2AOTA

Histamine methyltransferase complexed with the antihistamine drug diphenhydramine
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
288
structure length
286
Chain Sequence
MRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYEYDLLSTMDISDCFIDGNENGDLLWDFLTETNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for inhibition of histamine N-methyltransferase by diverse drugs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histamine N-methyltransferase
total genus 101
structure length 286
sequence length 288
ec nomenclature ec 2.1.1.8: Histamine N-methyltransferase.
pdb deposition date 2005-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2aotA00
1RJEA 4HGZA 5CVJA 2I7CA 3D2LA 3G2QA 3P9KA 3G89A 4P58A 2JG3A 5FADA 4YV1A 4MTLA 4CTJA 3FTFA 4DZRA 2I6GA 3FUUA 4KW7A 4BY9E 4QTTB 5ICGA 2P7IA 2IDJA 3ELWA 2XVAA 3OPNA 4FGZA 4OA8A 5EQJB 4EVIA 2PLWA 3KQWA 4CTKA 1AV6A 2EG5A 2DULA 3P9IA 3EEOA 1YF3A 4C06A 1ZGJA 1N7JA 3EVEA 2Y1WA 4O29A 3T7RA 5E1MA 2IH4A 1BC5A 3FYDA 3GIWA 3JWIA 3DMGA 4RVFA 5DXAA 5IH3A 2AOUA 3CJRA 4PYMA 1X19A 1JQ3A 4RVDA 3G8AA 1VP3A 2PKWA 1RI4A 3PVCA 4LWPA 1WXWA 4X60A 4L7VA 2C7OA 4PGGA 1KXZA 2FRXA 2P41A 2V74B 4YUZA 2WK1A 5K01A 1QAQA 3E8SA 1BHJA 4FZVA 3TPZA 1DCTA 2AN5A 3KQVA 2CMHA 4FS8A 1YFLA 5FA8A 5CD1A 2PJDA 4XCXA 5EHIA 1IY9A 3TKYA 4PONA 1IM8A 2VS1A 5LQKA 4ISCA 1G8SA 4RVGA 4P7GA 3OZRA 2IH2A 3UJ8A 1PJZA 5EVJA 1TPYA 4WVLA 8MHTA 3FUWA 1N7IA 3A7EA 2PVCA 3KQOA 3I53A 1R6AA 2AOTA 3SSOA 3UA3A 3M6UA 1X1BA 3KR2A 3PX3A 9MHTA 2ZZMA 4GOOD 4U7PB 4EK9A 3MERA 4PIMA 5P8WA 5T67A 1NKVA 3MCZA 2B78A 1NW8A 3P2EA 1EIZA 2BM8A 2ORED 4HSGA 1WG8A 3IV6A 1JG1A 3FRIA 3GRYA 4M38A 4YMHA 3FTCA 3K6RA 2C7QA 5EIWA 3G8BA 3EGIA 3VC2A 1EAMA 4MWZA 3SGLA 3UJCA 2NP7A 2NP6A 5EZQA 2EJUA 5E1BA 5CCBA 3KQYA 4IV8A 4XUDA 2FK7A 5KQRA 2IBTA 3HEMA 1EJ0A 3GCZA 3SSMA 1HNNA 2HR1A 2ZWVA 4C04A 1RJGA 1I4WA 3LCCA 4PYKA 5FQNA 4EMSA 5ICEA 2XYVA 3OU7A 2FCAA 3EEYA 5K05A 3P97A 1R18A 5LQUA 4ATNA 3PX2A 3JWJA 1ZKDA 3SR4A 4QPNA 5DM2A 2HMYB 4GQBA 4EQZA 3MQ2A 2HV9A 3PLAE 1KPGA 5C0OE 4MIKA 5KS2A 4M37A 3NDJA 2B2CA 4OQEA 5GIOE 2AR0A 4OQDA 1JTFA 1M6YA 2AOTB 3EMDA 4QDJA 2ZVJA 4FT4A 1X1DA 2GS9A 2P3LA 1XDSA 1KIAA 4RTSA 3EVBA 3S68A 3HVJA 2YUIA 4RX1A 5HIIA 4FT2A 1WS6A 5GM2A 1QAMA 1DL5A 4Y2HA 2OO3A 1ZHFA 3NWEA 4CKEA 3REOA 3DTNA 4R05A 3DH0A 2LD4A 3P9NA 4R6XA 2PWYA 5HFJA 2FPOA 2P8JA 3GJYA 2I9KA 2PWPA 3PFHA 2NNWB 1XDUA 3PB3A 4QPPA 3G2MA 2NXEA 2YXLA 4E31A 5E8JA 4E32A 5HIKA 5KQSA 3UWPA 3ME5A 2XBMA 3CJQA 1JG3A 1TW2A 3FUTA 3R6TA 5DSTA 3LSTA 1AQIA 5FQOA 3KQPA 4RSRA 1FP1D 4MQ4A 4RTRA 3BGVA 2QYOA 4E33A 1NV9A 3G5TA 5CIYA 2BZGA 4ER0A 4F85A 3T7TA 2Z6AA 2OY0A 1KPIA 3BKXA 1Y8CA 3NMUF 4DM3A 5E1DA 1SQFA 3HCDA 3MTIA 4E2XA 3ERCA 3C6KA 2ZLBA 2G71A 3C3PA 4PYLA 4YUWA 3FYCA 3H2BA 3A26A 3I64A 1JQEA 2O57A 2QY6A 3O7WA 3ELYA 3P2IA 1L1EA 5E9QA 2ZSUA 4PGHA 3HA5A 4RVHA 2GAFA 4RTJA 3UJ7A 3JWGA 5DX1A 3AWIA 2IPXA 4P7JA 1XJ5A 3BWYA 3U81A 5LSAA 2H00A 3RODA 2ZCJA 2IP2A 2XVMA 3F4KA 3AJDA 4ER5A 2JHCA 4KDCA 3B3JA 3DXZA 1AQJA 5ERGB 7MHTA 3RW9A 1FPQA 1P1CA 1Q0SA 3SX0A 5DM0A 4BP1A 3E7PA 3SMQA 5B1SA 4YUYA 3UJBA 3LX6A 4M7RA 3CC8A 2GB4A 4P7FA 3UZUA 3NDIA 3KR0A 1NW3A 2YR0A 5FHQA 2OYRA 4M36A 3FTEA 3HA7A 2QRVA 3GU3A 4AZWA 3Q7EA 3X0DA 5K0FA 4HTFB 1G60A 1UWVA 3EGVA 3HVIA 1DUSA 2B25A 3KKZA 3LDGA 1EG2A 5E1OA 3P8ZA 3IEIA 5LQAA 4YV0A 3GXOA 2ZIGA 4RTQA 2ZIEA 3FTDA 4R8SA 3AY0A 4RTLA 5JUWA 2GLUA 4F84A 2ZFUA 5DTRA 2JH9A 2P35A 3DMFA 3NTVA 5D1NA 3EVAA 2I62A 3GRRA 3R3HA 1RI5A 4POOA 1OR8A 2E5WA 4CKBA 5T64A 4QQNA 3EVFA 2CMGA 5F2OA 1YZ3A 1TW3A 4GOND 5EIFA 5CVVA 4AZTA 3A25A 4QVGA 1NV8A 4KRGA 3E05A 4R8RA 4X1OA 3SXJA 3G7UA 3TMAA 3TM5A 3TRKA 3MCTA 3CVOA 5CCXA 4GEKA 1G8AA 1FP2A 3I9FA 2EFJA 3Q87B 3LECA 3UJAA 3I5UA 4OBWA 5KYGA 2OB2A 1VL5A 2CL5A 4RWZA 3A4TA 3LDUA 3HA3A 3B3FA 3TR6A 5DRYA 2R3SA 3CJTA 1XVAA 2N47A 2YTZA 3GDHA 3BKWA 5HZMA 1MHTA 4QQKA 3WSTA 4Z2YA 4BLVA 4NECA 4E70A 2PXAA 3PS9A 1NBHA 5H02A 2HWKA 4OX9Y 1N2XA 3UJDA 2A14A 1XXLA 5G02A 3LKZA 3ID6C 4RTOA 1WXXA 4LWOA 3LCVB 2OKCA 3FUVA 1ZGAA 3GRZA 3KPWA 3NWBA 4HC4A 1V39A 2VP3A 3PFGA 3PTAA 2B3TA 5GWXA 3KPYA 2HTEA 3GO4A 5FHRA 3IHTA 3UFBA 5HIMA 4F86A 2EX4A 2H11A 2AOWA 3K0BA 3RIEA 2VDVE 2XYQA 3DLIA 4CWAA 2BM9A 5CVEA 1H1DA 5EMKA 4BLUA 3BWMA 2ZIFA 2PXXA 3KQMA 3MAGA 2PBFA 3DLCA 3FPJA 4GC9A 4PYOA 5DLYA 1INLA 1Z3CA 5EOVA 3TKAA 3BXOA 5EZSA 3VC1A 5K0GA 2IDKA 1L3BA 4HRAA 5E9WA 4KIFA 4CXMA 3EVCA 2OBFA 4E30A 2V7EA 3CGGA 1YB2A 2PX5A 2ERCA 3BUSA 5HILA 1BKYA 3G2PA 5EKXA 4AUKA 3LL7A 1VBFA 2AOVA 4IKPA 4AZVA 3QV2A 3EMBA 4PYQA 4DMGA 4PYJA 2DPMA 1JSZA 1XCJA 2JHAA 5DT2A 2C7RA 5T6BA 2HNKA 2Y1XA 3T0IA 5FTWA 4A6EA 3EGEA 1NW6A 2YVLA 5K0LA 3G5LA 1G55A 2PSSA 1NW7A 1SVUA 3SSNA 3DMHA 2P3QA 5GIPE 4PYNA 4LG1A 4DF3A 1F38A 2VZ9A 2ONYA 2BH2A 4HTFA 3SVZA 3A27A 2JHPA 5FCDA 2XYRA 3DXXA 3OU2A 3VYWA 2O07A 3L8DA 2AOXA 1UFKA 4C4AA 1X1CA 2AS0A 3HCAA 4V0QA 2IH5A 3R9XB 1R00A 1JQDA 1NW5A 4P7KA 4RTKA 3PT9A 5DM1A 4E2WA 4RTMA 2AN4A 1JG4A 3FRHA 2UYCA 1XDZA 4HG2A 2OZVA 4KWCA 1HMYA 3KQSA 1T43A 4U7TB 1RI1A 5DSXA 1XTPA 3KR9A 1O9GA 3QOWA 4YUXA 1X1AA 2QRVB 4GOLD 3NW9A 2ESRA 1FJXA 1WZNA 