2AOTA

Histamine methyltransferase complexed with the antihistamine drug diphenhydramine
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
288
structure length
286
Chain Sequence
MRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYEYDLLSTMDISDCFIDGNENGDLLWDFLTETNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histamine N-methyltransferase
publication title Structural basis for inhibition of histamine N-methyltransferase by diverse drugs
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 286
sequence length 288
ec nomenclature ec 2.1.1.8: Histamine N-methyltransferase.
pdb deposition date 2005-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2aotA00
2GB4A 4LWOA 3ELUA 3NWEA 4FP9A 2YXLA 1FPQA 1PJZA 2OBFA 5H02A 3KR2A 3ERCA 1X1CA 3HVIA 2C7QA 3MGGA 3DLCA 1D2GA 1VP9A 5LSAA 1F38A 1JQDA 4QPPA 4G56A 1O54A 2FHPA 2ONYA 5K05A 2H11A 2C7OA 3LGAA 2ZBRA 3GIWA 1QAQA 2IDKA 3TM5A 3G7UA 1IM8A 3PT9A 5F2OA 1KR5A 2K4MA 3KQWA 3CCFA 3HM2A 3I64A 3R0QA 1X1DA 3LSTA 2P1DA 1KPGA 1N7IA 1VLMA 3EGVA 3FYDA 1O9GA 3FPJA 3GRRA 3C6MA 3NW9A 5DSXA 5LR6A 1BC5A 1QZZA 3G2PA 5K0JA 3MQ2A 3NMUF 3P9CA 2IP2A 1QANA 4OQEA 5DTQA 5E2BA 1RI1A 3BWMA 4ER5A 2ZCJA 1P39A 5FHRA 2IH2A 1NV9A 3PFHA 2AR0A 2PVCA 3A4TA 2AVNA 2PXCA 2ZBPA 3P71T 4PYQA 3EVAA 3VYWA 3IV6A 1FJXA 4PYLA 3DMHA 3O4FA 3FPFA 4YMGA 1L9KA 3CKKA 2ZZKA 3PX2A 5EMJA 2XVMA 3CJQA 2V7EA 2PJDA 5ERGB 2I7CA 3OU6A 4OA8A 2NXNA 2CL5A 2PT9A 2PX8A 3CGGA 2BR5A 3GCZA 2JH8A 4WVLA 3MTIA 5EHIA 4QTUB 3AJDA 2P8JA 3GRUA 3I9FA 3RW9A 4PYKA 1AF7A 4HRAA 3OE5A 4V0RA 3KPYA 5K09A 5B1SA 3FZGA 2PY6A 4GQBA 4CTKA 1FP1D 2ZVJA 3M70A 2HTEA 1BHJA 3P8ZA 4CKEA 3TQSA 3BT7A 3LCUA 1HNNA 2PKWA 4FSXA 3ANXA 3HCAA 2YUIA 3BKWA 3KPWA 4P7GA 4YV1A 5K8VA 1YUBA 5HZMA 1R18A 1WXXA 1KPHA 5FQNA 3L8DA 3DTNA 1JSXA 3C3YA 3K0BA 4AZWA 1RI4A 5G02A 1KYZA 2Y1XA 1KYWA 4BY9E 4DCMA 5EQJB 1EJ6A 3KR0A 3GRVA 5HOQA 4PIMA 2IFTA 4XCXA 4BLUA 4QQKA 4RTOA 3HA5A 4GC5A 1IY9A 3SX0A 4YUXA 3FPHA 4DKJA 5FUBA 3FRIA 3P9KA 5E8JA 5FA5A 1YF3A 5E9JA 2E5WA 1Z3CA 2CMGA 3KPVA 2OYRA 2I6GA 3TFWA 1VE3A 1BKYA 4CWAA 1G8AA 1P1BA 3GRYA 5DM1A 3VC2A 2AOTA 2R6ZA 4P7KA 2QE6A 2O07A 4CTJA 3RIEA 1WS6A 4IKPA 3TLJA 4GOND 5FA8A 4LWPA 1SKMA 1F3LA 2FPOA 4CKCA 1L3CA 2WA1A 3E05A 3E8SA 5BW5A 1T43A 2CKDA 3O7WA 3OZTA 1QAMA 3ELYA 3KQQA 4Y30A 2I9KA 4PCAA 4ER6A 3BKXA 1JR4A 2G8NA 1JG2A 4C07A 5CVDA 4YUYA 2HWKA 2ZFUA 3IEIA 3REOA 3KPJA 3PB3A 2NP6A 3UJBA 4LECA 3ORHA 2YX1A 3G8AA 3UJ6A 3FUXA 4BLWA 5JR3A 3LPMA 1P91A 4GEKA 1YB2A 1X1BA 4ATNA 2XYQA 3UA4A 5ICEA 2IBTA 4QVKA 5K0GA 4R6WA 3DXYA 3T0IA 3SR4A 2G72A 4MHTA 5D1NA 1XDUA 3HA7A 2Q41A 3LKDA 5EKUA 4RWZA 4AZTA 1AQIA 2PX2A 3V8VA 1KP9A 3FPGA 4R05A 4POOA 5LQUA 5FHQA 2VDUE 2PT6A 3O31A 4QPNA 5HEKA 3TPZA 2OZVA 3I58A 2ZTHA 5CIYA 7MHTA 2B2CA 2R3SA 4OA5A 3DMFA 4RTQA 5CD1A 4RTRA 4U7PB 2YXDA 4YMHA 5GIPE 2C7PA 2IH5A 5DTMA 4HGYA 1AQJA 1RJDA 3NWBA 3HCBA 1ZGAA 5DM0A 5EIWA 2FK8A 4AX8A 3EEYA 5EPEA 4HH4A 2O06A 2Z6QA 2NYUA 3BGVA 3SXJA 4C08A 2VDWA 4XUDA 5LQRA 4CXMA 2JG3A 1JG1A 3RODA 3VSEA 2GLUA 2B3TA 1QYRA 5IKMA 2ZWVA 4BLVA 1JG3A 2G70A 5HFJA 3EVDA 3UZUA 2P41A 3AWIA 4E2YA 3LCCA 2BZGA 4RVFA 4ER0A 2QY6A 3PS9A 5K0LA 4RTNA 1RI2A 1XXLA 2WA2A 4P58A 4HC4A 4ER3A 4BP3A 3FUTA 4CKBA 3FRHA 5EC8A 5DRYA 4R6XA 3B89A 3PVCA 4KDRA 3MHTA 2FRXA 1JG4A 2QRVA 5DPMA 4IWNA 5P8WA 5EMLA 3HTXA 2BR4A 3JWGA 3DUWA 4QTTB 1X19A 3SSOA 3G5LA 5KYGA 3MCTA 3QV2A 3FUVA 3NVMB 5GWXA 2FK7A 2OKCA 2PXXA 1Q0SA 5DX1A 1XTPA 3KU1A 1HMYA 4ISCA 2NXCA 3UWPA 1UWVA 1XDZA 2O05A 3SVZA 1V39A 2OY0A 4KIFA 1G6Q1 2UYHA 3A27A 1JQ3A 2DPMA 3LL7A 2AS0A 3OZRA 3KQSA 1L3BA 2QRVB 1JSZA 3UJ8A 5CM2Z 5EVJA 3OPNA 4DF3A 2EJUA 3LBFA 3CJTA 3A25A 1XJ5A 2P3QA 2ZIFA 4E31A 3OU7A 1N2XA 2AN3A 5K0NA 2PLWA 3DP7A 2BM9A 2IH4A 2O57A 1EQAA 5FWAA 2QM3A 2JHPA 1EG2A 4C05A 4KIGA 3UJAA 2ZZMA 2H1RA 4RSRA 1XCJA 4H0NA 3KR1A 1SUSA 5DM2A 5C1IA 3BGDA 5CCXA 5BP7A 5K0FA 1VPTA 1KIAA 3KQTA 4GUAA 2UZ4A 4FGZA 4KWCA 1MJFA 2YTZA 3HEMA 4DQ0A 3UBTA 4GF5A 3M6WA 3M6XA 4RV9A 4DM3A 1QAOA 3HVJA 4LG1A 10MHA 3NVKI 2AOVA 4RTSA 3ER9A 5CVEA 4BP1A 5BW4A 4RTPA 3G88A 1EAMA 4GOMD 1DUSA 3GRZA 4F84A 4MQ4A 1JTFA 1XVAA 5K0BA 3HCCA 2PSSA 1BOOA 5C0OE 1P1CA 4GOLD 2FYTA 3QOWA 4PYNA 2OB1A 3JWJA 3P9NA 5E9QA 4M36A 5EEHA 1TPYA 4E2WA 5LQJA 3G8BA 2FCAA 3ID6C 5HIKA 9MHTA 3OZSA 2AN4A 2AZTA 3P2KA 2HR1A 2GAFA 4E2ZA 1I4WA 5EZSA 4PGGA 1NW7A 3OFKA 3TMAA 3A26A 3LHDA 3FTEA 3H2BA 2XYRA 3TM4A 3FPEA 2A14A 2ZIGA 3G89A 4ZTBA 4Z2YA 3EGEA 3JWHA 1B42A 5K01A 1NW3A 3NDIA 2ONZA 4RYLA 5EMMA 5GM1A 3R9XB 1VBFA 3BWCA 2B25A 2ERCA 1VQ1A 3MTEA 1G60A 3UJ7A 3NDJA 3GJYA 5EGSA 5EKXA 1IXKA 2AVDA 2ADMA 4XUEA 3LX6A 1NT2A 1D2CA 1RI3A 2JHCA 3ME5A 1JTEA 1ZGJA 2JJQA 3CC8A 5DXAA 5GIOE 3CJRA 4GC9A 3P9IA 2P3LA 5M5BA 4YUVA 4X61A 2GS9A 2XYVA 5HILA 1PRYA 3ELWA 1R8XA 3B3GA 3DR5A 3EVCA 3M33A 4R8SA 3G2MA 5EZQA 5FADA 2VDVE 1Q0TA 2ZZNA 1G55A 3LDGA 4PIPA 4GOOD 2NP7A 2ZULA 3C6KA 1M6YA 4R8RA 4P7JA 5EMKA 5GOZA 4L7VA 4KW7A 5EG5A 2C7RA 5FTWA 1NBIA 4FZVA 2CWWA 1DCTA 1WY7A 4RVGA 1Y8CA 1JQEA 1ZHFA 4OQDA 4A6DA 2AN5A 5DTRA 3P2EA 1L3IA 1SG9A 4ER7A 3OCJA 3PTAA 3FUWA 3E7PA 4E33A 2G71A 5E1OA 2IDJA 4WXHA 3TKYA 3EMBA 