2AOTA

Histamine methyltransferase complexed with the antihistamine drug diphenhydramine
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
288
structure length
286
Chain Sequence
MRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYEYDLLSTMDISDCFIDGNENGDLLWDFLTETNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histamine N-methyltransferase
publication title Structural basis for inhibition of histamine N-methyltransferase by diverse drugs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 101
structure length 286
sequence length 288
ec nomenclature ec 2.1.1.8: Histamine N-methyltransferase.
pdb deposition date 2005-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2aotA00
3FUVA 3P9CA 5D1NA 2C7RA 2P41A 4IV0A 1Y8CA 5EVJA 4P58A 2PKWA 3G2MA 3GU3A 3VYWA 2ESRA 1SQGA 3G2PA 3UWPA 2PX2A 3KPUA 3KQWA 3FPGA 1D2CA 3V97A 3KPVA 3TPZA 1IXKA 3P2KA 5DTRA 5E8JA 5EPEA 2GAFA 1EIZA 2BM9A 2HMYB 4HG2A 4O29A 3TFWA 3PX2A 5CM2Z 2VZ9A 2YTZA 3SSOA 2B2CA 2UYQA 4RTJA 2NP6A 3KR0A 4QTUB 5EOVA 5K0BA 2P1DA 4HGZA 3RODA 4X61A 2IP2A 1QZZA 4YMHA 4BLVA 4E30A 2NYUA 2FPOA 2DULA 4XCXA 2XVMA 4OA8A 3REOA 1PRYA 5T64A 3DXZA 4HRAA 5K0NA 5K0JA 3EMBA 3G5TA 3B89A 4U7PB 4C05A 3OFKA 2OY0A 4E2XA 2B25A 4KW7A 4YV2A 5FTWA 5DX1A 5K03A 3PT9A 3KQTA 2OKCA 5C1IA 2IH2A 4RTOA 1X1AA 3TRKA 1O9GA 5EEGA 5LQCA 1JG2A 4U7TB 2EG5A 1G6Q1 4RTNA 3WSTA 1X1BA 5B1SA 1YF3A 2ORED 4H0NA 3KR2A 2ZZMA 2PLWA 4LECA 3IV6A 3S68A 4GOND 4X1OA 3BWBA 1R8XA 4GOMD 3UJDA 3ELWA 3MTIA 3BKXA 5LQUA 2PSSA 4OX9Y 1VP3A 1JTEA 4DCGA 1NV8A 1SG9A 1WXWA 3P9IA 2AVNA 2HTEA 3G88A 3HCAA 3CJRA 2BM8A 2ZTHA 3UBTA 3EMDA 2AOVA 1DL5A 2FHPA 2XYRA 4M38A 3RW9A 3I64A 3SX0A 1M6YA 3HVJA 2UYCA 4YMGA 1WG8A 4PCLA 2AZTA 4MIKA 3CCFA 4GC9A 1QYRA 3M33A 1MJFA 4HTFB 3U81A 4R05A 4GOOD 1NV9A 1PJZA 3E8SA 4R6WA 2O07A 2N47A 2Q41A 2A14A 5EGSA 2KW5A 3FYCA 3O4FA 3UZUA 2ZSUA 3HA3A 2IDJA 3EEOA 5EKXA 3HVIA 1IY9A 4GOLD 4QTTB 5E1MA 5E1OA 3FTCA 3FYDA 3THRA 2DPMA 5E2AA 5ICEA 5DM0A 3LBFA 2P3LA 1JQEA 1RI2A 1D2GA 5K0GA 3UJ9A 3G5LA 2G8NA 4XUEA 3M6UA 3GO4A 4GEKA 4KDRA 4PYKA 3DH0A 3FUWA 4RVDA 2ZZKA 3UJAA 4QQNA 1XXLA 3LPMA 3OU7A 1KPIA 4MTLA 1QAMA 5ICFA 3BGDA 2YVLA 3BWYA 1BKYA 1YZHA 3DLIA 1XJ5A 2EJUA 2P3OA 2PX8A 3ANXA 3FTFA 3UA4A 4AZTA 2NP7A 3NWEA 4GUAA 1JQDA 2O57A 2FK7A 4R8SA 5BXYA 2JJQA 2ZULA 3AXTA 3EGIA 4Y30A 2HR1A 4ER3A 3M6XA 2JH8A 5E1DA 2AOTA 1L3BA 5HOQA 4C07A 3I58A 3ID6C 2IH4A 3MERA 4POOA 1NW5A 3UJCA 4OQDA 1ZGAA 4KRGA 1VQ1A 2R3SA 3P8ZA 4OBXA 1N2XA 5DX8A 5DRYA 4RTQA 2YXEA 2AOXA 1VP9A 4G56A 3IEIA 1H1DA 1JG3A 3LGAA 3P9KA 3PLAE 2GPYA 3LBYA 4RX1A 3GCZA 5FULA 3V8VA 5U4XA 2QRVA 1X1CA 2I9KA 2CMHA 3FRIA 3LDUA 3AXSA 3HCBA 4M37A 4RWZA 4RV9A 2G71A 3OE5A 3P97A 2JHCA 2PVCA 3HNRA 2H1RA 1EG2A 2AOWA 4WXHA 5ICGA 5DWQA 5DM1A 2PX5A 5DLYA 1BHJA 3M4XA 2C7QA 3EVCA 1P39A 5MHTA 4X60A 1TW2A 5K01A 4ISCA 5T67A 4BLUA 2ZIFA 3OPNA 2NXCA 5K05A 3TR6A 4XUCA 4BLWA 1AV6A 4OQEA 4R6XA 3ELDA 4FS8A 3T0IA 1ZHFA 4PIMA 3EVFA 3VC2A 5GIPE 3PFGA 5E2BA 3FZGA 1WXXA 3DR5A 3LKZA 5EIWA 1NKVA 2K4MA 3NTVA 3SR4A 2BH2A 1M6EX 2FK8A 2BR3A 2QE6A 2UYOA 4C03A 2HWKA 1KYZA 3R6TA 2F8LA 2ZIEA 3OZRA 4QPNA 3CKKA 4HC4A 3R3HA 4IKPA 5HIJA 3R9XB 1XCLA 3KU1A 4PYOA 8MHTA 3OE4A 3I5UA 3B3FA 3TMAA 3ELUA 2P7HA 1Q0SA 3EVBA 3OU6A 4A6DA 3PTAA 2FYTA 2PGXA 4KIGA 2ONZA 2IPXA 5EEHA 1NW3A 3LHDA 3UJBA 1AQJA 2P7IA 5FWDA 5BW4A 3P2IA 5EZQA 5GIOE 1UWVA 3KHKA 3DLCA 4E70A 3A7DA 5CCXA 4NECA 2ZWVA 3RIEA 2I6GA 4ER7A 1KHHA 3OCJA 5IKMA 3E23A 4Z2YA 2O05A 1MHTA 3DTNA 3K6RA 2ZBPA 4PGGA 5LQKA 4KWCA 5CIYA 2XYVA 2PX4A 2IFTA 2NXEA 3BWMA 2ADMA 5HEKA 4YUXA 1P1CA 1QAOA 1RJEA 3DXYA 3FUUA 4GC5A 3TOSA 3BZBA 4HSGA 5JUWA 2IDKA 5BP7A 1G8SA 4E2ZA 5DTQA 2LD4A 4C06A 1G38A 3NW9A 4MQ4A 1ZKDA 3G2QA 5ICCA 1NBIA 1DUSA 4CKCA 5EMLA 3EEYA 3ER9A 3ERCA 5H02A 2AVDA 3BKWA 3HCDA 4EVIA 3PFHA 4Y2HA 1XDSA 1XDUA 4K6MA 3SVZA 1G55A 5LR6A 2VDUE 3GWZA 3OZSA 3CVOA 3KPWA 2IIPA 4PONA 5E1BA 3FTDA 2ZBQA 5CVUA 2ONYA 3UA3A 5KQSA 1OR8A 3JWHA 4KVZA 3EVAA 5FUBA 5DRTA 4YUVA 4PYQA 3UJ7A 3TKYA 5E9WA 3QOXA 2JG3A 2ZIGA 4BP1A 2ZCJA 1F38A 2ERCA 4E2WA 3KQSA 2FRXA 3GJYA 5FA8A 2Y1XA 5HFJA 2B9EA 1D2HA 4F84A 2Y1WA 1QAQA 2GS9A 1RI4A 3PS9A 4QQKA 5FCDA 3B3JA 1TW3A 2OPBA 4M36A 5GWXA 3GDHA 4BP3A 2YXDA 4EMSA 4MHTA 1WZNA 2NXJA 5HILA 1TPYA 3MHTA 2JH9A 3DUWA 3GRZA 5KYGA 2PXAA 3EVEA 4C04A 3A26A 2PBFA 3KPJA 4HGYA 2ZW9A 1ZQ9A 1P1BA 3A25A 3LL7A 5FHQA 5EIFA 4EKIA 1R00A 4EK9A 3SXJA 3BT7A 2CMGA 5F2OA 5G02A 2VP3A 1VLMA 3SM3A 5EQJB 3P9NA 4LWOA 4UOEA 4CKEA 1YFJA 3C3YA 5EMMA 3AWIA 3GRVA 3HA5A 4ZTBA 2XBMA 4PIPA 4PYLA 2GB4A 2BR4A 3NVMB 5DTMA 4DF3A 2B3TA 2PY6A 5IH3A 2IBTA 3VC1A 1QANA 3TQSA 2GA9A 1UIRA 3QV2A 3NMUF 2CWWA 1RJFA 2O06A 5GOZA 1EAMA 2AN5A 1Z3CA 1NW6A 2PV0A 4X63A 1M0EA 4BY9E 1XDZA 2AN4A 1NW7A 3LECA 1INLA 3DOUA 2CL5A 4L7VA 5CUQA 1JG4A 4PYNA 3G8BA 3PX3A 5CVDA 3FPFA 5GINE 4RVFA 1P91A 4GF5A 4CWAA 4QVKA 5LQNA 2IGTA 2NXNA 3CC8A 4GBED 1X19A 5DXAA 3CBGA 4C4AA 4E32A 3DULA 1FBNA 2OO3A 3HCFA 5CVJA 4FT4A 2G70A 2OZVA 3B3GA 4FSXA 3C0KA 5LSAA 5EMKA 2OB2A 1KPGA 3AY0A 3T7RA 3GRRA 5K8VA 5F2NA 3IYLW 4HH4A 4PYIA 5K0CA 2WK1A 1R74A 3BWCA 3HP7A 2AOUB 3MGGA 1KYWA 5E9QA 