3DUWA

Crystal structural analysis of the o-methyltransferase from bacillus cereus in complex sah
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
220
structure length
220
Chain Sequence
MIETWTAVDQYVSDVLIPKDSTLEEVLQVNAAANLPAHDVSPTQGKFLQLLVQIQGARNILEIGTLGGYSTIWLARGLSSGGRVVTLEASEKHADIARSNIERANLNDRVEVRTGLALDSLQQIENEKYEPFDFIFIDADKQNNPAYFEWALKLSRPGTVIIGDNVVREGEVIDNTSNDPRVQGIRRFYELIAAEPRVSATALQTVGSKGYDGFIMAVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional insights into O-methyltransferase from Bacillus cereus
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transferase
molecule keywords O-methyltransferase, putative
total genus 85
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3duwA00
1BC5A 3FUVA 1P1CA 3EPPA 1WS6A 3G5TA 4EMSA 2YTZA 4M38A 2GH1A 3A25A 3LBYA 5GIPE 2PVCA 4IV0A 4MHTA 4RTOA 3RIEA 3PLAE 3G5LA 3P9CA 2XVMA 1L3CA 5MHTA 3FPGA 3HCEA 1NW7A 3B5IA 4C06A 4C08A 3VYWA 3CGGA 3FUUA 1XXLA 2EJUA 4HC4A 5D1HA 2IIPA 5E8JA 3P2IA 5K01A 3LGAA 1WZNA 4YMGA 4BY9E 3AXSA 3E7PA 3GIWA 4DA4A 1DUSA 3DMGA 3GRYA 2AOUB 4BLUA 1KXZA 4KVZA 2PX5A 3I64A 3TM5A 5DX1A 3GO4A 5FHQA 1O9HA 3DXYA 3A7DA 4FP9A 3GDHA 3DTNA 5D1NA 2Z6QA 1KPHA 1EJ0A 2JHPA 5DX0A 3ELDA 1SQGA 3GCZA 3KPYA 2AN3A 4YV2A 1U2ZA 1PJZA 1RI1A 3ELWA 3EVDA 5HZMA 1ZGJA 3NWBA 4DF3A 5C1IA 4IV8A 5K0FA 2YX1A 4WXHA 4GBED 5GWXA 2YXDA 3EGEA 2IFTA 3FYDA 5F2OA 3CVOA 3NWEA 5DXJA 1FBNA 1V39A 1VE3A 2PX2A 1H1DA 4PYKA 1L3BA 4QPNA 3E05A 1EQAA 5DRYA 1JG3A 1XVAA 3KQVA 3LHDA 5LSAA 2ZIFA 1XDSA 3DOUA 3IYLW 5P8WA 1P39A 1WXXA 4AZWA 2O0LA 1I9GA 3BWYA 2O05A 3BXOA 3UJ8A 4ZTBA 5LQKA 3I58A 4GOOD 2ONZA 2P7HA 3CBGA 4K6MA 1N7JA 3SX0A 4AZSA 1YFLA 2NP7A 3KQMA 5T64A 2VDWA 5F2KA 4RVGA 1TPYA 2ZLBA 3I5UA 5CM2Z 5H02A 1SKMA 2B9EA 2PJDA 3G89A 3OZSA 4U7TB 4ER3A 5ICFA 2B2CA 3LDGA 4HSGA 4KWCA 5DTMA 1RJGA 5EPEA 1NW8A 1R00A 3B89A 2OXTA 2P3LA 4E30A 4POOA 2NXNA 4F86A 9MHTA 3A4TA 1EJ6A 3KQYA 5GP1A 4ER6A 2IH5A 2JG3A 3KQPA 4BLWA 3BT7A 5DM2A 3CJRA 1RI4A 2ADMA 3ME5A 2NXEA 3TPZA 3LPMA 4G56A 4YUZA 5LQCA 3ER9A 1NV8A 5K0LA 4HH4A 1D2GA 4HG2A 3X0DA 4RTLA 3TOSA 5HIKA 3M6WA 3NMUF 2AN5A 5HIJA 1VQ1A 2AOTA 3JWIA 4PIPA 5E9JA 3UBTA 1JTEA 3EVAA 2DPMA 3GRUA 5EEHA 2BR4A 4RTKA 3HCDA 5FUBA 3OU2A 2OB1A 5GINE 1JTFA 3ER8A 1SUSA 3D2LA 4UOEA 2YQZA 4RTMA 5CD1A 2XBMA 4YUYA 2BH2A 1YB2A 2FPOA 1NBHA 2XVAA 5DWQA 4ER0A 4YMHA 4PYJA 2FRXA 1Y8CA 3H2BA 3GGDA 3P71T 5LQJA 1EIZA 3P8ZA 2G1PA 3B7PA 4A6DA 3BGDA 1M0EA 3FUWA 3FUXA 3KKZA 1FJXA 3C0KA 2ZWVA 3T0IA 2EG5A 3NW9A 1JSZA 3AY0A 2QYOA 3SR4A 2ZTHA 3OE4A 5BW4A 2VDUE 3DLCA 4P7GA 4RVDA 3SXJA 2E5WA 2G8NA 4FZVA 10MHA 3I53A 3CJTA 3G2OA 1UWVA 3HCAA 5FTWA 4EKGA 3TKYA 5ICCA 3KU1A 1X1AA 2AVDA 4R8SA 5DT2A 1XDUA 4RTNA 2I9KA 3JWJA 2ZBPA 4AZVA 3SSOA 1XDZA 2GPYA 2GLUA 4GOMD 1ORIA 2PKWA 3BGIA 4EKIA 4DCMA 3LKDA 2EFJA 4AX8A 4EQZA 4RTJA 2AOTB 2PY6A 4KDRA 4R05A 2QY6A 4RSRA 3FTFA 4BLVA 4RYLA 3AWIA 2ORED 2I7CA 2OO3A 3OPNA 4WVLA 2UZ4A 4DKJA 2IH2A 1NW5A 3NDIA 4E70A 5LQNA 5EC8A 1JG1A 4E2XA 2P1DA 2WK1A 3FPJA 7MHTA 4P7KA 3MHTA 2PWPA 1RJFA 1QAMA 5HILA 5BW5A 4X60A 3UJ6A 4GC5A 4MTLA 5EVJA 3VC2A 3TKAA 2GB4A 3EVCA 4RWZA 5IKMA 5DTQA 2ZZNA 2NXCA 3JWHA 3T7RA 1TW2A 3BGVA 3EGVA 3HVIA 3LL7A 1FP1D 1QYRA 2H11A 3P9KA 3KPWA 4L7VA 5CVDA 5E1DA 1ORHA 3KQTA 3WSTA 5F2NA 2UYOA 2AOVA 5M5BA 5CVJA 3THSA 4QDJA 1YUBA 1VIDA 1IM8A 5CIYA 1WXWA 4XCXA 2P7IA 4CTKA 1KYZA 3M33A 5JUWA 3ELUA 3ELYA 2B78A 2AOXA 2ZW9A 1XCLA 4ISCA 4FR0A 4FSDA 3R9XB 5EZSA 3NTVA 4CXMA 2YXEA 3KPUA 3EEYA 4QTUB 2WA2A 5FADA 2ZZMA 4RTQA 2PV0A 5DTRA 2QRVB 4LG1A 5E8RA 2ZZKA 1KPIA 1RJDA 1NV9A 3M70A 3B3JA 3BWCA 4PYMA 4RVHA 5DM4A 5EOVA 3FRHA 3LCUA 1TW3A 2BM8A 3EMBA 5BP7A 2C7RA 1SQFA 3G2QA 4PYNA 3FPFA 2FCAA 3ORHA 3U81A 3G8AA 1WY7A 2PBFA 5C9ZA 3KHKA 3FZGA 3LDFA 3A7EA 4HGZA 3M6VA 1BHJA 3SVZA 5FCDA 4V0RA 5K0EA 2FK8A 3OFKA 3GRZA 4OA8A 3MAGA 3AXTA 4FS8A 3FTDA 4PYQA 4M37A 2P35A 5EKUA 1O54A 2PT6A 4YUVA 2Y1XA 2HNKA 2Y1WA 1P91A 3IEIA 2UYCA 3BZBA 2PGXA 3MB5A 2CMHA 1T43A 1SG9A 3P97A 1MHTA 5EGSA 3HCFA 3C6KA 5HIMA 4IKPA 4C4AA 5LQUA 2IH4A 3KQOA 3BUSA 5T6BA 4PONA 5K0BA 3R6TA 3T7TA 3GWZA 4YV1A 1BKYA 3UJ9A 4F84A 2V7EA 1X19A 1RI5A 3KQQA 3B3GA 2H00A 5KS2A 3I9FA 4P7JA 3M6UA 3EVEA 3MTIA 2ZSUA 3MERA 5BXYA 3UJBA 5ICEA 3FPHA 4GOLD 1UIRA 3CC8A 4KW7A 3FRIA 3KQSA 3TQSA 1R8YA 4OX9Y 4O29A 5EMLA 3UWPA 4R6XA 2ZVJA 3LDUA 2C7OA 1QAOA 4HTFB 3CCFA 1EG2A 3FUTA 3QOXA 5DSXA 4BP3A 4U7PB 1B42A 4RTPA 1VLMA 5T67A 3TFWA 4C03A 2N47A 3BKWA 1JG2A 2NP6A 4OQEA 5DM1A 1YFJA 3LCCA 2WA1A 4P7FA 3PB3A 5E9QA 2R3SA 4OBXA 5EG5A 4PYIA 1M6EX 3UJ7A 5K09A 2A14A 2QRVA 3P2KA 5CCXA 3DLIA 1VL5A 4RX1A 1X1CA 4CTJA 5CVEA 4PIMA 1G8AA 4H0NA 1AV6A 1R6AA 2ZBQA 5K0NA 3G2PA 1N2XA 4GEKA 3KR2A 2BR5A 4PGHA 1R8XA 2EJTA 3GXOA 1L9KA 4PCLA 1O9GA 2XYRA 3PFHA 5E1MA 2K4MA 1EAMA 2IGTA 3HP7A 4QQKA 3UA3A 4PNEA 2Z6UA 2PX8A 5FULA 3O31A 2PT9A 2I6GA 2IP2A 5E9WA 2P8JA 1VPTA 4CKBA 4OBWA 1NW6A 3UJCA 2HWKA 4GF5A 4HRAA 3UZUA 2LD4A 5K0CA 3ID6C 4PYOA 1SUIA 4PWYA 4RVFA 1QANA 5LQRA 3PTAA 1N7IA 3FTCA 4PINA 1IXKA 2VZ9A 3HVJA 3UFBA 2FYTA 1VP9A 3VC1A 1M6YA 3HEMA 3DULA 3PS9A 5FA5A 1PRYA 2G70A 5K05A 3KR1A 4FGZA 2PLWA 2Q41A 2P40A 3P2EA 