2KQUA

F98n apoflavodoxin from anabaena pcc 7119
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
169
structure length
169
Chain Sequence
b'AKKIGLFYGTQTGKTESVAEIIRDEFGNDVVTLHDVSQAEVTDLNDYQYLIIGCPTWNIGELQSDWEGLYSELDDVDFNGKLVAYFGTGDQIGYADNNQDAIGILEEKISQRGGKTVGYWSTDGYDFNDSKALRNGKFVGLALDEDNQSDLTDDRIKSWVAQLKSEFGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavodoxin
publication title Design and structure of an equilibrium protein folding intermediate. A hint into dynamical regions of proteins
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Electron transport
total genus 19
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2009-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2kquA00
3EYWA 1AKWA 3NHFA 4LTDA 1J9GA 4HS4A 2Z9BA 4YAWA 1YRHA 2V9CA 1NNI1 4FGJA 4YAUA 2Q62A 1H69A 2QX8A 3F90A 4DIKA 4YQEA 1KBQA 4GI5A 4HEQA 2QWXA 1RLIA 1J8QA 2Z9DA 2OHJA 3OWHA 2B3DA 1FLDA 1AG9A 2R96A 5LJLA 4YAFA 4GR9A 2KLBA 2FLVA 4Y9UA 3JSXA 3N3AC 5A4KA 1F4PA 4ICIA 2X2OA 1RLJA 4CF6A 4F8YA 3W7AA 1T0IA 3HLYA 2OYSA 3F6RA 5FX2A 3QFCA 3FJOA 4QOIA 2M6RA 2HPVA 4Y9RA 5F4BA 3TZBA 2BMVA 1KBOA 1ZWKA 1AKUA 1XI2A 2QMYA 1E5DA 2Z98A 1TIKA 3ES9A 2QMZA 3GFSA 3D7NA 3OWXA 3NHSA 1FLVA 5EAIA 2FOXA 3G5MA 2FZ5A 4DY4A 4R81A 2AMJA 3ESYA 3GAMA 3L9WA 3N3BC 3ESXA 5LBUA 1TLLA 1JA0A 1CZLA 4N65A 1D03A 1OFVA 3UXHA 5BUCA 2FDXA 2MT9A 4ZVMA 1CZKA 4LTMA 2FAXA 5LVAA 1H66A 1CZNA 2QX6A 2X2PA 2MOKA 1AKRA 4U7HA 1AMOA 2ARKA 1D04A 1FX1A 3KAQA 2OHIA 3NHWA 3GFRA 4QOHA 1YCGA 3UXEA 4ESEA 2RG1A 1SG0A 2MWMA 1FLNA 3KLBA 3NLLA 2V5UA 1X77A 3OX3A 5LJIA 1AKVA 3LT5A 4YAOA 3GFQA 3N39C 1RCFA 5F51A 4FX2A 4LA4A 5EA2A 3EDOA 4QOEA 1CZHA 2W5UA 1VMEA 1WSBA 2GSWA 1YCFA 1YCHA 1D4AA 3RPEA 1ZWLA 2FX2A 3K20A 4S24A 5NULA 2V5VA 4GQIA 3R6WA 2BF4A 3NHJA 3FVWA 2QR2A 1FUEA 5F12A 1ZX1A 1YOBA 3B6MA 2ZKIA 3O2NA 1FTGA 2QX9A 2HNBA 1XT6A 4ZVKA 4N9QA 2WC1A 1AKTA 3F2VA 4QOJA 3F6SA 1GG5A 3ZHOA 1DXOA 4Y7CA 3W78A 4U7FA 4U7GA 1QRDA 6NULA 2A5LA 3TEMA 2XOEA 3SVLA 4ZVLA 1SQSA 1B1CA 4D02A 1BVYF 4XDGA 3FX2A 4QODA 3U7RA 5JROA 3FW1A 4C14A 4OXXA 1XYYA 4ZVNA 1QHEA 3FNIA 2Q9UA 1QR2A 3OJXA 3O73A 1YDGA 3OVMA 2BPOA 3HA2A 3P0RA 3OX2A 4C0WA 2Z9CA 4J8PA 3ESZA 3K1YA 1YKGA 4YALA 3TE7A 1DX9A 3KEGA 2M6SA 4C0XA 4FGLA 1CZOA 3B6IA 3NHUA 4XDHA 5B3LA 1CZRA 3QFRA 2R97A 3OJWA 5NLLA 4BMPB 2BZSA 1J9EA 3B6JA 3QE2A 4QOFA 1T5BA 5LMCA 2XODA 1J9ZA 1XYVA 1RTTA 5FA6A 4PTYA 2OHHA 3NHRA 1OBVA 2FZVA 1OBOA 2QX4A 4BMOB 3NHYA 2D5IA 3KAPA 1WSWA 4H2DA 4M0CA 3NHKA 3B6KA 1C7FA 4C76A 5LLDA 1FLAA 1V4BA 3W79A 1BU5A 4PTZA 5FUQA 4QOGA 3U7IA 3NHLA 2BN4A 4N82A 4FGKA 5B3KA 5EMNA 1C7EA 3LCMA 2KQUA 5TGZA 2MTBA 4NLLA 2HNAA 1DXQA 1AKQA 4PU0A 1QBGA 4LAFA 2F1OA 2FCRA 4DILA 3NHPA 5LBTA 3NFRA 1I1OA 3S2YA 1CZUA 3W77A 3HR4A 1AZLA 1FVXA 1AHNA 4NULA 5ULLA 4CETA 2N1MA 3L9XA 4H6PA 3OX1A 4LTNA 2FVXA 1JA1A
chains in the Genus database with same CATH superfamily
1ARZA 3MBKA 2PT6A 2HMTA 4QGBA 3EB9A 1QTQA 4QOSA 1A3CA 1YS7A 1WCYA 2ZB8A 3L7IA 4GEKA 2IYFA 2H08A 2JCGA 2J67A 4ZAGA 1Z2AA 4MGIR 3CUWA 2PH5A 4Y6LA 2EGUA 3SSNA 2WYOA 3WRWA 3KB1A 2OXIA 2XVZA 3VZSA 1XDWA 3RQSA 2IF0A 3CHYA 1FK8A 4QARA 4Y18A 1CY4A 4KYUA 5HCIA 4BLOA 2HSDA 5IDQA 5LNK1 1M72A 2IEGA 4F7DA 5B57C 4XGQA 4ALNA 5FUMA 4L0CA 3SCZA 3P1JA 2V4MA 3OHSX 4IRUB 2QLBA 4GKAA 4MKRA 1XCLA 1NP7A 3MINA 4PGHA 5B7GA 4DA0A 4MQLA 3DZCA 5AK0A 5AVWA 2PSHA 4JA2A 3VSCA 2NT3A 1SUBA 2NW6A 4A3SA 1UP4A 5JVDA 1WY5A 2F3TA 8OHMA 1IC6A 2X1HA 4GC5A 1WDLA 2F6RA 5KSWB 4PWZA 1RIIA 2JFFA 1KEZA 3BHMA 2QD5A 2DUWA 3CLKA 1QTIA 3JQRA 4M9SA 5K2OA 3FI9A 2ANBA 3TL3A 1QGUA 3F49S 3FCYA 4MB6A 4DKJA 4BLPA 3H86A 1P31A 4I50A 5T57A 3L8MA 1XJ5A 3VI4B 5D86A 2J3KA 3ZBTA 1GZUA 3C6QA 3MD0A 4OBEA 3A3KA 1OX5A 4DIFA 2QSZA 1JJBA 2D0PB 3V8PA 2I3BA 3HYRA 4DBLE 4A15A 5EHXA 3VPSA 3T0IA 2ZE6A 2PRYA 1NBAA 2HRDA 5JBNA 2C95A 5DI9A 5FI0B 4C5AA 2HTEA 3E15A 5HOQA 4Y9UA 4IP0A 4BU1A 4BAUA 4IDDA 3LLMA 1Z3IX 2F4NA 5KJ6A 2AN5A 4E88A 4PAQA 3V4PB 3EAGA 4YJDA 4BFWA 1YJAA 4ND3A 3GPLA 4N5LA 2ZUDA 3LUJA 1NP6A 5T4EA 3N2LA 2BFBB 4AKGA 3FWZA 1E8NA 1XRSB 1XJQA 3GJ8A 4NYIQ 2XAAA 4C43A 5JVDF 1FUUA 4FW8A 3W5HA 1P3DA 3RK0A 3N2IA 2GAAA 1KI9A 3Q7SA 4BQQA 1JDTA 3R8CA 4MQBA 2D2VA 2PQ0A 1M6HA 3TTVA 3E27A 2VKTA 1OBHA 1L4KA 1R8QA 2GBLA 3QQ5A 4NCJA 2G07A 3KDSE 4G65A 4RAOA 1Y81A 3IEXA 4G23A 5IWAB 3OURA 2I65A 2ILVA 4G5SA 1IHUA 5CFZA 3TZBA 1X7WA 4R5HA 1IN6A 2RGWA 3ENZA 4FJ1A 3IIEA 4Q39A 1FJHA 2PLNA 1V3QE 2I6TA 1P2GA 4KQ6A 4MP3A 3HB9A 4WN9B 3IR5A 3PX3A 2J3JA 3KR1A 5B7QA 4AZ3B 1VXOA 1ZL0A 1Q0SA 4YR9A 1B73A 1ZUD1 1ZOSA 2TRSB 1N6RA 2VSNA 1H05A 1XMIA 1BFUA 3HCWA 4IH9A 5THQA 1F2DA 3BJMA 2RGNC 4ITRC 1DRUA 3PJFA 3ZGOA 2XCIA 4JBHA 4KQ2A 4MB0A 4G1UC 1PR5A 4TQ9A 2BHLA 5CT9A 3UPTA 4FMDB 2FZ5A 2QYHA 5C18A 1WCV1 2WILA 2J0VA 2GGSA 4MVJI 3DLAA 4W7SA 2FK7A 3TM5A 2XMBA 3THYA 5JH7B 1E2NA 2TMGA 2FPIB 4LF7B 4BJ6A 3UTCA 5KU1A 3DLPX 3A4NA 3VKFA 3ZZTA 1MIHA 5HF6A 2F62A 4MQMA 5JWOA 5HQTA 4PGAA 1D1SA 3N87A 2BKUA 4KVZA 1MFPA 5LBUA 5ARCA 5I01A 4PXYA 4Q4AB 3GDHA 1HFWA 1CZLA 3C5VA 4N65A 5A9TA 1G291 3DUFB 1JIUA 2PLAA 3UOGA 3WB9A 4K6KA 5CDFE 5CVDA 2QLNA 3CKYA 1Q95A 2BGNA 4FDLA 5C4IA 4QGAA 