3DUWA

Crystal structural analysis of the o-methyltransferase from bacillus cereus in complex sah
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
220
structure length
220
Chain Sequence
MIETWTAVDQYVSDVLIPKDSTLEEVLQVNAAANLPAHDVSPTQGKFLQLLVQIQGARNILEIGTLGGYSTIWLARGLSSGGRVVTLEASEKHADIARSNIERANLNDRVEVRTGLALDSLQQIENEKYEPFDFIFIDADKQNNPAYFEWALKLSRPGTVIIGDNVVREGEVIDNTSNDPRVQGIRRFYELIAAEPRVSATALQTVGSKGYDGFIMAVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-methyltransferase, putative
publication title Structural and functional insights into O-methyltransferase from Bacillus cereus
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transferase
total genus 85
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3duwA00
3DULA 4GOMD 4F85A 3Q87B 1XDZA 2NXJA 3H2BA 4EKGA 2EFJA 4FS8A 4OBXA 4YUWA 2PKWA 2EG5A 1L3IA 5GWXA 5B1SA 5GP1A 1XJ5A 2BR4A 3IV6A 5EGSA 2NP6A 2ZW9A 3LCVB 5HEKA 7MHTA 5EKXA 1JQ3A 5HIKA 4PIMA 2HR1A 3QOXA 2P3OA 5DRYA 4YV1A 5E8JA 3AWIA 3HVJA 5GOZA 3GU3A 4E2ZA 3I64A 3KQWA 2O0LA 5FADA 5EMJA 2NXCA 3FYCA 3UJ8A 1N2XA 4YV2A 5DM1A 1JSZA 3EMDA 4RWZA 3TM5A 4BP1A 4C05A 2I9KA 2PGXA 4QDJA 3LBYA 10MHA 4F86A 2YX1A 3LSTA 4QTTB 5EC8A 1NW6A 4KIGA 2ZIGA 2ZZMA 5ICEA 3D2LA 2AZTA 3C3YA 2AOXA 1ZKDA 3OZRA 2I6GA 4K6MA 5EZSA 4YMGA 1FP1D 4PWYA 4KVZA 3RIEA 4E2YA 3P9CA 3OU2A 3R9XB 3ELUA 3DUWA 3EVZA 4RVDA 2B25A 3NDJA 1JTEA 3UJDA 3DTNA 3FRIA 5IH3A 5T6BA 2UZ4A 1KHHA 4M36A 3NTVA 5FHRA 1TW2A 1YFJA 3TKAA 2JG3A 1RI5A 3A25A 3G5LA 2OY0A 1NW7A 3HCBA 4DZRA 4DA4A 3AJDA 5DX8A 3UJAA 4R05A 3TPZA 1FPQA 3ELWA 2IGTA 3CC8A 1XVAA 3NW9A 4RVHA 1SUIA 3T0IA 2CKDA 3FPHA 3TR6A 1L1EA 4ER7A 4UOEA 5K0GA 2AN3A 3SR4A 2ADMA 4BLWA 3TM4A 5FWDA 3HA3A 3MERA 2PWYA 4X63A 1EAMA 1HNNA 2AS0A 2FPOA 3BKWA 4MQ4A 5ICCA 2G72A 3GO4A 5GIOE 3THRA 4LWOA 5DX1A 4DCMA 5EVJA 4CTKA 4BP3A 1UFKA 5K8VA 4GC5A 2AOVA 4XCXA 2AVDA 5DXJA 3VC2A 1TW3A 1NV8A 3DH0A 3FTCA 2Z6UA 2PXCA 1VQ1A 5FA5A 2H1RA 5K0EA 2G8NA 4GEKA 1EIZA 4GOND 2OB1A 2NXEA 4QPPA 3B3FA 1O54A 5EMMA 2VDUE 2BZGA 5E2AA 2OYRA 3SGLA 3G8BA 3LECA 3EPPA 1KXZA 2CWWA 2QRVA 3B89A 3TKYA 8MHTA 1X1DA 4PONA 5HIIA 2UYCA 3AY0A 5DSTA 2CMHA 3ELDA 4IV8A 1X1BA 1XTPA 2GS9A 3FUUA 5BW4A 3ME5A 2O57A 1RJDA 3FTDA 3OU6A 4DF3A 1XCLA 4RX1A 4WXHA 5K0BA 5BXYA 2XYRA 3KQVA 4P7FA 3GJYA 1RI1A 3EVEA 3KQPA 3G7UA 4RVFA 4PYKA 1Q0TA 3EVFA 3EVBA 2IBSA 2P7HA 1KIAA 5E1OA 3SSOA 1ZHFA 4RTPA 5LQUA 3A7DA 1D2GA 3HP7A 1Z3CA 1QYRA 2I7CA 5G02A 1YB2A 1ZGAA 4QPNA 4RVGA 2GH1A 3FPFA 4DCGA 3FYDA 3EEOA 2YR0A 4FP9A 3LGAA 5D1HA 3NMUF 3UBTA 1EJ0A 3KQSA 1NKVA 4AZSA 1RI4A 2Y1XA 1QZZA 3M4XA 1Q0SA 3O7WA 2HV9A 3TMAA 5FULA 4HH4A 1NBIA 3G88A 1V39A 3GXOA 3V8VA 1XDUA 3BT7A 3IHTA 3HA7A 3UZUA 2ZULA 3CKKA 5ERGB 2P7IA 4FSXA 3RW9A 5KS2A 2BR3A 2NXNA 1WY7A 4FZVA 2BH2A 1JG3A 3DLIA 5FA8A 5GIPE 2PXXA 3MAGA 4JXJA 4B17A 4YUXA 4E70A 1G60A 2HWKA 5CVDA 5DTRA 4MTLA 5EEGA 4E2XA 1IXKA 2QE6A 3F4KA 4RTLA 2QY6A 4X1OA 3P97A 1X1AA 4GUAA 2BM8A 1AQJA 5U4XA 2QRVB 4AUKA 3G2QA 1G8SA 1PRYA 3PFGA 2KW5A 1NE2A 2XVMA 5F2KA 3T7SA 5D1NA 2HNKA 3PFHA 2P40A 2HMYB 4H0NA 4C08A 1BHJA 2UYHA 3BWYA 3DXYA 1TPYA 3C3PA 5FHQA 3KR2A 2ZBQA 3UA4A 2R6ZA 3BWMA 5K0LA 4HSGA 4R6WA 4IV0A 4X41A 1SQFA 3SSNA 3KKZA 5DM0A 2PXAA 2PX2A 1VPTA 4FSDA 3P8ZA 1AV6A 2ZVJA 5DSXA 1BOOA 3KPYA 2O06A 1O9HA 2OBFA 4F84A 2OXTA 3VC1A 4PYLA 2IIPA 4PYJA 4YV0A 2IPXA 4CWAA 4CXMA 2WK1A 3M70A 3PX3A 5DPMA 2C7RA 4FR0A 4DM3A 3GWZA 2XYQA 3P9IA 2PX4A 1XXLA 3KQOA 2P8JA 2NNWB 5K0CA 3E05A 3G89A 3VYWA 4RTKA 1P1BA 3SMQA 4WVLA 5GINE 1P39A 4QVKA 3M33A 2FRXA 5C9ZA 1VIDA 4U7PB 1WXWA 3GIWA 4PYIA 4X60A 4YUYA 5C1IA 3FUTA 1QAOA 3BUSA 2FCAA 4L7VA 4KWCA 2Y1WA 3OE4A 4E33A 5IKMA 1AF7A 2BM9A 3PT9A 2ONYA 1NW3A 4LECA 5FCDA 5K0JA 4POOA 1DL5A 2P3LA 2HTEA 3QV2A 1OR8A 4C4AA 3FPEA 2ZIEA 5EOVA 3ER9A 4RTQA 5HILA 1BC5A 3NVMB 1DUSA 2ZBPA 2VDVE 3BKXA 5E9JA 4XUDA 2V7EA 2PSSA 1EQAA 5FTWA 3K6RA 3UWPA 3SSMA 4ISCA 2YQZA 2OKCA 3DMGA 5EIWA 5GM2A 4AX8A 3M6XA 5DT2A 4FT2A 1JG4A 4FGZA 1D2CA 5HIMA 3G2MA 2AOUA 1NW8A 3GDHA 2PVCA 5EEHA 2AR0A 2YVLA 4P58A 5KYGA 5K0FA 4QDKA 3LDFA 2P41A 5EQJB 4AZTA 4PNEA 4RTSA 3FUVA 2OB2A 4RYLA 3KPWA 2G1PA 2R3SA 1ZGJA 3LDGA 3Q7EA 2FK7A 4GC9A 1SUSA 3BZBA 3BGDA 1RJGA 1KPHA 4O29A 1D2HA 3GCZA 3U81A 4AZWA 5LSAA 3GNLA 3PVCA 4Y30A 1L3BA 4OX9Y 3CJTA 2ZWAA 3EVCA 2ZFUA 3E8SA 1WG8A 1XDSA 4DMGA 4YUZA 3JWJA 4EQZA 4R8RA 3P2KA 1P1CA 4FT4A 4EK9A 2IH4A 4LG1A 3GRUA 2B3TA 3OZSA 4RSRA 5M5BA 4ER3A 2PJDA 4MWZA 3G8AA 4BLVA 1INLA 2ZIFA 5K05A 4IWNA 5KQSA 4MIKA 5CCBA 3TQSA 3KQQA 2C7QA 1M6YA 1RI3A 2JH9A 3EGIA 5CIYA 3P9KA 4GOLD 1G8AA 1FBNA 5DRTA 2GPYA 1R18A 2OPBA 2XYVA 4PYQA 4C04A 1FP2A 1SQGA 2PX8A 4LWPA 5HOQA 3DP7A 2GAFA 2EJTA 2ZLBA 4A6EA 2JHAA 3A4TA 3EVGA 5GM1A 3QOWA 3GRRA 5LQCA 3T7TA 3HCEA 2PT9A 2IP2A 2PBFA 1F38A 4RTOA 3GRYA 4E32A 3ERCA 2VZ9A 2K4MA 2AOUB 2IDJA 1IY9A 1VP9A 5EMKA 1R8YA 3ID6C 4U7TB 3KQTA 2WA2A 3SM3A 3DR5A 3T7RA 5EG5A 4HTFA 5E9QA 4OQEA 1EJ6A 2B2CA 5EHIA 3SX0A 3HVHA 5EHGA 1I9GA 3LPMA 4EVIA 5LQNA 1SG9A 1PJZA 3C0KA 5F2NA 4CTJA 4ER6A 1KR5A 3PX2A 4YUVA 3MTIA 3HVKA 4OA5A 3PB3A 2ZZNA 3REOA 2ZSUA 3KR9A 3LL7A 4HC4A 1VLMA 1T43A 3CVOA 3KPUA 5T64A 2BR5A 2JHCA 2PY6A 