4PINA 3HP7A 3MAGA 4RTLA 3EPPA 5E1MA 2BH2A 1AV6A 3JWIA 3KKZA 3MB5A 1XCLA 4DMGA 4HSGA 3CBGA 3HCDA 1M6EX 5BXYA 1EJ0A 1ZG3A 1EIZA 1R00A 3GO4A 4RTJA 1SVUA 4DA4A 3ER8A 2F8LA 3I5UA 1WXWA 4PONA 4F86A 4C06A 1M0EA 2Y1WA 5U4XA 3SM3A 2JHAA 4QDJA 3D2LA 3M6VA 3PFGA 5E9WA 5F2NA 4E2XA 5IH3A 4PGHA 4YV2A 3KR9A 1NBHA 3NJRA 5EOVA 5GM2A 4MTLA 2NXJA 3V97A 1NKVA 1NV8A 5K0CA 3FTCA 3TKAA 3BWYA 5LQNA 5K0EA 3AY0A 4RTKA 1ZQ9A 5EEGA 2YQZA 2GH1A 3FTFA 1SUIA 4V0QA 4X63A 2BM8A 5DXJA 3WSTA 2VS1A 4YUZA 5ICFA 5ICCA 2P35A 3TRKA 1I9GA 4PWYA 4OBWA 4QDKA 2ZLBA 2ZBQA 3GDHA 2JH9A 1UFKA 1TW2A 3LDUA 5D1HA 5HIIA 2DULA 5FQOA 3LKZA 2IIPA 3GNLA 3K6RA 2V74B 2BR3A 3THRA 2Z6AA 1NE2A 3C0KA 2PV0A 4K6MA 5E1BA 5E1DA 3OFJA 2XBMA 2UYQA 5CVUA 5CCBA 4RVDA 4FT2A 3DOUA 5E8RA 4FSDA 5LQKA 3GGDA 3BZBA 3F4KA 4PYMA 1TW3A 1YFLA 3X0DA 1NW5A 3EVZA 3Q7EA 2P7HA 4IV8A 3BWBA 4OX9Y 2H00A 4XUCA 3KHKA 3R24A 4F85A 1D2HA 3GU3A 5ICGA 5CVVA 3HNRA 3EGIA 3B3JA 3HCEA 3UA3A 4IV0A 5C9ZA 3HVKA 3SSNA 4X41A 2OO3A 3OE4A 2KW5A 3DLIA 2G1PA 1UIRA 1SQFA 2XVAA 3U81A 3M4XA 2OXTA 1RJFA 1NW6A 2AOXA 2UYCA 2PGXA 4FT4A 4AZVA 8MHTA 2HNKA 2AOUA 3GWZA 4M7RA 3FTDA 4MWZA 4Y2HA 1YZ3A 3THSA 3TOSA 5CUQA 3EEOA 2ZIEA 2O0LA 5KQSA 3R6TA 2GA9A 2PX4A 1KPIA 3IYLW 3S68A 2NXEA 1INLA 2P7IA 5MHTA 2ZSUA 2VP3A 5DWQA 4C4AA 1R6AA 4DZRA 1KHHA 5LQAA 2UYOA 2OPBA 3P2IA 2LD4A 4PYJA 4GBED 3E23A 2OB2A 3KPUA 4M38A 1FP2A 1O9HA 4MIKA 3HCFA 1ZKDA 4DCGA 2AOUB 3LBYA 3B5IA 3FYCA 1VIDA 5E2AA 3KQPA 2AOWA 3M6UA 5DX8A 2P3OA 2I62A 2YVLA 1VP3A 3EVBA 4HTFA 1WZNA 5CVJA 4YUWA 5FWDA 2P40A 4E70A 4KDCA 3PX3A 4NECA 1DL5A 2EX4A 2QYOA 1MHTA 1SQGA 3B7PA 3BUSA 4EMSA 3DXXA 4RVHA 1RJGA 4FR0A 3G2QA 5KVAA 1WG8A 2N47A 3AXTA 3HA3A 2NNWB 2B78A 3G2OA 5DX0A 3BGIA 3T7RA 3HVHA 3IHTA 5EHGA 3GXOA 2ORED 2PX5A 1H1DA 2PWPA 4EQZA 5KS2A 4O29A 1KXZA 3LDFA 4HGZA 3DH0A 4HTFB 4EVIA 5T64A 4FS8A 4A6EA 5DSTA 4OBXA 4AZSA 1G8SA 3OU2A 3B3FA 4KVZA 4AUKA 2B9EA 3KQOA 4PCLA 4PNEA 3T7TA 3C3PA 5HIMA 5GINE 1RJEA 3EMDA 3MCZA 3NTVA 3UJCA 2CMHA 2EFJA 3FUUA 5K03A 3UJ9A 3A7DA 2GPYA 3AXSA 5GP1A 3EVGA 3I53A 3VC1A 2PXAA 2YR0A 2IBSA 5FCDA 1X1AA 3UJDA 1R8YA 2AOTB 1ORHA 5FULA 3SSMA 2WK1A 1FBNA 4RTMA 2PWYA 5DLYA 4C04A 4E32A 3Q87B 3KQVA 2ZWAA 3DMGA 5F2KA 3P97A 4KRGA 5DT2A 2IGTA 2ZW9A 3SGLA 4QVGA 5T67A 3R3HA 3G5TA 3CVOA 4QQNA 4U7TB 4P7FA 4X60A 1NW8A 3KQMA 5T6BA 3QOXA 4X1OA 4B17A 3T7SA 1XDSA 2HMYB 3TR6A 4EKGA 3KQYA 5EIFA 3SMQA 2Z6UA 3DXZA 2VZ9A 2YXEA 1R74A 3A7EA 3LCVB 1OR8A 1YZHA 4PYOA 3PLAE 2HV9A 3EVEA 4UOEA 1RI5A 5HIJA 5DM4A 3LECA 4PYIA 1L1EA 1N7JA 3ELDA 3UFBA 2EG5A 4RX1A 4YV0A 1YFJA 2ESRA 1G38A 2IPXA 4M37A 1U2ZA 3BXOA 3EVFA 2PBFA 4EK9A 4HG2A 1I1NA 4EKIA 4C03A 3DULA 4JXJA 5DRTA 4E30A 1VL5A 5JUWA 5KQRA 2EJTA 1ORIA 3MERA 5LQCA
chains in the Genus database with same CATH superfamily
1SBNE 1RT9A 3IXMA 4R1NA 3T3OA 3UW3A 2LXNA 1LV7A 5T3YA 1ODLA 2I6QA 3EXFA 3H2ZA 1DQRA 1JU3A 4TKVA 1F5NA 3VKUA 1AUPA 1QYWA 1F38A 4QPPA 5K9ZA 1TYDE 3DFUA 4F9TA 1VJCA 1J8YF 3G0HA 3AVUA 2VK8A 4Q18A 4A82A 3BIWA 1F14A 4FEEA 4RNDB 1N1MA 4YJDA 2DX7A 4E1VA 3SHFA 2XZDA 1T2CA 1C9EA 1FDTA 1YZFA 2G5GX 1H4TA 1Z5UA 3AFOA 1KYXA 3BTUA 3EDOA 3AUSA 1GXSA 4L27A 1JN0A 4N48A 1PJLA 3E2PA 3FG9A 2Q1XA 3GAAA 4NCXA 4TSFA 3R7FA 4DCSA 5BSVA 5LR6A 4R0VA 1V1RA 1KI7A 2B8JA 2P2ZA 3ZX5A 2IP2A 3K9NA 1WOYA 1N9GB 1DTWA 3WBKA 2BGTA 1V16A 2D00A 3MD0A 2YBEA 2N1MA 4WH0A 3DPIA 2PXCA 4M98A 1CXZA 1ZRHA 3P0FA 2R1TA 2HPZA 4K86A 4RMHA 1J5XA 4YMGA 2V1XA 2COKA 4EBFA 4UXJA 3N7UA 5SICE 3RWBA 4ZVSA 4QZVA 2I7CA 1XK7A 4GI7A 1XVLA 2VYVD 1VLQA 4CKYA 2X4GA 5EHIA 1G2OA 3GUCA 1S3GA 4RA6A 2QTCA 4TTVA 3ZZ1A 5I8WA 4TUYB 4M0PA 3OH8A 4EGJA 5CDTA 3RVDA 2CLDX 4C0AC 4CFSA 4YMIA 3IUQA 5B58T 1D1TA 1ZL2A 2OCKA 1N0WA 5JDIA 4RAQA 4BLPA 1JAZA 4PTZA 3T99A 1XEFA 1UKYA 4EYOA 5KMGB 3P8ZA 4Q24A 4ETMA 4NRDA 3EQ6A 4RD0A 2DE0X 4Q4AB 3PGMA 4ZQHA 5FORA 2LIVA 3BKWA 1JWBB 1S7GA 5D3MB 5H81A 5LJLA 1DXQA 2E4UA 4GP9A 4J7UA 4WMLA 3OE7D 3EIQA 4HMQA 4KGDA 3BD7A 1MJNA 4NQRA 2ZYDA 3OT4A 5BV2P 1UXHA 3B3QA 1FJGB 4DCCA 1OWOA 2L19A 5FX2A 1NZFA 4P4SA 4REQA 1RVV1 4KIUA 3A0UA 2JW5A 1GNRA 4GM0A 4ONEA 5I7VA 3I2YX 5BQOA 4KNWA 5IUJC 2HCRA 4UFPA 2HSGA 4A03A 1NULA 1T13A 2J5RA 1U90A 3RTAA 2E6KA 4H6XA 2V7TA 4TXNA 5LB2A 2ALJA 3EYAA 3L6RA 4UBNA 5BSUA 3ZV5A 2R6HA 2OFWA 2GQ0A 4FIDA 3VYRB 2PZLA 1IHPA 1KO5A 3NP9A 3CRQA 3QMPA 2X4IA 2JNWA 2YWJA 3L93A 4NTZA 4DRZA 3MTDA 3S70A 4IKPA 4IR7A 2PUTA 2QI9F 4MI3A 1WU8A 4PSCA 4Y6QA 4QRDA 3DBLA 4CLEA 4TLBA 4URVR 4MVJD 4L6IA 4BUJA 4GZ5A 3E05A 2WA1A 1S3IA 2FPUA 4FUTA 1KEEA 4OSEA 1GWNA 1SK9A 3GBPA 3O3CA 4DJJA 3NBKA 3PWSA 5BNWA 5HGXA 5ALNA 4JL6A 1EH5A 3R7NA 3ROTA 1VJ1A 3ZHQA 4BBPA 4RFSA 3DWIA 4HQNA 2J33A 1PE0A 1N1DA 3RLIA 3P32A 5AWFC 4LGCA 4CMBA 2PFSA 1E32A 2A88A 1Z6AA 1E3JA 3QPBA 3TBKA 1RHJA 3G8AA 4LRTB 4Q3EA 3FUXA 1HWYA 4FCTA 5A7GA 1PT7A 3ITNA 1Y5IA 3LPMA 1SXJD 4YA6A 4KITB 2B3DA 5THQA 2PO5A 3O2QB 4WN9A 4ARIA 3RKUA 2BI7A 1X7WB 3U16A 1ULAA 1Y37A 3BFPA 4MRNA 5LBTA 3W5JA 1V8OA 3G02A 4LJ8A 4U9IS 4FYKA 4UOQA 4RY9A 3TX6A 4L74A 2HREA 4RWZA 4E2FA 4PNZA 4WTOA 3RRXA 4F9FA 1C30A 1UZMA 1PGOA 3AR7A 2B94A 3I1IA 3CNHA 2O0KA 4A2WA 5CDUA 2A7XA 3NG1A 2M2IA 3SJ7A 