2P65A 1BWPA 1T5DX 4XLLA 1U5CA 3AERB 4TV8B 1H2FA 1O4VA 1YWGO 3PI6A 4HXGA 4TLCA 1Q3HA 5LA6A 3NYIA 4JL5A 4QJ5A 1O87A 3T5MA 5I6DA 1PNQA 1PVVA 4J2HA 3GJ3A 3OSUA 5C7IO 3ZUPA 1Z28A 3PNBA 4YQYA 4TTPA 3VM6A 3IOMA 4O2AB 1OFUA 3UB4A 2QX6A 2ZI5A 4XGKA 1RAIA 3HO1A 5BR8B 2MOKA 1N5MA 4M0UA 4QFBA 5GM2A 3OZAA 2DFDA 4DYVA 2DMRA 4II7A 1VE1A 3NJRA 3NS7A 4IJKA 3C3XA 3SZRA 5I7EA 5K4AA 1UEIA 4FS3A 4W5RA 3BRWA 3LTNC 3UK7A 2A1TR 4A82A 3VKGA 1IXYA 4MVJH 2W4MA 4QELA 5JIBA 3NHWA 3G2OA 4WBXC 4OFBA 1VL1A 1KOLA 1JDBC 1BDIA 1WD5A 1JKJB 1A95A 1CUBA 2ZBGA 4HDAA 3LA6A 5FBQB 2Q8PA 2GD0A 3CMCO 1L4UA 3IDFA 4WUTA 2GWHA 4YX9A 1NDQA 4BVBA 1X8KA 4PYKA 4X6XA 4JB8A 2QB5A 5KZMB 1AKVA 1TZBA 3D31A 3PUJA 3NT5A 4NH4A 1FP2A 3FOAA 1KH1A 2VWGA 2VZLA 1DAMA 3STXA 1L5FA 4ECEA 1D2EA 4KR7A 1R0ZA 3ZGXA 4CRWB 3U3XA 2IYPA 2JGDA 3E1KA 3OE1A 1XQ1A 4F85A 3GLUA 1IHDA 4G25A 2NXJA 4JEMA 1YCFA 3BD6A 1HZZC 2X6TA 4KDRA 4R16A 4AY4A 821PA 3ZE0B 3NBXX 3AL0C 5EIBC 2PZAA 1Z63A 4IDBA 5KO2A 3QSYA 1C3JA 1YTUA 1ULZA 1WWKA 3C24A 1ZWLA 1ONBA 4A16A 2Y3IA 4IJVA 1GL6A 3N75A 4RENA 1NRWA 5LDHA 2NTEA 1DAOA 2D4AA 4LZJA 2XE6A 3Q8LA 3K8QA 1FTNA 3H04A 4GGPA 1OWNA 2LBPA 3OPYA 2P0YA 1FQKA 1JDJA 3GC6A 2VDLB 2SBTA 1P1CA 3R0JA 4RGVA 5EE3A 1J49A 4TL7A 5K3DA 4F5YA 5IKEA 4CM3A 2FGJA 1K75A 4AW9A 5DXJA 1PKEA 1JHAA 1EQUA 4OHFA 4O29A 3VR6A 4EY6A 2BGRA 3NOQA 4F6LA 1W36C 4GYKA 3AIOA 5IAAA 3H65A 3UV6A 1Z75A 4KQ9A 2J87A 3RB8A 2JAXA 1FTGA 1QHHA 2VATA 1LBTA 1W1IA 2CUNA 2GUGA 5DM0A 1NONA 4R2HA 5C81A 4PSAA 1T1SA 1U0RA 4IJ5A 3EMDA 4TYQA 1QH9A 5BQPA 2C0PA 1QKIA 4AYTA 3TG2A 1YQDA 4PNPA 3AW9A 5EQDA 1H0KA 2Y6UA 4WNIA 1SCDA 2R47A 4QOJA 4HEA1 3OMXA 4C0LA 5C52B 4ND7A 3IV7A 2Q8NA 4R9VA 4RD6A 1JEEA 2Y67A 3ZX5A 1YASA 3C8DA 5CG2A 3C74A 2WU8A 2P2ZA 1BKDR 4ISCA 3SMQA 3KTOA 3W78A 5HZGA 1DV1A 3OF5A 2BOVA 4E7PA 1P73A 3TRJA 3ORSA 4RF4A 3H4IA 1J25A 3PCTA 1YB2A 3AFMA 3JZAA 2BW0A 2IRWA 2V8OA 3A6HA 1CB0A 1DOZA 1G5IA 1VIAA 2AC4A 3BJIC 3C8UA 4G56A 2GF0A 4HWGA 4CHTA 5L53A 5LQJA 5C80A 2PUAA 1E0JA 2VDWA 3B5EA 1N2JA 1OILA 4OQ4A 4PLHA 1D9ZA 4U9UA 3TLXA 4Q00A 3VFDA 3WKBA 1P9WA 2H57A 4UNQA 1N5DA 2PTGA 3FYTA 4G07A 4NG4A 5IDVA 3LYLA 2VF5X 1WBJB 1ZNYA 1LGYA 1NE7A 4JVNA 4DXHA 1AB6A 1BCRA 1HTWA 3IQWA 3SJCA 1RC8A 2A4MA 3NEYA 1SY7A 3DC2A 3U80A 4B3FX 3N74A 4BL5A 4EG1A 4ZMBA 1TTTA 2PK3A 4V1CB 3L0YA 5ALTA 4G0ZA 3KV3O 1EFDN 4Y9SA 3ZWOA 2MCFA 1L7MA 3WK5A 4PG8A 3IQXA 1B0UA 2F3UA 1QH1B 2FMHA 4N49A 1B2RA 5C1BA 3ZLJA 3O92A 3Q3CA 1KYVA 4K81B 5JLJA 3ITNA 1KZ7B 2DWOA 3LBNA 3CEMA 3RS9A 3G9UA 3SSAA 3C15C 4MV9A 5TC4A 4XJVA 3DNFA 5BQ5A 2WJPA 4JU8A 1RZ3A 3DBHA 1PGNA 1QS0A 1JG3A 1MC8A 2GF9A 3EF1A 4HMOA 4RKYA 2RAPA 3CA8A 1MIOA 1W0JA 2X1LA 1OFHA 4I6JA 1JR4A 2BLNA 4LZNA 3VNRA 3J81A 4UAVA 1Z6TA 1TAQA 4KVFA 2DKFA 1OPRA 1R0CA 2NIPA 3EN0A 1DTEA 3AKCA 4F38A 2B8JA 1XJCA 3OG9A 3OZIA 2DY0A 3VZQA 4WZAE 1D5CA 1R37A 3WV5A 4CDRA 5CYGA 4UD2A 2JLZA 2G76A 4Y9DA 4RZ3A 4US2R 4WCFA 1TK9A 2Y05A 2HTFA 3AR3A 3HDQA 4FXOA 4JVSB 3PEFA 1RKBA 2PEYA 3JWGA 4XYBA 3Q87B 2NYRA 4YP1A 4WHMA 1Y89A 3WKDA 1OU0A 1Q7CA 1YR6A 2JFUA 4KBGA 5AH0A 3WC4A 1RP7A 5AM5A 3BHNA 2YWFA 4AMBA 4BQOA 2X0NA 4EUNA 4ZO7A 2CXOA 5EWLA 5K5EA 2WWYA 4BLUA 1WX1A 4UOZA 2A5FA 3MB5A 4Q37A 1CFZA 5K0BA 2ZRIA 2RK3A 3WGLA 5IM4F 3HH8A 3KYJB 4O25A 2JIOA 3PRJA 4OHUA 2GESA 1SA0B 3RUIA 1PR1A 5ALWA 5JDIA 4RYLA 3HB4X 1OA1A 1ECJA 4R2JA 4WZ6A 4QT0A 4O63O 4W63A 1G1MA 5AM1A 1QRRA 4Y1RA 4MKZA 3QM1A 2ZUWA 4NZZA 4RACA 4C05A 1RTTA 1I9CA 2PD4A 3WTCA 1ZR4A 1Z5ZA 2CMFA 2LDBA 4OHWA 4I1SA 3OFJA 3ZXXA 2W4QA 2VXOA 5BSMA 4CTNA 3IA7A 4M55A 4YTEA 3REFA 4V0RA 4IV0A 5B7PA 4YY3B 1KO1A 1E9AA 4HQFA 3L7NA 3NHYA 4NFSA 1IPEA 1WSWA 3EDQA 3H05A 4OQQA 2ZIXB 2JCXA 1KY3A 3KZOA 3O8QB 4W4TA 2BRUA 1GQRA 2QDXA 3G79A 5F21A 3WMWA 4M0CA 2P7IA 3OZGA 2RGEA 2GR9A 4B6QA 2QP4A 3T3DA 3HXOA 2IQ5A 5JMTA 3DEFA 4EL0A 2HGSA 2OXRA 4J6FA 5K05A 4W9NC 1Q1QA 1H65A 3PGVA 2CNLA 4NMMA 1G98A 2O14A 3RU3A 5LZ7A 5TPZA 4AY6A 2YCLA 2VHCA 2IHNA 1EK2A 2DTDA 2YX1A 1WPRA 1CQIA 3GRKA 3K2BA 4WQMA 5EINA 3TUIC 5A5GA 1XXHA 1LJLA 1T4MA 3FPCA 3SE0A 3SXJA 4EG7A 3LF1A 1BU5A 3PDHA 4PTZA 3GQBB 4CV0A 4M1ZA 1WTCA 4FN4A 5EJ4A 3EJWA 5IT5A 4I66A 3LC2O 2ZITA 3GJ0A 3CX7A 3CVXA 1ML3A 1KEUA 5DNAA 3ER8A 2P2NA 2ZSIA 4MVJE 1KYQA 3MINB 3LYUA 1M5TA 3OY2A 4JB2A 3AIMA 4FOLA 3UT0A 1J0BA 2X2EA 1O5TA 3O03A 1MO6A 2CFRA 2DWUA 2RGAA 1TX4B 2FUEA 3SKVA 3K71B 1FFDA 1UBKS 5JVDB 2MR5A 5AUQA 5ALDA 3OZWA 2G9VA 1K5DA 4H35A 4UM9D 3E8XA 2O5EA 1UBNA 1YACA 3HLKA 4QU0A 4ZTZB 2AS0A 2PS0A 4WNCA 1SIWA 1K7FB 1LV8A 3G17A 3JASA 2XUDA 4BECA 3SKYA 1RYMA 2F9FA 1T3GA 1KI8A 3I83A 3OEWA 4KE9A 3PQ7A 1UWKA 4JS0A 1ZGAA 4E5UA 1XHLA 2HXYA 3D7RA 1AUOA 1CUDA 4KB5A 4XUCA 3G8DA 2VRWA 3L7CA 2FRVA 5KYXA 1SUWA 1GQOA 1ODLA 2TSYB 3Q40A 1AKQA 3QBEA 4MWBA 4REQA 3T4XA 3A28A 1EZZA 3FLMA 4HGNA 5J5VA 4F91B 2QRKA 1QV7A 1G8HA 3BFKA 3MQFA 3E7PA 1QBGA 1K9VF 4XZ3A 2OBNA 3AUYA 5AJXA 1FVHA 4FUTA 2P9FA 4K05A 1TQ4A 3WO0A 5K3FA 5GZ3A 2OGUA 3QXGA 4NNOA 1E4VA 2VK2A 4YEDA 2R4QA 1OIVA 5G3ZA 3CR8A 4B4DA 3QXJA 4HGPA 3GGDA 3GA5A 4V03A 2E4ZA 4LBWA 1WSDA 1I10A 2VRCD 1CNFA 3WXBA 1EQ2A 5D51S 4GMFA 4UNRA 2QTZA 1QPZA 4RHXA 3ANNA 3GD7A 3PHIA 3A2NA 4M1SA 3EBPA 