3QOWA 3HCCA 1EQAA 3A4TA 2JHPA 3A7EA 4FZVA 5GM2A 1NT2A 2IBSA 2XYQA 3HM2A 2FCAA 3DXXA 4B17A 1N7IA 4YV1A 5K0EA 2UYHA 1ORHA 5E9JA 5FA5A 3OZTA 1I4WA 2HNKA 2V7EA 2PXXA 5FADA 1ZGJA 1N7JA 3C6KA 4RVGA 5DT2A 4FT2A 3MTEA 5FQOA 1YUBA 3TKAA 4JXJA 1SQFA 2QYOA 2GH1A 3KQQA 5CVVA 4DM3A 3HVKA 1KIAA 3Q87B 4V0RA 4YUYA 4PWYA 4RTLA 4OBWA 4V0QA 4CXMA 1I1NA 3CGGA 3JWGA 4RYLA 4DA4A 3BGVA 4LG1A 1R18A 1R8YA 10MHA 4QDKA 1KR5A 3JWIA 1JG1A 3P2EA 5EHIA 4E2YA 1ORIA 3F4KA 3I9FA 1L1EA 1VL5A 3AJDA 5HIMA 4RTRA 4P7GA 3HVHA 1FP1D 1EJ6A 1RI5A 5DX0A 2OXTA 1FJXA 3FPJA 1O9HA 2H11A 3EPPA 3CJTA 2BR5A 3LDGA 3KQPA 3DP7A 3TM5A 3EGEA 2QM3A 4FSDA 5EHGA 2OB1A 3UJ6A 1JTFA 1G60A 3SSNA 5C9ZA 4AZWA 5K0FA 2GLUA 2AR0A 1FP2A 4A6EA 1WS6A 1XTPA 3FUXA 4F85A 1O54A 2G1PA 1L3IA 5DPMA 4AX8A 4RTPA 3CJQA 3FRHA 3GGDA 4DMGA 3GNLA 2PWYA 1HMYA 1YB2A 5ERGB 3SSMA 3FTEA 1JR4A 2WA1A 4CTJA 1SKMA 3DMFA 3KQYA 5P8WA 3DMHA 2I62A 3KPYA 3L8DA 3NDJA 4GQBA 3BGIA 3GIWA 3KQOA 2ZLBA 4RSRA 5FWAA 3BXOA 4HTFA 4E33A 2PJDA 2VS1A 2YQZA 2PT9A 3T7SA 4ATNA 2EX4A 4EKGA 2XVAA 2YXLA 5M5BA 3EVZA 1V39A 2JHAA 1DCTA 5KQRA 2CKDA 2EFJA 3ER8A 3OU2A 1JQ3A 3M6VA 4RVHA 3HA7A 3C3PA 2IH5A 4KIFA 3B7PA 2UZ4A 4DCMA 3MCZA 7MHTA 5GP1A 4R8RA 5KVAA 4M7RA 5K09A 4ER6A 2P40A 3R24A 1L9KA 3IHTA 4FP9A 5DXJA 4PYJA 3SGLA 5DSTA 3G89A 1NE2A 4QDJA 1KXZA 3MQ2A 2PXCA 3H2BA 4OA5A 4CTKA 2HV9A 2ZVJA 3LDFA 3ORHA 3EGVA 3LX6A 4P7FA 1AF7A 2V74B 3FPEA 1BC5A 3GRUA 5CVEA 1Q0TA 2VDVE 3O31A 2OBFA 4KDCA 1NBHA 1KP9A 1KPHA 3R0QA 5CCBA 1UFKA 4C08A 3UFBA 5E8RA 5LQJA 3DMGA 2C7OA 3X0DA 2Z6AA 2P8JA 3M70A 3MAGA 1ZG3A 5F2KA 4EQZA 1B42A 3NJRA 3A27A 2C7PA 1F3LA 2AS0A 3LCVB 1SUIA 3T7TA 1XVAA 3MB5A 4WVLA 1SVUA 5D1HA 2VDWA 5DM4A 5JR3A 3JWJA 4IWNA 2R6ZA 3FUTA 4YV0A 4FGZA 3GXOA 5C0OE 3C6MA 3OFJA 5EMJA 5BW5A 2WA2A 3ME5A 4ER0A 4DKJA 3NVKI 4MWZA 4X41A 2B78A 3P71T 4AZVA 1NW8A 3NDIA 3E7PA 3SMQA 2G72A 4QPPA 4YUZA 3HEMA 3HCEA 4LWPA 4PYMA 4RTSA 2ZZNA 1RI1A 4P7KA 5K0LA 5HIKA 3KQMA 3BUSA 4FR0A 2PWPA 1VPTA 2YR0A 1R6AA 3ELYA 3LCUA 4PNEA 1T43A 3PVCA 2I7CA 4YUWA 4IV8A 5FQNA 3UJ8A 3E05A 4RTMA 5CD1A 2AOUA 1SUSA 3THSA 1EJ0A 3EVDA 2EJTA 1VIDA 5KS2A 5HIIA 4RTKA 1L3CA 3EVGA 1BOOA 4ER5A 4PGHA 3NWBA 3VSEA 3KQVA 3G8AA 3LCCA 5GM1A 5T6BA 1FPQA 3TLJA 1U2ZA 2ZWAA 4DQ0A 4AZSA 4DZRA 3Q7EA 5DM2A 9MHTA 4XUDA 3KR9A 5DSXA 1JSXA 3O7WA 3MCTA 5EG5A 2ZBRA 5HZMA 3KR1A 4QVGA 1X1DA 1RI3A 2P3QA 4F86A 1AQIA 1RJDA 1I9GA 2QY6A 4PCAA 2AOTB 3GRYA 5LQRA 2H00A 3M6WA 1VBFA 2P35A 4PINA 5FHRA 2YX1A 5EKUA 1G8AA 1VE3A 3HTXA 1HNNA 3LSTA 3I53A 3K0BA 3KKZA 5LQAA 2Z6UA 4P7JA 3G2OA 3TM4A 2Z6QA 2NNWB 2OYRA 2AN3A 1XCJA 3PB3A 4AUKA 2O0LA 1IM8A 1RJGA 2ZFUA 3FPHA 4E31A 2BZGA 1JSZA 3D2LA 5EC8A 1YZ3A 2YUIA 2E5WA 1WY7A 2PT6A 3B5IA 3G7UA 4CKBA 1YFLA 5EZSA 3LKDA 2QRVB
chains in the Genus database with same CATH superfamily
1OASA 4YK7A 2VJPA 2WWVD 2PMBA 1J2TA 5JC1A 5EVJA 4C0LA 1Z8NA 3NTQA 4JUCA 1WXHA 2V1XA 3TVTA 3UTCA 1XTJA 3NOQA 4YRLA 2GDJA 3TZQA 2PRJA 4ZHQF 3PGJA 4HB3A 2Y3IA 3QPAA 4AJHA 4CM5A 1KGDA 3NM5A 2QF7A 1IE3A 4IYRA 4MUEA 4HL6A 3R7NA 1A9XA 4GNRA 3ZCPA 2VK4A 4FIDA 4ED9A 1DAEA 1ZNZA 3ROPA 2QTCA 3I2YX 1F51E 1VE1A 4JI6B 1HZZC 2EFDB 2P0AA 3ADKA 4BKUA 1Z29A 3IQIX 1Y1KE 4BFTA 2DJIA 3NDPA 1IEWA 4TL9A 1NMXA 2H06A 5AICA 2J67A 4C0KA 1BCRA 4K28A 5JDIA 3WX0A 1QV9A 3DXZA 5TPWB 3EMBA 3K0HA 1O77A 1XTVA 1JJ7A 1U1FA 2J3KA 4XCQA 4DBLC 4GPD1 4IXDA 4YLYA 3S4YA 1J56A 4RGBA 4BE9A 5B1DA 5FYDA 1Q7GA 3M89A 2DXIA 4CMIB 1UDCA 3TRKA 4C7MA 3P0HA 1ACLA 2ACKA 2BW0A 3LW8A 1Z5WA 2VF5X 3Q1LA 1QPGA 1G5PA 2ORED 3ESBA 3EQZA 1O97D 5JXJA 3EPLA 1JB1A 3IV6A 3VPSA 3I83A 3S68A 4JLVA 5HKBA 3L1JA 3OKFA 2X40A 1Z6YA 4AUEA 4O5AA 3GLGB 5K8UA 1R8XA 1C1DA 2AG0A 3OA2A 4Q12A 3MTIA 3VRHA 1EK2A 1WPXA 4O4HF 4TTPA 1NV8A 2JLZA 3C4JA 1ZD2P 4CGYA 3IO5A 3CKYA 1W29A 3PC2A 5H0IA 4C89A 3EZ9A 5ELLA 3WLNA 3WYAA 3EZGA 4MQFA 5KTNA 2HTEA 4LDAA 3E9QA 1GU1A 1P9OA 2V7TA 5I9SA 1E5XA 5L3SA 1D0VA 2VHCA 4Q9IA 2C9CA 1NN1A 4KV7A 2GZ2A 2G17A 2L19A 2PWBA 1E2IA 4XX0B 3ZEIA 4X7RA 1QVVA 3Q2OA 1WZ2A 2H9IA 3OCWA 1MAAA 1KZ6A 2EEZA 3BHNA 4GC9A 1JVBA 1WUTA 2ZDHA 3LYHA 4W1SA 5EZ5A 1F8XA 3T95A 2HA3A 3FYCA 4BV3A 1Q15A 3A2MA 3HA3A 1XFDA 3L1KA 3DLBA 3KJFA 2Y9MB 4EJ6A 2GM4A 2I6QA 4QTTB 3FTCA 2Z8ZA 5DM0A 2UUAB 1YVEI 4E11A 1D2GA 1C2YA 2GVNA 3CB2A 3VYUB 5I51A 2V4MA 3N58A 3IOEA 4RL6A 2WF5A 1OGIA 3HHPA 4LZZA 4RJIA 4H60A 3Q85A 4OSOA 1OIVA 1G5TA 4R1UA 2X1HA 4PHCA 5BSTA 2QPOA 3LD9A 2PCLA 2BBTA 3F96A 2QUKA 3M82A 3BGDA 4M1EA 4OG2A 3TINA 4A6XA 2ZYVX 2J5BA 4I1PA 5C8YF 1M2OA 1Q77A 1XVTA 4BHTA 3JZMA 2IHVA 5DNAA 4II2A 2FEXA 1QGYA 4DC1A 5KDDA 2I3ZA 4JWKA 4R8VA 1F9EA 1OTYA 4JXKA 2RGCA 1LC0A 2PKEA 1X2BA 3FNRA 3WICA 2RD2A 4EF6A 4MB6A 1GPH1 5TF4A 3UK0A 4BL5A 4KAAA 2HY7A 1QMGA 5I8WA 1W36D 4NMHA 3E9EA 3BQ9A 2GN8A 3H9BA 1X7DA 5AK4A 1F2UB 1L7NA 3G5AA 3IEIA 5CYFA 3IMKA 1T1IA 1I1OA 2OQ2A 1JG3A 1VCIA 3W5DA 4XWTA 3WIDA 5B6JA 6ADHA 3R74A 4RK0A 2B99A 3VHRA 2I54A 1M8JA 3GMDA 1AHHA 2H54A 3G8YA 2GRAA 4Z4CA 3F98A 2M6LA 2P2YA 4M37A 4RS3A 1J1IA 1RXWA 3F78A 3I6YA 5CYGA 5KYNA 2BMJA 3WTBA 1JALA 1EG2A 3OLYA 4QO8A 3SNKA 3W9BA 4EZEA 5CB4B 4PANA 4M6WB 1E5QA 1BHJA 3FWZA 1N6PA 3FYTA 3EVCA 4F9GA 4F97A 