1C7FA

D95e oxidized flavodoxin mutant from d. vulgaris
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
147
structure length
147
Chain Sequence
PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKVACFGCGESSYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Crystallographic Investigation of the Role of Aspartate 95 in the Modulation of the Redox Potentials Of Desulfovibrio Vulgaris Flavodoxin
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Electron transport
total genus 50
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1c7fA00
2R97A 4CETA 3QFCA 3ZHOA 3QFRA 2BMVA 2QX9A 4QOFA 4ZVKA 4LTMA 3ESZA 3NHKA 4LTDA 5FA6A 3OVMA 3JSXA 4LA4A 2ZKIA 3NHSA 1YDGA 4N82A 4QOEA 3B6JA 3HA2A 4DILA 3ESYA 1FX1A 4YAFA 5NLLA 5LJLA 4R81A 4GI5A 4C0WA 1FLVA 2F1OA 2BPOA 4ZVMA 5EAIA 3ESXA 2KQUA 1D04A 3TEMA 2GSWA 2QX4A 4U7HA 3P0RA 4HEQA 2RG1A 4FGJA 1FUEA 4QODA 3HR4A 1XI2A 5BUCA 2B3DA 1FLDA 1J9GA 1AHNA 1SG0A 2FVXA 2QMYA 1RLIA 3EYWA 1AKWA 3EDOA 1RTTA 2OHHA 5F12A 5B3KA 3O2NA 2Q62A 5LBTA 4QOJA 1DX9A 1GG5A 4CF6A 2MT9A 2FZVA 1CZRA 3NHRA 5LBUA 1ZWLA 3U7RA 1QHEA 3B6IA 2M6RA 3FW1A 4FGKA 2XODA 1DXOA 3B6KA 2BZSA 3TE7A 3OWHA 1OFVA 4Y9UA 4Y7CA 2X2PA 3F90A 3NFRA 4ZVLA 1QRDA 3NHPA 4ZVNA 2WC1A 3UXEA 4F8YA 4QOGA 1B1CA 3U7IA 4N9QA 1TIKA 2BN4A 4PU0A 1AMOA 2BF4A 3OWXA 2KLBA 1AKRA 4ESEA 1DXQA 3N3BC 3NHLA 1FLNA 1RLJA 4H6PA 3F6SA 2MOKA 5TGZA 4C0XA 3K1YA 2OHJA 3W78A 1D03A 2MWMA 4XDHA 5A4KA 2HNBA 1WSWA 4LAFA 1J9EA 4C76A 1XT6A 3L9WA 4H2DA 4FGLA 4J8PA 1YCHA 5NULA 1J8QA 3OX1A 4YAWA 4C14A 4PTYA 1RCFA 2R96A 4YALA 2V5VA 2QWXA 2W5UA 2Q9UA 3F2VA 3K20A 4BMPB 2HNAA 3UXHA 3OJWA 3N39C 3W79A 2FCRA 1XYVA 1AKTA 2FOXA 3FNIA 4XDGA 1AKQA 1I1OA 4PTZA 4M0CA 3NLLA 3R6WA 2QMZA 5ULLA 3SVLA 1E5DA 3FX2A 3ES9A 4NULA 4OXXA 4HS4A 1AZLA 3FVWA 1JA0A 3N3AC 1YKGA 4YAUA 2V5UA 5EA2A 1YRHA 3O73A 4D02A 4DIKA 4N65A 3NHJA 3B6MA 1TLLA 3OX3A 4QOIA 2FX2A 1C7FA 4U7GA 2V9CA 1VMEA 1NNI1 5LVAA 3KLBA 3TZBA 3GFRA 3NHUA 4ICIA 5FUQA 3KAQA 5LMCA 1D4AA 2HPVA 3QE2A 1BU5A 1CZHA 1AKUA 1CZKA 1AG9A 1T5BA 4U7FA 3HLYA 1H66A 2FZ5A 2FAXA 3LCMA 2FLVA 2XOEA 2D5IA 3GAMA 1FLAA 3KEGA 1C7EA 4S24A 6NULA 1CZOA 4YAOA 1CZUA 2M6SA 2Z98A 3S2YA 1AKVA 3NHWA 3D7NA 3W77A 2N1MA 4DY4A 5EMNA 3GFQA 3G5MA 1OBVA 1KBQA 4LTNA 5LLDA 3L9XA 1WSBA 2ARKA 2QX8A 1JA1A 1KBOA 4GR9A 3OJXA 5FX2A 1X77A 3LT5A 2AMJA 5JROA 1CZNA 2OYSA 1QBGA 1YCGA 5F4BA 1BVYF 4YQEA 4BMOB 1V4BA 2FDXA 4GQIA 5LJIA 1SQSA 1CZLA 3FJOA 1YOBA 2QX6A 1FTGA 5F51A 4Y9RA 4FX2A 1T0IA 1F4PA 4QOHA 4NLLA 1FVXA 3KAPA 2OHIA 2X2OA 1XYYA 2Z9BA 3NHYA 2Z9CA 1OBOA 1ZX1A 3GFSA 1YCFA 1ZWKA 2QR2A 3RPEA 1J9ZA 2A5LA 1QR2A 5B3LA 3OX2A 1H69A 3F6RA 3W7AA 3NHFA 2MTBA 2Z9DA
