3DUWA

Crystal structural analysis of the o-methyltransferase from bacillus cereus in complex sah
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
220
structure length
220
Chain Sequence
MIETWTAVDQYVSDVLIPKDSTLEEVLQVNAAANLPAHDVSPTQGKFLQLLVQIQGARNILEIGTLGGYSTIWLARGLSSGGRVVTLEASEKHADIARSNIERANLNDRVEVRTGLALDSLQQIENEKYEPFDFIFIDADKQNNPAYFEWALKLSRPGTVIIGDNVVREGEVIDNTSNDPRVQGIRRFYELIAAEPRVSATALQTVGSKGYDGFIMAVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords O-methyltransferase, putative
publication title Structural and functional insights into O-methyltransferase from Bacillus cereus
pubmed doi rcsb
source organism Bacillus cereus
total genus 85
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3duwA00
1O54A 2CWWA 5EEHA 2ZVJA 4FR0A 3THSA 5U4XA 3P9NA 2Z6AA 4FT4A 5GIOE 4C4AA 2EJUA 4YUVA 3FTEA 3PX3A 1L3IA 3KQQA 1YFLA 1I9GA 2G70A 3O7WA 3NVMB 4EKIA 2G1PA 4YUYA 3LCUA 2E5WA 3ELWA 3PFHA 1M6YA 4RWZA 3KQOA 3OU6A 1X19A 3UA3A 3LDUA 3UZUA 2IPXA 4DF3A 4P7KA 2YUIA 4QDKA 3FUTA 2H11A 1XVAA 5K0FA 4QTTB 1JTFA 3HCEA 5DTMA 5E1OA 1R18A 3TM4A 2O05A 3DUWA 3VYWA 5HIKA 2PX5A 1NW8A 1WXXA 5KVAA 5CD1A 2O0LA 3KPVA 1L1EA 5LR6A 3EVBA 3OE4A 1P1BA 1JQEA 1KR5A 2EG5A 1G6Q1 3P8ZA 5EKXA 2B25A 1AF7A 4RVDA 3A4TA 2AN5A 5DRYA 5DX8A 4LG1A 3AJDA 3EVGA 4P7FA 4IWNA 2XBMA 4PONA 4HH4A 1XJ5A 1JG2A 3G8BA 4RTLA 4X60A 5EEGA 2P3LA 4POOA 3SSMA 5D1NA 3A26A 2VZ9A 5DXJA 2Z6UA 5KQSA 3ELYA 4BP3A 1YZ3A 5FA5A 2B2CA 2IGTA 3EVFA 3LCVB 4FT2A 3M33A 3GIWA 3VSEA 3BGVA 3FTCA 2NXNA 5FTWA 4PNEA 2XVMA 2PY6A 2VP3A 4AUKA 4QQNA 5IKMA 2HWKA 3QOWA 1G8SA 4HRAA 5T6BA 4E2WA 3LBFA 4GOOD 4BLVA 4EVIA 5HOQA 5K8VA 3ELUA 3RW9A 1FBNA 1NV8A 2FK8A 2HTEA 3PLAE 5K0BA 2IDKA 1O9GA 2BM8A 5GINE 5HIIA 4KRGA 4RTNA 3ORHA 3TRKA 1U2ZA 3LKZA 4GOND 3L8DA 4GC5A 4AZTA 4FGZA 5HIMA 2O57A 4ER0A 2YR0A 2CMGA 9MHTA 3CJTA 5LSAA 2AVDA 3UJCA 3BZBA 3IHTA 5E9QA 1NE2A 4EKGA 3FPHA 5FUBA 1NW6A 2EX4A 2ZLBA 3ANXA 2IIPA 3CGGA 3I53A 3TMAA 3VC2A 2HMYB 3C3YA 3IEIA 4DMGA 2UYOA 5K01A 4GEKA 2WK1A 2BH2A 3NW9A 4F84A 2JJQA 5EC8A 5E8JA 3NTVA 3T7TA 2PBFA 3EVZA 2EJTA 3EGEA 4GBED 2HNKA 3G2PA 1SQFA 4MQ4A 4A6EA 4P7JA 2BM9A 3JWIA 2ZFUA 1JTEA 1ZQ9A 3G5TA 2C7PA 3G89A 3GWZA 5DM1A 1V39A 1MJFA 4X63A 3A7EA 2FRXA 4E31A 2PXCA 3O4FA 1VPTA 2PXXA 3AXTA 1QAOA 2XYVA 3B5IA 1G55A 3OZSA 5IH3A 3D2LA 4E30A 3M70A 5F2OA 4PYJA 5HIJA 3DMHA 4MTLA 2Y1WA 2O06A 1WS6A 5DM0A 4UOEA 2ZZMA 2NYUA 2ORED 3G7UA 3LBYA 1XTPA 4XUCA 5KYGA 2PKWA 5LQAA 3UJAA 3B3GA 3HVHA 2O07A 3FYDA 4YV1A 5K0GA 4RTOA 2JG3A 3G88A 3KPJA 5K09A 3UA4A 1D2HA 3EMDA 3GRVA 2ZWAA 4ER5A 1KPHA 1VE3A 2GH1A 3PVCA 2AOXA 2V74B 3OZRA 5EG5A 2CMHA 1VLMA 4H0NA 3X0DA 5LQUA 1UFKA 4DCGA 1X1AA 1AQIA 4F85A 3FYCA 4K6MA 3G2OA 4WVLA 3SGLA 2P7IA 3I58A 1JG3A 1L3BA 2QYOA 5EPEA 2UZ4A 4XCXA 4RVGA 3OU7A 5B1SA 3SSOA 2PWYA 4C05A 4PIPA 2P3OA 3TKAA 5BW5A 3DR5A 1JSXA 1F3LA 3DXZA 3EVEA 3GJYA 4RVHA 5DXAA 5FWDA 3SMQA 3V97A 4ER7A 5KQRA 3NWEA 3NDJA 3P9CA 4OBWA 5FQNA 3TR6A 3UJBA 3HM2A 5FADA 4IV0A 3H2BA 4P7GA 1P39A 2N47A 4GQBA 2FPOA 5CVUA 4CWAA 2CKDA 5KS2A 3GRYA 1N7JA 3DTNA 4PGGA 3S68A 2BR5A 3BWBA 4CXMA 4C07A 2IH2A 4LECA 4RTMA 3LL7A 5BXYA 4P58A 2CL5A 3GU3A 2PT9A 3OPNA 4LWOA 5EGSA 2PT6A 1YZHA 2ONZA 3JWGA 5EKUA 5ICGA 2AR0A 5LQKA 1NKVA 4BLUA 4E2YA 2ZIEA 1NV9A 5C1IA 1R74A 4KWCA 4CKCA 5CCBA 1D2GA 3GGDA 4E70A 3FTFA 4KDRA 2GB4A 3C6MA 3G5LA 2KW5A 1JQDA 5FHQA 2ZTHA 3G2MA 3RODA 1G38A 4HTFA 2ZWVA 4AZVA 4PYMA 1M6EX 5CM2Z 1TW3A 1X1CA 3C3PA 5DWQA 3TOSA 4YV2A 4MIKA 3K6RA 5EIWA 4AZWA 3DH0A 3R3HA 7MHTA 4M38A 1YF3A 3LECA 4HC4A 4E33A 1KPGA 3I9FA 1BOOA 4PYIA 4FP9A 1KP9A 3CCFA 3KR9A 2QRVB 5CUQA 4DQ0A 4QPNA 4G56A 4RTQA 4EMSA 5K05A 3MGGA 1FP1D 2VDVE 3LHDA 4MWZA 3R0QA 1TPYA 4PINA 3PTAA 2DPMA 3KQTA 4OBXA 2PX4A 1DL5A 1Z3CA 3AY0A 4FSDA 3K0BA 2AVNA 1KPIA 3MERA 4GOMD 1VQ1A 1HNNA 5DX1A 3T7SA 2C7QA 1SKMA 2IBSA 5BW4A 3KQYA 1IXKA 1EQAA 4OQDA 1BKYA 5GP1A 2B3TA 3MCZA 5K03A 3P71T 3KQPA 3FRHA 4FS8A 4XUDA 2AZTA 3P9KA 3DP7A 2I6GA 2K4MA 3BXOA 3MAGA 3R24A 3P2KA 3HA5A 4HSGA 4BLWA 4E32A 5CVDA 2IP2A 4RTPA 4R8RA 2XVAA 3KPUA 1R8YA 3WSTA 4CTKA 1B42A 3UWPA 4C06A 1RJFA 2NP7A 4U7TB 2ERCA 4QVKA 2Q41A 3FRIA 3LDGA 2GPYA 2G72A 4KIFA 2G8NA 4XUEA 4PCLA 2A14A 5GM2A 3VC1A 4MHTA 2NP6A 3UJ7A 3C0KA 2QE6A 5EZQA 1TW2A 2P40A 3FUVA 4X41A 5E1BA 4F86A 3LCCA 2AN3A 1JQ3A 4C08A 2I7CA 2IBTA 4E2XA 3FTDA 2QRVA 3Q87B 2PXAA 3KHKA 5DM4A 3BGDA 5T67A 4OX9Y 2PLWA 1DCTA 1INLA 1IY9A 1ZGJA 3P2IA 2P41A 5K0CA 3HP7A 2FCAA 3GRUA 5ICCA 3HCAA 4QQKA 2V7EA 3EGIA 5FA8A 3A7DA 1Q0SA 1JSZA 4PGHA 3E23A 3Q7EA 5FCDA 3GRZA 4X61A 3BGIA 3GRRA 2PGXA 5GWXA 4B17A 5K0JA 5EMLA 5DTQA 1NBIA 3HTXA 2OZVA 1ZKDA 5E1MA 2JHPA 5M5BA 4PWYA 1KYZA 2JHAA 1BC5A 4DKJA 4EQZA 2ESRA 3CJQA 1XDUA 3KPWA 2R6ZA 3KQVA 4PYLA 1SVUA 3LSTA 4PYKA 3U81A 4HGZA 3QV2A 1KIAA 4HTFB 4ER3A 2PWPA 1DUSA 3UJ9A 1RJGA 4QVGA 1L9KA 3IV6A 2ZW9A 2PV0A 2Z6QA 2XYRA 5DT2A 4ATNA 4CTJA 1G60A 1X1BA 5GIPE 1QAQA 2JH8A 3BKWA 2DULA 3BKXA 4E2ZA 1IM8A 1EJ0A 2GLUA 1I1NA 2VDWA 3I5UA 1VP3A 2IH4A 4FZVA 1NW3A 2UYQA 3SVZA 1MHTA 3ERCA 2GS9A 2UYHA 4OA8A 4LWPA 3DOUA 4M37A 5E2BA 1N7IA 3GCZA 3ID6C 4IV8A 5H02A 3SM3A 2QY6A 2H00A 2WA1A 5HFJA 1D2CA 