3KHKA 2GPYA 1SUIA 4H0NA 4GF5A 4C08A 1Q0TA 5LQNA 3E23A 4ER6A 1QANA 1G38A 1SQGA 4YMGA 3OCJA 3LBFA 1I9GA 5GM1A 5CVDA 2PXCA 3MHTA 5K0EA 5LQJA 2NXCA 3BWBA 3GRUA 5DXJA 2PY6A 3LDFA 4LECA 3OU6A 2AVNA 3UA4A 4PINA 3B3GA 4C05A 2GA9A 2F8LA 5FWDA 2NXJA 5DTMA 4AZSA 3BGIA 4FSXA 3OFKA 3B7PA 2ZBRA 4PWYA 5DRTA 3KQQA 3OE5A 2VDUE 3T7SA 1KPHA 2R6ZA 3KPUA 5EG5A 3SM3A 4X61A 2IFTA 4UOEA 1M6EX 1VIDA 3JWHA 1PRYA 4HGYA 3KU1A 1KYZA 5GP1A 1NE2A 3ELDA 2OB1A 3P9CA 1BOOA 3O31A 5U4XA 2IGTA 2AN3A 1VLMA 4AX8A 4GC5A 2G70A 1P91A 3GRVA 4PCLA 4RTPA 3HVHA 2CWWA 4XUEA 5E8RA 4RTNA 5ICCA 4ER3A 5F2NA 4BP3A 1VPTA 2ZBPA 4K6MA 5FWAA 1B42A 3M33A 3G2OA 4QTUB 1KYWA 5E2BA 1D2HA 3ELUA 2YX1A 3FPFA 4OBXA 2O0LA 4X41A 3TM4A 1AF7A 4A6DA 1SUSA 5EMJA 1I1NA 2NYUA 3DUWA 3HNRA 3KQTA 4FSDA 5CM2Z 1R8XA 4R6WA 3EVZA 1RI2A 4PIPA 4ZTBA 3BT7A 1YUBA 3BWCA 3NVMB 2UZ4A 3FPHA 5EHGA 3A7DA 1KHHA 3THRA 1YZHA 3IYLW 4QDKA 3O4FA 2NXNA 3C3YA 4QVKA 3EVGA 4MHTA 2AOUB 3KPVA 2P3OA 4FR0A 5LQRA 5F2KA 4OA5A 3UJ6A 2ZW9A 4BLWA 1JR4A 3AXTA 2OXTA 2JH8A 2EJTA 2IBSA 5MHTA 1ZQ9A 2UYQA 3DXYA 3M6VA 4KDRA 4ER7A 2G72A 3M70A 2PX2A 5EEGA 3MTEA 3QOXA 3R24A 3KR1A 5DPMA 3AXSA 3HM2A 1ORIA 2P1DA 3HCFA 3M6XA 3ORHA 3LBYA 3CCFA 1P39A 5BXYA 4EKIA 5EEHA 1VQ1A 1RJDA 2BR3A 3BGDA 3GWZA 5LQCA 2UYOA 5EKUA 10MHA 3EVDA 2YQZA 2PX8A 4IWNA 5EPEA 3LKDA 2ZTHA 5K0JA 1G6Q1 2YXDA 5BW4A 3ANXA 1D2GA 4E2ZA 2P7HA 3HCEA 3MGGA 5IKMA 3HCCA 3LHDA 4DCMA 5K09A 3P2KA 1F3LA 5GOZA 2WA2A 5M5BA 3TOSA 3ER9A 4EKGA 1UIRA 2ADMA 3OE4A 4JXJA 4X63A 1EQAA 4KIGA 3R0QA 5DM4A 5EC8A 3B89A 3EPPA 2O06A 3TQSA 3NVKI 3GNLA 3CKKA 2GH1A 1RI3A 3HVKA 3TLJA 1VE3A 2PT9A 4DQ0A 3M4XA 2O05A 2UYHA 2ZWAA 1SKMA 2Q41A 4B17A 3HTXA 4PCAA 2ZULA 4Y30A 3V8VA 4E2YA 5D1HA 2G1PA 2PX4A 1L9KA 4GBED 5DTQA 5E2AA 5DX0A 1KP9A 1O9HA 2BR5A 1R8YA 2C7PA 3OZTA 1WY7A 5HIJA 3BZBA 2VDWA 3G88A 2IIPA 3GGDA 4DA4A 3UBTA 5BP7A 4WXHA 5CVUA 5C9ZA 5FA5A 1FBNA 2P40A 1QZZA 1SG9A 4FP9A 4KVZA 1QAOA 2FHPA 5LR6A 3FUXA 5HOQA 4GOMD 5K0NA 1IXKA 2AVDA 2OPBA 3DR5A 5K0CA 2CKDA 5FULA 4RV9A 3FPGA 4DCGA 4C03A 2PV0A 2FYTA 2ZBQA 3C6MA 2ZZNA 1JSXA 2ONZA 4YUVA 5HEKA 4PNEA 3VSEA 3M6WA 4GUAA 5K8VA 2G8NA 3THSA 2Z6UA 1JG2A 5E9JA 2Z6QA 4V0RA 1MJFA 1XCLA 3ER8A 2JJQA 4DKJA 5C1IA 1ZG3A 5EMLA 3UJ9A 2PT6A 3V97A 3DOUA 3LGAA 1NT2A 1M0EA 3LCUA 4G56A 2AZTA 1VP9A 3CBGA 1RJFA 1EJ6A 2K4MA 3P71T 5DWQA 5K03A 3C0KA 3NJRA 5EGSA 3TFWA 4IV0A 1D2CA 4YV2A 2B9EA 1NBIA 1O54A 4XUCA 3MB5A 5BW5A 2ZZKA 2KW5A 2QM3A 4HH4A 5CUQA 5EMMA 4CKCA 1QYRA 3HP7A 1P1BA 1L3IA 3B5IA 1R74A 3OFJA 1L3CA 3FZGA 1U2ZA 3LPMA 1KR5A 3I58A 5K0BA 1JTEA 2WA1A 3DULA 2PGXA 5ICFA 4C07A 2YXEA 3KPJA 4RYLA 3OZSA 2QE6A 5KVAA 1YFJA 2BR4A 4PYIA 1ORHA 3FPEA 5JR3A 2FK8A 3HCBA 5DX8A 2H1RA 3DP7A 5FUBA 5GINE
chains in the Genus database with same CATH superfamily
1P1JA 4D4MA 2J4CA 1XMSA 5IM5A 1UC5B 2PGAA 4O5AA 4Q9JA 2VLIA 3QJYA 5FADA 4MTLA 1I5EA 2QBYA 4D5EA 1PN3A 3C4QA 2MIIA 4KW7A 5IVIA 3CUUA 3DQPA 4RQAA 5EYPB 2J3HA 3QU2A 3B7WA 5ULLA 3SPXA 1DX4A 5JD5A 5F9FA 1A4IA 1B6TA 1YZQA 4E1BA 3W5SA 1DAHA 4FBMA 4NNPA 1ZGJA 5T57A 3W05A 5JZVA 2W2MA 2PD6A 1E2PA 1EUCB 1PT5A 3GIWA 2QL9A 3V7FA 4P33A 9LDBA 3HP4A 2AOUA 3U40A 1LD3A 4QATA 1QQAA 2FMFA 3LF2A 5FFFA 5LA6B 4DIBA 1RI4A 2JFNA 3MN1A 4IRMA 3N75A 1WXWA 4C30A 1OLXA 2UUOA 5C1BA 2ACKA 3GYBA 3OIVA 1HLPA 1UBUS 1NNSA 4IKEA 4N40A 1T5BA 2BHLA 3FYUC 5JU6A 1GKKA 3DTVA 3NB0A 3W5HA 4G4IA 4I4CA 2C5EA 2HL6A 3N87A 5CDFA 3UMRA 3HI6A 4MX8A 1GKIA 2XA1A 1NIJA 1AXEA 1L7OA 1S8FA 2CW5A 3D7NA 3AW8A 3RAJA 2ES4A 4DJEC 3DVLA 4IMJB 3NBZC 5LQKA 4DIFA 3FPCA 4KXLA 4RBNA 2RG1A 3GT0A 1G41A 3AFGA 3SR3A 1N7IA 4M1YA 1S3SA 2RHWA 4B3BA 1N2GA 4OHYA 1JJ7A 1FVOA 2ZBGA 2ZJ0A 3C6YA 1GTL1 1QHXA 3O3OB 4RD3A 3WGHA 1V1JA 3EZLA 3JQGB 4WY2A 1RACA 3SKVA 4NCAA 3KETA 1T8SA 1GGVA 3LPNA 1RS0A 3PQ8A 1DU4A 1M5RA 2VZ0A 3L6UA 3WYBA 4MQBA 1VPVA 3NJ4A 2GGSA 1R0RE 2ZSBA 5AK4A 4C6SA 1E7QA 1EHYA 1QV9A 4V0NA 1NHGA 4J1QA 1SOWA 1HYGA 1CUYA 1UZUA 2ZYAA 3WGNA 3OM1A 2B5WA 2Q6OA 2XCTB 1Z36A 4G0UA 4GYWA 3KSDO 5E4YA 1QU2A 4ZCIA 2HCBA 3AUSA 3LQ1A 4I50B 2CUZA 5HKAA 3GUHA 4IV8A 2IOFK 4BZQA 4KN9S 1EJ0A 3SSMA 1JAXA 3UWSA 3HZZA 1W30A 3C5VA 5DNUA 1TQ2A 2Q07A 1ELOA 2JBWA 4GP6A 4OYRA 1DINA 1WMBA 3UMFA 1R5BA 2PUWA 2AR9A 1FDTA 3PX2A 4HWRA 3L4SO 4WX2B 4PM4A 3QVLA 1SCBA 2I99A 5J23A 2Z5FA 3HHEA 1MZPA 5GIOE 1YZLA 3RRYA 3A28A 4GYJA 4K5QA 4ARZB 5FB3A 3HB0A 4UXHA 3VBCA 1I2CA 2IZ7A 4QDJA 4YRIA 3HFJA 2C5AA 2OFXA 4ZQFA 4W7SA 5LB2A 1CDZA 1KYIA 3S68A 5CP8A 3J7TA 4ND6A 3U3ZA 2R79A 4QBFA 4QDUA 1Z2CA 2X42A 1EXWA 1UKZA 3WO1A 3F71A 4EX6A 1PNVA 1PYDA 4LY6A 1PU2A 4QTXA 1U3DA 5DW0A 4W7IA 3LCMA 4EZIA 5A7FA 1T36B 2WF5A 5KDLA 1ZITA 2GD2A 2IITA 2O59A 3ZI4A 1CUIA 1XDUA 1XTVA 5CMLA 1YZKA 1U3GA 4FMPA 4E32A 5K8IA 1UDBA 4C7KA 4DJJA 4QDOA 3CJQA 1SXQA 5DSTA 1CNEA 1KH1A 2ZVPX 3DT9A 4X20B 4YBRA 3VU9B 2J0EA 2ZM6B 3SQWA 2WSBA 1HFEL 3E7XA 4WOKA 4KQ6A 4LISA 2OCAA 2R8ZA 4EO9A 3FSJX 2WVAA 3X2EA 5JS7A 1VJGA 3DW1X 3TQHA 3LW8A 3BMCB 4UM5A 4WTOA 1XRQA 4MCJA 3V1KA 4RH0A 3MTIA 4RDHA 2ADFA 4BNTA 2V3WA 1TEHA 2GPBA 3N2KA 3QFFA 4OQPA 5LYJA 3RU7A 3SDZA 4Y2GA 3QPDA 1YI1A 1U5BA 5CLGA 2SNIE 2O20A 1L1EA 5BQ5A 3W9SA 3WWYA 4G5FA 