1L1EA 4E2WA 2OZVA 3JWGA 1Q0SA 5EZQA 5HIIA 3HM2A 4PCAA 3C3YA 3GJYA 4DCGA 5LR6A 1JQ3A 5K8VA 3HVHA 5EHGA 3LKZA 5DXAA 1P1BA 2CWWA 2OKCA 4OQDA 4DM3A 4MWZA 3OZTA 5E2BA 5FHRA 1KP9A 2C7PA 2HMYB 2O07A 1G55A 1D2HA 3M6XA 2HR1A 4IWNA 3GRVA 1UFKA 5CUQA 2JH9A 3HVKA 2JHCA 1NT2A 3THRA 3TM4A 5ERGB 5K03A 1NBIA 3KR9A 3GNLA 1JR4A 1SVUA 4QQNA 1RI3A 2AOUA 5DSTA 2ZCJA 1F38A 3GU3A 2UYHA 2CKDA 5GM1A 1RJEA 5EIFA 1NKVA 3A26A 2AN4A 2NYUA 5K0GA 5EMJA 2HV9A 3NJRA 4DQ0A 4EK9A 2HTEA 5FQOA 2VP3A 4JXJA 2O06A 1D2CA 3SGLA 1KYWA 3E8SA 3V8VA 3OU6A 4ER5A 5EIWA 2CMGA 2GS9A 3DH0A 3IHTA 3G88A 1OR8A 2ZIEA 1WG8A 3PT9A 3ERCA 2B3TA 2NXJA 5HOQA 3PFGA 5B1SA 2G72A 4V0QA 4E33A 2IPXA 3IV6A 4DZRA 4OA5A 5KYGA 4YUWA 3O7WA 4X63A 4C04A 4RTSA 2DULA 3GRRA 2PWYA 3K0BA 3PVCA 3P9IA 3MGGA 3BKXA 5DPMA 3G8BA 2JJQA 4C05A 2IDKA 3REOA 3DP7A 4Y30A 4ER7A 1YF3A 1R74A 1L3IA 2PXCA 2QE6A 5EMKA 1IY9A 4QVGA 3MQ2A 4E2YA 4YUXA 4LWPA 1ZKDA 1BOOA 5G02A 4GOND 5LQAA 3QV2A 4F85A 4LECA 4YV0A 3UJAA 4QTTB 4KRGA 3O4FA 4KIGA 4PGGA 2GA9A 4X41A 3HA7A 2BR3A 1FP2A 4LWOA 2EX4A 2ZULA 2ONYA 3KPJA 3LECA 1NE2A 2OPBA 3DUWA 4XUEA 1G60A 3RODA 8MHTA 2NNWB 2P3OA 2FHPA 1R18A 3K6RA 4XUDA 3EVZA 2PSSA 3EVGA 1KIAA 3LBFA 5IH3A 3DMHA 1RI2A 3SMQA 2BZGA 1XTPA 1ZHFA 2JHAA 4CKEA 3DXZA 2H1RA 5DX8A 2AVNA 3R0QA 4R8RA 2ERCA 3C3PA 3G7UA 3C6MA 2OYRA 4KIFA 5ICGA 1G6Q1 1F3LA 1JG4A 1Q0TA 1XCJA 3G2MA 3R24A 1NW3A 1VBFA 1INLA 3FPEA 1KHHA 5EQJB 3TLJA 4BP1A 1JSXA 2OY0A 5CCBA 5DRTA 3AJDA 3OU7A 3EVFA 1ZG3A 4QPPA 5KQRA 2ZIGA 3MCTA 3OE5A 4P58A 4AZTA 5EMMA 4GC9A 1YZHA 5KQSA 3EGIA 2YXLA 3MTEA 1X1DA 2V74B 1KR5A 5FWDA 3KR0A 3DXXA 1ZGAA 3TR6A 2F8LA 1G38A 5GOZA 1G8SA 5E2AA 4QVKA 4QDKA 3FYCA 2R6ZA 3OFJA 2BM9A 2XYVA 5CVUA 3CKKA 1AF7A 2UYQA 1KPGA 3V97A 2YVLA 2OBFA 2AOWA 2ZWAA 3EVBA 2CL5A 5HEKA 3TRKA 3Q7EA 4R6WA 3SM3A 4C07A 4MQ4A 1I4WA 5U4XA 4M7RA 5DM0A 2C7QA 4AUKA 4XUCA 5DLYA 3BWBA 2FK7A 3R3HA 2XYQA 5CVVA 3PX2A 1Z3CA 5GM2A 3RW9A 4FSXA 5FA8A 1AQJA 4FT4A 3EMDA 3F4KA 1FPQA 5C0OE 2ESRA 3Q87B 3NVKI 5EKXA 5E1BA 4KDCA 3B3FA 4HTFA 3HCBA 3NDJA 3HA5A 3HA3A 3MCZA 4B17A 5HFJA 4RV9A 3P9NA 3OCJA 5KVAA 1VP3A 3NVMB 3QOWA 4A6EA 4E2ZA 2ZBRA 1ZQ9A 4NECA 2G71A 5E1OA 1YZ3A 3BWMA 1JQEA 3M4XA 3ANXA 4X61A 2YR0A 1QZZA 5JR3A 4ATNA 2ZFUA 2QM3A 1I1NA 3SSMA 3T7SA 5FQNA 1MJFA 4GUAA 2IBSA 1XJ5A 3LX6A 5K0JA 4Z2YA 2VS1A 2P3QA 3FTEA 3PX3A 3UJDA 2YUIA 3S68A 4CWAA 4E32A 3DR5A 3SSNA 1JQDA 3VSEA 3HTXA 2PXXA 4PYLA 5EEGA 1DCTA 2AR0A 3KPVA 4GQBA 3DMFA 2AZTA 4E31A 3E23A 2IDJA 2IBTA 3LCVB 3A27A 2I62A 1HMYA 3OZRA 4Y2HA 2Z6AA 4M36A 2OB2A 2PXAA 2P41A 3CJQA 1QAQA 4DMGA 4CKCA 5GIOE 3UA4A 4FT2A 2GAFA 2AS0A 4X1OA 1DL5A 3HCCA 3KQWA 2KW5A 3L8DA 2VDVE 1X1BA 1HNNA 3LSTA 5FWAA 4EVIA 2PX4A 2JH8A 1AQIA 3HNRA 3TMAA 4RTRA 3EEOA 5EHIA 4HGYA 2O57A 4MIKA 2B25A
chains in the Genus database with same CATH superfamily
1GGNA 1JHPA 1KMIY 3UIEA 2I3BA 4XGNA 4V1CI 3OA0A 3AFGA 3DOFA 2GH1A 5A05A 4LMPA 1XEWX 5JCJD 2PZAA 1K63A 2NO1A 4TUYA 3TD6A 4AKTA 5KREA 3PC7A 1MG0A 3UCEA 2G80A 2JFGA 1Z6QA 1UP6A 4LJ6A 1A5BB 3Q0TA 1VRVA 4BNHA 3DBRB 3ZI4A 4JLDA 4C08A 4TM8A 1PEDA 2OXEA 3F8WA 2V7BA 3AY6A 1CUVA 1KE2A 3W9BA 2D54A 3Q4GA 2EP7A 2UUCB 3SNKA 2O2IA 5DN6D 3WK9A 4PX2A 4CQNA 2VRBA 4TQ9A 1CC1S 1VMKA 2DERA 4LA4A 2UZ1A 4M60A 2E4VA 4YP1A 5AVKA 4AROA 2BCEA 1YVEI 3RSLA 3TW8A 5HRAA 2WJPA 3FR7A 2XUHA 4ZOLA 2FG5A 3SNHA 5L4SA 2FOXA 3IURA 3FOEC 5A7GA 1IWBB 4R51A 1EFRA 1IY0A 3PVSA 1FDRA 3GP5A 1Z3IX 3NWBA 1GL6A 3IQEA 221PA 3M3PA 3E3MA 4AU1A 5A9SA 3R9XA 1CDOA 2QJOA 4FMPA 2CUZA 2YCLA 1NN1A 3E7DA 3R0IA 5GMOA 5GVSA 3JYNA 2DJIA 3LDAA 4NLLA 5EIBD 1ESEA 4KX5A 1PS8A 1D8TA 4YBZA 2DOKA 2BDEA 4ZYLA 4Z3OA 1BMFD 5LSAA 2PFGA 3IYLW 3I3OA 1CY2A 3HN6A 1NFQA 1EX6A 1NMYA 1EP9A 4PLZA 4UVGA 4Y7DA 5JNRA 3WLTA 4OXNA 1Z73A 2FZ5A 3TZCA 3IVCA 3L46A 4DSAA 1GRCA 1LF5A 4PC7A 1TQDA 4MRMB 4PLVA 1LSUA 3HJTA 2AA3A 3KJGA 4GZMA 4L8WB 4Y2VA 4U7TB 3WK4A 5J2UF 1BQ3A 1ZOPA 1QHFA 1X3SA 5EUCA 2WUWE 3H8JA 1E2EA 1I4LD 1V11B 2XKAA 2P3LA 3DJFA 3AF2A 3ITEA 3LC7O 1PQ4A 5CB8A 5IULC 4FOSA 1R50A 3ZW8A 1J90A 4TYYA 3KUKA 3O1IC 2VWQA 3LA6A 5IT9A 2F4VB 3GI1A 4BC1A 1H0SA 1OAAA 2QI9F 3CW8X 3M9LA 4CM8A 5A02A 1WLSA 1D5CA 1NN5A 2H1SA 4TLBA 5CNJA 2DPHA 2M32A 1UBOS 2RJOA 3K94A 2OB1A 3UWDA 1E61A 2SECE 1GPWB 1R9JA 3D2LA 2HCJB 3JARB 4WUVA 1AK2A 2C2ZA 5H70A 3E7WA 4WL0A 4B3JA 2JBHA 2ZT8A 4HBGA 4I1VA 1NBHA 3T54A 2Z1NA 4JC0A 4NKRA 3WIOA 2FRXA 3H1GA 1C9KA 3UW3A 4PYJA 1Z5WA 5KB3A 4FMDF 5LQJA 1BHQ1 1O5TA 2LKCA 2ZS7A 5THXA 2DR2A 1Z5PA 3SI7A 3MINB 2B92A 4LZLA 3I9OA 1FP7A 2V6FA 2ZWVA 1K75A 2WB2A 4MLCA 1F06A 1ZEMA 3LY8A 4KV7A 4EY3A 2XOEA 1F6WA 2Q7DA 1QV7A 4BQFA 1TCUA 4OHWA 3VVLA 3MJRA 1UKEA 3PNQA 1VOTA 4FEGA 3TAXA 1UZAA 4U39A 3HJGA 1Y5IA 2V7VA 4FYPA 1R9GA 4ZK2A 4EB0A 4KYTA 4B46A 3LBAA 2ZK7A 1RQ2A 4AKSA 1Z0IA 2JIRA 3FAZA 3LE8A 5DOZA 4DS3A 3E8XA 4ZEMA 2V5AA 2XLCA 3JAWA 2QAJA 3CEPB 3CXRA 3E27A 2N9UA 1RM0A 1S2IA 2JCGA 4NU5A 1A2QA 1H0RA 1KMQA 2GAOA 3H16A 2EL9A 2XITA 1RQXA 4JB8A 1L7OA 3JZMA 1HE3A 2EL7A 2YICA 4UEJA 3V34A 4PXSA 5C18A 3NH6A 5JC1A 1GRNA 2RARA 1ST2A 1BGWA 2H1CA 3U80A 3NDIA 3WGHA 2NUBA 2G4CA 5CXXA 4EG1A 2ZPAA 1J56A 2VSXA 1SUWA 3IB6A 2H65A 1UKZA 4GXTA 