3DUWA

Crystal structural analysis of the o-methyltransferase from bacillus cereus in complex sah
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
220
structure length
220
Chain Sequence
b'MIETWTAVDQYVSDVLIPKDSTLEEVLQVNAAANLPAHDVSPTQGKFLQLLVQIQGARNILEIGTLGGYSTIWLARGLSSGGRVVTLEASEKHADIARSNIERANLNDRVEVRTGLALDSLQQIENEKYEPFDFIFIDADKQNNPAYFEWALKLSRPGTVIIGDNVVREGEVIDNTSNDPRVQGIRRFYELIAAEPRVSATALQTVGSKGYDGFIMAVVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-methyltransferase, putative
molecule tags Transferase
source organism Bacillus cereus
publication title Structural and functional insights into O-methyltransferase from Bacillus cereus
pubmed doi rcsb
total genus 85
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3duwA00
1VL5A 3G2MA 5HFJA 2PT6A 4CTKA 5C9ZA 3M6VA 2IP2A 3EVAA 1RI2A 3JWIA 3ORHA 3FUUA 1L9KA 3LKZA 1UFKA 5CM2Z 5FADA 3UA3A 3P2IA 4EVIA 1NW6A 3KPWA 1ZGAA 3KPYA 1NW7A 2JJQA 1Y8CA 5LQRA 4QVKA 2OB1A 2PX5A 4HG2A 3LDUA 3CC8A 5CVUA 2ZW9A 1TW2A 3AXTA 3EMDA 3G88A 4GBED 2QYOA 2P7IA 3OZTA 5B1SA 2P8JA 3FTEA 3TM5A 2GPYA 4WXHA 5EMMA 5EMJA 4KDRA 2IGTA 3SXJA 4AZTA 3NVKI 1B42A 4PYLA 4QPNA 3EGEA 4YV2A 3MTEA 4C04A 1QANA 3KQSA 2DPMA 3I53A 5DT2A 1OR8A 3UA4A 1D2CA 2PY6A 2VS1A 2PSSA 5LQAA 2P35A 2C7OA 2HR1A 3CJRA 4FSDA 2CMHA 2XYVA 3OZSA 3C0KA 1WXWA 3KPVA 3CVOA 3HNRA 3R3HA 1ZG3A 4PGGA 3UJDA 4EKGA 5K0JA 3KQYA 4RTRA 4OBXA 5KQRA 1VP9A 1SKMA 3PLAE 1BHJA 2PX4A 2Y1WA 3HCEA 3JWGA 4RTNA 1IY9A 2UYCA 3D2LA 4IV8A 4YUWA 2H11A 1VP3A 3ME5A 4OQDA 3DLCA 4QQKA 5F2NA 3R24A 5CUQA 1JG2A 2ZTHA 2ERCA 1EJ0A 1WXXA 1R8YA 2V7EA 3AY0A 3KQVA 3PB3A 5LQUA 2ONZA 2IDKA 5E1BA 2N47A 4RTJA 4KIGA 5F2OA 2QY6A 2P7HA 3RIEA 2AN4A 4OA8A 1PRYA 1ZHFA 4HGYA 5K0BA 2AOXA 2GA9A 2AVDA 3AWIA 3UFBA 5E1OA 3LDGA 2GH1A 5CIYA 2Q41A 4F85A 3DR5A 1WY7A 2VDVE 5E8JA 1SQFA 2HWKA 1N7JA 2AN5A 2JHAA 3B5IA 4GUAA 4KIFA 5GM1A 4C07A 1X1DA 2UYQA 3BXOA 1WG8A 3CKKA 2BR5A 1QAMA 2G71A 2ZSUA 3KQMA 2BM8A 3NTVA 2YR0A 4YUVA 3G2OA 2NP6A 2IPXA 3GNLA 3FPEA 4Y30A 3RODA 3IHTA 5K8VA 3HCCA 4CXMA 1FBNA 5CCBA 1JG4A 1NT2A 2P3OA 4A6EA 3UJ7A 4RVFA 5BP7A 5K05A 3DOUA 2YX1A 3QOXA 3A7DA 5ICGA 1D2GA 4HSGA 4EQZA 1AV6A 1I9GA 4QDJA 1R74A 3PS9A 2ZULA 2B25A 2ZIEA 3BGDA 2V74B 3LBFA 3M6UA 5K0NA 1FJXA 2G1PA 3EVBA 4FP9A 2I9KA 5T6BA 2BM9A 2ZBRA 1AQIA 3FUWA 3A4TA 2PT9A 3V97A 4ER5A 4OX9Y 2EX4A 3TLJA 1VE3A 2KW5A 4KRGA 4CTJA 4E2WA 4E2ZA 1QYRA 5FQNA 1IXKA 1ORIA 3O4FA 3MHTA 1O54A 3E7PA 5E9JA 1G6Q1 5LSAA 3FTCA 1SQGA 3TM4A 1R6AA 1EIZA 3G89A 3LHDA 3FPFA 3HVJA 3PT9A 4X1OA 1YZ3A 1UIRA 3EGIA 4HC4A 3HEMA 3P71T 1NBHA 1X1CA 3B3JA 4ER0A 1O9HA 1TPYA 3FPJA 3OPNA 4U7TB 4RTLA 2ZFUA 1X1AA 5CVVA 4PIMA 4YUZA 5EVJA 4NECA 2EJTA 3JWJA 4RTKA 3P9NA 5LQJA 2PWYA 2O57A 5JR3A 4RSRA 4X60A 4YV1A 4C08A 3OU7A 2IIPA 4P7FA 3NMUF 3MTIA 4ISCA 2ZIFA 2OYRA 5FWAA 3LGAA 1ZGJA 1N2XA 3MCZA 2ZBPA 3BKXA 3OCJA 3DP7A 2ONYA 4IKPA 5HIIA 5JUWA 3U81A 1JQ3A 5EEGA 5C1IA 4ZTBA 2NP7A 5FCDA 1KPGA 3EPPA 2PJDA 2H1RA 3BWBA 2AOTA 5E1DA 5FQOA 3SR4A 3X0DA 4BLWA 2UYOA 2C7RA 4PGHA 4GC5A 1R8XA 2I7CA 1NV8A 3GJYA 1XDUA 5DWQA 5FUBA 4DQ0A 3GCZA 2PXAA 2ZIGA 3M70A 1V39A 3O31A 2G8NA 1JSZA 3FTFA 2VZ9A 1NE2A 5EZQA 3UJ6A 3R9XB 3A27A 3KR9A 3OU6A 4V0QA 1BC5A 3REOA 2FRXA 2NXCA 1KHHA 4A6DA 5K0EA 2ZWAA 4QDKA 2AS0A 2IFTA 3DXZA 4YV0A 3NDIA 3UJ8A 5EQJB 10MHA 4KDCA 4YMGA 3NWBA 4AZWA 2XVMA 4GOMD 4BLUA 5IKMA 2CWWA 5D1NA 3ERCA 2HNKA 2XYRA 3GRRA 3OE5A 2GAFA 4RVHA 1L3IA 1RJFA 1VPTA 5ICEA 1WS6A 3P9KA 3VYWA 2Z6QA 3P2EA 4P7JA 2OO3A 4PYKA 3QOWA 1VLMA 4PYOA 1VIDA 1H1DA 3QV2A 2PVCA 4M7RA 2YQZA 3LCCA 3OFJA 5DM0A 7MHTA 1EG2A 4M36A 2EJUA 5CVJA 2IH4A 3HA5A 1G38A 5ERGB 3LL7A 4FR0A 2AOTB 4IWNA 3R0QA 3HA3A 3TKAA 3GRVA 4HGZA 3G5LA 4BY9E 1D2HA 3A26A 3NWEA 5DLYA 3PX3A 4DF3A 2HMYB 4DMGA 4HH4A 2IBTA 1F3LA 3C3PA 3B3FA 3KQOA 2GB4A 4PWYA 5DTRA 5KS2A 5HZMA 5EPEA 4RVDA 2AOUA 3E23A 1SUSA 4PYQA 4R8SA 3R6TA 1L1EA 4POOA 4AZSA 4IV0A 3I58A 1JR4A 3FYCA 4KW7A 4MWZA 4Z2YA 5K0CA 3TPZA 5K0GA 3SVZA 3VC2A 4M37A 3KR1A 4RWZA 5EHGA 4C06A 4E33A 2B3TA 3DH0A 3P2KA 2B78A 4ER3A 3FZGA 4V0RA 2AOUB 3P97A 2EFJA 3FPGA 3TQSA 2VDUE 3UJ9A 3PTAA 4G56A 3BWYA 1R00A 3GIWA 2FK7A 2OBFA 3DMFA 3ID6C 5EKXA 4F86A 2ZCJA 5ICFA 3OU2A 2R6ZA 4X41A 4MTLA 4H0NA 5GWXA 1NV9A 3HVIA 3DULA 3GXOA 5T67A 2YTZA 3PFGA 2FCAA 2VDWA 3ELDA 3GGDA 3I64A 3M33A 3M6XA 3SGLA 1ZKDA 3MGGA 4GC9A 4GF5A 4XUCA 3MERA 4RYLA 1UWVA 3CJQA 3LBYA 3HCAA 4ATNA 3LECA 5DM4A 2UZ4A 5E1MA 4PNEA 5HIKA 1MJFA 3IEIA 3K0BA 3G8BA 1N7IA 1FPQA 1XJ5A 3EMBA 5FULA 4PYJA 5KYGA 3EEOA 1QAQA 2BZGA 4R05A 2PGXA 4K6MA 3DMHA 4PCAA 2VP3A 1INLA 2YUIA 3LKDA 3P8ZA 2C7QA 1JTFA 3G2QA 2OY0A 1Q0SA 5HOQA 3T7RA 3B89A 1NW8A 5EMKA 4FS8A 2UYHA 3DUWA 4PIPA 3VC1A 4XUEA 1EAMA 4HRAA 3S68A 3GU3A 2EG5A 2IH2A 2ZZMA 1JG1A 3E8SA 2I6GA 3IV6A 3TR6A 4ER6A 3UBTA 1P1BA 3KQWA 3KHKA 4DA4A 1L3CA 2NXEA 5K0LA 1I4WA 2PX2A 5U4XA 3M4XA 1M6YA 5DRTA 9MHTA 4R6XA 3FYDA 5DX1A 5GIPE 1NW5A 3F4KA 1IM8A 1QZZA 3AJDA 5E9QA 3T7SA 2XYQA 2CKDA 2Z6AA 3AXSA 1U2ZA 1SUIA 4X61A 2JH8A 1JG3A 4LWOA 1O9GA 1G55A 5KVAA 4E32A 3BUSA 4L7VA 3SMQA 4C05A 3GRYA 3FRHA 4QTTB 5LQNA 2PBFA 3C6KA 1XDZA 2LD4A 3SSNA 1XTPA 1XXLA 1HMYA 5EGSA 1JSXA 