4OXYA 3I05A 4DNFA 3KHUA 3EQ7A 3PXXA 4NCXA 1SCAA 4Q18A 2IPLA 3BICA 2GPSA 4NNJA 5IAOA 2QMUA 4J2OA 1C1DB 3FCSB 3HZHA 2DR3A 4ZAYA 4AULA 3X0DA 4G84A 4X84A 3UAXA 1BN7A 3R3XA 2R1VB 2ZSFA 5C37A 1Q7BA 1DC4A 2QTBA 2XDQA 2YZGA 1DKPA 1MDFA 4H9GA 4UUNA 2LIVA 4F8EA 2QXTA 3T3OA 2QQFA 3W9BA 1ZVVA 2PGDA 3OLZA 2OORA 1B6GA 1BRMA 3GPCA 4E22A 1XZMA 2GUWA 4Z9XA 3H2ZA 4MCAA 1CEEA 4CFYA 5HFJA 3H5OA 2PUGA 5K99A 2P9GA 1C9NA 3CX8A 2CXXA 4CLOB 5SZHB 3ABIA 2B9VA 1QIEA 3CKKA 3DTTA 3X44A 3THYB 3UJAA 3GFPA 3OPXA 2FFJA 4RGYA 4M8LA 4QYMA 5AUPB 1JNYA 1PJ3A 4J1QA 1TQDA 2CLMB 4CM4A 4JMLA 4XIJA 2QX8A 3MAJA 4XYLA 4NRDA 4K9RA 4LRTB 1QGAA 5E6UA 3YASA 2XIJA 5FJJA 1OZFA 3AHIA 3UA4A 1IWOA 1P0PA 3OKPA 2AWOA 4XFKA 1AQJA 5K8UA 1V4NA 1F2VA 3KQYA 4D8YA 2B4TO 3V2GA 5ILGA 4GIBA 1A1SA 3M2TA 1E2IA 4QHSA 4XWOA 3T3GA 2W11A 1HTTA 2VHQA 2XUGA 1DVRA 3DAPA 1ADFA 1E2LA 4HPWA 2HSWA 4HBZA 1ULHA 4J29A 3CVOA 5CTJA 2V0NA 4L08A 1Z6AA 1KWKA 2D1YA 3EVEA 4DMHA 1RW4A 3P19A 5ERXA 3TKLA 4QUAA 3L7MA 1AGXA 4MNTA 4JLVA 2HPHA 2WYWA 1Y3AA 4WSOA 3FF4A 3LUKA 4XUGB 1CHDA 3U3ZA 3HMQA 1LQ2A 3RC2A 2GYWA 3RVOA 4B2LA 2OHGA 1ABFA 4XJSA 1VECA 4JKYA 4UVHA 5F2KA 3EDMA 5JZ9A 1NT4A 2AFIE 3PZRA 1GU0A 1TUIA 4MR8B 5J2TA 3GDWA 4JJ8A 2O3JA 5D7BA 1O95C 4GVLA 3TX6A 1HEUA 1U0TA 3X1MA 1LF5A 1VCIA 4Y1FA 2N42A 3WHLA 3N0WA 4EL5A 2X76A 1SCKA 1YC5A 4GM1A 2I6UA 3FJOA 3CE9A 1LNQA 1M34A 3I4CA 1BA3A 2C07A 2M6RA 4JFRA 1K8YB 4C2TA 4QHYA 3A6JA 4YUYA 4TS1A 4BVAA 2I3GA 1Y33E 2JGDB 2R62A 2DE0X 3H1PA 1XI2A 4UVEA 3HCBA 1VLMA 1ADJA 1Z8DA 2R7AA 4G2NA 4V2UA 4WKPA 3R3VA 4TL9A 1CR4A 3SF0A 5K45A 2FPKA 1GGNA 3ZQ6A 2B1QA 3D5QA 5J2UA 3MGKA 5K6TA 3BMOB 3SQMA 4TSRA 4QDUA 1QHXA 2A30A 4H7IA 3DLCA 1CDOA 3ELWA 3TKYA 4X3CA 5H3LA 5J2TF 2B25A 2NOAA 3G5AA 3K6SB 1HF3A 5HMMA 4R1OA 3KWJA 1FLVA 1N2ZA 4ZI2A 2H1OA 3UENA 4RSMA 4MIYA 4W5QA 5A02A 4UDYX 3DP9A 1YH3A 4KN8A 3CO5A 3OPYB 4P82A 4OGLA 2NU8A 5JY6A 1G5PA 2E55A 1CD5A 4I4NA 4L51A 3KQHA 4AS2A 1IB0A 1W5BA 3ML1A 1APBA 5CNMA 3K70C 1X3SA 2AI2A 1V45E 3N2YA 1YBMA 3QKRA 3QLUC 2VJBA 3FXAA 1EA7A 1AQIA 3E3AA 2PJDA 4BGVA 1ZD5A 2ZI4A 5LU8A 5BT9A 4DMUB 5DO9A 4BRZA 3ETLA 4TRNA 2HC9A 4KPFC 1LXCA 3BCUA 3SC4A 2AI3A 3L0CA 4JLSA 1PNRA 4G5YA 1VMDA 1W581 4YLYA 4XIYA 3EAQA 5J2UF 2GDJA 3W1WA 4F5ZA 4DNXA 2Y1XA 3OY7A 4KIFA 2HMUA 3B1XA 3B60A 3ONFA 4M38A 5DM70 1GKUB 4N5HX 4R9UC 5ICSA 2YINC 3FVQA 5LP6A 4OQFA 3KZMA 1S3GA 4GX1A 5BOSB 3TXAA 5DN6D 2VTBB 5F1KA 3ME5A 4RY8A 3II6X 1DNPA 1V6AA 3KSRA 1RPNA 2WWIA 5BMOA 5LP1A 2O8CA 5A5FA 1NVKA 1YOVA 1E2GA 2LVBA 4N3AA 4ONEA 4S35A 3FUWA 3TZ6A 4X8MA 3TPFA 1EJ6A 1VB5A 4KFSA 2EERA 1FBTA 4I4TF 2XZTA 4XUEA 4EHBA 1TM5E 2HA2A 1C30B 4FJ2A 3UG7A 3THXA 2PEZA 3O1IC 2CHUA 2VT3A 2O8BA 2OQ2A 1XP5A 4EI9A 2HWYA 3IUEA 3NASA 1DC3A 1II8A 5SY6A 5I7AA 5B58T 4PQFA 1QAOA 1VSUA 4YHBA 3W8FA 2RG1A 4HB3A 1FFGA 4Q7QA 5LP6F 2DH5A 2QP9X 1TZCA 1QGED 1L4HA 2RHMA 5LJIA 1WDMA 1NW3A 4YP0A 2BVNA 1ZK2A 2JFYA 4L76A 4N6OA 4NYMR 5JD6A 5K8IA 2G7ZA 4Y6SA 4GKBA 4MYSA 1CBUA 4IVQA 2RJ3A 3BDAA 4A6EA 2XF8A 1ELOA 3ZOZA 5HRCA 1P4HA 1IOVA 1KS2A 2AUNA 3K1TA 4GVXA 3RRYA 2PZGA 4H1HA 1FIUA 1H3NA 2QTFA 4L75A 1GUYA 3RFUA 3H2YA 1M1NB 2AOVA 1L4FA 3GL9A 3C3DA 5AW5A 2PMDA 3A7EA 3EFEA 4J0EA 4BQSA 3KB6A 1O96A 3DBHB 1BH6A 1LBIA 4BV2A 4G9BA 4H15A 1P77A 2BP7A 2XTAA 3LGSA 3ZHQA 5A4MS 2NZ2A 3BGOS 4UUBA 1DARA 3TPCA 5FTNA 3K20A 4I3HA 1I5RA 3KOYA 1KOFA 3P94A 1XN4A 3KG2A 3I0ZA 3CS3A 5A5VA 5KKNB 2EP7A 4FFNA 4IDAA 3AVUA 2I76A 3GI1A 2PA0A 4TZTA 4PFKA 4YLEA 4I6EA 4MV0A 4RMGA 1UMBB 1U7WA 5D87A 2UXCB 4FFPA 2GB4A 2XB6A 3FTNA 1KSJA 1R8SA 4MZDA 1AXGA 3R3WA 4DGQA 2NAFA 3H3FA 3K4PA 1ZJWA 3A06A 2WHEA 5DHPA 1UPBA 3C87A 4LMRA 2W70A 2V4UA 1YZHA 2QX7A 3UUGA 4OPMA 1O7JA 3MBOA 4O0LA 4YPOA 5IJZA 1SC3A 2ZKIA 3G0GA 3ORYA 3NDPA 5HSGA 2WKQA 2Q3EA 1NXOA 2R6ZA 5KSPA 1IM8A 1PNVA 3UWMA 4ECAA 2V3CC 1XXLA 1D7OA 3JALA 2ZT8A 4OM8A 4NPHA 5ICCA 4NYJR 1DKNA 5EWLB 1TDJA 5JI2E 2PS1A 1E1YA 1TGVA 4IRMA 3VNAA 4UFPA 5IDWA 1ACJA 3RABA 1JYFA 2IXGA 1J7KA 1ODJA 1DJQA 2NM0A 2XR1A 4QASA 3V4ZA 3P0EA 2GKOA 2E2WA 2RG7A 2IDKA 1W75A 4G1CA 3TBHA 2HDOA 5CAEA 2WD9A 5JBIA 2C5GA 4EUSA 4NP6A 1YL5A 1RI2A 2F43A 2NO0A 2Q1SA 3L8ZA 4S1OA 3QHQA 4ND5A 4U7GA 4IGFA 1TRKA 1CR0A 3E0QA 1NXQA 3PLNA 2WKWA 1AHIA 2GO7A 3K16A 4HYQA 4ITUA 2A35A 1FJ2A 2XCSB 1N2BA 1U8TA 2ENUA 3DDNA 5JZVA 3OTHA 3N9IA 4ZRDA 4ZVOA 3T9AA 1DCMA 2VHUA 2KHZA 2W2NA 4NBSA 3STUA 3PL5A 4EGJA 2AEEA 5KWSA 3ZW9A 1NPTO 1I0LA 2BFEB 1Q57A 1XCBA 4LXIA 1QTRA 5A5EA 2ZWIA 4XTRA 1PT8A 2DULA 2JGJA 3O0TA 3UVEA 4E11A 4QDOA 3WZLA 4GBJA 1RXYA 4HEJA 1NVWQ 3LA8A 5EHGA 4CIVA 3NCHA 1IK6A 3SBOA 3COSA 1C4KA 2ZDQA 1O4WA 2HRRA 3M6VA 3O38A 3SU8A 1DUSA 3LZDA 3EGEA 2OG2A 4G6ZA 1ZG3A 1DBIA 5DDIP 1YSCA 1T3LA 1YL7A 3BJZA 1RI4A 3LVBA 3V34A 1V7CA 3DEAA 1SC9A 4X1YA 1XXHB 5IWCA 3CLUD 3L4JA 1PL0A 1QYDA 3MWEA 1SHJA 5EVCA 3T5AA 2WW8A 3PBKA 5AP9A 3CZCA 3I52A 2DERA 1IRXA 2NPFA 2JIZD 1ZCZA 4RLHA 2CXTA 2PKQO 1E4EA 2VT7A 3GRPA 5F73A 3KEMA 5BV0A 1J97A 2EHDA 3HL4A 1O5OA 2QRGA 1FNDA 1WUTA 3HCCA 4FGWA 3FHCB 4JI5B 4B2YA 4DM3A 1BNCA 2DQSA 2XXBA 2H6EA 4J76A 2IP4A 3RUEA 1Z7WA 1YBAA 1B15A 3KVYA 1ZRNA 1BMTA 1IXSB 3ESZA 1GZ3A 3PJGA 3IKMB 4LSGA 1B00A 3FPAA 