2AOTA

Histamine methyltransferase complexed with the antihistamine drug diphenhydramine
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
288
structure length
286
Chain Sequence
b'MRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYEYDLLSTMDISDCFIDGNENGDLLWDFLTETNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histamine N-methyltransferase
publication title Structural basis for inhibition of histamine N-methyltransferase by diverse drugs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 101
structure length 286
sequence length 288
ec nomenclature ec 2.1.1.8: Histamine N-methyltransferase.
pdb deposition date 2005-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2aotA00
5D1HA 4PYLA 4YV2A 2C7RA 3E7PA 4PCLA 2IDKA 2XVMA 3B3FA 2ONZA 4PINA 2FRXA 2C7PA 1KPIA 3TMAA 1INLA 1D2HA 5EOVA 3HCBA 3KR0A 4M38A 3SVZA 2H00A 4R6WA 5DTMA 3LKDA 2PY6A 3K0BA 4FT4A 4KW7A 3ELUA 3G8BA 4OX9Y 3B7PA 1O54A 2FYTA 4KDCA 4NECA 2Y1WA 1NW6A 3OU7A 4V0QA 3PVCA 10MHA 3NMUF 2Q41A 2CMHA 1AF7A 3HVKA 1DUSA 2P40A 5DTRA 1R8YA 1JQDA 3KR2A 4QTTB 2H11A 5T64A 3X0DA 4A6EA 2P7HA 3FPJA 2JH8A 2VS1A 3SMQA 4GUAA 1X1CA 4YUZA 1NBHA 3A26A 2G70A 3BGVA 4X61A 4RSRA 4HGYA 5EEHA 4E31A 1EG2A 3DTNA 1ORIA 2B2CA 5CVVA 4PYIA 4MWZA 5EEGA 1BOOA 4ER7A 2FPOA 3FPGA 5HEKA 4C03A 3HVJA 3KPYA 4GQBA 5CVUA 5FWDA 1JTEA 5F2OA 3ME5A 3SR4A 1JR4A 1RI2A 3EGEA 4KWCA 5DM4A 5LQRA 3HNRA 2ORED 3G2OA 3QOWA 1EIZA 1RJFA 1VBFA 1P91A 3NDJA 3LBFA 4GBED 4X41A 3IEIA 3TPZA 2OY0A 3P2KA 3PT9A 5FWAA 3FYDA 2B78A 3HTXA 5FQNA 3TRKA 2I62A 3AXTA 2P3OA 5E8RA 3M6UA 3OFKA 2YUIA 3NVMB 4CKBA 1WS6A 3SM3A 3PX3A 3DR5A 2C7QA 1D2CA 3GJYA 4IKPA 2BR3A 3HCEA 1QZZA 2NXJA 2ZVJA 2OZVA 3PFHA 2G72A 5C9ZA 2UZ4A 5LQNA 2PX8A 1TW3A 2YR0A 1UFKA 3KKZA 3P9CA 3KPVA 2P3QA 1RI1A 5DXAA 2PX2A 3SX0A 5E1DA 5CVEA 4RX1A 2ZBPA 4DF3A 5IKMA 5EPEA 5CUQA 5K0EA 2XBMA 1TPYA 5C0OE 3EVAA 3TM5A 3HM2A 5EKXA 2PJDA 4LECA 3DLCA 4HTFA 2FK7A 3C3YA 3LKZA 3KQWA 5FADA 3VYWA 3EVEA 4RTMA 4GC5A 2LD4A 3CGGA 2AOTA 2XYRA 4YV0A 2HNKA 9MHTA 3JWIA 4PYNA 3B3JA 3DMFA 3BWBA 3EPPA 5KYGA 3DXXA 2ZZNA 5LQUA 5FCDA 4XUDA 4AZVA 1L9KA 4YMGA 3LDGA 3THRA 3KQOA 5CM2Z 1SUIA 3A7DA 3A4TA 2O0LA 5DTQA 4QPNA 4RYLA 5E1OA 4B17A 3R3HA 1KIAA 2PXCA 3FYCA 4OA8A 5EHGA 3NWEA 4RVGA 5GIOE 3O7WA 2NNWB 1QAMA 1RI4A 5HIJA 4PWYA 3EMDA 5DSXA 2HMYB 4P58A 2VDVE 3NW9A 4RV9A 4F85A 5JUWA 3HP7A 1B42A 3VC1A 1YZHA 4ATNA 3QV2A 4CKEA 3Q7EA 4EKGA 5K09A 5K0BA 2I7CA 3LHDA 3LCVB 5FA8A 2QRVA 2YXEA 3HCCA 3BKWA 4YMHA 5GM1A 5LSAA 2IH2A 3GRYA 4AZTA 1NT2A 2OYRA 1FP2A 3P2EA 4PYJA 3AWIA 3LDUA 4FS8A 3TR6A 4C05A 3G89A 2QM3A 4RTPA 1X1BA 2AOTB 3KQYA 2HV9A 4M7RA 3B3GA 2JG3A 3UA4A 1G8SA 2ZBRA 4L7VA 4DZRA 3UJDA 3P9IA 3FTCA 3GO4A 3KQTA 3BWMA 1XTPA 3DXYA 2ZSUA 3M33A 1G60A 5EQJB 3BT7A 4RTLA 2Z6UA 4HRAA 4WVLA 5HIKA 1FP1D 3R6TA 1N7JA 2GB4A 2O06A 1XDUA 2PT9A 1EJ0A 2ZIFA 4IV8A 4OA5A 5DXJA 5KVAA 3BKXA 3OPNA 2GS9A 4MTLA 5DX0A 3TOSA 5M5BA 4R6XA 4A6DA 3T7SA 1NV8A 2PLWA 3P9NA 2EJTA 3HVHA 1RI5A 2FK8A 2GA9A 3G2PA 4FGZA 1V39A 2EFJA 3C6KA 4BP1A 1O9HA 2V74B 1ZGAA 4LWOA 2N47A 1T43A 1I9GA 2IFTA 3DLIA 5DLYA 5E2BA 4FP9A 2ZW9A 2Z6QA 4BLVA 3K6RA 2QY6A 2AVNA 3PTAA 5E2AA 2QRVB 3G5TA 1O9GA 1QANA 2NXNA 3P71T 1XCLA 3UZUA 1MHTA 1QAOA 2AVDA 2VP3A 3LSTA 1AV6A 1VP9A 3G2MA 2PV0A 4QTUB 4PNEA 4UOEA 4HC4A 3UJ9A 4AZSA 1BKYA 4U7PB 2A14A 1P39A 5EG5A 1F38A 1I4WA 2IIPA 2NXEA 2B25A 1IM8A 3SGLA 2UYHA 4ER6A 3I5UA 5DWQA 3KQMA 5FQOA 1R6AA 5LQAA 4P7KA 2DPMA 3C6MA 1R00A 1VP3A 2PKWA 1AQJA 3MTIA 1VE3A 3VSEA 5GWXA 3TQSA 3KQPA 3LCUA 5EZQA 3M6VA 1KR5A 2NP6A 1HMYA 3PFGA 1KYZA 3KU1A 3KQQA 3UBTA 1KPHA 2PT6A 3BGDA 1WY7A 3GDHA 3LDFA 4JXJA 1BHJA 1UIRA 4MHTA 4AZWA 4CTKA 2PWYA 4M36A 2EG5A 5EMKA 3DUWA 1YB2A 1M6YA 3AJDA 4QQKA 5T67A 2BM9A 3JWJA 5FUBA 1EJ6A 1TW2A 2R6ZA 2CWWA 2PSSA 2BH2A 4XUEA 2VDUE 2AOUA 5P8WA 3LL7A 2ERCA 2IGTA 5K0CA 4Y30A 2ZULA 2HWKA 3AXSA 1IY9A 4FZVA 3QOXA 4E32A 2ZZMA 2ONYA 5LQKA 4P7JA 1JQ3A 3UJAA 2CMGA 2ZWAA 3UFBA 4QDJA 3MQ2A 2GH1A 1XVAA 2PXAA 3HA7A 4P7GA 1EAMA 3GWZA 1JG2A 4OBXA 4PYOA 5ERGB 4DCMA 2ZIGA 3A27A 1RJDA 2PBFA 5K01A 2ESRA 2O07A 4RWZA 3B89A 5E9JA 5ICEA 3KQSA 5LQJA 3P2IA 4PYQA 4V0RA 5MHTA 4EVIA 1QYRA 1XDSA 3HVIA 2IP2A 4BY9E 3FUVA 4R05A 3LBYA 3E8SA 2AOXA 2FHPA 5H02A 1YFJA 2C7OA 3FTEA 2JHPA 3DXZA 3EVDA 3G7UA 3IYLW 3PLAE 2EX4A 1JTFA 1VQ1A 4PIPA 4BLWA 4CXMA 1M0EA 1VIDA 3R24A 2BM8A 2IH4A 4FSDA 2IBTA 5CVDA 3RODA 3MTEA 5HIMA 2O57A 4PYMA 1KPGA 3UWPA 2ZCJA 4XUCA 1WG8A 3ERCA 3BWYA 3M6XA 5E9WA 2AN3A 1G38A 3JWGA 3KR9A 1PJZA 3SSNA 2FCAA 1QAQA 1RJEA 3O31A 5KQRA 3M6WA 4EKIA 1M6EX 3UA3A 5DRTA 4DM3A 3DMHA 3OZTA 3A25A 4IV0A 7MHTA 2BR4A 1NBIA 4PCAA 2AOVA 5DPMA 2PXXA 4E2ZA 5DT2A 3FZGA 3MB5A 1L3IA 3BGIA 3REOA 3IV6A 1NW7A 1KP9A 4PONA 1SQFA 8MHTA 3LPMA 3R0QA 5B1SA 3B5IA 3EVCA 4ER3A 4C06A 3GGDA 5K05A 2JJQA 2B9EA 2IBSA 5GINE 3L8DA 3MCTA 1JG1A 2JHCA 3CVOA 2GLUA 3FTFA 2PWPA 4OBWA 1RJGA 2BZGA 1BC5A 4WXHA 1Z3CA 3GRRA 3OZSA 4YUWA 4HSGA 4HTFB 4E2XA 5EC8A 3I9FA 4DQ0A 4E2YA 5FTWA 2IPXA 2YXDA 2YQZA 3HEMA 4GOMD 2OKCA 3DP7A 3G5LA 1WZNA 3Q87B 4K6MA 4QDKA 3WSTA 5K0FA 2GAFA 2UYQA 3CBGA 1DL5A 1DCTA 2YTZA 3G2QA 1SUSA 3D2LA 4DCGA 2P35A 