5FTWA 2NXNA 3A25A 2ZZKA 3I9FA 5LQCA 1F38A 2NYUA 1ORHA 3MCTA 3NJRA 3TOSA 2H00A 5EZSA 2FYTA 5EIWA 4XUDA 4FGZA 5HEKA 4GOLD 3C3YA 1G8SA 4QPPA 2PX8A 3G7UA 3P9CA 4R6WA 5CVEA 3SSMA 2FK8A 1X19A 4Y2HA 2G70A 4FT2A 3SM3A 2BR4A 1YUBA 2R3SA 2ZWVA 3GDHA 2JHCA 1SVUA 4PYIA 5DXJA 3FUVA 4MHTA 2OB2A 5DTQA 3KQQA 3DTNA 4OQEA 2P1DA 1RJDA 3MB5A 4BP3A 1KPIA 1RJEA 5FHRA 4CWAA 4EMSA 1AF7A 3P9IA 3OZRA 1KP9A 1VBFA 3A7EA 3DXYA 2PV0A 4JXJA 4AZVA 1DCTA 8MHTA 4PYMA 3BWMA 3UZUA 1KIAA 2CL5A 4ER7A 3HCFA 3TMAA 3ELYA 4RTOA 1NW3A 3UJAA 1RI5A 2PWPA 2ZZNA 4E70A 1KYWA 2IH5A 1KPHA 3THSA 2O07A 5H02A 3RW9A 2OZVA 4F84A 1EJ6A 3BGVA 2C7PA 1AQJA 2AZTA 5DM2A 4DCMA 5CD1A 3FUTA 4QVGA 1RJGA 3I5UA 5EIFA 3HTXA 1I1NA 3THRA 3CJTA 3PFHA 5D1HA 4X63A 3HM2A 3MAGA 3T7TA 5K03A 5FA5A 2PXXA 3Q87B 3HVHA 2OPBA 3G5TA 3KPUA 3EGVA 5BXYA 3PVCA 5P8WA 2FHPA 2YXDA 1MHTA 1ZQ9A 3BWCA 3NDJA 1Z3CA 1YF3A 4B17A 4XCXA 4RVGA 2QE6A 2JG3A 3LX6A 3NVMB 4CKBA 3LCVB 4GEKA 1XDSA 4U7PB 3HVKA 1BKYA 3BT7A 2PKWA 3PX2A 4LG1A 2CMGA 2ZVJA 3UJCA 3V8VA 4E2XA 2AVNA 5EMLA 5ICCA 2IBSA 3MQ2A 5BW5A 3KR0A 1M6EX 2NXJA 1R18A 2Y1XA 5E2AA 3EVDA 2P40A 1DUSA 4RTMA 3EVFA 3LDFA 5DX0A 5FA8A 2HTEA 3NW9A 4HTFB 5EG5A 1YB2A 2YXLA 4FT4A 3KR2A 5DTMA 5DX8A 5E9WA 4YUYA 1XCLA 4EKIA 3HCBA 2QRVA 3O7WA 3TKYA 5E8RA 4P7KA 1P39A 2AR0A 4QQNA 2K4MA 2ZLBA 3H2BA 4EK9A 5HIJA 3BGIA 3LPMA 3IYLW 3KU1A 4OBWA 3GRUA 2WA1A 5K0FA 2E5WA 5CCXA 4LWPA 2P3QA 4LECA 3B7PA 5LQKA 4WVLA 3EVGA 3HCDA 1JTEA 3ELWA 2JHPA 2XVAA 3UJBA 1TW3A 2PXCA 1NKVA 4FSXA 4E31A 2O05A 2QM3A 3G8AA 5FHQA 4O29A 5HILA 2YXEA 4KWCA 5HIMA 2P3LA 4C4AA 4P58A 3G2PA 4CKEA 3WSTA 3FPHA 2NNWB 2ZBQA 1DL5A 2ESRA 3FTDA 3HA7A 2BH2A 1FP1D 2AN3A 5EOVA 1G60A 2XBMA 3M6WA 3JWHA 1XVAA 3DXXA 4GOOD 5DPMA 5M5BA 4BP1A 3SX0A 4YUXA 3LSTA 4PINA 5EC8A 5G02A 4PCLA 3KPJA 4UOEA 1SG9A 2AOWA 4RTPA 5C0OE 3CGGA 1M0EA 1QAOA 3GWZA 4AX8A 3ELUA 4DM3A 2FPOA 4QTUB 1P91A 1YFJA 2OXTA 3TFWA 3SSOA 4KVZA 4DKJA 2ADMA 3DLIA 4HTFA 4MQ4A 5T64A 3ER9A 1PJZA 3UWPA 4E2YA 4RTQA 4DCGA 5DSXA 2PLWA 4DZRA 2A14A 5GIOE 3EVEA 2YVLA 1L3BA 2OKCA 4PONA 2BR3A 3LCUA 4PYNA 3K6RA 2O06A 4YMHA 5GOZA 3OFKA 2QRVB 1VQ1A 2HV9A 3CCFA 1XCJA 5E2BA 3L8DA 1X1BA 3ANXA 5FWDA 3EEYA 2WA2A 3KKZA 4M38A 3HP7A 2F8LA 1RI4A 2GS9A 4P7GA 4R8RA 5DXAA 2WK1A 3CBGA 4BLVA 5K09A 2P41A 1KXZA 1G8AA 2ORED 1KR5A 3DMGA 5DRYA 3FUXA 1RI1A 1Q0TA 3KQTA 5IH3A 1RI3A 1JQDA 2B9EA 2DULA 2G72A 3BKWA 4RTSA 3ER8A 3OE4A 1HNNA 4MIKA 5DM1A 1BOOA 3EVCA 3KQPA 5EEHA 2I62A 3C6MA 3EVZA 4E30A 5KQSA 3Q7EA 3B3GA 5F2KA 2O0LA 1T43A 1KYZA 3GRZA 4GOND 3E05A 1P1CA 3FRIA 3T0IA 1JQEA 2JH9A 2AOVA 2IDJA 3GO4A 5EKUA 4CKCA 5GM2A 5LR6A 5EHIA 1YZHA 1YFLA 4RV9A 1WZNA 1FP2A 4GQBA 4RX1A 1NBIA 3VSEA 4C03A 5K01A 3TRKA 4OA5A 2Z6UA 5MHTA 4FZVA 3BZBA 5GP1A 5DSTA 2GLUA 1EQAA 5BW4A 4AUKA 5CVDA 2B2CA 5GINE
chains in the Genus database with same CATH superfamily
2JVIA 3P4YA 4ND8A 3CRZA 4CTKA 1YGPA 4KLCA 4B3RB 4PN3A 1E9AA 2F6RA 3M5DA 3WOHA 1T4MA 4C7BA 4QUKA 1UDXA 1I4LD 5IS2A 1B00A 1M2GA 4O0LA 5E6SA 4XLZA 4WX2B 5EWMB 2X15A 3WBKA 5C34B 1E2IA 3PKJA 1TD1A 3GUYA 4I2NA 4JC4A 3T3HA 2H1FA 2DFNA 5KUTA 3ZE6A 5FWXA 3LGXA 3OZTA 5FR1A 3AF0A 5TMEA 1NU6A 4DDMA 3T41A 4Q34A 3JSXA 2F1IA 1NXSA 4YS6A 4PAWA 2COUA 4WZAE 2IYTA 1HE5A 1I2ZA 4GYWA 3HMKA 3QELA 4Q1AA 4FSDA 3H5TA 2XXAA 2O1WA 4B3XA 3BXGA 3UJDA 4EI2A 1MTOA 2VQ3A 3HNRA 3R3HA 4EKGA 3IPCA 1AHPA 3SVTA 3O73A 1EVIA 1TC1A 4ZZ0A 1TTHA 3A9VA 4K2HA 2J3HA 5HF9A 1JRLA 3SJBA 2DHRA 4OSOA 2IF0A 2PRZA 4LOKA 1ADGA 1XMSA 2B2NA 1NYQA 2RGNA 2UXCB 4FHEA 5KSPA 1R8YA 1WNTA 2YY5A 4GBGA 4Y9UA 2OVFA 2IDKA 2IU0A 3HQ4O 2PWBA 1E59A 3OZCA 3OEWA 4JP5A 4I3HA 3CH5A 5KYWB 1QO0D 4LVNA 1PRYA 1ZHFA 3VNQA 3W7VA 5AKJA 2PBLA 1O6FA 5DNEA 3R6LA 3PWKA 4MUNA 4F85A 1FSPA 5JAPA 3IHLA 4BBJA 2Q6IA 5BWLA 2ASVA 4FXPA 1CX9B 1H3EA 4B2IA 2FDCA 2MSDB 4C0WA 4KVAA 4MGYR 4XFJA 3P96A 2ZPTX 4BNGA 1QAMA 2FJPA 3RCBA 1TM7E 2Q3DA 3O94A 4RZHA 1S8OA 4YUVA 3SS8A 3HB0A 1WSDA 4Q3EA 3GH3A 3UENA 3ZI7A 3UIEA 1B8NA 5CFOA 1X8KA 2MDTA 2W6JA 4BO2A 3LWZA 3SHVA 4KR6A 4RETA 3L04A 3OIUA 5K05A 2CJPA 4Z7JA 2O20A 4IEIA 3BILA 4AKHA 4EA9A 2ECFA 4J7AA 1VIAA 3ORFA 1KRWA 1PHRA 2PK3A 2VJKA 2OGTA 4LBVA 3E5MA 3AEQA 3RIXA 4C3ZA 4LHZA 2G4CA 4B0PA 4EUNA 2Y3IA 2CL6X 1PJAA 2HC9A 3FNGA 4FP9A 2A9OA 2R97A 3LRTA 4M9SA 1U65A 1KY5A 1O6CA 3GGOA 1W36C 3SR0A 3EVTA 1W88B 3JAWB 4WBXC 3T5DA 4JDUA 3ROPA 1SB9A 2JGEA 3JYNA 2E37A 4HMQA 4KYUA 3MJEA 4JEHA 5FX2A 4MUKA 5E9JA 4B3FX 1YR9A 3F96A 4MLZA 4CEJA 3H84A 5IVIA 1TXGA 1TFRA 1QQ7A 3G89A 5DEIA 4QU0A 4Z53A 4QUGA 1Y1PA 1FYFA 1H23A 1RRFA 2G77B 2Q5EA 2WJAA 3CFYA 5FWYB 4BX0A 2R1VB 3CLTD 3Q8WA 4OLBA 3U6KA 1KI1A 3OOWA 1Y7PA 1Z9BA 1SOVA 2C0CA 2GZRA 3QXHA 3BL5A 4YDHB 2QENA 2F8SA 3C5VA 1BRMA 1XTUA 2A3RA 4OM8A 4PM4A 1F2UA 3TXYA 3AVOA 1W0JD 4Q01A 4RE6A 4D6PA 4OXXA 5J2UA 1DVRA 1PN3A 4GP6A 3DV0A 1GDHA 4JP3A 5FPSA 4CQMD 3JVIA 1BS1A 3VM6A 2IHTA 1V1RB 2IHUA 4I3GA 3WK9A 3PD1A 4PXSA 5CGZA 3L3BA 4KIWA 5D5QA 1WD5A 3JQ9C 5EA2A 1Q7RA 2JW5A 4P4GA 3SAJA 2QT9A 1XTRA 2IOQA 4JBHA 5LA6B 2ZIWB 5ALZA 2X8LA 1JQKA 3DDNA 5PNTA 1CQJB 1ZI8A 4BO5A 3LP6A 4C7XA 5JSFA 2OGSA 4EUKA 1DOHA 1I33A 1RXCA 1XD9A 1JVSA 1YJ5A 2NTJA 2O0JA 2XCQA 