3GRUA 1CUJA 4UNSA 3B9RA 2FXIA 4FDMA 3U40A 3PF8A 1DAGA 2CZGA 2J08A 3JASB 2J31A 4FGUA 3TD9A 3UCXA 4C2BA 3E7XA 1CLEA 2M6SA 3E9NA 5DPMA 3TQFA 2BTOA 2JK0A 1M8JA 3GZTB 4R7TA 4FGLA 4I6GA 1OXSC 4LUCA 3RSGA 4LDJA 2JKVA 4JLJA 3HXPA 4CKZA 2D1RA 5KYXB 1G16A 3DHVA 5TT0A 3IKVA 3LBFA 4XE5A 4CM1A 1KTVA 1V39A 2Z8YA 3PUZA 1CLUA 4LYDA 1H2RS 4REQB 5ER6A 5JCJD 4ESVA 4M37A 1Q21A 1T9GR 3GUUA 2KBEA 3FPLA 3KB2A 5FR1A 5GJWC 3EZ2A 2AK3A 3HZZA 4CLRA 1P3JA 3ZJUA 3DE3X 4RK7A 1H2AS 3QU4A 4KQXA 2HSZA 4M7RA 4JLOA 1NVUQ 2ZRAA 2RBKA 3H87A 1SOAA 2Q7OE 3B6JA 1XZBA 1VL2A 1VJGA 2ZJAA 3DWIA 3L04A 4ARAA 1US8B 4NZMA 4G0UA 3QMPA 1H2BA 2CLKB 4LOLA 3EOZA 4WACA 4TTSA 4OGKA 4YRPA 1EGMB 1PT5A 4J0GA 5FA6A 3BE6A 4KO1S 4ZQEA 4DWWA 3NTUA 3LKBA 4JP3A 3DULA 4ZRNA 2D3TA 2NUAA 4N0PA 4PNZA 4D81A 2AXEA 4BLQA 2NV0A 1JQBA 4FINA 2YZNA 1TAHA 1RS0A 1FP4A 5C0OE 4CQLB 5JWHA 4R9SA 2D5IA 4X8HA 1ZH2A 3BXOA 4WEQA 4KUHA 2PKCA 1RM4A 3D2AA 1KAHA 4LXQA 3CIFA 5K51A 1JU4A 2OWDA 3UUEA 4TXMA 4MKXA 2V1XA 4PXSA 3LBAA 4LQLA 4M46A 1FYVA 5JH7A 4MMZB 2G9UA 4X95A 3DL2A 4JWKA 2AV6A 3N2ZB 2EZ4A 4RVOA 2P6UA 4OLAA 1FFSA 1T8WA 4ZA2A 2B9EA 3U4MA 3ESCA 4QM6A 3DO6A 4BBJA 4C4YA 4F2HA 4YAGA 5FAXA 2YJNA 4MVYA 5AKIA 3ZHVA 1A9QA 2WZCA 3EC1A 3GGSA 5EIXA 1FZQA 4WXPA 4EMBA 4FB5A 4MRPA 2DC1A 3LP8A 3W79A 3EISA 1KYZA 1CEXA 3PC7A 5KNLA 1VM6A 2XXJA 3OLWA 3JVVA 4HVAA 1X6VA 4UXIA 4LQDA 3RI3A 3U7IA 1P2FA 1XVVA 3F2IA 4X20A 4CMIA 4NAVA 2A58A 2V6JA 3NU1A 1IPHA 2JGNA 1PGPA 1JEJA 4WLVA 5E6UB 1RYFA 3CZPA 4F1WA 2PLFA 3OIVA 4J3FA 3DQZA 3C6KA 3WFIA 1B7GO 3EGWA 2FX3A 1DBRA 1UFOA 5BN4B 3GMIA 1P0IA 1VJRA 1WOMA 4B6FA 5L3RA 1NBEA 4ZZ0A 5K7SA 1B0AA 4Q7LA 2O07A 1XNGA 4Z4QA 3C8HA 1QQBA 1XZAA 1WG8A 3DD1A 3OQIB 5HIIA 1N2XA 4DIDA 3KP1A 2VRCA 3CRNA 3EGIA 1W88B 5F3WB 2ORED 3EOAI 1JKMA 2XUKA 2ES4A 1ZICA 4UNIA 2VHXA 3Q3JB 3ON5A 4CIYA 3TX2A 2B1RA 1L7DA 3BWMA 3G2NA 4N7BA 4FFRA 3FPGA 4FNAA 5ICMA 2ZI9A 2JKYA 2EFGA 3HJGA 1TCVA 5BNZA 3ZY5A 4TVBA 1YQXA 1PJRA 1SXHA 3IXMA 3MGBA 3OTQA 4L07A 4ZOLA 2AQIA 4DILA 2OAGA 1R0WA 2RGXA 2OZLA 4Y2JA 4M1YA 3JW8A 2WUVA 4R2MA 4F21A 1JTFA 2VP3A 3JD3A 4JXXA 3QE3A 4Q9HA 4CI9A 4Q3DA 5CB0A 5J2TB 1UDAA 5J9FA 5DMXA 4QUDA 2AX3A 4V3BA 4B81A 4YP7A 2RAUA 5BMVF 5HCNA 5TMBA 3TSYA 5LQMA 5CFLA 4EB0A 3HR4A 2BH2A 2VXCA 3P8ZA 2I91A 2AG0A 3IUMA 4KPUA 1Q1EA 1AZLA 3HLTA 2VUIB 3PGXA 1M34B 4HRVA 5LQAA 3O8CA 1E60A 2E1RA 3OC6A 4BNTA 2VDMB 3A04A 1X7ZA 5A1TA 5ARDA 1IZ7A 4YAIA 4DIMA 3DBOB 2CHGA 4KNWA 4DV5B 2UDPA 1GN9A 4B32A 1FDSA 1FRFS 3ERCA 4J16A 1ESZA 2XTNA 1A4XA 4GKKB 3Q3GE 2REOA 1RXVA 4YMUA 2QYTA 3DMYA 3T5TA 4J0DA 2YTZA 3I1YA 2JANA 3L41A 4LTDA 1KVQA 2W43A 4XQGA 3SLRA 1I32A 2FPGA 2N9UA 2FHPA 1DC5A 2Q50A 1X1AA 2WUDA 1NY5A 5C1IA 4OQPA 4UMDA 4REOA 1T2CA 4PFQA 4EA7A 4MV1A 2RB5A 1UMKA 2Z9BA 4U02A 2YIDA 2NU8B 2PRZA 2NQ2C 1XCMA 1Q7TA 1XRQA 2DHCA 3ISJA 4IM7A 1LW6E 4B75A 4GNRA 4Q66C 4KSCA 3IVGA 3NHZA 3OJOA 1ZCAA 1E7QA 3DAOA 1SRRA 3KSDO 4X3PA 3FZGA 4M99A 4OJMX 4Y98A 3RTBA 1H94A 2E1PA 3PU6A 4I4TB 4G1VA 4CQMD 3TR5A 3MYYA 2Q2OA 4EW2A 4LOKA 3S2FA 4BCDA 3DPSA 3ONEA 1JMVA 5EXPA 1UKYA 3A6ZA 2QMOA 3W2FA 4ZEVA 5ITSA 4QXQA 5BYBA 1EAYA 5I4CA 2GCEA 1AUPA 3CZRA 1XCPA 3STVA 2BBSA 3OI7A 3SMVA 2IPMA 2QRMA 3SC2A 2POQX 4Q05A 3D2LA 3SK0A 1NBME 1UMCA 3JX9A 5LP6B 2OD7A 4P32A 1J8QA 2FSVC 2XEXA 3M5WA 2BFNA 3ANTA 4DCJA 4U2CA 4EY7A 1XAGA 3BKWA 2XT6A 1N77A 2GLXA 2X0EA 1ZRMA 3FMIA 1AG9A 4LECA 1UBMS 5T64A 2O8CB 1YOVB 1W4RA 1J70A 3HVIA 4HY3A 4IIJF 4RW0A 4ENRA 1P5JA 2CVZA 2BH9A 1DAPA 4GR9A 5G1OA 4ZCLA 2R5FA 2DKOA 2Q7DA 1N3LA 3UKDA 3ICQB 5EZ6B 5A4KA 3FSRA 2OO3A 4RA6A 1L3IA 1LEHA 4GP7A 3STTA 3T3IA 3IVMA 2WFAA 3HYTA 3IEIA 1FXWA 1X0VA 3OLCX 2FW6A 3Q7TA 3HZOA 3PX7A 2EP5A 3NKLA 1RDFA 3U49A 3RSQA 4BP9A 1II8B 2W2KA 1V1MA 1XWIA 3JQPA 4JQZA 4FFDA 3IYLW 2W6QA 3ZWKA 4GZ3A 3QK7A 4NBWA 2GN8A 4FYHA 1LNSA 3V7YA 4O33A 1KERA 2WV7A 4YV2A 1Q14A 1QB8A 5FPYA 4MVJD 1XAJA 4QOIA 1DOHA 2O2SA 2O1SA 3MD9A 4LXUA 2V7UA 5CH8A 1RXCA 1G21A 2QT0A 3V2HA 1SU6A 4PN3A 3RAEC 5LCXA 4QTZA 1I7PA 1MQ9A 3F47A 4YACA 4PZPA 1O5IA 1Z5VA 5LZ8A 4D3DA 3KLOA 4BP8A 7REQA 2DSTA 4RSGA 1MH9A 3TSZA 1PBTA 2MSWA 3H9UA 5KUTA 1EYZA 3SJZA 2AI1A 3M5DA 3TCXB 2IITA 2ISQA 4X8OA 4XH9B 3GG9A 2XRYA 3INTA 1Y9DA 3RJMA 2BM1A 9LDBA 2BP7B 2CWDA 3OWXA 2XHEA 2DQ4A 5P21A 4QATA 2PVCA 4BBPA 2IE0A 1QQ5A 3ND7A 2BGUA 3QX7A 1NQ5A 3VAZA 4AJHA 1W35A 2PGNA 2VBGA 3EDCA 3W5UA 2VPPA 5DN6A 1XZDA 1ILWA 2APJA 2JJMA 4J7UA 4GLFA 4B3JA 1IOWA 3ESYA 3LP5A 4NR0A 4DM7A 5BW5A 1KOGA 3QNWA 3B2EA 3C5CA 3UKJA 2BGJA 3ENNA 3L9WA 4B3GA 3ZNNA 1GA6A 4TUYA 4C89A 1E20A 1YB6A 2WMDA 3M9XA 4KNVA 4YJ2A 1SKMA 1QDLB 4JBXA 4ENTA 2GNAA 3GWGA 1R15A 1XEWX 1PR0A 2ZUVA 3WRXA 1PD0A 4D5EA 1GXSB 1ESEA 2P6PA 5TGDA 2QQEA 2XRMA 2Z58A 3JALB 5JS2A 3IP3A 3DC7A 1EGHA 3KT3A 4ZK2A 3I8XA 1JDUA 3DJFA 3ZWQA 3CB2A 2ZVDA 4ZOEA 1E94E 2SKCA 3D6JA 4QU5A 4RK5A 3WL4A 1E8MA 2Y1EA 4CMEA 3HSSA 4NNPA 3NBZC 5DYIA 4DCTA 2VYVD 2Q3CA 2Q4RA 2WAXA 4EB6A 1CJSA 1W44A 4WUVA 5IC6A 5T8KA 2F43B 3WVNA 1HNZB 1WSAA 2INGX 4MUJA 1PZNA 3S3TA 2O8DB 2VSYA 1PW7A 1EI9A 1VC2A 4EO4A 2G80A 2QMHA 2QTAA 4TQAA 4GE3A 4YJ2F 3JARA 4B17A 3H9GA 1DB3A 4WY5A 4BZZA 1HYHA 1QIGA 1C0KA 3VPBA 1R4MB 1K27A 