1SUPA 5ALPA 4BECA 4O63O 3S5JA 3Q8XB 1GKYA 2HIAA 3OEEA 4GZMA 5I9MA 4R7TA 2XGSA 3UJ7A 2VHWA 4G1UC 1WXHA 3BXHA 3R77A 4YASA 1DQZA 1YQWA 4M0KA 2IQ5A 2W8BB 2QUIA 4BPBA 2GD0A 1JU9A 1ESDA 1R6VA 1X1RA 1JDJA 2P9YA 3B8EA 2C42A 3VPBA 3WLTA 1RXVA 1KVRA 4CF3A 4JR1A 2B83A 2D8MA 1AQJA 2RHBA 3GYGA 3U09A 1KFKB 1P1CA 1YWGO 3BH6A 1GGNA 3FJ1A 4GI2A 2X2EA 1CEXA 4LK2A 1Z4QA 4DBLE 5LXTA 5KOJB 5FV7A 4G37A 3DZFA 2BW0A 3T41A 5KKNB 5DIZA 4JJEA 3IT3A 2O2XA 1PEAA 2AJ8A 1PV1A 4ZAFA 1FMFA 5LQNA 2ID4A 4MSUA 3R7WA 1GZ6A 5CHYA 3C1TA 4MS3B 3QY0A 3SF0A 1LPPA 2WHPA 4JU8A 4RTQA 1XLTA 3MWGA 4ZAYA 3PEYA 4QYIB 3L0OA 4MR9B 4R5HA 4XQEA 4AF6A 1SULA 3EULA 4WLEA 3HB7A 1DVRA 2CVQA 4JFAA 4QLOA 1ODCA 2EF1A 4LVUA 5D85A 3EXAA 3B1KA 3QLUC 1N5RA 2ZRAA 3Q8LA 5D8DA 1AA9A 3DMFA 1OLOA 3O4GA 4Z3OA 5A3SA 4I9FA 4D0SA 5IKXA 4ESVA 1JMVA 3S7TA 4F91B 1BX0A 1ZN7A 3PNVA 3MOIA 5T64A 2ZIZA 2XD4A 5TV2A 2WY2D 1LPNA 1GPJA 4F4HA 2H07A 2BT4A 4LYHA 1TVMA 3WYEA 4ZMRA 3VMMA 3LWBA 3DLBA 2XCIA 2V6BA 4QVGA 4NJEB 2BJWA 5EIHA 3FWNA 5TQ2A 4N6OA 4P31A 2WUWE 2VC2B 3G5MA 5FI1B 1V6AA 1RLOA 3L0PA 3LOPA 5C8XA 3I9V1 3SJAA 3B78A 3X43A 2CL5A 2Q0XA 5DH9A 5KCMA 4BEVA 1ZLYA 5L4SA 4MTCA 2FE1A 3IUYA 3FOZA 2BP7B 2BWJA 3QHPA 3B20A 4LDNA 3WLAA 5L3SA 4TUYA 5DBIA 4JSRA 4PGFA 1LQTA 4BIMA 1CK4A 1U1CA 5U1PA 4NECA 2ACVA 1NFRA 4YYEA 4OBEA 3S2FA 1FPMA 1QB7A 4K6OA 2CHFA 2P0EA 2P9CA 2R7NA 3AUYA 1TAGA 1YR3A 4V2UA 3W2HA 2FSVA 2Q1WA 3K6KA 4IIJF 2F6RA 4IG9A 2QVGA 2FUEA 2XUJA 1XC7A 1JKIA 1OWLA 2J5XA 4JITA 4KQFA 5JZOA 1GOTA 1KKMA 3PHJA 2ANCA 1R7RA 2H8GA 3MWLA 2GJSA 4XGIA 4GZ5A 5CW1A 2WJ4A 2JGDA 2G07A 4U7FA 4ZK6A 3H8VA 4RLHA 4CWAA 1HX7A 3TIIA 1Q3KA 2JJ1D 3IT1A 1TYDE 3GRPA 4MV0A 5DYYA 4RCVA 5JSKA 1P0QA 3ZCUA 2XQIA 4AO6A 5B4UA 5JMWA 3TCKA 1NE7A 4TTRA 1A5ZA 3PNPA 3BE5A 3PJEA 1VIAA 3UHOA 2IDKA 3VR5D 4YIKA 2E21A 4YFYA 1NLUA 1OAAA 2XHEA 3IHKA 4INAA 3CE6A 3FDJA 3KDAA 2W6IA 4S2UA 3AJAA 5EINA 1XEWY 5KYUA 4N5DA 3H4VA 2CT8A 1KJWA 1QG2A 2GTPA 5HILA 4F7DA 4AUKA 1OXKB 1PR1A 3LL7A 1U7HA 2ECFA 5JZSA 4WOPA 1JIJA 3ROKA 2UVDA 1WBJB 3AR6A 4YXWA 1NSTA 3NTLA 1Z34A 1JSZA 1ZJJA 4GM0A 2QTBA 3PHGA 3T5DA 2DHDA 3EQ2A 4A6EA 2QZSA 4C6TB 1KH3A 3EGEA 1FVXA 3EXEA 3IESA 3B2QA 2B7BA 4PG4A 4KU4A 2D54A 4DEYA 5KS2A 1OGYA 4ICIA 5M04A 3F3KA 2IS4A 4OHOA 4IR7A 3M6FA 1XEFA 2QYSA 1RRCA 1KVUA 1OUMA 1E1CA 3IGFA 2CLIB 3O21A 1PLLA 1DZIA 2I4TA 4MW2A 3MT8A 2IH5A 3GP8A 1MJNA 3PT9A 4E2WA 2FDCA 5J63A 4B6PA 1J56A 3AUJB 2VTKA 4OQMA 1DEAA 2UYCA 1F8UA 4RXTA 5IBQA 5CA1A 1B00A 2ZR9A 2ZTMA 5K4GA 4A8TA 1EBUA 3PLRA 1SM4A 3PUHA 2YZKA 3ZIAD 3WNZA 4C7XA 1XLTC 4MV6A 5K3CA 2K2QB 3WISA 2LVBA 1Y4SA 2FKAA 3PFIA 5CFNA 4LCBA 5HZKA 1N5KA 1G0NA 2BFAA 3L6RA 1LLFA 1GL9B 1WZNA 4I3HA 3S6JA 1ZD2P 1H3EA 4UBIA 4CKEB 1AHNA 2JK1A 4H9GA 4BLSA 1HKHA 4KPEC 4I14A 2LIVA 5CNKA 3M82A 1Q84A 5AXBA 3SF8A 1OPRA 3IJ5A 3NBQA 5JQGF 4EZBA 3P2OA 1KDOA 3U2QA 3BK2A 3T4PA 3UFXA 4O4JA 1ZLXA 3OO0A 3SD7A 3SEQA 1YHYA 4L2IB 4W1RA 4WXYB 5FNVF 5FKJA 5L3SB 1PR9A 1U81A 3IELA 3VDMA 1NBAA 3HM9A 1MA3A 3DMTA 4KI7A 4LGCA 4ECAA 4M87A 1KQGA 1A9PA 1J8MF 1WF3A 2RBKA 4XQ0A 5EJIA 5U4QA 4V1CI 1W5FA 1UXIA 3OY2A 4KUHA 4LPKA 5H59A 3KPUA 1C7RA 3KSUA 4S1NA 4GXTA 4UOEA 3LPLA 1C2TA 3EG9B 4DL9A 1H8ED 1V47A 5IZ4A 3BMNA 4HWKA 4MEBA 2DG2A 3M81A 2NVWA 1SK9A 3KDSE 3QE2A 1USUA 5U4XA 1TUGA 1G4AE 3ADPA 4YAGA 2IGTA 2EERA 2NZVG 1JXOA 3FETA 4JY7A 2FSIA 4UVIA 3RS4A 4D42A 2PQ2A 2NZ8A 2X6TA 4QQRA 1FRZA 1ZIOA 2HFJA 4IO1A 4QXMA 3TZBA 2YWBA 2FZLA 1SMKA 2D4HA 2D1TA 4UEQA 3GEHA 2XGMA 1Q91A 3Q98A 1DKNA 3ZZ1A 2AI1A 2PZFA 1D2HA 2BGIA 3FPKA 1NJGA 2YX1A 2HA5A 1OFHA 2H0RA 4X41A 1X77A 1T24A 4A6DA 3MBOA 4GH5A 5KTOA 5MGBA 4LV5B 4INPA 3WLJA 4RHTA 4F4UA 2O8NA 4ZU3A 1AY0A 4PSDA 3KJFA 2ZXEA 3THRA 4BGIA 3AM3A 3BGWA 4ZFNA 3TL3A 4BN5A 3UJ6A 1V3UA 4BTEA 1J8YF 3ZHVA 3MVEA 4INOA 1QG6A 1YDHA 4XOUA 3CY6A 2A0WA 2PM8A 1D6SA 1CVLA 5B4VA 5CD9A 2HHLA 4XW2A 5EEGA 4YJFA 5BOVA 4EG3A 1BRMA 5E9AA 1T8RA 1U65A 1BS9A 2OVFA 3R76A 3R74A 4A0HA 4AYWA 2YWDA 3M6XA 2H1IA 3K72B 3LUKA 2TMKA 3DO6A 3WYNA 3VTKA 3DLAA 1M10A 1RJDA 4GE3A 3AO0B 2Z09A 3O2JA 4AL4A 3JS5A 3T1TA 2UYOA 2BFOA 3EDYA 4V3BA 1OQAA 2ZJOA 2LGJA 1Z8DA 4MR7B 2YXDA 3CG0A 1ZVJA 4YRPA 3T1NA 3QUSA 2AYXA 5IABA 1NVMB 3RK0A 4FJ2A 3CVJA 4BO3A 1QRDA 4CI9A 2R8XA 4E2ZA 3EIEA 4D4IA 2WF9A 3AUXA 4EPYA 2Z58A 2FWBA 1QQBA 4BO1A 2NAFA 3L41A 1WSBA 4L22A 2PBRA 3G9TA 5LIPA 6ADHA 4FONA 6PFKA 2A57A 4AYXA 4N41A 3GQVA 3REQB 2ZIXA 4KC0A 1STOA 2ZUBA 7ADHA 3DL2A 1FNMA 4TYNA 1K9VF 1VYUA 2D5LA 2OMEA 1DAFA 3GUYA 421PA 1LJUA 1T8WA 2Q3CA 1ZOIA 4TXLA 3EA4A 3FVWA 3KK0A 5DTQA 1HQKA 3M1LA 3QM1A 1KP9A 5FF9A 4BMVA 1X1QA 3CLRD 5DGCA 3VZQA 4QULA 4J1TA 5IVPA 2RH8A 1NQUA 1T0UA 4V0SA 5B55A 3NETA 2WFZA 2GN9A 1GPYA 2XE4A 3WZMA 4FLFA 2VQFB 3JQEA 1WCIB 1SIWA 4IDNA 1IZYA 2PD3A 3AY7A 3FCOA 4LZZA 3TLMA 1PJ3A 4L73A 1R8JA 1ADGA 2H17A 4ENTA 4YRSA 4C2TA 3ZJTA 4OX9B 3MA0A 4M49A 2AXQA 3OUUA 2A0UA 3KL4A 5F76A 4C1BA 3O7MA 3HDHA 4CUZA 4EHDA 2C96A 2X8JA 3C6MA 3D5EA 5KTNA 1UMBB 3KKNA 3LIPA 4R9RA 3JD1A 5EKSA 5KYWA 3SC3A 5SY4A 2YWXA 2DHEA 2I4NA 3G2NA 3I1YA 4UVGA 3VOBA 1XCLA 2P9GA 1WHSA 1BJKA 1Z9BA 2HSWA 1EWQA 5C1IA 2EZ4A 3AR4A 2ZYSA 3SC6A 4L15A 1IB0A 