4RULA 3IP6A 3RRMA 4XEHA 4P6VF 1CCWA 2Q2WA 5FWXA 2VKTA 4YVFA 1G8HA 4IHJB 3HWSA 3N8DA 5LZ2A 4WXPA 1FVXA 5COQA 3CSUA 3UAGA 4BZPA 2OQIA 4AW9A 4BLWA 3E9DA 5F7ZA 1N4DA 4E22A 1QHYA 4BNXA 4E08A 3QLJA 1GL3A 4QUJA 1KI9A 1SHZA 2F62A 4B6PA 5JRDS 3RBZA 3SDZA 3LY5A 2FJ0A 2XQVA 3TZCA 3NUQA 3DAFA 3ZDZB 3C45A 2W2QA 1G2IA 1VLQA 4EBFA 2IP4A 4EHAA 4ZTZB 3U3XA 4BECA 3KOYA 2PZFA 5B7GA 4IKPA 3JQ9C 4UNSA 3L4BA 3KU1A 2Z43A 3RK0A 4A8JA 4D9HA 3PUYA 2IUYA 3BM5A 1V3UA 4D4MA 1G9TA 4FNMA 2NUTB 1M10A 3DTVA 1X0XA 4FKZA 2OXFA 2ZVPX 5AYVA 5ILGA 4CEHA 4YI3A 3K9HA 1Y33E 1RQ7A 2A7XA 3MEQA 4JIMA 4U2BA 5FL7A 1XBTA 4IILA 2J3JA 4Q24A 4GZ6A 4ARUA 4TWZA 2JJ2D 3IXLA 2JJ8A 2XYVA 4O5OA 1SQ0A 3RGGA 1QK3A 1X8LA 2J3MA 3OOEA 5AK0A 4B8ZA 4U2FA 2C4WA 1PBTA 1P4GA 4D9NA 2IJGX 5BWMA 1Q1QA 4MEBA 4NOLA 1X39A 2X8JA 3JAKB 2IODA 1QG0A 4R40A 5HGXA 3D3EA 4L95C 4LW8A 5IDXA 2ZS8A 2QYTA 3NW9A 4X66B 3FHTA 1ID8A 3E61A 1RWOA 1IQUA 2GEKA 3ESZA 3H11B 3K15A 2CNDA 2WSMA 4LJYA 3KZKA 4ZFNA 4NCBA 4FMCB 3KWFA 1IATA 3WYDA 3FZQA 1W8IA 1XLVA 2JVIA 2O2DA 4N0PA 4UZSA 2QTFA 4BNLA 5H9VA 3FLMA 1NHWA 2G0AA 3DNMA 3ASYA 3CZ9A 4FCWA 4KVZA 2XVZA 4KMOA 1F0KA 1O6CA 3O73A 4I1VA 5I9BA 4TVBA 4YUVA 5KYKA 5HCNA 3A6ZA 4ESEA 2HA0A 1VI2A 3KQSA 4J16A 1U0RA 4K05A 2FEOA 3TAHA 3VU8A 2PE5A 2ARKA 1XU4A 1XTRA 2QDKA 3PUHA 4D9FA 2FPGA 3WFZA 3PS9A 1CUWA 3I9LA 1W36B 2J5KA 3ILSA 3URMA 1P2FA 3GDHA 4FHGA 1DG3A 2P9GA 5HILA 3RB8A 1SQSA 3VH4A 3AUFA 1E1NA 3AI3A 1VMDA 4KVAA 4JNKA 5EWLA 1A2BA 1XL1A 2ATIA 3HCWA 4L5AA 4Q37A 3QF4B 4NS1A 4DTIA 4MKGA 4JROA 2B83A 4OHPA 4DEYA 1JPVA 5BVGA 2W4IA 3R8CA 1XV5A 3LUKA 1V7QA 1K86A 1UKZA 2BVNA 2XMBA 2O8DB 2CMGA 5G02A 1JJFA 3LFUA 1LSSA 3L6CA 3IUPA 2QOEA 5J1TB 3I9NA 3VVMA 3KWLA 4DXDA 4P3OA 5IKXA 1UR5A 5HF6A 1UXHA 4PYLA 4ALIA 3S5UA 2QB5A 5EIHA 1H9CA 3MZ0A 2VBFA 2ZJOA 2HN9A 2CJXA 3DDZX 1OWNA 1WB4A 2D1QA 2VG8A 4WKGA 4GT1A 1IBMB 2ZT8A 3DBIA 2BEWB 3DPSA 4QRDA 5BWOA 4PC2A 4E7PA 5CUQA 4F96A 4XE5A 3SC2A 1BA2A 2YWBA 3K4HA 4A82A 1FFEA 5HVNA 1GKUB 1ZVMA 2K7ZA 2Z3VA 2IGTA 2NXNA 2ORWA 2XE4A 1X1TA 4H17A 4MARA 5D8DA 1CR1A 4DPLA 1MW8X 1GGKA 3IHKA 3KB1A 2VNIA 2DWQA 2C0QA 3HACA 2XT9A 1YJAA 3GLVA 3S55A 1H2FA 3UICA 5A03A 3NTXA 4LJKA 1GV0A 3KL4A 1Q6YA 2JGKA 4CLHA 3TG8A 2R5FA 5DLQC 4LZOA 3HP7A 3LQ1A 4MZDA 4MB2A 3KQNA 3Q8KA 3HMKA 1G19A 2B21A 1IY8A 4H7JA 3ZS9A 2EZ4A 2P78A 2FCAA 1Q0LA 4KJZA 1N7IA 3I04A 4U8HA 2PX0A 1ODJA 1A27A 4KODA 3ZHXA 2PLNA 5KWIA 3JPWA 2HNKA 1KRXA 2LW7A 2WZDA 3AEUB 3ESDA 4JJEA 2F3RA 3AEKA 3OAAD 3RRXA 1JFSA 4HXEB 1W96A 4IIVA 3DOHA 1RACA 1R10A 5BW5A 1FP4A 5I01A 2PH1A 5HUHA 3HS3A 3DFUA 3JZDA 2I7VA 4GZLA 2DCMA 3PGLA 3CX8A 4MP3A 3QVVA 5FWYA 2VTBA 3F6SA 1G4HA 3T41A 3SD7A 1CKEA 2WU1A 4V0LA 1RBZA 1G0OA 4LFAB 2C2YA 5BWBA 1M5UA 5A02A 5F23A 3FPJA 2B94A 4KE6A 3CJTA 3Q7RA 1UBNA 4WJZA 1TVCA 4PYRA 4XM0A 4G01B 4IJVA 1PR4A 3O94A 4WQMA 3IPCA 2P4SA 4G97A 2DUUA 4G63A 4RGVA 4RABA 5FNVB 3UGQA 4AZWA 5K0FA 4A6EA 3Q3JB 2ACEA 4F85A 1YT5A 4HUQB 1HQDA 4H1UA 1LBEA 1MX9A 2C5HA 3AZQA 5K4HA 2AFRA 2GASA 3ZV5A 4CM1A 1OWOA 3QV1A 6CHYA 2ZIXA 3EY9A 4LAFA 1K9VF 2EP7A 5DGCA 3V1NA 5EIEA 2ZTSA 1PQ4A 2HMSA 2QPLA 2VTVA 3KLNA 3KQYA 4LDRA 5EXTA 1E60A 3G82C 2ZLBA 4V0NA 1D1TA 2A0UA 2DTXA 3FG9A 3QXJA 1AH2A 2MR5A 2X4DA 4IHAA 4B2LA 1ST3A 2OO5A 1UT8A 2JHAA 4CFYA 4M0PA 3PEEA 3R3ZA 4TKVB 3C7DB 1KJ8A 4QIHA 4J7AA 5H82A 5AD1A 3PHJA 4WL0A 3ZVNA 2H2WA 3NAMA 4QDOA 4I5GA 4NNOA 4R8RA 4IIBA 4B7CA 5ESWA 1LLQA 1DC4A 4DSZA 1P7ZA 1ISMA 1L9KA 2IEYA 4U7DA 1U2GC 2UXCB 4Q4AA 3HH8A 4Z1MD 4LOHA 3G89A 4CM4B 1Q21A 4OXYA 5B7NA 4ZT3A 1DHTA 3I6BA 1WUYA 2C5EA 4O2BF 3CX4A 3LX6A 4N5DA 2FOXA 4ZT4A 2EL9A 3BGWA 3GRUA 2WSSD 3IRUA 4ZQGA 5C5DA 1TADA 4H9GA 4FEAA 2HPZA 1TK2A 4HXYA 3C7CB 5LQJA 1OU0A 2QTLA 4ENRA 5LZ7A 3KXDA 1OKKD 3OJCA 4B8YA 1ZN2A 5BRNA 3TIGA 1ORRA 3A27A 2C5GA 2Y99A 2YYYA 1OZFA 2V6BA 3UOAB 4Z49A 1O6FA 4IEEA 4AZ0B 3Q3GE 5IHPA 1M6NA 4Q9AA 2RAFA 1WPQA 5K6AC 1J2RA 4EG6A 4X6YA 3AFNA 4P36A 1J8YF 4GP9A 1HYGA 2YNMD 3MF4A 2K2WA 2ZYHA 1FRZA 4OHZA 4DZTA 5FI5A 5F35A 4E88A 4B81A 3IOYA 1NQAO 1X77A 1E3DA 3W1WA 4RS4A 1BE8A 4RGQA 1OWLA 4FKMA 3NDIA 1DFHA 5JC8A 3B20A 1E6MA 4TMXA 4D79A 3IKTA 1TLTA 1ZMTA 3TS1A 4P7KA 4DM4A 4LY9A 1PR6A 4EFKA 2ZYAA 3KYDA 4LKOA 5DK4A 4JJGA 1DTSA 2QL5A 3WWDA 3ZE6A 3I9OA 3PIIA 3BWEA 2W2PA 4TWJA 2FV8A 2UYGA 3HBLA 1EUYA 3CRZA 5J4LA 3IOCA 3D4LA 2AGVA 4S0ZA 3NWBA 1C4KA 2A35A 4H3KB 5FOQA 3PJFA 3AVUA 1IWOA 4H7HA 4RVCA 1IXYA 2ZRLA 4TWBA 1Z7BA 3DKKA 3NIGB 4UTZA 4FR2A 4LPSA 4NWIA 4MLZA 4DEVA 3CZ5A 5JZBA 2RHJA 1W5BA 1AMOA 1E62A 4WNYA 2X0JA 2QRNA 4BNGA 4W1RA 2AOTB 4C4YA 1KERA 4LZLA 2O3TA 3DDSA 3RS2A 1OOEA 4NESA 3YASA 1WW8A 3AL3A 4L5CA 1ZGHA 2IHKA 2ZPAA 5FTKA 2X22A 1GYPA 1NP6A 2QTWB 1KJWA 2HCTA 1TLLA 1WEHA 1YZLA 3FDJA 3TM4A 3N53A 3N8HA 5EJFA 2ZBDA 3RWOA 5GGXA 1GG5A 2QW8A 1U4SA 3H86A 1R7RA 2VXCA 3BK2A 3A0UA 4XD7D 1UBCA 1G3QA 1U9IC 1DFGA 3ACBA 3THYA 1QIHA 2QZ9A 2VP5A 3IDFA 3C3KA 3VR4D 3ZXIA 4PN7A 1V6CA 1CD5A 1OB2A 4WCVA 1Y5LA 2NIPA 3ENKA 4DMCA 3FUVA 3P9CA 5LBUA 1XJ0A 2HPAA 1LF0A 1OFHA 4WV3A 1DEOA 1JU9A 2G36A 2ZJAA 3B1VA 3GJ7A 3DB2A 1KNXA 3F6YA 4HEJA 2Q99A 3L8CA 3CNOA 3U3DA 2DH6A 1CJMA 1T4DA 2GM3A 3FPGA 4BAGA 4EYSA 