2PX8A 3CONA 3LQ1A 4IS3A 4N54A 4WXRA 5MFPA 4RTMA 4ZCPA 5CLHA 2OHIA 1JSCA 5J4VA 1E9VA 4XASA 4MROA 2XGGA 3TUJC 3ZHXA 3GK3A 2IH4A 3LNCA 3N2NA 4O4HA 1MJGA 1MX9A 5EXTA 5FB3A 2CFSA 4AF6A 5B64A 4B3SB 1SBQA 4CG1A 4KXFB 4CKXA 4GZ6A 3AZQA 5JZMA 1ZFNA 4Q9NA 1SZCA 9GPBA 1NWHA 2VTDA 3ADOA 2DP4E 3K9LA 4HXEB 3DHNA 3FFAA 5JMPA 3V4OA 1CX9B 1ZBDA 2ZBFA 2G9NA 4F6RB 3K6KA 3OLXA 3SNKA 3LT5A 2VRNA 2W8ZA 2JVKA 4B6GA 2ZJ8A 4H0CA 1RCFA 1DIGA 3DAFA 4Z86A 5AKYA 4CG0A 3URKA 2FZEA 3ZHCA 1BKSB 3G7UA 4CCYA 3VO9A 2DOKA 2LR0A 3JRWA 2H07A 1L3BA 5K0TA 3RVRA 1VMEA 3MWEB 4CE6A 2NO4A 1V26A 2ZVJA 4LJKA 1QP4A 2A0FA 4FEGA 3U3KA 4NCKA 4PCAA 4DCVA 1ZN9A 5PGMA 2XUFA 2AL7A 3U16A 3X1XA 3P2MA 2G70A 1XTZA 2WU1A 4I81A 5JCZA 5H8WA 4KH1A 2GBLC 5L40A 2WG1A 1PV4A 3Q15C 2AG5A 2PVPA 3K8ZA 3M6XA 5D1NA 3SHWA 3WLEA 4MDFA 4EPVA 4KIWA 1KVTA 1QWSA 1GT91 2AMLA 1YS1X 5J1SB 3AJAA 4BBZA 1GPAA 1JR2A 4EHHA 2IU4A 2PWPA 1RAHA 1SWWA 5ETJA 1W19A 3S40A 1RIFA 1T15A 3OZTA 4GM0A 3VOTA 4E2FA 4D4GA 2IIVA 2YY6A 1PG5A 4PLFA 4URWR 5HKOA 4FU0A 3IT2A 2QR2A 2I7XA 3GAAA 3PNOA 2KW5A 3HO8A 2AF4C 4C3UA 4ZHQB 1SQ5A 2BTQA 1ZX1A 2ECPA 3JQ6A 4HL6A 5F12A 1MGPA 3TNLA 1CF2O 5CVUA 1EG2A 3AETA 3DOOA 4B87A 5J4YA 2W58A 1RQXA 3WYEA 3MT7A 1U0HC 1L5NA 1K8ZB 4HX9A 3UK0A 3IP6A 4ZYZA 5KC9A 4IOJA 4TWZA 4CLRB 4D9CA 3WL6A 1CQXA 2GEBA 1I0IA 1W87A 3PUKA 4Q3CA 5BQOA 4EOGA 4MRNA 3Q9LA 3HNPA 1M2EA 3C5HA 1YU9A 4RH3A 4Z2YA 1G66A 1NGSA 3DL0A 4AMVA 3CUKA 5E9QA 4J0QA 3CRW1 3OIDA 4INPA 1JE1A 1TZJA 2IYUA 1UDRA 2DHQA 1KFKB 3BCRA 3KOWA 3MT0A 3X1DA 4AG6A 2VHZA 4DR6B 1XA3A 2JHFA 3J7TA 2A5LA 4D9MA 1KAOA 1L7AA 2NUAB 4B44A 3QVWA 4EELA 2ZGVA 5IBQA 2Q3MA 1PX0A 1XG5A 5CDFA 2FSFA 1VLJA 2F90A 2LRHA 4ZCRA 2Y76A 1E58A 5CNIA 5INTA 2JIZA 5I9NA 1FZTA 3NDBB 1OV6A 3RVNA 2PV0A 5I9LA 1PS9A 1SD5A 3EFHA 1I24A 4Q7MB 1VI6A 2PKRA 3DZFA 4JA0A 3FPBA 2CLDX 4Q4HB 1RWWA 4IMJB 5DLYA 4PN7A 3OCZA 4IIYA 5FLEX 5ER9A 3T94A 2JJ2D 6REQA 1RBYA 2UUOA 1B1CA 1XK6A 3T5GA 4PQEA 2OV3A 3JVEA 4I1IA 5E8RA 2GBIA 3FW1A 3UM9A 2B20A 1K3FA 3OQPA 1UDXA 4BQPA 1GD1O 3T4PA 4BNZA 1WTAA 2BELA 1YC2A 3RIXA 4PBSA 5KOJB 3MOGA 5H82A 1N4AA 4BO1A 3CVWA 3AUAA 3M4YA 4BN5A 4DLAA 4ND4A 3CLVA 4RF2A 3PXEA 1N1DA 1FCJA 4ZXFA 3BMXA 5BWCA 5IF9A 1A5AB 2SKDA 4R69A 4DL9A 3L7LA 3AKEA 3RFTA 3T1NA 5CCBA 2P5SA 2A9VA 3SYLA 5JCJA 4YRRA 1QWOA 2F48A 3L1VA 4MH0R 6LDHA 2QQGA 1DV2A 1QIMA 3DDOA 4KO8A 3WWCA 3NM5A 2WWFA 5KYYA 1FQJA 3OZEA 1G1AA 4DQ0A 2Z9CA 4GBMA 1GNSA 1WHTB 3UYLA 1PG0A 1TZ2A 2J5XA 3HP7A 1DDIA 4QUIA 5FIUA 5LIRA 2GN6A 4QIHA 2FEMA 3QU9A 1ID8A 4K7JA 3A1CA 3S70A 5BMVB 3PT9A 4P35A 4RLFA 3ZKAA 4F97A 1NKTA 3LLUA 4YALA 1EVLA 4HAVA 5IAJA 4OLBA 1RTKA 3AUKA 3VTFA 4FCTA 3BH0A 4RJ2A 3PWTA 3A1UA 3IQEA 4Z49A 1W5SA 1N5RA 3QE0A 3H4VA 4NDNE 4BTEA 1CWUA 1DJPA 1WMBA 5JDCA 1ZISA 2Z8YM 3Q8XB 4KQCA 2OB2A 2QW1A 2OV1A 1GFWA 1E3WA 4R31A 4W1PA 3UV7A 4HVTA 3R3JA 3GFFA 3LSYA 5H4HA 4XYEA 1QNLA 1HETA 2ZJ1A 3WV4A 4ON9A 3LXXA 3OD1A 1CU1A 3OBIA 1YJBA 3AEKA 1IVNA 3SQXA 1D6JA 1INLA 1WPXA 3A6KA 4G24A 2FW1A 2OZLB 4HAYA 4EZBA 2HDWA 5AW4A 4PXAA 1GKKA 2FZWA 1LI5A 3DBRB 3ZXUB 3VSAA 2ZI6A 2K7ZA 2CF5A 4UE2A 3RLFA 4EHKA 3DZKA 1GDTA 1DJMA 1J2RA 2R4TA 2A4KA 3HFSA 3SEFA 3RUPA 1H6CA 4DIUA 5I4IA 4C7OA 1SVSA 3KSBC 1D1PA 3CR7A 3FZEA 4FNMA 5AI4A 4KPUB 3LAWA 4PTYA 4AJLA 4MRMA 3UUFA 1OI4A 2A3RA 4M86A 2XYHA 1YQ9A 4QA9A 3HJCA 3UHPA 1EB8A 1OBVA 1GKYA 1OYOA 1XFDA 2IL1A 2O8VA 2XCQA 3AJ9A 2FZVA 3AY7A 1F2TA 4UCFA 5IKPA 4LRXA 4BPBA 4N7RA 1R88A 1X7ZB 1Z4OA 4TLAA 3FZQA 4BWVA 3C3CA 4A27A 5JECA 1QUEA 4P36A 1SZJG 1Y48E 4LJSA 5CDYA 4EHLA 2WIFA 2PR7A 5A2QA 4QTXA 2X0JA 1OHHD 1JJIA 1JQLB 1OV4A 4U7TB 4E08A 4EW1A 5FTJA 1BA2A 3OLYA 1QG0A 3PP8A 1ZK1A 4H6XA 4RGBA 4NFHA 4ZT5A 5IEBA 2FPGB 2OY0A 2YIVX 3G8CA 4P34A 3E2MA 5LM3A 3B13B 3U1TA 1YB4A 1WDWB 5G41A 2H5EA 3QEKA 1OT3A 4KAJA 5JYCA 3IIIA 1O89A 3ZHSA 3PD7A 4BMSA 4F5EA 1QV9A 2XSZD 4IIJB 4RY9A 5TQ0A 3V4VB 1XNQB 2RBGA 3B36A 3LLCA 5FL7D 4FGKA 1IRIA 4G1BA 3STYA 5EHQA 1DRWA 1GRCA 2C9ZA 1ADGA 2ERYA 4DSOA 3CR3C 3E18A 3ZDQA 5ALUA 2AQ8A 2FWRA 1KQPA 1N7HA 3S29A 3D6TB 1H2HA 1AGRA 3KQSA 3BXEA 4G5RA 5E1OA 3VPFA 2A0WA 1L1FA 1UBSB 3BFJA 1RYEA 3WLRA 1LD3A 3SC2B 2VBFA 2DT8A 4DARA 3L4EA 3E9RA 4OF4A 1J8MF 3DEZA 4M8KA 5AK3A 4ZAWA 1NTOA 3KVNA 2PD6A 5IC5A 3V1KA 2F8TA 3PDIB 1UINA 1RM0A 3MWFA 1FSGA 1PK7A 3I01A 3RVBA 1NWCA 4UHDA 1AO0A 3LQKA 5EE9A 3PICA 4EPTA 1U2EA 3FR8A 4X94A 1P17A 4R2WA 1YE5A 2GZAA 3H5WA 4AF7A 3FOBA 3T1QA 3R0XA 3S8EA 4MHTA 1JUDA 5LUBA 4XQEA 4PV7A 1SC6A 1FTWA 3SF8A 2A6PA 1M8KA 4KLAA 4PZYA 2YHIA 4MUIA 1PQPA 3UQYS 4LGCA 3KRTA 2I1QA 4JU9A 5KJEA 1GEEA 5T5QA 4WZAA 1TYAE 3IVRA 3VA7A 1JH9A 4WCFC 2ZRDA 2B4QA 2W2KB 2F8LA 2QN2A 1E2QA 4I5GA 4PZCA 3OE4A 4PS1A 4DCOA 4UE6A 4ER7A 1KKMA 1DIOB 1F4VA 2MINA 2ACEA 2RHHA 3TIGA 3TNYA 2QY6A 1WD7A 3W5IA 3RG8A 1ABBA 4XQ9A 1KTIA 2EZ8A 2SCUA 1GZ4A 1K7SN 1UPFA 2DQZA 4Y6QA 1ZL2A 3F78A 1GZDA 4W5HA 4AB1A 4N5MA 1V1RA 4ETMA 4K86A 1NURA 1BX1A 1L0BA 1G21B 2D54A 4FOSA 3GNQA 4YPFA 3UJ8A 1G5FA 1M83A 2XQGA 1O54A 5DK4A 1JFSA 4D7AA 3QUBA 4GOND 3A1SA 3BJEA 4H1VA 1DBPA 4O8CA 4CQMA 7REQB 1H2ZA 1E7RA 2WPDD 2YWXA 1QZ3A 3SFVA 4D97A 3ITEA 5JDIC 2CWWA 3B52X 1LVUA 4XQ0A 4C1BA 3I23A 