4QTUB 3EVAA 3PFGA 3DXYA 2AOUB 2AS0A 3P2EA 3M6XA 3CC8A 5DLYA 3CVOA 5DPMA 2IH5A 1ZHFA 3BT7A 4M7RA 3E05A 3DLCA 3FUXA 3M6UA 5K0NA 3MQ2A 4OQEA 4QDJA 3TPZA 4YMHA 5DSTA 2YQZA 5ICFA 3MTIA 4Z2YA 5CIYA 4PIMA 3OFJA 4RTKA 3P9IA 1F38A 3C6KA 3GNLA 1P1CA 4ISCA 3FUUA 4KIGA 5C0OE 4R05A 5G02A 2OO3A 3EEOA 2VDUE 2YXDA 5GOZA 4FSXA 3P97A 1RJEA 3TLJA 1XDSA 4RYLA 5DSXA 5HILA 2BZGA 1RI4A 5EIFA 5P8WA 2YXEA 3TM5A 1VBFA 3DULA 4YMGA 1AV6A 1VIDA 1PRYA 1XCJA 5DRTA 3CJRA 1QYRA 3MCTA 3EPPA 1JR4A 3BWYA 4L7VA 4ER6A 1QZZA 3KKZA 2LD4A 5LQJA 4QPPA 2OYRA 1NW5A 1SG9A 3EVCA 1JG1A 3NVKI 2IDJA 3SR4A 3UJ8A 2ZIGA 5JUWA 5DTRA 4PYQA 1Q0TA 2ZIFA 3OZTA 1WY7A 3KPYA 4BP1A 1VL5A 2PX2A 3T7RA 3G8AA 4A6DA 3R9XB 3RIEA 2PX8A 5E9JA 3SX0A 1BHJA 2GA9A 3B3JA 3NDIA 4R6XA 3TQSA 5E8RA 5CVVA 3SSNA 3HVJA 5EHIA 3UBTA 4DA4A 2IFTA 3NMUF 1G8AA 1SQGA 1OR8A 1X1DA 2H1RA 1WG8A 1YFJA 1SUSA 4YUXA 3JWHA 4PCAA 2FK7A 3M6WA 2Y1XA 3KQWA 4U7PB 3M4XA 2AOUA 5CCXA 2C7RA 1T43A 3HVIA 2WA2A 2BR4A 2NNWB 4RSRA 3NJRA 5DM2A 2AOTB 3LDFA 3A27A 1NBHA 2AOWA 4R6WA 4RV9A 5F2KA 4RTRA 1EIZA 4KVZA 3I64A 4C03A 4GUAA 5DX0A 4EK9A 3CBGA 1RI5A 2P35A 3HA7A 3IYLW 2HV9A 3LPMA 3MTEA 5LQRA 1FJXA 3BWMA 1WXWA 4RVFA 2B9EA 3GXOA 3MB5A 3M6VA 4V0QA 3JWJA 4AZSA 5T64A 1WZNA 3KR2A 4Y2HA 1R8XA 3THRA 4IKPA 4HGYA 5JR3A 1XCLA 3F4KA 3PS9A 1PJZA 3B89A 3O31A 1UWVA 2YXLA 3HNRA 2OB2A 1P91A 3AXSA 1YUBA 2JH9A 1EJ6A 5EMMA 2OBFA 5ERGB 5EMKA 2ONYA 4PYOA 3FZGA 1Y8CA 1UIRA 2B78A 3E8SA 3KR1A 3EMBA 2NXCA 5HZMA 2FYTA 1FP2A 1NT2A 3HCBA 2AN4A 3LX6A 3FPEA 10MHA 4DZRA 4RTSA 3HA3A 3OFKA 5CVEA 3V8VA 1NW7A 2ZULA 4OA5A 4R8SA 2BR3A 3QOXA 3CKKA 4V0RA 5EQJB 3SXJA 2PJDA 3T0IA 4YV0A 1RI3A 1QANA 3OU2A 3DLIA 4CKBA 5FQOA 2OPBA 3HCDA 5F2NA 2P1DA 2UYCA 2F8LA 2PSSA 5EMJA 2ZBPA 2XYQA 3EVDA 1HMYA 5CVJA 2AOTA 2ZZKA 3KQSA 3B7PA 2VS1A 4WXHA 4AX8A 4BY9E 1QAMA 3G2QA 3MHTA 1SUIA 2G71A 2EFJA 2YTZA 3KR0A 2OKCA 3UJ6A 5LQNA 3EGVA 2HR1A 2ZBQA 3FPGA 3FPFA 3FPJA 5BP7A 5C9ZA 2YVLA 4PYNA 3R6TA 4C04A 1EG2A 4X1OA 4GOLD 3FUWA 1KHHA 3ME5A 3ER8A 1KYWA 2OY0A 5K0EA 4KDCA 4Y30A 1N2XA 4ZTBA 5D1HA 5EHGA 4JXJA 3KQMA 1O9HA 1ORHA 5E2AA 2P8JA 3KU1A 1M0EA 2ADMA 2NXJA 3LKDA 3PB3A 2ZCJA 2NXEA 3TFWA 4RTJA 1AQJA 1RI1A 1FPQA 1R6AA 2FHPA 2I9KA 2ZBRA 1I4WA 3REOA 4CKEA 2I62A 2OXTA 3AWIA 3DXXA 4GF5A 3HVKA 5FWAA 2P7HA 2PVCA 5LQCA 4RX1A 5EOVA 5FHRA 2R3SA 1L3CA 5EVJA 5EZSA 4DM3A 2P3QA 3A25A 1XDZA 4YUZA 2OB1A 5FULA 3HEMA 3GDHA 2GAFA 1RI2A 1R00A 1XXLA 1YB2A 1ZG3A 3UFBA 1H1DA 3OE5A 4HG2A 4NECA 5GM1A 3GO4A 2JHCA 2AOVA 3DMFA 3UJDA 3PX2A 3ELDA 1VP9A 4M36A 2ZSUA 5E9WA 4GC9A 3TKYA 4O29A 5K0LA 2C7OA 3HCFA 3LGAA 3HCCA 5MHTA 3B3FA 1EAMA 3OCJA 5E1DA 3E7PA 3PT9A 2YX1A 1JG4A 3NWBA 1KXZA 3EEYA 4YUWA 1RJDA 4DCMA 2QM3A 3ER9A 4KW7A 8MHTA 1ORIA 5HEKA 3DMGA 1ZGAA 5ICEA 3BWCA 2ZZNA 3BUSA
chains in the Genus database with same CATH superfamily
1WCYA 2D1RA 2RGGA 3BORA 3LU1A 4WT7A 3VDXA 1QV7A 2O8FA 4GR4A 3KIPA 1HT3A 3IV7A 5KOJB 1GLVA 3F9RA 4QOJA 5KYWB 1JX6A 3NETA 2B5VA 3JASA 4KFSA 4MUEA 4Q9IA 4C6TA 1PEKE 1PJRA 3C8ZA 3GLQA 1Q5PA 1W52X 4BUJA 2JGDA 5AVJA 3K0AB 3T9AA 2G04A 3TLEA 3LBIA 4QTZA 2IHTA 1IONA 4M0DA 2I0FA 3HU5A 3TIIA 2PUGA 3MILA 4D9GA 5KVAA 2G36A 4JOQA 3EVBA 1RWBA 2GD2A 1QP0A 4MMYB 5HP4A 4ZO8A 1T34A 4KGZA 1GXSA 1E2GA 1JEEA 1SBNE 2ZIWB 1R6TA 5A0TA 4LG1A 1O0BA 1RVV1 4RTLA 5T4FA 5FL3A 2VQFB 3OC6A 2H07A 4DR5B 1A04A 3EZ9A 1UBRS 4ZGGA 4G5OA 4FCVA 3ELYA 1MZVA 4QUEA 5LXTF 2RHHA 1G19A 4C2BA 2CZQA 2RI0A 5KQMA 4ZFNA 4PO9A 5DV9A 3DLTA 1Q95A 1GCAA 4QQNA 3EG9B 2OENG 1CEXA 5E6SA 3CNQS 3ZXUB 2GLXA 3QOWA 5HUJA 2WILA 1NW9B 3ELUA 4S0XA 4HN2A 3RW9A 4B2LA 1JHAA 4D0NA 4WXPA 1NV8A 1C3VA 4JJ7A 5IZCC 3LVFO 1YL6A 2A35A 3CH4B 4KRGA 4G63A 4UHKA 1E9DA 2VVTA 3UGJA 3EFEA 2AF3C 2O20A 4X1KB 3BDAA 3V7YA 3H2ZA 2IEIA 1PEAA 5BSHA 2O57A 1C41A 2Y9MB 1E94E 1FRFS 3B7WA 4E1AA 4CCYB 1UQRA 2FPIB 3MQFA 1YL7A 1NHGA 5D85A 2AX3A 2J7PD 1F4LA 3U7FB 3VR4A 4JL8A 5HQTA 1X70A 5CB0A 2VDQB 5K01A 4WFQA 2CZGA 2J9FB 4G9BA 3NW9A 4ZMBA 2H6EA 1O77A 4HAUA 1BDBA 2XZDA 2POCA 4OHXA 4ROSA 4AJPA 1YBVA 2HJWA 4JN6B 4ENSA 1WHTA 3DAYA 4MQFA 4P8RA 2GNPA 5BN3B 3CVUA 2C7PA 3AG6A 3QFHA 2EARA 1K92A 3KFVA 4X63A 1ZAYA 2OUKA 5IN5A 4GNKA 5KKCA 2F1IA 2P2GA 3MOGA 4DV5B 1LH0A 4Q05A 4HLCA 5E4FA 2ZI6A 4UEKA 3RS5A 2IP1A 3L7LA 1E4EB 1F06A 1ULAA 5KTPA 3WX0A 1P7VA 5AHWA 3X1MA 3HYLA 3LVQE 5I7RA 3EWSA 3HN6A 4RSHA 3ZOKA 3B3GA 1DTWB 1N2CA 4J4BA 1HRKA 1ZITA 3ER6A 4TLDA 2PLAA 1ZYUA 4XDGA 5JS8A 4RK1A 2Q27A 5AW8A 3HVRA 3PJEA 2D5BA 5DOVA 3D1LA 5IF3A 1F6DA 5AIAA 4NHOA 1LZKA 1M5UA 1WKBA 1EFCA 1HE2A 2OAP1 3WK9A 1X3LA 3N74A 2DXIA 1Y8RB 3SM9A 5KNCD 2A58A 1TF2A 1FVXA 1TMYA 1KARA 3OTGA 2H5IA 4JJEA 4KPEC 1IBKB 5DULA 3W9YA 2EXXA 2CDBA 1T0IA 3U9TA 3WYCA 3QOYA 4A27A 3BFJA 1JG3A 5JNVA 2FSSA 2EBFX 2P9GA 4XCXA 3SSOA 5FBLB 1SHZA 2KLBA 3TGPA 4K6KA 1JSXA 4BC0A 4CQMA 5IVHA 4U00A 1LWOA 2FPGB 1DBQA 3IB3A 3LUGA 3MF4A 4MV8A 4W6ZA 1M2VA 1FRZA 1P39A 1ZOLA 3NRJA 3X1DA 3TB4A 3LOUA 3UMGA 1GHTA 2H5JA 3OLWA 4JLDA 1BOFA 3PWTA 4WINA 2AG1A 1A8QA 2DPLA 4B0OA 5DBHX 3U16A 1CR1A 2G76A 4D3SA 4IO1A 4RFLA 1JFSA 2YIVX 3HDQA 4J2OA 1KYYA 4PVCA 3LC7O 4LECA 5FAKA 1OZFA 1TA9A 2A3NA 1ZK3A 3CEHA 4JNKA 3WTCA 