5BXYA 4RTSA 1XCJA 2XYVA 1X1AA 4MQ4A 3V97A 3NTVA 2ZZKA 5E1BA 5HZMA 3MAGA 2ZWVA 3DULA 2BR5A 4QQNA 5CCXA 5DM2A 1N7IA 1NKVA 1ZKDA 4GOOD 2KW5A 5DX8A 3DMGA 1Q0SA 3MCZA 5DRYA 3AY0A 5DM0A 3TM4A 1NW8A 1SKMA 3ELWA 1FJXA 3R9XB 2UYCA 3BUSA 3KPWA 3ER8A 4C04A 2AR0A 5C1IA 2OB2A 2V7EA 4PIMA 5DSTA 1NW3A 4M37A 3E23A 1U2ZA 4QVKA 5GOZA 3HCAA 5EHIA 5EGSA 2I6GA 5GM2A 3VC2A 4GF5A 3TLJA 2P1DA 1VL5A 2GPYA 4GOND 3TKYA 4RTQA 4E70A 2NP7A 3NWBA 3UJ8A 3V8VA 3I64A 3RIEA 2ZLBA 3SSMA 2AZTA 3C3PA 3CJTA 3EEYA 4OQDA 1SQGA 3I58A 4F84A 4YUYA 3CJRA 2H1RA 2P8JA 4EMSA 1P1CA 2XVAA 2O05A 3PB3A 3ANXA 3C0KA 5HFJA 5K0NA 4BLUA 4RTKA 4POOA 3O4FA 4RVHA 2ZIEA 3T7TA 1KYWA 1AQIA 1ZGJA 2AN5A 5ICGA 1ZHFA 3IHTA 4E33A 2XYQA 4CTJA 5F2NA 3H2BA 2YVLA 4HGZA 3LCCA 3OE4A 5LQCA 5FHRA 5K0GA 4MIKA 1IXKA 2AN4A 2AS0A 3PX2A 5KS2A 1L1EA 4RTNA 2WA2A 1G6Q1 4RTRA 3EGIA 1F3LA 4ISCA 5JR3A 3UJBA 2P41A 1G55A 3HCFA 4R8SA 4Y2HA 1L3CA 5GIPE 4KIFA 4GEKA 4C4AA 4AX8A 5FA5A 4RTOA 4KDRA 3CC8A 4KIGA 4FT2A 3OE5A 3A7EA 3NJRA 5E8JA 3P9KA 2ZTHA 3T0IA 2IH5A 4X63A 3FUUA 3BXOA 3THSA 4DKJA 2G1PA 4DA4A 5IH3A 4GOLD 2ADMA 3KQVA 4HH4A 1H1DA 5G02A 3OFJA 3U81A 3GXOA 4OQEA 2QE6A 4E2WA 1D2GA 3EVGA 4F86A 1ZG3A 1WXWA 5CVJA 4ZTBA 2HR1A 1X19A 2WA1A 3NDIA 2ZFUA 1ZQ9A 5FULA 5EVJA 1X1DA 4IWNA 5EKUA 3GNLA 4ER0A 3MHTA 4U7TB 2WK1A 3MGGA 5K0JA 1RI3A 1KHHA 3FRHA 4HG2A 4G56A 2YXLA 2G8NA 1I1NA 3M4XA 3OU6A 3FUXA 3GRUA 4XCXA 5T6BA 3MERA 2JHAA 4GC9A 4LG1A 1JSZA 2G71A 1NE2A 5CD1A 5HOQA 3CJQA 5DM1A 1PRYA 1NV9A 3F4KA 3UJCA 2EJUA 2AOUB 3EMBA 3I53A 1N2XA 3BWCA 4PGHA 4X60A 3FPHA 1G8AA 4DMGA 2YX1A 3DH0A 1JG4A 5BP7A 2R3SA 4O29A 1FBNA 1R18A 3JWHA 1P1BA 4CKCA 3SXJA 3CCFA 5CIYA 4R8RA 1FPQA 3TKAA 3EVZA 3M70A 5EMJA 2QYOA 1ORHA 1HNNA 2VZ9A 5E9QA 4FR0A 4C07A 4CWAA 2NXCA 2Z6AA 4E30A 5HILA 1WXXA 3OU2A 4C08A 3UJ7A 5LR6A 1EQAA 1OR8A 3G88A 3ORHA 3HCDA 3EEOA 5K03A 2JH9A 2HTEA 2ZBQA 3FPEA 5EMLA 2OXTA 2VDWA 3NVKI 3EVBA 3OZRA 4YUVA 5CCBA 3GU3A 4PGGA 4YV1A 5F2KA 3GRVA 4H0NA 4LWPA 1XJ5A 3EVFA 3S68A 1XXLA 3BZBA 3FTDA 3LECA 1JG3A 4FSXA 4RVFA 2UYOA 3P8ZA 3CKKA 4X1OA 3OCJA 3TFWA 3EGVA 3T7RA 4RTJA 5D1NA 1YUBA 2Y1XA 3GCZA 3ID6C 2PX5A 3KR1A 1JSXA 5EIFA 1Y8CA 5BW4A 2P3LA 1VLMA 3GIWA 1R8XA 3FPFA 1JQEA 3FUWA 3HA5A 1YFLA 2OO3A 1UWVA 4QPPA 3G8AA 2DULA 3ELYA 2CL5A 2F8LA 2IDJA 4Z2YA 3ELDA 4AUKA 3FRIA 3ER9A 4QVGA 4EK9A 5GP1A 2OB1A 2AOWA 4KVZA 5ICFA 3DOUA 5EMMA 2E5WA 1R74A 5EZSA 4BP3A 5E1MA 2PVCA 3KHKA 3KPUA 2I9KA 1VPTA 1SVUA 4KRGA 1SG9A 2K4MA 1YZ3A 4P7FA 3RW9A 1NW5A 4ER5A 3SSOA 3FUTA 2OBFA 3E05A 1L3BA 4PYKA 5DX1A 5EIWA 2B3TA 3UJ6A 5KQSA 3LGAA 3KPJA 2NYUA 3LX6A 4RVDA 1YF3A 3GRZA 5FHQA 1Q0TA 1KXZA 5ICCA 2CKDA 5BW5A 2PGXA 3PS9A 2OPBA 5HIIA 3P97A 4YUXA 5U4XA 4EQZA 2PX4A 3HA3A 5K8VA 5K0LA 1XDZA 1MJFA 2P7IA
chains in the Genus database with same CATH superfamily
4GXRA 2PCJA 2I2AA 4IDBA 4E21A 1FPMA 1B76A 1UOQA 1OH6A 3LF2A 3K1AA 2JGJA 1CUEA 4MUIA 3IA7A 2VYFA 1UJNA 4MA0A 2RHOA 1UPTA 4MWDA 3E4CA 3OURA 4OQ4A 4IS2A 1Z7WA 2GBLC 2JGKA 2PGIA 1PZEA 1ORDA 1VKNA 2VHCA 1RYDA 2ZIAA 3HB7A 3I1IA 1WW8A 2OAEA 2RG7A 4MK4A 4MUAA 5HWSA 4O59O 4Q19A 2F8SA 4B87A 5JZSA 2P40A 1AGRA 1J2JA 1ZH0A 2YQ4A 3BE8A 1HDIA 1MB9A 2VIIA 2VSNA 2H52A 4M6WB 3T8YA 4FB4A 2IHYA 1UFRA 2C4NA 2VS1A 3U6KA 4TV9F 2CD7A 1TK9A 1ZINA 3GJ8A 3P2MA 3OOHA 3GUCA 3H9GA 1GIAA 1UP4A 1SQSA 2B20A 3FMPB 3M6LA 5CMLA 3LSYA 4Z4HA 4H77A 3FPGA 4C03A 1E4EB 1XZEA 3WWCA 3NGMA 4UULA 4HGPA 1G5RA 4BZXA 3ZBUA 4ZK6A 1C3EA 4XQ9A 1RI2A 2ETXA 3HNRA 4I8IA 3P96A 5IRCD 1IXSB 3NAQA 4Q21A 2VPZA 4OFBA 3E1KA 3LBFA 1GCGA 3DM5A 3V8BA 3ZZ0A 4JJKA 4UAVA 4IUCS 5JRDS 1T5TA 3H4MA 3T7CA 1XQ9A 2R7LA 2X9NA 3MGBA 3NTUA 5LJLA 4E1VA 1KI4A 1MDFA 4R3UC 3CINA 5KMGB 4AD8A 3I12A 3EOZA 1NOIA 3DLHA 3P20A 3FOAA 4CEHA 3H17A 1PK9A 3ESDA 3QWHA 5EQDA 1BEEA 3K9CA 5IM5A 1THMA 4ID3A 4NS1A 1MQAA 1TW3A 2Y1DA 2ZYAA 4NK4A 1OAKA 3JS5A 1ICEA 2QPLA 3C39A 3DPUA 3ESAA 5HP4A 3X1DA 1ZN8A 4WLFA 3LQYA 1NX9A 3HXTA 2PTHA 4OPMA 4GRIA 4GDFA 1F0YA 1O58A 5JO9A 2WWHA 4P81A 4ZOLB 3NP7A 1E3LA 4YJHB 5IJXA 4CMIA 2O8DB 4L4RA 3C3XA 1BCRB 1B6GA 4GYJA 4ZO4A 3U3RA 3VH2A 3ZWQA 2G7ZA 3O91A 2ZZNA 5KYGA 3LT4A 1BJKA 1S2OA 2JKVA 4W8OA 3VO2A 2M1XA 4UMVA 2WJ4A 1KI9A 4YMGA 5LQUA 5CFNA 3DV0B 3MBIA 2JGEA 1GTJ1 1SC3A 4JQZA 3A4TA 3I8XA 2O0LA 3PNVA 3SYTA 3TTTA 5LQMA 3RSGA 4Q47A 3FBTA 3IEMA 3O2NA 2O8FA 2JLAA 1YR9A 3DMTC 1YOVA 1N7HA 3U31A 2I7VA 1JKFA 3ECAA 1QNLA 1NR5A 5I9NA 2YYSA 1JE1A 5B58T 3EMDA 3B6JA 1EK2A 3MXTA 3FNFA 3HA2A 3UMYA 2V7TA 4NI5A 3ILHA 3AEUB 3HV2A 3V7NA 3U4QA 1E6MA 2PGLA 2YJNA 3BKWA 5E3JA 3VPHA 4JLOA 1O0SA 2W2TA 4L8FA 3INTA 4EUEA 3HVRA 1HQKA 4CNBA 3FGZA 4DQKA 2FJPA 4GR5A 3JD1A 1P6XA 3WGZA 4H16A 3GFRA 4LNAA 3SHFA 3TPCA 2WJ3A 1X1BA 2DAPA 3C74A 1RZRD 2W2KB 2XZDA 3UJDA 1U99A 4QDTA 1JXMA 1LPBB 3EXIA 2P8SA 4EELA 1AD2A 2O2CA 4DRZA 1KS2A 3IBSA 4PFQA 1EJ0A 3RV4A 2V5UA 2EBUA 5JBQA 1E2BA 2PPLA 3A6JA 3TOSA 1UXKA 4RHXA 1CIJA 1E5TA 4O25A 4A6DA 3WWPA 4F8YA 3EXG2 4TQGA 1WX1A 1G2OA 1TADA 2CLDX 2G9VA 1SVOA 3O4IA 4G2TA 4RJJA 4WDQA 3WB1A 5AUOB 3WK7A 4PHFA 4R7ZA 1MKYA 1OZFA 3THOA 5H68A 3G2KA 3SZLA 4GDMA 3AVWA 1P4SA 2XAUA 3WQSB 4UM9B 1RKBA 2IFTA 3DTTA 3KDPA 5KREA 3K9GA 3SBEA 