3FRHA 4HGZA 5EMLA 3KR1A 1ORHA 1WS6A 3HTXA 3KU1A 1R6AA 3EEYA 2VDWA 1RJEA 2AOTA 4QVGA 5ICFA 2C7OA 4GBED 5LQRA 4PYMA 1FJXA 3TRKA 1JG1A 2WA1A 1M6EX 4CKCA 3FPJA 4GF5A 4XUCA 2Z6AA 3EGEA 1YZ3A 2B78A 3O31A 5FUBA 4C07A 3JWGA 3DMHA 2CMGA 1L3CA 5DX0A 3MCZA 4CKBA 1N7IA 3UFBA 3C6MA 2O05A 3SVZA 2IBTA 3R24A 5CVJA 5CVEA 3FTFA 1QANA 3TLJA 3GRVA 3ELYA 1N7JA 4RTJA 3E7PA 1KPIA 4BLUA 4KDCA 1VP3A 3CGGA 3I53A 4AZVA 1KYZA 3G5TA 2PV0A 3EVDA 1XCJA 5DM2A 5CD1A 1BKYA 1IM8A 1F3LA 1P91A 4HGYA 3UA3A 5P8WA 3R3HA 5E9WA 3MB5A 4HTFB 1I1NA 2P3QA 3B5IA 3UJ9A 4E31A 5K01A 4PGGA 4QTUB 1SVUA 3HCCA 3L8DA 4OQDA 1MJFA 2AN4A 2UYQA 1JSXA 2ZTHA 3UJ7A 4C06A 1YF3A 2IH2A 1ZQ9A 4OBWA 2GLUA 1YUBA 2DPMA 5EKUA 5HIJA 3NWEA 4DKJA 3M6WA 3THSA 5K09A 2AOWA 1JG2A 3BWBA 3IYLW 3MQ2A 4P7JA 5DTMA 4M37A 5LR6A 2PLWA 2P1DA 4YMHA 2AOTB 3P9NA 3G2OA 5F2OA 1YFLA 2GA9A 3EGVA 2PT6A 4R8SA 1UWVA 3KQMA 3LBFA 3FZGA 3KHKA 2NP7A 1JQDA 3ANXA 3R0QA 3TOSA 1ORIA 5HZMA 2IDKA 2H00A 2JJQA 2YXEA 2UYOA 3WSTA 1R74A 3P2EA 3FUXA 2QYOA 3RODA 2PX5A 5ICGA 5FWAA 4ER0A 5DLYA 2G71A 2LD4A 1L9KA 2IH5A 2H11A 2VP3A 4EMSA 1X1CA 3TFWA 3KPVA 4QQKA 1VBFA 3OE5A 1R00A 3MGGA 2ORED 1O9GA 3LHDA 3CCFA 1JTFA 3PLAE 3P71T 3MHTA 9MHTA 4PYNA 5DM4A 4RTRA 3DXXA 3E23A 3B7PA 3OCJA 5JR3A 3OFKA 3LX6A 5CCXA 5E2BA 5CUQA 4A6DA 4NECA 2EJUA 4KW7A 4M38A 5KVAA 2XVAA 2ERCA 1RI2A 3BXOA 2XBMA 5KQRA 3JWIA 3CJRA 3DOUA 4PGHA 3S68A 5K03A 5DTQA 2ONZA 2IFTA 2PWPA 1R8XA 2ZBRA 3I5UA 3C6KA 3CBGA 4G56A 5CVUA 3AXSA 5E8RA 1H1DA 3UJ6A 2OO3A 1KYWA 5E1MA 3DMFA 4V0QA 3B3GA 4C03A 1DCTA 3HCFA 1WXXA 3IEIA 4KDRA 3FPGA 4PIPA 2YTZA 3HEMA 3KQYA 1UIRA 3LDUA 1QAQA 3DXZA 4KIFA 2YXDA 5LQJA 5LQKA 2ZZKA 3EVAA 3HA5A 5E1DA 3PTAA 1G38A 2ESRA 1RJFA 1SKMA 1G6Q1 2F8LA 4OA8A 4X61A 4E2WA 2Z6QA 2NYUA 3A26A 3HVIA 4PCLA 3A27A 4ZTBA 4BY9E 4GOOD 2FYTA 3O4FA 3NWBA 3B3JA 1NV9A 1I4WA 3A7EA 2OZVA 5T67A 3HNRA 1YZHA 3I9FA 3VSEA 3GGDA 4GQBA 1MHTA 4QQNA 3KPJA 1KP9A 1AQIA 3GRZA 4HRAA 5E1BA 3NDIA 2JHPA 1ZG3A 3BGVA 5EPEA 1WZNA 3HCAA 4DQ0A 5BP7A 4MHTA 3CJQA 3NJRA 3UJCA 4IKPA 2A14A 5K0NA 3FUWA 1Y8CA 2AVNA 2CL5A 3LKDA 4R6XA 2YXLA 5H02A 4ATNA 1HMYA 2C7PA 2ZCJA 4M7RA 5HFJA 2FHPA 5MHTA 1KPGA 3OFJA 2EX4A 2P35A 1QAMA 4HG2A 5JUWA 4KRGA 2N47A 3DLCA 2FK8A 2YUIA 1NT2A 3K0BA 3M6VA 5EIFA 1NBHA 3EMBA 2ZWVA 1B42A 2G70A 4V0RA 4RTMA 2AN5A 4XUEA 5LQAA 1JR4A 3V97A 2O07A 1EG2A 1VE3A 3X0DA 3KR0A 5BW5A 3NVKI 2Q41A 3ORHA 1JQEA 5CVVA 4Z2YA 1M0EA 1G55A 3HM2A 4PYOA 3LCUA 4P7GA 2JH8A 2V74B 3R6TA 3M6UA 4PCAA 1X19A 3OU7A 2VS1A 4RTNA 4PINA 1NW5A 4CKEA 3UJBA 3OPNA 4E30A 4EKIA 5DWQA 5C0OE 3JWHA 3PS9A 2B9EA 2DULA 3AXTA 3MCTA 4P7KA 3SXJA 3FTEA 3LKZA 3LCCA 5CM2Z 3ER8A 2GB4A 3OZTA 3I58A 2E5WA 1U2ZA 5FQNA 4Y2HA 1VL5A 3HCDA 5FQOA 2I62A 4RV9A 2QM3A 3G2PA 3P2IA 5EZQA 4ER5A 3BGIA 3BWCA 3MTEA 5DXAA
chains in the Genus database with same CATH superfamily
3W7BA 1TKCA 1V48A 1Z6AA 5FTMA 4ZKEA 3L7JA 3H3JA 3OECA 1YJ8A 3GROA 4XASA 2I5PO 4NBLA 2R11A 4TSKA 3VSCA 1B8UA 3RQSA 2WFAA 4OQXA 3L0SA 2W6ZA 1M2VA 4MV5A 5C51B 1GPUA 3J81A 1QVWA 2DWPA 2WWIA 1PWZA 3HBFA 2C5HA 1K5DA 2P9QA 3MELA 1V47A 2Q5OA 1ZUIA 1Q0LA 3N8KA 2DQZA 3ZDQA 5TB5A 4URWR 4ZYLA 3NO4A 1ZQ1A 5F64A 3U0BA 1Z0ZA 4OM8A 2VHXA 4Z9YA 2BFEB 1DQSA 2CHVA 2E6UX 3TOVA 3CQ9A 1GEGA 4YLEA 2A58A 4OGLA 1B8NA 1H1LB 2Z5LA 3VNSA 4R9SA 1GVNB 3V1NA 2AWOA 4EBBA 4DLVA 4REQB 1GZSA 1IJBA 2ZIGA 4CFZA 2X7HA 4OHXA 1CB0A 1Y6QA 2GVZC 3ESAA 1JXMA 3HSSA 2CFRA 3QEBZ 4V3BA 1TUBB 3K9QO 1M2FA 4TYMA 3KETA 3GPDG 1USWA 1OXUA 4B8ZA 3F5SA 1Q7CA 3UCFA 2X9NA 1T6ZA 3O84A 2XT9A 4BKQA 4RVDA 3OD5A 5FLXA 2GESA 4W6ZA 3OJOA 3K8OE 3LCJA 2GYUA 1JTEA 2RH5A 3Q3EA 5T6BA 3SZ3A 2JJYA 2V55B 3D3WA 1WY5A 3NTVA 5ICMA 2W90A 3V1YA 1P0CA 1HLGA 2PGDA 3DG9A 3L7CA 4ZJUA 3O6VA 3MJRA 1WKVA 3OEED 3UEOA 4UTVA 4CL3A 3WYBA 2QE7A 1N25A 1XXHE 3BIFA 3T7CA 4ZVPA 5REQA 5KMGA 5AKZA 2NU6B 3QF4B 4K6OA 1Z9BA 5ITWA 2XLCA 1A8PA 4FNMA 4TLEA 4TRMA 3R23A 5KJCA 4YAFA 4ILEA 4BZQA 3IMFA 1VCHA 1NLMA 2BH9A 2G0NA 3QU5A 2QRLA 4DCMA 1OD6A 3D8SA 1E0JA 1XRJA 1X8JA 1V7ZA 1Z29A 3CLVA 3D7MA 3KL4A 2P2YA 3K0SA 4QUKA 2DFNA 1ZOPA 5AI6A 3VKFA 3AK4A 3ASVA 4G01B 2XCLA 1PG0A 1V8BA 1EDOA 1OXBB 3O74A 1EJ2A 2BP7A 2EL7A 4R8LA 1SELA 2BSAA 2FZCA 3EPPA 1BGWA 1WUJS 4BNKA 1VOTA 2PKQP 4LBZA 4LW8A 4PW0A 1F3OA 4FMCF 3AY0A 3K9NA 1W75A 3EXFB 3MFYA 5DLQC 3T52A 1WQ3A 2O8DA 3EDCA 5JFGA 2HB6A 1R4ZA 1DPFA 4IGFA 4R1MA 1QQTA 3CB2A 4LDNA 4AT1A 2GJAA 1M74A 4HYYA 3KB8A 4LJSA 1VCMA 2G9QA 2MR5A 3L93A 4F06A 1GKYA 3I62A 4NK4A 1KIAA 2XNCA 4K87A 5ER6A 1WU7A 5TVKA 2PRSA 2REQA 3TRJA 4KFSA 4MJLA 2HDWA 2BUCA 2G9RA 2OBNA 5LYJB 2R1TB 2I7CA 4E13A 2QTAA 4BO4A 4D79A 4N5NA 2HJGA 1ZY2A 3R4CA 1JR3D 2WU0A 1U28A 4QUIA 3SIXA 1HH4A 4PXSA 2QTTA 1KMHB 4B3FX 4TROA 1AXRA 1QZZA 3MCVA 2BFBB 1EZZA 2VAWA 4I1VA 4WE3A 1WXDA 3AHIA 4OL9A 5EL0A 3RC7A 4CT5A 2YXPX 3U44B 4C30A 3EAFA 1SVSA 4JUIA 1B6RA 3KK0A 4IQGA 3COVA 4X1YB 2XE7A 3G23A 1P4AA 2IPNA 2A35A 3IJRA 2XHZA 3H1TA 1FMJA 1SULA 2RHMA 4MI3A 1VBKA 4LV6A 2PR2A 2ACVA 4QU0A 3TMKA 3WO1A 3WRYC 3WX0A 4GOKA 4KE9A 4DUZB 1UUFA 2DLCX 2XXAB 3SQXA 2J5KA 1UL1X 1JG7A 2DE0X 1FVHA 3MAGA 5FI1B 2B69A 1GU1A 3KT3A 4LKRA 1AMUA 4DKXA 2Y0DA 1GTSA 5KB3A 4GUAA 