1JP7A 4LYJA 2PGLA 4MRSA 3LUBA 2R97A 3IE2A 3M81A 1IHUA 5LJLA 1Y1RA 3ICVA 4PNHA 3QKRB 1TLLA 3CEJA 4OQNA 4ZANA 3SJUA 4A8JC 2XUDA 1EZ4A 1E0DA 1M5UA 1ZH4A 1YMUA 4H35A 1T1EA 1EFHA 2ZVPX 5E1DA 3DLPX 1BRTA 2Q3MA 1H2BA 1VBKA 4W5OA 4G85A 4EP1A 1E92A 4M9CA 4RXTA 1X77A 1E1QD 3OZBA 2I4OA 5FOSA 3SF8A 2O4CA 4PR0A 2GKSA 4HNHA 4ROSA 4L7QA 4TQAA 3GLFB 2DP4E 2L82A 1RWVA 2Q2WA 1UBEA 1W1WA 3V1LA 4D6XA 3EEYA 5FADA 2ZZMA 3O4GA 4MGEA 5U4QA 1SOVA 3B12A 4W1QA 5JU6A 5GADl 1E8NA 4OLAA 5A9TA 3S7ZA 4LQ4A 1X9IA 4HLCA 1SQFA 4AZ3B 3B6JA 1HEUA 1YJQA 3KM0A 2X7JA 4RXMA 2OYCA 3QLVA 3GUUA 3KLBA 5A3SA 3VR3A 3WLQA 5K8TA 4FR2A 3QGMA 4RPGA 5TS2A 1BHJA 2RGUA 5LOVB 4L6IA 3ROMA 5GV7A 1XTUA 3AJAA 3CR3C 4AP9A 1H23A 2VAPA 3G13A 3MPOA 1JKFA 2HA7A 1JWAB 3LLUA 4IWYA 1G0NA 4MV8A 2I4IA 4RENA 5FUQA 4AG6A 4EGFA 2Q6VA 2E21A 3TB4A 5DI3B 2CMHA 3P97A 3VH3A 2NSYA 4MH0R 4O33A 4AF7A 2F59A 2Z58A 1C9NA 4PONA 2VATA 4C0AC 4UDOA 1NJ5A 3OP4A 4XD2A 1LF0A 1M6WA 2C98A 5CEJA 1XAJA 3GLGA 3DBRA 1W7AA 1XRMA 3EODA 3IXQA 1WW8A 4KAFA 4R9UC 3AO0B 2AD1A 4JR0A 3H2KA 2WYVA 4BMYA 2MYPA 3M6UA 2FSUA 3EVEA 3A6FA 2YVAA 2VCHA 3P45A 4U7GA 5DASA 2WFMA 4ZVVA 4DILA 2B3DA 4RL4A 4O25A 5JALA 2QR3A 1LLQA 1SN7A 3MWDB 1R4MA 3KQSA 4JP3A 4EY8A 3TUJC 1WD7A 4A2WA 2CVHA 3UWPA 1F51E 3OD5A 4CG3A 5TGTA 3LQ4A 4UNIA 3LXMA 4HGQA 1L1RA 4BWGA 4D8UA 4D9HA 5DE3A 1R9NA 3GT0A 1KWGA 1E7YA 5AMXA 4CUJA 1TVCA 2BFCB 1VMIA 2EYQA 3HUUA 1KOJA 5CA0B 4R16A 4K1XA 1N1MA 5HWSA 1A0OA 1Z15A 2VP2A 2TECE 1RXIA 2WIBA 2XJ9A 4PYIA 3BN3A 4TUYF 2IYLD 5FI3A 3JQ8B 3HV2A 4ALIA 3BXGA 1N2SA 1CQXA 1AGRA 5EXXA 4EY7A 3COJA 1EXWA 1R27A 2JD0A 4QD3A 3SJBA 5C4IA 4II3A 1DIAA 2ZBQA 4RJJA 4BUZA 1FS4A 2HM7A 3KAKA 1QGAA 3LXRA 3GXOA 3ZLTA 1OLXB 2VWGA 4TT8A 1P60A 2D4HA 2CFOA 5EKSA 2BTQB 4PNEA 3EGCA 2JFZA 3L7NA 4WLVA 2PX8A 4CGYA 4EKDA 4TVBA 3W5VA 1UAGA 5BURA 4P2GA 1RMYA 4KKXB 1P4AA 1VPTA 1Z0KA 2W2LA 1YOVB 5AH0A 4PHFA 4A8HA 4CKBA 5JQGB 1DOHA 3QLVC 2RBEA 3UZUA 4CTMA 5ELLA 1W34A 2FTKE 2LZ0A 1K5HA 3IPYA 2XMGA 3ONWA 1IZ0A 2FWBA 5J23A 2JI7A 2W2KB 4GBGA 4M0EA 3USZA 3YASA 2CLKB 4F9TA 3UGKA 3HEMA 2Q49A 4DG8A 2A30A 2W43A 1PRYA 2X2PA 3PP8A 5FL7D 3SYRA 2JAQA 4BVFA 1NC1A 4DR1B 2IHVA 4RAQA 1EZ1A 5E6UB 5FNZA 2IE8A 2NQTA 1QQAA 3NALA 3VOAA 2A94A 2G07A 4PCAA 4L5BA 2EGUA 2Q4DA 4TMZA 2P5UA 3FSRA 2XGJA 1CY7A 4ZV7A 1T6ZA 3PGJA 4GNRA 1LA2A 1J0EA 2NVBA 4Z0NA 3STYA 3ZDEA 2CWWA 5TQ0A 4LFCB 4OQDA 1X2BA 1FOEB 1MZVA 4J9UE 1BYIA 5E2BA 4TKVB 3LY9A 4ZQCB 1S7CA 1YS7A 1PX0A 3A6LA 3TL2A 3K70D 4OHKA 1UFKA 2CFSA 4BIMA 4CIAA 4WLNA 4IIBA 4XOIA 2JKZA 3IKJA 2QGNA 1YR3A 2PQ6A 3H6KA 3W5AA 2PZLA 3A11A 1W75A 4NV0A 4QATA 2DG2A 4CMIA 4QNNA 5IDWA 5IDQA 2QORA 5CYPA 1NP7A 2HGSA 3T1HB 2D2FA 2WNHA 1T8WA 4QXQA 2BWJA 4CFZA 3TIFA 3TD9A 1ND5A 3VFDA 3ZBTA 1MTOA 4R1MA 1ZW1A 4DA6A 5KQGA 2EKLA 4RULA 1LB1B 1T8SA 4LQDA 3IEMA 2FEAA 4K9KA 4B83A 4DABA 3CF4A 2QLTA 1N2IA 4B4VA 1RYNA 4RZ2A 2PXHA 3VBCA 1U3VA 1ZNQO 4XWOA 5KJFA 2VEOA 3IUNA 4WECA 1NXQA 3A32A 1ESMA 1X7GA 1Y1QA 2B1IA 4MUEA 4EA9A 3FDJA 2QE6A 3DW3X 2BKEA 2WUFA 5EXDA 4LWPA 3WTCA 3GD7A 3MAJA 3WQBA 2HBZA 2AN1A 1Z4OA 3P4UA 4DARA 1F4PA 5EJ7A 2HXYA 2WYWA 4ZD6A 4LECA 1YDFA 1Z12A 4NZYA 4UBNA 5AVXA 3MJHA 2CK3D 3KYCB 4LV8B 1LGYA 4QYIB 4QELA 5JS2A 2QXTA 3HO8A 1E6MA 3JU3A 4LNHA 5EXTA 1J09A 2GXQA 2MR6A 4DLVA 1IN1A 4IR7A 3BGSA 1NWHA 4OHPA 5G1OA 4U8GA 3FBTA 4QJ4A 3WKCA 1L4GA 1SVWA 2PS0A 4YP9A 4BFCA 3ZCPA 4RHFA 4ZZ0A 5AKGA 1XTPA 1ZHFA 3DV2A 4B82A 3JPWA 3SLKA 1NAIA 1KY5A 2ABWA 1D7AA 2DUNA 4D4IA 1JPJA 4BBPA 1TJ4A 4PLWA 4TV8F 1R3UA 3NHPA 3NYIA 1G6Q1 3P96A 5DIZA 4Q3DA 3ZGYA 3TE6A 1FZQA 4J7UA 1Y7TA 2Q5HA 4ZK6A 3EHDA 4LF8B 4LN1A 1XLTC 3RG8A 1FNNA 3FRJA 4HAIA 1EGMB 3FOCA 3QXXA 4U6SA 1O6FA 1AN9A 1WM1A 1W4BA 2ZIGA 4WN9A 1PD0A 3CN7A 2H16A 3DHVA 2FPRA 3KZVA 3EN0A 4Q9DA 4KR7A 1DZIA 4PSAA 5KDLA 1DXOA 1PDOA 3CN9A 1KR5A 1MXFA 3IDAA 4FJ0A 4QFMA 1UM9A 4M1TA 5EMNA 3X44A 4D3FA 4FLFA 3M4NA 4NZMA 2RCYA 2OMKA 3MCUA 3V97A 1PWHA 1C1HA 4JLVA 2Y77A 4D96A 2PD6A 1A9QA 4RCZA 4S2EA 3LZCA 2PTGA 4JKOA 4MV0A 2VNKA 2DQZA 3T3OA 3W2TA 1DT3A 3LW7A 4EITA 2HMWA 5AW6A 1X2EA 2C8LA 4N76A 1NNEA 1H8HA 1XLVA 4H9GA 4IUCS 5F51A 4YIHA 4CEIA 1HT3A 1GPUA 1ESDA 1ZGHA 3HB9A 1GL7A 1ODJA 4FT4A 4TL9A 5FF9A 3S55A 3U0BA 2FPGA 3BK1A 3MUFA 4ARAA 2O1EA 5HJ7A 1EUCA 4PAWA 3PPXA 3MCZA 5JYBA 2FGJA 2QD1A 4IIJF 1KYYA 3FZYA 3OCJA 2ASVA 1WV0A 2R5FA 3WGGA 4DA7A 3UTCA 2VHXA 4CIVA 1U2PA 4DGQA 3AF6A 2XSZD 5M7EA 1L8OA 2QTMA 4LJKA 4MW0A 2MSNA 1YZ3A 1KK2A 1E8DA 3OIFA 3ORSA 1PFQA 3N07A 3ANXA 5K0ZA 4MVJD 1LQUA 4FI3F 2BEJA 2AE2A 4GUDA 1ZSVA 4LYDA 1BD3A 2DWOA 3P9QA 1KSJA 3R7BA 5KPDA 2X8LA 5DYGA 2XD4A 3UXMA 3L4JA 1XTRA 4A0SA 1LI7A 1NJGA 3F0TA 5INTA 5K8JB 2ODNA 4ARVA 1ZH8A 3OQBA 4K2AA 1Z4QA 4Y2JA 1IYZA 1EK0A 2YUIA 1DMRA 5JSKA 2FN3A 2VJKA 4EFMA 1QB7A 5ALXA 2QYTA 4ARBA 4EZBA 5J47A 3SQWA 1EBBA 1VE9A 4MWTA 5AVUA 2DH6A 3BD9A 3B6IA 3DAOA 3VX3A 1HDZA 2I34A 1LFAA 3PA6A 1HMYA 2K5UA 4PPFA 5EJFA 4M36A 5F12A 4CCYA 4ZYVA 1BDIA 1E2BA 4RVUA 4M0PA 3PNBA 3RU7A 4PRYA 2IIVA 3IBSA 3HB0A 4QNRA 2AKAB 3SE0A 4BNZA 4KMSA 3WBJA 1URPA 2Y0CA 2H17A 4ECEA 2QUBA 3ZWMA 3GZ4A 4KLNA 2O3UA 3DJYA 1SIBE 2GUWA 4YCCA 5ALVA 4BO7A 4RY8A 2PRJA 8ATCA 