3AILA 3HRHA 3DD1A 1PEKE 3QFFA 2J5BA 4QYMA 4AY5A 4YX9A 3DB1A 5BNWA 4XQEA 3LG2A 1NT4A 2PH1A 2CMDA 2FR1A 4OYHA 3D1LA 1JBKA 2I4MA 1YWGO 2F9FA 1JSZA 3K9HA 4L5YA 3RIYA 4MUIA 3SF0A 1RKVA 2CL7X 1BGWA 2Q7DA 1RDFA 3DMRA 2I54A 1O94D 1SOMA 2QTWB 4MVJP 4LS3A 5AIAA 4D96A 1NBOA 4PO3X 5F98A 1XV5A 3PYLA 5K0EA 1AO3A 4NYJR 3ZDBA 3ZDEA 1QONA 2IFTA 2J48A 3BWDD 3JD4A 3IP7A 4HQ0A 4JSYA 4WNAA 2NUPB 1CR6A 3L1UA 5TQ2B 1PX0A 2F67A 5JCJD 3I6IA 4YMLA 4JIGA 5DU2A 5D1NA 1JU3A 4E70A 1G1MA 3IO3A 4TUYB 5FA6A 3ENZA 2O3QA 4LQCA 2WF7A 3RIMA 3ZVRA 5CAEB 1E3LA 3H9JA 4WFQA 3AL3A 4M8KA 4Z1MD 2Z6QA 2X22A 2PQ2A 4UTZA 1B73A 4Y18A 2P6NA 3MWEB 5AM0A 2OCKA 3C3DA 1A98A 4KR3A 3AY7A 1GILA 1UBCA 3FMIA 1TAHA 3B2EA 3KYDB 2ZRBA 4JP8A 4NXMB 2IH4A 1ISSA 5JAQA 3F0TA 3RB8A 2ZYVX 4Y1FA 1E4EB 4HFNA 4NBSA 4PHTA 4PSUA 1PK8A 4IGIA 4YQEA 4DILA 5JCXA 4IWNA 1GEEA 1HFKA 5D00A 3TMKA 3V2GA 4ASUA 4EENA 1MAHA 3PX3A 1RNLA 1WM1A 3BIFA 4KE7A 4CZ2A 3A1EA 3OLQA 4LXQA 1F60A 1QHXA 2AT1A 3DMNA 5CNMA 4B83A 2CDRA 4CMEC 4NAVA 4PCUA 4DEXA 1YVDA 4BNWA 2OTCA 2OE2A 1U0FA 1TO6A 4HAXA 2ODAA 3DKVA 2PO5A 1J8QA 1IWOA 2Z56A 3GJXC 2PLAA 3KVRA 4N12A 1QQ6A 4U7GA 3C7DB 3EHEA 4UE2A 1ZS9A 4ZRMA 3SF8A 4R9SA 4Q9NA 2VPZA 9LDTA 1ZSVA 2DUNA 2VH5R 3MF4A 4B7XA 5JRZA 4W6QA 3EA5A 3U7HB 5ICFA 5JNWA 1R0LA 3CNOA 3NHFA 4S1TA 2XNDD 3QX7A 4B3BA 4DWWA 4HJXA 3HVIA 3GXOA 4ZO4A 3STUA 3T3OA 2AJBA 2W6CX 1CP2A 1U9YA 1OLUB 2WWRA 1EVQA 3ELDA 3PFGA 3RC9A 1RKUA 1VE9A 2BGNA 2HA7A 1XCOA 1ESNA 1VKOA 4KQXA 3QJYA 4PZZA 3D7RA 1FLNA 2FDXA 4Q00A 5K0ZA 1U0EA 1R8SA 3GHYA 3NJ4A 3TSYA 3VPSA 1G63A 4ATNA 1PV2A 3DM5A 4QWMA 2J9RA 2ZQ5A 3ABOB 4N5NA 1MJFA 5E1MA 4K0RA 2GPJA 3IIIA 2IX9A 4D92A 1FPQA 1RRCA 2P5UA 1BSVA 3OCWA 1APBA 4Q7MB 2VSYA 1MEJA 3FE2A 1SIBE 4K6MA 3AI7A 5LYJB 4YFVA 2JIBA 1CY1A 5GJVC 1MGOA 3VPBA 3C6QA 5A4DA 1YJQA 1YMQA 4TQGA 4V0SA 1O3YA 5BMVF 3TGLA 4ARBA 5HDBB 3EODA 3ETLA 4BN5A 4UOZA 1YRWA 3JX9A 4ENRA 3KE9A 3Q9SA 4OLFA 3KQWA 2UZAA 3JWPA 1C9EA 3L7IA 2G40A 4BVFA 3DXFA 3H2JA 3LRPA 5HQ3B 1G16A 1K3FA 3K5WA 2NO7A 2JC3A 4R6XA 1DAOA 5EQFA 1U8YA 5GTDA 1QPZA 2DG2A 3RVBA 1D1TA 3ZY3A 4E46A 5JROA 1Z7EA 1ZVKA 2XYQA 3BEOA 2I2AA 1NZJA 1CY0A 2MSWA 3E61A 1E6LA 3OA2A 3ZNNA 5J4KA 1G7SA 3KVVA 1AZLA 4I1SA 2GXQA 3TAXA 3TS1A 4LWOA 3L0BA 1ML3A 3DDZX 1JNYA 3TSZA 4Q4CA 4Y1GA 2VCHA 1FJGB 4QECA 4WN9B 4E3WA 3MJFA 2WHQA 5TY0A 4XVUA 1JG6A 1I4OA 2BT4A 1T26A 2VEDA 4ARCA 1HMYA 3PCRB 1WZUA 4IIEA 1NNSA 5JARA 1B15A 4UAJA 4OQ4A 3H99A 4UUAA 4D9JA 1JEDA 1BIFA 1NX6A 1SXJD 1IAVA 1J8DA 1YR3A 2DQKA 3EHDA 1X7XB 4XX1A 3SJAA 1TU3A 4AU1A 4BQPA 4EM6A 4D4HA 1DIHA 2DPLA 3G5UA 5K5EA 3RRFA 4GSKA 1RPJA 1FFXA 5LDDC 3RSFA 1IY8A 2OUIA 3CKYA 3R9WA 3HO1A 1PZHA 2WYIA 1NVUQ 4PZEA 4NF2A 2I6SA 1OV6A 2XQIA 3DTNA 1QYVA 1QS0A 3MB5A 2BSXA 1GRQA 1GFSA 1FDOA 4HDNA 1EM6A 3KALA 1VBFA 3ZLVA 4OJQA 1RRGA 4NMHA 1CR4A 4WK0B 4TMZA 3UZUA 2V6JA 2SKEA 3HUDA 3UJAA 3UUFA 4QGBA 4ZPXA 2TMYA 2PGOA 4MPDA 4ROSA 5KYNA 3HXTA 1Q84A 1QF6A 2P9CA 3C97A 2AZTA 3BTOA 5EXDA 4DCPA 9ABPA 1I7DA 1SVSA 5SYMA 2HN9A 2ZRMA 3H4VA 3R4CA 5FOUA 1I1NA 4ZP1A 3CN7A 4H77A 4EQ6A 3FSEA 1SZJG 1E3IA 3LKVA 4BQNA 2FX3A 1H9BA 3FBGA 2I1LA 2P0EA 5KDLA 4U7WA 2Y1EA 4JFRA 5TT1A 1G59A 2XWQA 3K2QA 4YP0A 3O1HB 1CHDA 4D9BA 4AWAA 3VISA 4QQFA 4EZBA 5KEIA 1MZVA 2GDJA 2Q0XA 3OMLA 1D7OA 2YJZA 4FLMA 5TMDA 1QIJA 2NSYA 3DKPA 4JFAA 2W6QA 4L0DA 2I2WA 1O5TA 1XCBA 2JG3A 2GA8A 2H4FA 3DAYA 1UBSB 1Z8FA 3T9AA 4DLNA 1BKYA 2CLSA 2C9YA 4INAA 5LP6A 1M5RA 2AVNA 4EATA 5L3QA 5IUJC 1PSDA 4YRNA 5I4CA 1CQIA 2AMVA 3DUFA 1HFWA 3FZYA 4N5IX 4R83A 3MXTA 3RFTA 1FXSA 2BHNA 3D7LA 4IVNA 1OMOA 4OH7A 4UUNA 4TXNA 4EBFA 5I9LA 3DT9A 5J4YA 5JG7A 4A0SA 4MV9A 1FUUA 5F4ZA 2X6QA 3LUKA 3OWHA 1AKYA 2YVUA 3G6WA 3JQCA 3OUTA 4P7KA 2K4MA 3UUWA 5AVKA 3BRWA 1Y80A 2QTGA 3AINA 3WLIA 3QU4A 5CCXA 2BTOA 3FVQA 5IYZB 2D5BA 4DV1B 4X24A 3E0XA 3H7AA 1IZ8A 1ZGHA 1RRVA 3RC2A 2VP9A 4EI7A 5LVAA 4WOPA 2VBFA 2XVAA 2H1HA 3ZC3A 3BXHA 2GCEA 3P4UA 2R44A 1UP4A 2NPIA 2VPXA 3ELBA 4ZDKA 1KEKA 5AJTA 3ZJTA 3P52A 2FWNA 2B1QA 1KDTA 4JEUA 4JJ6A 1T0PA 2XV1A 3GLHB 2Y66A 3JU3A 5KPDA 5FI3A 3ZV5A 1EFTA 3A6ZA 3FPHA 1G3UA 1NY5A 4LCEA 4M1SA 4NE2A 4A0HA 2CV2A 4ZCLA 1JJBA 1P7WA 5FDFA 1XNQB 4NOJA 3IESA 4I50A 2IHYA 1FFBA 3QVJA 3RVNA 1XQ6A 3SX0A 2LCQA 1CU1A 4DG5A 3DZKA 3NOOA 2WLTA 1SEVA 2C2YA 2VWGA 1KF0A 1P31A 4PLHA 2REQA 4WNAB 4ZQHA 3VVMA 4BBPA 5KYXA 2ZDGA 1JKMA 2ZGVA 4L8VA 3NWPA 2V7GA 3CZRA 4FVTA 4S3MA 5BT8A 3RUEA 2BTQB 1RXWA 2YFYA 4ARUA 1LI5A 1U02A 1Z4QA 3TQCA 4KQ9A 3PE6A 4JLMA 4PX5A 3HKEA 1G21E 2IIVA 3QWHA 1NTOA 3IMFA 1FBTA 3SK0A 2C8JA 1VDMA 5LUAA 1SUBA 2NZ2A 1GFIA 3EVEA 3BMOA 1Q3TA 1DDGA 1XEWX 1Z5OA 2FPIB 3V4FA 2XTMA 4DV4B 1XNHA 4L4UA 1UM8A 3VKVA 1GTJ1 2P2YA 2QRHA 3IIKA 2XB6A 5B55A 4DV5B 2HV9A 4G5GA 3EIOA 4CG3A 4AYTA 2LKCA 3WR5A 4NC9A 4U6SA 3PHLA 1UXJA 2TYSB 2JJMA 3S2GA 4XWWA 3UMSA 1VHDA 3AKYA 1P5JA 2C2GA 2Z5LA 2OZLB 4UAVA 1KAMA 1G17A 3A3KA 2ZBGA 4DLXA 1GZ7A 1LD3A 5AW9A 2EAUA 1ORWA 2CN1A 4YEDA 4EF4A 1YC5A 1ACJA 4TRMA 5DYGA 1NR7A 3EH2A 1P1FA 3BE5A 2R1VA 2ZJ7A 3W1WA 1E92A 3GRZA 2HQ1A 1Z15A 1QQAA 2R60A 3K0FA 4DN6A 2UV8A 2ZCVA 1GPNA 3HV0A 5CT5A 1ODKA 3GO4A 3H8SA 1UQUA 1OZFA 2YYAA 2M98A 2VJCA 3EZ6A 