5U4XA 1THZA 3BRWD 3K2IA 2GM5A 1ICEA 1E2MA 3DM5A 1TOAA 1PS9A 4M9RA 4NBKA 3H0CA 4CG0A 2CXOA 4WBNB 4QUBA 4WAUA 1BHQ1 3RWBA 3HR4A 5BPHA 2Q27A 3N2KA 3WHPA 2IOFA 2NZWA 2RH9B 3P19A 4F3NA 5CBPB 3VO2A 5LJLA 3FPCA 4G89A 4YRGA 5EJ8A 2IJGX 2QX8A 2ZSJA 3C98A 2ERXA 2JCVA 1BRMA 4J29A 5T3YA 3UXMA 3W6NA 4GI1A 2JK0A 4PSCA 1J0AA 3BK1A 3IQIX 4LYYA 4QYTA 3HB5X 4Q7LA 1V95A 1XVIA 2WIFA 2Y05A 1X86B 5AI9A 5FBKA 2OBBA 3N0RA 1D0VA 4YAGA 5KCMA 1NUTA 3ECSA 1PVOA 2E49A 1NQTA 3DE2X 1N3YA 2C82A 1P0MA 1JJ7A 4C0WA 2WNHA 1BXRB 4ZK2A 4CV2A 4C7JA 5B58T 4J4HA 1EVEA 4HEJA 3VVBA 3A4LA 2QTVA 1KE2A 3NX4A 5JJ5A 5IN5A 2KLBA 4XFJA 1YDGA 2IPLA 1ODFA 4NNPA 2GO7A 2ZYRA 1FTSA 3HJAA 4Q1FA 3WLPA 4B46A 3ENQA 3BSYA 4HDKB 1SXQA 1FYDA 4RPKA 2E55A 5CX4A 5DGCA 2GNAA 5B53A 3IEPA 3D02A 4E33A 5K8UA 2ONYA 1CUJA 2EFGA 2GXUA 4Z3DA 1QHIA 4EZIA 4V24A 5KVSA 2ODQA 3DVRX 5KKAA 5CHEA 2NO7A 4UTXA 1KVTA 2AMVA 3PQ6A 3HJRA 1BC5A 3CEHA 3OLYA 2VDVE 1EDDA 1JEYA 2DC1A 2YNMC 3KUDA 1EQAA 2WTXA 4IDAA 3B2NA 4UU1A 1T3SA 2BM0A 3E5HA 5LA6B 4YV2A 5JWOA 1IZ9A 2WIGA 1K4KA 3LWNA 4IGAA 3SAJA 1D4ZA 5IK2D 3CX7A 4FGZA 1HFEL 1NW8A 1HNXB 2ZVQX 5DFAA 5EEHA 1I80A 4YRZA 1Z16A 4KQ6A 3TL3A 2XZLA 3H2KA 5TC4A 5I7HA 3GDWA 5DN6D 5F4BA 2NUTA 1AQNA 2ATIA 2BEKA 2E9SA 1YONA 2FLKA 1HT1E 3P9PA 3FUVA 2LR0A 4Y18A 3ZWNA 4ECAA 4HNSA 4ZP1A 4RYLA 2H2AA 2VQEB 4BYMA 5JSUA 3MSXA 4LYGA 4V0KA 4CF4A 5L53A 2R3SA 5JJKA 4OHRA 1SUSA 3T9BA 1T2EA 5B2ZA 1QIFA 2W9XA 4IO1A 4LDJA 4MK4A 5L6MB 1W19A 1YDMA 4JD5A 2E1RA 2G25A 2OKGA 1P1IA 3D0RA 4WTOA 5B3JC 4DBLE 1DHTA 4UW9A 1LJ8A 3G2KA 3RS2A 2F1RA 1O8CA 3ZJYA 4P38A 1G6OA 1XA4A 2PJDA 4MWZA 5IT0A 3FSJX 3M3DA 2VCEA 4G5RA 3OFVA 3OP4A 2BISA 4QDZA 3KSBC 3PRHA 4ZIRB 3NYIA 3PNQA 1X92A 1A2QA 4W7HA 3AR6A 1WSBA 2XDYA 2ZDGA 4HLUC 2WTAA 3LU1A 3PTLA 2I54A 4MXDA 4E7PA 3R44A 2UZ1A 4AMVA 3DP7A 4E6PA 2JA2A 1DADA 5CYOA 1QFXA 4GDFA 3ND9A 3GGJA 2CV0A 1A4IA 3OZAA 3QJ5A 3B70A 4Y2YA 3C1TA 4GLJA 1FZTA 2R7LA 1D7AA 3U9TA 2OCXA 3VPDA 1RVDA 3F5QA 1JIVA 2XPCA 3RVDA 3T9FA 4TWJA 2PR7A 3EC2A 1BN7A 3G5MA 3O0TA 2AE2A 1UWKA 1YHYA 1UAAA 5FUXA 1NXTA 2BI7A 3ANSA 1ZPDA 2YV3A 1T13A 3RAFC 3ISVA 4H3KB 2Q49A 3RT7A 4EHNA 1FLAA 3NBFA 4P92A 4JLPA 1GARA 3DEIA 3MWLA 3N6RA 3DCIA 2O2GA 3AV0B 3R6DA 4YUVA 3VAYA 5A1JA 4NCBA 3CUKA 5ER9A 2ZZNA 3U19A 3T5BA 2G1KA 3NNNA 3TIXB 3OSUA 1T43A 1XDWA 3KPUA 5DWDA 3BRSA 3FPAA 4B31A 3Q9UA 4EELA 2O5VA 1Z88A 3WDMA 3WMXA 3UK2A 3EA5A 1OLSB 1SVOA 4FDVA 4MS1B 3PENA 2QA5A 4QZVA 3GZTB 1EM8A 1SKYE 4HGPA 3T7EA 4QGGA 2ISQA 2X0NA 1JPJA 2SECE 3AEKB 4UNQA 1Z68A 5CR9A 4HAVA 1HL3A 1BG6A 1BDIA 1C29B 4RA6A 1VZ3A 3T1QA 4YROA 4I4TF 1ZNZA 4C9BA 4MR9B 4P3YA 2EFYA 1LDNA 1JYFA 3DV2A 3JRWA 1NPDA 3DS8A 4B2PA 4EMUA 3MMNA 5FL3A 5JRDS 2O2YA 3TLJA 5J2UA 2CLOB 3VZPA 2L0XA 1JYSA 4OP1A 5BUCA 5AVUA 2YS6A 5BOSA 3DDSA 1C9EA 1PWHA 3PUZA 1O97C 1OX5A 2V7UA 4FYJA 1KZGB 4KDCA 3B82A 4Z86A 1TK3A 3UXHA 2D1FA 4RF4A 3U09A 4LRXA 5BVGA 1PYOA 3BFVA 5AI0A 1E1CA 4GICA 5DLEA 4HGYA 2H18A 3TIFA 2FF7A 1JX6A 4CLOA 2ABWA 3K0FA 4URUR 3ICWA 4I2NA 1JPNA 3EQ6A 1Q0RA 4X00A 3UJ9A 4HF7A 1K7FB 1XTQA 3G49A 3EVTA 5CLIA 1DDOA 2FRDC 3IVXA 4BNIA 3NM4A 4IILA 2JLYA 1K0FA 2UYQA 4F6CA 2C77A 1RR6A 2EKBA 2JRCA 4KQ2A 3DCNA 3WFIA 2I55A 2BGLA 7GPBA 5E3JA 3E7DA 1IPEA 3BMNA 4MMYB 1SHZA 1VMDA 3E35A 4EITA 4FE7A 1IN6A 2FMUA 1A8HA 2VHUA 4WXYB 3P9YA 3C15C 1MZVA 3A0UA 4R41A 3P0EA 2WSYB 3KFXA 3ZE0B 4DB4A 2WVAA 3F8WA 2NV0A 3LM8A 4WCVA 1QJCA 4MH0R 2CL0X 3URMA 3PITA 3G2OA 3E3MA 2FZVA 3KXDA 3GL9A 4TL6A 4TWRA 2FOXA 3GEDA 2QVXX 1CUFA 3DPSA 4TT3A 4O4IA 2W5UA 2WHRA 1EA7A 3A37A 3KHKA 1ECCA 1X0VA 3R0QA 1IL0A 4D8WA 3TZ6A 3AG5A 4XDYA 5HCNA 5KSZA 2C5BA 4H6XA 4Y98A 4J9VA 4L6AA 3EE6A 3P2EA 1JA1A 3DBOB 3L8MA 4IHQA 3ZYCA 1GCGA 2AFIA 1RU3A 4RGBA 1KMNA 1PEAA 3AKDA 4RQTA 3TRDA 2WUEA 3STWA 3NGXA 4NU5A 4FMDB 1SJ9A 2XMSA 4K5QA 3TSWA 5DYWA 3W79A 2XGGA 2XCSB 3E9CA 3KFLA 1UPUA 3UYKA 3VOTA 5U4QA 4Z6KA 4YDSA 1Y8RA 3WWEA 4DNOA 4WVFA 5A4JA 1M2KA 1A69A 1RTKA 1XV5A 5AKJA 3BERA 4IVPA 4BOYA 1YHZA 4Z1MD 1IHOA 4LF8B 3BRWA 2UUAB 1NNUA 4TYPA 2YFHA 3TB4A 5L40A 2NZ2A 5F9HA 1N0UA 2ZJ2A 4G8CA 4CCAA 5K03A 4Q24A 2IFTA 4RNDB 1EGMB 2B94A 2JHFA 2RJOA 3EX7C 3V6MA 4KUEA 2F62A 3EA0A 3IO5A 1QHSA 1ARZA 1DX9A 4MVJE 3RRZA 3SEZA 3UAYA 1O77A 5C18A 5IUNC 5LWQA 1RDFA 4N1AA 1X80B 4ZZIA 1FSGA 1J5XA 2GBPA 4KDRA 2C07A 2Z4TA 1F0KA 1CHDA 3KQYA 5DOVA 2C2HA 5D5HA 1G8MA 3M9XA 3EVAA 2DPHA 3D7LA 5KVCA 3HJCA 4D5GA 1PJTA 1CULC 1T9CA 1OWLA 2ESRA 1NJSA 1JIIA 2R6FA 2YYSA 3H17A 4TKVA 4RQUA 1FSFA 4UBLA 1EUQA 4OA8A 1GZDA 3AF5A 4M0DA 1DAFA 4EUSA 2Q45A 5JJCA 2VWHA 4FONA 4CIDA 8ADHA 4GVXA 4ZCTA 3IPLA 1QKKA 1AKVA 1WP9A 3O4FA 4X45A 2IHUA 4I4TA 2OZVA 2APJA 4A03A 3I9FA 1EXDA 1MHTA 3T61A 1RXCA 2FFHA 1A82A 1K8ZB 2HL6A 4C01A 1QP4A 4HYQA 2JHPA 4IHKA 2V7PA 4P5PA 1SXGA 4XRGA 3HCAA 2TRSB 4BVJA 4EKNB 1NI4A 1XXHB 1ZOIA 3PUVA 4LSWA 3ESZA 4BNDB 3U61B 1DCKA 1V35A 1XQ1A 2AVNA 4JK3A 3ETCA 4U3JB 1KRHA 1KPGA 4FDUA 2P35A 1YVDA 1JSCA 4MUBA 1DXHA 4Y9UA 2B4QA 3LUFA 2C9CA 1I7QB 4EI2A 4BXOA 1XA0A 1UWCA 1VA4A 3MT7A 2Q5EA 1LDEA 3UKDA 2AFHB 4YAOA 1VE3A 2Y2UA 3CLKA 3HDVA 2ZRHA 3DPUA 4HRXA 4IXNA 4QBIA 5AW9A 3UHJA 1G55A 3UXYA 5I7AA 1N5IA 3C1UA 4L57A 