3UNXA 1EX9A 1KHTA 2DWUA 1TIKA 3EQ8A 1OJLA 4XOUA 4I1OA 1TYCA 1P1CA 3R3WA 1WS6A 4R2WA 2XMPA 2XDAA 1DO2A 3MWJA 3V7NA 1QS0B 1E9DA 2PVCA 1G8FA 3KL4A 4DPMA 4CGZA 2CE2X 4RTOA 1AQUA 1VDZA 1SU7A 3ZNNA 1T36B 1X87A 1IHOA 3OX2A 4I5GA 1AKEA 5I8PA 3NT4A 2AG1A 5FBZA 4AWBA 4BPRA 1GAEO 2PANA 3USES 5D1HA 1T4MA 5JZVA 2R8BA 2V0GA 3DHYA 3LGAA 1Q57A 3LT0A 4D7AA 3KHUA 5E38A 3EQ7A 3DKKA 4Q03A 3CTMA 3LPDA 4RA9A 2P0YA 5EZ6B 4AMVA 3HSKA 1MD9A 2WFLA 4B74A 1DIRA 4MHSA 3GZTB 3I64A 3LVFO 4FIDA 4YB8A 1K89A 3G8YA 1RXVA 1GN8A 1ZN7A 3GDHA 3P4XA 3QHAA 3RQIA 5ICSA 3IA2A 4QOEA 3FFTA 1AGYA 4OU5A 4K81B 5FLYA 3LT4A 1CB0A 2Q6TA 1E62A 3OOJA 1U2ZA 1NMZA 3KSMA 3PSHA 5CPBA 3UT5B 3LQFA 3Q7QA 1HDGO 4A16A 3AHCA 4R83A 2YXDA 4AUMA 1P3JA 3PLRA 2G28A 4P8RA 5TSDA 3LP5A 3W7AA 2Y0BA 2YHIA 2FPSA 1YDWA 1NDHA 2XEDA 4Q4JA 4BAGA 1XQVA 3A4IA 3R77A 4UZSA 4UPEA 1C8BA 1Q1GA 2DFDA 3WI7A 1XELA 4DKXA 1A7AA 2FPIA 3L8EA 4QGAA 5BQ5A 3WGZA 3TN7A 1WXXA 3BWYA 3KKKA 1RWBA 1RYEA 1XCPA 2X3UA 1RRKA 4YEDA 1S96A 2OENG 3CTPA 4Q4AA 2VYNA 3UWSA 1ECCA 1GAJA 3T7EA 2JVKA 2IKSA 2ZLBA 5D3KA 1RFGE 3DOIA 4S1OA 1MOPA 5L7YA 3S27A 4CMEC 4BO3A 5JYCA 2R5WA 1V5EA 5EPEA 3L92A 3P26A 2CLDX 2QRHA 4ARSA 3DEHA 3SQOA 4CLOB 3VPGA 3OLCX 3C41J 4DJAA 1JJVA 1MZPA 3T7CA 3JQBC 3KJEA 5AJZA 1DAEA 2X0NA 2GVZC 2QD2A 3PKIA 2B21A 3F3SA 4GE3A 2RHRA 2Z8YM 3KVYA 4GPBA 4EJ6A 4AURA 1T1JA 3PG5A 3NMUF 3BJZA 5DNCA 3CX4A 3N86A 3AM4A 3ETLA 2X5OA 4FOOA 4J1QA 1AQ6A 4LNUB 3GFQA 2NSJA 2BR4A 3MRVA 2WHXA 1A9TA 3HCDA 4M7WA 2P6NA 5TMDA 5U1PA 3TSZA 4RTKA 2I67A 2Q5CA 3PQEA 2BMJA 2ID7A 2V5UA 5JNSA 2XBMA 4TKMA 3LRXA 4C7OA 2XCIA 4FDMA 1IMJA 2AEJA 4N5LA 4YR9A 2EF0A 3UOWA 2QTGA 2IWRA 5JZ9A 1AKRA 1C3EA 4I4IA 2JCVA 4GVLA 5TPZD 1UJ6A 3FUWA 4Q1DA 4XXHA 2ZRPA 2NT4A 4NYMQ 5LA6A 3SFTA 5BWBA 1OFVA 4RESA 3H1BA 4WKBA 4X8MA 1N1EA 1KRXA 2QYHA 4TMTA 4F96A 3IKVA 1RR6A 4FOLA 1M7GA 2DCMA 2Q8NA 2WSLA 3FCSB 3OE4A 3GL9A 3OO0A 3QXSA 3TGWA 4FDUA 4R5HA 1QUFA 2X9NA 4GL2A 5FTLA 1NZFA 1ZIXA 1EHCA 2G09A 2J3LA 2VUSA 3BREA 3IQWA 2Y76A 3ETJA 3LUFA 4MP6A 3VH4A 1UWVA 3WGUA 1DC5A 1X8JA 1QG0A 5HVNA 4W5NA 4S1NA 5FUWA 1WBBA 2P1RA 4X66B 2QMUA 3REQA 5CDYA 3CISA 2HCFA 1UAAA 1XDZA 2GPSA 5IYZF 2VHWA 3I1FA 2OUIA 1DBVO 1JDVA 1FSSA 3AUSA 3DW1X 4QASA 3BWEA 1E1DA 4HYEA 4IDPA 2CSUA 4FFPA 1E8MA 3T7KA 3UUFA 1QXSA 3FPKA 4CU5A 4BJ1A 3FTFA 3QWHA 4PO3X 4D0RA 2QBYB 2OXCA 3QVVA 1OXUA 5T5QA 3AWIA 2IYOA 1KC3A 4W7HA 2PSEA 4KQXA 1BCRA 4D3DA 2B6NA 4OQFA 5IDXA 2Z5VA 1QIMA 3FPJA 3V33A 2BFFA 4P7KA 1Q1AA 2PWPA 4QSMA 4MINA 3SZMA 2CNWA 4F9GA 1OVMA 4PC2A 1G3QA 2ZRGA 2GB4A 1Z2NX 3C7CB 4Y3UA 2FFRA 3IRUA 4F3RA 5A2QA 3WNCA 3U3DA 1U94A 1RW4A 4PW0A 5J1SB 4HLQB 1LPOA 3GRFA 3OUTA 2IZ0A 4DV3B 1K08A 3WC4A 3UMGA 4NFLA 5D3QA 1XT6A 5FXMA 4Q9AA 1Z26A 2HA2A 5BSKA 1W5BA 4HXEB 4OQPA 3DZBA 2D8AA 2XVXA 2BAGA 4RHTA 4AVYA 2P7IA 2VRCA 4JAVC 3CH5A 1OFUA 2O5VA 3O91A 1L5SA 2GSDA 1E1NA 2Q2QA 5L8VA 1U5BA 2XYGA 2CB0A 1E9VA 2F3PA 3H5AA 5BN1A 5H3HA 3KPUA 4C22A 2A78A 2WA2A 4OKIA 1UPFA 2ZE8A 1L1QA 3LHSA 3O8NA 3HABA 2JNWA 2F3QA 3CSDA 1V48A 1ZGBA 3EIEA 1YACA 1IRIA 3EMBA 1QGZA 3F9RA 1P3Y1 4ISBA 1ODTC 1AKYA 3E9DA 3CB4A 5DBHX 2WJ3A 4A6XA 1MVNA 4DL9A 2MYUA 5AJWA 5IMBA 1SC4A 3RYCB 3SVTA 1JI3A 1NOIA 4ZTZB 1E9BA 3OOHA 1LBSA 2R85A 3DV0A 4JDPA 2Q5OA 3DDNA 4RKRA 3HWX1 5LWHA 5LDGA 2VH1A 4W99A 5IARA 1N92A 4ETMA 1NQXA 2HMSA 5A06A 1V1RB 1LRKA 3N5CA 5F98A 1VZ3A 3EBOA 1YR9A 5TC4A 2X3FA 4NBVA 1CQZA 4BNJA 1Y48E 4XWKA 1MB3A 3C6KA 3ADDA 4FFSA 1VYVA 1I7PA 2VG8A 4MYRA 5D5PA 5AJVB 2PBRA 4DJDC 2C54A 3QBVA 5GZ6A 2XEXA 3TFOA 1O0BA 3BTOA 1OC4A 2C2BA 2JIOA 3IUJA 2BBOA 3KXIA 4KGVA 4O2AF 4A23A 1E6WA 2YQ4A 3B3GA 4HRYA 3G0OA 4N01A 2BLLA 4HWPA 4QLBA 2ZSUA 2KQUA 1UJ2A 2W93A 4JVNA 4YNBA 1Y0BA 1S3IA 4AECA 1SHUX 1X7ZA 2A9VA 2IZ7A 1HDRA 5BV1A 5FWXA 3ENVA 5CXUA 4CEJB 1KRWA 4R1LA 2JVJA 2WE8A 1E2KA 2ZVJA 3O94A 2FPGB 4MQ6A 1BYUA 3CCFA 2YXBA 1N5LA 3CHYA 1TAGA 5ALFA 3MEQA 4U7FA 3MAAC 4TS9A 3ZC3A 4OAPA 2F3RA 4IXTA 4F4CA 2VA8A 2YIJA 4RD4A 4V02A 3G7NA 5A3RA 1UDWA 2I1VB 5C4MA 1TEVA 2ZWMA 3I30X 1TMKA 1VHJA 4IQ8A 1BWSA 2X4GA 3E1SA 4QRDA 4WA7A 2OBNA 1PTJA 4MGZR 1R37A 3FX2A 4MUBA 4WCDA 1CUHA 1J8VA 1GG2A 3A58B 4NX2A 4YS6A 2YV1A 2WM3A 2XB6A 4TV8A 1GA6A 3A3NA 3OIUA 4P3PA 4JGGA 3F4BA 2GEKA 2YOHA 1S8NA 1JHZA 5F4BA 2R0QC 1E7MA 2NO6A 1FTYA 1EAMA 2PKEA 1Y5NA 1SC3A 1HR0B 2I7TA 2OM2A 2PUDA 4ZJUA 1PFVA 7ABPA 2EWWA 5EPOA 5LXTA 2PT9A 1W2HA 1JEAA 5E9WA 1C50A 4I9GA 1O87A 2IELA 4INOA 5EIEA 2V3CC 4JZKA 4RK5A 1ID1A 5HUHA 3ID6C 3RK1A 3RTDA 3Q98A 4WX2B 2UXCB 4DUPA 2XWJI 2PAFA 2X2FA 3OT1A 2YRFA 1WTCA 3VJMA 1E6CA 2XXJA 3GMSA 1SZPA 1G63A 3A0UA 1G8JA 2QN9A 5CK5A 3VC1A 1JAIA 3BRWA 1TM3E 4NOLA 3A8TA 1T3LA 2ZT5A 2FUG6 4U7WA 3HU1A 1JILA 5JE8A 1UINA 4ZOCA 3CNLA 1R66A 2AFHB 2D1SA 3ZHVA 2G06A 1QS0A 1PLLA 4BX8A 2G7MC 5ITVA 4K6KA 3HVHA 4H6WA 2L2QA 4PCUA 3Q2OA 2DB3A 3H05A 2NVUA 5CFRA 4PFSA 2OKCA 2Q21A 3GEEA 3SHVA 1TAUA 1YL7A 2WSYB 5D5QA 1IXZA 1EFVA 3L77A 4PX3A 4IXMA 3EEQA 1VHTA 2PGNA 1AUOA 1XA0A 3AM3A 4N54A 4ZIRB 4QECA 2JHCA 5CD9A 3WGMA 3HI6A 3WLKX 2X8WA 3WRYA 2AOUA 1Z8DA 3K9QO 2F1JA 3O4HA 4TTPA 4Z7OB 1UT6A 3FPSA 2ZYRA 3C7TA 3W9YA 4Q15A 2NYUA 4FXPA 1IL0A 3VO9A 3D4PA 