1RFLA 1F5NA 4TXMA 4CKCA 3VZDA 4RULA 1EK1A 3B1FA 1Q17A 2QSYA 2X0JA 4FWIB 4UKDA 1NNUA 3KRTA 4MRMB 3KTFA 4O2BF 2E4AA 2FUNB 4TQ9A 3PWTA 4UBNA 2ZS9A 1U0BB 4E5UA 5FADA 3PV0A 1ZLYA 2O14A 3WKBA 4TX1A 1K68A 2R87A 3UTDA 4K1XA 3SOZA 4YUAA 2H52A 3SHQA 3KKNA 3VPXA 1BW9B 1Y3DE 3UA3A 5BUZA 3P2IA 3KXLA 3EOAI 2P9QA 3ECCA 1IJFA 5B3JA 621PA 4OHOA 1Q21A 4DA0A 5KNCH 3MSCA 1PEDA 4GVPA 3AQ4A 3PSHA 2OV3A 2X4DA 4YPOA 5HM8A 1IBLB 3UGQA 4RADA 3AKCA 4TTSA 1VB3A 2RHLA 1TW2A 2FE4A 4GBED 5K8UA 4G9BA 1WIWA 4LRUA 1JAXA 5B1SA 3TXXA 2I66A 2XUQA 4PF1A 5H81A 5AW4A 3QWBA 4JL8A 3QYJA 4HBGA 4LZAA 4QO8A 5FWYA 3AR2A 1VRWA 4TN1A 1D4ZA 3K16A 1AUPA 4URZR 2F1HA 1T9KA 2VS1A 2WNSA 3WYBA 2FSSA 4S0ZA 5AVOA 1K89A 2C7OA 4RY8A 1UBHS 3CJRA 5JSYA 5IARA 2CMHA 5BOSB 4ZARA 1HX7A 2R6DA 5K0JA 1Y9AA 2DBQA 2XUKA 1E1RD 3I9JA 5BN4A 4KO2S 4IOLA 1NM5C 3ZCPA 4ZN6A 1S2MA 2JFQA 1VLJA 2FF5A 2UYCA 3W78A 4F97A 6CHYA 4FYMA 2FR8A 1CQZA 4Q1VA 2I4IA 2CD7A 1CYDA 3MIZA 1SJ9A 2IWRA 1ZFNA 3AY0A 5LQUA 4ALKA 3IDQA 2ONZA 2D74A 3T0FA 1CVLA 2JRLA 1S4QA 2QM0A 3NHBA 2HT6A 2QZSA 3PQ8A 2P7HA 1CDOA 1DI0A 4GPZA 4MW9A 2PX6A 2PE5A 1GFZA 2GA9A 1NP7A 1XN4A 5A7HA 1MF7A 4DNPA 2Q41A 1HDOA 3I2IA 2YH2A 4BLRA 1C1DA 1NLFA 2GYUA 3HG7A 1J06A 1TVMA 3B5IA 1PT5A 3RTCA 3T0GA 3GAZA 3DT8A 4HLUA 4KGZA 4DLKA 5AVZA 2P30A 1ZMOA 1XDWA 2A7XA 2IYSA 3O8OB 4IO0A 5EUCA 1IY0A 3HJAA 5ELLA 4FKZA 4GM0A 1CS4C 1G64A 1Y8QA 3BORA 5DHFA 2QD3A 1HE1C 5K8CA 1ZRSA 1I51A 3FTNA 3HCCA 1T9GR 5ERXA 3PD7A 1JE0A 3VO9A 3AESA 2L17A 1HLDA 1W94A 2GRJA 2X7JA 1L7RA 4YCAA 1DRWA 3RU9A 1H22A 2PFKA 2ZVDA 3ZDXB 1DPFA 1LPMA 2V54A 3IVGA 3ZDRA 4KODA 1J24A 1XQXA 3OX1A 2GHQA 4YAOA 2Y99A 2GEKA 3A4TA 1XEAA 1Z38A 1P61B 1AY0A 3THOA 1QX3A 3W8RA 2O59A 4FFWA 2H4JA 2DR2A 3SLKA 2VHQA 4RA9A 3HRKA 1NR1A 3H1BA 2XI4A 2JFVA 5KNCD 1ECLA 3R5HA 1OWOA 2H59A 1SBCA 1SQGA 2GBFA 4H9GA 1U7OA 1R6AA 1EIZA 4XGQA 5DN6D 2PFGA 3FPFA 3NIGB 1TOAA 4NDAA 2DLCX 1DC5A 1A27A 1USIA 4H7HA 1G9SA 1T0JB 3RPEA 4D57A 2VATA 3O8QA 2GUWA 2HEIA 3Q7QA 4OIFA 2X8WA 1SXJE 3MTJA 3MINB 2I99A 2O2DA 4RZQA 1B93A 2RGWA 3BCSA 1XQ1A 2W2LA 3DZGA 3MMXA 5T4EA 3SJUA 1VG0B 1QKKA 4KLAA 4G5SA 1LDYA 1TYDE 4KFSA 1QCYA 3OQHA 2HIMA 4U6QA 4DLUA 4NV1A 5ARBA 1ZVVA 1SVKA 4C3UA 6REQA 4JI2B 1MW9X 3C39A 3GFSA 3P9NA 2PL5A 5J43A 4K6GA 4W8OA 4ZCMA 4I4TB 2H1SA 1E9VA 4GICA 4ZDWA 3V42A 3IBCA 2EW2A 3H2YA 3W5IA 4AUEA 5I8PA 1F4VA 4L6IA 4O2AB 2IIPA 4L02A 4Y6SA 2XEXA 1NVXQ 4ISCA 1WB9A 3DEFA 2PSFA 4REQA 2Z9DA 1EFVA 1N2XA 3A11A 4J0JA 1MOPA 5ALXA 3TDKA 2CHEA 5COQA 1R15A 3AEYA 5BO5A 1Z5PA 3IMCA 4AJHA 5E7QA 3EPPA 3RYIB 1BG6A 1KZ9A 4QASA 3BWBA 4BGUA 3MAAC 4RKFA 3HB9A 4TN5A 2CLOB 4DSOA 2HA0A 4UC0A 2R4QA 2C95A 1MTZA 1THMA 1PUJA 2A9VA 1IG3A 4UUBA 3GCZA 5T6BA 3UMVA 4G5FA 3W5SA 3WNBA 5HHTA 4Y2PA 4L28A 2V4UA 3FTFA 1RYEA 2WVGA 2WWTA 2HAEA 3H2GA 2Z43A 4PQYA 3UWKA 2GZMA 4EMUA 1YASA 2WMOB 4FMCB 4KQJA 2VHVA 3DSRA 3G1WA 3CQ9A 1JAHA 4V0QA 3IT3A 3DR3A 3CLVA 1GGFA 3MINA 4L76A 5I9SA 2AS0A 3WMEA 4YV0A 3A6JA 3ONWA 3ZY6A 1V11B 3I52A 5FH9A 2AD5A 4N18A 4AZWA 2E4ZA 1H1LB 1F8XA 4I1OA 4B82A 1TKCA 1KAQA 3GN2A 4EHDA 1R64A 4BQFA 2QN8A 1SBNE 2WTAA 2EERA 3CLRC 3WFZA 1QH9A 2X0RA 5A02A 3M8KA 2JEYA 2OQRA 1T2VA 1T8PA 3EB9A 2W9XA 2ZYGA 5ESRA 4Q9KA 4QAQA 1IZYA 2AOTB 2JD2A 2VWHA 3HA3A 4ETWA 4X8LA 4XDYA 3VO2A 1GCGA 1Y4SA 1A4RA 5EKTA 2OLEA 1XLUA 2W2MA 4QOGA 5AJZA 2HBZA 421PA 4OL9A 2M6RA 1V6CA 4AZ0B 5A0VA 1V37A 1E1CA 2WIJA 3E8XA 4QLAA 3F7MA 4GLBA 4OXQA 1GM5A 4JYAB 1GLVA 2PRYA 2ZR7A 4XEUA 4FNOA 4OHWA 2Q5IA 5LIRA 2EC5A 1MJGA 3WYEA 4Z49A 3IBGA 1II9A 2C20A 2W2LD 1TK3A 1F6DA 3VPGA 2UZ0A 4XWYA 3JXEA 3F8TA 4RWZA 4IBOA 5EHGA 1CUJA 2X7HA 2HA6A 1IZZA 3IKLA 4BDTA 5JD5A 1GQFA 1PZNA 3HP1A 4G9GA 4BPBA 4BCCA 1Z68A 2Q99A 1NVVQ 4PG7A 1OASA 4JLUA 4DM4A 4F6RA 4JOQA 3DMFA 2C61A 3N7AA 4DTCA 2O8EB 4QDXA 4TRNA 2P9HA 4OYLA 2CBZA 3ZEIA 2OCGA 3NT2A 4NMLA 1KFBB 1F2TB 3LQ2A 1QIIA 1PFWA 1P4GA 4X00A 1MUUA 1YVPA 1QLWA 4OHXA 2PS1A 3K7EA 4WNIA 1A72A 4ZDIA 2ZBDA 3BVPA 5JAZA 3RRYA 3SIPA 2KBFA 2JIQA 3GUVA 3GPBA 5JO9A 3ODPA 4E5SA 4D98A 4DJFC 3CTMA 5D86A 5CIQA 1IQPA 5IRCD 1RZUA 3BXZA 3H0KA 3G8BA 3L0YA 3H2KA 4JJEA 5B64A 1KEZA 1TU0A 3PVSA 4MVWA 4WA8A 4AB1A 1F6BA 4M9CA 4XDGA 2OFXA 1GN8A 4Q1FA 2V8OA 4JQYA 1X8JA 5EKSA 5K3SA 4TZ6A 1PJQA 1RMQA 2ZXEA 4KGDA 3KEQA 5EMKA 3HWWA 1KY4A 1E6KA 5F7XA 4QM7A 1IY1A 1JG1A 3GLRA 1UBRS 4JHXA 3UBTA 4LQLA 3WRXC 5BSVA 1ZH8A 5DP1A 1I3MA 4ZHQB 5KMGA 4S1NA 3TOZA 1LEHA 1SHUX 2QYSA 3K30A 2TMDA 1TJ4A 3LC2O 4HLCA 2WM9B 4MMZB 1QZ3A 3IDFA 5KOIA 3S8MA 3PUZA 4ALIA 2GAIA 3NV7A 3JYHA 4H7DA 2VK2A 4ML3A 1C4OA 3LF2A 5EESA 1SHKA 2F3SA 4A15A 3K94A 4RGQA 4JI0B 1EGVB 3B85A 1IUKA 2KPOA 3ABRB 3H04A 3NVDA 5K3CA 4WBNB 1QIMA 4L7VA 1F2DA 1UOPA 4XIIA 4CNBA 3ADBA 3FJ1A 4H6XA 4Q1BA 1BMTA 3FDFA 2AFHA 3T5BA 3NT4A 2GKOA 3PNLA 4PGAA 2OAP1 2FQWA 3A25A 3E3NA 4UEQA 5K3FB 4MWGA 4WZAA 4Z3DA 4FI3C 2OHJA 3UB3A 1S7CA 5CDHA 2Q9CA 4YO7A 3TZBA 2I6FA 3CLUD 3ZBPA 3FOBA 4LKRA 1PJBA 4P98A 1KYIA 5DE3A 3KHUA 1H4QA 6AT1A 1DAEA 1PNQA 3HRIA 1Z8NA 2V6MA 3ICPA 1N5MA 4WESB 2GESA 2XOEA 2COEA 3TNDA 3O4VA 1KKUA 3D0RA 4Q19A 1T0BA 4WN9A 4XUGB 3RAPR 2NV2B 1J22A 1Y48E 4OCZA 3T9EA 1LRJA 4BKPA 1ONNA 2P1DA 1KPIA 