4ETNA 5FAKA 1I7SB 3R9WA 4F3RA 2C3YA 3Q8LA 4JJ4A 2DRIA 3RHZA 3V3KA 2JA1A 3GNQA 5DN6A 1GNPA 4RO0A 1J5EB 1JPVA 2RI0A 3H9JA 3GBVA 3SXJA 4BGVA 3BE8A 1FNCA 1H94A 1XQWA 1SC6A 2D00A 1GQ2A 2OECA 4UM5A 5BWBA 4PC6A 4FILA 1CD5A 1I13A 1C4KA 2XA2A 1P5HA 2BEUA 1WU8A 1WZ2A 1F60A 2AF3C 4CVNA 1YZGA 2PUWA 5DCUA 4HVLA 2NXJA 4L73A 3KV1A 5B2FA 3H5IA 3WIOA 3CRZA 4D4LA 1DAMA 1XNGA 2WJ4A 5FOUA 2UVPB 3MRXA 5GZ6A 3VR4A 2Z3WA 2V6IA 4QJBA 3H11A 2AF4C 3V9PA 1ZL2A 3R5TA 4UM8B 5EKXA 4K26A 3Q0TA 2CN1A 1EKXA 3WYCA 4PIMA 1SIUA 3UFXA 4JZKA 1KMIY 4M0PA 1E94E 5CEEA 1QQBA 1TQ4A 5DBOA 1Q3KA 4DC9A 1UZUA 5THXA 2EV9A 2DUJA 3V42A 4WLOA 5B7NA 4I5EA 1F8GA 1RIFA 3B38A 4MV7A 2F3UA 1WXGA 3WGNA 4B9EA 1QGAA 2F00A 2LPMA 5IT4A 4D02A 3ZE1B 3O8LA 3TTTA 4Q39A 1ZKDA 3OZRA 4BLQA 1QGUB 2R0QC 1TF7A 4FYWA 3ER6A 4LZZA 4AURA 4MIEA 3R9IA 5K45A 4CEJB 2OGTA 3IOEA 2CMFA 1LWOA 1LQUA 1QB8A 3OT1B 4G1VA 3SC6A 4HAYA 3IJ5A 4O33A 1VPVA 3ZQKA 3NDJA 1FDWA 5JYEA 1LDMA 1JG6A 2V8OA 1TEZA 5BQ3A 2VFAA 2E85A 4BEJA 4MV4A 3D64A 4LS3A 2P5UA 4UFOA 2AIRA 4CLRB 3JCZA 4F97A 3HKEA 4S12A 1S89A 3A25A 1ONOA 2O2JA 5EXDA 3ZHSA 1DV2A 1PO7A 1NG1A 1VIMA 1L4MA 1XVAA 2GD2A 4XIFA 3TR6A 5EGNA 2XDQA 1ZNWA 4I99A 3HUDA 4R1OA 2I3ZA 1R1DA 1FLDA 1LZLA 3A31A 3GH3A 1Z4JA 5JWRA 3BDIA 3NP7A 4NZPA 3DZCA 3Q2IA 1Z4OA 3DOHA 3K05A 1VJRA 4KB5A 3MT0A 4L4ZA 2R60A 3N5CA 3PF8A 3THOA 2Y68A 3WKBA 3OIWA 5EWMA 2RK3A 3OZVA 5EN4A 3ESYA 4RKWA 4B3MB 1G2PA 3JASB 3PHHA 3SU8A 3FWNA 1QRRA 2PAAA 3IQEA 3QKRB 1PFWA 3MOSA 4GP7A 3JVIA 4RJKA 1RQGA 2FPPB 6REQB 4EFNA 3FMFA 4CN9A 4E3ZA 4EHAA 1B8OA 1KXZA 1IN1A 4WV3A 1QZTA 1YOVA 5DSTA 2H6EA 2BBOA 2TMGA 2ZRMA 5JOQA 2J4CA 2W4IA 3AESA 3D54D 4HLCA 3NBUA 1DAIA 3PXGA 4MR8B 3RIMA 1RZRA 2WIKA 1E3DA 2Z2YA 1ZVQA 3AP2A 2NXWA 4UD6A 5LYJA 4YREA 1D04A 5DW0A 3UWMA 3S8EA 1RJ9A 4B4WA 1F51E 1PR4A 3EZNA 3HBNA 2QZZA 1FP4A 1QH1A 1YI8A 4KWHA 4QG7A 4NS4A 3L79A 2I4OA 2PMKA 2C5AA 4O4LF 4QQ8A 3PSAA 1CRQA 4RVGA 4MWDA 4YLYA 2IY7A 5D1HA 3LGAA 2AEJA 2X1LA 4FYHA 3V2IA 3WLEA 3MWJA 4YAJA 2ZK7A 2QGZA 1C3JA 1Q0SA 2BEVB 2C94A 4F7DA 4MI1A 4F4CA 1E3QA 3OPYA 2OV3A 3G88A 2CF5A 3ZIAA 3SFTA 3IHTA 1DQRA 4C2TA 1CF9A 4MP8A 4A2WA 3RARA 1AXGA 2XCIA 2JGMA 2XRMA 2R2GA 4JJIA 1W36D 2PLRA 2D0IA 2IIBA 1T4CB 4EA6A 3LGXA 5D51S 2Q0SA 3AHEA 2CY0A 1T5LA 1YH3A 5AKYA 3RYHA 3FYTA 4H7HA 1J09A 3QVGA 3H5VA 4YP6A 1E79D 4ZCQA 3IUEA 1WEKA 3GG9A 3STVA 4C3ZA 3IOMA 1P77A 1SUAA 4S1NA 1RWKA 4L78A 3IGFA 3EFOA 3I42A 1LLFA 1I0ZA 2IYFA 1AQJA 1GTRA 1QE5A 3E1SA 1Z0UA 1CZRA 1TQHA 1ISRA 2VHEA 3C70A 4XB6B 4G09A 2F48A 4KVFA 1EGHA 1RT9A 1U6IA 1T3TA 2YZ2A 3IUQA 3KLNA 3N2YA 3NT4A 4NEHB 3ESCA 2XGOA 4H0NA 2Q6OA 4AWBA 2B4RO 5JBQA 3C3PA 2VNKA 4LHVA 3RS0A 3ORYA 2Z2XA 4GX2A 2YCBA 5DASA 4Z1MA 3LZCA 1JFVA 2Q3EA 2AG0A 3NFRA 4FDMA 1ODKA 5A7FA 2G4LA 5DM0A 1AV7A 4UHHA 4CLXA 4ZEMA 2C2GA 5KOYA 1P1HA 1LPOA 4FEEA 3QWBA 2O8FB 1QFJA 3Q3IA 2DHQA 4DBLC 4Q66C 1GNQA 5B7PA 2ONKA 4TT8A 3CNLA 3KYDA 2KWIA 2R48A 5JAZA 3QWHA 1GAJA 1KYTA 2F90A 1RADA 4G0VA 3PICA 5A9RA 3T7AA 3ZY3A 2EW1A 1TM3E 2NNWB 1GAWA 5KDLA 4DREA 1QTQA 3IODA 1OYWA 4A5SA 1RSZA 3HKDA 3RCBA 4AD8A 4OQZA 5GJBA 1G3UA 3GEBA 3GVPA 4X5OA 1XLTA 3A10A 4M60A 3L0YA 4R54A 4R8KA 1DPGA 3FUTA 3RTGA 4BJHB 1GCIA 2H3HA 2SKCA 1OYYA 1XIVA 1PT8A 1ST3A 3VR4H 3ZNQA 1IN4A 1U8XX 2GN9A 4LECA 5D5QA 3S2UA 1ELOA 3DMYA 2X23A 1QK3A 3PI7A 3EYWA 1I7PA 1W4AA 5EOVA 4ETIA 1DIGA 3HYLA 4AF6A 3EOAI 3GB9A 2ZXFA 4JP2A 5CIWA 3H9UA 5KU1A 1RACA 1XAJA 2E4UA 3BN3A 4JLBA 2AW5A 4OHCA 1C1XB 5BO5A 2XUAA 3E1GA 3UWPA 4IDCA 3Q2OA 1YJBA 3CX6A 4IIVA 1CUZA 2B7LA 3KEFA 2QJTA 2GKSA 2JDIA 2YYZA 3N0XA 1RMTA 2XUIA 3CONA 4CKWB 2EEPA 1I4TD 1XQVA 3PQ7A 2QEQA 3ZOZA 3EH1A 4IYRA 1WVIA 3M9WA 4W99A 4UQLA 1JH8A 4QHTA 2I1WA 1IVNA 4D3ZA 1WJGA 3GX1A 2NIPA 4DC0A 3IP8A 3EQZA 1PL8A 1BJTA 1HUQA 1QH9A 4KGXA 3X2EA 1E4EB 2HA2A 2LBPA 3T3IA 4KE7A 2FK7A 3VXKA 4L15A 3W6UA 1X2BA 3BGDA 3PNLA 1EP3B 4O29A 721PA 2WHYA 4OX9Y 4OYHA 4J7CA 1VJTA 2V6JA 3CJTA 4PZZA 4XR9A 4LY3A 1RP1A 1Y8QA 2BKXA 2G0TA 3C14C 3GP5A 4YA6A 5JNWA 1G8FA 1OBHA 4HDNB 2P9GA 1TYZA 2P0YA 1TNDA 2WM8A 1DI0A 1E7MA 2P6NA 3OPXA 5HWSA 1JVBA 2HF2A 4GSYA 1SVNA 3PCXA 1AGRA 5EQFA 2I66A 3CWZA 3RGWS 3VZDA 3KQQA 4MQLA 1FP7A 2OLEA 2P30A 2JKZA 2VBFA 4JT9A 3R3WA 3VPXA 1U5CA 2QJRA 3UY4A 3WHLA 2W2KB 2N9UA 1GU7A 5H83A 5DRTA 1OXXK 4B71A 4CHTA 3LWBA 2PX8A 2PIAA 4LUCA 5FP0A 5JY1A 5KNLA 1TYAE 2AZDA 1DOHA 3NIFB 4M6WA 4IF6A 5IAAA 2P6RA 3V1LA 4TLCA 2R4TA 2H65A 1P8JA 5FBHA 3QYJA 4O1MA 5KYVA 2ZITA 5IM5A 1CUEA 4KREA 3T9DA 4U7TB 5D8DA 3CZ4A 4OHMA 4AG5A 5A02A 3T7RA 5EG5A 3AB7A 4B09A 1RYHA 2OOSA 1AIPA 1NI3A 3N86A 4BB6A 1H2RS 5F2NA 1HY3A 3C0KA 4OUDA 1C3EA 5G53C 1AH2A 3DBRA 1CWUA 2XE6A 1BIFA 4Y0NA 1TJPB 5ES4B 2CDCA 4PO8A 2IUEA 3PFNA 4MIOA 2QPTA 1P8AA 4HQRA 3NYRA 1ILWA 1UXOA 4WKOA 1CUGA 3OCZA 3WFJA 2EYUA 3Q6NA 1L7QA 1HLFA 2NQ8A 5FO0A 3TD9A 2ZIZA 5F1YA 1QRTA 4MJXA 2Q9AA 3ZKWA 2HF9A 3QKSA 5J2TB 1TM7E 1X7HA 4QXAA 1MC8A 3O31A 1N5JA 2H06A 2VAVA 4WZZA 4AMYA 1IOWA 3DZ8A 4MW7A 3WGTA 3ZYZA 4DYDA 3IEMA 3GLVA 3G0GA 3BIXA 2AN9A 2O05A 4HN9A 4EBFA 1ABEA 1YDWA 2IF2A 3CINA 2IYVA 4KE8A 4ALJA 2D7DA 3JAKB 4AS3A 4DDUA 4RPLA 1TQ8A 4JJEA 4CQJA 3V4FA 1KAOA 1Y63A 