5KNCA 2DY1A 2Q46A 2W2KB 1THZA 3JYQA 1EIZA 3TFWA 3CYFA 4D1YA 1MABA 4Y2PA 2X6TA 2NM0A 4D4JA 2ATEA 2PJUA 4DPKA 3WS7A 5C8YA 1XZBA 1M9NA 2OK8A 3LA8A 1FP6A 3NIWA 4KREA 3KUDA 1C3OA 4FEEA 4IBOA 3LAWA 2AZDA 5FTJA 1T1GA 4DGSA 4IUBS 4E30A 2BSQA 4LPKA 4XCXA 2KPOA 4NG5A 4OAPA 1RPJA 1VA4A 1CJUC 1TT5A 2VNAA 3LFTA 4BKOA 1V8PA 4YX9A 2AUMA 1FVOA 3T4PA 1OH7A 3BDIA 1OZAA 3OFKA 2C94A 3GOHA 3AETA 3DGFC 4TSFD 4M7PA 3UAWA 1CB0A 1RYFA 1EFVB 2BCJQ 2XDAA 3G2LA 4I5IA 1O9GA 4FX5A 2IV2X 3IRVA 4AIRA 1UFQA 1QGAA 3Q9SA 4FQ8A 5LQCA 1G6Q1 4WBXC 4F1KA 2A8YA 3B1WA 4Q9KA 3RS9A 4H0NA 1O6BA 3TQIA 1BRMA 1GAEO 1PW7A 2I7XA 2IYZA 2QDXA 3OVMA 4EITA 1OLSB 5JMWA 1L7DA 5KCMA 1KFEB 1V8DA 5JSYA 3D0QA 2GZSA 1B4DA 1V5IA 2DZDA 3KC2A 4H6VA 1JIQA 3FOAA 4KK4A 2ZBEA 4L5BA 5DW3A 3VKVA 5JASA 1ADGA 2B6HA 4QYSA 4QBIA 5JD5A 2JFGA 1P7YA 2WWIA 3QFRA 3L4JA 2JKYA 3I2JA 3RADC 5JNVA 2HD4A 5CT9A 4O1HA 1L7AA 3EVTA 1RYZA 5A1TA 2EIHA 2WIFA 2ZTHA 4G23A 4I2NA 3B5EA 4BJ3A 4Y8VA 1KI1A 3PTZA 1RWWA 3QX3A 4QFBA 1QB8A 3VBCA 3IUEA 1UJNA 2H9YA 3FVVA 2SECE 3IURA 4J2OA 1JHUA 5KNBH 3AERB 4J43A 3UKDA 1TQ8A 3C3JA 3B82A 4AM8A 2PT7A 1IPFA 4J1TC 3E8SA 1VPVA 1Y9ZA 1DC3A 2O07A 2Q41A 2QX6A 3HR7A 4NABA 3WKAA 1S2OA 3I4CA 3EEOA 1T9DA 3S44A 4RIEA 3OY7A 4N7RA 3G23A 4Q3LA 4XIJA 4AKHA 3ETCA 1W9MA 2DPMA 4ETWA 5CAEA 1WHTB 3OFSA 4PPNA 4H16A 4WLVA 3LLSA 2OLEA 4GMFA 4GRAA 4LJ4A 1IM5A 1QUFA 2ZI3A 4YQYA 3SIPA 4DLWA 5BN3A 3UXMA 4L8VA 3T7KA 4D7AA 2V6JA 1UBOS 4MW4A 1UPUA 2O1WA 3QLVC 4G0NA 2OQVA 4EHJA 2ZTVA 3SJCA 3U61B 4RVDA 3S0JA 5KU7A 1XXLA 2X58A 3E7FA 4O1IA 2V3WA 4LFCB 2HMVA 3GZJA 3EH2A 3FWNA 3NHLA 1MNQA 1T24A 1UXIA 3IAEA 3OJLA 4DCUA 4IL5A 1GG9A 1LU9A 1MPTA 5B5SA 2BI4A 4Q47A 4XRRA 3VR2D 3I61A 4OO3A 1NXSA 1SC3A 5E4YA 1NBAA 2VSFA 4XIYA 1CQPA 5IBRA 2CWDA 2QM0A 4Z7OB 4AQYB 1TA4A 3JASB 5IVDA 3OSZA 1L5YA 4HVTA 4C07A 3VTZA 4RXTA 5EL0A 4RM3A 3HB1A 5EXXA 1WO8A 4W5WA 1ZGAA 3WLOA 2AFHE 5J2TA 3NANA 1EVQA 2V7QA 4L0DA 2ZUTA 4DUPA 4RJLA 2VWQA 3T9AA 2PKXA 1EG7A 4FMDB 4NPCA 3LWBA 1W88A 3ZZTA 4Q9LA 3IP1A 5F1PA 4QDZA 3TRJA 5J47A 2Z56A 1FZQA 3N5KA 4BB5A 1BKDR 2I9KA 2C54A 4Y2RA 2Q3EA 3RYIB 1P6UA 1O5TA 2QN6A 3DWFA 1DKRA 1B2LA 2FPSA 3M7IA 3GJSA 4AY5A 1HE1C 4PLCA 3P97A 2V7XA 4FN5A 1MEJA 1SCJA 2F7SA 1U63A 1RBQA 1SCAA 3PUVA 4ZVPA 4PFQA 2Y0CA 1RZRD 2V03A 5JWRA 1DJLA 3FYUA 2GBLA 1TIBA 3BOSA 3KOUA 1L9XA 3TMKA 2WV7A 2IIQA 2D1SA 1YB5A 1W59A 4QLOA 4X20B 3AHFA 4IVQA 2B82A 4PZUA 5GJVC 2Q1TA 3A10A 3TNLA 1PV1A 2ZJ7A 1QOQB 4O3FA 2TMKA 4EENA 4HLCA 4OK3A 5C34B 1GP2A 3AJAA 4JI7B 2F48A 4BBJA 3AF3A 2AXNA 2UVQA 1XJCA 4P2BA 4RXMA 3QIAA 2CXQA 4KWIA 2H59A 1NRIA 1WCIB 2OBYA 4AIIA 4RGYA 4XYGA 2VQ6A 2W4QA 2P3SA 4II7A 3ZYZA 5LB4A 4AMVA 4ETMA 4NSNA 4HO1X 1DT5A 3VDNB 4LVNA 5AJUA 4ZARA 1S8FA 2BH2A 1U0JA 3UNXA 1ZC3A 5EJ5A 2BR3A 3DPIA 2AFIA 5E6RB 1JI0A 1MXFA 4Y0NA 5CHYA 4ZKDA 3QXHA 4PYOA 3ZG6A 3IB3A 1ILWA 5E6UA 3WB0A 4JR2A 1XEFA 1NXQA 4A6DA 3PFNA 1Q7TA 4LQLA 2IPXA 3MINB 2XH8A 1GCOA 1H3NA 4WW0A 3H8WA 3DLCA 1NXVA 3A7DA 3GV0A 4RF4A 4MYDA 3W9UA 4MV3A 1SCDA 4C20A 3QGMA 1RJWA 3ZV7A 2ZATA 2UVDA 1M73E 2DWPA 1CJCA 1CR0A 2BFBA 4PGGA 2ZRAA 2AUNA 3HJGA 4AJ9A 4HV4A 3A6HA 2WUFA 3TB6A 3H5TA 3RC7A 5CIYA 3ZHYA 1SAYA 1N92A 2DX7A 1Z5NA 4FYMA 1RTKA 4GC5A 4I5FA 4J9VA 4YT2A 5MN4A 1F2TB 4D2IA 5KJCA 2G83A 4I9HA 5BP7A 1GKYA 3FGNA 1T8TA 2AK3A 5JNLA 4W9NA 5C3MA 3H87A 1FYWA 2PL9A 2ZSFA 5LLDA 2YHSA 4YCNA 1RP1A 1Z16A 2VJDA 2YC4C 1CWUA 3SEFA 3AUJB 1ZMBA 3CWCA 2WHPA 4OTZA 2JEOA 3FTDA 1E58A 4LXGA 2A3RA 5ALZA 2YWJA 1C1XA 3GPIA 2XV1A 1BGVA 1Z18A 2PS9A 1ZSYA 3PJEA 4A1FA 5IDYA 3NS7A 4KE8A 4UU7A 4PR0A 3U7QA 2TMGA 3V1MA 2ZPUA 3PU6A 1YDFA 3FTPA 4I9NA 3ZXUB 2PYDA 1YE5A 1O6ZA 4UAVA 2GF2A 1GXSA 5CYPA 5ARBA 2I9PA 5JZVA 1R50A 3KM0A 4RTLA 4M36A 5KTPA 3PHGA 4G4JA 3D0KA 2FQXA 1YZVA 3GRZA 2WTNA 1M1NA 3WK7A 3ODGA 1I13A 2JBAB 5IK2D 1KDZA 2GO1A 2FP4A 1R00A 4NV1A 1S8OA 4WACA 3AB3A 3R0JA 4WZBA 3NBKA 5ALYA 1BMFA 3WQQA 5CPBA 2ISCA 2FPWA 4A92A 1ZIPA 2ASEA 3MWEA 1O8CA 4WZAE 2PUTA 4KEAA 4X95A 1S7CA 4BB9A 1GNQA 1B0UA 1DJOA 1II8A 3A70A 4HMQA 3NVMB 2J32A 2NN3C 1R4MA 3LH5A 2EGHA 3KWJA 3Q9UA 3VC1A 4I1UA 4C78A 4FJ2A 5IAGA 1CJKC 2O2HA 4O4IB 4YI5A 1D3AA 3FDIA 3NTOA 3RABA 3WMWA 1V35A 4LY0A 5A6VA 3EBLA 2CL5A 1HM5A 4IOKA 1JG4A 4YJ3B 3G8BA 4X6XA 2O3UA 4EEZA 1YCFA 6Q21A 5GINE 1J1ZA 1V37A 1EP1B 4FFWA 4QUDA 3UT0A 4NEGA 3KDAA 2XNJA 3LT4A 4DLNA 4ZVNA 3B3AA 3V7FA 2B69A 3DULA 4Q1EA 3S3TA 2N3ZA 3H2YA 1VB5A 1ZC4A 3CH4B 1ZXBA 3W4KA 2RGDA 3I9JA 4R1MA 2QN9A 3WG9A 5JNUA 4BJHB 2HEGA 3C3EA 1JYSA 2QSYA 3C43A 1XMOB 1JEOA 1IOLA 4MQUA 1FEZA 3O83A 4XA8A 1R74A 3R7SA 2VNSA 5G4LA 2HU2A 4AZ3A 4DQXA 1G17A 1PN3A 1T26A 4LOJA 4Q5IA 3M8KA 4O2BA 1G6KA 4IMRA 1ZQ1A 2MHCA 1XMSA 1R37A 3R9XA 4RVUA 2WHQA 3I0NA 2W6NA 3QXCA 3TEMA 1HQKA 1ORHA 4D6YA 1YQ9A 2WWHA 1I4WA 3IJRA 3OZTA 3K71B 1P9LA 3HDHA 2QD1A 1TYEB 4FFRA 1IEQA 5B55A 1HY3A 1JQBA 1YOVB 4JP8A 1DX4A 1LTKA 4LE0A 4OREX 2CNKA 3H4IA 5JY1A 1JEJA 4CXMA 3OIUA 3N74A 2XWSA 4YCBA 2RGNC 1UADA 4R9UC 4AYXA 5LBTA 1BQ3A 3CR7A 4GLLA 5J9FA 5JIBA 5DO9A 3ZDQA 4NZMA 3TRIA 5BV1A 2A1TS 4R0NA 2BGUA 1J99A 1U3DA 1VLZA 2DOKA 3KZVA 5K3CA 4QU8A 4KPFC 4JI0B 3KAPA 2ZR9A 3F4BA 3KP1A 3H13A 