2HRCA 1NT2A 2O2ZA 2VSQA 3I9JA 3LGAA 1W52X 3NC4A 4G56A 4HEA1 4NQZA 4Q48A 4PX5A 5K51A 4DBVO 4HLDA 3V7WA 1MCZA 3QBTA 1VCOA 3NM4A 3D3KA 1A4XA 2B9EA 1NBIA 1O54A 4MW9A 4O5OA 3MLBA 2KYRA 4UMVA 2OC9A 4GQAA 1LBIA 1AUVA 5TMBA 2QM3A 5SYNA 3WTBA 3WMRA 2VDPB 4HL6A 1Y0BA 3OPYA 3AF2A 3AILA 4NF2A 3PIIA 1OY1A 1QNLA 4B75A 4DLXA 1OLUA 3A37A 3H7IA 1CQJB 3F5FA 3FB1A 4Y9TA 2MMGA 3CLKA 5CH8A 3QTLA 3I42A 2WA1A 3OWOA 5CFPA 1Z0UA 1X80B 3UT5A 3CZ5A 2B8WA 4M0EA 2XI4A 4MMZB 2OGTA 3ZY3A 3TLCA 3B1ZA 4OJQA 4WFKA 3HCBA 2EQAA 2VBFA 2IHJA 1F5NA 3RVOA 1S3FA 1DB3A 5H82A 1L7VC 4BQEA 4EYEA 1B3BA 4RPLA 5AJXA 1ZM3A 2BOVA 4ARBA 2Z9BA 3HNOA 2EJVA 4JBGA 1II0A 3I0NA 2IPLA 2GXQA 1P2GA 1JJAA 2PL3A 2UYGA 2DQKA 4A8JB 4E51A 2XT0A 3ZU4A 2AFRA 2X4IA 5ICGA 1SBTA 4EVIA 6GPBA 1PV2A 3L07A 4EGFA 1BH2A 2OQRA 1CV2A 2ZJ6A 1I01A 2H59A 4BVLA 5BT8A 1QE3A 2FEPA 4QUAA 5IH3A 3CJRA 5CLIA 2R8OA 1JQ3A 1M8GA 1H42A 3LH5A 4R2JA 1XZHA 4MIYA 1A72A 3LC0A 4GRAA 1X6VA 4GO1A 1KEKA 3R5FA 4CF4A 1Z2PX 4PZYA 2GO7A 3WLKX 4O8ZA 4WV3A 3FTQA 1IBRA 3E8SA 5K01A 1BHJA 2A5LA 3E0QA 3KQVA 1WB5A 4HUQB 1G21A 3C97A 3TIGA 3BTUA 1ENYA 2FUNB 3BXGA 2VAXA 4LC0A 1VLZA 1YA4A 1N6PA 4DIUA 4D8XA 6REQB 1XE3A 4GGOA 2P6OA 2XB2A 1UDCA 1QJ4A 3JZAA 3M7IA 3NHJA 3OT5A 4NG4A 2EOAA 4XDZA 3VKVA 5HRUA 4MB0A 4D45A 1CRPA 1L5MA 4GWGA 3WYAA 1E3WB 5DDIP 2FWRA 4G2TA 3PDUA 4ZOEA 5JASA 1NLMA 4YJ2F 5I8ZA 4DRZA 3R3JA 2BBSA 2JATA 4RIHA 1NAIA 4LSMA 4RIEA 2ZZMA 2JFUA 1RW4A 3MD0A 3PXBA 2PSJA 1O0SA 3IKJA 3JQCA 3KO8A 4N3NA 5C7OO 1T6XA 2KB0A 1ISHA 1NL3A 1NY6A 2R7LA 2QTCA 3MCZA 1YR9A 4JEUA 2XMPA 4ZVLA 1AB5A 3RPEA 1G17A 2C9OA 1J49A 2Q1UA 3REGA 2OO5C 1EIZA 1AE1A 4Y67A 2JNWA 2RG7A 4HSGA 3T15A 4YJ2B 1E59A 2QUJA 4Q3BA 1ZUD1 2GEVA 2Z3ZA 5EIWA 4MVWA 4B3DA 2GF2A 5E38A 4MWZA 4A8JA 1C7JA 3AVVA 3VU1A 2NP7A 4JBHA 4IEFB 2YWEA 4JD5A 4TKVA 1U2RA 3AOGA 2L19A 2GPSA 4TT8A 2PS3A 1T4CB 2DGDA 2QE7D 2RFLA 5JCOA 2IOYA 3OU7A 2BZ0A 1O2DA 2C94A 4X0EA 5BQ3A 4YRFA 4K8RB 4RMHA 1S7GA 4K9RA 1TQDA 4EQZA 3WGVA 2HCJB 1F60A 5I7WA 2O7VA 1EK5A 4LNAA 5IMSA 2GMWA 5FWNA 1M6YA 4K6FA 4DMFA 2QXYA 3RBVA 3GW8A 3L7OA 1W0JA 2ZYDA 3P45A 4LHVA 3JQGA 3DDZX 3BEDA 4YREA 3RVJA 2E48A 3MCWA 5HSGA 1ZD9A 1MT3A 1SWWA 2Q3JA 4WUTA 3RADC 2JIBA 1QHGA 2AR7A 5GONA 1X2BA 5IJ0A 3KE9A 4KXUA 2W6ID 4U7JA 3BCRA 3BULA 3T4XA 1F2TA 4ES6A 3T52A 1CLEA 4JR2A 4UTPA 5HFJA 4RF5A 3VPGA 1GPBA 1XTUA 2GEJA 2HM7A 2COUA 1YS6A 3PB3A 3N74A 3Q1KA 3UK1A 4E31A 4EPTA 4DPKA 4OXKA 1QP0A 4BFVA 3UWPA 1LJ8A 3R6TA 1TCCA 1L7DA 1QMPA 3D6HA 4KJZA 4TS9A 1GARA 2HLDA 4WDRA 3WOVA 4LYJA 1ULTA 3KZXA 4PZAA 5DB4A 5C3UA 1BDIA 4EF6A 2Q9UA 3GROA 1C1YA 2W71A 4KUEA 3QSGA 2IZOA 2ZRBA 1KJ9A 4REQA 1FUKA 3TRHA 4B82A 1VJ0A 3ERCA 1B74A 4Q02A 1SZJG 5JVDB 4PC7A 4TV8A 5BORA 2QD3A 4HX9A 4FFLA 4BV9A 1GQQA 5JO0A 3SEFA 1YOVB 1P1IA 3W8DA 4WJLA 2QY6A 2FWAA 3ELYA 1UMDB 4D9BA 1FLVA 2IDMA 2AHOA 1TZMA 3OI7A 2FZ5A 1EX1A 2GAFA 1PQ4A 1JB9A 1NP7A 5ENZA 3WOHA 5IJ9B 3DL0A 3IPYA 2NU9A 2LBPA 4FMDB 4G25A 4BUCA 1XQ9A 4ZEWA 1ODLA 1Z63A 1M72A 3FFXA 2IP2A 2FEWB 4IJKA 3DL4A 1QHHA 3ILYA 1DWUA 3PGKA 4FDUA 4WMLA 5IT5A 3SLKA 2HZ7A 3FOAA 3OLYA 2IEDA 4KBYA 3IILA 4BHTA 1Y9JA 1JA1A 2VLBA 5AWFC 3UJBA 1SB8A 2H85A 3W5VA 1E5QA 1GCOA 4OJMX 3QF4A 3RF6A 5L4LA 3ZY6A 1D4AA 3NFRA 5K0FA 1EVEA 1WB9A 2CDCA 2BZ1A 1TECE 3HVIA 4R8MA 2F9LA 1KP2A 3GMSA 3IEIA 1QHIA 4WCFA 2GYVA 5THXA 4MHSA 5IAGA 2CXXA 2KLHA 3CUYA 1CD5A 1CR1A 3IAM1 3QU5A 1VE9A 3PDCA 4KAXA 2OSVA 2IPOA 4CIDA 2X0RA 4DG8A 4DYDA 1OH5A 1YZYA 4R2IA 5B36A 1ND6A 1IHXA 4C4SA 2YH2A 2ZSJA 5KQGA 2QN9A 1M8KA 2E5WA 4UHFA 2RC6A 1Z2OX 5E6SB 3EVFA 2CMGA 5T8KA 3RNOA 3KUUA 3ONEA 3ZY4A 1E8MA 2A33A 4RY9A 4NBSA 2R2GA 5ILQA 3HY3A 4MYCA 4PWZA 5D84A 3R3VA 5ALVA 2O8BB 2W2LA 2R1ZA 5LZ2A 3ZH2A 2H1HA 3UMSA 1Z2DA 1G8AA 3L77A 2RIPA 3JCZA 3LZ6A 3MWYW 2OXRA 3PF9A 5KTRA 2MSEB 2P1ZA 1ZM4A 3SAJA 1E62A 2BEWA 2GERA 4FBGA 4EG5A 2AF4C 3EXHC 4EW3A 4QE3A 2Y99A 3H16A 4N01A 1WTCA 3ZEIA 4BNDA 3IAUA 2BISA 1VSTA 3ESXA 2E1PA 3FIJA 1RAIA 3G1WA 2LCIA 2WI8A 3GA7A 3L1JA 1MF7A 4LYYA 4QUJA 3ZW8A 3CUWA 4UTNA 3BIJA 3OFND 1EFAA 1N9GA 1DX6A 3EGDB 5H02A 4KRXA 1N2XA 2ODTX 2QJFA 3JQQA 3EISA 5HOQA 2X6RA 1X1EA 1KZ6A 2AG8A 4AUEA 3GNQA 3DG9A 2JJMA 3AKDA 3LLVA 4LWOA 1VLHA 4MW5A 3Q7PA 4HC4A 5INTA 3PPYA 2PPVA 3PFGA 1YB6A 1KQ3A 4F71A 4GGPA 3EWNA 1CZHA 4G5RA 2LCFA 2DSTA 3TQFA 2VRCA 3LQ4A 3HMKA 4Q3NA 2OHIA 3RIEA 1L7XA 4NENA 3DLIA 3ZOZA 2ZU6A 4Y6SA 5EJ7A 4R3UC 3TZKA 3DAFA 3C16C 1WP9A 3ENVA 1IFXA 4HJRA 4R2WA 2NXWA 1WDKA 2Q6KA 3LYAA 1FUYB 1PZNA 2YXPX 5EZSA 1U2SA 4M88A 3TMYA 3X1XA 4D4LA 3EMVA 4CDNA 1XRNA 1U0LA 4M9QA 2NTJA 2VJKA 3FA2A 2JLSA 2D06A 4DRXB 1DARA 4CM4A 4ENPA 3ONFA 5EFZA 1E92A 1YRHA 3Q40A 5KTPA 3HGMA 1U0NA 3A9WA 1OYYA 3D6FA 3QKRA 2NAPA 4B4KA 2Q6VA 1C1DB 1S7CA 1C80A 3W8FA 1T2UA 3TH5A 1F0YA 1E4VA 5JO9A 3WWZA 1XCJA 1T9KA 4UJ3A 4EW2A 1DP4A 3F9CA 4IICA 1FFAA 1APBA 3D4IA 3OP1A 3E6AA 3I2GA 1GQYA 3WBFA 2B36A 2BFDB 1OX5A 1JLMA 2D3WA 5AKYA 3PA6A 4EECA 2RHJA 4DJAA 1NOJA 2AYZA 2H63A 3OOEA 2QX9A 1UFVA 3QQ5A 1RXCA 4G5HA 4PLWA 4Y2UA 1SXJB 1ZZGA 3AR3A 2DUNA 5FCDA 4C0BA 1YS7A 3NRBA 1QS0A 2O07A 3LIIA 2AOXA 1UFKA 1L2TA 2ECKA 4LOAA 5CA1F 2VSNA 4FEEA 1NN3A 1R00A 3DM9B 