2JBAB 1USVA 2X15A 3K3PA 3EVDA 4UE6A 2EFDB 4HQKA 1FXWF 2PDAA 2WSMA 3AKCA 1GTMA 3IR7A 4XYMA 3JQ6A 4B2YA 4JKYA 1QQ5A 1P75A 3WL6A 3FNEA 1CUVA 4RGVA 3V4VB 1OOEA 5BN3B 4AZ3A 4IDBA 2EKQA 4IZHA 3HDJA 4J2OA 4LVCA 4XLLA 4N3CA 3D31A 4MUNA 5B5SA 1GFIA 1NQVA 3RU3A 1JHRA 1ZQ9A 6PFKA 1VJGA 3UK6A 3CV3A 2RFLA 4EVRA 1T9KA 1Y5RA 2EL9A 2FQYA 4FWIB 2ZAGA 2DGDA 1PJBA 5KNBA 4TTRA 2IZOA 4IUDS 5IM4A 2NVUA 4TMWA 3VYVA 4ND6A 1K9VF 4QUHA 1V7CA 3PR3A 3DZFA 1BXKA 4RKQA 3OJFA 3RR2A 4PN7A 1ZWKA 1DKLA 4B76A 1AKUA 2ZJYA 4JEMA 4MAMA 1ZD2P 4PPNA 2JLBA 5E6UB 3GUYA 1DKPA 2QG4A 4PG5A 3SF0A 4ANFA 4DUGD 3TOSA 1RYMA 2CLKB 2YXEA 5A04A 3AUXA 1TA4A 2YN2A 1RC0A 2QYOA 4X8HA 2C42A 4L02A 1A7KA 3EPKA 1L9KA 1OAOA 4S2UA 5J40A 3THYA 3GOQA 3KDAA 1BS9A 3NFYA 5G4KA 4PLPA 1CUSA 1OLUB 1J39A 4L8LA 4MQFA 1JLLB 4N7MA 5B64A 4N4AA 5C1PA 4B40A 3I52A 1YQWA 1Q12A 2JHGA 2NTEA 4PYNA 4BJ3A 5F1KA 2QNRA 4EJ2A 1TFUA 1Z8DA 3U4CA 4RZ2A 3CZQA 4TQAA 5C52B 1B93A 1ODLA 5KVAA 4MRSA 4ZEXA 2ZJFA 1TVEA 2FDCA 3FGPA 1U3CA 1FDSA 1II8B 1XDBA 1JMKC 3IP1A 3LX8A 3CJRA 5TVGA 2QQEA 2IELA 2BI8A 1L8LA 3JQBC 3OF5A 4PQFA 5KIAA 3R7DA 1M33A 4OX9B 3I9LA 1KDRA 5FV4A 5LZ5A 3PQEA 1QTIA 2C29D 3MG9A 4D0LB 1KARA 1PQYA 1UBGA 4C5CA 2I9PA 3H2ZA 1NMXA 3T54A 4C03A 5JCJD 2D7JA 4BAUA 1Q20A 1YD7A 3C7AA 2IYLD 3KKQA 4AULA 4X90A 1E3SA 2A57A 2P90A 4M54A 2BW0A 3K2BA 3NKVA 1FYFA 1RQXA 1E6KA 4KO2S 4WT7A 3TFOA 1G6Q1 3C45A 3SDSA 2WQ6A 1VIAA 4F1JA 4X61A 4YPOA 3LLSA 3SVLA 3A26A 4OOEA 1NOJA 3JQ9C 3A27A 4HDMB 1N1EA 5DTJA 5J47A 2V7BA 4D99A 1XEFA 2VN8A 4G5FA 1LEHA 5JS2A 3TLGB 4LXQA 5LIPA 1DHRA 1NN1A 1Y6ZA 3HDYA 3VJRA 3EDOA 1MB9A 3ODPA 5KYKA 4UU0A 5J4VA 2Q2VA 1XZDA 4QBGB 5TXGA 4ZHSA 2E4YA 4HNAA 2XUHA 2JJMA 5JCPA 2P2ZA 4NX2A 1N2EA 1CKEA 1QMGA 4IEFB 1G17A 1LPSA 5IARA 3TQFA 1TD1A 2CCKA 3WB9A 2J0UA 1BJKA 1SZDA 2PUVA 3I4LA 4LMAA 4LYFA 1T15A 2IY8A 4TS9A 4DABA 3FUWA 5DMHA 1ZM4A 1EGAA 4TOIA 4TRJA 4M7RA 1E6MA 1FXWA 4OJTA 3BK7A 3EPJA 1ZCZA 2OAGA 9ABPA 2WSBA 3U17A 2J08A 1H1TA 2YUIA 1Z2OX 1ZIXA 4ZRNA 5ARDA 3PC4A 4QFBA 4AB1A 4YMLA 3OX2A 3GP8A 4P93A 1N2CE 1QH8A 1RKVA 1YB6A 3B52X 2QNIA 3FOAA 3GLTA 4XJTA 2GASA 4YN3A 4BNHA 1OFUX 1Z17A 2BPOA 2IP1A 3EF0A 3NPMA 5F2EA 3KKPA 5CVVA 3P27A 3WO0A 3CS3A 1G5FA 2ZIXB 1PLJA 4OFXA 2P9ZA 3HWSA 3I04A 4OQQA 1ZXBA 2O2SA 1NXSA 2A92A 4OQMA 4FNAA 2VQ6A 2ZYHA 3O3NB 4KI7A 3R9XA 3N2NA 4EKIA 1OAKA 3QA3E 1TUGA 1ZJZA 3D9QX 4RHUA 4HP8A 1UBSB 1TD9A 1W2HA 3DDCA 1MNAA 4AJJA 1F6DA 3Q1KA 4EEKA 2QM3A 4ZU1X 2BTEA 1YIDA 2H3EA 1ZUWA 3ENZA 2XT0A 3OBBA 3PG5A 2VJNA 4U7WA 1P74A 3QKTA 2QVBA 5D7NA 2JIDA 4Q3CA 1AGYA 4DZZA 3JARB 1PT9A 3MWFA 1I5EA 2XJ4A 4ITVA 3SXPA 3IVGA 5IDVA 1T1RA 2K7ZA 1WULS 4L8YA 1X3LA 2JFVA 4EMTA 2QN3A 3CLUD 4NLLA 1SY7A 4FHZA 5AHRA 2J3IA 2CVZA 4YRQA 1SU4A 3SYLA 3V4ZA 3TDMA 3PHIA 4DLRA 1K8QA 1Q0QA 2ZW9A 2V8BA 3TQIA 5CFNA 5FFNA 1I0LA 3V55A 1RE0A 2OXEA 5KBYA 5KYXB 2VP4A 3PRKE 4W7IA 1REQB 1Z75A 4JU8A 2L18A 2LIPA 2Y9MB 1NF8A 3PKJA 1XEXA 3I1YA 3PQ4A 3W05A 3LTEA 2H54A 4HUJA 3BAZA 3FX2A 4MOWA 2HKIA 2ZJOA 3FTPA 3AILA 3VNAA 1NU6A 1E8DA 1IZ8A 3LYLA 3PGKA 1KJQA 5EMJA 4EHBA 3DEKA 1KC3A 4PRYA 3FKQA 4NAVA 4QDJA 3DPIA 1DS6A 5IEBA 3ZW9A 3QTTA 4XX0B 3IIEA 3Q7TA 3WGOA 3D2LA 4WKNA 2DTEA 3DFUA 1O96B 2I2DA 2ZI6A 3ASZA 3LDHA 4MQ6A 2CXNA 2I6GA 1F4PA 3RSQA 3ZBTA 1L5SA 5D84A 2FFJA 4JI8B 4E2YA 2BMEA 3IVRA 5IP5A 2C8VA 2PGOA 3U3OA 1L4LA 4YXFA 2BKVA 1VCNA 1T2AA 2P4QA 2FG7C 1FDRA 2VPPA 4HWGA 3S4YA 3THXB 3G8YA 3GJQA 9LDBA 3DE1X 1YQTA 2BCJQ 2ZSFA 1E58A 3FRIA 1IEQA 2MSKA 3I1IA 4Z0PA 4CM9D 4YJ3B 3GDFA 2A67A 1PX2A 1XK7A 2C96A 1FXSA 3B6JA 4N3NA 3W0LB 1RI5A 2WUVA 4IBOA 4HN2A 2Q3JA 1ZJ6A 3I9KA 1KJWA 5BORA 5KNBH 4XPIA 1RBQA 4CKXA 3PKIA 4RMGA 2JAHA 4KZPA 3P5SA 2I1LA 2QN6A 3DLAA 4QJIA 4RJIA 4UDYX 4UOEA 2E6KA 4I1SA 1LC0A 3TX2A 3KJEA 4AO6A 5T4HA 5A3QA 3MINA 3PDJA 3RK4A 4NHOA 2VOEA 3D3KA 3KHUA 1YL7A 1XCOA 3EXEA 3FD8A 5IKPA 1V3TA 3MEQA 4C3OB 2FP3A 3MS7A 1N5OX 2AVDA 4K05A 3RFCA 2YASA 4I8IA 3GUHA 2J07A 1MPXA 3SYNA 1ZRHA 3WWDA 5CEFA 1D2EA 1AS3A 4IZOA 5JISA 2WAAA 2G8NA 2NZJA 3GGPA 4YV7A 2BEWB 1ZBDA 3G0HA 4MMXB 1C7JA 5EMMA 2QKYA 4OBBA 3M1IA 2NUAB 3TUIC 3NEYA 4F4JA 3G8BA 2PE5A 1FJGB 1XZAA 1JJVA 3NHWA 4AS2A 1YRBA 1VSTA 1ISMA 3I5YA 1WUIS 1M1YB 5BYJA 1G21B 5IVPA 4P82A 1DIOB 1MFZA 4HLQB 5BW4A 4LMPA 2BLNA 2Y1EA 3PDWA 1Y3DE 4FBLA 4Y67A 4D57A 4DCVA 1ZCAA 1F0NA 2Q1TA 2C7OA 4MWSA 2IYYA 4LA4A 4LX8A 2WICA 3WBJA 2VDRB 1T9AA 2VXOA 4RD4A 3T4XA 4WY5A 5E1OA 1UJ6A 1EK2A 3TG2A 2F6RA 2VYFA 2WMDA 3ZZ1A 4RMHA 1A4UA 1LS1A 5LZ8A 1D2GA 4P0TA 1FL9A 1VJ0A 3FIUA 3IDZA 4ID9A 1QQ7A 2R7MA 1K3TA 3TD6A 4KO1S 5CXXA 1BX3A 2X2FA 4QT0A 1SOUA 1ZI6A 3BCSA 2HSEA 1XCGB 3N07A 4K1XA 1JAXA 3DF9A 4Y9DA 2NYVA 4JI3B 1H0KA 1T8TA 3UHOA 1NBIA 4BYGA 4F92B 1V39A 2OCIA 5LLDA 1Y1PA 1V5WA 2SCUA 3AUFA 4RH3A 4RW0A 1UC4B 1FRVA 4GZ3A 5AJZA 5ARBA 3W34A 2G08A 3K35A 5HSGA 3WNCA 4CBVA 4PQYA 2QUKA 3I8XA 3MLBA 2PD3A 1G42A 4IIFA 4L8WB 3V8BA 2FPGA 4FLMA 1G60A 1DAPA 1A9XB 1V5EA 3EIUA 3FPKA 2GGSA 4J75A 5KU7A 1DUVG 2GJKA 1Q92A 2DY1A 2H1FA 1U2PA 3SJBA 1LLUA 2Z58A 4AJ4A 3QU9A 1SBCA 2COUA 4IDFA 1UKVY 4L22A 1JQJC 2E7ZA 4HJRA 1G8SA 4WIAA 3VOAA 4RFSA 2MCFA 3UC9A 1A9SA 1IDOA 4W9NA 2XF2A 4J49A 