2D5BA 4HDOB 5JAMA 1W44A 3LFTA 1S2DA 4OA5A 3DMFA 1NT4A 4H1VA 3V4FA 2PH7A 1RS0A 1ISPA 1G1AA 2ZTLA 3I34X 4G5YA 1RJDA 1XGKA 1JPUA 2Q3BA 2QTLA 5A9SB 5BV1A 1XHLA 2CXNA 2EFHB 3P9PA 4C3UA 5CXXA 1GSIA 1J0AA 1A9QA 1J2RA 1OZAA 2HK6A 2NYUA 2VDWA 3KVVA 3OCVA 2DBZA 2Q5IA 3L7KA 4D0NA 2AFRA 4F9GA 4A0GA 2PTHA 5ALZA 4ERNA 2G70A 3VSBA 3AUYA 4PLCA 4AG5A 1Y3CE 2IOFA 3G5MA 3HGQA 4E2YA 2QX9A 1NG9A 4F4IA 5K0LA 3W2IA 4KQ2A 4YRDA 1W52X 1G18A 2C00A 3KUCA 4BWYA 2L69A 1SD1A 4OYRA 3S99A 4AZ3A 2EGHA 4BAZA 1UMKA 3BHJA 2WHYA 2UU9B 1H4SA 1B0ZA 4Z0PA 1AQNA 3RCBA 2QBYB 4IWNA 2DQYA 3AU8A 1ZH4A 3ABQB 1VI5A 1BXZA 1WSBA 5LCXA 2RONA 3GR6A 3IAS6 3QFCA 3AB8A 1A82A 2P9FA 3QYPA 4JP8A 5DCWA 4V0ME 1ZXBA 2YMLA 1KTIA 1M2VA 2OKCA 1HV8A 4ILKA 5KX5F 5DX1A 3KVOA 4P98A 1KDVA 1T6ZA 1GSHA 4EG1A 1C5KA 1JECA 1NRWA 3EXG2 3IX7A 2H1SA 4G63A 2RHOA 5FWYA 3KOWA 1C3VA 3E9RA 3TRIA 3RC8A 2FRDC 3WWYA 4CNBA 1XQYA 5CM2Z 4XR9A 1OZFA 2X7HA 5KWSA 2YKGA 1OW3B 1XTBA 4DIMA 3L82B 2X86A 3GYGA 3V4RA 1R9MA 2CXSA 2PS3A 2MCFA 1P3Y1 4G5XA 3JAWA 2Z9BA 4OBEA 4DV2B 1SXPA 3QXXA 2O57A 3A36A 4BN5A 2PKYX 2J09A 5BV8A 4AKIA 4PG6A 2VXCA 1JDTA 1T6BY 1RACA 5I9MA 5HM6A 4INOA 1SUSA 3PNLA 2VP6A 1N3IA 3WFZA 1ODKA 1IONA 1VA5A 2WYUA 4TRRA 2SKEA 3QXGA 1QF9A 5EZ5A 4DQ0A 2KBFA 1S8NA 3OZUA 4HATA 4ZXPA 4QYIA 3TI9A 2IYUA 4DY4A 3MS2A 5FBVB 2A4MA 4EW6A 4D46A 4F3NA 2VG8A 3F6PA 2C3OA 1RWXA 2V6FA 1KJNA 2KS6A 1SHZA 4LZJA 2BHSA 4HMPA 5A5GA 2OM6A 1L5LA 4S2EA 5HJ5A 4U39A 3AVXA 5SY6A 3A6DA 1VGRA 2OD7A 2VJNA 4TS3A 5BN5B 5JD5A 2OB1A 5JEEA 4C0KA 1ADFA 2P2DA 1Y8ZA 1T8PA 4RXUA 4AD8A 3VR6D 1GD1O 5HIKA 4RCZA 3UT5A 2AN4A 3U37A 4XRGA 1IVNA 4GBMA 4X20A 3TQCA 4YRZA 4P36A 4M1SA 3EXHB 3PD7A 1JIKA 3R40A 5EIOA 5JXWA 3A26A 1IZ7A 3IALA 3MB8A 2PS0A 1Z5ZA 3CQ9A 1ZHHA 4E22A 1R4NB 4XM0A 4FBGA 4MVXA 4TX1A 1ABBA 4FQ8A 1G7RA 4YRJA 2P4SA 3HKDA 3VZSA 2H2FA 2Z8YA 2CV1A 2AJ8A 1P75A 2V5UA 1PCXA 4IUBS 2C7VA 4QXMA 1S9DA 4Z4CA 3PQDA 5LYYA 3QU5A 4ZT4A 5CFLA 3ZLBA 2IOHA 2YOGA 3GT7A 5ALEA 2DEUA 1TLLA 1OXSC 3O8OA 4OIFA 1S2GA 4B3MB 2KHZA 3WQRA 5LZ2A 4UKDA 3QLVA 2V58A 1GFSA 3VR2D 4RH3A 2BJHA 1H2AS 4KW7A 2XSZD 2XXBA 3E70C 1NBIA 3E3OA 2ZJ0A 4U2DA 3M89A 4PIVA 4WXYB 1M1YA 1KFJB 1T9BA 5K4GA 3O93A 4F45A 3N58A 2XQKA 4JT4A 1SG9A 4ER7A 4KUGA 2H4FA 1J9GA 3LDHA 2AXQA 5KTTA 1O96B 1YI8A 4BUZA 5BMVA 3TKYA 2RK4A 1USUA 4HDCA 1YWGO 1OTYA 1ISIA 2G88A 2OHHA 4WZ6A 5EPOA 4UULA 1EK6A 3WTCA 2EL7A 3VPGA 1E6LA 1PBTA 2IU4A 3B1VA 1C3JA 4FYHA 3EZYA 5F77A 2CNBA 4IDDA 2JKZA 4TQUS 4HO1X 1Y3HA 3LU1A 1KHTA 1TO2E 2CL6X 4OIMA 1E5TA 3W2EA 4C06A 4EFKA 3ORQA 3HY3A 2Z58A 1YC5A 4QDOA 5E9WA 3SDBA 1NDUA 4ENWA 3B2EA 3DOIA 2P2GA 2ECKA 3E8XA 3AQIA 4GDFA 3CCBA 2FG5A 1ZDMA 2M32A 5K0CA 4QUGA 2IGBA 3VRHA 3FNFA 2TMGA 4PGFA 4Q93A 3OTWA 4RFLA 4DQXA 4RTKA 3VJKA 3HU3A 4M86A 2CFCA 2OV1A 5A3RA 5AK6A 5DT9A 2WUEA 1ZFNA 3GVIA 4L8LA 2AF4C 3AOEC 2JCXA 1J56A 3CLRD 4RQAA 3LYAA 3ESZA 2CGEA 3NDPA 5E4YA 1M75A 3LFUA 3HY6A 2QXYA 4G81A 1DBPA 1RBYA 3JYPA 4QYSA 1N5JA 1M8FA 2GJSA 2DQKA 4JFAA 4LHSA 5E6UB 3L5OA 4B8YA 2P1RA 3LBIA 4IWXA 2W2QA 4YN3A 4ETIA 4J0EA 2FH5B 3KHTA 1RBMA 3ZHXA 4G1CA 4KNYA 1BDJA 4PS0A 1FFXA 4FT2A 1E7MA 4HUQA 5LMCA 4ICIA 4NPCA 4FWBA 3G0BA 4J6FA 4EAQA 3IP1A 1SZCA 3GGDA 3F4KA 3ESRA 4CQLA 4YYZA 2CBZA 1V25A 4IZHA 5H70A 2AR7A 3SBXA 1LSSA 3A3NA 4IQGA 4F7DA 4RKEA 1V43A 2W58A 2QSYA 3CLSD 1MH9A 3KHKA 2BH9A 2P9HA 3IEKA 3CLHA 2D54A 4UW9A 1CZNA 3KK0A 3PQ5A 2JLBA 4JL5A 2DKNA 5ICGA 5IJ0A 4P33A 5IEJA 2BMWA 3S55A 4IV0A 5C9ZA 4IIXA 3HVKA 4AZ0A 2ZPTX 3C85A 4W7HA 4YT4A 3KB6A 5CA1A 2JCYA 2PEZA 1VKHA 3NIGB 3U0BA 5KPDA 4C01A 3D64A 5HSGA 1N2IA 5BR8B 2VSOA 2DCUA 2W6NA 4YJ3F 3RRBA 2AOUA 4IH1A 4Y2HA 4B75A 3QOYA 2O0LA 2VNJA 4CMEC 2I8CA 5THKA 5JPCA 4DIKA 4GIBA 5CM9C 4M8NE 1QV6A 1WNTA 1YL7A 2G9UA 3HCOA 4TWAA 3RNLA 1K88A 3VZPA 4DCTA 4EENA 4ZEVA 5KYWB 1XZHA 1EM6A 2OMEA 4JQOA 3W5DA 1KHHA 5LKAA 1Z82A 1IUPA 2QVYX 1M10A 2Y93A 2LD4A 5CLIA 1I80A 3GZJA 4MIKA 3DD5A 4RMGA 3PE3A 3TFQA 4LXGA 5HPYB 4Y2JA 2P9YA 1NBOA 4CLXA 1ZUNA 5DX8A 1W34A 5CYOA 4YP6A 2CJFA 2WFLB 5EIAA 2EBWA 1SCJA 3ICOA 4RJIA 4D8YA 2ZPAA 1PFQA 2UZ0A 2HA5A 4DM7A 3MWLA 4E5DA 1FP4A 1PNOA 3WIVA 1LSUA 4QTXA 1KVTA 1I5RA 4MQFB 2BTQA 1W5EA 3AP1A 4HFJA 2ZIZA 4JCOA 5IF9A 4ILEA 2PL3A 3A4YA 3QY9A 2Q2WA 2R9VA 1WU7A 2N47A 2VEDA 2XDAA 4GI1A 4KQWA 3G2OA 1I3NA 4BFXA 4M54A 1Q50A 2ZSEA 3RT9A 3T7RA 4YEDA 3IHTA 4QM7A 2ORED 2ZJ7A 1KI9A 4DB2A 3ZWKA 1IBRA 1TIBA 2UZIR 2RHHA 3K8OE 3LDFA 4HTFB 3CZAA 3LC2O 3V1LA 4Z4IA 2Q5QA 1HRDA 1MIOB 4Z1OA 2PX3A 3AERB 2G5TA 3QKRB 4IFTA 1G7SA 4XTRA 3KQLA 4RZ2A 5BT8A 2JBAB 4B8ZA 1BWSA 2GF0A 1Z9BA 1B43A 3EMDA 5GINE 2Q45A 2C77A 3P9XA 2IEYA 2POCA 3PHCA 3VC1A 1YXMA 3UMCA 2ACKA 3AF6A 2IBSA 4M9SA 3L04A 2R96A 2Y0BA 4N7JA 3EGDB 2DETA 4XH9B 4N82A 4WY8A 1QCYA 1WQ3A 2RH9B 1MEJA 3V4OA 4BQFA 4EQ6B 3H0EA 1LVGA 1MMFB 3LLCA 3LY7A 3ORRA 4ZANA 3V7NA 4AJ2A 3TECE 9ABPA 1CUEA 3AYXB 3RRMA 3LSYA 1Y89A 5L8VA 4N3GA 2PAAA 2JJ2A 2RGDA 3UHJA 5C7OO 4YFVA 2XLBA 5ED0A 3B12A 1VG9B 1CQIA 3RUEA 3N0VA 2AEJA 5AW0A 4NOLA 2BDEA 2A3RA 3A7EA 2IKSA 2NZ8A 3P0IA 3PG5A 5A5FA 4TXMA 5H9WA 3OOSA 1CP2A 4TMFA 2JANA 2Y9MB 4TWZA 2QV0A 3S7ZA 1VJTA 2GAJA 3UCEA 3AOEA 3LK7A 