1GPKA 2YMQA 4DKXA 2W5UA 1T3TA 5B2ZA 3LDGA 1DBVO 3EGEA 4ALMA 2HDNB 1NNSA 3AFOA 4RKYA 3UJ6A 3DR3A 3RYCB 1UAAA 4YDHB 1EGAA 2BY4A 2CMKA 2R96A 3AVQA 3FUXA 2YBDA 5DPMA 4YRQA 3B6KA 3C6BA 1LPSA 2FEMA 4OQ4A 1YONA 2D4HA 3BFXA 3E3AA 3MMNA 4GXQA 4QKQA 5LPNA 1J8QA 2J85A 4BMCA 3FZYA 3U80A 1W30A 4TMZA 2IH5A 3FWYA 3TSZA 3BGIA 4MW5A 1PEYA 1REQB 1UBMS 1URPA 2PT9A 2ADFA 2W58A 3T7SA 6REQB 3ZNNA 2BELA 4UREA 3R7AA 1MUUA 3QJYA 4ONEA 3QLTA 4Q3CA 4B2PA 2Q7XA 4P53A 1OYYA 1IMJA 1JL3A 3EHEA 2B5OA 1LK0A 2DHRA 4L51A 5HUQA 1G5FA 1E6KA 2GEJA 5K8IA 1N3LA 1E96A 1WMDA 3ZXSA 4PAOA 5IP5A 1Z7WA 4R71A 3TW6A 1QE5A 3L02A 3OTIA 4EPTA 3OIFA 1G8MA 4F3NA 3CRNA 3EXFA 3KD2A 1ADJA 1NUHA 1H42A 1TLFA 1XQ1A 2EKQA 4GM0A 2XUGA 3UVEA 4EPRA 3K2IA 5LQDA 1ZD9A 3FN4A 3N8KA 2XDQB 3SEQA 5JCXA 4J76A 3IL2A 1V7PC 2WE7A 4NBSA 2GN6A 2ZRMA 4XDHA 4M8NE 3CLKA 4P7FA 3FDZA 3OD1A 3Q6IA 1JLMA 1GZSA 4R3NA 2XUZA 2EDAA 3FZEA 1ZOPA 2WWWA 2VJCA 3COSA 5CIWA 3F5QA 1T8UA 1X87A 3GPLA 1N9GB 3H5AA 4MV1A 1QYCA 1AZTA 4M1YA 4RHUA 4RV4A 4B43A 1ZR4A 4AO8A 1B7GO 5H80A 2W6PA 3OM8A 4KV9A 4N8DA 3TTYA 4EJ0A 2XCIA 1QGED 3BGSA 3H2SA 2LGJA 2R00C 2O4UX 4BNKA 1J22A 2GZMA 4JOQA 1SVUA 3RGWS 5A0TA 2P79A 2GK6A 3FAZA 5JCJD 1EEHA 5LP6F 4TWAA 1BMQA 4E46A 1NF2A 3C6MA 1UXGA 5B1IA 1K75A 4KGDA 2PZEA 1VJ5A 1S9DA 3HCPA 3MJHA 4LRYA 4R84A 1KOLA 1PF7E 2DP4E 3KKLA 1II9A 5JD6A 1HR0B 2O4CA 5JOQA 4G09A 3WP0A 1Q3KA 2BUCA 3RSGA 1UP7A 1YI0A 3LCUA 2G04A 1DADA 4V3BA 3HYTA 4X3OA 3NT2A 3DYIA 3WK9A 1NFRA 4O33A 2AOUA 4CM9A 2FPIB 1U80A 2IXTA 4ENVA 1GY8A 1QG4A 1EX7A 1J09A 1T6NA 2EJTA 2Z9BA 5HUJA 1ZWLA 1PQPA 1L3CA 1ULUA 2JGDB 4TKUA 1A9TA 3E18A 2BEVA 3AINA 2JI6A 1XELA 3HBMA 3KQVA 3LCCA 4ND2A 4OBEA 1QE0A 5ECYA 5T6BA 3AY6A 3IQGX 4WXRA 2C99A 3S70A 1TEZA 2UZAA 1W8DA 1MH9A 2IP1A 1NG1A 5K51A 5JXGA 2XUFA 1LWOA 3PIRA 1RI3A 1RXSA 1EUQA 1L2TA 4KFUA 2AJCA 4YJFB 5TX7A 4UNNA 1XTQA 2CLHB 2ODEA 4FUTA 4M88A 2QY6A 1VM6A 1FSGA 4KPUB 2H00A 3OBIA 3SIRA 1OHHD 2YX1A 4C87A 1W4CA 1V41E 1VRWA 3T34A 3EIHA 2DWCA 3C5CA 2XMQA 3MSXA 3DBRA 1AQYA 1TZJA 2YH2A 3AYXB 4C2UA 4LOKA 2HA5A 3ZZ1A 5A9RA 2AFVA 2ZJ6A 1IM8A 3FPHA 1IOZA 2BZGA 2GVDC 1FW6A 2IHBA 5CM9C 5CJPA 2WU3A 3WLMA 2YUIA 1Z75A 1ECFA 1LI4A 1ORTA 2CLKB 4IH4A 3W77A 2F3SA 2JGAA 4GSKA 4P58A 3PQFA 1IJEA 3F7OA 3M83A 3TQHA 3VNRA 4GM4A 3DZDA 5ECGC 1SKAA 3C3DA 1SCKA 3H9CA 3NFYA 821PA 5HM8A 2RHBA 3D59A 1DRUA 1MAUA 2HIAA 3KZOA 3A4NA 4PXYA 2YJGA 2VT2A 4PSKA 5E8JA 2C4NA 4AY2A 2O6HA 4OFBA 2IEZA 2A78A 3N0WA 1DKQA 1H5NA 1OY1A 1YDMA 3AHGA 4MMZB 4MVJD 4UQLA 3EGCA 2NP6A 1E7RA 1L8OA 5KC9A 2BD0A 2N46A 3WWOA 1TMOA 2PLFA 3ILXA 2DF8A 2QT9A 3H9GA 1KSHA 1MP0A 1NAIA 3JXEA 4KN9S 1Z4IA 2EF0A 1SBCA 2IQIA 2FMUA 2R85A 3E3LA 4UD6A 1GLVA 3PNKA 1C0IA 2CDBA 4WFIA 2ICAA 2X42A 3W2IA 3C98A 2RK6A 1NATA 1WAMA 3D7MA 1JDPA 3GJTA 4RPIA 4WK6A 2YXPX 1PEAA 3FW1A 5U4QA 4MIYA 4J7XA 1GWNA 3BYZA 3E2MA 4IW3B 4Z7JA 4GDFA 5L3VA 3AP3A 3I5MA 1Y3BE 4WFJA 3ECCA 4W5OA 5HK8A 4G26A 2QRKA 3JQ7A 1Q84A 5BRJA 4C0XA 1JG2A 1EPUA 1XZEA 3FSJX 2ASVA 5CH8A 4EYOA 4D26A 1YK0A 1YF3A 2P9CA 5JAZA 4B46A 5F3DA 4MA0A 3ZEAA 4W5JA 2WFMA 1SD2A 5AW4A 3H65A 3F6BX 4KN5A 2IL1A 3PZRA 3VZDA 3ELWA 2X0FA 2CEKA 2VA8A 4OX9Y 3JTEA 2GNAA 3FPCA 4RF2A 4JB0A 1YZKA 1BWSA 2BV3A 3AR7A 2WKWA 2FMKA 3QVOA 1Z2EA 2Y1EA 3RRJA 5CVTA 3EIFA 3DCYA 1PR0A 3W8RA 3UBTA 1A4IA 1K7CA 2JFZA 1COWD 1TVKB 5BVHB 4UUMA 4KBGA 2YRXA 4GSLA 3RAPR 3COWA 4QYWA 3JWEA 1CVLA 1P0QA 2ENUA 2PN1A 3GZTB 4LCBA 3T35A 3U9LA 4ADSG 4YCLA 3I9V1 1KS2A 1Z0DA 2FR0A 3IQXA 2HFJA 4NU0A 4GI3A 1QYRA 4B4WA 1WVIA 4BFVA 3MWDA 2Q1YA 1XZHA 2N47A 4TX1A 3TCXB 5KO2A 1LXCA 4NBUA 2ZSUA 4IQ0A 4ACAA 4KFSA 5FI3A 3HVIA 2HA6A 1JV2B 4JK3A 4KIUA 4GBJA 1PJAA 3AR3A 4GR9A 1VXRA 4KP7A 1MQ8B 4L8LA 4WY8A 5E2AA 1T13A 3VR5A 3H0CA 2EQ5A 2WFZA 3IV9A 4A0FA 2JVJA 3Q11A 4GPAA 3PGXA 3G5LA 4CI9A 5K0GA 2C3UA 1W0JD 3C6YA 3ZQ6A 4GEKA 5TR9A 1R66A 4GI2A 4Y7CA 4PPGA 4ZO4A 3PKJA 4ZYLA 2BHLA 1V0JA 2QTZA 1Q0PA 4HDSA 4C6TB 3DBVO 4DYDA 2UU9B 3IBGA 1P61B 2YVLA 3NEPX 1HV8A 1TYBE 1NVWQ 5I5EA 4YJGB 4C7BA 2QMQA 1TO1E 1NXWA 1V95A 3TBKA 4BNDA 3GHHA 3A3YA 5B53A 4ZDIA 5ALMA 1CDOA 1K06A 3EF3A 1X0VA 5BXYA 4Q1CA 3PWSA 4KQHA 2D2EA 1ZY2A 3ZWOA 4MQ5A 4PZZA 1E6WA 3ZHSA 5I7EA 2PUGA 4P80A 3L18A 4Q7JB 3CXUA 1C7FA 1N36B 3VH1A 3JQ6A 4NJOA 5JQGA 1H0SA 1Q0QA 3FPKA 4OQDA 3N6RA 3RK1A 2W6CX 3HO1A 4NJMA 1W1IA 1NE7A 3BMXA 5TY0A 1QFYA 2JAOA 5DRYA 5IM4A 2UXDB 4ZK6A 1YR6A 1DUVG 4Q6WA 2A84A 4UQOA 4UTPA 2G76A 4BIIA 3SX2A 4HVLA 1GCIA 1YS2X 2EXXA 2VDWB 2W2LA 4KQ9A 3A1VA 3WFIA 3ETLA 3R7WA 3DBLA 3P9KA 4UUOA 4X90A 4NFHA 4C14A 4RX1A 2VN8A 2NV2B 4CRWB 1Y1PA 2WWFA 5JPIA 4YBZA 1NLZA 1FMTA 1MIOB 4MVJE 2GLXA 2A9KA 4WXHA 3DDNA 5JJKA 2ZYUX 2BE7A 2HIMA 2HK8A 2PX5A 3N5CA 5CK4A 2BFCA 1RLMA 2FX5A 3PNOA 1XI2A 2BC9A 3GX1A 3IAM1 2X5JO 3GBSA 4HUJA 3WLAA 3UUFA 1W47A 2JIOA 3TTVA 1ORWA 4S1WA 2CXPA 2P5TB 2JIPA 4LZNA 3TSOA 1CNFA 1SA0B 1KVQA 2XE8A 4UUNA 4E5UA 1RXUA 3OPNA 1QC5B 1J20A 1E2LA 1JEEA 3GGOA 1Q95A 2NO5A 5TVGA 4LHVA 4OQEA 3PGMA 3HSSA 1G20A 2V9CA 3F2IA 3THOA 3B8EA 4DQDA 2ZRDA 1AO3A 2G88A 3OX3A 3U4IA 4A8HA 1DKLA 1DRVA 2OHVA 2WT4A 2B35A 4NFSA 5ALPA 1IG3A 4O3MA 3A1TA 1OVGA 2OM6A 4D3ZA 4HAXA 1CS0A 