1WHTB 4OHWA 3DNFA 3NHKA 4IDNA 3HLKA 3U7IA 4AX4A 4C08A 1BHJA 1OJLA 1AG9A 1R6BX 4IJWA 4R2HA 1Z39A 2VTDA 1DRKA 2C0PA 2C95A 3E8XA 3IDOA 5K4HA 2A9JA 4GWGA 4IRUB 4JLDA 2GEBA 3MUEA 4WLUA 1MQSA 2JIQA 3KKZA 2C9YA 4V03A 3P8ZA 1V16B 2IOYA 3JD0A 3TEFA 4LAFA 1IE3A 1TTQB 3DP9A 1V5GA 2EATA 1J00A 4CETA 5IJ9A 1L6IA 4F6RA 1YVUA 3MM4A 1J06A 3H1PA 3A1EA 2VHCA 4JUFA 1AO0A 4TLBA 4EUFA 1XD2A 1F6BA 4WKPA 2VSYA 4FR0A 4RAQA 3R8XA 4JQSA 3TLZA 4DNXA 3RYCA 1MRNA 2FUCA 4LCJA 4EF6A 4AY2A 1HXHA 4BZWA 4RIHA 1XPUA 4EW3A 2I99A 3G89A 5K3EA 2I0FA 1U31A 3LUJA 1Q7RA 2ZPAA 1A9OA 1TEXA 2HHAA 3M33A 1V8OA 4MICA 1NT4A 1WR8A 2P69A 1J9EA 2Q3FA 2IXEA 4EPRA 1FDVA 1PD1A 4KWCA 1CVRA 3W1WA 2GI4A 2QR5A 4I9UA 5K7SA 2BKLA 4LRQA 2J3QA 3KEMA 3LQQA 3IKTA 3QV2A 1Z63A 3M89A 2BUAA 1CUDA 4LNAA 3DCYA 4CMJA 1XD8A 3GFQA 5CMLA 2GZ2A 3OM0A 5HILA 2BFOA 3HUFA 4LBWA 1OJ7A 1A8QA 4LI0A 1NN5A 4EB6A 2J5RA 2OMKA 1JEQB 2R79A 2H08A 4G4JA 5HGJA 5KVQA 3OA0A 5L4LA 3DMGA 2WJZB 4MROA 1Z6ZA 2Y27A 1N2GA 4QGAA 4CM4A 4DG9A 2JI7A 2FF5A 3L2OB 4OXNA 3TVTA 3WWPA 2WIJA 1I51A 3K16A 2HCJB 3L8EA 3O5AA 4OK3A 2PQ0A 4Y1RA 5F1PA 3TCNA 3TZBA 2XAUA 1ZN8A 3CLRD 1A1VA 3PE4A 2R2AA 4PGAA 5HJEA 3ETDA 5EIOA 1FFBA 3KPWA 1UAYA 4GM1A 1I1QB 2MSDB 4R98A 2OPHA 3ACCA 5A5VA 5EZQA 8ABPA 1RJGA 2PV7A 1IAQA 2ADFA 3F2IA 1V6SA 2D4HA 3I2GA 2QX4A 3CUSA 3GG2A 2ETVA 2W70A 1D2RA 3ZEIA 3AT1A 4DRXA 4EYSA 3CX3A 1ESEA 4QOEA 3IDFA 1XLUA 4QOHA 1QIMA 1OYVA 4NONA 2NZXA 2B3TA 1BFKA 1HSOA 4XB1A 4W1SA 2Z2ZA 1YMQA 1SBHA 2ZI9A 2B21A 1OI3A 4PLGA 3PC7A 3L05A 3OQBA 1NVXQ 3TOCA 1J56A 4EPXA 4CMAA 4DY4A 1OFVA 3O4RA 4LZNA 1PDVA 1E0SA 4MUIA 3JU3A 4Q5IA 5CPFA 2ZEJA 2CNWA 4Z9FA 1Q74A 2BCEA 3C6BA 2QF7A 1VI5A 4GBJA 4X8OA 3SDZA 1ZD8A 3T99A 4E5MA 2ZLBA 3ZU4A 1DG3A 4IM7A 4EEZA 3CRRA 1YRYE 2XEXA 3UM9A 3IT2A 2G9ZA 2W2VA 3A6KA 3IERA 3A1NA 3L5OA 4KQHA 4NRDA 1RAEA 4RHCA 4WZ6A 4AN1A 4ZHQF 1Z8NA 1SU8A 3KEQA 1AN0A 1MP0A 3ZN2A 2OCLA 2RHDA 3B1ZA 4FN5A 5IJ0A 3NC0C 4GGPA 1IVYA 1LRLA 3W5CA 1XZQA 3QZUA 4NJOA 4CR6A 4RIFA 3K5WA 3W5DA 4IDHA 2BKAA 1GFSA 1KO4A 2QQFA 4LJ4A 4P4GA 3ZGYA 4ZOQI 4P32A 4UUOA 2ORWA 5B1DA 3ZVLA 1DT3A 4GL2A 2ZYVX 4BMOB 2VTKA 2FR1A 1LK5A 1O5TA 1JLSA 3SX4A 6Q21A 1Z82A 3FRHA 2PGJA 4XR4A 3HY6A 4BO7A 4EGJA 1QIDA 5C5EA 2JATA 2MYNA 1NVDA 1RJEA 1ZMRA 3AHFA 3I04M 3JS5A 3JYQA 1JR2A 4PZ0A 1KY3A 1UDBA 3F7TA 4BQNA 3D43A 3EMKA 3EGEA 2B78A 3FLEA 4X7MA 1ZAYA 2ZSBA 2AL7A 3DV9A 4WLNA 2FW8A 5CGQB 5IFKA 2V3CC 2Q9BA 1O94C 5E6SA 3B9QA 4O2AB 1UM8A 1QPGA 4XWKA 1PU2A 3V2UA 1DKRA 5L3SA 1Y7TA 3BXEA 4DA9A 2RBKA 4OYRA 4QGFA 2Q7XA 1CV2A 5EFOA 2QR3A 1Q84A 2X6TA 3PXUA 4AZVA 4YT8A 2NTYC 1UM9B 4KNVA 4HK4A 5HDQA 1W4BA 5DM2A 3SOZA 2NVOA 3ZCUA 4NE9A 1ISFA 1ECBA 1P91A 2P6UA 4L4XA 1E2LA 1W5TA 2BAGA 1S3IA 3DHVA 4G0PA 5E9WA 5TR9A 4LF9B 1HE3A 3SJAA 2RGAA 5EHXA 3T1YB 4TTQA 4PGGA 1QPZA 2BJVA 2ALJA 1L7OA 2WHQA 4ROTA 4DJDC 5KKNB 3AQIA 2CD7A 4XSGA 1JSXA 4M8KA 1QU3A 3SZLA 3WLSA 5IPFA 1T5SA 1VFNA 2DPMA 2GTPA 3LUCA 4ZDKA 4BL5A 4AXBA 1Q19A 4UTRA 4ZYTA 1TKBA 1A3CA 2YVAA 3I3OA 3DMRA 2OV8A 3TE6A 1T2UA 4KLRA 5DTMA 4TV8B 3A6JA 3AI7A 3DHWC 2OAP1 4GMFA 3PKZA 4NCIA 5FUYA 3ZVNA 1Y6FA 2R5NA 2WFMA 4QYIA 3OUTA 2II6A 2BDTA 1RWBA 2PFKA 4EJ0A 1TO6A 2C1ZA 2RDMA 3EIXA 4L8FA 3GFVA 1XNRB 1E7RA 3LXUX 1SHKA 3UK1A 4PG8A 3QBTA 4FD2A 3TLCA 4X7BA 4BZZA 5SYAA 1VRWA 2QRKA 1CP2A 1VJDA 3H4IA 4C7XA 4MO2A 4LZLA 1JFFA 2WD9A 2R6HA 4BO1A 1XK6A 1IAVA 4BGUA 1DARA 4XGIA 5E95A 4IDPA 4RQAA 4R0MA 1OX4B 2VYCA 2AFIE 3DXFA 2WJ3A 4JJ7A 2J9GA 1BU5A 6LDHA 5AW4A 4DJAA 4ROSA 5LIRA 2VUSA 4UMVA 2XTNA 4AY5A 1UJMA 1YFKA 2N75A 3L3BA 1KEPA 1M1NB 1UPBA 3FHJA 5EQTA 1JIXA 3HY4A 3ZQJA 4S1VA 2D2XA 4ZN6A 3LFUA 2TMYA 5AW1A 4ZHQA 1U63A 5IG2A 5K3OA 1UODA 4LIPD 1A5TA 1SVWA 4BZPA 2XBMA 4KPUB 2FLVA 1JKJA 3JQQA 4EY3A 1JUDA 4GPBA 4TRNA 4CIAA 4AL4A 4QBKA 2A9KA 4FGKA 2CUNA 1NYTA 4JVOA 1RABA 3IRVA 2ONZA 3R5SA 3GFPA 3ODGA 3OM9A 5KWEA 3A4MA 2JI9A 1QP0A 4OHYA 1P6XA 1DMRA 4MYTA 1FEZA 1CFJA 5TEVA 3ZTWA 1E5DA 4DQKA 2OHIA 5HE8A 4PZLA 5JASA 4CV1A 2FQQA 4Q21A 4R1UA 3WNBA 3KSMA 3TF5A 5IAOA 2FMKA 3HEMA 2PKQO 2PBLA 5ALMA 4EI8A 4BLTA 4D80A 4BC0A 4XGRA 5HZHA 1RJFA 3S8MA 5G3ZA 1V1JA 4RZUA 3TZQA 1IY0A 1Z12A 5A3RA 3RVRA 1AUVA 3JAWA 3OJ0A 4U5QA 1B3BA 5JMTA 1LC3A 1Z06A 4LHZA 1J07A 4TQGA 4P4NA 1ENZA 3JQPA 3B3JA 2DUUA 1N6HA 2R6DA 2VHWA 4F4UA 1U8CB 4L85A 1YZHA 4WNAB 5EPUA 4YR7A 1TU3A 3QX8A 4UZFA 2C57A 1XTRA 3IH5A 1ZIPA 1KP9A 4H7FA 4YRSA 1R7RA 2P4SA 1T8PA 2VT7A 4HRAA 4GAEA 4KPEC 1AS0A 3CJQA 2HBZA 2Q5QA 3MMSA 3T3GA 1AQ6A 2CL5A 3IOYA 2IUSA 4ND5A 1U4NA 5DBHX 4UM7A 5CAEB 1PSWA 1O9BA 4NR0A 5REQB 4BU1A 2H57A 2PRIA 5DHPA 3NIWA 4DWVA 4UAGA 3N70A 4GZMA 4XVQA 1Y7LA 3WLNA 2PWZA 4LC9A 1ZUD1 4DMKA 3PNBA 5A1TA 2DP4E 3NJ8A 3TTYA 5LLTA 4MHSA 1Q6ZA 4EHHA 3OQIA 2W2NA 1YBMA 2DZDA 1KJZA 4PICA 1JQEA 2WFZA 4P7GA 4LQCA 1X19A 2JLQA 4ZV9A 4PINA 5AVYA 1KH1A 3NC4A 3RFFA 5CXUA 2JGNA 3LG2A 1NFFA 2ID8A 3LZDA 3PHLA 4RKEA 1WKBA 5H4GA 3ULKA 1BXGA 4FI3F 5K6TA 2ECOA 1F48A 5CM2Z 3S40A 4DLSA 3USES 1SOMA 3V5NA 2ISCA 4V0OA 5AXCA 5CT9A 3L1JA 4BB9A 2ZU0C 1SXIA 1QLJA 2AEEA 3U80A 1B41A 3Q8MA 2WG0A 3KTAA 1T5BA 4RDXA 2WTMA 4AJLA 3M5DA 3PZRA 2BHNA 1EQUA 1JDPA 4Y2XA 3J81k 3SHOA 1UCFA 