3ETGA 5CFZA 2IPNA 3LH5A 3K2QA 4YJ3A 1Z83A 1BKDR 5DNEA 1J97A 3RSGA 2P9QA 3LIIA 3L02A 3WJ2A 4E2YA 1U98A 1R74A 3G6KA 5REQB 1F5SA 1D2GA 4OHCA 1YZQA 3AJEA 1KMQA 2NWQA 5DE3A 5DI9A 5ELLA 3WJAA 2F8MA 1BVRA 2ZWVA 3G13A 4PLWA 1HLGA 1QRRA 2HU8A 3UGQA 1Q3KA 3SX2A 7MHTA 3AI3A 4GI3A 4M98A 3U4AA 3CT6A 4R9RA 1YF3A 1BOOA 1NXXA 1KP9A 3DE7X 4H3HB 4CF3A 4H1VA 4R8LA 4G56A 4O1MA 4BFWA 2AIRA 2FH5B 2PUJA 4L6IA 5I8PA 1Z47A 2P9TA 1U94A 3O2NA 4Z9AA 3DDWA 3PHBE 5EQDA 4JYBA 2ASVA 1IBCA 3H84A 5IVDA 3D5QA 4QC2A 3L0DA 1QH9A 4FR5A 4I50F 5EJIA 3HUUA 2Q0QA 3WLPA 3HXLA 4PBSA 4CM7A 5F73A 1BS1A 4P4TA 3E9ZA 5IKXA 2H7CA 1IXKA 4P08A 1TJ3A 2AD1A 5FUXA 1Z38A 1FRNA 4BOYA 1DAOA 1B74A 3KD2A 1T5SA 4PG5A 1E6EA 2ZYWX 5J5CA 2IYXA 4OXRA 1DC4A 2WB4A 2B20A 2WD7B 4N01A 5HZHA 2REOA 4DV3B 1SHUX 5GGYA 1F7VA 5F4ZA 3UQZA 1QHIA 3KPUA 3WGIA 4RENA 1I4EB 3WSTA 4ZZIA 1DUIA 2VIIA 3IEKA 3SLGA 3ZLUA 3UWPA 2ATEA 2Z4RA 1H3EA 2Z08A 1FUEA 4FYVA 1B14A 4G4IA 2NGRA 4GRIA 4EWLA 1BO6A 4H6XA 4MVCA 1K06A 2J3QA 1L8AA 1NQTA 2YINC 3HO8A 3NAGA 1F9EA 2R97A 2GBGA 2D13A 4Z8YA 3PHJA 3MCWA 1SB9A 3QVWA 5ALVA 3RUCA 1MD9A 1N1EA 2P40A 1QQTA 1JR2A 3L40A 1N2HA 4I6JA 3TBHA 4TS9A 1WNTA 2P2SA 3EOBI 1GPWB 5GPBA 3ND7A 4MPTA 2D8MA 3D6HA 1A76A 2NSJA 2ZJ8A 1X9HA 3DE4X 1XK7A 4INAA 4OGKA 1GTG1 3W5SA 2XHEA 5FDFA 3CVYA 1VG9B 2YOFA 3STTA 3I2JA 4EECA 4EHAA 4PGHA 1POXA 3E23A 3RUHA 5FBQB 5TPWB 5LYJF 3DGFC 1U6IA 1YZUA 5GWXA 5U9CA 1ZLXA 4ESEA 3WK6A 2HFJA 2YY6A 3LY7A 4MUNA 4B3FX 4C4TA 4C89A 3R0IA 3MTQA 5EJ7A 3RVBA 1G63A 5K3DA 1WPGA 3P5BA 4MV3A 1TUIA 1O08A 1C3OA 3JAKA 5G0VA 1G8JA 4Z4CA 3EEQA 2X2PA 4E7PA 3B51X 2WQ6A 3V9AA 4MP8A 1RLIA 1XJ0A 1OFUA 4Q24A 2V03A 3I3SR 4OJKA 2XYHA 4X3CA 3SQLA 3ETLA 1Z7YA 1UFOA 2FN8A 3Q8WA 1Y1KE 3V1MA 5F51A 2CDAA 1IM8A 1ORVA 2GLTA 2I33A 2MR5A 3PXEA 4OH1A 2QLFA 1H2XA 2UYHA 1H2EA 1K5DA 1RPJA 1ORRA 4PZEA 2C5EA 2GN1A 1HK7A 1MV8A 2Q3LA 4RKYA 3WTBA 4EFKA 1K7CA 1W4ZA 2ZIZA 4P0QB 3BERA 2YJTD 3KWJA 4D0GA 1LW6E 4DJTA 3H1FA 1AB6A 1JMVA 4NULA 3WGLA 1DKOA 4C6TB 4WBSA 3IKTA 3K9LA 1WX1A 2IBMA 3PZRA 4DDWA 3M8KA 4QDJA 2VJBA 3PRHA 3UB3A 3IFSA 4PBTA 4LFAB 1BDMA 4O4JF 1IB6A 3ZVKA 3FGZA 4GOXA 3WP0A 4A0FA 5B6IA 3QMVA 4OJQA 3AY6A 5DYWA 4EI7A 5IJZA 1AG9A 5JXIA 3HJBA 1TCVA 3WSVA 1U8CB 1UMBB 4C0JA 3CYFA 3WV4A 1CQIB 1FBTA 1U6JA 4LZZA 3WL6A 3IP3A 4Y18A 1L5VA 3C48A 4XLZA 2MINA 5J2UA 4S1NA 3MEQA 3QY9A 5HCNA 4AC9A 3CCBA 4EHJA 2ATIA 4IHQA 2QN3A 1AD2A 4QPPA 3G9UA 6PFKA 2RJ3A 4MUYA 1CF9A 3EZFA 3LKVA 3H2JA 5DTRA 1MIOA 2E4WA 4GZ5A 1F4PA 3OLQA 4HNRA 4ZQEA 1PEYA 4XA8A 4DSZA 4KDEA 3U17A 3WGOA 5ABPA 1ZVQA 5DN6D 1MBZA 4PRKA 4I4CA 3SZMA 1PGJA 3SX4A 1FYXA 2OCGA 1F8GA 3AKYA 4JFAA 4ZCLA 5LP6B 1JLRA 3K9BA 2ZE6A 4RVCA 3TQSA 3OPQA 4DA4A 1VOTA 2QG4A 1O5TA 2GCNA 2NSLA 2PGJA 2Q6KA 1GYQA 3OCCA 5ADUS 2HK9A 1FNSA 3OM1A 4Z0PA 2MSWA 3AGPA 3KJGA 1K7FB 4LK2A 1DO8A 2AJLI 2VHJA 4D8WA 1N36B 2QRUA 4OJTA 1QOPB 4RJJA 3LHFA 3EDYA 3ZD6A 2E2WA 2O8CA 1KOGA 2R47A 4N6OA 1TM7E 1JHRA 1AIPA 3COVA 4CG0A 4KHPB 4LGYA 2W6QA 4AJHA 4ZTZB 3A27A 2ZBVA 1JSLA 2VCYA 4DCUA 1GGJA 2VAPA 3KDSE 3LPLA 4YP9A 4PO3X 1T3LA 4NQRA 4MCAA 4XGNA 4EJ6A 4DDKA 3CBGA 4I46A 1JNYA 2TMYA 4UNPA 1AV7A 1YVUA 2ZYSA 3UWKA 5C7YA 4WK0B 1TGVA 3OIGA 3HNOA 3PQFA 2GWRA 4YI3A 4ENWA 5E38A 4F4IA 3H0CA 4F0JA 2ZTMA 4ZOLA 1B8UA 2A86A 1TL7C 2CC2A 2VNKA 3KUXA 4CLRB 4DUZB 1PT9A 4XFDA 1SUFA 2C3MA 3VR5H 2P2ZA 3CO5A 3MD0A 3M9WA 3SZ3A 3AESA 4KQEA 3FNEA 1PJZA 3W4JA 1CF4A 3QLJA 4U0JA 3JX9A 2WZDA 2CY0A 2PLRA 3SKYA 4YCSA 3AXSA 3VVLA 2JH9A 3NANA 5FBZA 5FPHA 3KQLA 1B6TA 1RSZA 4R1UA 3MELA 3CVVA 1TUEA 3E8SA 1SC1A 4P31A 2F3PA 3CRNA 4H08A 2IS2A 1AS2A 1YU6A 1NT2A 1Y4ZA 4QJIA 4PSKA 1Z62A 1BROA 5EERA 1YI1A 1LPAB 3FOZA 1W87A 4MCIA 4AKHA 3DOIA 2GO1A 5DYYA 1NVUQ 1M2HA 1H8EA 2XMZA 1MVNA 2A0WA 3OU2A 4JDUA 3RRMA 4KJZA 1KWKA 1RXVA 3IIMA 3ENZA 2NV0A 4K3VA 2ZUSA 4MJXA 4V3BA 1O94D 4L4SA 2ZGVA 1NU6A 3EH1A 3B7PA 3THWB 2EIXA 2C9CA 1WJGA 3MHTA 4IUCS 2QE7A 3KR0A 3QG1A 1NUSA 1J8VA 5IM5A 2FQ1A 1ZD8A 4D6YA 2EHJA 3AVYA 2C3PA 2ISQA 2MTBA 3H4VA 3E9RA 4O3MA 2XMDA 2ZJ0A 3FG9A 3ITEA 4JQYA 1KAQA 1TYDE 3O73A 4IY1A 4FI3F 5EQTA 5IMBA 4WECA 1WD7A 2OM6A 3INYA 4OMUA 2ODTX 3T5BA 3QVLA 3G49A 1U1DA 2QRGA 4S1PA 1JP7A 4JI1B 4B7AA 5CHYA 3F3SA 4NOLA 2WHPB 5D1HA 4G67A 3RC9A 5JADA 1CUUA 1VKNA 1X74A 3LT1A 4MS3B 3ZI0A 1DAHA 1D6SA 1GZVA 3VI4B 2ZSEA 3T61A 2ZCJA 4DTCA 1YTUA 1O2DA 1PG0A 2X13A 4ESHA 1AE1A 1BYUA 4F1WA 2ZUTA 3U48A 4KO8A 3REOA 2Q7DA 4Q4AB 2LRHA 3DPSA 3HV2A 3DDNA 2F55A 1TUGA 2C1ZA 2QZPA 1X80A 2Q2QA 2VDRB 2WJHA 3IKMB 3KLOA 3QVUA 2QBYB 1IXYA 3I34X 5EE9A 4E51A 5JH7F 4LOAA 1A96A 2Z9DA 4E3WA 2G28A 1BXRA 1QE0A 2EWMA 3WNDA 4L08A 2H17A 4L28A 5GM1A 4IJVA 2G9ZA 3ZE7A 4YRSA 1ZONA 2GKGA 3GIDA 3R4CA 2X0KA 4IGEA 4M36A 4UNSA 4UAJA 2YASA 2C7OA 2WZBA 2X4LA 3TPCA 3O3CA 2OHHA 1X7WB 5K4GA 1W94A 3B1WA 1IZ8A 1MJNA 3ETNA 1KDZA 1KVSA 2A5DA 1XAJA 3RU2A 3TSCA 1YIDA 2FETA 4CMEA 2QHXA 2Y2UA 2KBFA 1GTVA 4MJLA 4XWGA 5I48A 2V7GA 5A2GA 1W35A 3ER9A 2OHXA 3EC2A 2R62A 1MAHA 3KQQA 3X1JA 1K9VF 3HKCA 3LL4A 3TI7A 4E07A 2HWYA 2ZVJA 4JB3A 5K8CA 4V0MA 3WRXC 3A0UA 4QBGB 2Q3JA 3DFZA 3Q3IA 1X1EA 4RHXA 1DAKA 1ZVMA 3KKQA 4B2IA 1F14A 1LV8A 1YJAA 4MZXA 3IX7A 