1TAHA 2XQGA 2V54A 2OBBA 4XJSA 3S2FA 4U9UA 1K7XB 5KWEA 3IRVA 1PQWA 3QF4A 4IEEA 1UBMS 3UZUA 2WABA 4KFCA 5AK6A 3MMZA 2GPAA 2SICE 2QP3A 4EIWA 3E7DA 5B1YA 3DFMA 3FAZA 4UOEA 2AD1A 1I7QB 1T2FA 4WH0A 1XQXA 3KLOA 4HC4A 4MARA 3AERA 3ETJA 4MVJH 2A14A 5B36A 4O4HB 5I6DA 1QE3A 3D1LA 3DD5A 2Z43A 1I2BA 1U0BB 4WZBA 3B1KA 4EYQA 3RTEA 3AI1A 1GG9A 4L4XA 4MDFA 1DLJA 1A2BA 5DW3A 1VLZA 1Z47A 5FAKA 1T4MA 4TRJA 2XA9A 2I7XA 4ENVA 2ZYGA 2B8JA 3LQQA 1XKTA 3L7NA 3LCUA 3AFHA 5KNBD 3S2YA 5KTOA 3EG5A 1CY7A 4YP6A 4IR7A 1PTJC 1X1QA 4KQXA 5BOVA 2JKZA 3OUTA 4BCBA 1C3VA 4ZIRB 4BDTA 2A8YA 5DH9A 4UZFA 2NU7B 3FOBA 3NOVA 2JVIA 2AHOA 3GPCA 3VU9B 4FKBA 4PE5B 1I3KA 4D9GA 2VZ0A 1C7FA 2XPCA 4MKFA 3ZEIA 2BE7A 3H8VA 3OEYA 4IFBA 4KRYA 4NENA 2B2XA 3G1WA 2IGTA 1GQOA 3WZMA 3ZLVA 2PD3A 3VSDA 1RZVA 1IY9A 1RD4A 3PPIA 3BQ9A 3GMTA 4FFLA 3EIFA 1ECCA 2WHRA 2ZYWX 2KI5A 4ZO6A 4D9MA 1LCIA 2Q6IA 4P5EA 2C07A 4YNBA 1ULAA 1R4ZA 1XNGA 2CHGA 2REOA 3S0JA 5BRJA 4CEJA 3J7TA 4W8HA 2HKIA 3OI7A 3GEGA 4MHOA 4W7IA 3PFFA 2FXVA 4IJ6A 5CCEA 3PZBA 4Z0NA 1EFHA 1SAYA 2VF2A 4L15A 2ZAYA 4OYYA 5AKHA 4LS3A 3L41A 3NHJA 4BQOA 4X8HA 2VP0A 2R751 4BY9E 1HUQA 1PEYA 2C2YA 2IIBA 1PG0A 2QHXA 3OLWA 3QKSB 4AKSA 4BC1A 2XF8A 3R40A 2JFOA 1L4YA 3KTFA 3PL5A 3TQOA 2JHPA 5B30A 1FMLA 2DBRA 4XWGA 1H69A 1XPOA 4PHTA 3DNMA 2GBPA 2OD7A 3AHEA 1RBZA 4KXWA 4HVCA 1KF0A 2AG5A 1SKUA 1TJPB 3EVTA 3NEJA 4BLRA 4HAWA 3PXXA 2QUHA 3UHJA 2VXOA 3G9UA 4RH0A 4TTQA 3ZX5A 1TCVA 2GR9A 4ND2A 3ZWPA 3GLGA 4G8CA 1PLKA 1SCUA 2XGMA 3IBGA 3M6XA 1HORA 3TFQA 4DILA 3EGXA 1Q19A 4YRGA 5JAOA 3PRHA 3JTEA 1E6UA 2RHLA 2CLMB 3MFQA 1RSZA 2ZM6B 4KVFA 3PQCA 3ZUPA 1Q3KA 5CIWA 3QY9A 1N2SA 2EJWA 3EDRA 4F60A 3A1VA 5B37A 3WYFA 4LXUA 2B4RO 1DPGA 3H6HA 3HU3A 4RGBA 3EX7C 1G20A 3ZDEA 4PONA 4MUFA 5AYVA 3R0QA 4DQDA 2Q3EA 1RCTE 3OAAD 2UVPB 4MJLA 3MJHA 4RS4A 3FFXA 4AS3A 5DTEA 3CVOA 2I8CA 4KQMA 4Q1CA 3PLNA 4WLVA 4CKWB 4RIFA 3H8JA 1FTSA 3KQNA 2WG1A 3R74A 3BXXA 3TG8A 1DQNA 3EF1A 1CS4C 1GNLA 5LMUB 1EP1B 1UMCA 4MR7A 4CVNA 1Z0AA 1IWOA 1KMQA 3PYXA 3JQ8B 4KLNA 4OMUA 4DCSA 3UMCA 3NAMA 4MVJF 5K6AC 1Z56C 2I6SA 1QZUA 2KB0A 2UDPA 3JALB 1WJGA 1C7EA 4KXYA 4Y9SA 5HM6A 2VDJA 2FAXA 3NTVA 2FRDC 2H4WA 1AC5A 3W79A 5ALHA 1L4NA 2B36A 3JQ7A 1E0JA 1EM8B 2H1SA 1BN6A 1EVQA 1RBQA 3HADA 3HUFA 1CUBA 1VXOA 4TX1A 1F1BA 1HTTA 3AK4A 4JGBA 3LOQA 3G79A 1Y4SA 2YJGA 5DYTA 5SZKB 1A9TA 2OHHA 1O87A 2QNIA 4JZKA 1KJJA 1PFWA 1NVXQ 3JQBC 1I5EA 1O6BA 1V1MA 2VK2A 1M5TA 2Q8PA 2YW9A 4QU8A 5JHGB 3ER6A 3R3JA 1NUUA 2Z30A 4ZV7A 1PE0A 3S2UA 2W11A 4YCNA 5KPDA 4WPGA 4N48A 2F4VB 1L1RA 1DTWB 1OFGA 3OP4A 1U7PA 1XAHA 3IVCA 4GOND 4OP2A 4GP9A 4UBIA 1P9OA 4DIFA 3GLIE 1TLFA 2ZLBA 2CT8A 1W46A 3R8CA 4BHTA 3TI7A 1KMMA 5GV7A 1I3CA 1AQNA 2B6HA 4D4JA 5CDTA 2UUBB 3GFOA 4X00A 3I30X 4C4ZA 1KE1A 2OV1A 3V2GA 2QTWB 3KWLA 4AICA 1M1NA 2FW8A 1EDBA 1SRQA 2FG7C 3FFTA 2G9NA 4ALJA 4D4GA 4POOA 2XB2A 5I3ZA 2G5TA 3MEQA 1XZFA 3UCEA 2XXAA 3EH1A 1QWOA 3ENWA 3JVVA 4Q7LA 5C1PA 1C5KA 1QOPB 2Q1YA 4Q3OA 3OE7D 1DAGA 1EX7A 3FDZB 3FH0A 4R2LA 5TVKA 4NULA 3MHPA 3FLBA 1JJAA 1M2VB 3EQ9A 3HHEA 3LCCA 1EFRA 3GHYA 3HYNA 3PZRA 4QDUA 2FW0A 5CTAA 2OCPA 1EVYA 3I2KA 3L0SA 2DMRA 5A4AA 1P62B 4RO0A 4NCKA 4BRWA 4P1ZA 4G97A 3LUDA 4NKRA 5J9FA 1FSZA 1CRWG 1NMYA 4MUGA 3U7JA 4BNKA 3B5JA 3WAKA 1U0LA 1R0ZA 1XEWX 2BGKA 1R0RE 1YJBA 3INGA 3FLMA 1YL7A 4JR2A 3T0IA 3FVVA 3JYLA 1UEJA 1GUFA 3VNRA 1EGMB 1MF7A 2FSFA 3BCSA 3VO9A 4G0ZA 1G7TA 5E4TA 3RBZA 5AVXA 1YQTA 2O3JA 1N6PA 1NAHA 1NDHA 4HRXA 3U7HB 3IB3A 1Y7HA 4M9QA 4BWVA 2K7FA 1U0OC 2F67A 4DRXB 3LXXA 4FFDA 1NQXA 1BXZA 1UZUA 3FRHA 3IR5A 3BYZA 4KH1A 1ZMTA 3CNQS 1OFIA 1O5TA 4IIGA 4NBUA 3P7MA 3GC6A 4JYCA 4KPFC 2PUHA 5JAUA 1MCZA 4R8VA 1C1YA 2YY7A 1HZZA 1T9GR 1XZGA 2ORWA 5EN4A 4DCJA 5ILOA 1U0FA 1TU4A 1RXWA 1UZAA 4QYXA 1XRRA 1ZN9A 2OBYA 3AP3A 3GW8A 4DGQA 3GBVA 2YWDA 3G8CA 2Z5FA 1FC0A 4KR9A 1N77A 2A78A 2ZDHA 1RRVA 1GKUB 4HNAB 3CONA 1U5CA 4TGLA 5LA6F 1T26A 1MX3A 1ATIA 3SFZA 1Y9DA 4RVOA 3HI4A 1FU8A 1IZ8A 2WF9A 4IIBA 2G0AA 2ZJZA 3BJIC 3L46A 4X7BA 3UJNA 3FPBA 2ZWIA 1KQGA 2ID8A 1HNNA 3DDOA 3C5EA 1R0CA 2OD9A 1FFSA 3LFHA 4K9LA 3RFFA 4DLKA 4NP6A 4E30A 1ONNA 1TUBB 5AI9A 3QEBZ 2I3GA 5ER6A 3UJ7A 3P0HA 1OR8A 4RK6A 4HDMA 4O4IA 5KTKA 5K03A 4LTNA 4IH4A 3VVLA 1KAHA 3F67A 5K6RA 4KK3A 1GZSA 3K0AA 1AHIA 3QSYA 2NV0A 4YHHB 2ZWPA 1MJHA 2Q2VA 4KAFA 3NVKI 3GZNB 4TL6A 2H4HA 3OJLA 4JUAA 3HEBA 4PX5A 2X0FA 5A06A 4ZCRA 5LXTB 3QEAZ 2VKQA 4Y6RA 3ZIAA 1PYDA 3HDHA 4ZAGA 1XDGA 4UXIA 1QFJA 2RJ3A 4EGQA 3V4FA 1D2EA 1WNTA 1YQUA 4X64B 1MQ9A 5CAEB 2H4YA 3HE3A 3KR1A 2BFFA 4DBLC 1GZVA 4QUIA 5EIFA 3ZUGA 1U2DC 1MB3A 3BF7A 2XA2A 1R8XA 2AC4A 3ZDXB 2ZRHA 2HK8A 1Z37A 4QUAA 3STUA 1YZQA 1Y3IA 5BR4A 2M6RA 5EA2A 1ISJA 2GJSA 1QB8A 4W1RA 5AWFC 4NSNA 1GDHA 3DOHA 2XQKA 3DZ8A 3RRMA 3QVSA 4MQFA 1R74A 2I9KA 1VI6A 2KPOA 1XI2A 5E6UB 2FUG1 4TVKA 3FKSA 1G9TA 1VDZA 1E1LA 3NRCA 2F4NA 1JQBA 2WMYA 1GNVA 2AMVA 4YJ3A 5G0UA 2DY1A 2ZETA 1FF9A 2G04A 2OE2A 4K3UA 2P2YA 1B3BA 2EFGA 4MVJI 2W6QA 5FTLA 3KQUA 2RHRA 4Q93A 5KNBH 3LY8A 1JAYA 1AXEA 1JT9A 4KPUA 3BXHA 2JFZA 1PG2A 2ZRCA 1ORWA 2QJOA 3KB8A 1JU4A 3N7TA 1O89A 3DYIA 3PS9A 1H3FA 3I3OA 4HAOA 4ND8A 1XZIA 4FEYA 4E88A 