4AJKA 2CLEB 1QV6A 2F3TA 2AC4A 4MQUA 3GUVA 1OA0A 1WVMA 3Q6NA 1FFXA 2E4VA 2OZVA 3OZGA 4JB3A 4JIMA 5H70A 3KELA 3RRBA 4IH1A 2EYQA 1XB2A 3T3HA 5HCIA 1SUEA 1G5QA 5DSXA 4OKNA 3R7DA 1Z0ZA 4MI9A 1O9GA 2IL1A 2IPAB 4V0OA 2HF9A 2VT2A 1J0EA 1KI9A 3EXIB 2R6DA 3K9QO 3KVOA 2QIPA 3OX1A 4HADA 4N18A 5AW4A 3S4YA 3OJWA 3D4BA 2OFPA 4H0NA 2QQEA 4JJKA 3MS4A 1Q0TA 1H4TA 2G88A 3INYA 1NNLA 1XRJA 3QQPA 3RFTA 5BPHA 3TZCA 4XRGA 3CUTA 2C5FA 1I9GA 5ESRA 4GKKB 2EX0A 2J87A 1NMSA 3BPSA 5LMUB 4B3IA 2SKCA 4XYMA 1BHSA 5F64A 1J21A 5DN6A 5DTMA 4IFIA 1L6RA 1OI4A 2OD7A 2YMPA 4IIUA 3HXMA 1D2MA 2QW1A 4NHOA 4NK5A 4EA9A 4LF5B 1JNYA 1P29A 1X86B 1Z4JA 3TOCA 2GARA 2I3GA 1G1MA 1KPHA 1Y82A 4DDKA 1BVHA 1IUPA 1FS6A 3MJCA 4O1MA 1MC1A 2XHZA 7REQA 3E70C 4RA9B 1VKNA 1CRLA 1KYZA 5HRAA 2BEUA 2J48A 1Y4DE 3RRNA 3CWCA 1IVSA 2FB9A 3Q72A 4WY5A 4A2PA 4MUKA 5B37A 4QOIA 3ACDA 4V02A 5KWVA 3I4LA 2WAXA 2I8AA 2WOJA 3EAFA 3DLPX 3ANSA 3HVHA 3FTNA 5DGHA 4A26A 4ZARA 4ALKA 4Q82A 4RTNA 1E7SA 2E4AA 3GGOA 4YCDA 4ME6A 2OORA 1SRRA 2QX6A 5REQA 5IDXA 3OOSA 1U63A 1O7JA 3FPFA 3SIRA 3WBJA 3C6QA 1GKUB 1OYVA 2J0UB 3O82A 5DLPA 2GUGA 3UO8B 5IT0A 1PS8A 4HH0A 5TX7A 1TUIA 4CT0A 4KR0A 4BFTA 2XSZA 2PUAA 2PWZA 5A6SB 4ZD6A 1HMPA 2NT4A 2QMUA 4AG3A 3P0IA 1XD9A 3EVGA 4MHTA 1E7YA 3CW2A 4D8UA 3Q9SA 2J9YB 1A8IA 3GPLA 2J6BA 2J08A 2VPYA 1UBSB 3SHQA 3WQQA 4CLHA 1JJBA 4MPDA 5MHTA 2B6NA 3DKIA 3RVQA 4C4PA 2PZEA 2Q5LA 3QLVA 1O1YA 1TD9A 4RDCA 5DMXA 1JQ5A 1V1MB 1RCTE 1CZUA 2APJA 4WZBA 3ZV7A 4EELA 1C9NA 3RG8A 2GVNA 5C7LO 4XD2A 3BICA 3GDOA 3AT1A 4H08A 4U0JA 1YMVA 3HDJA 1GNSA 1ZEMA 2DFTA 1YR1A 2BUBA 2QN7A 4B79A 1Y3AA 1PVDA 1OJ7A 3P9ZA 4QRDA 1EX7A 1DTEA 5CYPA 3WL7A 3COPA 4LTDA 1SR8A 4QQ8A 5G3YA 3W78A 2WZBA 2R1UA 2J9XB 2CVHA 3NHWA 2DT8A 1R0CA 2DCUA 4P83A 4TV8F 4BS9A 5IKMA 3E3MA 3CR7A 4GGMX 4MRVA 4RH3A 1BA2A 3R0IA 1WB4A 1TUBA 1UIRA 1TCBA 2ADMA 1PK9A 1UK7A 2FJUA 3OE4A 4K9KA 4RPJA 4ZDKA 3QJ5A 3CR8A 1I33A 2GF9A 3EPPA 3TQSA 5KBYA 1DO0A 1JIVA 1NR1A 3VZBA 3HJRA 2LXNA 3ZLUA 1RI3A 3LUHA 3MG9A 2Y0DA 5K6AA 1VZ3A 2XDYA 3HN6A 4JIGA 4B17A 4X97A 3ZK7A 1G3MA 1N2IA 3H5IA 1I2MA 1DG3A 2BGJA 4JP8A 4KGVA 3W1EA 1GJRA 1SURA 3GRAA 1S02A 1UBJS 3L1VA 4FCVA 3S27A 1AS2A 1MABA 1Z5OA 4ZYYA 3FBWA 5KX5F 1GM5A 3GC6A 4FVTA 1QTIA 1YVDA 3F3YA 3C3EA 5A9SA 1DT5A 2OGZA 3OKFA 1U0SY 4QHTA 1YDEA 1QZUA 3U5ZB 3TWOA 3H83A 4K3UA 1Z5ZA 2JGEA 2G9RA 3NX4A 1IZ7A 5C7IO 2OV6A 1T4DA 3IEKA 1UBMS 5BUZA 5AW7A 1SPXA 4QU9A 3VYVA 4CCYA 5A62A 4RV9A 1W4RA 1AA6A 3WB9A 3UAGA 2ONKA 4DT1B 1UEXC 4YUVA 1WEKA 3JPWA 1F3OA 2WSSD 3ZXSA 5HHTA 2NZ2A 4FXPA 3PDHA 1L4EA 4BFWA 1WETA 2QPOA 5G4KB 1LU9A 4PLZA 3EUFA 4MDEA 2WG1A 2RH5A 3PXXA 1CG6A 2QKYA 4UUAA 4I5DA 3ADBA 3FOCA 4ZOAA 1DXHA 3E18A 4H60A 3GX1A 2X9NA 3C0KA 1KF0A 4IQ8A 3AL2A 2GD1O 1NYRA 4KWTA 5KOHA 5AUOB 3JQ9A 2VXCA 1UJ2A 1L8LA 4OXQA 4XUCA 1VB5A 3Q3CA 5FEUA 4F6CA 4HJXA 1T0BA 1QUEA 4WN3A 3ZX4A 4YDQA 5JD3A 5I48A 5JAHA 2JCBA 1Z6YA 4L3WA 4U0KA 1NRIA 1Y3CE 1NVGA 3PWZA 3RQSA 3U26A 1L4YA 1XVTA 2X13A 1J7JA 1XHLA 1EFCA 2WMYA 4FSHA 4CNQA 4RADA 3OZSA 5JECA 2ORIA 4PS1A 2RI1A 1KRWA 4MV3A 4EO7A 5JXIA 5HNKA 3W6ZA 1OB5A 2PNJA 1PFWA 1N25A 1T5DX 2FE4A 4UNQA 4YJHA 5ALZA 4CE6A 1ENPA 3HGTA 4PXYA 4UBNA 3BQNB 1U0EA 4UM9D 5HCUA 3D81A 2ZQYA 3RT9A 5I7VA 4QGAA 5HRCA 2HI0A 5J2TA 4EMUA 1NQTA 3TZHA 1JILA 3C87A 2GT1A 3NATA 3EY9A 1VG1A 3LRTA 1PR0A 4YEDA 3ELWA 5FWXA 1P72A 2IK8A 3ZY5A 3EZ7A 4TWRA 1MO5A 1K6IA 3VNQA 3U16A 1AV6A 1E79A 1D4ZA 1TJ5A 3CLSC 3RU2A 5FR2A 4O29A 3W5UA 1K3TA 1CPYA 3H6KA 4Q3AA 3TQOA 2ODWA 1YBHA 3JAWB 3ZU2A 5BSFA 3HGQA 1SXHA 1NYTA 3AYZB 5BN5A 1TA0A 2QVYX 2QVBA 2PZJA 4NNOA 3EWSA 1RNLA 2VUTA 2WJJA 4J3FA 5ALJA 4HNAA 2OC4A 1F6DA 2IEAA 5IBCA 3AETA 1QQ6A 4G5QA 2FRXA 2P41A 2B4TO 1NJ2A 1CRZA 4AN1A 1JWAB 3A9SA 1QIMA 4FZVA 4LKRA 5AH0A 3DVAA 5EJMA 5F5NA 1HETA 3KYBA 3OZWA 1AV7A 5CD1A 4GECA 2HWWA 1YE3A 5JRJA 1EWTA 4MWTA 3K0CC 1KIFA 2VS1A 4RVGA 4NAVA 1EP2B 2AMVA 3WL5A 3OQMA 3FUWA 3ZWCA 3BD8A 1DBWA 1CIPA 1KI8A 3VGPA 3DE1X 4BVBA 3B9RA 3LI2A 1ESMA 2EIHA 1J25A 3IAXA 3HLYA 3MGBA 5AIAA 2QTNA 3PPIA 4BKUA 1DOHA 1RWVA 1R6DA 2Q7DA 4QICA 1V9SA 4EUKA 4AKIA 4A0QA 3Q0IA 5LYYA 2R87A 1CFJA 2VJMA 4TRNA 4CCAA 2QROA 4XE5A 2VNHA 2AQHA 1P33A 4G63A 5FTMA 1FW8A 2AEMA 3LQKA 3ROXA 5KPDA 2F55A 3DUFA 4ND8B 1OHHD 4YCNA 2Z8YM 2UUCB 4N0EA 4X1IA 1GRQA 5EXSA 1Z6AA 3AEUA 3B2NA 5IC6A 3L49A 5HQ3A 3AGQA 5LBUA 2ODPA 3MWJA 2PN1A 3C8UA 4DR2B 3H87A 2MMCA 3C8ZA 3TR0A 2A59A 4FCWA 5BRNA 2DFNA 3UJCA 4D3XA 2WIBA 2NP6A 5I8PA 1LXCA 1EK2A 2G83A 1E2BA 5FOTA 1Q74A 2D1FA 5ALNA 4BP9A 2YV1A 5TB5A 4FFRA 1MN6A 4RNCA 1ECGA 5BN1A 2ZSDA 2HUNA 3SR4A 4BBPA 4QPNA 3GBVA 5DM2A 1VG9B 4XJSA 3ZV5A 2Q1XA 3JARB 5A71A 5FD8A 5BWBA 5CDUA 4O4LA 3LDHA 5K5EA 1LX6A 2VUSA 3EMDA 1F2DA 3M5CA 4CTOA 4DR6B 3OWHA 4M1KA 3MSCA 2P3LA 1N1MA 4DNPA 1KIAA 1S8OA 4IDAA 3ZTWA 1M2GA 2PUVA 3WKAA 2WVGA 1E8DA 2GBPA 3E0XA 4X66B 2QYHA 1QGDA 4GSLA 1LDNA 2IVFA 4JGGA 3J80A 4YI3A 2OV1A 3RVRA 1P74A 3TNFA 4MWOA 2A1UB 1G3IA 4R2KA 3REOA 3BREA 1VA4A 1K7FB 3DH0A 4CN9A 4FB4A 7ABPA 2MSLA 4HB0A 4A2WA 2FPOA 4XGQA 1XCBA 3VHXB 1S2GA 4YMSA 4G0VA 1V4BA 4N6NA 4Y0AA 5F35A 3EC7A 4KO3S 1M1ZA 2CLHB 4I4LA 5E8JA 4DA7A 3P9PA 2CLLB 