1OSNA 2GETA 5J1SB 1KK3A 3SIXA 3I12A 3CS3A 4PWZA 2C2MA 3DCJA 1EJBA 7REQB 8GPBA 1LK5A 3T38A 1TQ8A 2HK6A 5F7OA 2BHSA 2G08A 2HU7A 4LSZA 4NDZA 3TRIA 4BIMA 1NMEA 5A2QA 1YI0A 2VH5R 4LYYA 5KREA 4Y1RA 3VKFA 1VHDA 2AMJA 1QVRA 4GAEA 3NC0C 1TAUA 1MU0A 1II0A 3NT4A 1WSBA 2I8LA 2X2OA 1MT3A 4TZ6A 2EWVA 4X60A 4WPGA 3U80A 2IZOA 2WJAA 3P2OA 4P33A 1YQUA 2I03A 3D31A 4AMYA 5KWIA 4TWIA 1XVUA 3IQIX 1E79D 1M2OA 1YGPA 3TE7A 3P9RA 4LF6B 4X71A 4FHDA 5FYDA 3WK5A 1Y5NA 2Z3VA 3LCVB 4GYKA 2DQKA 2G09A 4TKUB 4A0RA 1RC8A 1LSJA 1OFTA 3A32A 3JVEA 2XVMA 2I3GA 3OEHD 4EZBA 1AX9A 1GJRA 1HYEA 3KB8A 1F48A 2IYWA 1TQ4A 2QRMA 3O90A 1LSOA 3Q15C 1F2TA 2IE0A 1OMOA 4XB6B 1U02A 3KXDA 4GIBA 2HTEA 2VWGA 5HNKA 2C4WA 2GF2A 1O9GA 2J30A 1MIHA 3W5UA 2Q4TA 4K87A 3OAAA 1WEHA 1E1NA 2VUUA 2IV7A 2OFOA 2UDPA 1X94A 3DPUA 3WWYA 5HOEA 2W6OA 4NJMA 3U61B 4TT3D 4ZC8A 3ZDEA 3PA8A 2WJZB 4KR0A 4P9NA 2YR0A 4U63A 4WQMA 3V8PA 5LSAA 3HCNA 3TLXA 4ROTA 1EUQA 3CPSA 5HCUA 2GA8A 4NK5A 4YDQA 3ZE1B 2F1JA 3V7NA 3FKSA 4OFXA 2RH9B 5KMGB 2QI9C 4Q3EA 1AN9A 1TXGA 3JQ7B 1W5EA 3DWFA 5GONB 1FTGA 2ZB3A 3W6PA 2JGLA 5AVRA 4U2BA 4XYMA 1ECJA 2D7DA 4YJ2F 2PBFA 4AMBA 4MULA 4UM9B 3FMGA 5AVVA 3ZLJA 3IDFA 1QF7A 2UUPA 2W2LD 3LZCA 3N8DA 2DTDA 5TMDA 3SR0A 1C7FA 2Q2WA 1QP8A 3FD8A 1QZ3A 4XB1A 1BX3A 5DM1A 3WYDA 1PQ4A 2A9QA 2O52A 2OC9A 2RONA 1Q11A 3CRZA 4UHCA 4AU1A 2IZ6A 2PXCA 2WWXA 3GBVA 5JHHB 1OT3A 1ESNA 3AXTA 3BXGA 1Z2AA 2IUEA 1YQDA 1VZ3A 3B5IA 3GN2A 5J5VA 2XD9A 3WQSB 4AJIA 4I66A 2PTHA 2M6LA 4Z4QA 3JVUA 3DZIA 4UXJA 4ABYA 1UDRA 4Q1CA 5JFOA 3GAZA 1XD9A 1XZNA 4G8CA 3RTDA 3G8CA 4L9SA 5TS3A 1RKUA 4Y0NA 1O96B 4TKLA 1MB2A 3WK8A 3OEED 1IUNA 4CRWB 3F8SA 3M2TA 3NKLA 1VG8A 1E1KA 3A4YA 3LSYA 4PY2A 3ZWAA 2FN7A 2OEPA 2UZ0A 3AJ9A 4RCYA 3KTAB 1GA6A 1NVBA 4QWMA 4CEIA 4FFRA 1HMPA 3GPLA 1G5IA 2XV1A 3PVCA 2PHZA 4KP7A 3T3DA 2DFNA 2V74B 4NBVA 5LDHA 1DT5A 3HEAA 3OX1A 1VLMA 5CGQB 1H2YA 4ECEA 4R83A 5IK2D 1A2QA 3CWQA 2GNAA 3WB2A 1IDN1 2ZXEA 4PZUA 1JQLB 3EUAA 1SU7A 1XTTA 3FYUB 1HA3A 2AYXA 3FOCA 5AMXA 5KWEA 4B3SB 3EOZA 3D8UA 4EW3A 4MH0R 1LC3A 2P6PA 3EPRA 1Z8HA 1JJVA 1DQNA 1GFZA 1ZU4A 3GJ4A 1TFRA 4HXEB 4P38A 3VPCA 3HBLA 3AUFA 4E2FA 4ZK6A 3PFFA 1BWPA 4NPCA 3DO5A 3DTVA 5CW2A 4EYGA 3N28A 1HLDA 3OMWA 3GI1A 4P7GA 3DQPA 3IBFA 2ID9A 3BPSA 3F6RA 2IS4A 2OAGA 2WU1A 4M86A 3UIEA 2CUKA 2P79A 1WAMA 1LI5A 5CU7A 1IQ0A 5HFAA 1LS1A 1THTA 1XC7A 5FOVA 4PICA 1ZBQA 1LZLA 3B5JA 3QU5A 2LP4Y 2WU8A 4H2DA 3S5UA 1JPUA 2FFHA 3NS7A 4IIGA 4JC8A 3TD2A 3OQ1A 1ZM9A 5ICGA 1B4DA 3GLRA 1V8PA 2X0FA 1CDDA 1SKYE 3B9PA 3B8HA 1X0VA 1YT5A 2AN1A 3OIDA 3RKRA 4I2VA 2Q2NA 4PO8A 4O2LA 4ACBA 4GKJB 1M75A 2GB4A 3ITDA 4QDTA 2CFOA 5IARA 1ISGA 2JCSA 2YVKA 3SFVA 1E9FA 2Q1WA 4MQBA 1O6ZA 4A0HA 2ZSBA 4ZAYA 3DO8A 5DWQA 1X1CA 1JFVA 3K1TA 3VAAA 2X7XA 3TIGA 4I1SA 4E11A 1P44A 3G7NA 1MAAA 3QUTA 2QV0A 5EVCA 3RAPR 2G4CA 3ILXA 3JQAB 4DJJA 2BIFA 3ZGLA 4ZI3A 1UQUA 4N5DA 4DWOA 3C1UA 2QRVB 4W5TA 3HDHA 3VNVA 3KKMA 1KI1A 2X0IA 5BWCA 4XFKA 4CLXA 1M54A 3A9VA 3RIXA 2I8AA 4KHZA 3ZE9A 1DHTA 3AERA 3L1UA 2XTZA 1PZHA 3QFFA 5FNZA 1U0GA 1W2HA 1T15A 4ZAFA 1T2FA 2QRZA 3KK0A 2DECA 4PHTA 1G5PA 3EXIA 4OHPA 2WM3A 3WKAA 2GFIA 4M9QA 1U7PA 1NI5A 3IVRA 4YRMA 3K5PA 4N5LA 3OWOA 3B2EA 3EQ9A 4MV9A 1G6HA 1JLKA 4RLQA 3ZGNA 5FFMA 1WB4A 5T4BA 2KHZA 4Q7MB 4U7DA 3GR6A 4RZXA 5L95A 3VUEA 1HXHA 4QYIB 1QWOA 3BB1A 1XDGA 1Z17A 4HDRA 4A2CA 4LXHA 3BE6A 2XUIA 3TOXA 1CUZA 1DAEA 4C78A 3IMGA 4GMGA 3JARA 4FM9A 4OX9B 4QGAA 1NOJA 2Q2OA 2V7UA 1BCSA 1N6PA 2VYQA 2FOLA 3LXMA 4FDLA 2HMAA 4KAFA 4KQ1A 4MKGA 3FCCA 4ZT3A 4FHZA 4DXDA 5EJ6A 1W7AA 2IWHA 3TR0A 6ADHA 1I2ZA 2IU6A 4R7ZA 4FD2A 3SQXA 2NP6A 2OECA 2B4KA 1NC3A 4DQLA 4F5EA 1TCBA 3D6TB 5BQFA 3S1AA 2HA4A 2R5NA 4PNPA 4F86A 1ZCJA 1RWVA 4OYHA 1VB5A 1VPDA 1E9AA 3ANLA 4MV5A 4Q16A 3DE1X 5FOSA 5U4QA 4B44A 5JC8A 1KAHA 1SO8A 3KSUA 5DM4A 4MS4B 4EHFA 5BR4A 3Q7SA 3I42A 2N75A 5IVPA 1WVGA 1HURA 1P1JA 3Q6NA 1XFAA 2XUJA 3KSAC 3PU6A 1NXSA 2L17A 2IF2A 3RANA 2I54A 3WK7A 2JEZA 1LS6A 2UUOA 3E03A 1QRSA 1Z8DA 3IH5A 3HKBB 3N0WA 1NULA 5KQLA 4Z0TA 2FB9A 1IZ7A 1VMEA 2EEPA 2FZEA 1B41A 3OE7D 3ICPA 3PGMA 2OORA 1ZHHA 1U0EA 3BRWA 4FLEA 3U1VA 1UT5A 2YFHA 2OAEA 3KQVA 3IQHX 3UMFA 1NLYA 4FGWA 4F3TA 3RVOA 2XNSA 4F8EA 3SZGA 3GA0A 5AOVA 3OLVA 1UFVA 1SD5A 3P4YA 4E13A 5JQGF 5CX4A 4JI7B 1RJGA 2R00A 4B80A 3EWAA 821PA 2VT7A 2X0DA 3ZYZA 4X9XA 2YMPA 1W44A 2O0JA 2R6DA 3IVCA 1FDVA 4JUAA 3T4PA 3KKEA 2XUPA 1Q1BA 1G20B 2GLUA 3COPA 2JFZA 2NVOA 5DEIA 2IU3A 3JQAD 3KYBA 4NC9A 4TQ9A 1IXRC 3PFWO 4FB4A 3QKSA 2GS9A 4TXLA 1LTQA 4ZT5A 3GGSA 3RGGA 1WMSA 2CXUA 1KY4A 2A9JA 1H1TA 3C6XA 3ID6C 4OKIA 1QFJA 5H02A 3TFQA 3TXAA 1DEHA 2OZLA 4DS3A 5L51A 1JH9A 2J4CA 2ZEJA 2P0AA 2DM6A 1BU5A 3OZ7A 5F2EA 1X7YA 2R6CA 4OUKX 3LJKA 3HVUA 1IEXA 4O2RA 1NLFA 4LQLA 4M7RA 3U7IA 4DL9A 3SXPA 5BPFA 5HKAA 3UXEA 5L4NA 2B0CA 3IQZA 1DWPA 2VSOA 5H5JA 4CL3A 1Z25A 5I7UA 1OFIA 4RDHA 3FN4A 4HTAA 3W5CA 1QNFA 2X2EA 1CUCA 4PFSA 4D3FA 4DTIA 4D9NA 2I6SA 4JY7A 1RJEA 2H06A 1XDSA 2H5EA 3KUDA 3PWKA 5F76A 2UUBB 4RKRA 4R2WA 3ADOA 5I01A 2DY0A 2XMSA 5FI1B 4WEOA 2P5YA 4L7VA 4C0LA 5BV0A 2CXQA 3JQRA 4GKBA 4JGBA 1PJ2A 3LW8A 1VE5A 3ILVA 2P91A 2XVZA 3OT1A 1YVDA 3GOQA 