4QOHA 1SOMA 4C1NA 2G40A 1RMQA 4HDQB 1UH5A 4YUZA 2F8LA 5ABPA 6LDHA 4UQPA 3CKKA 3T5MA 1G2OA 1Z4KA 3GBPA 3TAXA 4YXWD 1ZVKA 4ZICA 1L5OA 4O0MA 5TARA 5JLJA 5A0VA 3H5OA 4QFDA 5CDSA 3K92A 2C9ZA 1NW3A 2VH2A 5EEHA 2OHIA 1DEAA 1KFKB 2JIBA 1NXPA 3CUSA 3I72A 1T2EA 3WLLA 5CITA 2XTMA 3PWTA 3V6MA 4GXRA 2ZWVA 5KNBA 2E55A 4BC1A 4MV7A 3H5NA 1I7SB 1R8SA 1VSUA 1WABA 3GJZA 2FZLA 4AQ7A 1AUPA 5JAPA 1L8XA 4IDCA 2I6UA 4IDEA 4KWCA 3B6IA 4WT7A 5HEKA 2OHOA 2J0UA 2H1FA 4KX5A 3W8EA 1XPRA 3BK7A 4PLTA 3IAAA 1ODTC 4KE9A 3C3MA 5FOWA 1JWBB 1UMCA 3BX1A 1DB3A 4OU5A 3V9PA 3ZWAA 1F5NA 1CZNA 2YVUA 3JQAA 4EPYA 2X8LA 5HRUA 4X97A 1EFLA 1YB1A 1R27A 5H02A 3T1YB 4FEGA 2R5WA 3U9TA 4GOKA 1HEYA 3CZMA 3VTKA 4DV6B 4K6MA 3LC0A 5F5NA 4CT5A 4DT1A 1IRIA 2DFDA 3GWZA 3VTAA 3MJFA 5B37A 5ER9A 3GPDG 3K9NA 2JA2A 1WBDA 5DK6A 3A3KA 4B76A 5GAJA 2IF0A 2X2OA 2YQ5A 3IA2A 3JYOA 2XT0A 2F3UA 4R2MA 2AQKA 4ESOA 2RG1A 5I7UA 4LGYA 4DRXA 2B34A 3J7TA 5CX1B 4CYMA 3HO6A 1E2UA 1AV7A 3L8MA 2CBZA 4U7WA 1D2HA 2C4VA 3AKDA 4KO1S 5HFJA 3UCXA 5CURA 4OHVA 4BVEA 1KJYA 3L7IA 1DGQA 4N40A 3SZRA 4P8RA 3W2EA 3NHAA 2C2XA 2GD0A 5EJMA 4PFJA 5LU9A 2ODBA 2VAXA 2EGUA 4MYCA 4IVPA 2JH9A 4MS1A 1DDOA 2BHTA 1FFXA 2XVXA 1H2AS 1P1BA 2YWRA 2YS7A 4ARSA 1U8ZA 2JRLA 1LFAA 3QH4A 5TF0A 1IN5A 1P31A 3QUSA 5DGIA 2DQYA 4ZQIA 3RSHA 1GGJA 1V1RB 2C3YA 4L72A 1SWVA 4QOEA 3P9NA 4PE5B 1TA0A 3ABIA 5EMMA 4ZQFA 3DV0B 5LYYA 2XUQA 4E1VA 1EA7A 2OOKA 4UTXA 2BFAA 4CL3A 3D8HA 2ZRIA 4BNIA 4G24A 2IBTA 1X94A 1RQRA 3U7HB 3TSAA 1BAPA 2I55A 1C7QA 1E3IA 2J5RA 3MNFA 3QMPA 1M2KA 2RG7A 2XD4A 2V9ZA 2Q6IA 1SFRA 3JZFA 1U8TA 1BXRA 1N7HA 4GXTA 4Q3OA 2IXDA 4TV9B 4Y6LA 2R5NA 4DY4A 1H0KA 1E8NA 2XOEA 4LYYA 4Z54A 1YH3A 4I55F 4TS9A 2Z8XA 3PC7A 2FDRA 4UPVA 3R0XA 1EUCB 1XVLA 4QPJC 4QXPA 5FA6A 4DZZA 2C98A 3OT4A 1WXDA 2SCUA 3HBNA 2O1EA 3G49A 3L92A 4TS1A 5IMSA 5KOJA 5LA6A 5L4NA 3PYLA 4E32A 5AW8A 3TG2A 3UATA 1FYDA 1KJJA 1GJRA 3U4MA 4K9OA 4Z4FA 1G6OA 1QO0D 2O3QA 2Q5CA 3AB8A 3D3WB 4NYMR 2WHEA 4DABA 1ZCFA 1A5TA 1KAGA 2IS1A 4PRLA 4YCSA 3DZGA 4K03A 3TI7A 3IYLW 2I7DA 1ZD3A 1U3CA 1DQNA 1JR3A 2WK1A 3RDPA 3EGXA 1R6UA 2OXRA 2Y4NA 3ADOA 4MIOA 5TT0A 3ZGVA 2JHPA 2OV3A 1HZJA 3LE8A 1KYVA 1DAPA 1QHHB 2UZ1B 4FJ1A 4IJWA 3HM2A 2GZ1A 3KZNA 4R3WA 1PD0A 4CIAA 1V3TA 1MOQA 2AIRA 2TRSB 1X1EA 1NUPA 2PRIA 2LTAA 2CJWB 2YBEA 1JEAA 1OI4A 4NXNB 5FADA 1EVZA 4CU2A 4YHHB 2CMDA 1RADA 4NU6A 4DG5A 2X13A 2E6UX 4INAA 3V8NA 1TEXA 2FUNB 2W71A 2MDTA 5AM5A 2WDPA 5CVVA 2EF1A 1J5EB 3WGJA 1FF9A 1KMHB 2HCFA 3K1TA 4B3TB 3JWGA 5EI5A 2FGJA 3GLFB 2V6IA 3RRNA 2WNSA 3K9WA 3C6ZA 1G3RA 3N0VA 1NKSA 4INPA 3KKOA 4KO4S 4QDKA 2HNAA 1AJEA 3JYNA 3GP5A 4PZLA 3F4KA 4JGBA 3KSAC 2Q1XA 5A5DA 5DBHX 1GQQA 1ECPA 4UFPA 3RFFA 2IX3A 2R751 5AI6A 2CNNA 2ONKA 1KY3A 1JHMA 1JILA 1EJ6A 3PUJA 4MYSA 1J0XO 1N5DA 4IVNA 2B1JA 3RSSA 1RHKA 1VYVA 1IAQA 4L4ZA 4RY2A 5EJ2A 2OB1A 5BWNA 3R0IA 4MR7A 1E0DA 5ICMA 3OKAA 2AR0A 4B44A 2HLDA 3DF7A 2R6AA 1QLJA 1OVMA 4PG7A 5FJJA 2RC5A 3U44A 4BMSA 2Y0PA 3AOEC 4U9HS 5FT9A 1QO9A 2HT6A 3C5VA 4GYKA 1A8HA 1P3JA 4H08A 4ISBA 4KMRA 4ZMSA 3FF4A 3WGHA 1SXJC 4JCOA 2VS1A 2YQZA 2ZKIA 1A9XB 3ZKWA 1GCGA 2YN4A 3ANSA 1R0WA 4DCVA 4YMVA 2J6HA 3T99A 1X6VA 3VVCA 4DARA 3DFFA 4GL2A 3VOBA 4RQBA 3DD1A 1TZBA 1L7OA 1KOFA 1Q22A 4OUDA 5FOVA 1RKXA 3EPKA 1BCRB 4MEAA 5C80A 4WOKA 2ZJ3A 4JLDA 4D8TA 4B3DA 4LXUA 1E9RA 2YINC 5K3OA 3JVUA 3ZBTA 4EW1A 1P1FA 4AG5A 4MS3A 4V0SA 3QBVA 4MWOA 5AKHA 3TQTA 1N6OA 1IZYA 4LI3X 5CLIA 3VU1A 4B75A 1XZNA 1Q0TA 1BYUA 5H3LA 2OOSA 1R9JA 3FI9A 1SBIA 1LV7A 2FW8A 2J9FA 5AKEA 1S1MA 4WSOA 3RASA 4F4JA 2A86A 2J0QA 3VR5H 3ZWBA 5BPHA 2M6SA 3CNLA 4FNGA 1OFUX 4KXWA 4WN9A 1OSNA 2GZRA 4RCZA 3DE7X 1C1DB 4C76A 2JJYA 1C7JA 1A96A 4G1BA 3GF4A 1I3MA 4UD2A 3P5BA 4PS1A 3NJRA 4M0LA 3RTDA 4MQFB 5BQ5A 3B70A 1WCV1 1FOEB 1GTSA 1J8VA 1Z25A 1DLJA 3DTVD 3NBMA 5H5JA 2B8EA 1EXWA 1OPXA 4FKBA 3ZE8A 3DFIA 4IQGA 5L3SB 1ZHOA 1SB9A 5I7HA 5FL7D 2VSXA 3U31A 3QTLA 5IW8A 1IZ0A 3VSCA 1XJWA 4NX2A 3NVKI 1UKVY 2A9FA 1DS6A 2VTEA 3P71T 1JPJA 2QTTA 4RKQA 1NU8A 3H17A 3WGUA 2UZ0A 1I3OA 3GJ4A 3E7PA 2G72A 3CLTD 4S05A 2WMDA 3OJWA 2YFQA 4F4CA 3CEHA 3ZD6A 4IDHA 4B2YA 2C29D 4M49A 4MKZA 4K0RA 4PLHA 3D7SA 4DNFA 4J3FA 1SUSA 2HK7A 2C5SA 3EVNA 4NLLA 5A3SA 1KH1A 3IJPA 3C87A 3QLEA 4LDPA 5KS2A 4TRJA 1P2DA 1C7EA 2CUNA 3IELA 2I5PO 1FNMA 1AO0A 3VSEA 5FI1B 2FN7A 2H5LA 3UYLA 1ZIDA 2D3WA 1P80A 3SBXA 3Q7QA 1M2OB 1N5MA 2Y71A 3EC1A 4JLNA 1M66A 2VWPA 3CFYA 4JOBA 3CNHA 3WRXC 2OD7A 2OHHA 4TL6A 4DLLA 2WOJA 3RVKA 3RCBA 5LOVA 2KYRA 2DERA 3I1FA 4PHFA 4G0WA 4BQOA 4IYJA 4LJ8A 2UZ3A 3CGWA 4QG7A 4R8KA 2VYNA 2ZRBA 2WB4A 4AF8A 5B4VA 3C4QA 4JI1B 2BM1A 2JDIA 3L7MA 1ZHHA 5A7HA 4K1XA 4FDTA 3I3OA 2ACWA 3N8GA 2HCBA 3PC3A 1PR3A 3O4JA 1QHEA 3RTGA 2RBKA 5EVCA 3LLUA 1DZ3A 2JFUA 3VA7A 4LDQA 1NX9A 3FWHA 4PRZA 4ZI7F 1AKNA 4O1MA 2FE4A 1W4RA 3TLBA 3W78A 5G4KA 4RMNA 2PZGA 2VNJA 2W6JA 2Z9CA 2H57A 4WVFA 1TJ5A 3BSYA 3KPUA 3G9TA 3W6NA 1GPAA 3TJMA 2VRCA 4B40A 3EXG1 3QNMA 4PG6A 1E79A 1PWHA 1KSFX 1QH0A 4H4CA 4WINA 2G1JA 1SO8A 3FJ1A 2DPLA 1IOVA 3B6EA 2OGTA 2H5JA 4RTJA 2A57A 1ADBA 3GJQA 4ID9A 3IIEA 4ZOLF 1I3LA 5H83A 5BMVF 1EEXB 1RVDA 4YMHA 3TUZC 4FCVA 1K7XB 2WOOA 2XMDA 