4ARSA 1EXDA 2PLNA 1AX9A 2DF8A 3GJ4A 3HJHA 3WSWA 2C9CA 2WMDA 5IC5A 4N5MA 4WRRA 1Y1TA 4G3XA 2LZ0A 4V3BA 4P31A 2WTEA 4I9HA 3RC8A 2AFHB 2OXRA 3B6ZA 2YXPX 3F78A 4LGCA 3RM3A 3TNDA 5FT9A 3KYDB 3ROKA 4BO3A 3ZVMA 3MSXA 1ZCBA 4B3HA 1DXQA 2QJTA 5EJGA 1MAHA 5C8ZA 4DBZA 2HWXA 2NO5A 3DE6X 1CZLA 4WBSA 3ZCUA 4BV9A 1PJCA 1EU1A 4LXXA 4NE7A 4EJSA 2J3JA 2JIMA 4Y6SA 4YDSA 1R8YA 1JQDA 5KSYA 4AZ3A 3KBBA 3ILXA 3TLZA 3K4PA 2XUJA 1YBHA 1LI4A 1SN7A 2YJ6A 5FD8A 4DDTA 3BGVA 4ZPJA 4HJXA 1VG9B 1YK1A 2D1YA 3EOAI 5IT5A 4JU8A 4XASA 3O3OB 1SXIA 1DBIA 1F8FA 4R9VA 2OCBA 4V0LA 1Y34E 4KHZA 1V5GA 1D9XA 2Q8QA 4N4AA 4P2BA 4NAVA 5JCZA 2JVJA 3ZNPA 3WLMA 1ZM2A 5FWDA 4P9NA 1GTL1 3BRCA 4F9EA 4YT2A 1EXNA 2B4KA 3PE6A 4Z54A 2O3TA 2VAPA 3PHCA 2O52A 4NJMA 5AW0A 3CRW1 3UGTA 5FWAA 4PG4A 2WAMA 3ZY4A 1P77A 1V96A 1MB2A 2NQTA 1QYVA 2QTVB 2QMOA 1YJ8A 3AQ4A 4CG3A 5BSWA 2NU9B 4QU5A 3AHCA 2G40A 1X7WA 3ABZA 3PX3A 1XT6A 4NAHA 3EZFA 1PV1A 3Q41A 4RANA 4YO8A 1HQYE 3T5MA 1O95A 3GEIA 5F33A 4PG5A 5KTYA 2JLQA 3DDWA 1KO8A 5D3KA 1W36C 4KMMA 1P7ZA 4M76B 4TM7A 2F59A 5DXAA 2ISCA 4D4MA 1CUXA 3CKYA 3T95A 1VIYA 1LPSA 2UU9B 5EPEA 4M60A 1DCMA 4Y9TA 5BO5A 2UXCB 1CJSA 4KIWA 3HJAA 3QXHA 4J9UE 3BM5A 4AY2A 4GE0A 1GPBA 3TX2A 4HV4A 1DI0A 4YJGB 3H6KA 4P35A 3KOXA 5BNZA 4HLNA 4JXZA 1JEYB 4LF8B 5I8WA 1BRTA 3LO8A 4UUQA 3WGHA 3VPGA 2BBOA 5CYGA 1T2CA 4MV4A 3SS8A 4W99A 1L4HA 1Y98A 1LPPA 4LSGA 5DO9A 3FYSA 3UC5A 4I1VA 1G16A 3GD7A 4XX1A 3DR3A 5T6MA 1YT5A 3OF3A 2CDNA 2XDAA 2F3QA 1DAEA 1FDIA 2JGLA 1E1NA 2XHEA 4U6SA 4XDHA 2ET6A 3VYSB 4PWZA 3VMFA 5HQ3B 4EGAA 1NKSA 1MGPA 3I0MA 2GAAA 5KJCA 1TFRA 5DSXA 4ALKA 3D3NA 4F97A 5JUWA 3WGUA 4E5DA 2ROQA 3HSYA 3IDFA 4B7CA 3TLCA 2PUWA 4ENSA 3LW7A 3OPYI 4AYTA 5AJTA 1Z5UA 4DQUA 3O26A 2E4YA 5CW1A 4BO1A 5K3OA 3AR4A 4Q9DA 1M1ZA 3EC7A 1I8TA 3GRYA 3NVAA 1ZRNA 4BVBA 3SICE 5HHTA 1GLNA 3TR6A 2RGWA 2AKEA 4MDEA 3SKVA 5FORA 4EHDA 2GMWA 1RP7A 2BMAA 2MWMA 5BNFA 3LTEA 2JG3A 4A4DA 4DZRA 1FLVA 4RFSA 1EUCA 2MDTA 2OV6A 3EQ2A 1XAIA 5HF6A 2EKBA 3ZHXA 3HBNA 3L8MA 1RJ9B 5EQJB 4C3VA 5F5XA 1U6IA 4U7FA 4ALLA 4D0RA 2RHJA 5A4FS 3WIOA 2FG5A 3HCWA 3HUUA 1N7JA 5CG1A 2CC2A 5DXJA 4EUSA 2PT9A 1N0VC 3Q6IA 4P4UA 3PQ6A 3LUFA 1XTUA 4JT2A 1XOIA 3ASZA 3AHGA 5ALXA 4R6XA 5G0TA 4DA9A 1WOYA 4DIEA 1RLMA 1DBPA 1U0JA 2J32A 4G5FA 4NVRA 4NCNA 3U4GA 1XYGA 4KWTA 4JROA 4EA6A 2EFJA 2GM4A 3MOSA 2BUBA 2C88A 1HQDA 1X7XB 2JFHA 1QCYA 1YJQA 2N47A 4GX2A 4IYRA 2BFAA 3H1BA 2ZJYA 1DDIA 1P29A 2K7ZA 2CB0A 2YH2A 3PD7A 3T34A 3OTOB 1JJBA 1TO6A 1TZBA 2QRVB 3K16A 2YN0A 4U8HA 3AVYA 3TEMA 5I7WA 3V4OA 1BH6A 4IIJA 1AGPA 3HKBA 1JFFA 4CW7A 3PQ3A 5AVOA 4DC1A 4D2IA 5GOTA 1V26A 3V1UA 4ZI7A 3GRPA 3IOYA 5CB8A 4MGEA 4FOTA 3LT0A 2JHFA 2HZ7A 4JVOA 4V02A 4DR2B 2BFMA 4PANA 2XB6A 3KAKA 3TTSA 4I2VA 4C0AC 3U4QB 2VT3A 3OCWA 2HXYA 1I5OA 2FWBA 4HLUC 4ILKA 3F4LA 3VKUA 2ZYSA 2QT1A 1X13A 2E82A 1C41A 3U5TA 2CUZA 2BE9A 1SH7A 2BHTA 3BWDD 1ULTA 3C41J 4ALNA 1R0LA 2CHUA 2HHLA 2FSGA 1WY7A 1ZOIA 4R3WA 5CH3A 3S1SA 2C3YA 4CTKA 4RQAA 5TEVA 1K2VN 4OP3A 3JYQA 4MJ7A 4QQKA 1SURA 3TIXB 3B1VA 2O8NA 1KOFA 4AY6A 5CB4B 3O03A 2VSXA 3IIJA 1OSNA 4S24A 1RXUA 2O2XA 4DV4B 4KBGA 2W70A 4EHIA 3ZDDA 1ZHHA 3H42B 1FJ2A 3R3YA 3COPA 1T9BA 4XVRA 4DLVA 5LM3A 1NMEA 2DM6A 1EXWA 5JMTA 4AY4A 2HIGA 4RXMA 1QIFA 1RC8A 4FNOA 4KIJA 2ZWAA 4XOIA 1LC3A 2FSPA 5FLKA 4XWAA 4P7GA 2RD2A 1Y82A 2GZMA 4MW5A 4BZWA 2Y1FA 1P2BA 3PCTA 3STXA 2YWJA 2FPGB 5I7FA 1R9MA 2J6CA 4G67A 3C24A 3K9BA 3NNDA 3O0TA 4B8YA 3JAKB 1YZVA 2B5WA 1OYWA 3G0DA 3K6KA 4MEAA 4UBLA 3ZDZB 4QL3A 4BNNA 3H13A 3LBYA 1VOTA 6ABPA 5H02A 2ZUFA 4PC7A 4UXJA 1ZXXA 3HZOA 4FK8A 3AHIA 2DE0X 3TNFA 4YJ2B 3TN7A 1HT3A 3ENZA 5CJ2A 4ZDKA 5ABPA 4IJKA 1RLJA 4X84A 3OKAA 3TQTA 5HG0A 1E6WA 4AJPA 5KHOC 3MWLA 1F0NA 1QU3A 3FNRA 1KJQA 4Q15A 2GTIA 3NOXA 1A96A 1W36D 3FWPA 3C1OA 4A73A 3JQAA 2QAGA 1A9SA 1FFWA 3Q2OA 4A27A 3QKIA 1BDJA 4RHCA 1OX5A 421PA 4UHDA 2I67A 4ZAXA 5A4IS 3TB6A 4YP7A 4CCYB 3ZWDA 3DOCA 4C2TA 3NOQA 1BS1A 1SOVA 2NXWA 2V96A 3H9JA 4R5HA 2XT9A 3UOWA 4OAPA 3JWGA 3GEMA 4N54A 4LF5B 4OHMA 4HH0A 2E21A 1RPTA 2FCAA 2IKSA 3CUSA 3MILA 3Q7RA 5ALNA 5BSTA 4M7PA 3T4XA 4DAOA 1GA6A 4EKIA 4AQ7A 1GGHA 3NKFA 4EVSA 2AFRA 5CIQA 2ZM5A 4R54A 4HNUA 4PY2A 3RWOA 2BR4A 1Z7YA 4MVJM 3QXCA 5CXSA 1WBJB 5LWQA 1EFRD 2VJCA 3N3AC 1AHPA 1VTKA 3REOA 2CLHB 3D8TA 2HHJA 2G0TA 2GOYA 2P78A 2VT6A 4HFRA 2R5FA 2QTRA 2WDPA 4A2WA 1DWQA 3KJQA 4RM3A 3QMPA 4UPVA 2GLUA 3ND9A 3DC2A 4L85A 2OQ2A 2J0UB 7GPBA 2FWMX 4N3CA 1EXMA 3Q9LA 3IP7A 2KMLA 1FFXA 2QD3A 3I9FA 2PWZA 5G1NA 2HPZA 1V5IA 5FTWA 1QGUA 1UPBA 2GVNA 2IPXA 4EITA 4GRDA 1XZJA 3QRWA 2PYZA 4WZZA 2XZLA 1I32A 3FCCA 3G2QA 2FRVA 1SHTX 2FSHA 1JAIA 2VWPA 3KDAA 3IFSA 3ZDQA 1T8PA 1ND5A 1PGOA 4CYMA 4OUDA 4K46A 2FEOA 4RH1A 1NPTO 3O0DA 2JAXA 3VPAA 5EJ7A 1JTVA 1Z28A 2P9GA 4OQQA 4QULA 4RNCA 2RGAA 5M34A 3OLCX 4IX1A 1NKVA 1ISRA 1STOA 2KW5A 2NSDA 3M89A 3GLHA 4NYIQ 5A3JA 2OHGA 4RORA 2G06A 3ELWA 1E58A 2QM0A 1GRNA 2DSNA 2CD9A 1PEDA 1NTRA 5F7ZA 3CIOA 4OL9A 3DVRX 1VJRA 1E9EA 1I2CA 3E1SA 4J43A 4XFKA 3Q40A 3LT2A 3ZLBA 2FMIA 1M7HA 4ON9A 2QZ4A 4N5DA 3A9WA 4IHJA 2ZUWA 4MV8A 3DEAA 2M6KA 5BV8A 4TWJA 4MV3A 3R0VA 5KKNB 3BGSA 2ZUBA 1BDHA 1CT9A 