2X19A 3U48A 3ULKA 3ZD7A 4JXJA 1B6TA 4WFKA 3PDIB 3T3IA 3U3JA 1DKNA 3PQFA 3V8VA 4EKEA 5G0VA 2ZIEA 1WG8A 3K9WA 5KKAA 5JAMA 2NXJA 1XF1A 1I7DA 1BXRB 3DEKA 4YRPA 1L5FA 2D4AA 3LP6A 4K9SA 1MDFA 2D1RA 1RPNA 3NNDA 1SURA 4LF7B 4JQYA 2B7LA 1HDXA 4QYIA 4R1UA 1R5JA 4AK9A 3ABZA 5A4AA 3K2QA 3QLUA 1ESNA 1Z16A 1MQ9A 2Z9DA 3MOSA 3C2QA 1ESZA 4ALKA 1U99A 1L7VC 4UNNA 1NTOA 4J2HA 3LZDA 3OC0A 3TZKA 2J4DA 4EI9A 2AG0A 2HL6A 3EDQA 3K72B 2O3JA 1I4TD 3KZ1E 4ZQEA 5ITSA 5JQWA 2VBFA 3AF4A 3MMNA 3RGGA 4DSNA 1CR4A 4IYRA 4GICA 3S2IA 2QV7A 4YMTA 2GKOA 4JYBA 4AN4A 4JKYA 2XZTA 5HKBA 3LECA 5K6AA 4NJEA 1Z5OA 1D4OA 4ZYWA 5K6AC 1TMOA 4R1PA 5E3JA 3K6RA 3TLEA 1FFYA 2PSSA 1LLFA 3IPXA 1C3VA 3MTGA 3N8DA 3DMHA 3O93A 4D4HA 3BGWA 2XDWA 4Q18A 3X1KA 4PZLA 4QXAA 4RFSB 4XPIA 4C0HA 2Z2IA 2A92A 4ZT3A 4QREA 5THKA 1UJ4A 3VA7A 1WUTA 1J33A 3G7UA 3V6MA 1DWPA 4DIMA 4D92A 2ZYTX 2RGBA 1QK3A 2E85A 3N2KA 4XWAA 2DETA 1D07A 3A9UA 3IDFA 3DBLA 2QXYA 3TZBA 1M2EA 4JUAA 4U2EA 4JU8A 4QDXA 3P9PA 4NEHB 3RIXA 5CURA 2BGGA 4JQZA 2WVJA 5KHLB 5ARCA 2BF7A 2IITA 2QMOA 3HUTA 4YDHB 5LQSA 1JEYA 1IZZA 1G1MA 4P58A 3D7RA 4R3NA 2IZOA 4OOEA 4A1FA 5EERA 5DM70 3VKHA 5BNTA 5E7IA 5AOBA 3GUCA 1NE7A 3R44A 3G9TA 1WEHA 3W4IA 5IZCA 1HG0A 1J24A 4MRVA 4ZCRA 4KR6A 1MAUA 3ET4A 1U6IA 2FSGA 1V43A 1EUCB 1VGQA 2RD2A 4Q4LA 1Q95A 2BE9A 3VJLA 4Z4GA 5HUJA 4XAQA 4NEQA 2DBRA 5BN4B 4KQ1A 4DMKA 4X71A 4KNYA 5L51A 2ZM5A 1IOZA 4MQ4A 3ZZTA 1E3WB 4YDSA 5IWCA 5JD5A 4WZBA 3GV0A 1XFAA 1I5RA 3DLHA 2R6R1 2H18A 2JGKA 3EG9A 3L9WA 4TXJA 4GWLA 2DFNA 1UZLA 4B87A 1GLVA 1DDIA 3FSJX 5I3ZA 3DE7X 2DHDA 4CEJA 1GARA 4WT7A 4URXR 3QVUA 1HRDA 2LDXA 4JJKA 1DQPA 4HLDA 1MX3A 4PRZA 2VRCD 4S05A 4B17A 1RMTA 4G0PA 4UKDA 2QROA 4IIYA 3I8OA 2NV6A 4GIBA 4BE7B 4AKGA 4IM7A 3A04A 1SCJA 2B1JA 2G71A 3BCRA 4Y2UA 2YS6A 1BAPA 4JROA 5GONA 1V9LA 4DUGD 1P2SA 4IW3B 3V2GA 5B2EA 1OBHA 3T7SA 5C37A 2P0AA 4M89A 3L0IB 3PE4A 4R71A 4I6GA 1JFFB 3HJAA 3LJKA 5HF8A 3KWJA 1IWPB 1WP9A 5IBQA 1RXEA 2NUTA 3DR5A 4JJFA 4A0GA 3VSEA 3ZHQA 1ML3A 1EVKA 5CX1A 3HTXA 1ZNWA 3LUKA 3I9V1 2GCIA 2FF5A 4M1YA 4ZCLA 2J0UA 3ZIAA 3QUSA 3OAAD 1ABBA 1NQWA 3F5FA 1M1UA 1JLKA 3D0QA 4HDQB 2QN7A 1WVGA 2IC5A 3PL1A 4WXEA 4AN0A 3KALA 5J2UB 3RS0A 2RHWA 3A1NA 4LYGA 2AW5A 1GO2A 3BJEA 4G84A 3L8DA 2X0DA 4DCNA 5AK4A 4ZXPA 4EVIA 4RUKA 4H7IA 1A69A 3TOCA 3ZHUA 2ID4A 1ZAYA 1L5HA 1E3TA 1N8TA 1WUKS 1G6OA 2QMHA 2PAAA 1M76A 1G8KA 5C8YF 3VO1A 4FFNA 3EWAA 1W46A 1E99A 1M0WA 3FWKA 1O94A 3OIDA 3EG5A 5WRFA 3CKLA 2X2EA 1P3DA 4IDFA 4IVQA 5TVKA 2O2HA 1NW4A 1Z88A 1CJVC 3GFVA 3RS9A 5GIPE 4RD3A 3MG9A 1AOXA 3CCBA 5C8ZA 1AKQA 2MMCA 4D0GA 1NVXQ 1E20A 1YGYA 4DYVA 1BE8A 1PG0A 3QI2A 5J5AA 5BSUA 4NDAA 1YK0A 1GSOA 4I5EA 8GPBA 4YXWD 4FGKA 2Z43A 1BFKA 2N0SA 3ZXXA 4KQFA 2UUPA 1H2FA 1ZJWA 3R5XA 3FNGA 1XRNA 2FWRA 4BY9E 3L7KA 3E7PA 1KQNA 3GA0A 5TPWB 3GIWA 2YOFA 2Y4OA 5T41A 2XGOA 2G5TA 4UOZA 2AE1A 2YHUA 5BR1A 2VJMA 3ISJA 1Z2EA 3IVRA 3LG2A 1JLLB 4XW2A 4B7CA 5JTTA 1JDTA 1KPHA 4EUSA 4G37A 3B1ZA 3K4HA 4EYKA 4QXMA 5LQDA 3CONA 2WZCA 3O92A 1ACMA 1NHWA 2FRVA 2PE5A 5K4AA 1IIBA 2YASA 4AZTA 3DFMA 4NCXA 3L5OA 2BY4A 2HWUA 2ID9A 4B7AA 2YMPA 4CQMD 2EGGA 1XVUA 3EISA 3N2ZB 4IV8A 4ZAWA 5BQXA 2YWDA 3OZVA 3KWFA 1EYZA 2IHZA 3EGEA 4OCZA 5KIAA 1DC4A 1NNSA 2QX4A 1C3LA 2IOYA 5L3ZA 1RD4A 1P5ZB 3CZ9A 1FP4A 1PJBA 1Q2UA 2BM0A 2FETA 1X13A 4K0RA 3TXYA 1USKA 1FFWA 3ILYA 4RACA 4JI2B 2WJAA 5LIRA 3RTBA 3R6LA 2ENWA 1ONPA 1T5OA 3F7MA 2CJFA 3ZWDA 2WU3A 1IB6A 4PC6A 4KQWA 4P86A 4PLTA 1EIWA 4QDZA 2OGTA 4ITRC 1AA9A 4YAGA 3U4QB 5CB6A 2O5CA 5KU1A 3H9GA 3I2JA 4X7PA 1NW8A 1GYQA 1IDOA 1JVSA 1LK5A 4QUDA 5D8DA 5IC5A 1NXSA 2I22A 1HY3A 3DDUA 4ER6A 1WUHS 3CJRA 3HZZA 3N58A 1E3IA 4P3XA 4Y0VA 3LQQA 4O2AB 3N3AC 3RK0A 1GFIA 5KNBD 5JVDB 2VYND 4ENPA 2X6QA 3ASYA 3QWBA 5SYMA 1HNZB 4AC9A 1SUSA 2HW8A 4C4OA 3UPDA 5I7HA 3IUBA 4YJ3F 4WPGA 3C6BA 1FU4A 4HPWA 4W5QA 3PRKE 2OQVA 1A3CA 4CE6A 1GA1A 4OQYA 4IFBA 3FSGD 4MAMA 5JI2E 3JQQA 3OBBA 3P71T 1Z4KA 4AY6A 2RAVA 1XHLA 4A6DA 1AV6A 3GLVA 2X5XA 5DKFA 3JQRA 3G79A 2GO7A 3T0IA 2EG5A 2NUAA 2IWHA 4RU1A 1IK4A 1P4GA 5CVCA 5ES4B 1JSZA 1U1IA 3NI2A 3P2OA 1P77A 2AJTA 3I1YA 4YMLA 4QYSA 4UHKA 5CFPA 1T5DX 3RUCA 1VPLA 2GFQA 2GTHA 3MYRA 1J0CA 4LGCA 10MHA 4YJHB 1XZQA 3WXMA 2OZPA 4FILA 3TXAA 3QYFA 3I4FA 1X1AA 2AVDA 2R2GA 2AMYA 2ZAOA 4P4LA 4NAVA 2YV3A 2ZBPA 1XUOA 1FFHA 3W34A 4TWBA 3UAVA 2WB4A 5ALHA 1RYDA 2PKWA 1ZK0A 4YFYA 4BC0A 4ZGWA 4R9SA 1UBJS 5BOVA 1B0AA 3U37A 2C2KA 4Z54A 1ECGA 3OOEA 4OKSA 3KL2A 3L93A 1EWRA 1ZWKA 4LZJA 4B9EA 1AKWA 3HQ4O 2E1RA 4CQMA 2IYAA 5CA0F 4NJMA 2XB4A 3BX1A 1CV2A 1ES9A 1JG1A 1PHRA 1VCNA 2P1DA 2WK1A 3H8SA 3JD1A 3NJ8A 3IR5A 4E2XA 3L7BA 1BJRE 2BCJQ 4KXLA 1DC6A 1Y37A 4Y9TA 5DI3A 4BMNA 1GNTA 3REFA 2RIRA 1P9NA 1CQPA 2AEEA 1J1IA 4EUKA 1AZWA 1Z8FA 4UD2A 5CA1A 1EU1A 3LLMA 2H11A 1MEEA 5K3SA 3VKGA 1A4RA 5TARA 5HQJA 2DKFA 3N7UA 3RYCA 4QDJA 4MLDA 1VIDA 4OAOA 5GJBA 2O14A 2ZBVA 4DR5B 3IPCA 2A5GA 1BNCA 3ELYA 3EQ2A 1XPOA 3EXIA 3VNSA 3EZ2A 2HMVA 5EZSA 1LCIA 4RZUA 4M1SA 3RU9A 2YXEA 3V8EA 1ST3A 5E3HA 3WDMA 4XX1A 2M2IA 3PR2B 4J94A 4LG1A 5KBYA 3BWCA 3EPHA 2FPKA 4PZYA 2VVTA 3C4VA 3H5WA 2FFHA 3FGNA 4IIUA 3N75A 4H4CA 4S1VA 4AMYA 1S9HA 