4Y2JA 5KVQA 5J2UF 2NSLA 4G07A 3VHLB 4EGSA 4I4NA 5LNK1 3OZWA 1YJQA 3B89A 4M1SA 4C05A 5C53B 1XWWA 3WL8A 1WQ4A 3IESA 4EQ6A 4F4IA 2PR2A 3RJZA 2K6GA 3L8FA 3EX7C 2IZ1A 1SR8A 4FNOA 5AKJA 1FBTA 4L4SA 5AI0A 3TE7A 3UTDA 3AEZA 5T4BA 1I3KA 1P6XA 3PSHA 4KWTA 4R51A 1JAYA 2NU7A 1QHFA 4MMYB 4N47A 2ZZMA 5JYDA 1E1YA 1H1LA 4XWWA 2RHMA 3GUZA 2H92A 2P9JA 3BVPA 5IYZB 3U3OA 1U0GA 3GJXC 4RDHA 3QVUA 4A4DA 4CEHB 1ZRSA 3W7VA 3TJRA 1QHXA 2AMYA 2AXEA 2UUOA 3KX2A 4AULA 1GQFA 4V24A 4DMMA 4ZYZA 3L1IA 1HDYA 1TIPA 1BDBA 3I64A 1UF9A 1CG6A 4WLNA 5IUNC 2BCGY 1NASA 4TTQA 1NWCA 1UXKA 2X8JB 3GGGA 2AZTA 5LC1A 1T3LA 3H6GA 3P52A 4JI5B 3WGLA 5K6TA 3CCFA 1BE1A 2HJGA 1L6RA 4EX6A 3E9MA 1G2QA 4JL5A 1NV9A 3H1FA 4JVNA 2GN1A 2BDEA 4JKIA 4LBWA 2PUDA 4DIKA 3D6VA 3KT3A 3W5JA 4QXAA 4KQ2A 4U9IS 4GOLD 1IY9A 3AY3A 3AR9A 4JJ7A 2EJVA 3L41A 1J0EA 2RKOA 1X70A 1P1HA 2W11A 3VPDA 2PZKA 4ZMBA 5AJZA 4C7KA 3IC5A 1W52X 2OP0A 2GEVA 4RQAA 4JI4B 2XHEA 3DH0A 3H16A 1CY6A 2D0PB 2DFTA 4PHTA 4TQUS 5AIAA 3T8YA 3LPMA 5EZYF 5AVXA 1BJTA 4WHMA 1ZCBA 5F12A 5ICFA 1NVAA 4XQEA 3KBBA 5H59A 1JA1A 3QHAA 8OHMA 1X3SA 1JXQA 3ZWNA 1J7KA 2JASA 2WFAA 4B35A 2L2QA 3NWEA 5FOSA 2JJQA 2ANBA 2AQIA 2QG4A 2ZULA 3AXTA 2BZSA 2VUSA 4OMCA 4PVDA 4RKEA 4Y30A 3GZNA 2ZT6A 3PZBA 4IGAA 1HFJA 2PJZA 4MROA 4O0LA 1DVRA 2HREA 4Q9JA 5DGTA 5DISB 3FNQA 2ZI4A 2DE0X 1HZZA 5FP0A 4DC0A 4H1HA 2DR2A 3K73O 5BVGB 4UM9D 5K8CA 2FR1A 3IUMA 3RKUA 1VP9A 4I36A 4KKVA 5AHOA 4MLDA 5KOIA 1KC1A 3DS8A 4A0SA 4EUEA 1CVIA 4XGNA 3MG9A 4BTLA 4CMKA 2IYSA 1T5OA 5DJ5A 2JLUA 3G1UA 3M1IA 5LQMA 3V8VA 3AT1A 5TGZA 4FZ5A 3PKZA 3RTBA 1JJBA 3DDUA 1UKCA 2DHDA 3EMKA 1YRAA 4ITUA 5BNWA 3KCQA 1G3IA 1Z63A 1HBJA 1UC8A 2PVCA 5GOTA 3T61A 1YBVA 2PG3A 3ICEA 1WDLA 4CGZA 3O2NA 1E9EA 4AMBA 1CUVA 1JS1X 5DWQA 4ARVA 4FXOA 4M89A 3ADBA 2GUWA 3QY0A 1EK5A 2MSDB 3R7FA 2RGYA 4DMKA 1GFIA 5L4SA 1QGDA 3DKPA 4DPMA 2GAAA 2Z2ZA 2OGWA 2E49A 2FU5C 5E7MA 3T1QA 1D5CA 4NP6A 1M6WA 1XLTA 4BLUA 4YPFA 3L7CA 1WF3A 4PWZA 1ZRHA 5GZ1A 4EB8A 4PX5A 2W90A 4O4LA 5JFGA 4WOPA 3ORYA 4R2XA 3PRHA 3GRCA 1HI9A 2NYAA 3PFGA 2OCAA 4R9NA 3GDOA 3QG1A 4JLBA 4BRSA 3O8RA 5A4KA 1JAHA 4YB8A 4TUYA 3MYRA 4IS3A 1HOXA 1QIJA 2QRQA 4TMVA 4XX1A 1ZICA 3HYNA 1Y80A 4W5QA 2NUAA 5EP1A 3P20A 2Q1SA 4RFVA 1A72A 1MA3A 4H7PA 1N3YA 1Y1LA 1SHKA 2A59A 3O2QB 2G5TA 1MD9A 1A5SB 3AEKB 3ASZA 3O9VA 1CQZA 3UG7A 5CPFA 1UKEA 3P2IA 4CF6A 2ZTMA 3DL2A 5B3KA 1I24A 1FS4A 1ZA1A 5C1PA 4B7XA 1FP4B 3K9FC 3GFSA 3QX9A 3BAZA 1A77A 1CUEA 3ZD9A 4BASA 3ICVA 1KNQA 2NZXA 2QJOA 4HPXB 5FWYB 4YREA 2VTBB 4Z9AA 4I55A 2H2GA 1IQPA 1Y3FE 3L7YA 3RTEA 4CNBA 4AJJA 5FBVB 2ADMA 2AKEA 3JYLA 4S1NA 4TN1A 1Z7YA 3I5YA 3GDWA 3REFA 3ND6A 4UVIA 3R4VA 1EM8A 3OPQA 1JBEA 1X9GA 1PZNA 2B20A 3NG1A 4KRXA 1N8NA 4TLBA 5H3HA 3VPGA 1JE1A 5ICCA 3ERCA 1NJSA 3BE8A 3I09A 3R5HA 3EEYA 4ZHQA 2GAIA 4H4DA 5AKGA 1V2HE 3G6KA 5C1DA 2Q3HA 2DQSA 2QZPA 4BQNA 5CFLA 4CMGA 3I52A 3PHLA 2FWBA 2F4NA 4C5BA 3JRNA 1N6LA 4BNUA 3A2LA 2BH9A 2RHLA 3CT6A 1THMA 4P4TA 3VBEA 4DCPA 3LU1A 4JENA 1GFSA 1CY1A 3H84A 4E2WA 3NP9A 2WEKA 3W5HA 3IDZA 4MVYA 2NUBA 1E20A 4K6GA 1GKIA 5EE0A 5KNCD 2Y1XA 5CNJA 1ZUNB 2BMWA 3RS3A 1JPNA 4LTMA 2AE1A 1OYOA 2CVZA 3WNCA 4COOA 2ETVA 2P9YA 3MT8A 3W9SA 5FFMA 4EY3A 1JFVA 2Q07A 2QUBA 1T5SA 3CLHA 3IQDB 1JXMA 4B7AA 4R5HA 4Q4AB 2AG5A 3MT9A 4EAQA 4KITB 2YDXA 4ZOAA 4HNQA 4ARAA 4KFCA 3A25A 3ROKA 1U8CB 2R7KA 2JGJA 4P93A 2J7PA 1SUCA 2VEDA 4R83A 3ZDXB 4X54A 4EKIA 4EK9A 2HW8A 3G9QA 4YS6A 1SCBA 5CG1A 2E4AA 4YJ2A 2GZ3A 4MUJA 4IRXA 3KKMA 1YDWA 1VOTA 2B1GA 5B7PA 3NTRA 4RLHA 3UHPA 5JV5A 2PV7A 2F1IA 4HY3A 1H6DA 2CF5A 3W3AH 4CVNA 5IDQA 4OGGA 4JELA 2WSYB 3TFOA 2IKQA 2ZSBA 2P65A 4I8DA 3O9MA 3TQSA 2QBYA 2ZRGA 4Z0HO 3W5IA 2AR9A 3QV2A 4MS4B 4PSAA 1ZBQA 3JQ9A 1B0PA 4O25A 4HF7A 1D2EA 4YYEA 3KD3A 4BX9A 1EAMA 1K08A 3LUJA 1A7UA 2PV0A 2WWTA 5BNIA 3QHQA 3RUAA 2GTPA 2O8EA 1PZGA 4L6AA 1CDEA 2XYPA 4XDYA 3QFSA 3PX3A 4R81A 1JPUA 3A6GA 2WJHA 3QEJA 1JGTA 1S8AA 3UJHA 1IN4A 4AJNA 2QNBA 1N8TA 2WYVA 4IZOA 3AVPA 1XZJA 2HBQA 2IUUA 4NOJA 3WK6A 3DOJA 3KOOA 1RZUA 3ZGZA 4JC4A 4K87A 2BKUA 1AQ6A 3PUWA 3TDMA 4CUZA 1ZD4A 3B3GA 3U4HA 2V5AA 3GK3A 3I8XA 3INTA 5COBA 3RAGA 4BN0A 1JHOA 3MWKA 3NRBA 3GIDA 3GRRA 3U6BA 3KYDB 1GZ7A 3SZ3A 4ILEA 4EIWA 4R1SA 1D2AA 4ENQA 3ZU4A 5AQEA 5HJ5A 2CZCA 2NNLD 4ZAZA 3ZTYA 4YTEA 1GADO 5B3JA 1J39A 1F0NA 1KH3A 1FMLA 1E1RA 3SK0A 3H5RA 3C8ZA 2CN1A 1GYRA 2FJPA 3I8OA 1N5IA 3B9BA 3PXCX 4M9ZA 5K0EA 5TE9A 3OX1A 4NBKA 3LXXA 1CP2A 5B12A 3V8MA 1HE3A 4F3RA 4F5WA 5CDUA 4MR8A 1SHJA 5DTIA 4X8OA 4PLWA 521PA 5K2OA 1KOGA 1KWKA 2B4KA 2GJ8A 3U3KA 4OJKA 2OMKA 1HLGA 4L5JA 4PWYA 5TQ0A 3C6QA 2BHNA 1UKAA 5JPDA 1SXGA 1FMJA 3TLYA 3ZX4A 4DLRA 4AYTA 4L8GA 1A1SA 1FC0A 1R18A 3UUGA 2JFNA 4MWBA 4Z0TA 3VR6A 5IAKA 5EHIA 5KTTA 3NQ41 1ORIA 1GRNA 1RM4A 1KS9A 2XA9A 4RZ3A 3X2FA 4EL0A 3W0LB 3EODA 1B1AA 2PU7A 2NTJA 3AR6A 3LDAA 4XR9A 2JCYA 4YPVA 2AC2A 2NAFA 3M2PA 3SF8A 1RAHA 3BXGA 3IUBA 5ULLA 3VGPA 1XYGA 4C9BA 2EKDA 4MUMA 2QM3A 4GX2A 3THYB 5CBKA 3CBQA 3Q8LA 1NVKA 2IRWA 4DA0A 4HLDA 1FP2A 5SZJA 4DDWA 3WWPA 2YQ4A 3GAZA 3L0PA 4RTPA 3WYEA 4MUIA 1TDJA 2R48A 3GGDA 4IUYA 2FWIA 1XZFA 1Z5UA 3OEHA 3VKFA 2MOKA 1TD1A 4D25A 3Q7SA 5FWNA 