1JIJA 3QMMA 4F4IA 5NULA 3HSSA 2EWMA 2PIAA 3ABQB 4HNRA 2ZR9A 4IJ5A 4JU9A 4WJLA 5M04A 3RUHA 3QX9A 4L4SA 3UXMA 4BNTA 2PUAA 2O05A 5EPOA 1LPOA 2W8BA 2RGYA 2ZRKA 4H59A 4OD0A 5L3SB 1GU1A 5FBRB 4DLRA 4BB5A 2PKQP 2QSUA 4Y2YA 4LNUA 1SBNE 1CHDA 5GQSA 1NVDA 2REQB 4N39A 1JB9A 2CLIB 4QSMA 3S8MA 3FCYA 2Y0EA 5KS2A 2IOQA 1NN0A 2CL6X 5DWVA 5E6SA 4AYWA 3RHSA 1X3LA 4LZJA 3IHLA 1UFOA 2CUTA 3K1YA 1PX0A 4O0MA 4OJQA 3HB4X 3QWIA 2PL9A 4J7XA 2PT7A 3IQXA 4EHLA 1OH7A 3NGXA 1MRNA 1T36A 4AB1A 4XPZA 1L7PA 3HCOA 3DUFB 4Q7JB 1HDGO 2JFXA 4MULA 3NM5A 5DCYA 5E8JA 5HBRA 5ILQA 5ARDA 3AKCA 3C8ZA 2Z1MA 1KJ9A 4E5KA 2EL7A 3C6XA 4HH4A 4XIIA 3GFSA 4XFDA 1P9RA 4DN6A 1AB6A 4JI6B 4ND1A 1JUDA 3DZIA 4E2WA 3K6SA 5F3WB 1Z62A 2FZGA 4DLWA 5IXJA 4MB2A 3NDIA 3IUQA 4KQHA 4M1KA 3A4MA 3DQZA 1ONSA 4A82A 1C4WA 1F2UB 1BEZA 3FKSD 1AK9A 2GN2A 4KRXA 2R00A 1FB5A 4YRAA 3LIIA 4J1SA 2HNAA 2MJLA 1XMVA 2VHUA 2W98A 8ATCA 4DR5B 1YS9A 1XA0A 1QQBA 2O5CA 5AM0A 1P7WA 2IOYA 3R41A 1ZA2A 4FFPA 1T0JB 4CV0A 1XHEA 4FX2A 4BVLA 2C9BA 4F4UA 3H65A 4DCVA 1XCOA 5C3MA 3LY7A 4PC3A 3PRJA 4KO3S 1Z0ZA 4U7DA 2YWEA 3IPCA 2PJUA 3I4CA 4M2LA 3DJYA 1QRTA 4FGSA 5AFSA 2O59A 1DO2A 1M74A 5EVCA 4ZT6A 2B94A 1FFEA 5KQLA 1GGFA 1N0HA 2FOIA 1MENA 3OZDA 4CKCA 2FPUA 3NXKA 4KJZA 4D6YA 3M70A 4UXHA 5L7WA 1MAAA 1XZHA 2O3UA 4K86A 4QPDA 3CZ4A 3QEKA 3VKGA 4B7ZA 2X1LA 2WRZA 2QLBA 1NVVQ 4YECA 2ONJA 4EO9A 4AKIA 3KJNA 1LDMA 1IC6A 2BISA 3AFGA 3T1TA 2FDRA 2OLJA 5J2TB 3CRRA 2HI0A 1Z0SA 2HLNA 1HI9A 4KQ9A 2Y4NA 5T4FA 4HAXA 1Q7EA 3QLEA 3IP5A 5LBTA 5LBUA 3S7ZA 2A30A 1V3TA 4XARA 4CFSA 1XTZA 2L17A 4Q3DA 4KU4A 1HNZB 2Q3FA 5AR1A 2ZB2A 3K31A 3LECA 3ZHTA 1VE5A 3CR8A 2H18A 3E58A 1PFKA 2C20A 2NZWA 1FRZA 1JXAA 2PCLA 5EKSA 2CV2A 1Z08A 2NW6A 3HLYA 4PVCA 3DVAB 4YAEA 5DULA 3WLSA 4HR7A 3TSCA 3U4HA 4Q37A 4EHAA 1J0DA 4LFBB 1UBUS 4PC1A 3S7TA 3IT1A 4DCUA 1F1JA 3SC2A 4HQ0A 1EKXA 3W2HA 1Y3AA 4BX3A 1NVKA 3CVUA 3N5KA 3QF7A 3BIXA 4DIMA 1L7DA 1N5DA 2Z5GA 3C8HA 4HUTA 5BY2A 1FNCA 1UBTS 4B48A 3EGDB 1M1XB 5KJ6A 2Q3JA 3ZKWA 5JS2A 4X7RA 3S2GA 4ASUA 5G53C 3WKEA 1SOMA 1CXZA 4F56A 2QAGC 3IBYA 3VKHA 1OA1A 1LBIA 2Q4DA 3ED1A 1SXHA 1OT3A 1YB4A 2HMWA 1QRDA 3IPRA 5DX1A 1T5BA 5B1EA 1RKXA 3SEAA 2PX6A 3HKEA 1VJ0A 2FZWA 4CQMA 1PR2A 4BQIA 4YJFA 2F1OA 3TECE 4AX4A 1UQRA 2DBYA 7YASA 5MN4A 4FW8A 3ZLTA 3DDUA 4Z8XA 2NPIA 3EG9B 4KO1S 2ZCVA 2RH5A 3EISA 3EZNA 5K0LA 2RI6A 4QOEA 4TMKA 4QEDA 1IN1A 4EFDA 4DSNA 3C4QA 3K72B 1P45A 2BDUA 1INLA 5CLIA 1CUHA 1FX0A 3KS9A 5EOVA 3VRHA 4YCSA 5J4KA 3BDIA 4PO8A 1NE7A 2DPGA 4DWOA 4BJ6A 4EARA 2O7RA 4HDOB 1JX6A 4DIOA 3JAWB 1O54A 4J3FA 4NXMB 1ZS9A 8ADHA 4YAUA 4FIDA 3GJTA 1QC5A 1YHYA 3I04M 3D3KA 1SBYA 3PVCA 4GBGA 3HVKA 3OEWA 5AHXA 5BVGA 2EW8A 3BMOB 5M29A 4DMMA 3A6DA 1OWNA 2C7VA 1VYVA 1NF8A 2BSQA 3GEEA 1F17A 1K6IA 3DBHA 3W7BA 4BVGA 4Z5XA 4RSRA 1JIQA 3NASA 3LTNC 3FPAA 1X7YB 1SD1A 1RYHA 2UYGA 3NDRA 4KOAA 4PYIA 3A6ZA 5KSPA 3ZGLA 2NU6B 3QJGA 3ROGA 2B3DA 2IE8A 4Q7KA 3D2AA 4OV6B 3GJ0A 1WCXA 2VXCA 4H60A 1JTEA 5DHSA 4ZO8A 1GPNA 1F4PA 1RWXA 1SHLA 2DBZA 1MFZA 2B0JA 3EY4A 3Q5EA 4UFNA 4XH9B 4EYSA 2J9RA 1FLNA 3E27A 3THWA 4YLEA 1P91A 3FCOA 2FN9A 1T2DA 1N5KA 3SSNA 2Q4EA 1KP2A 2D1FA 4I9UA 3WADA 4BGIA 2QZJA 3K3PA 2GD0A 3SZ3A 2P3OA 4QUDA 1YRYE 3FOCA 2VK1A 1NIPA 4MVJG 1FRQA 1QHGA 2X86A 3A2KA 2K2WA 2DU8A 3PXGA 2Z8XA 2R1VA 1K66A 1A7UA 5BN3B 3HCEA 3IO3A 4HYEA 2DHDA 2BGUA 3OCCA 3FNHA 2CYCA 1X8XA 3OT4A 2H2AA 1PSZA 3B53X 2QVLA 3KU4A 2G4CA 1Z34A 2AFIA 6Q21A 5KYXA 1TJ3A 1X8LA 4KIUA 4MS1A 5IKMA 2ZBPA 2HADA 2AW3A 2OOKA 5FBVB 2GX6A 5C0OE 2EV9A 2HMTA 4B3CA 3TM5A 2AEMA 2WE8A 3R5JA 1DWUA 3IVGA 5C46F 5K8LA 2VAVA 4CM8B 1MFPA 1Q83A 1QS0A 3L1JA 3JQ9C 3PSHA 4L2IA 4NATA 1Y5MA 1HSOA 3PIDA 5TQ0A 4BV8A 4ZVLA 1DADA 4EYGA 2UZIR 3B1WA 3GFGA 5DGXA 4IGKA 4RD6A 1U9CA 2JJ8A 5DM60 4CDRA 4TSKA 1CERA 1JHAA 1Z6GA 2PVSA 3CTPA 3PC3A 4Q4LA 5ALQA 2AMLA 2CFOA 5DMHA 4XX0A 1DZ3A 1E7YA 1JNXX 3U44B 2QYHA 1FNNA 1EWYA 3N0RA 2WFLB 4P33A 3V1MA 3FFBA 1U1GA 1MEEA 1WTAA 1KMNA 1ZL2A 1RDFA 4Z7QB 4LW8A 2CKMA 1YL6A 1X0XA 2Y8EA 2YIDA 1DV1A 1CR2A 4I2NA 1N1EA 1RWOA 5G3ZA 1YULA 3F5SA 3RVNA 5F12A 3RT1A 5FBQB 4ZQIA 4F91B 5EESA 2YV2A 2DQ4A 1UP6A 3QXXA 1IZYA 3L1HA 1O77A 1B42A 2G6TA 2MYUA 3E22A 2JLRA 1U28A 3GA7A 4QXMA 1MVNA 1UZLA 1JEDA 1Z18A 2X2EA 4JP8A 2O8BA 1Y8RB 3ONNA 2YXEA 2G07A 5EJ4A 4C88A 2D2IA 1CRZA 1AGYA 1CUGA 3L92A 2PUDA 2NV2B 4ARZB 3N53A 4D9EA 4FD2A 4JQSA 1JHYA 2WJZB 4J0FA 4R1OA 2O2SA 5DN9A 2CNBA 4ZI5A 2XKJE 4BKMA 1TEXA 1UJCA 1QF9A 4WGGA 4YC7A 2R00C 1XXHA 1XFAA 5T5QA 4IOKA 1RP1A 3FCXA 4S1PA 4LISA 2OVBA 3BWMA 2IUTA 1XNJA 3DXFA 3WDKA 5IAGA 3HL4A 2VDKB 3Q3GE 1GQFA 1K5DA 1U9IC 2GM3A 2ZJ8A 1X42A 3NBAA 4JL6A 3K8OE 4V03A 4MTCA 1WP4A 1UAAA 3FFWA 5KVAA 3QMVA 3FCUB 5DX0A 4RHFA 5LZ8A 2GEVA 1NV8A 2HQRA 2WNIA 1SBQA 3NV9A 2EJTA 3P9NA 2GA9A 4PSKA 1EFKA 4RD0A 1U8AA 1SOUA 4I3HA 2J9YB 3BCUA 1WQ3A 3KB1A 4ZI3A 1Z5PA 2PL5A 3DLIA 1ZD4A 1I9GA 3PKZA 4OXRA 1BQ4A 4Z9AA 3T99A 4FP9A 5BW6B 2XBLA 3JQAD 2WW8A 2J46A 5K3DA 2CL0X 1KEVA 2CJWB 4BLVA 4MWEA 1A9XA 3G17A 4Q16A 2DTEA 4XEHA 3OMWA 4B35A 1T5IA 3G2JA 5EXSA 1ZVJA 1RXYA 2ZSJA 4PNEA 1ZD2P 1USVA 1WULS 1FS5A 1PL6A 1QGDA 2REXB 4EPTA 4RJTA 3RIYA 4EPWA 