2A78A 3TQRA 1L1RA 1OI7A 4TWJA 5B5SA 2BUAA 1Z0KA 2Q1YA 1W85B 3UV7A 5JJIA 1PTKA 3LC1O 4ID3A 1OD6A 3OX4A 1HQCA 2ZYRA 3NO4A 4KQKA 1KI2A 4JB3A 4M1QA 3TIGA 2O8CA 3K32A 3B51X 4QBFA 3BTVA 1JFSA 5JI3E 4DCMA 5CRIA 3FZNA 4ND4A 2WABA 2ZJZA 2DQYA 1FNMA 2KE5A 4MMXB 5EIFA 4CKXA 1AS2A 3ZNOA 3MCWA 1E1QA 3WZ2A 3ISVA 4WRRA 1V7PC 1D4OA 2QF7A 2YOGA 8LDHA 5FYQA 1Z06A 2WTEA 1N3YA 4G9EA 1WUHS 3DUFB 4KRXA 4V0MA 3WICA 2OFOA 2EF0A 3S1AA 5B3JC 5IDQA 3HI6A 5P8WA 4PW0A 5TPWB 1AIPA 1ZK4A 1W46A 1HYEA 2A0XA 3LP5A 1H05A 5CA1B 2KWIA 5K0TA 1YF3A 2VJDA 2XVYA 3BFKA 3F3YA 3OZIA 5JEEA 3ASVA 4HAOA 2YHIA 4QBIA 3LX6A 1U1GA 3CMMA 3VKGA 1M8GA 4U7PB 3TRHA 4DRZA 1CQWA 1U7WA 3LJKA 2P9GA 2QUJA 1J7JA 2R2GA 2P77A 3I04A 3RC8A 3OIVA 2ZUEA 4UCWA 2NIPA 1YVUA 1GOTA 2EGGA 3L0SA 1D1PA 1DUSA 2C3UA 2RHBA 4GVLA 4HATA 3ASZA 1K9SA 4QIHA 1GTMA 4HTFB 3ZHUA 2GRUA 3IB3A 3KR2A 4ITVA 1ODJA 4DR3B 3HCBA 1NBMA 2E4YA 1U28C 1VGQA 2CXUA 2QRVA 4OK6A 1FS5A 4P3KA 2V03A 4XB1A 1WSBA 1P39A 3L9XA 4NDZA 1C14A 3UJHA 1OF1A 4QYSA 2FZWA 3K6SA 3HU1A 1Y6GA 5A9TA 1G8FA 5EYPB 2DC1A 4EG6A 5JWOA 3N2YA 1N2CA 4Q37A 1VLHA 2CGEA 1MNQA 2GNPA 2W22A 1CQIB 1ECCA 1DPGA 1S3SA 3RUCA 4JVOA 4IRXA 1OPRA 5J2UF 1FP6A 4KNWA 1F2VA 5K6AA 2W6ID 5CT8A 4KXFB 4P58A 3LWDA 2DUMA 4HDRA 4F9TA 1LBIA 3D8TA 3E2MA 3OKCA 3DBHB 2H2FA 4TS9A 3W5DA 4RUKA 1EFUA 3A58B 3K0HA 1CUIA 4GI5A 2QE7A 1N4DA 4IHAA 5K6RA 5EJMA 5BN5A 2UVPB 2DWOA 2Y77A 4ZD6A 4AX8A 4LJKA 3GRAA 1PD1A 2JNWA 2OD9A 4DM3A 1VMAA 1RD4A 1AD2A 4EHAA 2WJPA 3UT6A 5FNZA 4N49A 3LNTA 5BWNA 3OE1A 2YW9A 1TA0A 1S6YA 3OOJA 4BMVA 1JEYB 1RCUA 3SNHA 4ZT5A 1QO7A 2APJA 2PSEA 3CX4A 1FMCA 4CQLA 1LV8A 3HR7A 3P19A 5GIOE 3GLHE 3K1TA 1Q50A 3PNYA 4LA4A 4QUIA 1P3Y1 1QDUA 3DEJA 1T1JA 5E3JA 2Q9AA 1P2FA 3GHHA 1MABA 2DFVA 2E4VA 2FI1A 2GEBA 4HYQA 4CLEA 5BNZA 1JDSA 3QKUA 3TE6A 4BECA 2E85A 2V5UA 3U44A 2PCJA 5FWDA 4EGSA 3NHSA 4KJZA 2ZAIA 4M38A 3IAM1 4F3YA 1BEUB 1RI4A 2IZ5A 2H6EA 4OJYA 1U3TA 4RE5A 1EEXB 3L8YA 1VBKA 4II7A 5HXAA 4RIEA 1Z07A 4GMGA 2Z2XA 2G0AA 3SHTA 5CLJA 4L74A 3KYIB 1CYEA 2UVQA 2WG2A 4YTEA 3KOZA 4OTZA 5TJHA 3BMCB 4PSVA 1WA5A 1J5XA 1Z6TA 2OBBA 2YZNA 3B3GA 3B48A 4CG1A 1D4FA 2YJ4A 4P3PA 4G0XA 4DMMA 2X0IA 4KAJA 2XVXA 3NYRA 4C29A 3I0MA 4NAUA 1XK7A 1ZY2A 2N42A 3HUUA 3NH9A 1H8HA 3PNOA 4TQUS 2VRNA 4J0IA 5EGNA 1NDQA 1N3BA 3UJPA 3MMPA 3SQNA 2C5AA 3R5KA 5CVDA 1K8YB 1QGAA 3Q9LA 4UUOA 4G1EB 5F76A 4ZYUA 1EB9A 1AS3A 3RS7A 2R8PA 3G2MA 2WVHA 1PLJA 5CNJA 3Q3VA 5ES4B 1R3UA 2PT5A 2NU6B 1JEQB 1ZD9A 3AR8A 4KI0A 4HH3C 1L9KA 4N6GA 2WUFA 2YHIB 1WXIA 3KPWA 4HEA6 2JJQA 3E9ZA 2X0DA 4TRRA 1OIVA 5LQRA 3Q72A 2YKGA 1DXQA 1NXVA 3FF1A 3ESXA 4JELA 1QKIA 5F21A 1P0PA 3AY6A 2QZ4A 3W5AA 3FMFA 3GRCA 3I62A 2ISSD 2ZW9A 4B6EA 3TTXA 4RTJA 1TC2A 3AHFA 3LIPA 1WF6A 3PLRA 3AEXA 1XVTA 2XTAA 3BA6A 3QTBA 4I9GA 4ZVNA 3T15A 2HF7A 2RFLA 1AN9A 3TZQA 4YV2A 4K5QA 4AMVA 4GBMA 5DBEX 3K9BA 4C04A 4EY4A 5F3RA 3SS9X 1ORRA 4TKLA 1E8NA 1LDBA 2C4HA 1ACLA 1R0ZA 1UEJA 5EE9A 1S3FA 1Z45A 3WX0A 1UC5B 3CEAA 2XYVA 3R5XA 1IMOA 4N5LA 1XG5A 3C48A 2GEDA 3KPVA 1MB9A 1QFJA 4GBJA 3WL3A 5LN1A 4JI8B 4J0HA 4CYMA 2VDJA 4RTRA 2I29A 1L7OA 2JGDA 1V95A 3MHPA 3ZZ1A 1YU9A 3NC1C 2O7RA 1CUBA 2Z9BA 4K9KA 2W2PA 4KBFA 4QXMA 3V8QA 5HJ2A 4AZ3A 3AG5A 3STTA 3GQBA 4EHBA 3OM9A 1C7RA 3PB3A 4FW8A 5GV8A 1U8ZA 2M9MA 1DZ3A 3AEZA 3AI1A 4KWTA 4NTZA 5JATA 3OIFA 2UU9B 1XXHB 2PD4A 2I6TA 3QU9A 5IXJA 3LUJA 1Z74A 2AVDA 4CMHA 3AWIA 5K0BA 4IJQA 2VYFA 2Z4SA 2VP4A 1SG0A 3K2BA 1M73E 3GP3A 4R40A 1V5FA 3M34A 5KYWA 2PKQO 3LQKA 4I4CA 2CYAA 3T5AA 3FNRA 4QGAA 5B1HA 1QLHA 1FP4B 2DSTA 2SHKA 3GFVA 5DM70 2BM8A 3QX8A 4ZAVA 3AKZA 3IS3A 3ETGA 5F35A 3W8FA 2A9KA 4UTXA 1ABEA 4NK5A 5BP7A 1U3UA 3SFTA 4PHHA 2FPGA 2ZJ2A 3RU2A 1D2GA 1ZJ5A 1ZMRA 4CQLB 3OPYA 3WDLA 2Q4TA 3MWLA 4HGQA 3D43A 3IVMA 5B1IA 3ZW8A 4WZZA 4KR2A 2XXAB 5FL7A 4G0YA 3HDGA 1SUDA 3JALB 4IX1A 4EVSA 4FCVA 1HDEA 1Z37A 3BRSA 3EEIA 1GYRA 3PXXA 4PHCA 1P3JA 2O7NA 5CPFA 4ZVKA 2PGIA 3WMFA 1O1YA 4ER5A 1WXDA 3ADKA 1XQVA 1YTLA 2C2HA 5C18A 2CNWA 1R0RE 2H2IA 3O4FA 4B7UA 4NJEB 3Q8KA 4IDBA 3ZWKA 2IXBA 1ISIA 3G13A 2PRIA 2H4XA 3FRJA 4Z9XA 3ZHVA 3EMKA 4X1OA 2QMUA 3EGIA 4I8DA 3KYJB 5ALHA 3P45A 3SCZA 4LOIA 1JKFA 3GJRA 3WGMA 1GLNA 1L4UA 1NRXA 3PRKE 4GE0A 3UK0A 2GILA 4GI1A 3ZVLA 4GMKA 3FPJA 4BN4A 2DWCA 1NF3A 3OJXA 3ONEA 3OP4A 1WDWB 2W6MA 2GTPA 2ZRKA 5CVVA 3TTWA 5K20A 3VZSA 3TNYA 1NSFA 2EHDA 1XTVA 4NJOA 3MGAA 2QV0A 3LPCA 1TZJA 2ZYIA 2OYCA 2DHCA 4L73A 4DRXA 3UCXA 3KZCA 3FHLA 2TMKA 4IIUA 3BHJA 3NC0C 1NKSA 4KQGA 4FU0A 1PIWA 2GZAA 2Q5HA 4U5QA 2MJLA 2QG9A 4HVLA 3L7JA 2PUDA 4C4YA 3OCJA 2ZBPA 2ZI9A 4O1HA 1BWQA 4TTTS 4WH0A 1L8OA 1ONSA 3E8MA 2R85A 1ICEA 1ZUIA 3ZHTA 4KPUA 4B3IA 4M99A 3PHIA 5E1DA 2IQ5A 4FYPA 4PSAA 3RRMA 4FOPA 4RIGA 4E88A 4F4UA 5BQ5A 2Z08A 1JPNA 2ZIGA 4HMOA 4Z6KA 1LS6A 2WSBA 2ORIA 4Z99A 3S2EA 1KQPA 2FR0A 3AETA 3HJHA 5GGXA 3U13A 4DDHA 3LBNA 4FGKA 1P72A 3KR9A 1JIQA 1U2GC 2I8LA 5HPYB 3IJ5A 2FRXA 2C9BA 4A6DA 3LV8A 1E0KA 2ZIVB 3MLBA 1DKQA 4DFDA 4CG0A 3KLPX 3QGMA 2IHKA 4KDCA 1XE3A 2A1UA 2ZTMA 4UUQA 5TT0A 4XRGA 2WHRA 5IKMA 3KJNA 2QLFA 3GLGE 4DLTA 2ADFA 1E6CA 1P19A 2HBRA 4AF8A 1XLWA 2I7XA 3CUTA 3EF1A 3EF0A 4TL9A 4Q3NA 3VYWA 4KLZA 3R41A 