1PS8A 1WM1A 1BD3A 4BUZA 1AZTA 2PKWA 2VCYA 3ABRB 3D6VA 2GBCA 4XI9A 1BE0A 1ZH4A 3UWOA 5B1SA 3AW8A 5C8ZA 1OFHA 4OLAA 1V9SA 3ZXSA 5E7JA 4J3FA 3CUEF 1M1XB 2B6HA 4RLHA 4G07A 4L08A 1EWQA 1KS9A 3FTNA 4TUYB 1QORA 1FQKA 3K0AA 1JDNA 2OOKA 2FV8A 1Z45A 4L4YA 3SQOA 4D3DA 5BNWA 1E77A 1OZAA 2VNJA 2H1SA 3O3CA 5DISB 1S8OA 2PKXA 3VPFA 4D96A 1SGWA 2XNKA 3FHLA 4F21A 3FYCA 3PU6A 4QX6A 2B61A 4BP1A 1X9GA 3WP0A 10MHA 1WUKS 4FQ7A 4QTTB 2X0EA 3W3ZB 1N8SA 1RWXA 4J6EA 1OKKD 4ESEA 5CXQA 4OMFG 2A1IA 4B4KA 5C4IA 3NHZA 3L84A 3OZCA 1X2EA 4LXGA 4I50A 3TAUA 3VUFA 5E0KB 4Z4IA 1H0HA 5COAA 4RJLA 4A16A 4NI5A 4UCXA 3B9PA 3EQ9A 4D0NA 3KAJA 1O87A 3AUSA 1KL7A 2ODTX 1J22A 4J0JA 4EO4A 8AT1A 3T1VA 2HCRA 2OZEA 2BHSA 1KBZA 2VDLB 3A1CA 3AEUB 3Q7PA 3TSCA 3THWB 1EVZA 3MWKA 1ULSA 2WINI 2IYSA 3IBTA 1HI9A 1YRAA 5JALA 2QZSA 3SLGA 2BFFA 1DC5A 2JFHA 3HCBA 3FNQA 4ARZB 1QUEA 5F7XA 2X3YA 1WLYA 2GPJA 4C4PA 5CDUA 3R40A 2D06A 2O2XA 2QM7A 3IVAA 3VPGA 2IZ5A 2O9JA 3B1KA 4ER7A 4FM9A 4IUYA 1B16A 1Z15A 3W8DA 1QHXA 2EHJA 5CH3A 3LYAA 1DWQA 4XJXA 3TM4A 4BLWA 4RACA 1TCAA 1XRSB 4KV9A 4A4DA 1PK7A 1CRWG 1SCJA 1ODIA 2IHKA 3EOBI 2VNAA 4S0ZA 1SXJA 3GO4A 3ZCPA 4CTOA 5BSWA 2ZQ5A 2QLTA 3C3AA 3E3AA 4LWOA 5EP2A 1ZAKA 5JFOA 3WK5A 3PFWO 1UK8A 1DT5A 3BX1A 2BGIA 5DHQA 1XZJA 1JILA 3HXOA 1DMSA 4LDQA 1S8FA 1GADO 1W0JD 1MCZA 2QTRA 3OO0A 4RANA 1LPPA 3LT4A 4N3AA 4US0R 4YS6A 1U02A 1OWNA 1RWWA 2BUBA 2JZCA 4XM1A 1PCXA 1HQKA 1M6VA 3I1JA 8GPBA 3V8RA 3OY7A 1RHMA 1XFDA 2DH5A 4URVR 5IHXA 2PBZA 3SEQA 5FH9A 2QP9X 4PHTA 3ZWDA 3HM9A 1KVUA 2PRKA 4IFTA 2RG1A 1C3LA 1Y80A 2YCLA 4YACA 4ZI5A 5ES3A 1XTZA 3WKCA 1KP2A 1XELA 2RAVA 4YCBA 1V37A 4LI3X 1M2NA 4U2EA 3NAQA 1CJCA 3PDIA 1GLNA 2JFOA 2DPLA 2Q0HA 3E70C 4XEHA 4A91A 5HXAA 2OV1A 2QLBA 1ONNA 3EVEA 1Y82A 4KQFA 4RVFA 3TO5A 3ZWQA 1Q0TA 1OXMA 2OUIA 1SHLA 3N76A 2RGNA 3IEKA 2OP1A 1HE8B 3F74A 3LYUA 5BV7A 4OB8A 5IASA 1IY2A 2YWHA 4INJA 3QNMA 3NXKA 4D4HA 2ANCA 2FY8A 4KFRA 3X2FA 4P0PB 4OHZA 1BMQA 4LVOA 4YO8A 2R97A 1I1HA 5HFAA 1YR9A 2YJ4A 1NKVA 2Y1XA 1Y7IA 3QVOA 4E21A 3EUAA 4CL0A 5EHNA 3K9LA 1NBMD 1O6CA 2A3NA 2CL6X 4HZUA 3UAOA 3S7TA 2PKEA 1E63A 4KCGA 4Q7EA 1U0OC 5BYBA 3WRXC 4EAQA 3H5LA 3E3NA 3RW9A 1F8XA 2PA0A 2OZLB 2DBRA 3QKIA 1DC3A 3A1SA 4FZVA 3U7GA 1B23P 3CWCA 3DWFA 4YUXA 2JFGA 1Z5PA 1U9IC 2RSLA 1VE7A 2JLUA 4MTLA 2QTFA 4E2XA 1IMJA 3WAJA 4BBJA 3C3BA 4X1OA 4OXQA 1SKAA 2BBWA 1DBSA 1WKCA 3PI6A 3L1IA 2G5TA 3GYGA 4J4BA 3I5AA 1D1SA 1LTQA 1W4LA 1XN4A 4GYWA 3KYIB 1WF3A 3KJHA 1AKRA 1E2QA 3GN2A 3PE6A 1I4DD 3Q7SA 1E5XA 3WBKA 1ND6A 2HPAA 3QXXA 1WB4A 2C1EA 2F9FA 1LK7A 1DNPA 3WGKA 2UYHA 4C5BA 2AW3A 1KTVA 3R0VA 2ZROA 2YN4A 2PZAA 2BMJA 2ZYIA 3U9SA 5L3VA 4HSGA 1J2YA 4A10A 2HCFA 4Z9AA 3GLGB 1FDIA 4FYIA 3O1HB 4F5WA 1FZQA 1W52X 2IRWA 2O06A 2VJMB 3BHNA 2UZ1B 3EJWA 3F3MA 4HI0E 4HQFA 3G8DA 4FX2A 4PIVA 4QEZA 3SC3A 4INZA 4DXDA 5B4VA 5BQFA 4N48A 4IW3B 4YRCA 2PFGA 4WBSA 4MPPA 3BIWA 1A9ZA 3U7QA 4CF3A 4WCFA 5E7MA 2PZMA 1R27A 3LC1O 2G0AA 1Y81A 1XMPA 1SC3A 1XXLA 1Z35A 4HAUA 4JLWA 2PG3A 3ROTA 5KO2A 1DTEA 1W35A 2FR8C 3G9ZA 2HU8A 4FD3A 4BRZA 3CGWA 3DTYA 5J4HA 5I4BA 1ZESA 3PXDA 1YS9A 3CKLA 4BGIA 2FN7A 2N46A 2JAPA 4PAMA 1L7DA 4UCWA 2VQSA 1IY1A 2JNWA 2WZBA 3RIGA 1T25A 2POQX 2G1UA 3LC0A 2XADA 8ATCA 2WM2A 5G0TA 5ALDA 2B35A 1AF7A 2AYZA 3AWDA 4QNMA 5DGDA 3ZTYA 2GN0A 3GUZA 4OK6A 1E20A 4Y6LA 3TUZC 4AKSA 1OR8A 3P2OA 3KHSA 4BB0A 1AKTA 3ESQA 3NRCA 1E59A 1JB1A 4NJEA 4MQ5A 3KWJA 3SBXA 1ADGA 2GEJA 1FU7A 3OQNA 1Q83A 1N1MA 3RTDA 3EG9B 5I9SA 2Q7OE 3FZNA 3TNYA 3R6GA 2PUFA 3OLWA 1DX4A 1HDEA 1XG5A 4DE5A 3CUYA 3KAQA 5IU6A 2IYWA 3UG7A 1A8SA 3IT3A 2G80A 3TK1A 3ZV7A 2OAEA 4XDZA 4DT1B 1MJ5A 2XGSA 3LRTA 4B3SB 2BY4A 2WHPB 2G1PA 2Z56A 3JSAA 1ZOLA 4EGCB 2VWQA 5ENVA 4E94A 4D0GA 2WILA 2J0EA 1L4FA 5G3YA 2ZYDA 4CM3A 1EFHA 1XQ6A 4OH7A 5IWAB 2VTBA 5DNEA 3PNMA 4A73A 3C4JA 1HZJA 2ZFUA 3U5ZB 1XDSA 3B2EA 2YMQA 2O2CA 1DOZA 3QWAA 1GKUB 3B36A 4KUHA 5KX5A 5DNVA 5EUBA 5LUAA 3ZHOA 1K8RA 1PN3A 2VH1A 5AK0A 2B30A 1FMTA 4P5DA 4UNSA 3IHWA 4ZQFA 3RRYA 1HNZB 5KQSA 1KEEB 1KI6B 2WI8A 3ZCTA 4DFDA 1XPRA 2CK3D 3UT5A 3NBKA 1Q15A 2FTKE 5CIYA 3C41J 4FW9A 4I4CA 4LHEA 4XVHA 4BKUA 2I8LA 2Y1FA 4MRVA 4BCDA 2XCQA 3SZRA 3HXKA 2HT1A 2H1OA 3B9BA 2FQ1A 3DFIA 3KUXA 4MGIR 4XE5A 3SWWA 1J97A 2RAPA 4Q4HB 5JNLA 4L28A 4JLJA 3EVGA 2J9FA 5LOVB 1SZCA 4BWYA 4G3XA 1MXHA 1NJGA 4KXMA 2PT9A 3HXMA 1V6AA 3GRYA 4KMOA 1TZBA 1XVTA 1AKNA 2K4MA 2P6OA 4QYWA 2OV6A 1OH6A 2A9QA 1JI0A 3DLBA 3CZMA 3WWOA 2AFIB 1FTWA 4MI9A 4ZOEA 1RKQA 5KVVA 1RPNA 4MV9A 1EJ6A 2YC4C 3AVTA 4CFSA 3ITNA 4JSRA 2B3DA 1UMBA 4J91A 3S7ZA 4K9QA 1Z5VA 1EWRA 1GNVA 1MABB 1RXIA 5G0UA 4JI2B 1G5PA 4DA8A 3ETNA 3ANMA 3WIUA 3S70A 1B0AA 4U7GA 1VMIA 3L77A 4HC4A 3PL5A 2PUHA 5EJ5A 1VLMA 4E4YA 3CNHA 3COPA 4YUAA 1TTTA 1N9KA 1TM2A 3MD0A 4FEAA 4NNJA 1GGKA 5JMOA 3SJCA 5CA0F 4X44A 1AY0A 1RC8A 1JG1A 4TL7A 1NZJA 3PGA1 4RORA 5IBQA 2BD0A 3H75A 2CF6A 1X38A 3FPJA 1PAUA 1E3WB 1NQAO 4MKZA 1I4OA 1RTTA 4Q6WA 2AFRA 2ZRCA 1L3CA 1LNSA 2PMEA 5HUQA 1A77A 3RBAA 5EYPA 4M0KA 3C6MA 3SVZA 2YRXA 4MR7A 3R24A 1N75A 2HK9A 2H8GA 3ZWBA 4U0KA 5CM9C 4BMZA 2EFCB 1I7LA 3ZU6A 4JI7B 4RPGA 3SS7X 3ADPA 3I76A 2AV6A 4YP0A 2D0PB 1K0UA 