3L8YA 3U4AA 4D6XA 4EJMA 4H1WA 4BFVA 1ZOSA 3VNUA 5E4YA 1G4UR 1N2IA 1ZZEA 2ZR8A 2CY0A 4YWJA 3VFDA 4QX6A 1F9EA 4II3A 4P7KA 4ZAWA 4XVUA 3T12A 5TF0A 3DKRA 4ZARA 3T0FA 3VSAA 4ARUA 2ZUVA 5K4HA 1AQJA 2G1JA 1MTZA 3VSEA 4CT5A 2YV1A 1OFHA 2NUPA 3KQPA 2ODBA 2VP9A 4XPIB 5CA0B 4Y6GB 3QVKA 1KYZA 3SKYA 2GO1A 3WGGA 3WWOA 4QM6A 2XUPA 2ZJ7A 5MGBA 2YJ4A 5AVQA 2J9ZB 3DMNA 1XTKA 2JAPA 4ND4A 1WV1A 1U8EA 2AT1A 4X8LA 5AVWA 3U7RA 4D9CA 2IEGA 2R6ZA 2AH5A 3PHJA 3Q9SA 1XDDA 4CCAA 1PNOA 3VKFA 2RH4A 3N75A 4GUDA 2ERCA 1OBOA 4JY7A 4G24A 4Y30A 5TJHA 3GUYA 2PAAA 2ZB8A 4FLEA 2WJIA 4H4CA 2ZKLA 2ZZMA 2WM3A 4RIGA 2ZS7A 3M6MD 1LRJA 4KSBA 3VU8A 1HLPA 1QIKA 4MP6A 3SS9X 2E4VA 1J00A 3KSUA 5TXGA 5ERGB 2PGDA 3D6AA 2EP8A 4IDHA 3PDWA 3EQ8A 2IXGA 4Q05A 3C97A 4F11A 3VX3A 1YKFA 4V1CA 5LQJA 3P2IA 4PYQA 1VFNA 1RYEA 3FYHA 1YKSA 4B6OA 3GFFA 4E6EA 2BEVA 3FI9A 4OHUA 4R05A 1JKJA 5G40A 1CUWA 1LRLA 1PWXA 3N0XA 4HEHA 4LHWA 4MVCA 1W85B 4YH1A 3IE1A 3UF0A 3L4KA 2D54A 1NIJA 5JY6A 2XD9A 4K9QA 4BFYA 3KKEA 3NVDA 4R83A 4ZVSA 5KB3A 3T7DA 2LVBA 1WDTA 1YS2X 2BZ1A 2R6HA 3ETCA 4N0DA 4RD1A 5HF8A 3WWEA 4A3SA 3N86A 2IKQA 2CHEA 3KWMA 4X62B 2FMUA 3UWPA 3EFOB 4BBPA 1K63A 5TS3A 1QH8A 3VH3A 5E9WA 2XA1A 2XKBA 3L8HA 5HKOA 4KYTA 3L4SO 1TXGA 1QAQA 3WE7A 2I1WA 2PSHA 1JHDA 2FZVA 3M1LA 3O31A 4QIHA 1J20A 4JX8A 3VI3B 1CZKA 1OVMA 2NAFA 1YRBA 3MJSA 1E8NA 3OD5A 4LJRA 2QP9X 1WKBA 3A6KA 1K06A 3TL2A 2ZAGA 2XW6A 1AS2A 3F6PA 3SFTA 1QYCA 5EXXA 2PUFA 4TMVA 3QLVC 1R3DA 4D41A 4CTMA 5B1SA 1XGKA 3VDXA 2ZPTX 4FDMA 3SQDA 4E15A 2MMCA 2Q6KA 3CSDA 3MLBA 4RPLA 1SUBA 3ZWOA 5I8PA 5AXAA 1MGOA 3PUYA 1CJKC 2XMBA 4C6HA 2IU0A 1W88A 3I2IA 4BZPA 3SF0A 3ZWWA 2RCYA 2COUA 2DRIA 2PMWB 2XMZA 1YR2A 5A3VA 1XJCA 3GH1A 5BPHA 5AVJA 5KKCA 2I7DA 1KI6B 3CBGA 3QI7A 1KYYA 2NTJA 1COWA 5TGZA 3RGWS 4EQ6A 1GGNA 1SUSA 2XWPA 5B4VA 2R2AA 1XCJA 3I73A 3IMFA 3MPOA 4OI1A 3SZOA 4G09A 4OHZA 2CFIA 2F3SA 1G8GA 3BULA 5DGTA 4F21A 3ND7A 2ZWVA 2OHVA 1VHWA 4WESA 1UODA 3KAPA 3D3JA 2FGKA 4GH5A 4PM4A 2GWRA 3N9IA 1MB4A 4OJYA 2Q50A 3AY0A 1G2IA 3IUJA 4H7PA 4JMPA 4JI3B 4R7TA 2ZXFA 3LRXA 4DLNA 5K3FA 3WV4A 3OFVA 1Z5WA 4YJ3F 4YMSA 5E9AA 5C1IA 4JB8A 1V8BA 2QMEA 1THGA 1UDXA 4Q82A 2H16A 1FIUA 4GGPA 2IS6A 4WNIA 4K9KA 3WGVA 1EDDA 4CM4A 3R6LA 3TIIA 4GMHA 4GF5A 3WK6A 3TLJA 3QUSA 2KLBA 2YXNA 3HCPA 4PZAA 5KBYA 3HYCA 3A4VA 1IAVA 1XEXB 3KTAB 4KX3A 1U2GC 5K51A 4D9KA 1JPJA 5CBPB 5JXIA 3P9QA 2ZRJA 4JXXA 4M0PA 3WK9A 1RXIA 2BOVA 2H1RA 5J23A 3WLRA 1SPBS 3OQJA 4KQEA 4DG5A 3KXIA 3CVWA 4WKPA 2XRFA 4NV3A 1QGAA 4KFTA 1SC6A 1AKNA 2W9XA 2XDQA 4I1RA 4JLDA 2Q7DA 4B71A 3O74A 2P6RA 4N1AA 4UTRA 2Z4TA 4P08A 5ECYA 3ROEA 4ENRA 4L8YA 3W34A 1Z4JA 4I6GA 3W05A 1U3UA 4WW0A 1DDOA 2H1CA 1P1RA 1Q44A 3QPBA 1U28C 2CXPA 3RHTA 2ZT5A 2X8JA 3L07A 3OE4A 1HFWA 4WZAB 5DGCA 3UHFA 3WS7A 4X85A 4J7UA 1Y0BA 3PX2A 4G07A 5ELMA 4CFYA 1M5UA 1Y48E 2Q1UA 5DJ5A 3VNBA 2O54A 2ZSAA 1YU6A 2ZBVA 1HDXA 3TJZA 4J76A 4FMDF 4QECA 3B2NA 3IPYA 1G1AA 5AKIA 2I4RA 1P4AA 3BTUA 4JOCA 2F48A 4AMBA 1AE1A 3N2YA 4H31A 3VR0A 4D4HA 1MG5A 1QXSA 1NBME 5AW5A 3E7FA 1HG0A 1JT2A 2B7BA 3EWNA 1HFKA 5HF9A 3R20A 4YMIA 2IYRA 1QCDA 1QKKA 5EE5B 2DEUA 4CV1A 2PUCA 1DAFA 2IPNA 4HWOA 2QE6A 1P18A 3BSSA 3FDJA 4IF6A 2X7JA 3LUKA 4AN1A 1VCHA 1HZJA 4X1YB 4RABA 5EZYF 2J6HA 3QE2A 5JFTA 3MHTA 4LDPA 5DHPA 2QTNA 4HG2A 4I9FA 3OZFA 4KUHA 2QU7A 4TSRA 2YXLA 4ASUD 4F2HA 4FBMA 5HZGA 4R31A 4O4JB 2BY4A 3ZS8A 4HDNA 3QITA 5T6BA 4DMRA 4B44A 4KLCA 4ZKDA 3NANA 3P9XA 4REMA 1G8MA 4B6QA 4CQMD 3BPSA 1JEJA 3P5SA 3H2JA 5HUQA 3RARA 3K0EA 4A7PA 4PTYA 5PNTA 3VYVA 4EI2A 4HGQA 5I4IA 2C1ZA 4X91A 4HQKA 4X60A 5EE1A 5GVRA 3HN6A 3MUOA 4M9ZA 3A1DA 3JQCA 1EFVB 5BP7A 4HDQB 3VV2A 1KYVA 2C58A 3FB4A 4G86A 3N87A 4R8RA 1WE2A 3SLRA 1GPH1 6GPBA 4G0UA 5TB5A 5L3QA 1GO2A 2CXQA 3JQGB 4OATA 1Z63A 5KAMA 4ESEA 3QV1A 2DETA 2VJNA 1QH1B 1F48A 3H97A 4ZVMA 1F0PA 3NBQA 1N5IA 1VYHA 1WXXA 4FJ2A 3SYMA 3BFVA 3JQEA 4MRMB 2BRUA 2YMQA 4QLOA 1BKDR 4TTAA 2D1RA 1YUMA 5J47A 3NHKA 4Y1FA 2VDWA 4RADA 2VVTA 4AFNA 3CPHA 3ODPA 2E4XA 4I7EA 4FZRA 4IJWA 4UPDA 3RH0A 4TTTS 4C5AA 1HY3A 1HWYA 3T7IA 1S7CA 2HO4A 2ZSIA 2OC9A 3DCYA 5CW2A 2FEAA 3L01A 3U40A 3O9ZA 4R7GA 2AFIE 1JG3A 3FB1A 4I4TB 4RA6B 3SZUA 1KO5A 3LI2A 4FW9A 4P53A 5BSRA 5L4NA 1URPA 1OXVA 1CULC 1VLMA 4Q02A 2Z2JA 3EFBA 4D0GA 4EGFA 4F3YA 4PS1A 5M7EA 2EVWX 3GDWA 3VR3A 4G5SA 2VPTA 3T4EA 1SXJE 3QBVA 4QPPA 1QHHA 1TMKA 4EB3A 2XIQA 1A88A 2R8RA 4Z2YA 4MUBA 3SBOA 3Q8MA 2AJTA 2EP7A 5FR1A 4KVZA 1U4OA 3C3JA 5HRUA 4H7JA 2QQFA 4LJKA 3OZCA 2QZSA 2JZOA 3VR1A 1LY1A 2ZS9A 1F4VA 3HWSA 5D3ZA 3AM4A 4TT3A 1AS3A 1GUAA 4E7OA 1LJUA 2OTCA 3RW9A 1FY2A 1I9CA 1X8JA 1PNQA 3FUTA 2A5GA 1IULA 1QDUA 2W4IA 3MWEA 4P3NA 4AWXA 2N0SA 3AJEA 4PYKA 3PQDA 4YRBA 4OGFA 2Q4BA 2R0QC 1P1HA 3O47A 4MAFA 1J9ZA 1E0DA 2J33A 2H1WA 4KXNA 1B0UA 4LKRA 1E2UA 5AW8A 3R75A 5ECWA 3CHYA 4RH3A 1XFDA 1U2RA 3TLGA 5JPDA 1AMUA 4HVAA 3ZCXA 4Q18A 1D09A 1FVFA 5ALGA 4LBWA 4I19A 1V11B 3JX9A 5GJWC 3HA3A 1RQPA 5FKJA 4I50A 4IIJF 3GT7A 4BJ1A 3E9RA 3BFJA 3E9EA 2C7RA 3U7IA 4UDXX 1S89A 2C7PA 1G6KA 5FF9A 4E7PA 1KPIA 4ZXFA 4KGVA 2XD4A 2P9CA 1XXHE 2JRLA 2ODWA 1TZMA 2VBGA 3AZPA 3A3NA 1Y9EA 4DKXA 4OGGA 1YMQA 5THXA 4FT4A 