1H2AS 4C2UA 3ZE6A 4J0KA 2BLNA 3HO1A 3NHAA 2SCUB 4KDFA 1U7PA 2FPMA 1DBWA 2UUOA 3C5HA 1JHRA 1SCNE 3LPLA 1OFIA 3SVZA 3VVCA 3DS8A 5I45A 2GFHA 1PR2A 4CLEA 4QT0A 2A59A 2WVAA 1BJKA 2WJVA 1PR1A 2HA6A 4PYQA 4V1CB 1RPJA 1ZA2A 2CMKA 3IEIA 2DFPA 1CUWA 2QLLA 3BZBA 1WMBA 3MB5A 2FPPB 4I81A 4HYTA 2P8SA 4GGPA 4LBYA 3M0EA 1QHEA 3RKSA 1JW9B 2LBPA 1WB4A 3D6VA 4ANFA 4CRWB 2PRZA 1ADGA 1Q0RA 4AM8A 2CHGA 1XN1A 4ZZIA 4RM2A 3DMDA 2YV2A 3HA2A 4QTZA 4LZWA 4KSCA 3EGWA 2V6MA 3OESA 4YV1A 4I19A 3WK6A 1FTGA 4GR4A 1HDIA 3LTEA 3A2NA 1PSDA 2HX1A 4H59A 3EWIA 1MB0A 1Z4PX 3H87A 4MYDA 4BKPA 3FA2A 1ZJZA 4DR6B 1QVRA 3BIJA 3H9BA 3TF5A 4U5QA 4HNSA 4QUEA 5EIAA 3V2HA 3CC8A 2AQIA 1XQYA 4EZEA 3WE7A 4BE4A 1F48A 2C04A 3CUSA 4XYGA 4YMIA 4GG1A 3AETA 1U8FO 4YP7A 5HPYB 4CEHA 1PJ2A 3Q5DA 2W5UA 3WIUA 1DO8A 1JG7A 2VAWA 2E1PA 4DADA 4DWWA 4EYEA 1KI8A 4IGFA 2G9NA 1ZH6A 4KDEA 2W2OA 4LJ7A 2BGIA 5DSXA 1XTJA 2C3YA 4RTPA 1HT2E 3K0SA 2C07A 2C4KA 2JLCA 3BKWA 3OLXA 3C7AA 3W5JA 5AM0A 1YR2A 5LPNA 1QTQA 4OYLA 2WZBA 2WA1A 3ITKA 1Q3TA 4MB0A 4P7FA 2VK4A 1PG5A 3VDQA 3V4RA 1AGXA 4NI5A 4JXXA 4FE7A 4JJ4A 4ADSG 4LF4B 2W2VA 2IP1A 1VCOA 1ZXXA 3DLIA 1P2BA 4E22A 1JNXX 3I61A 4XD7D 5IT0A 5ECGC 4DT1A 5EXSA 1TD9A 1O77A 2QDXA 2XWSA 1P0PA 4MWGA 1L5RA 1SD1A 1FVOA 1SXJA 3GHYA 1XZPA 3KR2A 3G9QA 4IDBA 4NP6A 4MYCA 3VR5D 2IW1A 4YCBA 2BMVA 3GX1A 4FZJA 2GVNA 1ZONA 3CNHA 3HP7A 4QQKA 5LD2C 1O96A 4MDYA 1WMFA 4QG7A 1B6RA 3PA8A 2K87A 5AOAA 4FIZA 3M6IA 5GONF 1EFCA 1NW6A 2FSHA 1BFUA 3DONA 3NAQA 2V6IA 3FOAA 1P6UA 2E89A 4FJ1A 3T3HA 1JJFA 1JHYA 2NSLA 4MUMA 3I52A 2H1HA 4C29A 4PYOA 4MR8B 2B1QA 3MJDA 1FMFA 2YH2A 4R1OA 5BSFA 4HFMA 2OV1A 2XF2A 1KEEA 2MTBA 3AB7A 4QUJA 4OB7A 4BNNA 1T25A 1XZGA 3TZLA 1L5HB 3RWBA 2IVFA 5K05A 4Y2SA 3CUEF 3KR1A 3ADCA 1TLFA 3DZCA 3FFAA 2P11A 4G8DA 4N0EA 4OTZA 5B30A 3HXQA 2HT1A 1W9MA 1NU6A 1JHMA 1HL7A 3GJYA 1Y6ZA 1JIKA 2IDMA 1UPAA 4IY1A 3JD2A 3VJKA 3LKZA 3QJ5A 1Q19A 4I46A 1TT7A 3NPMA 3RHZA 2FMIA 1NQTA 3LXUX 2I5PO 2MSEB 3EUAA 4Q9IA 3BK2A 1LBHA 3SC3A 3TJZA 5MN5A 2RGXA 2ZETA 3JQEA 4LW8A 4R40A 3OWOA 1Q1NA 2Y68A 4XIGS 3UOGA 1BDBA 1CDDA 1J9EA 4PN3A 4QXPA 1A9XA 1GPLA 1FMLA 3GXBA 1SCQA 3BHMA 4Y7CA 1KVRA 3HVKA 1LX6A 1F0NA 3THRA 2I7XA 3JQDA 1V4NA 2AC4A 2OAGA 4HTAA 5BSRA 2FSSA 1V8FA 1JQLB 1UJBA 1MPXA 2NTJA 2X7HA 1F8YA 1K4KA 2CNLA 1F38A 2ZRMA 3PIDA 5KYUA 1CWUA 2Q0SA 4YMVA 2YKGA 5K6TA 4KRFA 1T6XA 3IESA 3CUWA 2D8MA 5AUQA 3RH0A 2GJ4A 4B3TB 2GRJA 1V7PC 1GPDG 1MCZA 2FDRA 1IBLB 1NASA 3DTYA 1ABFA 1B3RA 4IDDA 1GUBA 4OJKA 5MGNA 1N78A 2O8FB 3G2IA 2D5BA 3PT9A 3RPEA 1PJ4A 2RKOA 3D6JA 4ZI7F 4RA6B 2QTWB 4V0QA 2SKCA 1CZUA 1AHHA 5KQLA 2ZSIA 3V7YA 5JBQA 3GEDA 1BSVA 2ZUWA 4RIGA 1KI6A 5KYGA 3KZXA 3OETA 4LRQA 4A4DA 3F8TA 1IFXA 2HB6A 3L6BA 3RWOA 3GRRA 1PE0A 1T3GA 3K0BA 5JPDA 3BMNB 5DPMA 3UF0A 1N33B 3CLVA 2VAMA 2OOKA 4DV1B 3DP7A 4QLAA 4RE6A 2IXGA 2PXCA 1VL2A 1Z0SA 4DYHA 1R6TA 4QVGA 5TQ0B 2M6LA 3VGJA 1W4ZA 3WHIA 3QVGA 2NX2A 3CPEA 4G36A 4EG8A 4QG3A 4KK4A 4UPDA 1J20A 4MARA 3T5PA 4TX1A 3TLXA 3VU3A 5ULLA 2ZPUA 1SBYA 3L7LA 3SLGA 5AJHA 4PE5B 3E4DA 1P2FA 1T1GA 4ZVNA 4PG8A 5KJ1A 5L3VA 3BE8A 3WL7A 2P5TB 2PSFA 3FOZA 2VNAA 3AIKA 3S5UA 1WDLA 1ZL0A 3CPSA 3I01A 4R3WA 8MHTA 1R0YA 2NNWB 2QSJA 1GRRA 1R18A 4LRSB 4XUDA 4BU1A 2I6TA 2ANCA 2H85A 4GI1A 1W73A 2Q99A 4FUQA 4MHOA 4Q01A 2A0KA 1QPZA 3AINA 1W0JD 2P9BA 3QOFA 4HDMA 2ZYWX 4OYHA 4RMNA 4Y6LA 5G3YA 3SICE 2JB9A 4W7SA 1F8UA 1TUBB 2WD7A 2XE6A 3GAFA 2CF5A 1GITA 3K8ZA 5IJ9A 1WVIA 5L53A 1QO7A 5L9AA 1E0SA 1YGPA 2VPYA 5BORA 1UUFA 3ZUPA 3OMLA 2JA1A 2PH7A 2Z98A 1ZRNA 5FPHA 3VUFA 1SCBA 2BGWA 2ZI3A 3EDRA 4REQA 2X4LA 2Z30A 3G1TA 16PKA 3E2MA 1HEYA 2WT4A 4I1SA 2ZSJA 1QH0A 4K9NA 2OV6A 3K30A 3A1CA 3N8HA 4PICA 1Z0UA 3M89A 3EFBA 2VDPB 4YLYA 5KQSA 3DVLA 1L2TA 3GIDA 3IBCA 4NAUA 1J97A 4IIJB 1JVNA 3TZHA 3KVNA 1JT2A 1ZGAA 4WXYB 3SBEA 1KAQA 1JR3A 4YQYA 2DUUA 3VRHA 4A8JA 4ZI2A 2R6ZA 4W5WA 1XRQA 3OFJA 3UAOA 3VKFA 1PJLA 2D1FA 1HQYE 3SR0A 4GMKA 3U7FB 4I55B 4TGLA 1YU9A 4J3JA 2ZB2A 3JRWA 4OHMA 5A3VA 1I4WA 3G8DA 3T1QA 3T61A 1UXKA 4GMHA 4MI3A 3TSWA 4M7RA 3IHKA 4XUCA 5DLYA 2WU4A 2QMQA 5DEOA 1MRNA 2LUOA 3WTBA 2QV0A 4BNIA 5HHTA 3Q8KA 4ID3A 1MP0A 3UMRA 3SJCA 4BRSA 1ADCA 3B13B 3EC2A 4QGGA 5FIUA 2ZQZA 3I2YX 4FDAA 1W76A 4PEVA 2IU3A 2PEYA 4Z53A 2ESRA 4A36A 3QE0A 5E4JA 5EKXA 3NVKI 1YUNA 3B3FA 3DG9A 4XJVA 4EYOA 1K6XA 2O7VA 1V8DA 2Q46A 2ZTUA 4O1MA 4A8TA 3F1KA 4ENQA 1HLGA 5CM9C 3I1IA 3LY7A 1N2OA 4W5TA 1PZXA 4E2ZA 2PKCA 1V8PA 4IQGA 4JLBA 1RRPA 4F60A 1B8OA 4YJFA 2EF1A 1HH4A 1L4HA 5LQMA 3M5DA 1TJ3A 2OO5C 5BMVB 2ZG6A 3QW4B 5EYPB 3JQ9A 2VHTA 2OR3A 4MKHA 3N0RA 1B7GO 2NYRA 4FFWA 1XZMA 3BDVA 3FOBA 2B98A 3K05A 4J4BA 4B7XA 7YASA 3FETA 3ZDZB 4DBLC 3FTEA 3WGTA 3L1JA 4Z0HO 3M1LA 1V35A 1LV8A 3L8FA 2Y0PA 3FHCB 5A62A 1CP3A 1L4KA 4OATA 1PFYA 4CM9D 3D3WB 4TWIA 3HL0A 3ORFA 4F2GA 2QN2A 4X7BA 3H65A 1SRRA 1N4DA 4WNAB 2OB2A 3VTZA 4DMGA 4IEIA 3VR2D 2R00A 2Q1YA 2FSIA 1JU9A 4NCHA 4KAJA 3HCCA 4FZ3A 3VPFA 4B40A 1KEUA 4J07A 4HMOA 2AEFA 3MD9A 2WKWA 2GJKA 1XZFA 1R10A 3Q3CA 4WLEA 4WNIA 2B9VA 4EF4A 5EJ5A 5SY9A 4HP8A 2JIDA 1VM6A 4Z49A 1N25A 4HGYA 1DHRA 1HOTA 3MGBA 1Z2DA 3CR8A 1BC5A 3HPQA 5CT4A 2BHTA 3IT1A 3SEZA 