2CBXA 4BLUA 1N6OA 1XL0A 1V96A 2P6MA 2VPIA 3KL2A 3F6PA 4FCWA 2OLKA 4FBMA 2VNIA 2WPDD 5GONB 3VJMA 1XCJA 2DCUA 2ZBUA 2WKPA 4HWPA 3TI7A 2VXCA 1IBCA 1Q0ZA 4NXNB 2E18A 1R0XA 5P8WA 4AVYA 4D44A 3CNBA 3D8NA 4GQIA 4LGCA 4ZCIA 4DB2A 4HTFB 1IUNA 3CCCA 5K01A 4F04A 2QD3A 2I4MA 2Z43A 2O8VA 4JA0A 3C3EA 2BMVA 3LLUA 1KFKB 3QLUA 1KQNA 3O95A 3TWOA 4DG8A 5JJIA 4BN5A 2W6PA 4J0CA 4MUHA 3LBNA 1I3LA 4WMLA 1OA0A 1VBNA 3ACBA 1QNLA 3EGXA 4NE2A 3VH1A 4HYEA 3SZGA 5D86A 3HRHA 1O08A 3BF8A 1WE2A 4HD8A 4PVCA 4WHMA 5DK6A 3JD4A 1NFQA 4Q9JA 2D54A 1E2JA 2H2DA 2HWUA 2HY7A 3M6AA 2A0FA 3NIDB 3LPAA 3W4KA 1FX0A 5BOVA 1OROA 2PVPA 2YNMD 2P0EA 1GR1A 2H4JA 3ZGVA 1FSPA 5BN5B 4DJJA 5HVNA 2NZVG 5KQPA 2CLDX 3LBFA 3KQMA 1GXSB 2IXFA 3TBFA 4DMUB 4QL3A 2YDXA 5GY7A 2NP7A 2VATA 3PUIA 1IFXA 1GSHA 4KX3A 4NL4H 3NIGB 4BX9A 3CT4A 2B5VA 2P8SA 2OWDA 1FB5A 1R6XA 1XO1A 1Z0DA 1NBMA 1W5SA 4C1NA 1M34A 2LD4A 3QW2A 4EENA 1L5MA 5JNSA 1TEVA 3M1LA 2A0KA 3VH3A 2ZXEA 1GV0A 1VBFA 3DE7X 1SHJA 3CO0S 3QHQA 4QPCA 2RC6A 4Y9RA 4X0EA 1RBMA 1U8ZA 3S0JA 3OCJA 1VLHA 4F93B 3OOSA 2OGUA 4RCVA 5JAPA 2V96A 4OTZA 2GHTA 4B6EA 4OYLA 4Z3KA 4PC1A 3ANLA 4BMSA 2O54A 3CSDA 4X24A 3UHAA 3AEYA 1YGPA 4U9HS 4RM2A 1YR1A 2PJRA 1E0KA 1BYIA 2C9DA 3S68A 2OMEA 4QDXA 3CM0A 3AMVA 5G40A 3UOAB 5CK5A 2BH2A 4FFBB 3BE5A 1PFUA 4V3CA 2QTBA 5IANA 1CB7A 3OZGA 4QGBA 2YHSA 4MITA 3OC6A 4LC1A 4PZEA 5EY5B 4DDHA 2OENG 4YFYA 3KOYA 2R8PA 3WQHA 3RAJA 1DQYA 1M2HA 1RWPA 1T3GA 3MWEB 2GPTA 5LQKA 3LW7A 1GIAA 4JHLA 2OQIA 3CR3C 7MDHA 2F8LA 3VYTB 2WF5A 2LW7A 4RE5A 3DEAA 4ZVRA 5TLSA 1CU1A 3HVIA 3DAFA 4MIYA 2IV3A 5EZ6B 1GTZA 1G9TA 2P27A 4CN8A 4G0UA 1COZA 4G5OA 1I4WA 2JIZA 3HNRA 1R6TA 4PZUA 1IOLA 1NXWA 3KRTA 1VHQA 5ALHA 3ZJ5A 3DUFB 5IKOA 4D43A 4CIYA 5KYUB 1JDJA 2FX2A 4ENVA 3GEEA 1SZPA 5AM5A 4LJRA 2D1SA 4BX2A 3Q2KA 4E5YA 2WYUA 1R8JA 3RV4A 3UJCA 1GP2A 5CNMA 5HP4A 3LKDA 1HMYA 2BFEA 4ARBA 5HFJA 4R3NA 1E61A 2P9TA 4FDLA 4IL5A 3AQ4A 4M1EA 3QY9A 2ZYWX 1G20B 3BMXA 2JLCA 1H1LA 4HNVA 2G70A 3LQYA 2HQBA 6ABPA 4PZ9A 4KVAA 1NUPA 3C8DA 3H18A 4FGLA 4REQA 2B83A 1HFWA 3VSDA 5LBTA 4ZQGA 4PYRA 3FJ1A 2ATVA 1WX1A 2NV2B 2XCUA 3INGA 5KQLA 3D5EA 1H4VB 2DKOA 1Z2PX 2KMLA 5IS2A 4NAHA 2C4NA 3PEYA 4E12A 2ZUFA 1XE3A 3FCUB 4F4DA 2DBYA 4QATA 3MTDA 1PGPA 2TECE 3V1UA 1N4DA 1R16A 3CRMA 5FTKA 1O03A 3S55A 4XARA 1U8TA 3GNTA 1O97D 4JOBA 2IXTA 4HRVA 2W6ID 1WCWA 3GFTA 3AX6A 4Y1GA 3PL1A 4PSDA 2GBIA 3AESB 4F85A 4DV4B 1J23A 3ZDEA 5EERA 2QX6A 4AZ3B 3F9CA 2IYAA 4MW6A 3W7AA 3F7MA 2NU6A 2CEKA 3QF4A 4PAWA 4B6GA 4BFWA 1MJNA 1TO1E 3ROXA 2JIOA 4Q19A 2UVQA 1K27A 2GF9A 2HLNA 3EWAA 5E9AA 3RIYA 4YRAA 2NP6A 5BR7A 3LCVB 3OPYI 2C31A 1H2ZA 3B13B 4TZTA 1E3JA 4CQMA 1ORTA 3RK1A 1JQ3A 2IVFA 3W78A 1PFQA 3VHXB 4Z3OA 2V4UA 1YMVA 3BICA 3OJLA 1C8LA 5CFPA 2FJ0A 4KI0A 5DRYA 4KIJA 5DHRA 3PGJA 2ATCA 2D3TA 3KQWA 4ZANA 2EGUA 4P3NA 1WQ4A 3EMDA 2XF8A 4OJMX 1XUOA 2W6OA 3LCMA 1IZZA 2ODEA 2ZZMA 1LKZA 2AZTA 1MG0A 3C3YA 5LA6F 5KTSA 2VQDA 3EXFA 4CODB 3F46A 1KSFX 1J49A 4YMGA 3QU7A 2FQWA 4R7GA 4KVZA 3DR3A 1Z33A 3NORA 4LOJA 3STHA 2WY2D 3EVZA 3FBWA 4MW1A 2Y4OA 1CZOA 1VE9A 3IT0A 1EI9A 3GA0A 2H2HA 3NOOA 4GKBA 3WRYA 2JG3A 1BHSA 1ISGA 4P83A 5FI0B 5EJ2A 1R5JA 3SYTA 3JVUA 4U00A 2R1TA 3KS9A 3IR6A 3AJDA 3CRQA 3LH5A 5COQA 4ZVLA 1M6HA 4R05A 3UJAA 3FYSA 1R9NA 4D42A 4UVIA 3SHFA 1YS6A 3QY0A 1AURA 1T2CA 3T3PB 5CHYA 1NF3A 2GT1A 5K0GA 3SR4A 1FS6A 3TTXA 1KMHA 3FWYA 2ADMA 3ROFA 1IM2A 4FHFA 4KNWA 2BFBA 3CW2A 3G82C 3U44A 1E9RA 2VTEA 2BGNA 3HSYA 4G36A 3BKWA 4ZYXA 1P73A 3JQEA 3LHIA 5K0TA 3GAZA 3RG2A 4X1YA 3M4JA 2J8ZA 1ZCFA 3KJXA 1WB9A 4B7UA 3U4MA 1PNOA 1Y89A 1H6AA 2AOVA 3PPIA 2OCKA 3KZCA 5GZ1A 4WPGA 5KJ1A 1PGNA 2XXAA 4RH1A 2J4FA 2H1RA 3M83A 5EUQB 1T0PA 4P98A 3NDRA 5EE9A 1NKSA 3DF7A 3CF6R 1ZGZA 4JC8A 1I32A 4COOA 1CUBA 4UMDA 2PUBA 1DCMA 1QYWA 1O0SA 2DSNA 2J59A 2Q6KA 2Y1CA 2EYQA 1IWBB 4NESA 3A1TA 4WBNA 1DKUA 2JVIA 3IR5A 3R8CA 1CR2A 4BV2A 1FW6A 1FSZA 5FOVA 1X1BA 4Q4AB 1QFSA 1XWIA 2DFTA 2EVWX 1AJEA 1CQJB 2VYVD 3JTEA 1MJGM 1KFCB 4TXLA 4P4LA 4A0FA 4RX1A 2FPLA 2WVGA 4DF3A 4EJMA 5CBPA 3H86A 1VDZA 1P9LA 4D9IA 4P7FA 5AVQA 2Z57A 1UR5A 4S04A 1RI1A 3ENKA 2X2EA 1HEYA 3MWYW 2O7QA 2P7HA 3O75A 2GPWA 4RY9A 3CHYA 1ZHFA 2Y6VA 3HV2A 4TN1A 5GJVC 1PJQA 5IYZB 1QMPA 2WU4A 5DVZA 4QTYA 1GPWB 3QHAA 4KO8A 1PUJA 1XLTC 2FW6A 1JAYA 4Z0TA 3EEOA 1SIOA 1SD2A 3SQMA 4OJYA 4XIGS 1W6RA 3E1KA 4AIRA 4AZSA 4DMMA 3HXQA 4Z54A 5C80A 3IPAA 2D5BA 2EIXA 1ND5A 3FNGA 4XTRA 4ENPA 3A36A 2AHRA 3Q98A 2V6GA 3RUDA 2UUCB 3L7IA 4I9HA 4IWXA 5ITZB 1XKLA 4AF8A 3KLPX 4LMBA 4F4FA 3PQ3A 3HA2A 2B9VA 3IQXA 4HDKA 4AO8A 2BM1A 2Z3VA 2PXXA 5FJJA 4XLTA 2UAGA 2VUIB 1E1QD 2A9RA 1KO5A 2ATXA 1MVOA 1YULA 2DOKA 3F4KA 1NE7A 4GX1A 1TCUA 3IAM6 2Z9DA 4A36A 3MS2A 1GNTA 1U7PA 1TU0A 5JCXA 2UV8A 3G2QA 1IHDA 1PRYA 2VHVA 2WWVD 3RHTA 5L4SA 2FEWB 4K8OA 3T7SA 2DB3A 1JJFA 5DMXA 1QO0A 1QP8A 1QIKA 4ND1A 5K3FB 3WK7A 4WLEA 3QUAA 5LA6A 1HTTA 3DQPA 1ZKMA 1L6RA 1DC7A 3R4VA 3GLUA 4KTTE 1SC1A 5B3JA 2ZBEA 3OKCA 1AV6A 1ULTA 1TGVA 4EQ6B 1BOOA 2AG6A 2BI4A 2ZI5A 4KJXA 3RAEC 5FLKA 5AHXA 3GA7A 3MAAC 2CHQA 1J6UA 2ZTUA 2JLRA 3FMIA 4IO0A 3WGGA 4KR9A 5GOTA 4B85A 3OH8A 3OQ6A 3USCS 1NTOA 4ZYZA 2FLWA 1U2QA 4AFNA