4OXYA 1QG2A 4LVCA 4D44A 3ZTYA 2WNHA 1L1EA 4XX1A 1RW4A 1MJGM 4YV0A 1ULUA 4L4UA 2NX2A 4RVSA 5I7OA 3JAKB 4B9AA 4BMPB 3ADOA 5CFRA 4I1YA 2IHJA 3RI3A 1B16A 3L0YA 4YH1A 4J2HA 4RV5A 3DF9A 3AO0B 4J0DA 4P3OA 2RAPA 1T36B 1SWVA 3SYRA 2LUOA 4NYJQ 1EGAA 5IT4A 4IHJB 3THWB 4P2GA 3SHTA 2JS7A 1XQVA 2BZ0A 2D5CA 4RY2A 4W4TA 3RFCA 4A5SA 1XNRB 5ESXA 5B7QA 2JVJA 3H8JA 3C3XA 2XF8A 3AM5A 5HRCA 3ERCA 4U2BA 1ODSA 4CV3A 3OHPA 4R40A 5CM8B 2C7QA 1LBQA 1N5DA 1NAIA 3CLVA 3D6NB 3DKKA 4HGOA 4MW1A 2DG2A 4Q12A 5JO0A 4B0PA 2V1UA 3ICQB 1HDEA 2QE7D 3H6GA 2CDRA 3GLIB 2X0IA 3R6LA 4N5DA 3ML1A 1VYVA 1R88A 2RG1A 2P9GA 2K4MA 4G6ZA 4CR7A 3C4QA 2X5KO 4ROSA 2ZJ2A 2FFJA 5IANA 1ZEJA 3HACA 4KYVA 2HNBA 2QOEA 4YAGA 1VLMA 4IYRA 4EA9A 2YZ2A 4RY8A 1JDBB 4M22A 2FEXA 3K5IA 3DMNA 3SVLA 3VX3A 1CEEA 4JBLA 1QQ7A 2IS2A 2DT5A 3WGNA 4OV6B 3D8RA 4PYQA 2Y6VA 4CCYA 2W70A 3C7DB 1JWAB 3NUZA 2D0PB 3TD2A 3OZVA 3DMHA 2JAQA 3GAZA 4MZXA 4MVJI 4U2KA 3DKPA 2IQ5A 3L8EA 3L7JA 4DL9A 3OU6A 2OCIA 2R4TA 4D3SA 1KAOA 2RGEA 4Z4HA 3N2KB 3ZU5A 5LD2B 2O8EB 1Q0LA 1QIDA 2GEDA 2FUG6 2WZCA 1OXMA 2I6UA 5FBHA 1WM1A 2IXTA 4JJ4A 4NMLA 3RE1A 3NHBA 4MEJA 2P8JA 1HT0A 3LXRA 4H6WA 3CVJA 4O4JB 3WGMA 1CS4C 4V0RA 1XZGA 3II6X 5EVCA 4PTYA 4B4WA 2OAP1 2VP2A 4UM8B 5IH7A 2VRBA 3Q2KA 3L6CA 2O8CB 1BXRA 1T9AA 1ZK4A 3A10A 3BH0A 4CQJA 4LGYA 1CVRA 3S40A 3LG2A 4X3PA 4XE5A 3ZCRA 2I6SA 3QLJA 4B5LA 2PKWA 3ANXA 3KPWA 1IIBA 2RMKA 2IW3A 2WINI 1JGTA 2DFPA 3ZHBA 4A91A 4CZ2A 4PNHA 5KBYA 1XTKA 1ZLXA 1PT8A 1Z2CA 2C2YA 2XMBA 3C7CB 3OP1A 1ISMA 4HAXA 4EG5A 3CWCA 3KTFA 1PG0A 3RFFA 3CIFA 4TTQA 4YUXA 1QDEA 1P80A 2ID4A 2UUAB 4X0EA 3HJFA 3HO1A 1P0IA 5IBPA 2B82A 1HQYE 3R0XA 2PL9A 3RABA 4H18A 2OCPA 3C7KA 4UBOA 2B4YA 1EHYA 2O1SA 5IRCD 2XXAB 1CBUA 3G9ZA 1XRMA 5C4IA 2X1MA 1OLSA 1YA8A 1AGRA 4MDHA 4BNDB 2IY9A 1MPTA 3U49A 4M6WB 2NZYA 4YUAA 1W85A 3O26A 3OO1A 5LDDC 4WQMA 2DPGA 4I1OA 4NU0A 4OI2A 1FLDA 1ND5A 3EY9A 5ER9A 1QVVA 2D7JA 1U0RA 1CR0A 4JN6B 5CNMA 3TYXA 1AURA 1PU2A 1EA7A 2BF7A 4GOKA 4P3PA 5EIEA 2BI8A 2QTBA 1R37A 3KQQA 4CL2A 3JRNA 5LQMA 3BPSA 2R65A 1ZI9A 2XGMA 3HBMA 2GAOA 1GNLA 2H5EA 1KYQA 1THZA 2HXGA 3I61A 4UM9D 3X1XA 3UJBA 2FAXA 2YJZA 5HCUA 5KVQA 1V8PA 1X86B 1LX6A 1NG1A 1JJ7A 3DGEC 2HA4A 1U3FA 4NWIA 4EL0A 1HH4A 3VO2A 4JXZA 4CKCB 1SXQA 1PVDA 5FL7A 1FDSA 3DHNA 1YT5A 1SB8A 2ZRAA 4GOJA 1GR1A 2FPPB 2W22A 3AI2A 4RK0A 1OGIA 4O2AB 1N2CE 4HB0A 4EOGA 3LKDA 4MHTA 1SUEA 1VLVA 1ZK1A 1QGYA 3LT2A 2R00A 2R4UA 4RVCA 4FW9A 1KQGA 4TSRA 3GZNA 4KPYA 4GSLA 4JIMA 3BCHA 1SUAA 1WHTA 1GLGA 1YIDA 2IYZA 1GL9B 2OZVA 2P4EA 2VHTA 2RHJA 3LOPA 4EDFA 4EUHA 2RGRA 4CIVA 2HFKA 2BEWA 2DQZA 3C74A 4X8OA 4HRXA 5LA6F 2JEOA 1V3TA 2CVHA 2JVKA 1JQ5A 4MS3B 5CYPA 5F2EA 1E4EA 5GIPE 1X7YB 3RAEC 4DR6B 2AJLI 2IHVA 4JKIA 4R0NA 1NP6A 5SYNA 3WV4A 2Z6QA 2OGSA 2X8BA 3D0OA 4NZOA 1RFGE 4ZAGA 1VB3A 2GERA 3TDKA 1T0JB 4I5EA 2JIOA 1E9CA 3H4TA 4BLVA 3DZGA 2XNDA 2BEVA 2XOXA 4YJGB 3CX6A 3ZN2A 1J49A 4IGEA 5JMWA 4G0VA 5AW4A 3ZJ5A 4PLWA 3VH2A 4S1OA 4EW3A 1J8MF 4B4KA 4QO8A 5CXUA 2HSDA 3KWJA 2C5HA 2HH9A 2RAVA 3NHUA 4HC4A 1XU7A 3WAGA 4F60A 5GONF 2CNDA 1U0OC 4NATA 4H60A 1E2QA 4IOMA 2LR0A 1JG4A 2GWRA 4C0XA 2Z5GA 2P4QA 5ARBA 4ZYYA 1FNMA 1CQJB 2XITA 1DBRA 3CX8A 2D06A 5KJ1A 2W2LA 3RTEA 1GA4A 5A62A 3GD7A 3N2NA 1JSRA 1M34B 4A8JB 4CN9A 1KZYC 4U02A 2WSIA 5DP2A 2AG5A 2HU2A 2O05A 1SKBA 3QZUA 4P1ZA 4Q4DA 4B3CA 4HB4A 4MAFA 1PR6A 3O8BA 1NFFA 4K26A 3JD4A 1L4KA 1JFFA 1WLSA 1Y4UA 2QRVB 3RSHA 3GARA 3PD1A 4OKNA 4WZAB 5BN3B 4BMXA 4BGDA 4HX9A 1P29A 4P32A 3KL2A 3TBFA 2ZT5A 3LK6A 4IIUA 2HHLA 3KSRA 3C5CA 3JQ6A 1MJGA 1ZD4A 4BIIA 1K5DA 3ZH2A 2IX3A 1FYWA 4WBNA 3BGSA 2HUNA 2EV9A 2PZFA 3OBBA 1LNZA 4J7XA 1C1DA 4J07A 3IAUA 3UJ3X 1IEQA 1IHYA 4NCBA 2HF9A 3PYMA 3OPVA 5T3UA 1XTQA 1GKIA 2VFAA 2VBIA 4J9VA 2HSEA 2EXXA 1MPXA 2WNIA 3DDNA 3L0IB 4NI5A 3RHTA 3ZD9A 3VNUA 621PA 1F2UB 3ZIAA 4DM3A 3HVJA 4LDJA 1QCCA 4A6PA 4EY8A 1NP7A 1T0BA 3F5FA 2BC9A 5GOTA 2I65A 4AWBA 4EKYA 4PX2A 4KZPA 4Z4FA 2I3ZA 1LBTA 1FFCA 2DHCA 1WOMA 3CPHA 4J4TA 1BXGA 3QEOA 1JR2A 2WTNA 2ODBA 3DPUA 4HNAA 2NZ2A 1ESEA 3P45A 3W2FA 1BOOA 4Q3CA 2DHQA 4XIGS 4J43A 1DZ3A 2CMKA 3FF1A 4PRZA 3R7DA 4KVAA 2YW9A 5E95A 4B3TB 4ZOQI 1YVEI 1P1KA 3RKRA 1D7AA 5KYXB 2R8YA 1C1YA 3AW8A 4V1CA 3G13A 5EZSA 5E6RA 4JVMA 4YRSA 2G76A 1IK6A 4TUYF 3UT6A 2C9CA 5F23A 3BQNB 4M1ZA 4CBVA 1KH3A 1YZQA 2O5VA 2ZXFA 1SUWA 3QWHA 4TVKA 1G64A 2Z57A 5HKOA 2ZJ8A 2WG1A 3VKFA 1VBFA 2Y27A 1AB5A 2VH1A 5FNVB 3F4LA 4YMSA 1OQAA 4RA9B 1TZBA 4LKRA 3MXTA 2ADMA 1M0SA 3OCCA 2ACEA 3FCUB 2DKFA 4CKWA 1N2EA 4LZLA 3O3OB 5IVDA 3EFOB 3SPXA 4B34A 5M5BA 1JQLB 2C8LA 1XKQA 2YNMA 3T1VA 1QV9A 2F8MA 3LO8A 1JVBA 1R8XA 2ZIXA 5HHTA 1UBFA 1Z13A 1DADA 3HKEB 3V4VB 5AJTA 1EHIA 4PIPA 4QOSA 5JIBA 4L8VA 4LYJA 4NG5A 2W6JD 3G0CA 4MPPA 3B6IA 4PF1A 3NAZA 4XR4A 3BBLA 5C7IO 4FZVA 4KBFA 2JD2A 5GAJA 4O63O 5J4KA 1DCTA 3OFNA 4DT1B 1Y8CA 2XTAA 4OQDA 5JAHA 1QLWA 4JJEA 3SKXA 2EP8A 1OLUA 2J0VA 2DTEA 4MKIA 3PTAA 3FUWA 4N0QA 1HDRA 4YP7A 4UVHA 3K6SA 2JI7A 2B8TA 3GEIA 4GHWA 3VHXA 3MB5A 4URFA 3ZY3A 5F35A 4F2GA 2GCPA 4PO8A 4DMGA 3O4IA 3HCDA 1UPXA 3DV9A 4DJFC 1UEXC 5SZKB 3IIIA 1L5KA 4CIXA 1P0CA 2FFQA 4KO3S 1PDWA 2Z5VA 3Q7IA 4FDUA 