2VK1A 2QUHA 3D3NA 3R6LA 5H16A 4P9NA 1KI2A 5HBRA 1J07A 3O1LA 3WXBA 1FP1D 2IHUA 4BFZA 2II6A 2DTDA 1JVNA 1CQJA 2NO7A 1UMBA 2X7JA 1XZFA 5LOVF 4MXDA 1M5UA 4PCUA 1J2TA 1GNPA 4JYZA 4ZCTA 5HOEA 3SSAA 3HJGA 4JL8A 4JEHA 4H77A 2CXPA 2HSZA 4N3AA 4IBOA 2GN1A 4GVLA 2UYYA 3PXCX 1OXVA 4E03A 4DJDC 3W5IA 3OZAA 1QIHA 1HE5A 4JXKA 4DXDA 2VJYA 3HA5A 4L3VA 3SBOA 4LRQA 4RTJA 2ONCA 1LNSA 2MWMA 1XVLA 5DX1A 1JG7A 1QR6A 1H93A 1ZZEA 2GCOB 3AV3A 4P7JA 4PZUA 5JLJA 4HLUA 4LXYA 1P9RA 3GEDA 5C5IA 2DY0A 3JARA 2IV7A 2DWUA 2QAGB 5ALWA 5H8WA 2QMYA 2LPMA 1P75A 1ZXLA 4LE1A 4RKYA 5IT4A 2ZUVA 3P20A 3GLFA 2B1JA 1RPZA 3KKPA 4PVDA 1L4LA 2G80A 1J2RA 2NMVA 3C6XA 2AGVA 5AJVB 4E5NA 2EBWA 5GJCA 3H8JA 4M7RA 3RR2A 2GB4A 3AVUA 1YSCA 1WZEA 3CPSA 1L8QA 1ZRHA 2QRVA 4XM2A 1E6UA 4AZWA 1DDGA 1E89A 2QF7A 4BGUA 4BRUA 1Y33E 1NXQA 2PKXA 3AIKA 4CM9D 3WQBA 4B48A 2VEOA 3LUFA 3SQLA 1R12A 1HTTA 4BQFA 4I1RA 2IUTA 3I72A 4Q3CA 1Z4PX 2NU6B 4RHYA 2VP9A 5DTRA 1RJ9A 1CS0B 4Q9LA 2X4LA 3AESB 5MN6A 5PGMA 4G1CA 3CGWA 4HWOA 4UEKA 4POOA 2JVIA 1B0ZA 2HQBA 2P9FA 2QX8A 2OK8A 5J4LA 2WIDA 2BZSA 2DQZA 3NOVA 5F2OA 5AVKA 3RIGA 2AC7A 1RHKA 5IF9A 1A9XB 1D4FA 2ANBA 3A25A 5IM4F 3K0FB 1V5WA 2WICA 4U6QA 4J7UA 4OP3A 2IUEA 2YYYA 3VH2A 1LBEA 1FX1A 2BHRA 4G1EB 4N8EA 1GY8A 3RUPA 1QFJA 4D43A 3AHGA 1M83A 3HC7A 3OCXA 3UAVA 4A7PA 5IXSA 1SA0B 4WWHA 1BU5A 1R9MA 3AR7A 5L6LB 1QKIA 3GUZA 1ZC4A 2IX9A 3T9FA 1FU7A 3LFUA 3H9BA 4RWEA 3RJ9A 3E2PA 1NKSA 1GNLA 1XRPA 3K53A 4JENA 3VAAA 4A73A 4KH1A 2WD8A 5JAUA 1AXRA 2QJWA 2X4DA 4F6RA 4UHJA 1Z88A 2OBMA 2OYSA 3IIKA 1K4MA 4KP7A 3ZE1B 1CHDA 4M1OA 2H4FA 2R7AA 4FC7A 3ORSA 5BUSA 2WPDD 2B8EA 4AWBA 2LDBA 5DCLA 4Y8VA 1UZNA 4Z99A 3DZDA 5FOUA 2FPSA 3LVFO 4BGDA 2IHZA 1G5HA 4L02A 2DR2A 3DBLA 2EQ5A 3RSOA 2I4OA 4LJRA 1VSQA 3NDBB 1QIEA 4JU9A 1NVFA 3H1TA 3IR5A 4OLBA 2Q8NA 4B47A 1C9JA 2ACEA 2V8OA 4W9NC 1ZBDA 3TNJA 5F9HA 2PBFA 1QZ3A 1R5OA 2X3FA 1EB9A 3PF8A 3IBSA 2JD0A 3Q9UA 4R9UC 1QFXA 4RY0A 4EY7A 4ZTZB 1ISJA 2OBBA 3GEEA 2ZTSA 1QCDA 1SEVA 2OBFA 1HQCA 3R6WA 4LZOA 3E22B 3AVPA 4WVFA 3N0WA 2I3ZA 3L4BC 1QB8A 3OEED 3ORFA 2RD2A 1E77A 3TLGA 3AESA 1PR3A 1W9MA 2OUKA 3FYHA 1VBFA 3JQBA 3KFLA 2JD2A 3M3PA 2EGHA 4H4EA 4MI3A 4D9EA 1Z13A 1G9TA 1O87A 4H4CA 1YUMA 2GO1A 4XPIA 4R1PA 5DT2A 4DRYA 4RGQA 4CQMA 4I8IA 2BHSA 4BNFA 3K1ZA 5FTWA 5BNZA 5KB3A 1LSOA 1T0PA 4JLOA 3HXPA 2Q1YA 4Q7QA 1SVUA 2O3QA 1WHSB 3OA0A 5CH5A 5GIPE 5HG0A 2ID7A 2ZYRA 4OY3A 2DETA 4GI5A 2XVYA 1TA4A 3BRSA 1H4QA 4K0KB 1WKVA 2BJVA 2MTBA 3AUFA 1CE8B 3PJGA 2NM0A 2WMOB 4QYSA 5JVDA 3GWGA 5EXTA 1E9CA 2AS0A 2B8JA 1O94D 2E6UX 5EPUA 1A69A 2XCQA 5I51A 4FFBB 3DDSA 2RGBA 4DV3B 1BG6A 1EVIA 5B3LA 3DCNA 1XMQB 3CURA 1Z39A 1H2EA 4NZYA 2XUZA 5DTEA 1T43A 5AICA 2NO1A 5FWYB 3TZQA 1HNZB 3ZDQA 3O8LA 2PK3A 2HJRA 3RUIA 3MCAA 1E0SA 4E1VA 2YVAA 3N5CA 5EE3A 4G24A 2ESRA 4RMJA 4GP7A 5KYTA 3WGGA 2DY1A 1UDWA 2IHTA 3K6JA 2ZWIA 4G9BA 2H9IA 2CJYA 4QYIA 1JHRA 4BNIA 1BN6A 4IDEA 3DEHA 4I3FA 5HUJA 3KOXA 3ESZA 1QYIA 4WY8A 2O1WA 4G26A 3SQOA 3PUWA 1R0XA 3WKEA 5GM1A 1YQTA 1SCDA 4NYIR 5LQJA 1FSZA 2DBVO 3BK1A 3OC6A 3I2FA 1O0CA 3GRUA 1XALA 2YJTD 5DNEA 2CNBA 5LYJF 1TT5A 2RGCA 3B3GA 2I7TA 4HB4A 4XASA 1ZD8A 2AT1A 3LY9A 1TDJA 4HN9A 2BCEA 3VVMA 1RXIA 3ZGVA 4XDGA 5KIAA 4ZT4A 4LE2A 3D4LA 3L46A 3ZHZA 3ZI7A 4AZSA 3OG9A 5IUKC 1WVIA 1GZ5A 5FL3A 4YT8A 3V4ZA 2CYCA 3EBOA 1WDWB 5IANA 4YRNA 1P7CA 4TLAA 4LBYA 3ZHXA 1PRYA 5CPFA 5CDTA 1NE2A 3QX8A 1ONSA 3EGCA 4TYQA 3P1JA 4YJ3A 1HRKA 1RC1A 3L01A 4BFUA 3IC5A 4R0NA 1DC7A 1XLWA 3QI7A 4DA0A 2PSDA 3D8BA 4LV6A 5AM1A 3MWDA 4DTIA 5BWCA 1OLSB 4EJFA 4DADA 5ICCA 1GYPA 2CE2X 2ODEA 1QHNA 3MWEA 3MQFA 4LZPA 5A3VA 3O84A 1JZTA 3ZD9A 2I1LA 3HJTA 4IIGA 5T3YA 1KFEB 4AECA 1NTRA 2F1KA 3O8QA 1Q1GA 2BM1A 2H2GA 3HDTA 3AKCA 2XNSA 4FYXA 3T6KA 3ZGLA 1M2JA 2AQ8A 3GNSA 1MAHA 4FFNA 1ODKA 4HS4A 3SHVA 3WX0A 2JGDB 2EVWX 3S8EA 4EEXA 1T2NA 2X7XA 3KXIA 2HPAA 1KHHA 4GMDA 1DC8A 2YNMC 2HA3A 1JECA 3HXQA 1W44A 4HGRA 3VDNB 1J39A 4MLDA 5BWNA 1DBQA 1T91A 2ZIWB 1L5SA 2P5YA 3MS7A 3PNBA 2NOAA 1QP8A 3LF1A 1NURA 2MCFA 2L0XA 5DPMA 3UQZA 4CM9A 3OMLA 4FFDA 3CUSA 1SBYA 2WHQA 4PQFA 1BYIA 4YDHB 4EG7A 1NP6A 1S89A 5TT0A 4EJSC 1NSFA 2N1BA 1XEXA 1AGYA 1WHTA 3L02A 4F93B 2V7WA 5LP1A 3TBHA 5FO0A 1FJGB 1GA4A 4U39A 3W9YA 2YQZA 2PX8A 5CH3A 2XODA 4RMNA 2J0SA 4DNXA 4CKWA 3PGMA 4OJKA 5AW8A 2XB9A 4KMOA 2BM0A 1T13A 1DXQA 1I1QB 1FYXA 1PWEA 1EQAA 4NCJA 4TS3A 5DM4A 1ZW6A 1N6HA 4AG5A 4YMUA 1SZCA 3NV9A 3GZTB 5TT1A 1QSGA 1QDEA 2O06A 2YZ2A 3NVKI 3F97A 3P0FA 1H5UA 3QTBA 4DA9A 7GPBA 4JBWA 1JKJA 3SC4A 4IS3A 5KNCD 4CN8A 3N2GB 2O05A 4BLTA 1UPBA 1SKMA 2Q41A 4MMXB 1DKRA 5JI3E 1AQLA 2D00A 3TSCA 4D80A 1MEOA 3TRDA 2J33A 4R2HA 3HTXA 1ATIA 4CKXA 3W34A 4ED9A 4AO8A 5CLFA 2IU4A 1ORDA 3G8DA 4X6YA 2KWIA 2QN2A 2QUKA 2XT9A 3BZBA 1U7OA 3GGDA 4G9EA 4HNGA 4X44A 2JZNA 4EA8A 3O8DA 4PXSA 4V1CB 2E89A 1OZGA 1RRGA 3IKLA 4LZJA 1FBNA 2Y0BA 4HDMB 4IJ5A 5B6JA 4KL8S 3RSQA 3GCDA 1DFIA 5KAMA 3MOSA 4B3FX 4CR8A 3H3JA 4LNUA 4EDHA 5FULA 4OQXA 4I5IA 1DWOA 1E9VA 3LPAA 3VSBA 2EWVA 3ITDA 4MV7A 5FFMA 3KM0A 4B4DA 2IX3A 3NJ8A 2B92A 3GLHE 3HG7A 1CDOA 3KT3A 4JOCA 2QJOA 2VUIB 5JQGB 4PAQA 2VUUA 4R84A 1TLTA 2HHHB 1QO7A 1HLFA 