4YX9A 1RXEA 3KETA 2P9YA 3DP9A 5KYYB 4IGFA 4B3MB 2V3WA 1Z0JA 1R8JA 1DKOA 3DNPA 1BNCA 2EEZA 4AROA 3I2GA 4DCOA 2RG1A 3ROTA 1T6BY 3TKLA 5JS6A 4IG9A 3G6KA 4IL5A 2H11A 4R01A 4JL5A 2Y9MB 2L18A 3SJZA 4ISBA 2HJSA 1W30A 2J4FA 1YXMA 1EG2A 4WXRA 3C5CA 4Q9IA 4XXHA 2OCKA 4CIBA 3QMWA 4Y2VA 1RYZA 4Y18A 1HYBA 3WK5A 1FNDA 1S7GA 1CQJB 3CZAA 3SE0A 4KBFA 4WOKA 5CVUA 3KZVA 1LF5A 1JU3A 4ZMBA 4I1PA 3G68A 1CEQA 5KNCA 3DE4X 4B85A 1KERA 4RKEA 4FILA 1YS6A 4F8JA 1TKBA 2O48X 3H1GA 4XSGA 4EJSC 1Y7TA 3V4RA 5C31A 1X3SA 4QVIA 1GZ5A 3ML1A 1MX1A 4OK5A 1KTIA 4UZEA 3WQRA 2HA3A 4LXTA 2Q2QA 1HC7A 3R09A 1GG8A 5AK4A 2ATIA 4FMCF 1WUJS 1U3GA 5UKDA 3SM3A 3N2KB 2C7QA 3OJCA 1RFLA 2HA0A 3T41A 1HE2A 5D87A 5TSDA 1YVRA 2AI2A 2DSTA 3AVTA 4OLJA 1IDN1 4XYLA 5C9ZA 5JNLA 4KI7A 2GK7A 4KLAA 4G0VA 3HU2A 4JVMA 3IPLA 5LQNA 1SU7A 1MDBA 1YDHA 1UFKA 2EP5A 2F3PA 1W35A 3RYFA 3FHTA 1DKUA 1XMJA 4BKQA 5CUQA 2ASVA 2C0PA 2J0EA 4M83A 3EVAA 1EB8A 1BWRA 1GFWA 1E4OA 1OLUB 3AC0A 2CNNA 3O3CA 2D6FA 3D02A 5FWXA 1ZH6A 2DLDA 1C1DA 3EGCA 3VOAA 4QDXA 1N5RA 1ECGA 3CGGA 1HTWA 2FX3A 1N5MA 2XT0A 2KSQA 4OX9B 2WHPA 1WAMA 2QPTA 3A1TA 2JCBA 4Y8VA 2CK3A 1CJVC 3EPPA 5FRDA 4RQUA 4YRPA 3VO1A 1F6WA 3A9VA 1DBRA 1E3WB 1UQTA 3W9UA 4BAUA 1GYRA 1YVDA 3DB2A 1NT4A 5IKEA 4EM6A 1QKIA 3IXQA 3BGWA 5A3SA 3IUBA 1OI2A 4RYLA 4AKTA 2FGJA 5DN6A 2GPTA 3RJMA 3GGGA 2E7ZA 1JFVA 2ZIWB 3WNZA 1GSIA 2YY6A 5SZHB 5J5AA 2G4VA 4L9SA 4MMXB 5KJFA 5KOHA 1R5JA 1PKXA 2OV2A 2HB6A 4OK3A 4F85A 3HP7A 1HF3A 3VU1A 4CKEA 4G85A 4Z1OA 3Q5GA 3AF3A 2J9FB 4I5GA 3LCVB 1VJ1A 1XO1A 3WMWA 3P2YA 1JFSA 3A4IA 4KNYA 2FUCA 1PJBA 3E53A 4KV7A 5IXSA 1Y3DE 2VOEA 2YYYA 3G89A 1PJ3A 1SKQA 2OILA 3O1HB 5IJWA 3H5NA 3BXZA 1YR3A 3HU1A 4JC0A 4BGVA 3RBVA 4E46A 2POQX 4DR3B 1P8JA 2AUMA 3CM0A 5JQWA 3IDOA 4I1IA 4P36A 4KOEC 5K3AA 1RAGA 1YQDA 4N5LA 4UBJA 4YMLA 1A97A 5ITWA 3D7MA 1NHWA 1P8AA 1QG0A 2J3LA 2OUKA 4GMDA 5C35A 2AUNA 2V4MA 3JCZA 2LR0A 2R6GA 1WY5A 1YQ9A 2AXQA 2BF7A 3MT8A 4DUPA 3T4PA 3HJRA 3CCCA 1VGVA 4WCFC 1GCAA 1Y7IA 2GYUA 2PRYA 4LDQA 4UM7A 2XCUA 3QPVA 2BHSA 2QD4A 5KPJA 2HT1A 5EIEA 4GHWA 4CQLA 4OLAA 3V00A 4UOZA 2HQOA 5A5FA 3V9PA 1N6IA 1EP9A 2E3JA 2XRYA 2P9TA 3HRKA 4QPJC 4WN9B 5REQA 3T5CA 4IHJF 4DMFA 4BCCA 4U63A 1EESA 1FYDA 4RZHA 1R50A 1LJLA 3F3YA 1ZICA 5LBIA 4W5WA 4DADA 5IT4A 5SYMA 2E6UX 1XROA 4ZDJA 1KY3A 3NBKA 5FO1A 5C80A 4KZKA 3QKRA 3QFCA 1TF5A 4L72A 3F6RA 3PQEA 1PDVA 1YSCA 5LQSA 5TMDA 4AJHA 1H4SA 4QPZA 4CZ2A 1LPNA 1F38A 1K86A 1NXVA 3F9RA 1QHXA 1O5OA 2QG9A 3JZMA 3OUUA 5DWQA 1KORA 4DV0B 3VKWA 3OZWA 5A7HA 1YZFA 3LPAA 3E2MA 1OIVA 3GJRA 3NH6A 2WV7A 4FZJA 4IBOA 4TV8B 4MHSA 2ZAIA 1AQ6A 4FLFA 4H6WA 5ED4A 4M0KA 1AZWA 1GPYA 4HWTA 2GXQA 2ZJ6A 3TX6A 1GKYA 4X20A 2ENWA 3MT9A 2ZTLA 1M0WA 4EPYA 4DZZA 1JW9B 4JOSA 5HIAA 3FOZA 4WJKB 4BLTA 2JJYA 4LWZA 3GP8A 3ETHA 1N5LA 2C04A 3KO8A 5DB4A 5G41A 1U3TA 1XALA 5BYJA 1BDBA 4TS9A 2ZB4A 1Z36A 5T67A 4C3UA 2FSVA 3BE5A 4QRDA 3SF8A 1WMEA 3OPMA 3QOYA 4LCEA 3FSRA 3ORQA 2CNDA 4PX9A 3GF4A 2DTXA 2GBFA 3ZV4A 4YAKA 2AOUA 5JJCA 1L7VC 1COWD 3VHRA 3AEQA 1K88A 1QFYA 1FRVA 4JI2B 5DLDA 5LQKA 3UJAA 5ETJA 5GJCA 3P0JA 4F92B 5LZ9A 4E13A 2FR8C 2NGRA 3UFBA 4IXDA 2FR0A 1XVAA 3HA7A 4UVIA 1Z5NA 2B1QA 4B3RB 5I7RA 4JYAB 1KU0A 5K01A 4HBZA 3UQZA 2C2WA 1U7DA 2J0QA 1RE0A 2GZHA 2VRCA 2F3TA 3PHBE 2F9MA 3GUHA 3KFVA 4L5YA 4Y9DA 4MLDA 3VDMA 4Z3OA 1SUWA 2OZKA 2VDQB 1P4HA 2IGBA 4H7EA 5BWLA 1TT7A 4X65B 2AG8A 3AOEC 4EBFA 5IEBA 4M1MA 5F9HA 3URKA 1FUEA 2ZYDA 4L4UA 4TUYA 4RNDB 1LSUA 4X1IA 4MRNA 1G3MA 3CUUA 4CXMA 2PANA 2BCEA 4F2DA 3G8DA 3M6AA 4LC1A 5LLSA 1P0IA 1NONA 2WR8A 3EJ6A 4FOSA 4JJIA 3ZV6A 4FOPA 3TVTA 4DABA 2AN3A 3KR9A 1RRKA 3WYEA 2WB4A 5FYDA 1QGZA 1W8DA 1FBTA 2NO7A 1ULSA 2YIMA 4NU6A 1ZSVA 3HPQA 1L2TA 4YREA 1ECLA 3UA3A 3ZD9A 5JLJA 2OHJA 3FPCA 3GCXA 3NIDB 5GJVC 2AYYA 1FYXA 2ODTX 2CCGA 2PXXA 5SICE 4PO1A 1EGVB 3ULKA 3MB5A 3UAOA 2Y4OA 3AHJA 3HCRA 3AKYA 5K4GA 1P19A 1JH8A 4UDNA 3WFZA 1BO6A 1E99A 1U3FA 4FFOA 3NIBA 3B9BA 1ZK3A 3H1AA 2JHCA 3ITNA 1H23A 3N2LA 2N3ZA 3ZH9B 4PTLA 1AV7A 1PR0A 3GLQA 4NFSA 3DOEA 1ZOLA 2IX9A 2RB5A 4US0R 3W5CA 2Q2OA 1TRHA 3Q6NA 1IMJA 2Q1WA 1PGNA 1B00A 1PTKA 1GWNA 2XSZA 1IPEA 2OKCA 1WZNA 1VZ2A 4K6MA 1RMTA 3FI0A 5HK9A 1JP7A 2H1OA 1DL5A 1UMBA 3M9LA 2PH5A 2W42A 1TD9A 1MB0A 3DAHA 1GKKA 1C9DB 5CBKA 4INOA 1P4JA 2DUWA 4PC6A 1SUEA 1SZCA 2HSGA 3MTDA 2V7VA 1W5EA 2VI5A 3AI3A 5F51A 3T52A 3M34A 5F1YA 1V16A 2ZXEA 4ZCMA 2VSYA 2KJQA 2I87A 2Q6TA 2W7TA 3L9XA 1V7ZA 2JARA 3OBIA 3D7SA 4ZK2A 3ZWMA 2X40A 5AXBA 5TE9A 1Q0SA 1U0NA 5I45A 2FOXA 4DY4A 5TT1A 5K45A 1K0UA 3FN4A 4ZOCA 2VQEB 5H9VA 1CZUA 1ECBA 2R1TB 2IYVA 2VWQA 3BUSA 2C1XA 1T6YA 2O5VA 3DW3X 3HR8A 3IP3A 1LW7A 4RLHA 1E32A 3UBMA 3EXFA 3LVRE 4J49A 1A72A 3P4YA 4PIMA 1NW4A 2UZ3A 3UK7A 3EIUA 4DTIA 1E1QA 3BHMA 1UL1X 4D42A 5EGSA 1F8GA 3WL5A 3DT8A 1VL5A 4RTQA 3EPHA 1FU7A 1L5QA 2CYBA 4Y2UA 1P2UA 2BUCA 3RIEA 2MYNA 2QDKA 3D6FA 4X24A 4UZSA 5D3MB 2WNSA 4PLVA 4EY3A 4ESHA 1Q95A 3B6MA 1BVYF 1AQUA 4JQCA 4R1NA 1T3SA 5AK5A 1H5NA 5K0NA 1E89A 3BFXA 3H5LA 4IRMA 4H27A 1ZXBA 4HDKA 1MQ8B 1G8PA 5HMLA 2ZIEA 1S5PA 2YHAA 3SIPA 2L19A 3G0IA 4U9HS 1E2GA 3VOTA 4O08A 3IHTA 2OQIA 2REBA 3IULA 4CF6A 1AIPA 2PYIA 3EEBA 