4NU8X 5JVDB 3VI3B 4DIUA 4F86A 1DQNA 1QCDA 3THYB 1E3WA 3RYHB 3M6VA 1A2KC 5LP1A 1AKRA 3EJWA 1U8CB 1VECA 4OSOA 5IH3A 2AT1A 3WLSA 1GZ7A 1PJ3A 4G5HA 4NBNA 1QJ4A 5GM2A 3TPFA 5C53B 2G4VA 4JKOA 1KYTA 1UMBB 5EZYB 2QL9A 1VZ3A 2QX4A 5HF6A 5KWJA 1JPNA 1C81A 2C2HA 3C3WA 3CWQA 3CX3A 4KO2S 4UZEA 4QARA 3I83A 5ALWA 5EE3A 1E6WA 3X1WA 2PQ2A 1GVHA 5JLAA 4PGMA 4CR8A 1IYZA 5ICCA 2P35A 1OB5A 4BDTA 4LISA 2C2WA 2XOKD 1YO6A 4FHZA 3DOCA 4HF7A 4HI0E 3ZTWA 1IZ9A 2BMAA 3DNFA 5IPFA 3UYKA 2XCRB 5CNIA 2RB4A 3QMWA 2AYZA 5B3KA 1JIVA 2G6BA 1NE2A 3QVXA 1EUCB 4NS4A 5HK8A 5TF0A 3BDAA 2DC1A 2ZATA 2RE8A 3FPKA 1F20A 2DMRA 3SYLA 1A7UA 1D4AA 1M2NA 1LF0A 2OHVA 4EP1A 2XCIA 1RLJA 2RB5A 4RLHA 4WK2B 3PT5A 2OESA 1YS9A 4LWQA 4LE1A 3KSDO 4YMUA 1D6NA 3VJMA 2VJKA 3BWBA 5AVVA 1AJEA 2H00A 5C4GB 1OT5A 1RWWA 1Z68A 3K1JA 4UTZA 2PUJA 3GYBA 5AJVB 2FEOA 4DIOA 1JZTA 2F1JA 4QLOA 3TR0A 4MIOA 1A8QA 2NZXA 1Z2AA 3L43A 3VV3A 2Q6IA 4W1SA 4IIVA 3RSSA 4BNHA 1XMOB 1I36A 3L5KA 4E07A 4QM6A 1G8PA 3L41A 3L7YA 4K46A 1CE8A 2ODAA 3CISA 3CY6A 4RESA 1BYUA 1NURA 4BNMA 2JIBA 1SBIA 3KFLA 4NFYA 1OFGA 1EK5A 4RSMA 1H65A 1FOEB 4EBBA 4L5AA 5G2OA 4Y98A 4I6EA 3TIFA 4F21A 1RC0A 1O77A 5AXAA 2RH4A 1PJCA 2WAYA 4FBMA 3CV3A 3F3YA 3OOEA 3RTBA 3ZK7A 3T3DA 4DZRA 4NXNB 3BD9A 1SVOA 2FUEA 3WE7A 2P91A 1U9IC 4JI0B 1JBEA 1O94C 4UUBA 5DYYA 1VKOA 3R5HA 5CW2A 421PA 5HQTA 1VIDA 4J75A 1CW2B 3KZCA 5T4HA 2HLHA 4EB6B 2IXFA 1ULTA 3LRPA 4MULA 3PC8C 1P1IA 4NBLA 2FG6C 2ZYWX 3QUBA 4EX7A 1YZNA 2OO7A 3EASA 1Z39A 2W2MA 4NZPA 4UHBA 3DZBA 4ZEXA 2P40A 2UUBB 3ZWPA 4YR7A 4QRHA 3PDIB 5CXSA 4HQFA 4M8SA 1FMLA 1LSOA 4NCKA 4C7JA 3V1MA 1MOSA 2XBLA 4DGSA 3E9CA 4MMYB 1I51A 2NNWB 4MQEB 3BGIA 1AK1A 1L5SA 4C4XA 2GCNA 3EQ7A 2Q5CA 2ZU0C 3ZGVA 1X1SA 3KTOA 1C14A 3R6WA 3HI6A 5KEIA 1KFKB 1W5FA 4XGQA 3AP2A 5BWCA 1LX7A 3AR4A 3Q7RA 3N3AC 4BBJA 3TRHA 1GPUA 1T5OA 1W88A 2IZ5A 4BS9A 2EJWA 4CUZA 3EGWA 1XL0A 3DTYA 3C5VA 3T1OA 4UHDA 4LJYA 3TJRA 3A4IA 4G1FA 3W7VA 2DXIA 3K9GA 1A4RA 3FTPA 3L84A 4R2LA 1Z74A 2DLDA 4BXOA 4GL4A 3O5AA 2W8ZA 1BDBA 3R1IA 1C0LA 3R9IA 2ZSBA 3F6EX 1HEIA 4OYLA 3PXGA 3SHQA 3GMTA 5U4QA 1UPCA 2FVYA 5F2KA 3PE6A 1XZEA 4UNRA 4DMLA 1TM7E 3AILA 1FU8A 2QUZA 3SGLA 2Y3IA 2GZAA 1H94A 4GZMA 1VLHA 4UDNA 3SS8A 4AUMA 3P26A 1SELA 4V0NA 5DYNA 5AVYA 5C8YA 4Q4CA 2SHKA 2YFHA 3TZCA 4V0MA 5HTKA 2DBVO 1UBRS 3H2IA 3PC6A 5FH9A 1UXIA 1FTYA 3DLAA 2EBUA 3MWEB 3SC3A 5J2UB 2J6CA 4RDIA 3SVTA 4HUTA 3ZH9B 4RZQA 3OZFA 2W6PA 1T8TA 2YL2A 1JIXA 2GVNA 2FA9A 2DUWA 3N86A 5EN4A 3PCTA 1EFHA 4URHA 4GI5A 2G4CA 4GW3A 2WJYA 2OECA 2ZUUA 3VPXA 3KT6A 2I2BA 4MB6A 4CEHA 5DN9A 1ORIA 2BRUA 4F96A 3NWEA 1CRWG 1FPQA 1W4BA 1XQ1A 2ZYUX 1MJ5A 1K0FA 3EZNA 4FGLA 2XEXA 2C3UA 3RWMB 1UP7A 4DC1A 2GXUA 1H2EA 4BVJA 4S3MA 4BP9A 3M6MD 3AFGA 5CX1A 4UREA 5JJ5A 3WHLA 2FDRA 1ZL0A 2J32A 3QIVA 1VE6A 5ALFA 4FYXA 3UOAB 4CU2A 3SZLA 3UKDA 2X19A 2Z30A 3ZDXB 3H5IA 4PG4A 3WMFA 2JFYA 4ARVA 1VKNA 2JVIA 3V2GA 5JY1A 1CUDA 3HPQA 3GRRA 3EGVA 2Q5HA 3KJEA 5JQGB 2AEMA 5DBIA 5CW1A 4GYKA 3V8QA 2I1QA 1JE0A 2IUYA 5DB4A 4NV3A 1U0EA 1V2HE 1NV9A 1EQ2A 3IQIX 2MJLA 4A7PA 3R23A 2Q1SA 1M1NB 2NU6A 5A3SA 1L7NA 4JUIA 5AD1A 3CKKA 3A1TA 1SHKA 2XVMA 3JPYA 1A8IA 4EATA 5JG7A 1U9IA 2MYTA 4MQ6A 4QUAA 3H9UA 5EXXA 3B2NA 5KWIA 4ZOCA 1ESNA 4IOJA 4BFYA 1LKZA 2PL5A 4DLNA 4S1TA 2FKNA 1UBHS 2J30A 1JJAA 4YLEA 1P0MA 1MDBA 3PC8A 4PGAA 5CA0A 3S5UA 4ODIA 4H2DA 2YJ3A 4K40A 4B4UA 1Z4IA 3IAHA 5AUNB 4QFDA 5JU6A 1FX0A 1VE7A 1X1RA 2PY6A 2ZVJA 4KQHA 4KTVE 4OKIA 2JFWA 2O3JA 3B85A 5CFQA 2WNSA 2W6QA 1LVHA 1JPJA 1SKYE 1VYUA 2CLCX 2XRYA 3BD6A 4V0OA 3RS3A 3SOZA 1HNNA 3TIIA 4BJHB 3W6OA 1XQ6A 2NAPA 1GGFA 3NZEA 2YUIA 4BFVA 2G1JA 2W0MA 1Y8AA 3UKJA 3ZE2B 1R18A 5FQNA 1B8OA 1ZZGA 3L8DA 1JSXA 3RAFC 3LDAA 3K0SA 1CZKA 5DWVA 3WLFA 4W9NA 1ID8A 4R1TA 1M2KA 3FN4A 1RWQA 1SRRA 2PR2A 4XCXA 2SNIE 3RYIB 1PR2A 1JX6A 1SCQA 4Z3DA 4D3FA 2BFMA 4A0QA 2UUPA 2WABA 2OXFA 5DH9A 5IVPA 3GLFB 4QDTA 1Z6TA 4CKEB 1MA0A 5AFSA 5C8ZA 4CWAA 4MYTA 2LIPA 2WIFA 4LFAB 2ZE7A 5FOVA 5PGMA 3TSWA 1YRAA 4Q1CA 2H07A 1VI6A 2PM8A 3EF1A 2QJWA 5FEUA 1KDTA 4MW2A 5DV9A 2I8LA 5JMPA 2B4QA 2ZJYA 3OC0A 1GFZA 1Z7YA 2A1TR 3DOOA 3DVSX 3E8SA 1ZNZA 1ONOA 3IB6A 4Q0MA 2AMVA 3DHVA 1OFVA 3SMVA 4FOSA 3QM1A 4P2BA 4DJDC 1Z33A 4WUTA 3Q1KA 1WXHA 2Q2VA 3OG9A 3TQIA 2NIPA 3CO0S 5I8ZA 4BGIA 1JR4A 4JI8B 4C07A 4M7OA 4CM4B 4QVIA 4UQPA 4MLCA 1F3OA 1NVFA 3PB3A 2AUNA 2IYEA 3BOSA 2INGX 4XQ0A 4NNJA 2D2FA 4BLWA 1LS1A 1E1RA 5BQFA 1ADYA 4FN5A 4CDRA 4HV4A 2O3RA 4UD6A 2OAQ1 3WK6A 5K0ZA 3FYSA 3TOCA 3U40A 2VQFB 3DB1A 3E5RA 2DPHA 1CY7A 3GJ0A 1NUUA 1XDUA 2HFJA 3Q9NA 4V0SA 1ZJWA 2FDXA 2DLCX 4DMRA 3SQLA 2B69A 4Z9YA 3ZKWA 3FJOA 4ZICA 2CLEB 4QOGA 2A57A 3V4LA 2PTGA 3BMNB 1NPYA 3OM9A 1DC5A 2OE2A 2Q9BA 4BE4A 4WD3A 1GKLA 3SX2A 5JAUA 2P2YA 1J2TA 5K6TA 2V03A 1Z7GA 5I9TA 1ZIPA 1EX9A 2QRUA 4KFTA 4URXR 3HCBA 5FTKA 1RWPA 4YT2A 1LUAA 4IMIB 1AA6A 4HH4A 2C58A 1OKKA 4JI4B 4WFKA 2Z5FA 4FE3A 5B2EA 3DT8A 2ZBVA 5C8XA 1OIXA 4FHGA 3VSEA 3EXIA 2B37A 2ZWVA 4YI3A 3JQFC 3TI7A 2HWWA 4ND6A 2VQ6A 3KCQA 5J4LA 4A15A 5ABPA 3SNKA 2VT2A 4FWIB 4IXWA 1WUIS 2R5FA 3L8ZA 4RTNA 2VDJA 1EVZA 3NORA 4P58A 2B8NA 3NYRA 4KLCA 2OCAA 3WQSB 3FDZB 4E5PA 3ORFA 