4X24A 3NBAA 5EMKA 5AHXA 3ROFA 3T3MB 3JU3A 5DIZA 4NTZA 1U7XA 4NABA 2RGDA 1ILEA 4IEFB 3CXRA 3IMGA 4DNQA 1QHSA 2OFPA 3EBLA 1G3IA 3R5SA 4S3MA 3TIXB 3FOZA 1WCIA 4WW0A 4Q4JA 5HUHA 2QE7D 5EESA 1NL3A 5K01A 2XJ9A 4DLSA 2WVJA 5IBRA 1DO2A 3KB8A 2IZOA 1C0EA 1XZKA 2EF1A 3X1KA 1WW8A 3W6PA 1UBHS 4QPJC 3V7FA 1PLJA 4YJ2B 2VUHB 1N34B 1M2JA 4ZEMA 1M5UA 2DKNA 3ENVA 4O5AA 1JRLA 4QLAA 1U8FO 1QFSA 3OJFA 2O3SA 4I1OA 1SU8A 5COBA 1SOWA 1U3UA 1SELA 2R6FA 2TMDA 3L6OO 4JQOA 2C77A 3D3EA 2PBLA 2JGLA 5JJ5A 4MLZA 4RHEA 3AB8A 3LI2A 4RLQA 3WJ2A 4B6EA 5KWVA 5LQDA 4X66B 3E48A 1JIVA 3MMPA 1L4EA 4PVCA 1FB5A 1KO5A 1V16A 2O7RA 5FTWA 5HZKA 1MXFA 3R8FA 1OB2A 1VE7A 1ZU5A 4HFRA 3U4QB 1YQWA 3GU3A 4RANA 4YMTA 3SM3A 5M04A 3V7NA 4BQIA 1OWMA 2IV7A 4EB6B 4ER0A 4BMZA 2KPOA 5TQVA 1NMXA 4O2LA 2H0RA 1GTSA 3KVVA 4MVJA 1TADA 2XBMA 1YZYA 2QORA 2WF9A 4B0PA 3QKWA 3JSXA 4KGVA 1MENA 3JARB 4P3NA 3OZXA 5AKXA 2XAUA 1H23A 5ECWA 1ADYA 1A2BA 4ALMA 3VKHA 4ZXPA 1EHYA 1OUMA 5E0OA 1OA0A 3H84A 4BRWA 2O20A 5FCDA 3JR7A 2XNHA 3FOEC 2GPYA 2C54A 3W5BA 4Z1MD 1RLJA 2OE2A 1R0RE 2HEIA 1Y34E 421PA 2I34A 4IFIA 3MWYW 2H2WA 4D8TA 3RSHA 3H75A 4DA4A 1ACMA 5AW1A 4G8BA 1WULS 3DNPA 3AR2A 3QIVA 3M1YA 4LJ4A 3R9XB 3HUTA 1PR9A 3UGTA 1M2WA 3V8NA 1SEVA 3N0VA 3MRXA 3MTGA 2JCSA 2YY5A 3NWOA 3ODPA 4Q6BA 1NOIA 1YVRA 4RXTA 3VVBA 4AK9A 3TQTA 1T1EA 3V00A 4MVJF 3SS7X 4F1JA 1Y7IA 4HUQA 1E1NA 2GEKA 4CCYB 1KBOA 5IVHA 4MEBA 2OC4A 1BE1A 1DBSA 1TVKA 1FSZA 2J6HA 1M6YA 2AJ8A 2Q5FA 2WEKA 3CW2A 4O02B 2GXAA 3LPCA 4BKPA 1B41A 2IHTA 3OU7A 2B7CA 3LT1A 5JPIA 3PWSA 1M74A 4V0QA 4IZHA 2PX5A 1ENZA 1WB4A 1EB9A 2C00A 3DB1A 3P9QA 3NAQA 3DT8A 4J6EA 1D2MA 2ICAA 2RHLA 1L8OA 1JFFA 1T34A 2H9IA 1UC5B 3C6BA 2K6GA 2FJUA 4Q15A 4IZIA 4ZO9A 3TK1A 1ZUWA 5EAIA 2Y0PA 3A11A 3G5MA 3ZY6A 3HKDB 4QM7A 5GONA 4ENWA 2IYNA 5FNZA 1B1AA 1QQAA 2G8LA 5HYVA 1X9IA 1F48A 3PCXA 3ZWPA 4UFOA 2VYVA 3RNLA 5IG2A 4DM4A 2CB0A 3PGMA 3CT6A 2NYUA 2WP0A 2PNFA 1FEZA 1KHTA 2FQWA 3DE4X 4PC7A 2BTQB 3KYIB 3L2OB 1C9MA 3CEPB 2IYVA 3FDZA 2PA3A 3KKOA 4RM3A 4Y6RA 5A7GA 3B8HA 2OORC 1IG0A 3AETB 2Y0CA 4HN2A 4M21A 4BAGA 1FFYA 1OGYA 4J4TA 3T7RA 4A2PA 4BJ3A 1D6SA 1W4BA 1WRBA 4JP1A 3S1AB 3A58B 1JU3A 3H13A 4C4OA 4EHJA 3ZDCA 1J06A 4EGSA 3AF0A 2B7LA 4ZANA 4I99A 2VLIA 3RRMA 4P98A 1I4OA 4DGSA 3O84A 5GONF 4RTPA 3ZNPA 16PKA 2IKQA 1QP7A 1E1MA 4MXDA 1KJZA 2OZEA 1CIJA 4G4IA 5JCXA 2X8BA 3Q8WA 4ENVA 4Y30A 1BTOA 1J07A 1D7AA 3FOCA 3K09A 2Y1GA 3FF1A 3OUUA 1D07A 2OV2A 2I7VA 2PYDA 2DGDA 1EK1A 2JRCA 3PPXA 1UPAA 4S1TA 4X5OA 5GOTA 4DYDA 3HYSA 1NG9A 4BIMA 1VIMA 1RQLA 4X60A 3MCUA 2J30A 1KRWA 4BJ5A 4UMFA 1MJGM 4DRXA 1EWQA 3GFRA 3I76A 3AGQA 3IOBA 2BFAA 3RS3A 1G8SA 2IP2A 2ZJ0A 1YCGA 2QROA 4ALIA 3GVHA 3KNZA 2FP3A 2Q6LA 5ECGC 1N1EA 3USCS 2ZWAA 2XT0A 4LSZA 5JFGA 3JQFA 3OX3A 3GT7A 2PLWA 3OH8A 3QXSA 4Q9IA 2X4GA 3D2BA 4MW4A 1THMA 1TW3A 4Q03A 3RM3A 3ZD6A 2CDNA 4PO8A 6GPBA 3ZPXA 1GPDG 4GZ5A 1VHLA 4M0KA 1F12A 2V7QD 2NZVG 1HGXA 3NWBA 3N59A 1QC5A 4XVHA 5JSQA 1I6MA 1CV2A 5DFAA 4WEOA 4K9QA 4L8FA 3LQYA 4FE7A 2D06A 2P1DA 4UU8A 4P3OA 2AFIA 1NBMD 5IBPA 1L7VC 4G0YA 4Q1AA 4ILEA 1F06A 4UM5A 5L51A 4WV3A 3RSFA 1NP3A 3ACDA 4EJ2A 3SJ7A 1SR8A 5DGHA 4KMMA 4UHCA 2GZSA 3C6XA 3NIGB 2QTRA 4HB0A 3LOQA 1BHQ1 4L4RA 2AD5A 3U31A 4BKQA 5BR4A 5KYYB 3QMVA 4BVGA 1YF3A 3BCSA 4Y8VA 5TSDA 3H5AA 3I6QA 4LMPA 5B53A 3PX2A 3RLIA 4GQIA 4R1PA 2G6BA 3BB3A 3ND8A 2FYTA 2RJNA 3KLNA 3AFHA 4RMIA 5C3UA 3U9SA 2QVYX 4EW6A 1GCAA 3BSFA 3O1HB 3QEMB 1V4VA 1Y1LA 4D56A 1PR6A 2NTYC 3HCDA 3NHJA 3GCDA 2V3VA 2GKGA 4B9EA 3AI3A 4JEIA 1TK2A 2BEKA 2WWXA 4OMDA 2YR0A 1G18A 1CF4A 1QIDA 1LPPA 2I33A 1E3WB 2GEUA 4K1LA 1XX6A 4BX2A 3K9HA 4E1AA 4E2ZA 1LBSA 2EKBA 4Q5IA 1IZYA 4INAA 4RH1A 1C8VB 1ZINA 4Q93A 5BUSA 2HHHB 3A4IA 5J4KA 3P0FA 4OHYA 1SBZA 3ASUA 1EXDA 3AEKB 4PIPA 4F84A 2GTIA 4GP6A 1B8NA 4CV2A 1XT6A 3DDCA 4ZVKA 3SQOA 3RF7A 2B8TA 2JFVA 4NYMQ 1EUQA 1PYOA 2EJUA 4C7BA 5A62A 2HMWA 3Q3IA 3ZS9A 2JJ2A 3F2VA 3EUWA 1MV8A 2GM5A 4KO3S 4E4RA 2QN1A 4HOYA 5KNBH 1D8AA 3OECA 5A2GA 2FN9A 2MYTA 3WHKA 3AY6A 1GQQA 1EVYA 1GVNB 1DC7A 3JWPA 4C7OB 2O2ZA 1VG1A 4KRXA 1TT5B 3OCXA 2VYQA 4IIFA 4DXAA 1KAQA 5AOAA 5LKRA 3PQCA 5CW2A 1NDUA 4MRMB 2CL0X 4CU2A 4MUXA 4TTJA 4E09A 1J0XO 1P0FA 1II0A 3E7FA 3TN7A 4DV4B 1EU1A 3FRJA 1N57A 3UWKA 3MSXA 2HLHA 3WADA 1F2TB 5H3HA 1OWPA 3ZWBA 4B76A 3MHTA 2J0QA 3FAZA 1UZUA 5KYNA 3WLMA 3DE7X 4PHCA 2BI7A 1DTWA 1BHO1 3B38A 3OZ7A 3W2HA 5F2NA 4KGXA 4EFNA 1TU3A 2PXAA 4AJ9A 1RZUA 4NJMB 2CHEA 1XZCA 5AQ1A 5EI5A 2CCKA 4D4LA 2RC6A 4JJIA 4MYTA 4E15A 2AWNA 4XYGA 5FPKA 1JLRA 4E1VA 4JDUA 3CYFA 3IT0A 3MS4A 4QBKA 4F9EA 1C14A 5JROA 2EX0A 2VQ6A 4JASB 1NQVA 3F6YA 3FUXA 3MVEA 4UHKA 2O50A 2OA0A 3W8DA 1EKXA 2YNMC 4OY3A 5EMHA 3P0IA 3ZK8A 2Q5IA 4FIZA 4Y2RA 2Q4OA 3JYHA 1MLDA 4MJ7A 4FHDA 4HRXA 2NN3C 1UK6A 1EBBA 1E9BA 4GOXA 5KMGA 1ANKA 4MKFA 5TQ0B 4TMWA 2X5KO 1CRZA 3GRZA 4NYJQ 5B1IA 4E7OA 3O73A 4KEAA 5ADUS 1WXGA 1V3TA 2QQ5A 1XMJA 3DOFA 5DX0A 5TNXA 2FR8A 2BF7A 2M6LA 3ZS8A 1OOEA 2NQ8A 3ZD7A 2YWRA 4HH0A 4IMPA 5I9TA 3RADC 2QG4A 1FDIA 3QSGA 4GO1A 4FQ7A 5AJTA 1ZXLA 4AVYA 3VR4H 3WB0A 4G01B 5T41A 3D2CA 2CVPA 1J23A 2LWIA 1NJ1A 1E64A 3WO1A 5L4NA 2B82A 1YK0A 5EXSA 3LKDA 1T9AA 