3K5PA 2J0EA 1YQTA 4RMHA 1I7QB 4XCVA 4KJXA 2EX4A 1MABB 2GNPA 1DT3A 2HHAA 1YQEA 4Z9XA 3RNLA 2MSLA 4OU4A 2P5YA 5EFOA 1DTEA 1QWOA 2YY5A 2ZRHA 1G7SA 3DO8A 3M6VA 1C3OB 2NYRA 1YZYA 4G5XA 4JUFA 1U6JA 4JJ4A 7YASA 1C4WA 2NVBA 3SYRA 1YAHA 1RC1A 3B1XA 4JEUA 1OFUA 1QKIA 1QQ6A 2CLDX 4MYHA 3VX4A 4DCTA 1TT5B 3MJ4A 4UCFA 4FHDA 3OJOA 5GONF 3L8EA 5HP4A 2IA5A 1R6DA 3AETB 4C0WA 3GEPA 4TTVA 1LQUA 1O94A 1QYDA 2LCFA 3MQ2A 4MB0A 3TOCA 2VLBA 1VSVA 3R3YA 1VL1A 3EGVA 5HQJA 1AF7A 4Z4GA 1IUKA 3W79A 2CE2X 4MPTA 5D85A 4UNRA 1KAOA 1VSQA 1S89A 4GKAA 1Z62A 4ZI7A 3CA8A 1CR6A 4UULA 5BV7A 5KX5A 3VXKA 1HNWB 4CV3A 4DN6A 4WESB 4LC9A 1A9OA 1UBEA 2AKAB 2P0YA 4FILA 4KPYA 3FLAA 1Z4NA 1ZG3A 4G1CA 3HABA 4JT4A 4NNPA 2XGGA 4DYHA 4EQZA 1NQVA 4PY2A 3ET4A 4DIFA 4ZAVA 3B8HA 1ORVA 4PZDA 3NWOA 2QJWA 4DIBA 1EXNA 4HDNA 1E9SA 2OENG 3MGBA 4O59O 1Y1TA 3MCAA 3LO5A 1KDVA 2EFCB 4MQ6A 3SQXA 9LDBA 4GEGA 4AF6A 2ZI7A 5I4CA 5G0UA 4QJ5A 1DAGA 1WZUA 2C2KA 1FLAA 1G7RA 2VF8A 4P1ZA 1QV7A 2J30A 5H16A 5J2UA 3FIUA 4B47A 1H0HA 3P0JA 1B43A 4LWQA 5JO0A 4TVSA 2G4VA 2W83A 5JFTA 5D84A 3KQMA 2J3DA 4C4PA 1LA2A 2X0KA 3L43A 2FKNA 3QVTA 5CJ2A 3MIZA 4LHWA 5DHUA 2R2AA 4S35A 1ZUD1 1KR2A 2HDWA 4ZVSA 1JYFA 2G0TA 2NTYC 2WVHA 3GNSA 4M9XA 3UMSA 4BP9A 5BN3B 3TTUA 2IDMA 1DP4A 1NPDA 1N2GA 3UPTA 1EWYA 1PEDA 3ENZA 3TN7A 1PSDA 1YVRA 2MSEB 3H0EA 3PC6A 1NI4A 3OPMA 5IJ0A 3RBVA 1YZNA 2FSIA 4LCEA 1FPQA 1PJRA 5FOUA 3WKDA 2AC4A 6NULA 3GVIA 5JDCC 6GPBA 3PYMA 2LR0A 2ZBRA 4PBSA 3IUSA 1CHNA 2BUAA 1TQ6A 2VSNA 4ITRC 5E4FA 2H3EA 2QM7A 3RYFA 4DJTA 1GGNA 5BYKA 4YRCA 3TOVA 2DU8A 2EKBA 2WNHA 3B7WA 3KAJA 1L7MA 4IKEA 3T5BA 3GLRA 4EBBA 4KWHA 1CETA 4N76A 1O57A 3OZCA 1DI0A 5FHRA 4CI0B 1BH2A 3PDCA 1UZUA 3WLQA 3WYGA 3QVGB 2YIVX 3K0BA 1AIPA 4TZTA 4JT9A 1B26A 3QU2A 5J2TB 1LJ8A 3ESAA 3LYLA 1IHUA 3SYNA 1DWUA 3HJCA 2WFLA 1ID1A 1YKFA 1TCBA 4P3NA 4OYLA 2WW8A 1X8JA 5EC8A 4F56A 3O8DA 1F1BA 3BBPA 3HDTA 4LVUA 4HUTA 4IIJA 2ZE6A 5CVCA 1P2GA 4YR9A 4J4TA 1QSGA 2NO6A 2XKBA 3QUTA 3TLXA 4E4YA 4HDKA 3IDOA 4JU9A 5JAHA 4TT8A 1VKRA 2AJLI 3DVAA 4TYWA 3M81A 5AJYA 3IULA 1NN3A 1S6YA 1ZVJA 4FDVA 3AFMA 3FYUB 1OTHA 3PUKA 5EZYA 2BM9A 1QX4A 3G1TA 1D6MA 4ZALA 4CN9A 5LZ4A 5A0FA 5J3JA 1WF6A 1KMCA 1JAXA 3GCDA 3WSWA 4UZFA 3HBFA 3F3MA 2XCSB 4DXHA 2P9ZA 1EP2B 1EAYA 3R5FA 1YRHA 2QAGA 5FFNA 4O2LA 2FPOA 4HT3B 2AQ8A 1VL0A 1J33A 1GNRA 2AB0A 2HCRA 2NW6A 5T64A 1WBBA 3TW0A 4QU5A 3QE2A 1K8XB 2DETA 1NTOA 3LQ2A 4M21A 2XUHA 2F90A 2JI9A 2ZEJA 2HJWA 3N2KB 2AFIE 3AHCA 3K32A 3BTOA 1AGYA 3IP5A 4C22A 2AFIB 4TRNA 3Q5GA 1JYEA 2EEPA 2QLFA 3V46A 5CA1A 1C8VB 5EEGA 1FFSA 5J4VA 3IE1A 4I7EA 2EG5A 1EFHA 2KI5A 5E6UB 4M55A 3TXXA 4GS5A 1UBKS 2PQ6A 3D6FA 5HIAA 4YO7A 1T0UA 1TKBA 1W76A 4PO3X 3WSVA 4NR0A 3TTXA 1L8QA 1CYEA 4AP9A 3OQVA 2JZCA 2PZLA 4CFZA 1YV9A 3IXMA 4D74A 1T3SA 2YZ7A 4BGDA 1F7VA 4FI3C 2IYWA 1L5RA 3R20A 1J1UA 4Q4DA 4BLPA 2BFBB 3SS7X 3ECAA 2BM8A 1WY5A 4XTCS 3VISA 4XR4A 3RW9A 5JAIA 2JLAA 1PVVA 3RRBA 5KQPA 3ULKA 4YMGA 5L51A 5KJFA 1XQXA 1Y81A 3NV7A 1GUYA 4IPTA 2GBFA 2O1XA 1W1UA 4FX2A 3IVRA 1KE2A 1ACMA 3TMYA 3GPCA 4TLCA 5KI6A 1JZQA 2H85A 1U5CA 1BWPA 1ZP6A 5F4ZA 3UZUA 2KW5A 1KYQA 2YN2A 4NF2A 1LBTA 4BXOA 4ND8A 1TUGA 1RXVA 3A31A 5GJCA 4WN3A 1E4YA 1YCHA 5DCWA 2BONA 3L05A 2OV2A 3PPXA 1SXPA 4MGIR 3LBFA 1G5HA 2OUIA 1BG6A 1ZOOA 1QP7A 3PD7A 3UAOA 3R9IA 1A8UA 5EXDA 4BUZA 4L3WA 4B3RB 1Y4AE 1YVDA 1C1XB 1GO2A 1U9IA 2ID9A 3D02A 4TMKA 4HLQB 5JLAA 1KRWA 1MC8A 3OF3A 4DNPA 2HLPA 2HYDA 4B4VA 3MS7A 3U7QB 1N2CB 5FPSA 5M3BA 2HRBA 2QPAA 1BKYA 4RIHA 3ESYA 1I2MA 2GYVA 3I9V6 1UJ6A 1RJ9A 4JJAA 1GXSB 1CSEE 2HPVA 4CZ2A 1YB6A 4CM8A 1HDRA 4LSGA 1JIIA 2V97A 2PRZA 1Q1NA 2QV7A 4J1SA 2Z2KA 5TC4A 3RVPA 3ZHUA 1C9KA 4POOA 1E2KA 1O95C 3C85A 4YT4A 4WZBE 2IK8A 1F7UA 1VQ1A 2FP4B 5DX8A 4WZBB 3DYVA 1WD5A 2Q28A 2CFTA 1M75A 3RFXA 1R4NA 3MWEB 5CTJA 1UBGA 1BKSB 3BA1A 1FK8A 4I2VA 2E4UA 4MPPA 3EYAA 2QRVA 5G0VA 2D2IA 5TVKA 1FA9A 4LSZA 1DBQA 1OU4A 1R4MB 3AR8A 3HC7A 4LMRA 4QTYA 2O50A 4JSRA 1TQ4A 4R68A 4XSVA 2QX8A 3RC3A 5BR4A 4CIWA 4JLOA 1YIAA 2H1SA 4MV9A 2H1RA 3EXIA 3IS3A 4BNHA 1CU1A 4P38A 4PRYA 5CLFA 3JQFC 5JEDA 1HEIA 3K70B 2WVAA 3M4XA 5EJIA 1YR3A 4JVOA 4G1MB 1KZHA 3KEQA 3INYA 2B1RA 1IBLB 3ADCA 1VI5A 5DU2A 4JFRA 3ZDBA 1QG6A 2CW5A 4BVHA 1ECJA 1XQ6A 1EQ2A 2WVGA 5T67A 1RFLA 1VLJA 2OGUA 4MR9A 1NM5A 3HPQA 4J3JA 3GCGA 5C5CA 2P9QA 3KTDA 1CFJA 3VR6H 2BMFA 4DLVA 4G5OA 2ZKLA 3QI7A 4KYIB 5DHSA 1GGHA 2PUAA 1BCSA 1JHRA 5I4IA 2B8TA 2NGRA 4Q18A 1GD1O 3SR4A 4AZ3B 2PZMA 5CNIA 4D8WA 2BT4A 2VPWA 4FLEA 5CDTA 4ESHA 5JSUA 2A33A 4OQQA 4C03A 5DTEA 4J1TA 3R9XB 2AD1A 1UBUS 2QX7A 3T1TA 1XCLA 4QUEA 2QSZA 3II6X 3I5UA 3WB2A 3MC1A 4R7GA 2BTEA 2ZWOA 1GIAA 4XM1A 1R0LA 4KIGA 4FB4A 3HJRA 4DL9A 1M1UA 5IF9A 4LF8B 2QUAA 4LBVA 4MV4A 4BEWA 3AEQB 2DBVO 2VAVA 3KVRA 3PDIA 1ISHA 4ER7A 1VSBA 3QLVA 2D2VA 5I9TA 2WTMA 3OCJA 3MLEA 3OM9A 1MLDA 3JARB 3IAFA 3JQ8A 2RK4A 3OOYA 2QYSA 2G4CA 4PBRA 1LQ2A 5EGNA 1FU8A 4YUXA 2P4HX 4O4JB 4QGBA 3O90A 3NTUA 5KUTA 3I4LA 3NGXA 3H8SA 1YMQA 1BH6A 1US8A 1WKCA 2D0IA 3BD6A 1H2HA 1PNVA 2ZWMA 4YECA 5FI0B 1WQ3A 1OXXK 1YL6A 3CLUC 2ERYA 5BSUA 4MVXA 4NCKA 5JYBA 3O5AA 5ALKA 3VC7A 4EF4A 1P9WA 4R5MA 1Z13A 5AK6A