2O8FA 3Q10A 1GDDA 4R6XA 1XRLA 1WCXA 4Z8YA 4BX8A 2VDRB 2VZLA 3BBPA 1TD1A 2NU9B 4AJJA 1ZA2A 2GMWA 1JLLB 3CBQA 3IBFA 3K0EA 3HN7A 4RORA 4TVBA 4Y18A 1RYZA 3VPHA 3WWCA 5I4CA 3GQVA 4LOJA 1M8GA 2WMOB 1QZUA 1GUAA 3H5LA 5GY7A 1STOA 2BBTA 2I03A 1EFRA 2VBFA 3EODA 4I36A 4P6VF 2RIPA 3IDOA 4HXEB 5A4JA 4ZVOA 5KYYA 3HU1A 1XTPA 1OFUA 1HMYA 3C3CA 3KU1A 1KE2A 4Q1VA 1S96A 2NXCA 3TXAA 3RSZA 4JJFA 1HA3A 3VFDA 1WSWA 5L3VA 4LFBB 1YVPA 1NF2A 3OCYA 4RAOA 4LY9A 5LZ9A 1SFRA 3DL4A 2KLBA 4IHJF 1OTXA 1FS5A 1FP7A 1N9ZA 3PJFA 1W35A 4UCXA 4UCQA 5LM3A 4CEIB 3WLQA 4D0RA 5JSZA 4R5MA 4XYBA 3T3NA 2ODTX 3OU7A 3I8XA 2WW8A 4MUIA 4XX0B 4GH5A 1P72A 1SZPA 1WVIA 4PWZA 5KJFA 1UUFA 4C4PA 1YASA 3GPCA 1YJCA 5CITA 3GDGA 2E82A 2FQ1A 4XB1A 4CPDA 3ZGZA 1ND6A 1XCJA 2C5FA 5C1IA 2HDHA 1U4OA 4EDHA 4FGUA 4BFTA 1MGPA 1U28C 1NKSA 3V4SA 4K5QA 5CCXA 1XPOA 1XMVA 4M0KA 3GOQA 1BHSA 2B6NA 1DBSA 2QI9C 2E55A 2DBRA 2OWDA 2W6ID 4AYXA 3CPEA 3LUCA 1NUQA 2AZXA 3G2NA 2C96A 4EGSA 1Y7LA 1U98A 2ZPUA 2Y71A 3DDHA 4E5UA 4JLAA 1G3RA 3FOFC 4QDZA 4FONA 3WIOA 3BSYA 2Z2YA 2NUTB 3K0FA 2JGRA 3VPSA 1U65A 3B20A 4F2HA 4XVQA 1YMQA 4FWTA 1HE8B 4MUKA 4ZAXA 4A2CA 1X8KA 2YVKA 4QAQA 2QTVB 4UATA 1MX1A 3P9NA 1TPYA 1XTZA 3S2SA 4C6TB 4CYMA 4ZDWA 4CV2A 3H9GA 2JAOA 3I6BA 4XA8A 4K6OA 3MJHA 3BXEA 2IYXA 1ULHA 1RVDA 4NENB 1X9IA 2NQTA 4GI3A 4MEBA 4O4JF 1XQWA 3NCTA 1I7DA 3LZDA 1JQBA 3QE3A 2X0DA 2G04A 2QRNA 5HNKA 3EGEA 3EVTA 2IPOA 4AK9A 4RD3A 5K0TA 1LU9A 1ZAYA 1CDEA 1XZ8A 4CUKA 4EG3A 1N9KA 5L7TA 3IHKA 1PK8A 5K45A 2RGXA 2VF2A 3ZIUA 1NVTA 3USES 1SC9A 2XE8A 5GIOE 4JEHA 4ZVNA 1GQOA 1CYDA 4C0WA 4D41A 8GPBA 1DMRA 3CW2A 4GC9A 1VL1A 4KVFA 1A72A 4BGEA 1HG0A 3ADDA 1RCFA 1UWCA 3DLTA 3ELWA 1QXSA 3B3GA 3H5WA 1JHUA 2X1LA 1V45E 2H4HA 3OY7A 1DE0A 3LDGA 2BMVA 1N7GA 1FFSA 2JGDB 3EDRA 3GP3A 3EZ7A 4HLCA 4HVTA 5I9SA 4CW7A 1MBZA 3WX0A 2HXYA 3RVKA 3VSCA 2A9FA 2YYZA 3D1JA 1WRBA 4MIYA 4EUEA 3CVXA 2BFWA 3DG9A 1FNDA 1OZHA 1PWHA 3KV1A 2AQHA 3OCJA 3LT0A 1BA3A 4CLRA 2AUTA 1O97D 2FMFA 1DC6A 4U7HA 5FB3A 4B6GA 2HRRA 4GX2A 3CH7A 3N8KA 2P5YA 3HB4X 1UT6A 2OUIA 3G6KA 4OP1A 5E1MA 4HAIA 2YWHA 3IKMB 3DE0X 3A1NA 1D0SA 4WGGA 1OX6A 2V9CA 1HZJA 1GAXA 1R00A 5DHRA 4ZVRA 2ZYVX 4IIHA 3ZE7A 4NMXB 1U7OA 1G9SA 4J1TC 1ETUA 3SM3A 2AQIA 2Q50A 3DNMA 1A5SB 1IOVA 2IHBA 3BS4A 4UARA 4MW7A 3AVQA 1LDYA 2QHXA 2ASEA 1DJLA 3UOWA 2ID7A 5FTMA 1KDYA 2FV8A 1O0SA 2WQZA 4RETA 4XD2A 4YCDA 3TIXB 4HBZA 1JFSA 2G80A 3DOJA 4LHYA 3DYBA 3RSLA 2C95A 3EQ9A 4QXQA 5JO9A 1CUXA 3FTFA 3BFXA 2EIHA 3FIUA 1ODTC 2GPAA 2ARKA 1XD9A 3I8OA 5IUKC 5BVHB 5JZ9A 4CEJA 4O2AF 2IXBA 3FNEA 1POXA 4GLBA 2X41A 4QYXA 1N2HA 4WX2B 2EDAA 1SK8A 4IY1A 1KMCA 3TRFA 3MM4A 4M60A 2VHYA 3MYYA 4KQMA 3G3EA 3M9XA 3V3KA 1PNRA 1NXPA 1MB9A 2PV0A 4LRUA 5E1BA 4ZVUA 4W7SA 3VNBA 4DC0A 3DP9A 3GELA 3L8GA 3KTAB 2W71A 4RWEA 4KMRA 2OQRA 4BZZA 4L08A 4TQAA 2R47A 3LGSA 1Z7BA 4LJ6A 1Z28A 2RKBA 4EG4A 4YMLA 2OD2A 2AV6A 2CNWA 5FL3A 1F8FA 4OX9Y 5HCIA 4EZEA 5F7ZA 3E5MA 4GG1A 2IA5A 1IQPA 2P78A 3NEJA 3Q7PA 4DC9A 4DPKA 2AIRA 2EX1A 1EGVB 2F90A 3EGIA 1U28A 2VZEA 3U3OA 3SF0A 1WX1A 2E6UX 2J6HA 3EXFB 1KC1A 4KSYA 3BSWA 1PJSA 1UQRA 2VIIA 4LMPA 3FB4A 3KOXA 2FOXA 4R8MA 1O6CA 4RFVA 2L2QA 1YU6A 1M7GA 3OJOA 4RMJA 5JSKA 4YPVA 4X7PA 3J80A 3THSA 1MG5A 3NHYA 1YB4A 1XEXA 4FLEA 3NM5A 3WICA 3UMYA 1QQ5A 1X7ZB 4MGEA 2ENWA 1WJGA 4FB5A 1PHRA 1E7YA 1WXGA 3AUAA 3S68A 1GXSB 4NARA 3PEWA 5JJLA 3NX4A 1YQQA 3ZHOA 1QWOA 3DDWA 4F12A 3MOSA 1OYYA 2Z9CA 4I4LA 1ADCA 2EJCA 1ONPA 1X1EA 4C3VA 4HCJA 2FEKA 4F3CA 1DTWB 4JX8A 1EXDA 1EE1A 2I2DA 2BZSA 1I2DA 1M9NA 1V16B 2OB2A 3HZOA 4RBNA 3NBFA 1J0BA 3P2OA 2GRUA 4K05A 1PR1A 4PHCA 1G8JA 3NTRA 2R1TB 4PZZA 3RBVA 4YXWA 3AF0A 3I9OA 1GILA 2DHEA 2ISCA 2W48A 2ZRIA 4WRRA 1Y63A 2ZVQX 5CIQA 5KAMA 3N59A 2NN3C 4G25A 2IYNA 1P7VA 2Z3ZA 4JP3A 1NVMB 1WZNA 3RK1A 1W2HA 4RA6B 3N0WA 1P2TA 4YUWA 3OMWA 2WJAA 3HABA 1NATA 3GFGA 3A9TA 3FE2A 2G28A 4NAVA 4BMOB 5CFMA 4MWOA 3UJHA 2XAAA 2Y1OA 1N2CA 4FJ0A 1WG8A 3CN7A 3WHKA 2GFHA 2K87A 3QTTA 3HS3A 1G3IA 4JT9A 4HGQA 5DX0A 1SRQA 4TTSA 1ZGCA 4YRLA 5C3MA 1TF2A 1KVQA 3HCRA 4I8DA 5ILQA 4O29A 1QTQA 1N78A 4Y2TA 4WINA 5TPZA 3U4HA 5FUMA 2IRWA 3TZQA 5KNCH 1A8PA 4RHUA 3X1YA 1Z26A 2BYTA 1R0SA 3QNMA 2I3BA 4OBXA 2POQX 4UE3S 3B3FA 4L9WA 1AMUA 4KJZA 3GXBA 5CDGA 4R8KA 1FXUA 4R16A 4G0QA 4REQB 1JFVA 5K1ZA 1ELOA 1PYOA 4MWGA 4OMUA 3UJCA 4TTRA 3S81A 1W36D 4R1UA 1G1MA 1C7IA 1NJ1A 2PJRA 1T0IA 1UM8A 3HYNA 3IAXA 1KVSA 3PC4A 1X92A 1XAJA 3QG1A 4ZO8A 4GPBA 3GEHA 2ZJOA 3MXOA 4S05A 5KX5A 4LBVA 3AI7A 1JH9A 1OFUX 4W7IA 4KLRA 5FNVF 3PPIA 1V11A 1KEEB 2KBEA 3T7SA 2XNKA 1RZRD 1PNQA 4PX3A 3KQYA 5B30A 3OPYI 1RCTE 4RFSB 1LEHA 2YZ7A 4G67A 4UU1A 1JT2A 2D7DA 2CLOB 1YZHA 3CVVA 1ORTA 4HPJB 4NV0A 2R85A 4EMTA 1NMEA 2O23A 3PZBA 3ON5A 3T7DA 3T7EA 2OBXA 3ZWVA 4RIGA 1OD6A 1THMA 3Q15C 2WSLA 4QUDA 4I5FA 3OIDA 1EP2B 3HP4A 4IIYA 2JGJA 2JFOA 3LCMA 5G3ZA 4WN9B 5I48A 4DBLE 5ENDA 3HFJA 3V80A 5HR5A 1KJQA 3VR3D 4X45A 4QEZA 1JR3E 5JFTA 3QFRA 1FLVA 5H68A 2CUKA 4BP8A 2IZOA 3EA5A 4LWOA 1L7OA 1RMQA 1C30B 1ZSNA 2IEBA 2YYYA 4FZRA 2UXDB 1MW8X 4ES6A 4EVQA 2Z4RA 3THXB 3G9TA 4ND4A 3JQAA 4LXQA 1H2ZA 2CE7A 2H29A 1Q44A 1TT7A 4BO3A 4EWLA 5LSAA 