2PGJA 3SDBA 3E7WA 3KPUA 1L4BA 4RVNA 3A26A 2N46A 2FFRA 3RAPR 4MO9A 4RDXA 5FA5A 3K0HA 5BSKA 3FETA 1SKYE 3IPAA 5JNLA 1P33A 2PS3A 3CG4A 4GOMD 4L6AA 4M0DA 5B2EA 5F2EA 3CPSA 1Z62A 4K6GA 1EFTA 3IVXA 1ACLA 2CK3A 3I34X 3ETEA 1MEJA 2I5PO 1V11A 1X7YA 2NWQA 2GQ0A 3AV0B 4GYWA 1HDZA 5EJ9A 2HADA 2J4FA 3K92A 1NXVA 3CINA 2VFAA 2PSDA 4RQBA 4D9HA 3RK4A 4A0QA 1Z5WA 3UHAA 1I4EB 4WZAB 1BX0A 1OHHA 1C0LA 1EUCB 5CP8A 4B33A 3DCNA 5LQKA 4QZVA 5SYMA 1Q50A 5HX7A 5DNWA 1PCXA 3SOZA 3BE8A 1XLVA 4L3WA 2MINB 1IXZA 2BMDA 2VP5A 3GX1A 2Z30A 3BHJA 3KZKA 2EWVA 2NO9A 1GADO 4K2AA 2SCUB 3TL6A 1NI3A 4AWAA 2WT4A 4H18A 1T9HA 1V1RB 2PL5A 1SKAA 5HQ3A 3RO7A 2XSZA 1BJTA 4P4TA 4IMRA 2YYSA 4JT9A 2VQ3A 4KWIA 1O0SA 1KAEA 4H7EA 5IMSA 1XLWA 5FL7A 1Y8QB 3W7BA 1POWA 3L79A 3QV1A 3VR1A 3CZ5A 3ZLBA 3NMUF 4G9GA 4AJ4A 4CQMB 1KZ9A 3HKCA 1OXMA 4OSEA 3FWHA 3RUFA 1I7QB 4QAQA 4LZOA 2W6ID 2RGGA 5CXSA 3EIOA 3O3NB 4LGMA 4C76A 1ZDMA 5HFNA 3ECAA 5BSUA 1RYBA 3JAKB 1CUZA 1BGVA 2FR0A 1P1JA 3TEJA 1Y3CE 3EZYA 3FIUA 1KFEB 3GEBA 5KB3A 1M33A 4Q4JB 2VPZA 1XWFA 4XWYA 3VHXB 1RVDA 1MO5A 4EPWA 5B4TA 1DI0A 2A92A 4QOGA 2VDOB 1Z4JA 1OXBB 1Y8CA 1UPUA 3UW3A 4DIEA 3GLGE 3KQKA 2QEQA 3OOSA 3E58A 1S3IA 3GCZA 1V9SA 2O8EB 1RXEA 2XYPA 5DI3B 2FFQA 3BFPA 4M1WA 3KJEA 2QDKA 4M60A 3N86A 1QE5A 1L3CA 2IYZA 2RAFA 3BH7A 2Z4SA 1I3CA 2C20A 3NRCA 3OQNA 4L7QA 3R7NA 2FNAA 2P41A 3PRYA 3COZA 5FBLB 5FBWB 3GJ4A 2JCVA 5TGZA 5DLQC 3I01M 1V16B 4EY8A 4DMLA 4BTVA 3BE4A 4NLLA 4QVIA 3NBKA 3EHDA 3VAAA 3UMVA 1QF9A 4UXHA 2OGZA 3K0CA 1UKVY 1RWPA 2OKCA 4LN1A 5CJ2A 3IDAA 2G9QA 3ZVRA 2HNAA 1OWLA 1UWLA 1PK8A 3TKAA 2XGJA 1EVIA 2WTNA 2ZWMA 3H16A 2L69A 4G5HA 4GSYA 4RS4A 4CGYA 3ZTWA 1OX4B 1NF9A 3Q7IA 1W6RA 3OEYA 5ALQA 5GY7A 4CM7A 3ZDBA 1TAUA 5I48A 2F1OA 3LF2A 3ZDFA 1DKMA 3WA7A 1L7XA 4DVJA 4GI1A 1F7UA 1BWRA 2WPDA 1U0SY 1I30A 1YZTA 4PYIA 3SVZA 3PXDA 3OOEA 4I8XA 2I62A 1E89A 2JFHA 1NNLA 5TPWA 1LDEA 2JFPA 3M2PA 4KQHA 3P4UA 4Q48A 3BQ9A 1L7BA 1T2NA 3HV2A 3I09A 3K30A 4C2UA 1R10A 4OQXA 2QUBA 1H8ED 4JP2A 2QE7A 5DM60 3VOAA 4BZPA 4L4YA 1CVRA 1OXXK 4WZBB 1BKYA 1AS0A 1QVAA 1Y4ZA 3BE5A 5ECYA 5CAEB 5CA0A 1H3EA 3ZK7A 1F6DA 1HDOA 2C84A 3KLPX 1TVKB 3NM4A 4IDGA 5DBOA 4FB4A 5AIBA 1R16A 4FC7A 4MYDA 5MN6A 5KJ1A 3EULA 3LGXA 5HZMA 1XC7A 4RZIA 3V46A 5JSUA 3A14A 5CB4A 2LE0A 5FWYA 1P8JA 2AOUA 2PQMA 2CVHA 3EWAA 4MPJA 4A1FA 1SVIA 1ZHFA 4LNHA 2EBHX 5CMLA 4CUJA 3TJZA 4HDOB 1BX3A 2NNWB 4COKA 1JFFB 4NVRA 5DHUA 1X7GA 3VU0A 2W00A 3CISA 1Q0PA 3LFUA 3IBCA 3NBFA 2QNBA 3GYBA 3ZBQA 2P9EA 3C98A 2E5FA 4EGFA 1TRHA 8AT1A 1J9GA 1E0DA 1PJ2A 2JFGA 3A1EA 4H60A 4O3FA 4E32A 1XL0A 5U4QA 4DG9A 1GKLA 3AQ4A 3CWCA 4CG3A 1U1IA 1AGYA 1DKLA 1JG4A 3KLMX 5BVGB 1OFGA 1NNI1 1V6SA 2GI4A 4OHMA 4FMPA 2FVYA 1VFNA 4D45A 5C5EA 4WVFA 1JQ3A 4WKOA 5CA0F 8ABPA 3JD1A 3S2UA 1FJXA 1WAMA 1NW7A 4PF1A 5ITVA 2OZKA 5A0TA 4DIKA 2R6DA 2FN4A 2X7HA 2HU8A 3IGFA 1IIBA 1QBKC 4KCGA 4WFJA 4Z3DA 3TB6A 3VRHA 5CB4F 5IZCA 1U1GA 3CZ9A 4GXTA 3TOXA 5JAIA 5EJEA 1DJOA 4DWVA 1KKUA 4GF5A 5ARBA 1Y7HA 4Z1MA 5LMUB 4R3NA 5LZ2A 4RZQA 1X2BA 3AY0A 1I3OA 2VF4X 5EGSA 4EAAA 4C0HA 2H00A 4U2KA 4LX0A 5EJAA 1GGVA 2LGJA 3OEHD 3IP1A 4EKGA 1KFJB 2HY7A 1CY8A 1BS2A 3R7WA 1XRLA 4P0TA 3ILHA 3T38A 5LJLA 2VJPA 2BZ1A 5IHPA 3R76A 4DDMA 5JXIA 4BEBA 2W7TA 2EHJA 1TF5A 3HG7A 3KQNA 4YPVA 4KDEA 4LZPA 1PEAA 2I78A 3EXAA 2HFKA 3ESDA 4QO7A 4ZIRA 1Y4SA 3CFYA 1RLOA 1RABA 2O3TA 3TOVA 1V9CA 1ORDA 4Q7KA 3VH1A 4E5VA 4N48A 1N75A 2GBGA 1AB5A 3CF2A 4G8CA 2Q2QA 4DRXB 1XRJA 3B51X 3IILA 3OT1B 4ZVTA 3VYRB 3OCVA 5A7HA 1NKSA 2ZBVA 3EOBI 4MUAA 2AE1A 4BLVA 3ZIAA 2XF2A 2Q5CA 2UZAA 4JITA 3W2GA 3ILYA 5KHLB 2ZRBA 1DAKA 5EJGA 4ZT6A 4J0HA 3G89A 4UTPA 3ONWA 2GK7A 4Y6PA 4JIGA 4UBNA 2IEBA 3ELDA 3MM4A 3K0AA 5KS2A 3V9PA 3ROGA 4EYGA 1U0NA 3I5AA 1XO1A 4GPEA 5LFAA 1DRVA 1E9EA 2YMPA 9MHTA 3E8MA 3F6CA 4ENSA 4C30A 4JGBA 5JZOA 3U09A 3UV3A 4JV5B 3EMKA 1BVHA 1Z2DA 2AFIB 5H3CA 2PUJA 5JSYA 1E2HA 1OLSA 2V55B 3UH0A 1QH8A 3LWNA 3E1GA 4RJKA 5IUJC 5KPJA 2QVXX 1D2GA 2QRUA 1BH2A 3MCWA 1QPBA 3FRHA 5LLSA 5F5NA 2J6IA 4QQKA 5G02A 4NARA 1O58A 1XRNA 3BWEA 3HCNA 1SZPA 2Y0DA 1XRPA 1CUGA 1MEOA 1K6IA 1X2EA 3I3OA 1ZR2A 5C7YA 1RCTE 2SECE 1T6NA 4P3PA 4ZAFA 1BHSA 1F7VA 3LT0A 3TH5A 4BZXA 5G4KA 3KJHA 3NKFA 1C8BA 1RHJA 2AZTA 2O2EA 4E2WA 3EWNA 4PSUA 1G8MA 2JCYA 5AJUA 1K98A 2CBZA 4U6NA 4OVKA 3N2GB 1TKAA 2QZPA 5L3QA 3NH6A 1I1NA 3SR4A 1Z18A 2JJQA 4NHEA 3ENQA 2P4UA 3QOXA 3BAZA 4NZPA 4JD5A 4TWIA 5EWMB 4DR3B 2XITA 1BO6A 2IY8A 2Q6KA 4TXNA 4YRCA 2PUBA 5D5PA 4NX2A 4FEYA 4ROTA 5CHYA 2FI1A 1MW9X 3PE4A 5JEEA 1VHDA 1JDSA 3TEFA 2XNDD 3S7TA 3AVTA 3MWLA 4BS9A 2HWKA 1IFXA 4WK4B 4JI7B 3CX3A 4ED9A 3K2IA 5ENVA 2GJ9A 2R1UA 2IZ6A 3GT0A 1CZNA 3I2GA 3REOA 3N8HA 4LC0A 2GTPA 5IT4A 1MF7A 4JAVC 2VEOA 3WS7A 3SN6A 5D3QA 3K53A 1NXSA 5IS2A 3WK4A 2H29A 2V7QA 3N76A 2E21A 4OGWA 2D6FA 3B89A 2H54A 3NVMB 3X2FA 1I94B 1V8BA 3TNFA 4MX8A 3C14C 4HUJA 1EVZA 5CXUA 2WSIA 1NATA 1W52X 1NBMA 2HO4A 3A1TA 3KJXA 4KQMA 1DTWB 2HA0A 3R44A 4LY0A 3GEDA 1PKXA 4KQFA 2EEPA 4YMSA 3Q8KA 1CF9A 1FA9A 1YR8A 1WPGA 3WAKA 1CVIA 4MMYB 1T0JB 2ZRLA 4DR7B 5IDXA 1EGQA 4G4GA 1GDHA 1FDUA 1YVPA 1R3UA 4JROA 2BFFA 2GO1A 4XM0A 4B6OA 4NZNA 3DOCA 4DW8A 