2XE8A 4K0RA 4M21A 4O4HA 3SYNA 4BB5A 4LAFA 4UUBA 3KL2A 2R87A 2FPPA 3BHJA 4JLPA 2FUG6 5HF8A 3RHZA 1C9JA 2E0IA 3C1OA 3Q3HA 1VL5A 1NI4B 3T7RA 2C78A 2WT8A 3GJXC 3QJ5A 4DCOA 2PX8A 3VR5A 2GBIA 4H7FA 4DWJA 3M4ZA 1AKMA 3B3JA 1A2KC 3NDIA 3OIVA 3CGWA 4FKZA 1HDYA 5E8RA 3PX7A 4N9WA 4HAVA 1C0EA 4IP0A 1H4SA 1LI4A 2VJLA 1P7PA 2HHAA 3DZDA 3PFBA 1XXHA 3P9SA 3W1VA 4L8YA 1NTOA 1O95A 3W8NA 4MVJA 4Q3LA 1JIIA 1N2ZA 1S2DA 3WHPA 1EE2A 1FNBA 3KQWA 3GRFA 4B75A 4U2DA 1ADFA 3GL9A 1JDBB 1NUAA 1VB3A 2CXHA 3ZHZA 2BR4A 4F4JA 4LXQA 4H7DA 1Z13A 4NNJA 4R6WA 4QOHA 4RV9A 1KJJA 1L5GB 1YJBA 1ARZA 3KJIA 1ODLA 3SJCA 4CF5A 5L40A 3BSFA 2O7QA 4B6PA 5H0IA 3OUZA 1ILEA 1RJ9B 2XEDA 5KX5B 3FX2A 1Z2CA 4WNIA 2QJTA 1M6NA 3ICWA 5IBPA 2GBLA 3DNMA 2YN4A 2WABA 1KMCA 3ZDXB 4Z3KA 1SRRA 2KYRA 2WYIA 1KI4A 1F2DA 2P1RA 4YP5A 4E5VA 5COQA 5CB4B 1JBEA 3ZVLA 5JAQA 3D5EA 3E5MA 3CKYA 2XKBA 3DE2X 3PD0A 3M5CA 4FQ7A 6Q21A 2I6QA 5ESWA 2Q8PA 4ZHSA 3L04A 2FPWA 2A84A 3FZNA 4RUKA 4MUMA 3VC7A 2XCTB 2FEKA 4MRPA 4OHMA 1Y7HA 3PL1A 2RHGB 2PL1A 1PJQA 2M6SA 2X0NA 3HJTA 2OWEA 1J0AA 4ILEA 4J90A 4UATA 2RB5A 4IX9A 2GWHA 4L75A 5AXCA 2B78A 2RAVA 3FNFA 3IP6A 4KOAA 2JJ2A 4IDDA 5T6MA 4ZTUB 5A9TA 1RIIA 1TE2A 1FSPA 1MDBA 3MJVA 4W9NA 4JC0A 5HF6A 2WBLC 10MHA 3AUTA 4K40A 3SKXA 3TOVA 5CVEA 3GLFB 1KI7A 4D99A 2PH3A 3C87A 5U1PA 4B8YA 3T1TA 4V0SA 3CLUC 2W6ID 1G16A 3B6MA 4YV0A 2MSKA 1NAHA 2CLOB 2ZWPA 4N8DA 1J8YF 4XVUA 3ECCA 2IKSA 3T7CA 2BF7A 4EA7A 2OZKA 3LFTA 3BULA 4MW7A 3EIUA 4NQZA 1Y3FE 1OXVA 2G7ZA 3LYHA 3OT4A 3UYLA 3ZCRA 2BBWA 2ZWMA 3Q5GA 1SXGA 4AX8A 4CU5A 5DB4A 3EF0A 2QLBA 3RS0A 2H51A 1ZK2A 4P3NA 3KSRA 3K35A 2O3TA 1N2EA 1U9JA 3D7LA 3H8WA 1I5OA 4HL6A 3QVJA 4PSAA 1GZDA 2AKAB 2X19A 2PUFA 4NE9A 1KZGB 2OV6A 1EG2A 4BMYA 2G9UA 2YYAA 4RZQA 2GM4A 1PJTA 3LP6A 3L4SO 3ONVA 2A6PA 1JWBB 1NSYA 4WGFA 5EZYB 3OLCX 3R3WA 4Y30A 4IILA 3TMKA 4MW1A 1M33A 5B7GA 1OLXA 3DO6A 1W2WB 4QOIA 2PS9A 4E1BA 1O87A 2QTZA 3GXBA 3IAUA 1Z4JA 2J7KA 2CJPA 4F4HA 2BUBA 4F92B 2BP7A 5JMTA 1GA4A 1OTHA 2DG2A 1EP2B 4EABA 3OY7A 5F98A 2I62A 3RT9A 3LPAA 1XEXB 2BWJA 2NZYA 2VJQA 2ZG6A 3JRWA 3P0RA 3UO8B 5COBA 2O5CA 1E1RD 2EW8A 3K15A 3P94A 5FHRA 3TUIC 3PICA 3A25A 3F5QA 4BBJA 3HYRA 1EG7A 1Q1GA 4KQGA 1TKCA 2AXEA 2CNKA 5EWJB 1NC1A 5ITWA 2W0SA 2QVLA 3K4PA 4XPZA 3OMXA 3SJUA 3I6BA 5KOIA 1KQ3A 3DMFA 2AOVA 2JLAA 1AO0A 1GGFA 2BBSA 4OPMA 4PQGA 3T7JA 4FFNA 3AGQA 1W0KD 2V7QA 3O82A 4JU9A 4LY0A 5L6MB 5GJCA 2H65A 3HKDA 2BFEA 1BHQ1 1L1QA 3DVSX 3PT9A 1Z6QA 3D6MA 1VPLA 1AKRA 4X1IA 1G7SA 2VDPB 5L3ZA 2GRUA 3BJRA 1J99A 1XZFA 1JEDA 1TK3A 2ZB2A 2I6FA 4YJHB 4JI0B 1Q57A 1RHUA 3PDIB 3BUSA 1EGMB 1TQHA 1XF1A 1K6XA 4ZD6A 4E12A 1IMOA 4KLRA 4Q3KA 1V7PC 2H52A 2Z6AA 1ZD5A 3TF5A 3FTEA 2FQQA 3EXFA 3LXRA 1EX1A 1G4UR 3DE0X 4S35A 5D3QA 3T7AA 1PN3A 1ST3A 3QWHA 4OYLA 4BL5A 4YUYA 3WYFA 2YNMD 2AFHE 4KQJA 5H3CA 3BJZA 1CVLA 2RC5A 1EKXA 1Z4KA 4M9CA 2IPXA 4YI5A 3VH4A 1X7ZA 4P7KA 3QLUC 1J6UA 4REQA 2H92A 1K08A 2K6GA 2XJ4A 2HCJB 3R5KA 4D6PA 4XKJA 3SF8A 3B9BA 1NSFA 3OCUA 3RC7A 2PUAA 1DNPA 1EK2A 5K8IA 3NXSA 1CY6A 1QQBA 1YZFA 4KMOA 3F1LA 5IAKA 4EJFA 2WTEA 5FI3A 3WHKA 4KITB 3HJNA 2O3UA 1P1BA 2C4TA 5JRJA 2UUAB 1NVEA 4WBNF 4CM4A 5ILOA 3AF6A 1M5RA 4FEYA 4QQ8A 5KTYA 3WQBA 1JQJC 1U0TA 3JD3A 3DC7A 3QUAA 3JQEA 1Y7IA 4M3NA 4DLZA 3KKPA 1ZO8A 3D1VA 5IM4A 5JXJA 4IG4A 2H2AA 2WAXA 3GCXA 5KQSA 4FYJA 4BP3A 2I6TA 4II7A 3M33A 4WLVA 2PJRA 1ZZGA 1TTPB 3QVGB 4QRIA 3IUSA 2EF1A 4EVIA 2Q28A 3COZA 4RSMA 1TD9A 1NOIA 1IBLB 3NUGA 1KEEA 1Y63A 3G5UA 1CUSA 4LJAA 1WMAA 4NPAA 3UY4A 5I7FA 3QV1A 5LDDC 4RBNA 2NTYC 3NBQA 4L22A 4PLCA 1QCZA 3VPXA 3U3KA 2RBEA 4JQOA 5J63A 4I7EA 4B3MB 1KDTA 1PQPA 2EFGA 4NYIR 3ZNQA 5AW4A 1M34A 1MPXA 1P2BA 3CJTA 3UJCA 2HWWA 4P83A 5EHNA 8AT1A 4DDHA 3J81k 2NUPA 2DP4E 2QGZA 4Y2QA 4XSHA 3TJZA 3H97A 3V7UA 3AM4A 5IVIA 3WHLA 4ZQHA 5LXTA 3JQDA 3PTZA 1XTUA 4NMXB 1MFPA 2W2KA 3JD1A 2CJFA 2EJTA 2G4VA 2WSMA 3I5AA 3RS2A 2W6JD 3QLVA 4XFJA 2QJOA 1SFRA 3VZDA 3ZDFA 1VRWA 1OH8A 4LXYA 4KIWA 1RDFA 3G3EA 4GMHA 2F6RA 3GWZA 4A5SA 3PRKE 3O2JA 1LPMA 3E7XA 1GUDA 1XVLA 2JARA 2PXXA 2A5LA 4HZIA 4X7BA 1X1QA 4XI9A 1K66A 4LQCA 4O4LF 5IAJA 3SE0A 2C99A 4QXAA 1SOMA 5HIJA 3VUFA 4BN0A 3Q8MA 2VG8A 2FXIA 3ACBA 2Y1WA 3E18A 4E94A 1UDXA 1RYFA 4BFYA 2O0HA 1JA0A 2PQ6A 4M83A 4AL4A 1DRWA 4XIFA 5LQAA 4EL0A 1RVDA 2O07A 3FYDA 2ZYRA 3PVZA 4YV1A 3C6BA 1Y5RA 1UH5A 1XD8A 3FDZA 3DWEX 4PLFA 1FDRA 1MOZA 4H6PA 1LDEA 3NO4A 5CLQA 4C7BA 1ENPA 2VRCA 1J4AA 4MIOA 2PUCA 3M5WA 1I6KA 1Q83A 3P9QA 4FQ8A 1IPFA 2AOXA 3AKDA 3RFVA 4A8JA 2ONJA 2Z5LA 4G81A 2O8BB 5TEWA 4BV2A 4K2AA 5FWXB 3IVMA 1X1AA 4PM4A 4UOQA 1AQIA 4Z9BA 5AVZA 2HI0A 5MFZA 1E6KA 4JT4A 1ZUD1 4UMVA 2JAWA 4COKA 4R5MA 3JQFC 3A4VA 1FTNA 1TO2E 1XRRA 3EXEA 4QJ4A 5AJXA 1QGUB 5ALSA 3I09A 9LDBA 5C8ZA 4YR9A 1UK8A 2NADA 4KC0A 4YCLA 4F4UA 3UJBA 2RHTA 2XNHA 3PR2B 4KXXA 4RKWA 4AG6A 1LQTA 3H2BA 2PR2A 2WKRA 3AOGA 2HXYA 4RH3A 4Z0HO 3SSAA 2C4NA 4I2NA 3CLTD 5CLLA 4WL0A 1KYXA 3FSGD 1WY5A 2XGMA 4HYEA 2NTVA 3NHUA 3UT5B 5LU9A 4Q3NA 1RE0A 2IYNA 5IJWA 2VAXA 1D5CA 3Q85A 2J6IA 2Z4SA 2BFBB 2BUCA 2BJHA 2VDOB 1VJTA 1YU9A 4M89A 3OPMA 2NZXA 1XWIA 1XRMA 3LQYA 3DVAA 1ELOA 1NKVA 2ONCA 1QV6A 3EQ2A 4I9UA 1RAAA 