3HM9A 4HXYA 5JC8A 4G56A 4WN3A 3C6BA 1JA9A 3LYUA 2J7KA 5C4MA 4AECA 3D5TA 1R64A 2Y99A 5G3YA 2XUDA 1E1LA 4WUVA 5E3JA 5JVDF 2IDKA 5KZMB 1GQQA 3G7UA 1RRMA 3NHZA 5IT9A 4DZTA 1KR5A 5EJ5A 2NWQA 2H63A 2VDWB 1PV1A 2ZAOA 3ZXIA 4LRYA 4E7PA 3H1FA 2FWIA 3OICA 4KAAA 2OBNA 4QGHA 1O5OA 4H7JA 5EZYF 5BUZA 5IVKA 3KAKA 4KOAA 1E3LA 3O4RA 3NW9A 4N49A 3VR5D 3G2PA 1I1QB 3NKVA 2IPNA 1T3GA 3P9CA 4L5JA 2CJPA 4URYR 4I9GA 1ONNA 2BTOA 2IW1A 3PFHA 3MS7A 4MINA 4CM1A 2ZBPA 2WYIA 3JQCA 4PC6A 4AZ3B 4OUKX 3PHHA 4S35A 1KJYA 4M3NA 5KU7A 3FPFA 1ZCFA 4F4UA 3IP6A 5LYJA 1ZN8A 2BHNA 4TYNA 2ZRPA 4MUHA 3TAUA 1W48A 3VUEA 4D6XA 3GP8A 4Z9FA 3AETA 4XB2A 4DMKA 1KO4A 2OWEA 4LYYA 1SHLA 4UDYX 1E4OA 2AFIE 3N6VA 3U4DA 3CTPA 4MYHA 2AG8A 4WWHA 4G65A 1R10A 1DAPA 3ED1A 4X7RA 1E6UA 1XNJA 1PHPA 3DMYA 3OEHA 1H8ED 3KPYA 1DFIA 2Q3CA 1TIPA 4XEUA 5HDQA 5FWYB 1Y1KE 4NL4H 4I6JA 1T5SA 3WYGA 4KXQA 1RQNA 3G5AA 3U9LA 4EA7A 2WU1A 2O8VA 4CDGA 2PUGA 2ZTVA 3TQSA 3CF4G 3LCUA 3H6KA 4Q48A 4YCNA 2F1HA 5EXEA 2IYAA 1KSHA 3IT2A 3NTQA 1UC5B 5TEVA 4ESHA 4N9WA 1KPHA 1RXIA 4JQYA 2PGIA 4QL3A 3DV0A 3T1NA 1KY3A 1W2WB 3QSGA 2EIXA 2AFHE 4TSFD 1R6TA 1UBCA 2J31A 3AHGA 3GRVA 3NPAA 2MINA 1C9KA 3PFIA 3QBJA 4XPIA 3B51X 2ZI4A 2G67A 3GLUA 4JGGA 3T3GA 3WB1A 4E94A 1P2UA 1YBMA 2P6PA 5E8JA 5CIWA 5EZ6B 3IC5A 3RFTA 1DC8A 1L5HB 1WNFA 3F2VA 4K87A 5CT9A 4O4HF 5E9JA 4BNUA 4F4CA 4JLKA 3PEUA 5JPDA 1V4BA 3MLEA 1FCJA 1G8AA 2CFIA 3C3JA 3E7WA 4JUAA 2AOTA 4RCVA 2JIPA 5ECGC 1H4QA 4K2HA 3PI6A 1CUZA 1JHAA 2X0KA 2XE6A 4QYIB 1UP6A 4INZA 2WPNA 3PP8A 2ZRBA 3UICA 3TLJA 1PVVA 4LPKA 2QW8A 2IPMA 3H04A 3KXIA 2CXHA 1U94A 1EKXA 1Z75A 4PZYA 2GVZC 2OAEA 3O47A 1YS7A 2I87A 2QMZA 3CB4A 3FBTA 1NSTA 5HX7A 5KREA 1U0BB 3T3MB 4NJMB 1JDPA 2X9LA 1Y48E 3CEAA 3OF3A 2R751 1I4OA 4Y30A 2OG2A 3ORYA 1KZ4A 1SQ0A 3PNSA 3UT5B 2XZLA 1JG2A 1E1YA 3K1AB 4M1OA 5CBPA 3IEIA 3TTVA 1ZHOA 1FVHA 1X42A 2FFAA 2Y0CA 1WBDA 1I33A 3E9MA 3KHSA 1NDHA 4ESOA 1PEYA 2GYVA 1XCPA 1Z45A 3IOYA 3NBYC 3PUKA 1KY5A 2OL4A 4RVUA 3T52A 5J2UA 4YS6A 2JGMA 1I6WA 3NAMA 3ZBPA 4AROA 4E5MA 2G0TA 4ITRC 1MFZA 2W9XA 1EM8A 4DLWA 4I5IA 3TNJA 3TTWA 5EHXA 3G17A 3F6CA 3O75A 3QEAZ 4GU5A 1RMYA 4HSEA 1Z18A 2W6ZA 3FPGA 2I5PO 2VDPB 1U8YA 3O8OB 3E61A 1KEKA 3A28A 1GU7A 4HFMA 1KK0A 1WUYA 2OO5C 2WYHA 1UPAA 4UTNA 3QWIA 3RVMA 2D8AA 1DEXA 2P69A 1AKTA 2AG0A 4QO7A 2I4NA 3KOYA 3N3BC 4WACA 4LAFA 1ZGAA 2CK3D 2FJ0A 4BB9A 2VNHA 1LQ2A 5JAOA 1RRGA 3QVTA 4DPLA 1M1YB 3PBKA 4KV7A 3T0FA 1MW9X 3ETNA 3C97A 2D7CA 1FUKA 2UXCB 2C97A 2JCGA 5JROA 1ISJA 1U5AA 2QMUA 4LXXA 4KJXA 3TRJA 5J4VA 2BZGA 2CW5A 4TTJA 1Q3KA 1C7RA 4H4EA 3SOPA 1J9ZA 2XBMA 4B76A 1GQYA 5EA2A 1T6XA 4IRUB 2OUKA 1C2TA 3A9RA 5K8IA 1NY6A 1V5WA 1GPWB 5KQMA 1MLDA 1FJHA 2FE4A 2YQ5A 1J21A 4ND3A 3FJ1A 1GUFA 5FR1A 2BR4A 3WGZA 5J2UF 1QCZA 1A0OA 2YJNA 3DUWA 3KE8A 2O7SA 4NKRA 2FMXA 3N2GA 2G63A 1TGVA 1JIQA 1H0RA 3G0OA 4LF8B 2UVDA 4GQIA 2FMHA 3IV7A 3HBFA 5GZ1A 5ALHA 3QU9A 1L8OA 2V4MA 4ID3A 4ISCA 2QK4A 4N0MA 2QPLA 1XPUA 3KDAA 4OFBA 3MELA 4KIFA 3DBRA 5JSYA 3LL7A 4DR4B 4MUEA 2XODA 4DQKA 2NV6A 3H1TA 4QE3A 1QHIA 3MJRA 3LKVA 5F33A 3DBHA 2FUCA 5REQB 5HUQA 2HRQA 2ZK7A 3SZGA 3BB1A 3GLIE 3TVYA 4I0WB 5IWCA 1YRQA 1FDWA 5EJEA 4DSZA 2O2SA 1XAGA 2F1KA 3IPLA 3CKLA 1JDVA 2BM9A 2C04A 1T4MA 2GN6A 1S2OA 2NTEA 4HEHA 3M2PA 4DMFA 4NBKA 3UK1A 3TLAA 1JF8A 1GL6A 3HB5X 1GQ2A 1FFXB 1JAHA 1XWWA 4C05A 5ADWA 1E58A 2H1RA 1JZQA 4HRVA 4JQCA 4ND1A 4RVNA 3OPXA 1CX9B 3DOHA 3KYJB 3F8TA 4KWCA 1QFXA 4LGMA 3A1FA 4HH3C 4YAWA 5J43A 5F64A 2XIQA 3M6WA 2IPLA 3CR3C 1LPPA 3GZ4A 4M21A 1UOOA 4J0GA 1USVA 3M6LA 5IJ0B 5JQGF 2CLFB 2JIZD 3F74A 4X1IA 1JFLA 2W37A 3H0CA 1ZS9A 1FP6A 4KQCA 4UFNA 3U13A 4AZ0B 3B82A 2Z95A 2Q1YA 2X23A 2C98A 2GEVA 3PGA1 4MV0A 5CA1B 4KQEA 2C59A 3IPYA 4R54A 4YCAA 1FUYB 4EIWA 2C92A 3WMWA 1HSZA 1M6NA 3QENA 4H3KB 2ETVA 1UK8A 1E2BA 3KV3O 3A3PA 4A6XA 1NZJA 1GZ5A 2JFGA 4NY1A 3JQ9A 2PXHA 2IZ6A 4AF7A 4DLYA 1GAWA 3V32A 4MR7A 2AZ4A 4TWIA 4C2TA 2V9PA 2P8SA 3OX2A 5KPJA 2WIAA 5FO1A 5AVOA 4X6LA 5JCXA 5JANA 1QTRA 2G8LA 1UK9A 4Z2YA 2E2WA 1EFPA 2AMLA 3JWHA 2XCQA 3BWCA 4HDRB 4MVYA 1FUUA 1G60A 3EZ9A 3FWKA 4Y9RA 3WQHA 2AVDA 2CHFA 4KEAA 1ZUNB 4Z4GA 4HJRA 5GVRA 1NLZA 1KI3A 2YHBA 1FMJA 2GS9A 2ONKA 1KYIA 1RZUA 1FBTA 3O4HA 4C7BA 1WULS 3RF6A 4ZDKA 4CF5A 1GQSA 1P2GA 3I1YA 3L7AA 3REQB 4EPWA 3FOZA 3R9KA 5IVHA 4MQBA 2BTQB 3JR7A 1AHHA 3BFJA 3EARA 4G5GA 3ADKA 5TQ2A 2ZULA 4R2HA 1FNCA 5B1HA 3KKOA 3JARA 2ODNA 2C7RA 2EOAA 5LXTB 2JFBA 4C7MA 1JQJC 5AW9A 1P0FA 1T4CA 4MV3A 1KEPA 1ZH2A 1P6XA 1OI2A 1IN6A 3C8DA 4B44A 3N05A 4JJ7A 2OG1A 3PFBA 3D8BA 1IEXA 2RJ3A 2VJMA 2J59A 4P4NA 4KG7A 4P5PA 1WTAA 4YIHA 1DDOA 1ECFA 1HDZA 2ZM5A 3S44A 3UWDA 2PD4A 2XCLA 4TL9A 1DTEA 4O0MA 5CCDA 1L5NA 4PONA 2UXBB 1YS2X 5GQSA 1FA9A 1MAHA 1FZTA 1TAHA 3D2BA 5H59A 3STHA 5HF5A 4DDKA 5EOVA 1GDTA 3IHLA 1U0SY 5EWJB 3SI7A 4WT7A 2JJ1A 4K28A 3DBVO 1E79D 1R1DA 3I8SA 4BRWA 1IY0A 3LVRE 1KQPA 1E1CB 1CERA 1B3RA 1QG6A 3FYUC 1Z17A 2HHJA 1E0JA 3NYIA 4WIAA 1V1MA 2GOYA 1UFQA 4G07A 4PAOA 3UV6A 4RPKA 1A50B 1A9OA 1LLUA 2NZJA 2X9GA 3AJ8A 3IOMA 4RPLA 4XARA 1SQSA 3K2BA 3IVRA 3M4NA 3KXLA 4WK0B 1CQIB 2C88A 4YP1A 1I9GA 2I2AA 3TW0A 2JBWA 3G82C 1WLYA 2HK8A 