4JVLA 4NQRA 2ZJBA 4G5QA 4YMIA 1Y7LA 4K6CA 4LXHA 2GXUA 2ZETA 2G40A 5JJCA 5E38A 1Y80A 1Y9EA 1IOZA 2OO5C 1R6VA 2ALJA 3TNJA 5TJ9A 4KXXA 3WIDA 3PITA 3PTAA 2NU7A 2WWHA 4NPAA 3RYTC 5KMGB 4DQVA 1UK8A 1ZI6A 1ZM7A 4BE7B 4K6HA 5AJVB 4ZZIA 2C5EA 3LZ6A 2R6GA 3PL1A 4I55F 6PFKA 2I4IA 4LJAA 3VNVA 1HQCA 1SM4A 3QLJA 2RHRA 3H5LA 4ISBA 1AKMA 4EA6A 1HYEA 2C9YA 5DNVA 1ZLYA 3LG2A 3IALA 4XD7D 5NULA 2C8LA 2M1XA 2A1IA 2Z8ZA 2JGAA 2VAVA 1QLJA 4E03A 3PE6A 3H9EO 2EYUA 4GU5A 4ZYVA 2Z56A 4WBNB 3FHJA 1YJ5A 1CE8B 2QD1A 2ZYDA 3NVAA 3RQIA 4X1IA 1AJEA 1JEQB 3RAFC 3G9ZA 3UF0A 4DDWA 4KAXA 3IBFA 4D3ZA 3RAJA 3PCRB 2WUFA 3O2NA 4BFUA 3D3WA 3O21A 4YR7A 1G8AA 4X41A 4BNJA 4US0R 3KX2A 1AO3A 5DASA 1WZ2A 2OESA 2NACA 3N58A 4AIRA 1V11B 1X7YB 4QFDA 5DBHX 3CGGA 3BIXA 3GWZA 5EE5B 5LWQA 4ARCA 1JPVA 1V47A 4LYEA 4PZEA 3LQRA 1W2GA 3GJQA 1XL1A 4JR0A 4IICA 4XXHA 4CF3A 3JQ9C 4KAFA 4D99A 4ENUA 4HWPA 1QO0D 3KSZO 3KJFA 3LKZA 2XKAA 1GG5A 3GGJA 3T99A 4HADA 1JQJC 1TLFA 3IHLA 4H3HB 4MCHA 3IX7A 4QXOA 4UAGA 1J4AA 2I4LA 3G2MA 4HN4B 2PT7A 4CFSA 2MU1A 2CYAA 2HYDA 3CUSA 3DCIA 1P2BA 5HWSA 3C45A 1BW9B 3INRA 3N07A 4AO6A 1QRDA 2YVKA 4C03A 3E22A 3LY5A 3QKSA 4C21A 2CDCA 3T9DA 5HQ3B 2O59A 3B6EA 2CE7A 3FA2A 3GRCA 3KXPA 1FFEA 2XLBA 2Y77A 2ZIAA 3MF4A 1SHLA 3O9ZA 2ZYGA 2NXNA 1L5HA 3TSOA 3WX0A 2XDYA 2VJQA 3FPJA 5EWJA 4CMEC 4EEZA 2BKVA 4MDEA 3LGAA 3DHWC 3NQ41 2WOJA 3EG9A 1KDZA 3D0RA 3RJZA 1ONNA 3MK31 2JAQA 5LD2C 5T8KC 3MCZA 2FSSA 2COKA 5HGXA 5I4BA 1XQVA 1SGWA 3CTMA 2ZFUA 3ZCTA 1MOSA 1UT6A 1MX1A 3R23A 6AT1A 5HF5A 3PNKA 4HH3C 4ARVA 4AN1A 3GNSA 3KKEA 3QHAA 1PWHA 4ZO8A 4OXQA 3K6RA 3JAWB 1UFRA 1X7XA 1WB5A 2HA3A 1E66A 1NY6A 2P5UA 4AG5A 1CQJA 5KAPA 1A82A 1E3DA 1KC3A 2A86A 3ZXSA 4M8SA 1FFWA 3ZWXA 2W6OA 1MU0A 3GCWA 5K3CA 3VJKA 3R7LA 1NW5A 3DMTC 2JLWA 4RADA 3ZU6A 4BKUA 4DBLC 2IDJA 2VBIA 4GQBA 4P6VF 521PA 3JVDA 4KQWA 4DLYA 2RGNA 2C9MA 2HJ9A 3QNUA 1VJ1A 4E3WA 3PRKE 4HDNA 3ZK9A 1I3KA 2EFCB 2J4CA 3UWOA 3DXYA 2DF8A 2FU5C 2X3YA 3I9V1 3WQBA 1DIRA 4AJOA 1CP3A 3S68A 1TMYA 4EEKA 4F5DA 3C7CB 1BJKA 1B6TA 1E3TA 1IY1A 3JWJA 3NDIA 3IJRA 5DK6A 2WWVD 3TE7A 4MGYR 4YT4A 2GFQA 1DADA 3MPUA 5CEEA 4GG1A 4GPTA 4PLPA 2PXXA 1YZGA 3WLJA 1Q6ZA 4GW3A 1P4AA 4MUGA 1LSUA 2YVUA 4DS3A 2FGKA 2WJIA 4EMUA 5B3LA 2OCYC 4CBVA 1K4MA 3UJPA 1X9HA 3DQQA 1D4OA 2ONJA 1TJNA 2BM8A 4NV1A 5CITA 3DZGA 2UYCA 1EE2A 1J5PA 3A32A 1REQB 5NLLA 3TSCA 4BMPB 4C4XA 3T1YB 2ZIZA 3OSZA 1I3NA 3SEZA 3LWDA 3SXUB 2P62A 3H6HA 2X15A 4G26A 2JLRA 3WRVA 1WMFA 1NOJA 2WHRA 2H06A 2W6IA 2YUIA 2ZIWB 4W5NA 1N5IA 1W9HA 3BOSA 5TPWB 4Y6GB 1K86A 2XODA 2WFZA 4GRDA 2ZBQA 2PMBA 4UASA 1USIA 4X97A 4DBZA 4G0MA 3DVQX 1VBFA 5JNSA 3EEFA 4FEEA 5COQA 3ZOKA 2IYRA 4RCVA 1A8HA 1J00A 3PLAE 3USES 3V33A 1V37A 2WJWA 4ZYLA 2G1UA 3K31A 1QVVA 2AG1A 1E1DA 3EZNA 5KI6A 1ECBA 2QX4A 5CA0B 5LIPA 3JSAA 1RBMA 5AXBA 1K3UB 1G0OA 1SPBS 2ODWA 4FBMA 1CEYA 1COWD 4B31A 2X14A 1VDMA 3GG2A 1EH5A 3G02A 4U6SA 3WGJA 2IYTA 3WIOA 4IKPA 5CB4B 3A6LA 2YQ4A 4TMTA 3CEJA 2IS1A 2H17A 2PO7A 1P3Y1 3OFND 4RGQA 3ZQUA 3ZY2A 1IUNA 3LC1O 2AFRA 1IAQA 3GRFA 1OCEA 2QRZA 2FSUA 4U63A 3TXXA 2NVUA 1MABA 3C7DB 3CLUC 4PINA 5B36A 1E3IA 5BVHB 2QENA 1A8PA 1H1LA 1E6LA 3TQRA 1PJCA 1UC8A 3HWWA 4EQZA 4B4KA 1Q92A 1V43A 4JQSA 3IPXA 3H5TA 4NY1A 1X14A 4D41A 4Z0NA 4OQYA 1I80A 4OB8A 3C1OA 4QBTA 4P4UA 4BO6A 2VT2A 2H2HA 1HZZA 1I3MA 1Z4NA 3KKNA 3BTUA 2E6UX 2ZJ7A 3N8DA 4BYMA 3KDPA 1HQYE 3MTIA 3O8OA 1T0UA 1Z35A 2FUG1 4ARZB 1KMQA 3MWDB 5DW0A 2P8JA 4M1MA 3HO6A 5JD3A 3DZIA 1M76A 4JOQA 1O94C 3AF3A 2G1PA 2NXEA 4J3NA 1E1QD 1SCQA 1YDFA 3JQBC 3PQ3A 4JY7A 1YDEA 5SICE 1WNFA 2QMEA 3GVIA 3S2SA 3AM4A 3L07A 4ZAVA 3A8TA 3SS8A 2I6SA 4DNPA 1T2DA 2YHAA 2IUSA 3W34A 2OOKA 1DFIA 1QH0A 3UJCA 5HQJA 5BPFA 1A4IA 2WFMA 4Q3KA 1NUSA 2ATEA 3DBLA 4XKJA 3R9WA 2NPIA 1H8EA 1OAAA 1IY8A 3MAGA 2Q46A 2O2DA 4QNMA 3UB3A 5KVAA 1ISGA 4N3CA 2DPXA 4NOKA 2AK2A 2PQ2A 5KYKA 3ER9A 2MYNA 1EFVA 5JLAA 4RZ2A 2PMEA 4BPRA 2RGBA 1RWOA 4DMCA 1JIJA 4UU7A 3AUJB 3NHPA 1I1HA 3MRVA 1WLSA 1BFKA 4YONB 2PGAA 4LC9A 3L7DA 4OBWA 2GCOB 4YGYA 2IYOA 4EKDA 2C4TA 2BEWA 1YXMA 3V1LA 5LZ9A 4EF6A 4GL4A 2R7MA 1I1OA 4NMXB 5IEJA 3EW7A 2O23A 2I3ZA 2VHJA 3L46A 2YW9A 5JDCC 5K8LA 3W77A 2NUTA 3OQOA 2IEYA 2RKOA 3GGGA 2JRLA 4LQ4A 3GZJA 5DULA 5F7ZA 3LL4A 5BWLA 4LHVA 4L95C 1FVXA 1T13A 2AVDA 4E5MA 4CFZA 1YD7A 2W8BB 4TRJA 1HFEL 1UADA 3FCCA 4YFVA 2P9HA 3NG1A 5E9JA 5HTOA 2VQFB 4TTRA 1S2GA 2CMKA 5JPDA 1Z5GA 3HFGA 1R6AA 2YVAA 3AVOA 1LDGA 3DEKA 3M6FA 3QG1A 3RTAA 1K08A 3RVQA 3TVYA 4DCMA 1AQNA 1QH8B 2NYAA 3QYAA 3JAMA 1WUIS 3EA0A 1TYCA 1XU4A 1AK2A 1AKWA 1W46A 3NHFA 1VYVA 2YFHA 4AJKA 3ADKA 2H63A 4DZZA 1TAGA 5CLLA 1CIPA 4Y3UA 3STWA 3RT9A 1RYZA 3W2EA 3LCCA 1WL8A 1P7VA 5BW4A 3A6DA 2C3YA 1FYEA 3V4LA 1E0AA 2YUTA 4TKVB 4Z2AA 3B2QA 3OEHA 3MRSA 1YRHA 1QOPB 3D59A 3WGMA 1LLFA 4YAUA 2FG5A 4H27A 3FNHA 2VSOA 5G4KB 3GMSA 1PQUA 3UB2A 5F1PA 5JR3A 4BDSA 1H69A 3ZV3A 1IHYA 3AESA 5EGNA 5FHRA 3MJ4A 1G63A 1OLXB 1UDBA 4KBYA 3F8TA 4TLMB 4X93A 1VPVA 3EVFA 1A69A 1GARA 4ID3A 1DEHA 1QIHA 1RKXA 2G6TA 4KREA 2DBZA 4MP6A 2E89A 4MHOA 5IAEA 5K8TA 2A1TS 4CF5A 2G72A 3EGDA 3BRSA 3E9MA 4JOCA 4PBTA 1A9PA 2HF2A 2XZPA 5IJWA 8MHTA 2DECA 1TCBA 2NV2B 4H