4CYMA 4L57A 3FMFA 2I4MA 1V16B 4BCBA 3EN0A 5BO5A 4BCCA 3GG2A 3INNA 1J09A 1SXJA 2JANA 1RJFA 2BFPA 5TLSA 2RBEA 4CG2A 1FJ2A 2NVBA 5CW2A 3TQQA 4P4SA 3WHIA 5IYZB 2WDZA 3A70A 3QWHA 4OXNA 3W6PA 4D2IA 3CF4A 1BCSB 2SCUB 3K15A 2HIGA 4IHKA 2BONA 1JU3A 1TQ8A 3MTQA 3ONDA 2ATCA 1ZJZA 4HYYA 5AKZA 1L3IA 2NPFA 4DUGD 5I6DA 2HDWA 3HBNA 1LF0A 3EWIA 3KG2A 1PQWA 4U00A 3VZRA 3WB2A 2QMHA 4NWIA 4OAPA 5ICFA 5A4IS 1AK1A 2XRMA 3KPJA 2QE6A 3DTYA 4NZ9A 5DM70 2DR0A 1I4LD 3D7RA 1XL1A 3VJKA 4Q19A 3LCRA 3PL1A 3UKJA 1TAHA 4BRZA 4NONA 2OZEA 4HQRA 4ONEA 3MMNA 2QOEA 3I4CA 4FHCA 4BO7A 2HDOA 4BE9A 4HQOA 3F6SA 4GYKA 4IXNA 3H65A 3KD2A 2EBHX 4LVCA 5TGDA 1R0BA 2ENUA 1Z4KA 3VR4H 4V1CA 1VJ1A 2VO1A 3K5PA 4X93A 4WCFB 5FDFA 4JP1A 1W5EA 3UCEA 4HYEA 3TIXB 4EBBA 4C06A 4J03A 5JDCA 2VSYA 1FNSA 1K7CA 1SU8A 5EP3A 1N3BA 3CISA 3NVDA 5JAZA 4PQRA 1XZMA 4CMEC 3FYDA 2XW6A 3RLFA 4B6GA 1X19A 1LGYA 3N2GA 4KO1S 2XUPA 1UAYA 4BTVA 2PCJA 2F1HA 1BW9A 1IQRA 1ZUNB 3RC3A 1TEZA 4J94A 4GW3A 4FZRA 4YRQA 1B2RA 1YZFA 3KEQA 2KQUA 5KOYA 1BGWA 1CY1A 1ZNXA 2QTZA 3TCXB 1CUZA 1WUJS 4RHFA 1M1XB 1FQOA 5DSZA 1S01A 2XB4A 4ZZIA 3B12A 4RA6A 4C21A 2VA8A 2CY0A 3REQA 1YV9A 1HE1C 2FMXA 3IUEA 5LZ7A 5I4CA 1NQVA 4CL0A 2Z4TA 3DGFC 2GHIA 1QGAA 2J0UA 3EF1A 2F3SA 3WWEA 5C2JB 5MF6A 3G23A 4E94A 2HBYA 1G9SA 3IB3A 3LYLA 2X1VA 3HBAA 3PDIB 3I53A 3RS7A 1OGJA 1R6AA 3HYRA 1IC6A 1U0FA 4OJTA 1U4NA 2P5TB 2IELA 3GGJA 3KJIA 2Z5VA 4BO9A 4ARCA 1NVUQ 4FYWA 1QYXA 4YX9A 4TYMA 4HWGA 4Z4IA 5C34B 3GLGA 4OGGA 3ETCA 3N7UA 4W5NA 3DOIA 2XQVA 2C4WA 4RAQA 4WZZA 5AI8A 1CS4C 1GU1A 2ZSKA 5JJCA 1GZ4A 3OECA 1KERA 1Z5WA 3EK2A 3UMCA 3K71B 1GTSA 3GCXA 3L6OO 4J9UE 1MRNA 3M89A 2BKXA 5FI0B 3WLMA 1FC0A 1P7PA 4CF6A 1YASA 2JHGA 4OATA 1JG1A 1OD6A 2ZI4A 3O0TA 4XAQA 2Y1CA 1V3TA 2ASVA 1R88A 2QDKA 3G8BA 3NHKA 4RD4A 2C7QA 1ZK3A 2UUBB 4MZDA 5BRAA 4LRUA 1W0CA 3PGLA 2BLLA 4BNWA 4B5KA 5M29A 2OAGA 3GFGA 2X9LA 5KTYA 2C2XA 4ZRDA 3CX8A 4XUDA 3GCZA 1CEEA 1HNNA 1RKBA 5CJJA 5ICEA 2COEA 1RJGA 1XMOB 1RIIA 5JWHA 4E88A 2CN1A 1AGRA 3IBGA 5AM2A 5K05A 1GTRA 3TRIA 3C1OA 3E81A 4IGIA 1ZKDA 4BNHA 3U61B 1NRWA 1COWA 3QEJA 4K9DA 1B93A 1WMSA 1ULZA 3V46A 3NDJA 3VVLA 5KNBD 1GZVA 3K94A 1TE2A 1Z6GA 1F8FA 1JTFA 2H1WA 2Y92A 1RR6A 3G13A 1TT7A 3DPUA 1KI6B 2J67A 4G5SA 4H7IA 2GS9A 1EE1A 2P2ZA 3GVHA 4K05A 3WK9A 4ETMA 4RTSA 3VOTA 1CJBA 1KY3A 3IOYA 3WI7A 2PUDA 2MSCB 4CKCB 5DVZA 1DL5A 4A1OA 2PU7A 3T5PA 1A0OA 4CEJB 2VYCA 4WGGA 1B8NA 2QG4A 3O90A 3SYRA 5M7EA 1K7SN 3WRVA 3JY6A 3HCWA 2FNAA 3WGJA 4LC9A 5K4HA 2A7XA 1AK9A 3OPQA 5C8ZA 2AG6A 1MR3F 3S2ZA 2P67A 1PQPA 2FRDA 1R0YA 3L7NA 1A7UA 3JATA 3NNSA 4K2HA 1IOZA 1EAYA 5EGNA 4CMJA 4Q4CA 3VZPA 3DHEA 5A2QA 3ZD7A 3KQPA 1XK6A 2B98A 2MYUA 2RC5A 2QYOA 4FC6A 4BVJA 1FXSA 1P19A 3L7CA 4YRRA 5DU2A 4EHIA 2WOOA 2VH5R 1GUZA 4BVFA 3AU9A 1WABA 3NTXA 2WYWA 3AEQA 4KFTA 5TMDA 1KFJB 2GK6A 5IDYA 3JYHA 4Z4HA 2QPAA 1QRRA 4KWIA 4O4LB 3JYOA 6LDHA 1AXGA 4A2QA 5FP0A 3P2IA 2VF5X 5E9QA 3GH1A 3CQ9A 1U8CB 4BO2A 1POXA 1WXQA 2B9VA 3AJEA 2C99A 1W88B 3I1IA 1EHCA 1ZGZA 2B8TA 3QVKA 5J58A 5JYEA 3IO3A 3VI3B 3W2TA 3AWIA 4RZXA 4MS1A 2ZYUX 4NU5A 3EIOA 4C4TA 2AFHB 3U81A 3IIEA 2I8LA 1YO6A 1G64A 1ZM2A 4HAXA 2G9NA 3KXKA 2BKEA 3AJDA 1QCZA 2R0QC 1KY5A 3ACBA 2PWBA 1OT3A 3FNGA 5BPFA 1EESA 2FOXA 1UDAA 3PD0A 5IMBA 1LW6E 4LF7B 1EWVA 1X9HA 1E79D 1QVAA 2PKCA 4QBGB 3NHMA 5J4HA 4YXFA 3HXKA 1UM8A 3QLUA 4I9NA 2GK3A 3G7NA 1XXHE 2XTZA 4R16A 4UCFA 2R4TA 1KBQA 1RLTA 1G4HA 3UZUA 5K0SA 4ZYVA 2AUTA 4X6UA 1A8QA 2AXNA 1CQIA 2IUUA 2QMZA 4JYCA 4L51A 4R68A 5IBPA 2XKKA 1UWVA 1YS9A 4KXVA 5E1OA 4WNAA 4KYVA 3U1VA 2XT6A 1EFVA 1HOTA 2GESA 2Y1EA 2VK4A 4H4DA 3NPMA 2QRNA 3SICE 3ITNA 2D74A 1FQJA 4O25A 5F52A 3AY0A 3LT0A 1KK1A 3TXXA 2DT5A 3BXPA 4LS3A 4WRRA 3TNDA 4A0SA 4MQ5A 1A7JA 3DVSX 3GRRA 3RWOA 3TSAA 1LSUA 4IXTA 3Q88A 1W5AA 3V7UA 2XITA 2H7XA 3GPCA 1A2OA 3F8SA 2ECQA 4C88A 3OETA 3JQAD 5EUBA 1TU4A 3OLCX 1T29A 2J6HA 1Z35A 4HDOB 5ALOA 3GLVA 2PZMA 4RD1A 3G9XA 3MBKA 1JTVA 2FXVA 4D46A 4WK0B 4QSMA 4BGVA 3CN7A 1P44A 3CNEA 3N6VA 3ON5A 4AUNA 5IBRA 4HLUC 5KYGA 2VF4X 4MWCA 2E4XA 3ND9A 3A4TA 1BFUA 3HA3A 1HV8A 3QFRA 4Z2AA 5KSOA 2Q4TA 3B52X 2AW5A 1UWKA 2NZUG 4PRYA 3GLKA 4HH1A 4QQKA 4ZI5A 2J59A 4QDTA 4NDAA 4TL8A 4ZOLA 4OKSA 3O1IC 3GEIA 1W73A 1LTKA 2R48A 2AG5A 1DBIA 1NF2A 1VCIA 2WTBA 1UXHA 3FE2A 1AKVA 1Y80A 2J9RA 1PKEA 3QEOA 3R4VA 4NMXB 4U6NA 2CDNA 1E9FA 1UMCA 1EWRA 3FCCA 1IQPA 1Y6RA 2QMEA 4MUBA 4E5SA 4Q1VA 5GWXA 4EKNB 3KWMA 1OMOA 2AH5A 2MJLA 3MUFA 5LUBA 4KSBA 1ENOA 3UFBA 1XJCA 1RPNA 1BGVA 1H0KA 3EBPA 2VWGA 3H0CA 4MDYA 4PG7A 4ZQHA 3ROEA 5B7NA 1YTUA 2J8ZA 5JSZB 5A2GA 3IEVA 4X1IB 4KG7A 2ZWMA 1H1DA 1BMFA 1MX1A 3KQMA 1WOMA 4GC9A 3BSFA 1TQ6A 3DDNA 4ZODA 2BFNA 2Y2UA 8ATCA 4FS3A 1FY2A 4G4GA 4WXEA 2WJ6A 3OQ6A 1HDCA 3PZRA 4KIFA 1T2AA 4CMHA 5MFPA 1CY2A 4MVJM 5CGZA 1P81A 4K6GA 4Y6LA 3T7AA 4PE5B 2X19A 2AMJA 1IN1A 4QM7A 3PHIA 4KPFC 3QEBZ 1WCWA 1NUQA 2AOVA 4QEKA 4AZVA 2Q62A 1AHIA 1ZWLA 2D4AA 5GJWC 1R0LA 1IRIA 1RPAA 1Z0DA 2YOGA 2NO6A 4Z9AA 1AQ6A 5ALQA 3LPCA 3VH4A 2BGMA 3TEFA 2AMFA 1CC1S 2JAXA 4BTLA 2H6EA 3ICCA 4HSEA 4D0NA 1MQ8B 3S70A 1V8FA 1LBQA 4XEUA 4GI3A 4H2DA 4AX4A 4F8EA 5AUPB 5LUAA 1UF9A 4WOCA 3MF4A 