4HXYA 4US1R 5D01A 3WGJA 2XECA 3WZ2A 5KYXB 3GLIE 2YOGA 2OHFA 4ZZ0A 3G5LA 4JCCA 4WMLA 4Y2YA 5BQ5A 4DR6B 1GTRA 1AHPA 5AJYA 5LUBA 4AZVA 3AB8A 2YV4A 2ZUEA 2BEWB 4F38A 1BH6A 4QPJC 1DJQA 5BN5A 1R0RE 3NEPX 3IQXA 4G1FA 1R9JA 4OU4A 3R7SA 2LBPA 4BV8A 4CL0A 5F78A 1C80A 4PLGA 2JFPA 2NQ2C 4DC9A 1KPGA 4DIDA 1U2QA 1A9XA 2BFFB 5KNBA 1NP3A 1OILA 2VJDA 2R2GA 3FNHA 3HYSA 4KO2S 4OY3A 4HLDA 4S1TA 4WERA 3TLZA 1T9ZA 3U4GA 2BRUA 3K9FC 5DH9A 1UOOA 1AQYA 2ZRQA 4FMDB 1CQPA 3GJSA 4IQ8A 4MWZA 3WYNA 3PTAA 1TPYA 3Q3CA 3EDMA 4EPVA 4CU2A 3AVXA 1DL5A 3A9WA 3WG9A 2BZ0A 1JHVA 3W8DA 4IDQA 3E2IA 4MGIR 1KEPA 3MERA 4IXWA 2OCDA 3U39A 3K6SA 2BEVB 1VYHA 2OCYC 2VJYA 4WY8A 4CIXA 1O95C 4JSYA 2DBYA 4GXQA 2GVNA 4P98A 5FLEX 1C7JA 2F4NA 2XTAA 5EZ6B 1BEZA 1M6VA 3V4LA 4XUDA 1PR9A 3EBPA 4OAPA 3BB3A 3IAM6 5TGZA 1ZL0A 5IJ9A 1EB8A 3NGMA 2EV9A 5H16A 2DF8A 5IJ0A 5HF9A 2L69A 3CF0A 1FFEA 4C2AA 3EPLA 3KXKA 3MT0A 2PG3A 3BCHA 3IPRA 2WF6A 4LYGA 4KLZA 1R16A 3W77A 1MG0A 1O3YA 1U7HA 5BY2A 4CL8A 5K3FB 2NLOA 4EB6A 3HJFA 4U7TB 4YQYA 4AB1A 2YXPX 3GJZA 4RD1A 4UVIA 1CLUA 1M8FA 2FDRA 3F2IA 3T3OA 4CHGA 4W4TA 4UPDA 1I4LD 4TL8A 5K8TA 1USWA 4B34A 2RKBA 1ZDMA 4I50A 3AYZB 1M3SA 2JK1A 3D7RA 5JU6A 3I61A 5C35A 4MDEA 1DCMA 2ZU6A 4FHFA 1UM8A 1OASA 2WFLA 4BMOB 2I78A 5FLYA 1T4BA 3BGDA 4JQZA 4OX9Y 1FFGA 2GF9A 3OQMA 3EW9A 3CRQA 5K8LA 1TK9A 3W3ZB 3K31A 4ALLA 3OOHA 1R4MA 1OH7A 2BBTA 2V7EA 2ZSAA 3PFIA 4Q1FA 3A7DA 3AR9A 4ZGBA 2WSLA 1YS1X 3CPJB 3N0VA 1Y6RA 1X7HA 3SE7A 3W9UA 1V71A 1E62A 1Y1TA 1L4EA 4X24A 5JO9A 1ISJA 1EVYA 1L6RA 3LIPA 3W2IA 4ETWA 4O0MA 4Q66C 3A6PC 3CLTC 4GVLA 2QLTA 1SIOA 1CUXA 3KWFA 4J75A 4JX8A 1WF6A 2GJ8A 5CNMA 1VC2A 3K0EA 4ZVLA 3Q7TA 4WZBA 1SVUA 2CJXA 2HEGA 4PAMA 1MW9X 1E9CA 5GOTA 4R84A 3RC1A 3ST7A 2OFWA 4DRZA 1ZPDA 5A4IS 4U8HA 2NYAA 3PF8A 3CSSA 4XVCA 1OYYA 1R10A 1E8MA 1QCDA 1ESMA 1IBSA 3BK1A 3MUNA 4WKCA 5CRIA 1QYWA 2IY9A 4TZTA 1Q3TA 1QHNA 2Y1FA 3NBFA 4Z4HA 3BKXA 4OU5A 5D87A 4CFYA 4PR3A 1MB9A 4M8IA 4EOGA 1Z74A 4QG7A 2Q4BA 2VDWA 3D8RA 3Q2KA 2AXPA 1DEKA 2PO7A 1MXFA 2J48A 5HQ3A 5LYYA 1G9SA 3F6BX 3RSLA 1S0UA 4M0MA 4OA8A 2RGNC 3ABSB 3DOUA 1M8PA 1V3UA 1E77A 3BDIA 3HN7A 4M37A 3Q7IA 4UE3S 3SHVA 4DHEA 1R6UA 2O7VA 4FDTA 4BQEA 4D0SA 5LYJA 1VL1A 3GFBA 4MQ5A 2VSNA 3PXBA 3DXYA 3QELB 3ASUA 1EH5A 3VZRA 4DYVA 5HBRA 4JBYA 2AH5A 5FEMA 4C87A 4TYQA 2EGUA 3PSHA 5HS6A 4BO2A 6REQA 4XRRA 4BQQA 1E7WA 2W6CX 4TOIA 1BGXT 3TXXA 1Z39A 4V0OA 2VJMB 4HNVA 1R27A 1L7QA 3TZKA 2CUZA 4NABA 4W82A 2D3WA 2YZ2A 1EWYA 3RKSA 1QTIA 4V0LA 5A6VA 4XCQA 1N0WA 4IDGA 1FYDA 2BZGA 2DMRA 3IL2A 1D7AA 1EYZA 3O1IC 3P0JA 1KFEB 3SNKA 4UTVA 5TQJA 4GYWA 2P9CA 2QMYA 3CJRA 4QEZA 2AFRA 3MCTA 4P35A 1Y7LA 1NUQA 5D3KA 1IY1A 1XKTA 1NF2A 2ZXFA 4NOJA 4QFBA 3RYHA 2OM2A 1YIOA 3P9XA 1Q20A 3KZ1E 1P60A 4YXWD 1ZN7A 3JQPA 1KI9A 3DCIA 3PHLA 4ENQA 1V6AA 3HU2A 1L7MA 2WWTA 3VOBA 3PD7A 3OZTA 4J0JA 4DT1B 3KT0A 2I3AA 4Y0VA 1JHXA 5B3KA 3HC7A 1PX0A 4ITVA 1XL0A 4EKEA 2BHLA 3LUKA 3HB5X 4J0DA 3DB1A 1JEQA 2RGDA 2QDKA 3PVSA 5EXXA 5KKAA 4DW8A 3UBTA 1QQ7A 1P4HA 2V59A 3WLJA 2EYUA 3KE8A 4O4JA 1P6QA 3L01A 3VTKA 4EG8A 2QTWB 3UN1A 4F04A 3GPDG 2IXEA 2C7GA 4BKUA 5TMPA 4QUIA 2VK2A 2ZUDA 3QEBZ 2C96A 2SKEA 3TMYA 3UEOA 2WJ4A 3AU9A 3KOYA 1YE8A 1NBOA 4YBZA 2HOQA 2Z1DA 4RY9A 1IQPA 4B87A 2A33A 1COWA 3ZDZB 5DM2A 2AOTB 2DTXA 4UU7A 4FXPA 4GT1A 1DV2A 3IXQA 4OLHA 4EA6A 2QNRA 3CZQA 3WIUA 3FHTA 5A62A 3TQIA 5CCEA 2P4QA 4C4YA 1KRXA 4C3VA 1LD3A 2C7VA 3EEIA 4CV1A 4B0PA 4F46A 4YO7A 4K1XA 4EI9A 1FJXA 5KUTA 1VLVA 2VPWA 2D74A 3A9TA 3Q88A 4I4IA 4LC0A 4MQMA 1WXWA 3Q3GE 4I4LA 1CPYA 3ROZA 4CN9A 3C3WA 2PXHA 4V0QA 1BN6A 4JU8A 4L4UA 1UEIA 2DAPA 2C2ZA 3G79A 2ZM5A 4DG8A 3ZGOA 4HGYA 1WW8A 2X6RA 3F4KA 4OFWA 3CWZA 1U9IA 2WJIA 3B89A 3QE2A 5E6UB 2VJOA 2W71A 4M0PA 4DNPA 1BMDA 1AM4D 1LRJA 2ZR9A 4F6RB 1C1XB 1P91A 2VJKA 1HDIA 3B1YA 1GDTA 2W93A 5IDXA 4XWTA 1U8AA 1R7RA 3NX4A 3BMNB 3C41J 1QKJA 2B34A 4H0CA 2AN4A 4ODIA 2XRYA 5DTEA 3FPEA 5B64A 5JY1A 1YULA 1YK1A 4QGGA 1US8A 1OIXA 1PNRA 5AIBA 3PD1A 3OCXA 4RM3A 1WSWA 3SXJA 2JZCA 3VZQA 3SF0A 4U6QA 5C5CA 1N25A 1KERA 5FNVB 4C1NA 5HTOA 1M6HA 1MH9A 4GNRA 3V32A 4AW9A 2R84A 3QVTA 4CETA 4LNHA 2B21A 5JSUA 2Y4NA 3QZUA 5D7BA 5AHKA 1IYZA 1TYZA 3L6BA 1J5XA 4D5GA 3LT2A 4PN3A 4XAQA 4Y2RA 3KSZO 221PA 1O6FA 3GDOA 4CM6A 5LQNA 3U6KA 4I3HA 3GLGB 3NIWA 4DMHA 4MR8A 3UFXA 5DVZA 5FR2A 4DJEC 3MGAA 5HMLA 2CLKB 3QLVC 2X86A 3IXLA 2XADA 5GONF 5AI8A 3FKJA 4HFJA 5JAZA 3B5EA 1NG1A 3ZD9A 2FE4A 3ER8A 4JJ6A 1HORA 1NW4A 3N59A 3EJ6A 1QIIA 2ZM6B 4E08A 4JCOA 4EYOA 4PRZA 4DR1B 4JOBA 1KC1A 3FWYA 4IX1A 4JKYA 4RGVA 4ZTBA 2BH9A 4YS6A 1X14A 4NP6A 1E9SA 2FLVA 1JKFA 1P9OA 3JASB 1QZXA 2BJVA 5G3ZA 4YYEA 1AA6A 1M0EA 2V0GA 3I52A 3F96A 5DGCA 4RTJA 2IHNA 1R6AA 5JAUA 4UFOA 2JGDB 4PAWA 2ZOSA 2XZTA 2DERA 2WOJA 3AFGA 3K9HA 1T13A 4KOEC 4F4FA 4H3SA 1JIQA 1K8RA 1TT5A 2ZR8A 4DQKA 1BYIA 3HLKA 2HUNA 4M6WA 4PIVA 3H5IA 3W5DA 4NI5A 5C18A 1J9GA 2YVUA 4UNQA 4UUNA 3UK1A 2HCRA 5F9HA 1EAYA 1LSSA 1NKTA 2O7SA 3ZY6A 1GXSB 3QSGA 2IHJA 1KVUA 1R00A 5CNJA 4E5PA 3MAAC 3O83A 1V25A 2DVMA 4PGMA 2XAAA 4JIGA 3H6HA 4UKDA 1VP9A 1WUYA 2Y68A 3AM1A 4O29A 1OJLA 2IT1A 2F9MA 2OO5C 2YDYA 4GX5A 5FTKA 5PNTA 4X65B 