3P0RA 4AF8A 1IJKA 3GK3A 3GT4A 2DTXA 3HCOA 3HNOA 3WDLA 4BTLA 1CFZA 1XMSA 3PLAE 2CLHB 1J0BA 4Q7KA 1O95A 4EHHA 5KX5F 5KWSA 1A95A 3J7AC 4L73A 1SKYE 3LWBA 2HDOA 2JLZA 3CUYA 3PWKA 2AUMA 3G0HA 3NBZC 4YCNA 3O2QB 4KPYA 3HUDA 3O1HB 1YWGO 3TAUA 4HC4A 4MYSA 4WFJA 1WU8A 2P79A 2VP5A 2AQHA 1B0ZA 5ELMA 4J0HA 1JQBA 1ZYUA 2J9ZB 2V8OA 4A26A 3K70B 4CLRA 1Z38A 2FJPA 5BR4A 3CA8A 1T8PA 2VHUA 3DMGA 3QA9A 1XAIA 3GGCA 2HPZA 3NC4A 3LTNC 4ZGGA 3R3JA 3GO4A 3TSAA 5FHQA 3N0WA 5D51S 4LVCA 4YC7A 1V9CA 2WF9A 2BT4A 4G1MB 1QFYA 2EBUA 1PT6A 5C3UA 4DT1B 1GCIA 4MVJE 3R40A 3IE0A 2VAVA 4PFQA 2MJLA 2R6DA 4JVLA 5EWLB 5AKZA 3SDBA 4LC1A 1QUEA 1I7NA 2XNJA 4DCTA 3KP1A 3HFRA 3AHHA 2FQWA 4EB6A 1K3FA 2W83A 4ZVTA 4GBED 3W8NA 3HXLA 1XBTA 3U5ZB 4EVRA 2BFEB 2A5YB 3FYDA 1ZUD1 3HGQA 2GWRA 3CVOA 4HAVA 4N39A 1ZVMA 1VE3A 1DBPA 2LDBA 3B8HA 3O4RA 1H6AA 1JJ7A 1UFOA 4XJXA 1N77A 1G8HA 1XNQB 3QX3A 1T9GR 2B5WA 2JRCA 3G1WA 3PUJA 1AKMA 4XFDA 4BEWA 4J16A 4M55A 3VDRA 3CMMA 5E6RB 3T99A 4PO1A 4G8CA 1CR0A 1I0LA 5F2KA 1TA4A 4N0MA 1H6DA 2W2NA 5JMOA 3N87A 3JARA 1XTSA 3JSXA 3OZSA 4YTEA 2UXDB 5A9SB 3LDGA 2RHDA 4JLWA 3GA5A 2JJ1A 3TIVA 2GN8A 4NCNA 5I9LA 3C8DA 1O5IA 2B7CA 2C7GA 1EJBA 3JRXA 5GJVC 4YV7A 5KYYA 1ENOA 2I4MA 2EKQA 2VHZA 1MMFB 2YINC 4HWOA 3QIAA 4D3ZA 2YMMA 3EBPA 4E5VA 2I3AA 1JJIA 2PVPA 3UJHA 4RWEA 4WBSA 3KWLA 5IEBA 3AR7A 3TLBA 4U0KA 4PBTA 2JEZA 1Z2AA 4EG7A 3ZU5A 4C5CA 3DPUA 4UVDA 5FOUA 2BH9A 3OKFA 3UT0A 1C0PA 5T8KA 2IYWA 3KLPX 4UNQA 4REQB 3W3AH 1V11A 2XVAA 2F62A 4EPWA 2G1UA 1KBOA 2YWBA 2HF7A 3H7IA 1RLIA 3PGA1 3RRJA 1VHWA 3JAWB 3MT8A 3OLWA 5L4NA 5I8ZA 2R2AA 2BFPA 2XR1A 1NPDA 3OOYA 4BKQA 3D4IA 2FE4A 1J9ZA 2E4UA 3AY0A 3IAS6 1SMKA 2QYOA 4DXHA 2QSZA 3S3TA 3SZ3A 2ATXA 2CDBA 2RGGA 3HLTA 5BVHA 3SXJA 1QYWA 3VSBA 5FPQA 3LI2A 3RVQA 3TLGA 2B37A 3MOGA 3UENA 3WK7A 4EA6A 1YR6A 4FLMA 4A10A 1W59A 4HVCA 2I2DA 3AB8A 2P9FA 2CHUA 3AR8A 3DWEX 4M8SA 4NTZA 2VQ3A 5CDFA 3IQIX 3TTYA 5IAAA 4UEQA 4ZTUB 4DDMA 1LNZA 2IQIA 3ND5A 3RVNA 4EM6A 3HCWA 4O2RA 4TMKA 5KNLA 3DDOA 2ZJ3A 4ZFNA 1DADA 3GT7A 1Z0JA 2AWNA 1BE6A 1G8PA 1YJCA 4LNUA 1GLGA 2G17A 2NAFA 3EDOA 1A4UA 1KZ4A 4WY2A 4BLVA 4ZQHA 3FSEA 1BQEA 4BX2A 1LRJA 1NW5A 3DPIA 2XGMA 2O1WA 4C3VA 1DJMA 5EE3A 1CZOA 4LEIA 5AI5A 2RDMA 1JR3E 1VBNA 3SC6A 4Z9YA 4OM7A 5F7OA 1ZK3A 1WQ1R 3WS7A 4RWZA 5FDFA 2PUBA 2VWPA 3JV7A 3BB1A 3WLEA 1KEZA 4D9BA 5BY2A 1RZVA 1T5IA 3CSSA 3DE5X 4I6EA 3BGVA 3EAGA 1Q17A 2I8CA 4TKUB 2XA9A 4QPZA 5CDUA 4MVJI 5KMGA 2FVYA 1VGVA 5AIAA 5B6PA 4RQBA 4H4DA 4TKZA 4BXOB 4E21A 1QWOA 2YWRA 1SU4A 4IRXA 1IVYA 4J03A 1QONA 1L5MA 4V2IA 5KQPA 1ND6A 2JARA 2PFSA 2WAYA 1L4LA 4QRHA 1TYZA 4U6QA 2DRIA 2WKSA 3TOXA 3P0HA 4Q16A 1IUNA 2FJUA 4CM1A 4IEFB 3JQ8A 2RHJA 4XLTA 3AERA 3I62A 4FFRA 4ZT4A 3FRHA 2IEYA 3S7TA 2O2JA 2XIJA 5EJIA 2X23A 3U6BA 1AY0A 3R7LA 2CC2A 3N53A 1TFUA 5CM8B 1U63A 1JDPA 1O94D 5EIHA 5CFOA 1BXRA 1MO5A 4HRVA 2Q8PA 2GZRA 3IA7A 5FCDA 2DSTA 3MM4A 4BE9A 4WFQA 4J8PA 3N2GB 2HK6A 2PL1A 4EPTA 3WNDA 2YBEA 1UADA 1NR7A 1O54A 2WF6A 4HAZA 4YAWA 4ZOBA 3FFXA 1U4OA 3IOMA 5KOHA 1YIOA 1OC2A 2QQ5A 1A2BA 3EXEB 1GYRA 4O1IA 1MHTA 4JWTA 3KSUA 1QH8A 1H4VB 1JQJC 2JW5A 3B5JA 3BUSA 4AY2A 2QY9A 4WZZA 1BROA 1U1CA 2WY2D 3F97A 1DJLA 1EVIA 1XP5A 2J9XB 5IVPA 3F6YA 1QE0A 5TMBA 5LDHA 4DLLA 2YWCA 2GLXA 5TVGA 3H1TA 4FKBA 1DIGA 3STUA 3VHXA 1VKZA 5KS2A 1JU4A 1AE1A 3ZWNA 2FW8A 1EUDA 3TX2A 4F45A 4HN4B 1TU4A 1NI4B 3QXGA 4UUPA 4HJXA 3MVEA 3DCJA 4WD3A 1T13A 2WJ4A 2AFRA 4ZVSA 3RWMB 3V2UA 3PC4A 4MGHA 4C4ZA 1SXJB 5FBRB 3C1TA 3BIOA 3C3AA 1A82A 5CHEA 3QOXA 4YJ2F 3UATA 4MV4A 5T67A 3QYAA 4OQEA 2FR1A 2QTNA 1WUIS 3I6QA 1Y34E 5E9QA 3F6RA 4EUEA 2QRMA 2AFHA 3EUFA 5ALTA 1BMQA 2GETA 2Q3HA 3C4JA 4ZVRA 1ZD4A 1VCIA 2A9QA 1MQAA 2HMAA 2HU8A 2W9XA 4LYHA 4QAQA 1WNTA 2D7CA 1JEOA 1QK5A 1SBNE 1DRUA 2H1WA 4LXIA 4UNPA 5TB5A 4FONA 2YZNA 2AC7A 1DAIA 1DV2A 2WLTA 3CX6A 2ZTSA 3L9XA 5J59A 1QLJA 1N2XA 2WG1A 3E81A 5K0NA 1E1RD 3U5TA 1GQ2A 2BRUA 3QA3E 4JYPA 4N65A 1DP4A 1HQKA 4Q7EA 3SXUA 3HBAA 3R20A 2CKMA 1PVVA 2H5IA 1O8BA 1P5JA 1UIMA 4OHXA 2ZXEA 3DOHA 1JIXA 2C42A 1WR8A 2XF8A 3TOVA 3AF0A 2INGX 2PTHA 1VHLA 4GF5A 1HKHA 1K8YB 2BCGY 3GNTA 1BDJA 4DSTA 4ALMA 3OCVA 4QULA 1QANA 1UXHA 3GQVA 3T8YA 3N8IA 3PLNA 4NE7A 4PINA 4DNPA 1V6AA 3TVTA 5JAZA 5C53B 3PXXA 3UV6A 3L0BA 4RPCA 2WU0A 2CB9A 3O8RA 2CXUA 1GLNA 2YJNA 3HCRA 4L8VA 4JU9A 5A71A 2R86A 3K20A 4O4HA 1KH1A 3SU8A 4PGAA 1CNFA 1L1EA 2V7QA 1X7DA 3P2EA 4LHSA 2ACKA 3QLJA 1Y4DE 4Y1GA 3U19A 1YULA 5HIIA 4F72A 3WWOA 3HDGA 1Z83A 2GILA 2CUNA 3P27A 1T9CA 1EK2A 1JQ3A 1SXHA 1E2NA 1UC4B 3KT3A 2WR8A 1TRKA 2GZMA 3LA8A 2WHPA 2G9ZA 3MTJA 4IHJA 4WRRA 4QL3A 1CY4A 1ZS9A 3PFBA 4Z8XA 1OH6A 3PQCA 3BQMB 4XB2A 4DM3A 3CRNA 3ED5A 4LC0A 5FHRA 4W5RA 2C7PA 2FUCA 2HMYB 1L6RA 1B0UA 4U2KA 4D4LA 3K7EA 1JWBB 3ZQ6A 4B3XA 5C1PA 2GD2A 1RVV1 3ESYA 3JQGA 2CVQA 2P3SA 3BULA 4O4IA 4U5XA 4R9RA 4LWZA 3TM4A 1T4DA 2BMWA 4E14A 1R8SA 3PICA 4KXQA 5E6UA 3GNLA 5HKKD 4D5EA 2GYYA 1QFJA 1NT4A 5A6SB 2SICE 4D45A 4E88A 3K8QA 5EJ9A 4I50A 5FPYA 1KFJB 4LBWA 5I4BA 2IYEA 1HQCA 1MABB 2CVPA 2O3TA 1J6UA 2PUJA 2R7MA 3DWFA 4GZLA 4H16A 4RF5A 4GYWA 2O0HA 4QFCA 4TMWA 1DQRA 1QQ7A 3W6UA 4UVIA 4UTVA 1Q3HA 3ZHZA 3H97A 2ZYGA 