3SLRA 1ZKMA 3FVTA 1S1CA 1VIDA 1QQ5A 2J30A 3DWFA 5KTMA 2NZVG 2PVCA 5DNAA 4F7DA 3ZNPA 1IXSB 4P3YA 3TDNA 2I2DA 2IEZA 3C3CA 1BHSA 5DM0A 4W5TA 1VJ0A 7MHTA 3AEQB 3ZOKA 1DFIA 1T2DA 1YZQA 3JVUA 4NV0A 1Q19A 2JFNA 2UYYA 3C74A 1DX4A 1GKIA 3LC7O 3QSGA 3KB2A 2WJJA 5C80A 5E6RA 2C1EA 3W8DA 2GYVA 1P2UA 3GJ4A 2XOKD 4JWKA 1VMDA 5EUQB 4EW2A 2CNWD 4UQOA 4ZCQA 3BGOS 3W3ZB 3ESBA 2PSJA 3BIXA 1I2AA 4WOKA 3UTCA 4QDOA 3B3FA 4HQNA 3CX8A 5DTRA 3WLEA 4BMPB 5AW3A 5KS2A 3C87A 2B6HA 1PG5A 1UMDA 1R88A 1ZRMA 5G0WA 5DBOA 2RHRA 1KE2A 3TLMA 4LHEA 3GLFB 3HZZA 3KKKA 1NXWA 3Q2IA 4TTVA 2QMOA 1EGHA 4KW7A 4MB6A 4MWZA 3FNIA 4O4LB 3FY4A 4F3TA 5BRNA 1AKWA 4IQ0A 4MRRA 4EARA 4O02B 3PEVA 2WMYA 4TV9F 4WLEA 4E33A 4NOLA 5KHLB 4AK9A 3V55A 4BEJA 3ZIAA 5CP8A 2J9YB 5B4VA 1XP5A 3DP9A 1D7AA 3SZGA 1GNTA 2PIDA 4AJEA 3EIUA 4IFEA 1C7EA 3GIWA 3A6GA 3HYNA 3DNFA 3OZAA 1IOLA 3AOEA 4F86A 3ZDDA 3ZD9A 1GPJA 1Q6ZA 3FHJA 4FZRA 4J4TA 4WL0A 3TW8A 2J41A 3OZWA 4RCVA 2JBWA 1V2HE 1QE5A 1PL6A 4GIBA 1A1VA 3VR2D 1WHSA 2HBQA 1PVVA 3VSBA 4DT1A 3QLEA 3I4FA 3PGKA 3I72A 1XL1A 4RK6A 1NVMB 4TLMB 1W19A 5I7UA 2OCXA 1I9CA 3AYZB 3EIXA 3KNZA 3ORRA 4GC9A 4JAVC 3BWVA 2DQ4A 1GR0A 1L4FA 3FOCA 1UWVA 3IBSA 4KIJA 1ISHA 2HSDA 2AJ8A 3OETA 2GTIA 2CNNA 1R16A 4HPJB 3WB1A 1BS9A 1NW4A 1ZOSA 3WA6A 1G19A 1J8MF 1H3FA 1N7IA 1OTHA 2VJBA 1XJ5A 2I4OA 3GUZA 3HEAA 5KYGA 2C4TA 4KR7A 1E32A 1CRZA 5IDVA 2CCJA 2NG1A 2ZIZA 3H1FA 4CT4B 2DERA 2YYZA 5BY2A 2JJ2D 1XRMA 3IPAA 1Q0SA 1ZNWA 2CD9A 3OQJA 3T7RA 4EDHA 5ECDA 5HQ3A 1NW8A 3EPHA 4NATA 1XEXB 2E2WA 5FR2A 3F90A 5CIWA 4CL2A 2V0NA 4HPXB 2D2FA 2QUKA 4M86A 4O4JF 4RD1A 4XUEA 4EYKA 3IQHX 1OKKA 4JQOA 1CT9A 1XX6A 4LQDA 3SEZA 4G4IA 5HE8A 2D1YA 3I2HA 1N8SA 2VN8A 4LNUA 2QN3A 2ZWMA 1ZK0A 5JZ9A 5FWNA 2C4NA 4IXTA 3Q98A 2GZDA 3D54D 1Z4LA 5FAKA 5LU9A 5ES3A 2AEFA 4MYTA 5DX1A 3PXGA 3GYBA 2IP4A 2GLTA 2Q3LA 3WG9A 3HKDA 4H35A 2AEEA 1QH8A 1XAJA 1PG0A 4L8FA 1T2AA 2OCDA 1QHNA 4C4ZA 1JG3A 5ADWA 1N7GA 5IJAA 2YY6A 1T91A 2CUKA 4RF3A 1I4TD 3FNEA 3SXUB 2QG4A 2AI1A 5C31A 2JGDB 4QTTB 4JXXA 4OMCA 3KX2A 3NP9A 4QREA 1B41A 1OFIA 4DZTA 3O4IA 1XZGA 5KYYA 4EPXA 1KWKA 3URKA 3A6DA 3I9FA 4H16A 4RPLA 5L3SA 1R7RA 3PICA 4ZIRB 1D03A 4EZIA 2HMAA 3EDYA 3ROQA 4M7OA 2Z5VA 4GSYA 4C7OA 1GPUA 3TW4A 4QU9A 1CR1A 3LY9A 3LSYA 2FZEA 3P9CA 3IVRA 5HMMA 2FK8A 4RY0A 2VDQB 2I33A 3FKSD 4U9UA 4LGYA 1V16B 4C76A 4EEZA 2B21A 3SQLA 5IXSA 5JXHA 1KORA 1HI9A 4JBIA 1Z4OA 3AB8A 4UVHA 1ESEA 3IDOA 1SUFA 1M1YB 3DQZA 1IMJA 3OHPA 4QICA 4CF5A 4LDZA 1EFRD 2BFEB 4AJPA 4ZC1A 7YASA 3NR2A 2G4VA 3K20A 3EFHA 4MKZA 5AK4A 2NX2A 4YY3B 4A5SA 5F3DA 2D8MA 5D3ZA 3B2QA 3Q1LA 4P2BA 1H2AS 3UM9A 4XWKA 1DADA 2EFDB 3PI6A 5IHXA 3AVPA 3VX3A 1GWNA 3CNLA 1YBMA 1KAGA 2OZVA 1XMOB 1QF9A 1AQJA 3R77A 5CBKA 4OI0A 4URFA 3R3VA 2VAWA 5DMXA 3ZHQA 1E4YA 1QO9A 2AD1A 3M89A 5F1OA 5KJCA 5D1HA 3OZVA 4X63A 4DADA 2QP3A 1U3FA 2ZAGA 2NV0A 5HA5A 4J6FA 1JDVA 1DWOA 2XOKA 1ECPA 3BIJA 4GH5A 3SEFA 4HI0E 3D8RA 4HN4B 1G4AE 1T3HA 1E63A 5HIAA 1Z3CA 1EUDA 4DY4A 4BEWA 3PFCA 2DHEA 4ZT6A 3ETCA 1RABA 5BORA 1YBHA 4I9UA 1MRSA 3I39X 4H1UA 2V9CA 1L1FA 2WHYA 1PG2A 5CLHA 2JAHA 3BJRA 1I36A 3NC4A 1M72A 2K6GA 4MQFB 3GP8A 1R9GA 1K6IA 2V7WA 3LT5A 5IFLA 3TD2A 2IBSA 3F4BA 2XY4A 5AHXA 2DPHA 4Y0NA 4ZOCA 3TW0A 3V2HA 5DH9A 1ILWA 4L6CA 5ALPA 2N46A 2JCYA 2IXDA 5CCEA 2G1UA 4HUQA 4P4LA 2ZU6A 1NMXA 2QLTA 4J3JA 4L5JA 5E9WA 1JHZA 4QEZA 4M9UA 5DGDA 1USUA 2OUKA 5K8LA 2CDCA 3ISTA 4LF4B 1V7ZA 3RJTA 1KGDA 3CVWA 4JI7B 4YA6A 4HWGA 3GGSA 1KYYA 4P8RA 2PWZA 2YRWA 4HFMA 2GT1A 1GTRA 1IYZA 521PA 3WAGA 3EVGA 2PQ6A 4D0LB 3J7AC 1JLHA 1P29A 3TCNA 4DNOA 1UBNA 3R0JA 1GPBA 3QJGA 5FHQA 3RVQA 2C4VA 1I2MA 1UPTA 1B74A 2XRMA 1KOGA 4MITA 1FYDA 5IN5A 5C7LO 2I4LA 4A4DA 3BCRA 4DABA 2QZJA 3SHOA 2M2IA 1TGVA 4Q4HB 4CKEA 1B23P 4IJ5A 3PUYA 3L82B 1N2BA 3KTAA 4ZU6X 4FX2A 1G60A 1WUJS 2IIBA 1E7YA 2DH5A 4N7JA 3TUJC 4BP1A 5A4JA 5IANA 5M5BA 1H3NA 1IEQA 3G0OA 2I4TA 3HJTA 3N5KA 4NENB 3B70A 3TBHA 4TWZA 4DJ5X 4L4RA 2H7XA 3OI7A 3L8MA 2HUNA 4INPA 5KCZA 1DFHA 4E5PA 5HUJA 5DWDA 2J45A 1A9XB 2B1IA 1KDYA 3VDRA 5L3VA 2OXTA 4YWHA 3K0EA 4IJKA 5SZHB 2GRAA 4CIYA 4EAAA 3RWMB 1CIVA 4XOIA 1PI3A 2NUAA 2NU9A 5JPDA 2A8YA 5CH8A 3NJ8A 4ZV7A 1I24A 1HFJA 1YACA 3MWYW 3NEAA 1KWGA 1TKAA 1YJBA 5JNVA 1SAYA 3KOMA 4Q7KA 4IS3A 4PONA 2BR3A 1DKPA 1K3TA 2GZHA 1H4SA 5JNLA 1B8PA 1TL7C 2GK4A 2A94A 2BHRA 2ID4A 3SXPA 1DOAA 3N8DA 1V5GA 5ALUA 4M98A 4NH4A 4FHFA 4UCQA 1N57A 2BISA 3WL5A 4RIIA 4EMTA 2GS9A 2BEVA 1EHYA 2W6JD 4HMPA 4L8GA 1XRNA 4ND3A 5AI4A 4AT1A 1W4AA 2NUTA 5HR5A 4U6NA 4LJ8A 2WG1A 4R1OA 1J25A 1R0WA 3KOXA 4AKIA 4UUPA 3ER8A 3G02A 2ZAYA 3I2KA 4Q21A 3SJCA 1C3OA 1EX9A 1GFWA 3H4IA 3I9MA 2RAFA 2J9ZB 4DUGD 4OXNA 4BV9A 2PZMA 5A03A 3N58A 2P9YA 4B47A 4PGMA 5H3HA 3T0IA 1JQEA 4ZOBA 3TUIC 4JD5A 1JHUA 1Q7BA 4X3OA 5DTIA 4JBXA 3EDMA 4P5DA 2BC9A 3FYTA 2RBGA 3A3YA 2DRIA 3MYYA 2AMJA 4IIJF 4KYTA 1DBIA 1ZD8A 3LO8A 4BTVA 3VSEA 2IYAA 1E3WB 4F2PA 4C7VA 1X7GA 4JS0A 3UMGA 2JK1A 1AT1A 1R50A 3B3QA 5JHGB 1SKMA 2B2CA 2W90A 3A04A 2GVZC 1T6ZA 1IPFA 4IZOA 2VHEA 5HEKA 1RI2A 1XMIA 1J2RA 2PLNA 2Q8PA 3CLUC 4HAVA 3ZYCA 3JRXA 1ODFA 4URHA 2EBFX 3EBPA 3B36A 3LYHA 5KJFA 1Y8CA 3F3KA 2X3YA 4Q7LA 5EUMA 