2V3VA 4FIZA 1KBZA 4BEBA 3PC4A 4ZT6A 1JEYA 4QECA 4OAQA 5E95A 2ENUA 3NYQA 2GHRA 4LHWA 2O3QA 3BFVA 4BNZA 1YQGA 3NAZA 4OXKA 2PRKA 3NU1A 4EBBA 5E6SB 1PR2A 2DUNA 5AVTA 1OLUA 4C7OB 1P80A 3B20A 2GN8A 5CXQA 1SUBA 5I7SA 4WNYA 1PFGA 1DGQA 1B16A 2K2QB 2VOJA 3KVVA 3RVPA 2OQIA 1GL9B 3RAJA 2JDIA 1TYCA 1B93A 1UXJA 4XIYA 5FO0A 3UTCA 2YY7A 3NVMB 5IHXA 2VEOA 3GDFA 4PQRA 5H8WA 3OU6A 4H7IA 4PPGA 2H9YA 6YASA 4CEJA 1YASA 4EELA 5JH7A 5CYPA 2H11A 1U2SA 3HCEA 1PDOA 4MIEA 1BA2A 5I9TA 4GECA 1XZKA 1I3CA 2P4EA 4MWOA 3HZZA 4QICA 4WASA 4ZOCA 1BRMA 3HJCA 4R2KA 5C3MA 2A3RA 4ZO4A 4C14A 1I3KA 2X3UA 5JAOA 2NIPA 1WU7A 2YWJA 5DX8A 1NNSA 3L6UA 1TF7A 4BJ3A 4BX8A 5IKOA 2QTFA 1WHTB 1TADA 3LO8A 4EO9A 2IE8A 3MWJA 2H29A 4N7JA 4X20A 4J1NA 5AOAA 4BMPB 2VZ9A 2FZCA 2DZDA 5JG7A 1MV5A 3LNCA 1YZ3A 4EVRA 5LC1A 4QPCA 5CB8A 5AW0A 2ATXA 3N70A 3ZWMA 2PUWA 3VSEA 1Z5VA 4PNEA 1KP3A 4FBMA 4DLAA 1LGYA 4YHBA 1DXHA 2VRNA 4DBZA 3A1WA 3C15C 3I72A 1FMLA 2CK3A 2KBEA 1NN1A 4NHEA 1N2CB 1DDGA 3DT8A 3MVEA 3NEYA 4TYMA 1WBBA 2X1HA 3L0BA 1I7NA 2HO4A 4IEFB 3QWAA 4KQIA 4XJXA 4BO3A 4B6EA 1XBTA 2PD4A 3WBJA 3BAFA 4JK3A 1FFHA 2QP9X 2VYFA 3EF3A 2CMGA 4NBNA 2YYYA 4ZI7F 4YAOA 4U2FA 3LQ2A 2WYHA 3PGA1 4DIFA 1V7QA 1NW6A 1QB7A 4OFZA 3RC3A 4YLYA 1PJSA 2ZJYA 3EQ8A 2JFUA 5C7IO 3DD5A 1OGJA 4DIEA 3ZQJA 3AIKA 5BSEA 1G8KA 4JUDX 5CEJA 2AX4A 3R44A 2VQ6A 1UPFA 4CQMB 3NOOA 1DWUA 4ZVUA 4YT4A 3IJPA 2GN4A 3FETA 3GNQA 3HY4A 3PGKA 3DA8A 3SIPA 4X8HA 4KGVA 1M2VB 1IAVA 3CKLA 3JWIA 1JTEA 2VH1A 5TX7A 1EGAA 2XF8A 4KFTA 4KQXA 1N6IA 2YS7A 1U4NA 4NYMR 4AQYB 1T5DX 2SECE 4HRYA 1G41A 4E31A 2O2IA 4C29A 2JGFA 4KXUA 1F20A 2JJMA 2Y9PB 3M70A 1X0XA 3CH6A 1CQJA 1E3EA 4HQNA 2YHUA 6GPBA 2FSUA 1ULZA 2GZMA 3OIUA 4YJ3B 3UH0A 4DGSA 4XJTA 3L0PA 2XQFA 3T12A 3H2YA 1NFQA 1XTPA 2RSLA 4LVOA 4IO0A 4YGXB 4NCIA 3UJAA 1A82A 1DKQA 1Q7CA 4GO1A 3G88A 3M9LA 1GQ2A 4OEHA 2LKCA 1S3GA 3TZ6A 1VI2A 1ES9A 5KJ6A 4MGYR 2NOAA 5JMWA 1V3TA 3JWEA 2GH1A 3RK1A 3VR4D 5LZ4A 2ASEA 2H2DA 1OROA 3DW3X 3II6X 2XUZA 3SR3A 3QKWA 4YJ2A 2X9LA 1Z07A 2ZYHA 3X0DA 3ZIUA 1A9QA 4CZ2A 2FN3A 2GJSA 3KS9A 1GGEA 2PZJA 2Q0SA 2IF0A 1SVWA 3FI9A 3UK6A 5KYKA 3W9BA 3LZ6A 5EPEA 2VCEA 4KPYA 4Z2AA 3CN9A 1G21A 1AO3A 1G0NA 2IK8A 3HY6A 5TXGA 5C52B 2P3OA 3RS3A 2W8ZA 3DR5A 1F3LA 3QRWA 4JWKA 3GJYA 4E46A 5K0JA 3AJ8A 3LA6A 2HSWA 3AYXB 5SY9A 1TQDA 3Q7RA 2DKNA 3FMIA 4L5CA 2DU8A 2GXUA 4AJJA 4ZDKA 5HZGA 3R8FA 2CKDA 4PQFA 2XTNA 4JT2A 3N2YA 5I6DA 1D6JA 2MCFA 3T6KA 2ZT6A 3MJDA 1LPOA 2A9KA 5I5EA 1G8MA 2O19A 4EGAA 2NPIA 3K9QO 1L7NA 3LQ1A 4KYTA 4BJ5A 4HD8A 3CO0S 3N8KA 3OPNA 3WWEA 4C76A 1Y9ZA 2HGZA 1NVMB 1CCWA 5KINB 2JAHA 3M4JA 4HLQB 1S2MA 2N0SA 3X1WA 2CLIB 4A10A 1DBSA 4DQXA 1SUCA 1BS2A 2R85A 4IXMA 4GOJA 2FR8A 4UDNA 3G2MA 2V6JA 4MSUA 2HO5A 3OQBA 2VKQA 4Q34A 2L18A 2ZCVA 3D4IA 3CY6A 1AA9A 5HJ7A 3C3PA 1CWUA 1SKQA 3M5PA 1V1JA 1QVWA 4BASA 3W7BA 4A03A 4MP3A 4ALIA 1DX4A 3LECA 3O95A 4WXRA 4EYEA 4P3KA 3TAUA 1E2NA 5EJ2A 3GLVA 4CQMD 1QIMA 2PZEA 3IPXA 1HFJA 1A4XA 1JEAA 2AEMA 3BA1A 4NF2A 4URZR 2PX0A 3K1AA 4OM8A 3KLBA 2WINI 1GAWA 1T0UA 4XX0A 3D2BA 3HJGA 3GEDA 2P6OA 1OFVA 4XDHA 5BXQC 3ON5A 1CVIA 2MYNA 1Y6ZA 4FYYA 2BD0A 4JUFA 3WLKX 4B47A 4BVFA 4MV6A 5DHFA 3R5HA 3OETA 1FYWA 1KEUA 4GLLA 1FU4A 4IG9A 1PR4A 5CA1F 4LXUA 2ZB4A 1F7UA 1A3CA 3K05A 2XUQA 4Q9AA 1OBVA 2XQGA 1NUHA 1OWLA 1C3OB 3JAKB 2ZRDA 1U0JA 4QSHA 1AKEA 2W48A 1NG9A 1OA0A 1W9HA 3P2KA 2QG9A 3KYDA 4V1CA 1GT6A 1BXZA 1C7RA 1K8QA 1SBZA 2D1TA 4NZZA 4Y9SA 5GMOA 3VH2A 3FE2A 2J46A 1IZYA 1E61A 4IGAA 5HJEA 4ZZ3A 2HBYA 2HX1A 5FR1A 1H0RA 3I28A 5F64A 4Y2UA 1CZUA 4TL7A 4GMXA 2JD0A 2O7NA 4NV1A 3T7IA 1HNWB 2QUBA 1T0JB 2Q50A 1LTKA 3G9QA 1P4AA 1MJHA 3O03A 2X23A 4WK2B 1FX0A 3BTVA 3FA2A 3KLMX 3T4EA 3TRFA 2IP4A 4OHOA 4KKVA 1CUBA 3LHKA 5TC4A 3GPCA 1P7ZA 3SBEA 1EXVA 3CB2A 4JFRA 4DQ0A 3OF2A 1U9IC 4JHXA 4RMHA 5KTMA 2I7CA 1FTQA 5LUAA 2GZAA 4QUJA 4FYIA 1P81A 2PH7A 4OJMX 1WUHS 2J4FA 3V7FA 1OAOA 2FWBA 2QGFA 1IY9A 1MUUA 1OIVA 4ZMRA 5KJFA 3HP7A 2ZRHA 1T2CA 4OLJA 5L3SA 4UNIA 3IJEB 3DZKA 1IHYA 2JIOA 2QMZA 1YACA 4URHA 3OIYA 3BH6A 1P0FA 3JYOA 1GPLA 3KCQA 1Z9BA 2HF7A 1VCNA 1JB1A 3FY4A 1T24A 3MT9A 3AR5A 1XZMA 3ABIA 2VHYA 3COWA 1SWWA 5DHSA 4Q4LA 4N0DA 3MRVA 3UT0A 2QVBA 4LGVA 3E1SA 4NBUA 3TVTA 2R6ZA 1LPNA 2VSQA 2MINB 4PYKA 1E0DA 4TQGA 5J2UB 2IX9A 1QVAA 1THMA 3T1VA 3WADA 3MS4A 3H3FA 1WMEA 1YS9A 3VH1A 5FPTA 1DUSA 5F4BA 1C1HA 4MNTA 4RXUA 3WGTA 3LTEA 3U0BA 1CYDA 1TKBA 4UFPA 1R6DA 1MIOB 4IDNA 4D9EA 3U5TA 1G60A 4TTIA 1GZHB 1J9ZA 4LNUA 2CEAA 1R0YA 3BILA 3FVVA 3DEJA 3G02A 3LVRE 3STVA 3Q3JB 3DE6X 1DC5A 3BCRA 2A9PA 5L3VA 3I01A 4UARA 2OGSA 2P9HA 4DQVA 4ZYXA 4LBZA 2C2OA 1OVGA 1LU9A 3VVMA 2WDPA 1N7IA 4PLHA 1T3ZA 4IV8A 4WOPA 1KMNA 1KZ7B 1K7XB 1B3BA 1UKZA 3BXHA 2ZJFA 4O8CA 2E6KA 1DJNA 3QHAA 4IZIA 5AKEA 1Q3HA 1OWOA 2O8CB 4REMA 5IYZF 1ZISA 1N8TA 1HGXA 1ISMA 1ZJWA 3ET4A 4KAJA 1QRAA 4JI4B 2KQUA 3PV0A 2GAOA 3VPAA 2Q6TA 4RTKA 3P9IA 1NA5A 1P1CA 5ESRA 2PTGA 2V55B 3C1TA 3NWJA 1Z22A 2OO3A 1I80A 1E5DA 3LK6A 2ZANA 4CI0B 5JQGA 4GICA 4TVOA 3LT5A 3ZLBA 1O6BA 2GCOA 3SQWA 2F17A 1SZDA 4FFSA 4LDJA 1CVRA 2N9UA 3AHEA 3DPIA 3L0ZA 4ZOLB 5K3OA 3TDMA 2LUOA 2V7PA 4WKOA 1EQ2A 1EZ4A 1ZMXA 3M1LA 