3HBNA 1PT9A 1V3VA 4RIIA 5KOYA 4GL4A 4L5JA 1M2VB 1DEXA 2EQBA 3AV0B 3OM8A 3QZUA 5KTTA 1FVHA 2B3TA 3FCEA 4X85A 2FAXA 3TQHA 4NAHA 5HOQA 1PK7A 4E4TA 3A9RA 3KWMA 2MHCA 4FK8A 2A9KA 4CF7A 4Q9KA 5A0VA 1U0LA 3D8UA 1QGYA 2DULA 4HYYA 3IVGA 2QVXX 4RH0A 5MGBA 1PGPA 1NJ1A 1DC8A 1QH1A 2B0JA 3PUZA 4NICA 3W4KA 4JBXA 5FBHA 4O2BF 3VHLB 5A1JA 4YAUA 3HUFA 2E9SA 1C0IA 1FS5A 1JR3D 2V65A 4ZVPA 1PV4A 1M1ZA 5CAEB 2WJZB 4FCCA 4U3JB 3K35A 4F71A 3JX9A 2CHEA 4ZOQI 6REQA 5LYJB 3KKNA 5C8XA 1E9RA 3ER6A 3AF1A 1IG0A 2XZPA 3BTVA 1F1BA 2YDYA 4M9XA 1CYEA 4FFBB 1T3TA 2NO9A 1M6HA 5T8KC 2ZXUA 2BFCA 1DCMA 2Y1KA 2A1IA 2ZULA 3SYKA 4KQHA 2PMWB 4JCCA 2OHHA 1CLEA 2D62A 4JX8A 4R2KA 5BT9A 5M3BA 3V48A 3CZMA 2QL9A 4X8HA 2W7TA 3WNZA 3FZEA 2B4KA 3ROZA 4IHKA 2WAOA 5TEWA 3S1SA 3AVOA 5KKNB 1FFXB 3HVRA 1F8FA 1D4AA 3E22A 1XJWA 3WIEA 4DZZA 2RGDA 3NPAA 3K5WA 4YRKA 2ZR0A 1W0JA 3INYA 4N4AA 5FBVB 2GF0A 3E9RA 2CNBA 4RLHA 1G3UA 5DWDA 2AJ8A 1KZGB 2ZJOA 2VJQA 2NNLD 3R5HA 4HR7A 2HYDA 3M6MD 3VPDA 1YRBA 1UC8A 3IV9A 3DC7A 4HS9A 4X54A 1Y7LA 4OMFG 2HWXA 4MI1A 5DW3A 3NWPA 3U7IA 1EI9A 3IOEA 4M7OA 4C7BA 4DUZB 1ZG3A 1ZWLA 2C31A 3MCTA 5DWVA 5JLJA 5JSZB 3OQIB 2BSQA 3GGPA 3QEMA 5AWFC 3WBBA 4KXXA 1M2OB 3V42A 4ETNA 1KDTA 3OT4A 4CKEB 1CR6A 3VR4H 4L4XA 1O4WA 2IHKA 3ADPA 2Q9UA 3TR6A 4DEXA 1X7XB 5GOZA 4BZZA 4BLSA 3C3KA 3A1TA 1N6LA 1T4CB 1IOVA 2D2IA 1OYYA 3W05A 2FUG1 1PZNA 3ZWAA 2NTYC 3EOBI 4NENA 1MDBA 2AF3C 1DKRA 2VZ8A 4UFPA 2CBGA 2ZGVA 3UAWA 2NU6A 1L7EA 4P3OA 2CLMB 5K8UA 2GN0A 2EARA 5IX8A 1U3DA 4BFXA 3KJXA 2RC5A 3ROTA 3ZEAA 3TR5A 3FMIA 1YQTA 3WLIA 4BEVA 2I2WA 5HXAA 4AO8A 3F98A 5C0OE 2G40A 2ZJ5A 3KE9A 2QLNA 1LBQA 3PNVA 2AXEA 1EFTA 4MWEA 1KOGA 1P4SA 1F2TB 4RV9A 3NYRA 1HGXA 4Q3BA 2JCXA 4U8HA 3MNFA 1VP3A 2CFRA 3ZS8A 4RIFA 4BBJA 1IJEA 1PNOA 4E3ZA 4EUNA 1SVOA 4B8YA 3LWDA 4PAOA 4LKOA 2V9PA 5D87A 1OZGA 3GAAA 1FB5A 3JALB 3UAZA 2Q3CA 5HKKA 2H08A 3T3GA 4BPBA 4L6AA 4EYSA 4RIEA 3AKDA 1XMQB 4BN0A 4EB3A 1JAXA 4FEEA 5DXFA 2KE5A 1WCIB 2X77A 5CDGA 2KM1A 3CLSD 1THGA 1H2HA 4ZREA 5CDFE 3VZSA 2YN0A 1EDDA 3HSSA 4UHBA 4Q66C 5CYOA 1IZ8A 2FCRA 4PS1A 1SJ9A 2J9FB 3B53X 1UOEA 2ZJZA 3FOWA 3M4YA 1NA5A 2C5LA 4GX1A 2QRPA 4HNRA 3TSCA 2RHLA 2FRDA 4I4TB 1RHQA 2VCEA 2M98A 4MUFA 3KOZA 5HMLA 2ZJ0A 2J67A 3IXMA 1Y63A 2CMDA 2QVZX 2QQGA 1E3LA 1GPYA 3Q7PA 5JHHB 4UEWA 1KAGA 1CZNA 1AURA 1RRVA 2P0EA 2PXAA 1Z75A 3NHWA 2AG6A 3EG9B 1JHQA 3K0FA 1N0VC 4YASA 4BQRA 4YT5A 3N9IA 3BFKA 2WTNA 3CNNA 1LH0A 5DLEA 1SG0A 1OWMA 4L5CA 2EQAA 2VK8A 2EJWA 3KYBA 4OB8A 3DD1A 4PF1A 1DTEA 1QTNA 2G5PA 3HNRA 4GOXA 4QU9A 5D2CA 4OQ4A 2VLBA 1ZLYA 3RS7A 1MRZA 4FW8A 4MW2A 3WGQA 1YB7A 1DUVG 2BUCA 2HMTA 1HI9A 4AMBA 2H54A 2OK7A 4DLAA 2D5CA 1X14A 1N8NA 5ALJA 4QM6A 2DBQA 2ATCA 2Q45A 2DHQA 5H9VA 4E4YA 1YR8A 1JX6A 2R6CA 1DJPA 1SOUA 2GFIA 2OCDA 2DPYA 2LVBA 2QM0A 3QXHA 4I9HA 2DX7A 1SGWA 1A8UA 4DDWA 1LK0A 1K8RA 4NFSA 1GNQA 5LOVF 2X86A 4CZ2A 4BWFB 3H19A 5SV2A 2OO5A 4J0JA 2Y1LA 2EJUA 2Q9AA 4QGSA 2NUTB 5DN6A 1O4VA 4OFWA 4PLPA 3HKDA 5K01A 2Z6VA 3EZFA 3INTA 3OI7A 1WMSA 2TMGA 3QWAA 5CX1B 5G4KB 5HM8A 2PGJA 4KQMA 4YRJA 1DUSA 2WJJA 1T5LA 2RHOA 2HU5A 1VE6A 1W5AA 3QVJA 3RYHB 4F4IA 5C32A 5IAGA 1ZOIA 1H8EA 2J5QA 3RLFA 5IG2A 5HS4A 2I4LA 3A3YA 3I9JA 3JQBA 3NNNA 1JG6A 3KG2A 4DLSA 2OILA 1KJZA 4QVIA 1PR0A 2Z6QA 2IK8A 3V8PA 3I34X 2XWPA 2JK1A 4CPDA 1SKAA 1QBKC 2ZWOA 3AESB 3RYFB 1KU0A 1RWOA 3TNYA 1G2PA 3JCZA 3WISA 4JHLA 3BL8A 4LMAA 1RAEA 1P2VA 5AVJA 3ZLJA 2I91A 2O8BB 5K0FA 2QU7A 4DF3A 5C1IA 5BR7A 3K71B 5IJ0A 3QI7A 3OPYA 3VOTA 4NMLA 1QZTA 2FFQA 5DXJA 4DDTA 1UMDA 4RY2A 1TQ4A 5D85A 3VC7A 1ZNYA 1EGVB 1FBTA 1CHDA 1ISSA 4CMGA 5B1IA 3I05A 4OL9A 5KVVA 3COPA 3IAHA 4CR8A 2ZIFA 3P19A 5P8WA 1PFKA 2QEQA 1NN0A 3FM9A 3OLYA 4KGZA 1H3EA 2IHYA 3RTGA 4N7BA 2I4NA 5BV2P 3OM1A 4JBLA 4Y0NA 1B43A 3GPIA 3KXLA 4GLBA 1OV6A 2F67A 1VCMA 3TRHA 3UMVA 4EA8A 1BW9B 4NMWA 1V0JA 3LY5A 1A72A 1R00A 3L8GA 4POOA 1E2UA 3DOCA 3ISVA 3CKMA 3KQYA 5GP1A 1T6NA 2JFUA 5JS1A 1RI4A 1L8LA 3JD0A 4G56A 4CDNA 3Q88A 5TPZA 2B8WA 4UNSA 1MXHA 1Y8AA 3RSHA 5H7XA 3X0DA 1D2GA 2OBMA 1S3FA 2HH9A 1F0KA 2FPWA 5E9JA 1RAHA 2C0CA 3EVAA 5AI4A 3T4EA 4L4RA 4BBZA 3GFSA 3EF1A 3L43A 4NYJR 1U3GA 5TT1A 1XPRA 4RTMA 3PWSA 3U6KA 1TKRA 5CJPA 3O8CA 3ZWPA 3LC2O 1RYFA 2QLMA 1GSAA 3L1KA 721PA 1H22A 4F4UA 3SFVA 4LHEA 3C3XA 2O0JA 1XTKA 3EMKA 1HFKA 1O08A 3HG7A 3LUPA 2ZAIA 2VHEA 3ILVA 2DU8A 4KL8S 4BGEA 4FHZA 2R7NA 3LQYA 2Y1GA 3ITDA 4FKMA 3DZIA 4TS1A 4CDGA 1CDEA 2ECKA 5KYKA 2ASEA 3HDJA 4IKOA 3O0DA 1ZMTA 2C5GA 3GHHA 5HFNA 5TE9A 3HJRA 1MU0A 3BH0A 4QBGB 1UOOA 3V4PB 1U9IA 2GX6A 2O2XA 1YS4A 3VX4A 1FYVA 4YALA 4K9QA 4ZAVA 2VQDA 3AU8A 2WIKA 1OTXA 4KO8A 4RY9A 2VJCA 1PEKE 2BHLA 3ZDRA 4XQCA 3V4VB 1CETA 1I2DA 1NBEA 2AI1A 3IEVA 3T9CA 4RTNA 2RGAA 3UUWA 1HZJA 1YJBA 1RWXA 2D0OB 3HYTA 4HWSA 3SSOA 4C7JA 4E0BA 4YRAA 2XRYA 5HZKA 3W5BA 3ANLA 4Q4HB 5HKLA 4DCMA 2QG9A 4V3BA 2FQXA 1BA3A 3PGVA 4YRBA 3OQJA 5D3MB 2VPZA 1B6SA 2KBEA 5I7RA 4ESEA 3THWB 1QDLB 2QY6A 3EWNA 2P4UA 2BEVA 5M2QA 4EO7A 2PUWA 2PR7A 3DCIA 4RKQA 4B80A 5HCIA 2Q5FA 3DVSX 4Q47A 5LYYA 1C41A 1K2VN 3I6IA 4ZAYA 5LQNA 3E9NA 4DAOA 1GQOA 5CT6A 3GJ3A 4M88A 1J06A 3T3EA 1QLWA 4ZO9A 4AX4A 3AHDA 4UQLA