1TLFA 4DSNA 1P9RA 5HKKA 2XGMA 3T9DA 1QHYA 1R27A 5GGYA 4GLOA 3LVBA 5CVUA 1LTHR 1PNTA 2IYFA 3WRWA 4ILEA 4CR8A 4J9VA 4MCJA 3RVOA 2X5XA 4IEEA 2EXXA 4XX0A 1VJRA 3ZV6A 3M9WA 5CTJA 2P4HX 5EMMA 4Y0VA 4JLVA 4DLAA 3KSDO 3QY0A 3ZI4A 5JECA 1ULAA 1G6OA 4YT4A 2P9BA 3NIDB 1LBEA 2JZCA 4B76A 3IGFA 1KI6A 1WBJB 2JI4A 5KU7A 4J76A 1T5BA 4YRQA 3V5NA 3AFHA 4OF4A 4LBZA 4F38A 5TQ0B 4BFTA 1GNSA 4BO9A 2GO1A 1XVVA 5JSZB 1P73A 3H1AA 1QYXA 2PT7A 1JPUA 2CLLB 3BGWA 3MJHA 4OQLA 1L5LA 4CI9A 2GN6A 1KS9A 4IV8A 2FFRA 1J0XO 2BF4A 1M3SA 4PWZA 2I76A 4R0NA 3S5UA 5KX5F 3ENVA 1DKUA 3DBLA 2EQBA 3TOCA 4GQIA 4CUKA 2ABWA 2ZJ1A 4UBJA 3OD1A 3EZXA 4LZNA 1QOZA 4NU5A 4UAGA 4CIXA 3OLVA 3FOEC 2AOXA 5JFTA 1ZUNA 3GDFA 2AKYA 2WSLA 3C5WP 3QVGB 1COZA 3UF0A 1S8FA 1LWOA 3N3BC 2GBIA 2VDVE 1Y8QB 5E8JA 4FEEA 4WOBA 1N0VC 1WXFA 2JHAA 3MT9A 5JYEA 1L4BA 3MWJA 4KQ2A 1NP6A 3GA0A 4X44A 2CNKA 4XM1A 5J5AA 5FBZA 2J6BA 2UUPA 1DAKA 1ZC4A 3JD2A 4XX0B 1XT6A 4N0PA 1YOVA 5LB4A 1C1DB 2ZRJA 4X84A 2H5IA 1GARA 5K8VA 3BDAA 1Z5ZA 2X9LA 1ZH2A 5HG0A 4ILKA 1YQEA 1GSAA 4YQZA 3GVCA 4TGLA 2O8VA 1JDZA 4EZEA 3OSUA 2AXNA 2HXYA 3AUXA 1N9GA 1E79A 4AMYA 3ASYA 3ESAA 1CSEE 3I1JA 4TMWA 3QX3A 1K6MA 1AQIA 3UUEA 3HY6A 1Q1ZA 2GCOA 2PT9A 4QYIA 5ALIA 5FNVA 1EDEA 5FRDA 5G3YA 3V97A 3WFIA 3NATA 4GRDA 5I7RA 5ILOA 1DBRA 1E69A 5B6JA 4GR5A 4E7PA 1SRRA 2REQB 4HGPA 3KJQA 5ELXA 3FTCA 4DOMA 1R1DA 3IKJA 4OSEA 5C51B 1SOAA 2P2LA 4Q7EA 3T9BA 2C4WA 3Q7SA 4HC4A 4LSMA 3W4IA 3OQ6A 1N6HA 3RUHA 1N2OA 4DQDA 1MFZA 1JMYA 3LX5A 1UCFA 1C4WA 2ODTX 2P2CA 3GDGA 4ZAGA 1EUDB 2BEKA 4KC0A 4DRYA 1UMCA 2Q27A 1EFAA 5DFAA 2V3VA 3MCUA 4YUZA 3ZE0B 3KWLA 3T1TA 2VXOA 3QPWA 1IBMB 4M0MA 1GG9A 3F6CA 2GF0A 5I7FA 4KLNA 4DNFA 3ENWA 3GJ8A 1TPZA 3F46A 4H4EA 2B37A 2HK6A 1ZI6A 4HB4A 4A2QA 4P7FA 4F2GA 4OYRA 1M1UA 3DVLA 3NMUF 1X7DA 2IW1A 5CFZA 1YFLA 1IE3A 2BUCA 1STOA 2WWYA 1R6TA 5LMUB 3CM0A 3GFPA 4OXKA 1LF0A 4Y9SA 2QRLA 3GJSA 5A4KA 3SS7X 2BZ1A 3VOTA 4QGHA 2BRUA 4Z8YA 1U7TA 4NRDA 1NIJA 4DMKA 1E4VA 2J6HA 5B36A 5IM4A 3R75A 3UEOA 1HE2A 2DSNA 4HO1X 4JQZA 1O58A 1MXHA 3K9CA 4BJHB 4R3UC 2PXHA 1GQSA 2XJ4A 3PUIA 5EWLA 4KNYA 3K0FB 4R51A 3IMKA 4CKYA 4RK4A 1ATIA 4IZ6A 3EW9A 1XVLA 2RHTA 2FU5C 3UG6A 4JUCA 4EY3A 3REOA 3BERA 2ODWA 2QR3A 3JR3A 1QVRA 1N5IA 2CFCA 4UOQA 1J42A 4K3UA 3AB7A 2A1IA 3WGHA 3P0JA 4RHCA 4DHWA 3L43A 3QW4B 3L8CA 1YMUA 2BVNA 3NFYA 5GZ6A 4RELA 3W5CA 3HBLA 1JLRA 4N0QA 4D8UA 1D0SA 1YB6A 5ICEA 1SC6A 3EZNA 4RD6A 5JDCA 1E7WA 1TT5A 4IO1A 4LHWA 4UDYX 1J8YF 3FD8A 1U7XA 2B92A 4I14A 4QXQA 5C7YA 4E1AA 3MUNA 3WNVA 3TXAA 4EA7A 1P6XA 4XWOA 2GPTA 3SZLA 3Q2OA 1G38A 2FEWB 3B1ZA 5DK6A 2VHCA 1Y7HA 1N8NA 4UW9A 1D2HA 4KR0A 4HB2A 1V3VA 2DPYA 3PGA1 4ND1A 5IM5A 3LAWA 4IRUB 4I1IA 4D3YA 1FNSA 3DEZA 1EFDN 2GXAA 1GCAA 2O6LA 3GFBA 1P80A 1ZYUA 3UT5B 4XSHA 3E23A 4FDAA 1CEYA 4UAUA 3UQYS 3PL1A 2E55A 4LN1A 2NVBA 1E77A 4W63A 4BE9A 3R5SA 5JDIA 5HKOA 1Q1BA 3FR8A 4AZSA 1J1ZA 3EG9B 3WL4A 1X7WA 3TPZA 2Z8YM 3VPFA 1M0SA 1JIIA 1KJNA 4YRFA 4IWYA 4CL8A 1YA8A 3SBXA 2JFZA 3LFUA 3O0DA 4P54A 3N2ZB 3INGA 4OQZA 1DINA 1Z0JA 2FRDC 2AFIB 4HDAA 4JVSB 4QPJC 2X5KO 5HW0A 3TQSA 4S1OA 1V26A 1R00A 2KLBA 2OBFA 3GLHA 3LUBA 3DZFA 4MUBA 4X7PA 3L6RA 4JLAA 4F8JA 4KDFA 2XTNA 3LE8A 5K3DA 4INOA 1DB3A 1PU2A 5I3CA 1OBVA 1H8EA 4MDYA 3S6JA 3DBRA 1E60A 4KWEA 1FRVA 1L4MA 2FLWA 5PGMA 4OAPA 4EJFA 5KYYB 3TG8A 2ZUBA 2BFWA 4TOIA 1E1YA 4BQRA 1AHNA 1LC3A 5K45A 2W8BB 3FCCA 1E3EA 3UGJA 3CZ9A 4GX1A 1LW6E 2FZKA 2IT1A 4IP0A 3STXA 3WFJA 1DJQA 2WKRA 4RD4A 1T34A 3K0BA 4YLEA 4V1CA 2B1GA 2Z0MA 4A2CA 5I6DA 4ZRDA 3VO8A 5ISMA 3HB5X 3IVCA 4H0CA 5AVTA 4QVIA 2JASA 1XZKA 3A8TA 3L7CA 3CNBA 1G5RA 3HYLA 3NTLA 5I8WA 1U1IA 1DQPA 2OORA 3IH5A 4I6EA 5DNCA 5J3JA 1CUUA 1GA1A 1A3CA 1XF1A 2M32A 3KJHA 3LKDA 4HQLA 4ENQA 2O2YA 1OT5A 3P9YA 1J97A 4LHYA 4RSHA 4K6KA 3U7EB 2WYHA 4J2TA 1I0ZA 1U0RA 2PPLA 4HEHA 2XMQA 3C8HA 3ROTA 2PS9A 3JRNA 2LUOA 3RH0A 4W8GA 2ZZMA 1H6AA 2ZU0C 1VLQA 4BGDA 3U61B 1KRXA 1KEEA 1IVSA 4UHHA 3KHKA 1G6KA 3T4PA 4G26A 3Q41A 1X1SA 2HJHA 2AIRA 4S1WA 2HLPA 2IZ0A 4YJGB 3NV9A 5U4XA 4TKVA 1OZGA 3G0BA 1Z12A 1WW2A 3C1OA 1W59A 3GAMA 4CLDA 1KJWA 3I83A 4OHVA 1JH8A 2QVZX 4YACA 4DS3A 2I67A 3MT7A 3SXUA 3KSBC 1GGJA 5JYCA 5KVQA 3CX7A 2OBYA 1M7BA 4NYIR 1VI2A 4TL8A 2ODNA 4ACBA 1QFMA 1X3LA 1ZCAA 3H5IA 5IXYA 5KX5A 1XRJA 4M1TA 2QKYA 5ED4A 1ZSYA 3SMQA 3EQ7A 1YS4A 1M6HA 4WCFB 3F7TA 1ZEJA 2ATEA 1XDZA 3HBFA 3X3HA 5TGTA 1H2YA 2ALJA 4X0EA 3VSCA 1CDDA 3WBFA 4EH1A 1C0EA 2W00A 3CSUA 5AH0A 4EG1A 4MAMA 8ABPA 1K98A 1OW3B 3BQMB 1H9AA 1LZLA 2BKEA 5DK4A 3U56A 3W2HA 2I2BA 5U1PA 4PBRA 4Y1EA 1LWNA 1UQRA 2LPMA 3E5NA 3KYCA 2WWIA 3MOGA 5CVEA 4D4GA 2R1TA 2ZYUX 2IPNA 4X1YA 4Y2HA 3UHPA 3WWCA 2Y1LA 5AM1A 4BO7A 2BR4A 2VDMB 3ANSA 4WCFA 2HO4A 1LBTA 4MHTA 3EIHA 4NY1A 4MI1A 3THXB 3IIMA 4EIWA 1X39A 4K88A 3CUWA 4OFWA 4RVUA 4BP3A 1W6RA 2BIFA 3KT3A 1UKZA 2O6HA 3O47A 3M6IA 3OZRA 1IZ0A 2QUZA 4MQ6A 3PDCA 3AEUA 1SB8A 2I0FA 2P3SA 1E0SA 3GI1A 3Q6NA 3VU0A 1N0WA 3ICEA 2ZS8A 2P67A 1BXGB 3OH8A 1OU4A 1B14A 4V03A 4PPYA 2IH5A 4FCCA 3JW8A 3DFFA 1K6EA 4NS4A 4L8WB 4IIHA 3BGVA 1GTG1 3L1IA 2I3BA 4R1QA 4WOCA 2O7QA 4ZEXA 4UHJA 2XZPA 4QVGA 2G67A 1D6MA 3TLGB 3VR4H 7AT1A 3CJTA 4MVXA 