1UWLA 2HLPA 3QYPA 1XPOA 2DCMA 1NOKA 1FP4A 3AESB 4RPKA 1CP2A 3TFOA 4BYMA 4TLCA 1GKKA 3SR4A 4BZWA 5MGBA 3QU4A 2GEDA 4CODB 3EZ7A 1GZUA 1N9KA 1GTJ1 3T8YA 1S4QA 1T5OA 1PWEA 1WMDA 1QVVA 2PX2A 3PFKA 4BAGA 3KSDO 5JV5A 4IH9A 4LNAA 5AKIA 5CVVA 1JFRA 5C4IA 2A4KA 4CIVA 3LPCA 4MPPA 5ARCA 2GOYA 5EQFA 7REQA 2CB0A 3F3MA 2IZ1A 4JHLA 1SUSA 4UHBA 1QG2A 5KPJA 1PSDA 3MUEA 4TSFA 1T91A 4LV6A 3VVCA 2HRBA 4MGHA 3U56A 3HVIA 4D98A 3MS7A 1HTWA 3NASA 5CK5A 3SLRA 4Z7QB 4DLUA 2EX1A 3A37A 1RXIA 4NFSA 1NBMA 4KG7A 1L7BA 4G0WA 1LLQA 4RU1A 1PGQA 1ZD4A 3DBIA 2HDHA 4WESA 4BP9A 2C98A 1LKZA 3N76A 3T0FA 1UC9A 1K3UB 2LTAA 1XUOA 1TCUA 1BMQA 2R65A 2X15A 3LC0A 3MTEA 4FGSA 4DG5A 4OK3A 4NVRA 4F6LA 5HSGA 3D64A 3LS2A 3ZS8A 2IITA 4AZ3A 4EA9A 2R0QC 1TYAE 2HL6A 3E35A 4YP1A 5DGTA 1Z4IA 2BFMA 4RVFA 5TARA 2Y2VA 3GXOA 5B3JC 1XMOB 5BR1A 3IT3A 1W6RA 1F51E 3S2IA 3C8MA 2H9AA 1FUYB 3D81A 1KNXA 4UEJA 3H4TA 4P1ZA 3THRA 4LXGA 4EGFA 1BX1A 3VXKA 2P5UA 4D8XA 2X5JO 4NCNA 1ZNQO 3MHPA 4DREA 3RADC 3U60B 1D0SA 5J9FA 1R6XA 1BKSB 4TYPA 1T10A 2J31A 2UVPA 3HDYA 4MRRA 2P2YA 5CFOA 1T4CA 1FIUA 3R9XA 3IMKA 3ZU6A 3CLRC 2W8BA 5AHXA 4YCJA 3VI3B 4UTPA 2ACEA 1SRQA 1X80B 2M6RA 4HNHA 2VK4A 1CNMA 1CKEA 3L8FA 4OMFG 2E9SA 1MXHA 3KYIB 3AUSA 2RH5A 2XLBA 4N5MA 3ZQUA 4DZRA 2Q5OA 5EQJB 5BR8B 1GPJA 1BXRB 2AW3A 3C14C 1XLVA 3RVRA 2H2HA 3QITA 2OPBA 2E4XA 4IJQA 1J23A 2H3HA 2H16A 2YZKA 3DZHA 3OECA 3GZNA 1L5HA 4EKNB 5GV8A 1T36A 4OJYA 5DLDA 1R5OA 1H5UA 3JAWA 4OL9A 4GX2A 2QL7A 4LKRA 2OGWA 2AFIE 3VOSA 5MDHA 2H0RA 3E3LA 1HG1A 1CY0A 2OKCA 3QX8A 4K9MA 4F4DA 5I7WA 4L0QA 1H93A 2RBKA 4JEMA 3KRTA 4PFQA 8ABPA 3CRMA 2JAUA 5FH9A 3LY5A 4G89A 3HKCB 1LBHA 2VP4A 3BICA 3IESA 3PUKA 4PX5A 1L7PA 4W9MC 2JLWA 1E8NA 3GV0A 1H9BA 2LCQA 2WVHA 1XJWA 1Z12A 3QXSA 4PZDA 1YQWA 1XTQA 2FSIA 3C7KA 2D54A 1GAJA 5C32A 3HB0A 1YFZA 4IOJA 2OXTA 1T8RA 4FKBA 1FPQA 2FMUA 2CDNA 2GPBA 5CLHA 2Q46A 3WLRA 4C7KA 3BGWA 4GMDA 4KVFA 2NPFA 1SCIA 2CCJA 3W6ZA 4ER6A 3F71A 1QF9A 3QU2A 3RASA 3RIMA 4EZEA 1GEGA 2RGYA 2Q3BA 1H8ED 2Y1CA 4RF3A 5AKGA 4FOOA 2P3QA 1CR2A 5EZSA 1XDZA 3BQ9A 1AUXA 1U2GA 3NOVA 4Y1RB 4OYRA 4R2MA 1ACMA 4EMTA 3AUKA 4K86A 2RI1A 4P4SB 4DCPA 1LJUA 1KMIY 4F2HA 2EKBA 2GN2A 1FSSA 2R8YA 3R5SA 1ZH8A 4R1QA 2Y1GA 4CMCA 5CT4A 3I9KA 5AM5A 2WUDA 2QE7D 3Q9LA 4MKXA 4D2IA 2YXBA 2J9FA 2XUDA 2MYTA 3LGAA 3QQPA 1F8UA 2PBRA 1M2OB 4ETIA 1AZTA 3F0TA 1RP7A 3GRAA 1WM1A 1NRWA 4M8NE 4MW5A 5JD6A 2SHKA 4Y6OA 1VXRA 3ZE0B 3FHJA 4DB4A 3EXG1 3ODGA 1M2WA 2OK7A 1XZ8A 1QG6A 4S24A 3DSRA 1DAPA 1X8XA 2I80A 1D1TA 2Y1DA 3MNFA 1F2TB 3ORSA 1NQWA 4R0VA 2Z4TA 3LWZA 4B5KA 4D8VA 2CVZA 2QMOA 3U62A 4GR9A 2J5QA 1DXYA 1J56A 1GZ6A 2VF2A 2Z95A 3N0TA 5JALA 3O7WA 5DMXA 1LI7A 1EQUA 3EMVA 3KOMA 2DHCA 2FWJA 3LCUA 3OD5A 4NJMB 3PFHA 1Z0DA 4KZKA 4NONA 5SICE 1BJKA 1YS6A 3R8CA 3UA3A 2AZDA 1Q92A 3ORYA 1PZFA 3FOAA 4BJ1A 2IOYA 5DNUA 1S2NA 4GBGA 3RKUA 4QE3A 4B40A 4LOKA 5CD1A 3AP1A 2EJBA 1L1EA 5AQEA 2VF8A 2O1XA 3UMSA 4W8HA 3HBFA 4D82A 2V8BA 5CDSA 3CTMA 1G6Q1 3U26A 1CR6A 3W2FA 3WDLA 4YAUA 5EIXA 3ZGZA 2WTMA 1ODSA 3IHKA 4BB9A 1YBAA 3DE5X 4HQRA 4RZ2A 1TLLA 4XM2A 3UG7A 4J0QA 3VDQA 3U6BA 2B8WA 1R0LA 9ATCA 4POOA 3SKVA 4RAOA 4U7HA 4X8OA 5HM6A 4XE5A 1EXMA 1F8YA 5KSOA 4UJ3A 4OO3A 5ELXA 4L4XA 1Z5NA 3RT7A 1ZJ6A 1IEVA 1Q0QA 4N18A 3H83A 1GKUB 2SICE 4DM7A 1N8KA 1OZAA 5DIFA 4EVSA 1SC6A 1DKNA 2VP3A 1EX6A 3GEBA 4QEDA 5E3JA 3X1ZA 4C0HA 5T6BA 1D4ZA 3TECE 2QX9A 4J6FA 1UKAA 3P0IA 3K70B 4CDNA 3P32A 4FDUA 2XB4A 4TZ0A 2BGUA 4R8MA 3U1BA 1YI8A 5BN1A 2BAGA 1GD1O 5FD8A 1X92A 5BO5A 2J0QA 2FX5A 3A3PA 2LKDA 4IYRA 4CEIB 4HPXB 4KIJA 1H8HA 1XNQB 4DLSA 5FI5A 2XITA 3CZ4A 1RXUA 2IXFA 3FGPA 1PW7A 1PS9A 3NHZA 4G24A 2IS6A 1DS6A 4WBNA 1K8YB 2HAEA 1XQ6A 1CB7A 2QUIA 3T3GA 2HMYB 4MVJM 3OCZA 4DC1A 4JVMA 3L7NA 4TKVA 3QF4A 1N32B 4IFBA 3EISA 5IHPA 2IS1A 5TF4A 1XAIA 4AICA 1YB6A 2CHUA 1W0JA 4R01A 5LN1A 1QDUA 1Y0BA 3AHJA 4AN1A 1BNCA 3DTVB 3T35A 5EPOA 2HNKA 1DV1A 4XJSA 4MEBA 1MPTA 4CG2A 5AESA 4XTCS 2JGEA 4DIKA 4OK5A 1MJFA 2FN4A 4LZNA 5ALZA 5IC5A 3UK0A 5IVKA 2FRXA 2GJ4A 4BAZA 2QWXA 3O4FA 3T1NA 1VPTA 3B8EA 4JP1A 4N0EA 4HYYA 1JDSA 1ZM7A 2I4OA 2FMFA 3D2LA 2VDMB 3ESXA 5ED0A 4YQEA 3GEEA 3ZEAA 4H1UA 2PGOA 1XALA 2J0EA 2R2AA 1XWFA 2B7CA 4RZUA 4C4RA 1VCIA 3LVBA 4Y9DA 4IIYA 2H0QA 3S2SA 3OAAD 5LNK6 3MA0A 5L3RA 3NKVA 1M10A 1FLNA 1CUIA 1RHMA 4KQCA 3M3PA 5G1NA 1PAUA 3IAS6 2CNWD 2LNDA 3CKMA 3RRJA 3U09A 2ODNA 2RAUA 2Y0DA 4RZ3A 1CUVA 1KY5A 5FTLA 1XCGB 4PNZA 3PXDA 4K05A 2WD7A 1V4BA 3ZBPA 3VGPA 4I4TB 4DLWA 5FEUA 2I4LA 3I8SA 3TBFA 4YMSA 3FKSD 1PO7A 5CNKA 2ECQA 3M2PA 5T5QA 3UMRA 4JYAB 2NTEA 1EFKA 1Q84A 2IDZA 1PEDA 2ZAYA 4UU1A 4WVLA 1VE6A 3A9UA 3EIOA 2FWIA 3V46A 3PE4A 3GOHA 3AERB 2PWYA 2EW2A 1LK7A 4D4HA 3EIWA 4DN6A 3QKIA 1DIBA 1GLNA 1U7WA 4Y6RA 1QFMA 1UDWA 3LX8A 1J2YA 3PC8A 4O4LA 3GZJA 1DO0A 4KWIA 5JSZA 2HA5A 1SD2A 3DAFA 1S9DA 3EXIB 3B9RA 2AC2A 3TLGA 1IOWA 4B3GA 2EBHX 2GASA 1U1EA 1Q91A 1SH7A 1MCZA 3HLYA 5A0VA 4PLVA 4HB0A 1ONBA 3ETCA 4LXXA 5CDFA 4IQFA 3T9DA 3JYPA 4RS4A 3AC0A 1LNSA 1ODFA 1PHPA 3K70D 1A9TA 3JZFA 3LQRA 3AI2A 4FFDA 4HDRB 3EMKA 1PFWA 1RM4A 5EGSA 3JWGA 2HA6A 2N1MA 3L46A 1IG3A 5KJCA 4M1SA 5HG0A 3V42A 3ZWYA 5HRCA 3JARB 5AUQA