1YJAA 2FSIA 2MHCA 4XIIA 4BO5A 1BW9A 4L22A 1KA9H 3MJSA 4MUNA 3ZZTA 1KBQA 3OLQA 2REQA 5G0SA 4GZ3A 3JZIA 3WYFA 2O52A 2XE7A 3OCXA 3C6ZA 1U5BA 1X94A 2UYGA 5AVWA 2XMGA 5CPBA 4E5YA 1CD5A 2XWSA 1I1HA 3NJ4A 4JP2A 1TW3A 2B99A 2EKQA 4CMIA 3QX3A 3Q7EA 4D81A 5IT0A 3U1TA 3I6YA 4EITA 2ZRCA 1Z4LA 3O74A 2XUPA 5AXDA 3CUYA 5BQ3A 5IHPA 5JZOA 1D2HA 3RG8A 3MC1A 2IYVA 3V1YA 3U9SA 1C9MA 2Q2NA 5BQ5A 2QLMA 1YZVA 2XJ4A 4IIEA 4QX6A 5K3SA 3K70B 1SQFA 1UIRA 3M0EA 5EJ7A 3MBKA 5FYDA 4IQFA 1DG1G 2Z2JA 2YWGA 3E9EA 1BCRA 1WW8A 3PHGA 1LBSA 2HRZA 4OH1A 4MYUA 1A04A 3S6JA 1VJGA 2IT1A 3FKQA 3I1JA 3FTDA 4WKPA 2Q7DA 3UAGA 3ZEIA 4NXMB 3SICE 4F06A 4LHVA 3EEBA 4CIDA 5KTPA 3HN6A 4HAUA 1YDHA 2R62A 4BMDA 3IYLW 3LX5A 4OB6A 1KO8A 4QQ8A 2I0FA 4BTLA 4M0MA 5IKPA 2O1EA 4Y0VA 1ODJA 4WZAE 4C4AA 1Y80A 4HPWA 4NZYA 4JYBA 4B7XA 1HTBA 1XMXA 3WKBA 5HQ3B 1JEQB 1OC4A 1Z4NA 2FGKA 2ZI7A 4IPTA 3E4CA 1UEIA 3KPUA 3R8CA 2FQQA 4BRSA 4WBXC 3MCAA 2VTDA 3FYCA 4D9FA 1WKVA 1GG8A 4QU5A 4MROA 3ILHA 2P3OA 4BQOA 2Z3VA 221PA 3TE6A 2ZWOA 5JLJA 1Z0SA 3P27A 4IM7A 4R1OA 1K8XB 1WDMA 1QYDA 3IBGA 1BMFA 7REQB 3PFFA 2BF4A 1DEHA 4MR8B 3I6IA 3ONFA 1CDZA 3SKVA 3WBJA 1U7HA 4U2EA 4FDLA 4RKFA 2QTAA 3HO6A 2D8MA 1ZVKA 2GLXA 2V8BA 4EHLA 3HVHA 2K5UA 2BCGY 5K2OA 1AQUA 1B1AA 1CFJA 2NSHA 2GZDA 3DH0A 1QF7A 1H6DA 3PRHA 3A4MA 2WSSA 4ML3A 4MVJF 5FI1B 5T64A 4DLPA 3KQUA 5HK9A 3JCZA 2P67A 2W6OA 4YHBA 5LFAA 1YV9A 2YHUA 1CJMA 1E9EA 1T6YA 1QO0D 1QC5A 1RQ2A 3MILA 2X40A 3PEEA 4QGFA 3X2SA 1WB4A 2NU7A 1HOXA 3MCZA 3PDCA 3DVLA 2NUBA 2ES4A 3DONA 4UJ5A 1HK7A 5GONA 1G9TA 3MIZA 1OXBB 1HDIA 3DKRA 3LWBA 4B40A 1X1AA 1ZJYA 2R7AA 3GLGE 4I55A 5I3ZA 4DV4B 1MEEA 3HXKA 1Z4QA 2BJVA 4BNLA 1KBOA 4M46A 1XLTA 1UT8A 1W85B 2OCDA 3GUUA 3TE7A 1P44A 3UG6A 4XFDA 5EPUA 3EWSA 1R27A 5JNUA 4CM5A 2DFNA 3KWLA 5HXAA 1CR4A 1ZD8A 4PEVA 2JGLA 1J5EB 3MIIA 4EKGA 1UCFA 3DAHA 4FZ5A 4Z4QA 5SY4A 5IEBA 3FYUA 2VF5X 1L5VA 5JALA 4PPGA 5AKLA 3V7WA 2C7BA 2VYFA 2HL6A 5HIJA 2K2WA 2PK3A 2XD4A 2FU5C 3SHOA 2EG5A 3T94A 1JDSA 2ESRA 5AK5A 5JXHA 3FNIA 3NEAA 4G37A 4MV8A 3VKWA 3L7BA 1L7MA 2PBFA 2PCLA 2PT7A 4TWBA 2P9JA 2QP9X 4EY6A 5KI6A 1O5IA 5AKEA 5JECA 3HR8A 1SURA 1IOLA 4UAUA 2EJTA 5KQRA 3Q8LA 3AVWA 3TTXA 4FC7A 4QOHA 5L4SA 1J25A 3IIEA 5FUYA 1OH7A 5FOXA 4OGKA 3TOXA 1O6FA 4UEJA 5JYBA 2ZIUB 2VAVA 1DAEA 2XAUA 1DC3A 1WHTB 1HFKA 3K35A 4TS9A 1PR4A 1QOZA 2PCJA 1VP9A 2BEWB 1JQDA 3WGKA 4C87A 1XCMA 3I12A 4Q3BA 4XDHA 2ONYA 3WISA 3MS4A 3NS7A 5DO9A 2GFQA 4QFCA 4AJIA 4HH1A 1SQ5A 4D99A 5ADUS 1EFAA 3EPHA 4YRRA 1SC1A 2BN4A 4YI5A 4TYMA 3V8EA 2VQEB 3OX3A 1X1DA 1GCGA 1U11A 3WFJA 8ATCA 1W1UA 2ZSFA 1JW9B 4XWAA 1SD5A 3FRJA 4J0HA 4PFKA 1P1JA 4TMYA 4GKAA 1J1IA 1ZUHA 3LOUA 3NQ41 1CV2A 1NVAA 2QU7A 4TUYA 4NYMR 2FOIA 2O0MA 4NCNA 3IGFA 4OMCA 4ZRNA 5JRZA 2IH2A 1I7NA 5I7RA 5JAPA 2FZ4A 3IRUA 4FHCA 5AVQA 3IPCA 1DJNA 2VK1A 3ROMA 3LWDA 1P17A 3O4FA 3ZWCA 5KMGA 4G0UA 4Z3OA 1E1NA 1I7LA 2R8PA 2GJKA 3KSZO 1YJXA 2QX6A 2ZDHA 2AH5A 1B1CA 1I3MA 1WDTA 3MTIA 4QTUB 3KJGA 1PSDA 1E9BA 4G2NA 3M1YA 5J5VA 1RWVA 3CNEA 5KJ6A 1J1ZA 1D4FA 5IKOA 3PFNA 3BAZA 4EPVA 3K05A 1KQFA 4GQBA 3AJEA 1FP1D 1LQTA 2IU3A 5HZGA 5CDHA 4ITUA 1JFFB 4JJIA 3DE5X 1JYEA 3W9SA 1X7HA 4GYJA 4ZO6A 1R4ZA 1DQYA 2B61A 3PIDA 3R3UA 4PICA 1WV1A 4L5IA 3SG0A 4D9BA 1YUBA 4AS2A 2X15A 1RKVA 1WXXA 1YMVA 4DEXA 4P0PB 1YRYE 4GO1A 4DA6A 2X8WA 3MLBA 4D0SA 3FETA 4OD0A 1KYZA 1N0VC 2JFPA 4JR1A 4X84A 2A8YA 4YCSA 4A0HA 3KR0A 5LBUA 2PS9A 2LPMA 1NQXA 2YICA 4WY2A 1SVLA 1C1DB 1L4MA 3ANMA 3FPHA 2OCXA 3AHHA 1YI0A 3FRIA 3WKCA 2CMGA 1ZESA 3TN7A 1WDKA 4H17A 3RVPA 1S1MA 1M2EA 1YZKA 3R2JA 3ZPXA 1YH3A 3IIJA 3O0DA 3F49S 4IOKA 1FSPA 3AUFA 1JT9A 2O7NA 5AIAA 1PLKA 2VAMA 5G41A 1VDZA 3X1DA 1W6RA 1DX9A 1P4SA 4JOCA 2E9SA 3IUSA 1WW2A 4J7AA 1SKMA 1BXGB 2C1ZA 2WAMA 4O6VA 2M6KA 3AR9A 5JMOA 4O02B 1MVOA 1NASA 3OECA 4F5ZA 1ZOPA 4RELA 4DSTA 5TC4A 4NBVA 1X7WA 1FYVA 4UBMA 1KVUA 3BX1A 4MYSA 3DL0A 1GADO 1MOZA 2XNJA 3EQ8A 1K3UB 2PR7A 4NAUA 2FPMA 3WP1B 2J0UB 5T8KC 1NJGA 2XPCA 3GP5A 2OCYC 3ZCXA 4WLEA 3ORHA 4XYEA 3KKPA 2GZ3A 1RMTA 1NVDA 1FW8A 1L4GA 2QAGB 2YWFA 4MS1A 4OXIA 4AJ9A 2O9JA 3AVTA 3KJIA 3KVYA 1FUIA 2OFPA 3GPLA 1P9NA 3F3KA 4JI6B 3VVMA 1OXTA 2J7PD 1D6JA 4IAOA 4UUPA 3L18A 4JC0A 4HFNA 4LI3X 3KQNA 4N5MA 3HA7A 4NEHB 1LW6E 3U7GA 2Q3JA 2X2OA 2Q8QA 1W5SA 4BGUA 5A4IS 2Q5FA 4OXQA 3AL0C 1GGKA 3WLMA 3G9UA 1YGPA 1NTOA 1UPBA 2FW6A 1XZAA 1GPJA 2QRGA 2I4MA 3H5TA 2OXEA 3T0GA 5BW6B 1L2TA 1I5OA 5D01A 4RTRA 1EVJA 2F00A 5ITWA 1QO7A 2LW7A 5JH7B 1FDRA 2C7PA 1S7CA 3S8YA 1WVMA 3F8SA 4URWR 1R4MB 1ENZA 4X97A 1WD7A 5KVVA 2WTXA 1J90A 3R8FA 4HD8A 3QY0A 2JG3A 5A4KA 4MYDA 3ZCQA 1JG1A 1A5TA 3DZIA 3ZX4A 5L6LB 4FNMA 1JJFA 4KL8S 2V45A 3S2IA 2IJGX 1UKCA 4FYWA 4BZQA 2DT8A 4XFKA 5M34A 3B1FA 1UK6A 3KSMA 1Z16A 1DPGA 3TCNA 2IYTA 2BBSA 4MI9A 3VHXB 2ZT7A 1CQWA 3PS9A 2AMYA 1ATIA 2VXOA 3BJRA 2VHWA 1ZK0A 4BP3A 5L4NA 3B6ZA 3UXMA 3NONA 4US1R 2IE8A 5CXQA 2ZB4A 4KQFA 5FL7D 4LZZA 5BNZA 2HK9A 5DPMA 2QX7A 1YAHA 3PUHA 3SJZA 3A9SA 2PH3A 3BRSA 3EK2A 3MHPA 2JAXA 4DTIA 2A9PA 4Q01A 4EZBA 2CVOA 4HDSA 1H42A 2D2XA 3SAJA 2XEDA 2PIAA 1KFBB 3BRWA 4EO4A 1EEXB 4KE6A 2ATEA 5JSQA 1GPH1 1PWZA 3Q6MA 1DWUA 4MARA 2ZSAA 3MPOA