2XKKA 1KO7A 3G3EA 5A62A 2WU0A 4OQYA 1GRRA 2J6BA 9LDBA 2Q5CA 1B15A 3PNBA 3WJ1A 2NUTB 3WL7A 4DVJA 4MIKA 1KEZA 4M1WA 1XZ8A 4K6HA 5BURA 2ZITA 3EGIA 1RAAA 2QAIA 4YN3A 3UAYA 2EFYA 4PSAA 1C9JA 2LXNA 2Q3HA 3HCFA 1E92A 1IJBA 4R1TA 5SYAA 1B26A 3U1TA 5JBIA 1JS1X 2GEFA 2SHKA 3I9KA 3EPRA 4U3JB 4XIYA 5MN5A 4KDRA 4N3AA 2RONA 1CU1A 4NG5A 3Q3EA 4RD2A 4MIOA 2ZTHA 3UWOA 2XTNA 2QW8A 3TPFA 4F93B 1D2MA 3QUQA 2WSYB 3KQVA 3M1IA 3PCXA 5CFZA 3VR3D 5MN6A 3GQBA 4HSEA 4Q9NA 1XZQA 4EZIA 1B8UA 2WTBA 3DLPX 2F62A 4OYRA 1BOFA 3ECSA 4YT5A 3NHZA 2JASA 1QV7A 4CV3A 3IUPA 1L5SA 4TROA 4G56A 4GQAA 4TT3D 4KXVA 3ZY6A 2XJ9A 4TV9B 1V5FA 2VUTA 1CF9A 2C00A 5EJEA 3AUFA 3HZRA 5JC1A 4HEA6 5JZBA 2A59A 1E7RA 2E1PA 4NK5A 2VJKA 1P5RA 4PQRA 4K8RB 2XNSA 3SBDA 1THZA 4YO7A 3RYTC 5DM1A 5E0OA 2FQ1A 3THYA 1L4MA 3TSWA 4L6IA 2JCGA 5EJMA 1ILEA 1M83A 1U0TA 2G8LA 4DAEA 4HZIA 1U1DA 3CRMA 4JWKA 2PSFA 1NVEA 3ZJ5A 1A5TA 2IZ1A 2WJJA 3SXJA 1DDGA 1ESZA 1N5OX 3CCFA 1WWKA 3LC2O 1F5SA 4Q66C 5PGMA 3MWYW 3QU4A 3AH8A 3QM1A 4X45A 1PFVA 4URWR 2IWHA 1WXQA 1BGWA 1QK3A 3KYBA 1C1XB 3T3EA 3E5MA 1TLTA 4OSPA 2V4UA 5ICSA 1VGRA 4C08A 1GR0A 4N82A 3JQQA 2HBZA 3PQ5A 1SVLA 2GN4A 2FSVC 3GGPA 1M1YA 3OZ7A 3T1HB 5LMNB 1PT8A 3I9NA 5EXDA 1Q7RA 1E5XA 1J0EA 1E9DA 1MLDA 4S12A 1XJWA 1Y9ZA 4IXMA 2W2VA 3OJWA 4DLXA 3Q3CA 1WM1A 4H0NA 1G3RA 4HDRA 1OILA 1WSAA 5JVDA 3A2LA 1Z6AA 2DFNA 13PKA 4HB0A 2C98A 3EGVA 4AO6A 2HL6A 3TS1A 3DWIA 1V1RA 3DAGA 3N8GA 3Q10A 1SKBA 5A7GA 3ID6C 5EWJB 1R12A 5KNCD 1EWTA 1IK4A 1GNQA 3EGOA 4PZZA 1ZW6A 1N36B 3FPFA 1O94A 3BK2A 2GCGA 3USES 1AQLA 3MN1A 1FNBA 4CL0A 1DXYA 1QQTA 3Q7SA 4LOIA 1APBA 3BS4A 1GNRA 1H6AA 2PZJA 4B81A 1SC1A 2X0JA 3MOIA 4NJOA 4S1TA 2CXSA 1PR5A 1Q17A 3VM6A 3ZU6A 2XUKA 1AO0A 3I5YA 3F0TA 2RAFA 4GPIB 4RPGA 4U00A 4L02A 4BP3A 1K6XA 2B99A 1ZZGA 5HS6A 2B9VA 1P44A 5ITZB 1SC9A 3OEHA 4RK1A 2EIXA 1I6LA 3K32A 3IBCA 4M6WA 4BLOA 1L5WA 2H5IA 1MX9A 1B3RA 1FMCA 1XMSA 4CN8A 4UBKA 5E95A 1GQYA 3EQ6A 4XWYA 2TMYA 3X2EA 4D92A 4JLJA 2VLBA 3LGAA 3TXYA 4TZ6A 3QHAA 2I33A 3TIFA 4BO2A 3Q8LA 3OIGA 1OTXA 4FBGA 2OA0A 1A04A 2I65A 5BMVB 2QGNA 2H1VA 1XNQB 4NTZA 2XCRB 5K8VA 1AN9A 1P1IA 4MB6A 2DWQA 4XB6B 1ZNWA 2CK3D 3T61A 5FI0B 4PINA 4PCLA 2VHEA 4X90A 4DV5B 1D2HA 4ZVNA 2BBWA 3HCBA 1T9AA 5EYPB 1RM3A 2X7HA 3JARB 3E18A 3LUJA 4R6WA 1WVMA 4UE6A 1CDOA 3JW8A 4MV7A 4ZEWA 1TJYA 2COEA 3K0BA 5KMGA 1HKUA 4RQBA 5BUCA 3FMGA 3D6TB 4LDNA 5DN6D 1KZGB 5KTNA 5AIAA 1P1KA 1JPNA 2Z8ZA 3HB0A 3TFOA 1PNRA 3X44A 1SPXA 2W6CX 3IXMA 2FFBA 5HOEA 3ZGNA 3KR2A 4BQQA 1Y1KE 2QSZA 4BE7B 4D97A 3GJQA 1BCSA 1R7RA 1TJ4A 5IP5A 2UUPA 4JS0A 3NM6B 1CUZA 1NSYA 1SCDA 4YEDA 4W5RA 2A84A 1PJTA 4E31A 3DHNA 3E9ZA 4N5HX 4DCCA 4YUAA 1DIRA 4X95A 1E3QA 1MMFB 4P3OA 2QG6A 3CF2A 4ZHSA 3IOEA 2YFYA 4FE3A 3K35A 3YASA 1KFEB 3GRAA 2BMEA 1TJNA 3P5BA 4GMXA 4CLXA 1BX1A 4FNMA 4G89A 4DV6B 1XRLA 3AIKA 4LOHA 4R1SA 1EIZA 4MR9A 4XB2A 1EFUA 1WMAA 2GN8A 4OHKA 4AURA 4HOYA 3TRKA 5B1IA 1K97A 4ZU1X 4AF8A 4BUCA 3ZXUB 4GMGA 3M6UA 2YUIA 1ZL0A 3I8SA 3KD3A 3VH1A 3VO8A 3DR5A 1BKSB 1Z82A 3FZYA 5TQ2B 5LDDC 1V3QE 2BR3A 3PFHA 3AY3A 3J81A 5BSFA 1X14A 3BAFA 3GAAA 4KVGA 1TM3E 1N2GA 2J7PA 2PX8A 2WG0A 3AEUA 1NATA 2HXGA 3KKZA 4FIZA 1U8UA 3T35A 4BB0A 5BN1A 4B5LA 2ZI5A 1YI8A 4OHVA 2ZRQA 1OY1A 1IIBA 2IPLA 2QPAA 2A3RA 3VSCA 3PTZA 4MKRA 4IMRA 3NONA 1I13A 3AVQA 4P92A 2RGGA 3RUEA 3ABIA 2FUNB 3WI7A 3VYWA 4GC5A 1UZMA 4DSTA 1S6YA 4DA0A 1LRKA 5EINA 3W9BA 3DEFA 1E2PA 1MOPA 2QXTA 4FYXA 3E35A 4WGFA 3OM0A 1PSWA 2G76A 3RAGA 3RADC 1X7HA 3BIFA 3OEEA 4DV1B 5JS1A 4MI9A 3LPCA 2BFNA 1YBAA 4UTZA 4CKYA 3E84A 3K5IA 1WXEA 2JGAA 3HMQA 4G0QA 1S4MA 2A9KA 2R4QA 1L4BA 3RS2A 1WSBA 3L7BA 3AG5A 1QAMA 1N4AA 4ENWA 1FTNA 1FTWA 3AUAA 2HMYB 5HQJA 4DQLA 2Q4TA 1L7BA 1IXYA 5CHYA 5IN5A 4CODB 2PSEA 3FNEA 3AB8A 4CGYA 4BX2A 2PMKA 2CBXA 2I80A 2RBEA 2O6LA 2O2IA 3OPVA 5JI3E 2AUTA 2DT5A 2C9MA 1I4OA 2V65A 2WD7B 1L8XA 1S3IA 1C30A 3CMMA 2GEKA 1WMDA 1ZNZA 3WBKA 1LS1A 5EP2A 3ZWKA 4EY4A 4DR6B 4YV7A 1MAVA 4ZRNA 4I55F 4RTPA 2HV9A 3D6JA 1CP3A 1NJ8A 4NBLA 1YMVA 3B1FA 2EJVA 3P9IA 2XOKA 3PGA1 3B7GA 4MI1A 3OJOA 1TQ2A 3G23A 4BNXA 4OMCA 3ZHSA 3C3CA 3ET5A 1R0SA 1N6RA 1PK8A 1U5BB 3K0CA 1QTRA 3B38A 3OZIA 1IEQA 4K9SA 4OG2A 4A8PA 1OBHA 5HIKA 2Z6UA 3GROA 1IBMB 2JFNA 2J45A 4IZHA 1XDUA 2VRCD 4MRVA 2Q3CA 2VSFA 3GUVA 4JKYA 3PC7A 3RBAA 2Z83A 3K09C 1ZRSA 4TS1A 2PLWA 3HVHA 4RGVA 1KL7A 1UDAA 4O2BB 1COZA 1DAMA 2RC6A 4WCVA 4CM6A 1QVWA 1ACLA 4YBZA 3BTOA 1I7NA 1UBOS 2WOJA 1OI3A 2JI7A 1H93A 3PITA 1XCLA 1Z0KA 4A91A 1QAOA 4TL7A 3OPQA 3G2MA 1NLFA 4DL9A 3OY7A 4O2AF 2V5AA 2OZEA 4UKDA 5BN5B 3AG6A 2X9VA 1QP4A 1D8AA 1R0YA 3KC2A 3LP6A 4L3VA 1YB5A 2UZ1B 2B25A 3D3EA 3HYTA 4N5IX 2WIDA 2IF2A 4L0CA 1CY1A 4FS3A 5FJIA 5LQAA 5A05A 2X4IA 4YQFA 3UB4A 4NDAA 3PENA 4HCJA 1R4NB 2Q29A 2VT2A 1EWRA 3QKSA 3BXPA 4FHEA 5JAQA 1X2BA 2J5QA 2XTZA 3OG9A 4NZPA 6REQB 3WLJA 1E5VA 5K99A 3W5HA 2WYUA 4OHOA 4N47A 2YNMA 4BBJA 2FZKA 2HA4A 2QW0X 2JZNA 4ARVA 3I01A 4EY8A 1H85A 4HGNA 4HPWA 4QYIB 4TTPA 3RIHA 4F5YA 4TYNA 4MS4B 2W0SA 4XGIA 1RLIA 2FW1A 3CNHA 1NY5A 2AFVA 1H9AA 2B4TO 4GMFA 1O94C 4GVXA 3ZWYA 5JXWA 1ZO8A 4ZN6A 2BM9A 3K15A 2XSZD 3ZYZA 1FTGA 1FOEB 1MN6A 2C59A 1I4DD