3G0IA 1T5LA 1FDSA 3VSAA 3WIUA 1ZU5A 5JY6A 3FAZA 3P32A 3P0HA 5DJ5A 1VHWA 1YR8A 3FNIA 4B4VA 4EPWA 5LJLA 4UNSA 1C4KA 3FIUA 1X1CA 4I4NA 1NXXA 2JCXA 4TUYB 3S5UA 1T9CA 3WLQA 2AZ4A 1JG4A 2RHHA 3DHNA 1H6BA 2HCFA 4KWCA 2IYYA 4Q5IA 4LJ5A 4CKZA 3IPLA 3B1VA 1E4EB 5CFRA 3KP1A 3OCCA 1CZLA 3SZGA 1ZVVA 4YUXA 3OD5A 4PAMA 4TS1A 1Q0UA 5DNCA 5EJ2A 3F8TA 4G4JA 1D03A 5F5LA 1KMMA 2I6QA 4H1WA 1KRXA 5K6TA 3T0FA 3K16A 1KAHA 3LT4A 1ZHHA 3QMPA 2R97A 5TEWA 2HWUA 4ZJYA 3TLYA 5FH9A 1RABA 2YIVX 1EK6A 1DJNA 1N7HA 4BPRA 1RM4A 1NY5A 2CHQA 1TGVA 1LI7A 1X7WB 3UOGA 4W5WA 4PLCA 3WIVA 3SI7A 2ZDQA 3IE1A 1CFZA 4LECA 2JLZA 5JNVA 2GEBA 1Y3FE 1EK0A 2W4MA 1D0VA 1TM2A 4GI1A 3UV3A 5JTUA 3AR9A 1J33A 1C7IA 3MINA 1KA9H 4O33A 3NIBA 3VISA 2BE9A 2YRXA 4D82A 3MT0A 1LF5A 4UUBA 1Q1QA 3JU3A 3JVIA 5TF4A 4JKOA 3UT0A 4GPTA 1RP1A 3EF3A 1VIDA 2DWPA 2GWRA 3JWHA 3AF5A 5K2MA 1W2HA 3U3DA 1UJ4A 3D6VA 2IXDA 3ETNA 4AMVA 3O91A 4LRXA 4XWTA 3ELDA 2OB1A 2PBLA 1BOOA 5KI6A 3ILXA 1BQ3A 5JPCA 1WB6A 1W5SA 4ZI7B 1MC4A 4WKBA 3U37A 1NJ8A 5DXFA 3VPDA 3UAYA 3K9FC 4XUEA 5KAPA 1RQGA 3NZEA 4YAIA 3BXFA 1UKVY 5F5XA 5L4NA 3N0XA 1ZSNA 3RSCA 2I2FA 3WAKA 1EUDB 1IEXA 3OLQA 3B5EA 4H17A 2C9CA 1ORWA 3ZWOA 1MX5A 3KEOA 4K8OA 3DYBA 1R8XA 3EYAA 1RI2A 4OIMA 5LN1A 3DDHA 3FPHA 3VX3A 1BXRB 1YZHA 4QDKA 3UH1A 4E6PA 3B13B 3KPVA 4D99A 3IPRA 4QFMA 3A3KA 4MKXA 1SGWA 4L6CA 4HDQB 4UC0A 5LJIA 4B6JA 3DXYA 4PQGA 4PX9A 4C0QC 1RXYA 1RU3A 2CLOB 4G86A 4PSUA 2PGDA 3B3QA 2P6UA 3HRHA 3KR1A 1ZMBA 4LOJA 1ZGHA 3TJMA 4G0WA 3RC1A 4ZC1A 1WXGA 1NZDA 3K0HA 4IGAA 1GUDA 1YBFA 1NA5A 2V9PA 3IPCA 4WCVA 3RYHA 1J0CA 1U3UA 1G66A 2PRJA 3SY8A 4BX0A 2QR5A 4FYYA 2CYAA 3C41J 5ED4A 4LQCA 1LKZA 4YRAA 4GEGA 5BWLA 3BZWA 4NEGA 3EFHA 1Y3IA 3WBKA 1G5PA 1RFGE 3EQ7A 4C0XA 3H11A 5K0JA 3ANXA 4OHZA 3SZLA 1JR6A 1AT1A 2Z8YA 3HCCA 3K0CA 1ZNQO 5KYNA 2GBGA 1DZ3A 1AN0A 5LA6F 3H2JA 4DMLA 2AJDA 4AJIA 1NULA 1NBMA 4KE6A 1SBIA 4IEEA 4GPBA 1PDVA 4L50A 2R9VA 3BE4A 3NVAA 2QTLA 2GBFA 4KMSA 2NPIA 3IUSA 3LXUX 3P0RA 2BFWA 4CODB 1RC8A 1MOZA 4KQ9A 2VG8A 3N05A 2ZP1A 1YTLA 2ZULA 4YAKA 1IBSA 2QV7A 1SUAA 2PX4A 1GPWB 4AZ3A 5DX0A 2CXSA 1R8YA 3AQ4A 5CT9A 1ZUWA 2YMLA 1X7ZB 1XMIA 1Y6JA 1WXEA 3QX3A 1FVHA 2L18A 2XR1A 1X74A 2HZBA 4JLDA 5LL6P 3ZTTA 2ZROA 1X3LA 1SG9A 4EF4A 1REQA 4S0XA 3V1NA 1OH7A 1QH8B 2WT9A 4QASA 1YDWA 2WG2A 3CRW1 4TMTA 3ZI0A 4KLAA 2ZYGA 4M8KA 5JZ9A 3G5UA 4EY6A 4K9QA 2ODQA 5K6RA 4NOMA 2AWOA 3O8BA 1AUXA 5EQFA 3QWAA 1FYEA 1S9HA 5EKTA 4B2LA 2QT9A 2RKOA 5AKXA 5K8JB 2PS1A 2XLBA 3PXUA 3IQZA 3UVEA 3STXA 1O96B 3PPXA 4ZXPA 1BKDR 4FHGA 3PEEA 4XVRA 1IHDA 3KSRA 1YQEA 4B3SB 3OM9A 1A1SA 1Z3IX 4GPZA 4DEXA 3OZXA 3E48A 5EWMA 3STUA 3VTZA 3V1TC 1UZMA 4K26A 3A1CA 5BSUA 4DEVA 4HVAA 1EJ6A 2X1LA 5CYOA 5FI5A 1YJ5A 3GRFA 4BEJA 3I92A 2D5CA 1EUZA 3RGGA 3IAS1 5EZ6B 1ADFA 4I1IA 1XKTA 4Q7EA 1IQ0A 3W3ZB 3R0VA 3AF1A 4Y6RA 5CUQA 4YCCA 4YP0A 3PNQA 4OHFA 5CAEB 1F4VA 1P1BA 2MU1A 4FR5A 4JBYA 1U2DC 5E0KB 4KPGA 3QEKA 3HI4A 1PYOA 1VOTA 3N9IA 1PYGA 2GRJA 3X1WA 1JTEA 1MAUA 3BMOB 2PGXA 1V8OA 1PT9A 4G0PA 2FWIA 1Z12A 3K4HA 4JBNA 3T4EA 4PYIA 5I5GA 1SD5A 1PHPA 2B4AA 1CX9B 4BB9A 1E3DA 2B4KA 4M1QA 1HDRA 1BCRB 3ICWA 1NSYA 3KSZO 3NALA 1JFTA 1QG4A 3FF1A 3TBKA 2QLFA 3ND8A 4ZZ3A 3GZNB 4CTJA 1Q7GA 1MJ5A 2RARA 4GWLA 2VCHA 3H3XA 1LLUA 1ZYUA 1V1MA 2XRYA 2P7IA 3MTAA 4PTYA 3BL8A 3IDOA 1KORA 5EERA 4BC1A 4C9BA 3KQWA 3PQ2A 4JV5B 5CT8A 9ATCA 2Y05A 4RETA 3EEOA 2ZAGA 2REXB 1SHJA 1RYNA 1Z68A 2ISQA 1JIQA 3C3AA 4ARIA 2IV3A 3DZKA 4J0GA 5LM3A 2X8JB 3HKDA 1OI7A 1C8BA 1UBCA 1GQ2A 1M1YE 4M1WA 4PLPA 4A82A 4O4HB 1WOYA 4OLAA 2XUFA 1JG6A 3IOBA 5ENVA 3KAJA 1R4AA 1Z26A 2X14A 4LJYA 2Q1SA 4QU0A 3X1JA 1UANA 1MXHA 2Y68A 3DMRA 1EFLA 1S2DA 4M7WA 4FS8A 1B1AA 3IT0A 2B1GA 3QA3E 4ZOBA 5D00A 5TF0A 4ZTUB 1X87A 5FPPA 5CYFA 3UXHA 4EYSA 2FPUA 2C4UA 2BI4A 2DEUA 2Z2JA 1UM9A 2C29D 3ED1A 1Q50A 4GHWA 2ZE8A 2ZIXB 3AJRA 3BJEA 3NFYA 3ZWWA 4ILKA 1NOKA 4CCWA 2OXFA 3H1EA 1A95A 1T5OA 2A0XA 3A7EA 3CKYA 4KI0A 4LMAA 1MXFA 2GK4A 3CO5A 4LZAA 4ZQEA 4Z3DA 3RTGA 4E5VA 3L5KA 1WF6A 2G0AA 3M6UA 4MW6A 4QDZA 1IU9A 5K8CA 3ETLA 3CLTD 4FYMA 1W49A 4U7PB 5BNWA 4F9FA 2GXSA 1GLVA 3WLPA 4EENA 1FNNA 1X7XB 2HNAA 2R11A 3UT5B 4RELA 3IE0A 4GWKA 2ZB3A 1MKYA 3A3YA 1A50B 1TC1A 3VSCA 1IWBB 1JDVA 1UKCA 4MR9A 4N82A 2HYIC 1BD3A 4GM4A 1YR2A 2A3NA 2QAJA 4P6VF 4CLRB 1Z7GA 2B35A 1BD4A 1EFPA 3IV6A 1FNDA 1KZ1A 2Y77A 3GT4A 4LK3A 4OM7A 1QGUA 1KSJA 1CUCA 4DT1A 5KREA 1I51A 4NH0A 3AONB 2VZLA 1C8KA 1NJ6A 4KMRA 2D2VA 1E94E 1SK8A 3D4OA 4X84A 5AW9A 2IBTA 3GFTA 2FFJA 3CUVA 2CXNA 1E2NA 3P4XA 1KDPA 4ATNA 3JWJA 1UBTS 4JQOA 3PLAE 4M8LA 2O9JA 2HJ9A 3G0BA 4OLJA 2M6SA 4R3NA 5EZYB 4UHBA 4KDFA 2NZWA 5C0OE 1Z0JA 3FHOA 1QGOA 2XEDA 1FNCA 1XVUA 3IBTA 3KAKA 2O4CA 2VYVD 4O0MA 4FYPA 4L8YA 5F77A 1E2JA 5TJ9A 1T3SA 2M98A 1JS1X 4ZANA 3SYKA 5ELMA 5GM2A 1G1AA 4QUIA 1QAMA 5TQJA 1L9XA 2EJWA 2HLPA 2ZGVA 3LJKA 4M53A 4Y2HA 2FJ0A 3Q2OA 4DYVA 1Q0LA 4DLPA 3DTNA 1N6LA 2BTOA 3ZCXA 3C70A 1KOGA 3VPXA 2HSDA 2NNWB 2P4SA 3BMQA 5G1PA 2VOEA 1KGSA 3VNRA 2OZLB 2I7XA 4IIJB 4GLBA 2MR6A 1GXSA 3UMVA 3ET4A 3WP1B 1XYVA 1KY4A 1M8FA 4FOPA 3K20A 4K3VA 1SUDA 5HTOA 3G1UA 1A1VA 2DSNA 3ZQ4A 1LH0A 1Z5PA 2HPVA 4Q3EA 1N1DA</