1VL0A 3H9UA 3LK6A 2B82A 4UVEA 1K8RA 3HGQA 4OH1A 2VF7A 1MO4A 5FO0A 4LTMA 2WV9A 4ZV4A 4CKCB 4NL4H 5IKXA 4IXMA 3KELA 4PFKA 5LWQA 4GT1A 1D9XA 3PVCA 3WBJA 2C7GA 4QODA 1RYNA 1CTQA 3QIAA 4MR9B 3WOVA 2HHAA 4I4IA 5KTYA 2HF8A 3GD7A 1YA4A 2O48X 4HVAA 1AM4D 1IEVA 2PJZA 1S96A 3C3KA 3LCVB 1DEKA 2DY0A 4MCIA 1U8FO 2A4KA 1IK4A 3PX2A 4CM8A 1AA6A 2CMGA 2Y2UA 3FTPA 3I1FA 2A1TR 3OTWA 4JJAA 4LIPD 1T5HX 4RV5A 2HF9A 1JXAA 4BASA 3RHFA 1WL8A 3BOSA 1OGIA 1FMFA 4ZI7F 2EATA 1XTTA 2XTJA 3AJAA 3D8BA 3OJLA 5IYZF 3GLIA 1JXMA 3UATA 1DTSA 1RWKA 3S7TA 1TF2A 4L5IA 4UTOA 2P6UA 3R9IA 5KX5B 5HJ5A 1PR5A 1Z0DA 1G7RA 2H51A 4DLVA 5HZKA 3FA2A 4DQXA 3H0CA 4JYMA 3OKPA 1GUZA 1R4NA 4HWSA 1DGQA 2C4UA 2GBPA 4LWPA 1MIHA 4ZTUB 5A9SA 4BVLA 1CKEA 4I8IA 5KIAA 1E9RA 4QBGB 4JBYA 1G42A 1V5EA 1XWWA 3BJMA 2FOXA 2J08A 3EUWA 4N8EA 4PLCA 4BBZA 4D0GA 1WPGA 4ABTA 1L7VC 4IXDA 2YXPX 4E13A 2MYNA 4US1R 3ZZ0A 4F12A 2WU1A 2VPQA 1F4LA 2XT0A 5J59A 2A5YB 4CDGA 1XCGB 2ZBQA 2PGNA 3B38A 2AN3A 4ND2A 2W48A 1Z8DA 2XBMA 3M6WA 2MR5A 1CUGA 5F12A 3LSTA 5L7WA 4BUCA 1Z88A 3FGOA 4R01A 2PH5A 1DU4A 5HUQA 2JZOA 3N8IA 3GWZA 3D6JA 3PJEA 1EGAA 3T3IA 2P6PA 1II0A 3UYKA 1J1UA 1A71A 1QZUA 1UINA 1US8B 4EPRA 3ON5A 2QIOA 2XF8A 3COJA 2OBLA 4P92A 1C9DB 2RGBA 3ENKA 2LP4Y 3DDWA 3TZEA 5AM5A 2OCBA 1M34B 2UDPA 3H1GA 2AZ4A 4ZCTA 1R37A 4LFCB 2R25B 2X1MA 2MTBA 2NWQA 4HTFA 2HU2A 2J7PA 2NO1A 4LYAA 1P1IA 3QXJA 2J85A 3WLSA 2FSGA 4AIRA 1S89A 1E1MA 3PNPA 1JZQA 4MKHA 3LCUA 5J2UB 1H2EA 3LDHA 3CNEA 3M82A 1Y6QA 4PQRA 1ZRHA 1JJIA 1IDN1 4G67A 4YB8A 3EEQA 1EM8A 3JQ7B 4KR9A 5JW6A 1GT6A 1F0PA 4B4DA 1RYZA 1K0FA 1MB0A 3NHWA 2WA2A 821PA 4Y2YA 4LDQA 4EY7A 3V7UA 3FSRA 3OTHA 3FWKA 4AFNA 2YQ5A 4DRXB 4BBAA 3I6BA 1U7ZA 3B78A 3T95A 2Q5OA 2V7QA 4H1HA 2XGJA 5LDHA 1XZHA 3Q0EA 5IH3A 3WJAA 3QYPA 2HDHA 4XWGA 1HDCA 3COSA 1ESCA 1Y6FA 1AKVA 1F3OA 3EVCA 2XAAA 4HRVA 5IX8A 3QVOA 3TSOA 2C0PA 4D4IA 4NSNA 4QHSA 4LF7B 3V1NA 4H6WA 1C5KA 1NPYA 1MN6A 3E05A 3FRIA 3LF1A 5FUQA 3Q8MA 2Q4RA 1MT0A 5CB0A 3I28A 3ULKA 4OLAA 2MT9A 2HJVA 3ROGA 4OFBA 1YZHA 1V35A 3IJEB 4MVYA 1XIVA 4RD2A 5HE9A 4AD8A 1T5TA 1JR3A 3CPJB 2JVJA 2KB0A 1ZA1A 2P6OA 3T7JA 2QPAA 2IITA 3AOGA 2GN9A 4ACAA 2QIPA 4CU5A 1C7ZA 4XQ0A 2NGRA 3PGLA 1ECFA 4OJMX 1QIHA 3PQ7A 1QYDA 2B6NA 3DZCA 1DLIA 3KTOA 4YAWA 1O94C 3K15A 2CE2X 2YN4A 2X14A 1NW6A 1ZGAA 1FNBA 1JHMA 2HQSA 2QX7A 3PTZA 5ILGA 3NBXX 1XZ8A 1ZQ1A 4KAFA 5AHWA 4LOLA 4HDNB 4M87A 4PNHA 1QGDA 3W9BA 1YK0A 1EK0A 4U7JA 1U3GA 1YGYA 3BAZA 4OHBA 1U9CA 2A5LA 5LYJF 3HYCA 4UBOA 1QIFA 2IYEA 5EHNA 1FY2A 2D4AA 3B1YA 2GD2A 3OF3A 4QPNA 5IVKA 3M83A 3A6LA 4MR9A 1QANA 2P2GA 1TAGA 4F4HA 2KLHA 5LQAA 2IYWA 4DCUA 3PEYA 2GETA 2CVOA 4MVJM 1Y34E 1C0LA 4YP5A 3G5AA 2GBLA 1JBEA 1OROA 3L7NA 1R8QA 3DC2A 4COKA 1E58A 4DQKA 1KI8A 1R6XA 1R4MA 1VHJA 2AN9A 2PD6A 3BMQB 4KOAA 2HPVA 4RSGA 3UHAA 2PX4A 1Y7IA 4YUWA 1HORA 2C00A 3R3XA 4V1CI 1CRQA 1JZSA 3TEJA 2ZTHA 4KXQA 3ES9A 1X70A 2PANA 3N2NA 4WKCA 4XD7D 5AK0A 5LBUA 4EMBA 2GVDC 1T13A 2OG1A 1KU6A 5HRCA 1OREA 1T5SA 2QY6A 3MBIA 1KS2A 4OA8A 3JARB 1BVUA 4R98A 2QNBA 3UFBA 3E27A 4NCAA 1MO3A 3EWSA 4D8XA 1SQFA 1I5OA 2A9QA 2HWKA 4HNGA 3W2IA 4OXYA 3WLLA 3FVVA 3O90A 4J0EA 4A8HA 4AYWA 3QF4A 4KKXB 3ZHXA 4X1IA 5BV1A 2NAPA 1JHXA 1F6WA 1N7HA 3Q10A 3Q7IA 1L5HA 1G5FA 2JDIA 3RO7A 3U1VA 4DTIA 7GPBA 1CY4A 1M83A 1WDMA 4NABA 1LC0A 3DBLB 2NP6A 4NNPA 3GNLA 5CLQA 1VJDA 2VJYA 4OI1A 1EZ1A 1KI9A 1LRKA 2DWPA 1THTA 1GGEA 2P3OA 1SCUB 3A6KA 3ESCA 3UPDA 3RS4A 3N6XA 4RNDB 4DMFA 2D1QA 1TCUA 2NQ8A 4WK4B 3BH7A 2G1KA 4YHBA 5ICGA 4M0DA 5JXGA 4KAXA 1RACA 2V74B 3WGVA 5CBPB 3M1IA 1ZVJA 4A7PA 5IAGA 3KZ1E 4N4AA 1SOWA 2GFIA 2Q3MA 4BJ5A 1T9HA 2OOKA 3W6UA 4BZQA 3X1KA 2D2VA 1FNDA 4MEBA 1XHFA 3RTBA 3SWWA 1GAQA 2CFSA 4AJ2A 4UTNA 3WDMA 4Y6OA 3J7TA 2O23A 7REQB 2FP3A 2O2XA 2QAGB 3DBRB 5B7QA 5ALTA 3TQOA 1YA6A 2ZQYA 5JS2A 1WDKA 4CPDA 2AI2A 4YT5A 3UK1A 1R6DA 1TUIA 3B1VA 4FS3A 3S2ZA 1GLGA 3P1JA 1ZOLA 2GM4A 4BX2A 1FDRA 1RBZA 1MG0A 5EQDA 2WP8J 4X85A 4C0KA 3CE9A 1C3EA 2GPWA 3GRPA 4RTLA 5JAOA 4D0SA 2XD4A 4CEJB 4PAMA 1POWA 3KJFA 3K70D 4B73A 4Z54A 1TJYA 1Y81A 2BBSA 2CHVA 3CNNA 4B9AA 4EVRA 3FPAA 1T29A 4OHMA 5EMNA 4ALJA 1YJ8A 2ZSDA 1DRVA 4XE5A 3DKKA 1H65A 2RH8A 1ZD4A 4YV1A 2DUUA 2Q4DA 1LRLA 4EO7A 4R2LA 4IMIB 3OT1B 2P69A 4G85A 2GM5A 3I34X 4G3XA 4P0PB 2GX6A 4B4UA 3L4JA 3P20A 3UFXA 2IUSA 2D5LA 5KTNA 4MIYA 4QYWA 4PNZA 2OFFA 5TB5A 3VHQA 2V98A 1JQ3A 4CT5A 3OECA 3FWPA 1XTKA 1LK7A 4F7WA 4RMHA 1KYQA 2IYVA 2PMKA 3T3NA 2HWUA 5FQOA 2OWDA 4BV2A 1C3OB 2UYOA 2WWGA 3CA8A 3Q7TA 4BLWA 1C7JA 2FSVA 2ZYTX 4O08A 1PSZA 3RVRA 3R2JA 4TUYF 1XC7A 2RHJA 1ADBA 1LDMA 1JDUA 2J4FA 3BK1A 3DVAB 3M5WA 4MW5A 2CUNA 4FD3A 5DYTA 3D5TA 2OPHA 3RR2A 1Z3IX 3HCNA 3INRA 3IP1A 1YRAA 5CH5A 3RT7A 5LQMA 4WNCA 2JCVA 3QBJA 1TT5B 1PK9A 4LGCA 3ZHZA 5FT9A 1SA0A 5JS1A 2J5QA 2I87A 3CKLA 2JIOA 3AP3A 5HF6A 5C8XA 5JH7F 4C3VA 3O8BA 2FOLA 2CVPA 4TS1A 5EQJB 3B6IA 2PFSA 3BULA 1HNXB 2ZTLA 4Q5IA 4RKYA 1BH2A 2XVMA 3ACBA 4I36A 1E5LA 2AC2A 4D1YA 1EZZA 2NXWA 4H17A 1XLVA 1U8XX 2G7ZA 4B31A 3A2KA 3P2EA 4LE1A 1QHEA 3AR5A 3AGPA 1VJTA 5EWLB 2F64A 4BKOA 1JIVA 1XRLA 1TB4A 4A0FA 4BKRA 1DEAA 1FRNA 1CUXA 2E5FA 2ODQA 3OFJA 2Z1NA 2QJOA 2AE1A