chains in the Genus database with same CATH superfamily
2R97A 3ZH9B 2GPWA 1XFAA 2YIMA 5EKUA 3KLOA 1SK8A 1QE0A 3QFRA 5J5AA 3I28A 3PHIA 5AW0A 4D3ZA 4LG1A 1XZFA 1UM8A 3PQ5A 4Z53A 3CUKA 4EL5A 2W9XA 4TMVA 3W1VA 3DEKA 2IYSA 3K73O 4U00A 3C3DA 3Q11A 5ALPA 1NVWQ 4MCAA 2I80A 2REOA 3N53A 5D1NA 5TPZD 2IE8A 4G5QA 2OAGA 3TIFA 1T4GA 4LA4A 3I2HA 4RKQA 4TS1A 4ENSA 5HKKD 4O3MA 3ZNOA 3F7MA 3HS3A 4E5DA 2UYOA 3GJ8A 3V3KA 2FE1A 4P92A 3DEAA 3UH0A 2UVQA 2AN3A 5HPYB 1WF6A 3ROQA 3OU7A 1F3LA 1VFPA 3LIIA 5IM4F 3PFHA 4BGEA 4G0XA 4QOEA 3H11B 5JYDA 2JG3A 2O5VA 1DV1A 1HLGA 3PXCX 4AF7A 4TM7A 4CW7A 3EXAA 1XZLA 3O8LA 3PVZA 2X8BA 4TV8F 3HO1A 3BICA 1I6WA 4L4ZA 4PG7A 3M6UA 5J9FA 3L4BA 3UJ9A 4XDYA 1D2HA 4PO1A 6REQA 2R5FA 1CV2A 1PFKA 3CZAA 4BP8A 4W7SA 1Z4LA 5D5PA 1W29A 2BPOA 3T9FA 4W5RA 1UBFA 1BH2A 2WJYA 3GPCA 3D5TA 2QENA 2Q45A 2FSPA 1SB8A 1TI7A 4DJFC 4KDEA 3W5IA 1HE5A 1D8TA 4ASUA 4ONEA 4HDNA 2JFFA 4X3CA 4AROA 3M82A 4H1HA 2GLXA 3HLKA 2JRLA 4DB4A 2ZUBA 2Q3CA 2XJ4A 3INGA 2O57A 3I3SR 2JFQA 3HR4A 4OIFA 3UUGA 1G5IA 3FGZA 3HJBA 3WGZA 4CEHB 1SUPA 4RA6A 2HWYA 3FZGA 1JEAA 3DOUA 3EY9A 3CJRA 2PX5A 1F4VA 1SBQA 4NBKA 1SG0A 4Y6OA 1R27A 3JZMA 1CIPA 4KQJA 4LDPA 5JH7F 2LV8A 2P5TB 1AKWA 1NJ2A 4KYTA 4QL3A 5F5LA 5TC4A 1Q7BA 2XB6A 2JDIA 3QKSA 2AFHB 2XUOA 3QUCA 1LVUA 1T9GR 1YBHA 3HEBA 2CHVA 1MB4A 2CK3D 3SJUA 4CEJA 4L5BA 5CVCA 3ZCRA 4BNWA 4E2WA 1ZUD1 3BAZA 4EW2A 8ATCA 2QU7A 1WB9A 3Q3GE 1T8TA 3CSUA 3JTEA 3VX3A 3L06A 4GM1A 1KZ1A 1HEIA 1J25A 1UQTA 2C4NA 2WZBA 4H9GA 1UWCA 4PX5A 5I4KA 5JWOA 2YWJA 3HYSA 3CPJB 3BJEA 4QOJA 1UXIA 2MT9A 2QQ5A 2Z08A 3LIPA 2LTAA 1O89A 1PFYA 2OAP1 3AR5A 3HB9A 4QULA 2J5BA 4MUAA 3HYRA 5A7GA 2WPNA 4DRYA 2GNOA 2WU3A 3L40A 5LBUA 3ST7A 1IVSA 3QLUA 1JHQA 2JGDB 4LHWA 4BO7A 1C7RA 1DAMA 1NMSA 1IY9A 1U98A 1UBUS 3FPAA 2L0XA 3ZBTA 2Q21A 5KSWB 4WY2A 1XMOB 1RZUA 3AETA 3L1VA 5EIBC 4JGBA 2Q1SA 2UZ1A 3O4GA 4FYPA 4PG4A 4AY3A 2O8CB 5A9TA 2OO5C 3FW1A 2VF4X 1E8DA 5LQMA 3TSZA 2GEKA 4IKOA 3L43A 1OYOA 1PKXA 5DHQA 4REOA 3FHJA 1XA3A 4EUNA 2OMEA 4IXMA 5IKPA 3TK1A 4M0EA 4XPIA 2OZLB 2YWHA 4JVMA 4E5SA 3UJ3X 1GV1A 1L5GB 1A8HA 5AM4A 2CXQA 4ZYTA 4EF5A 3U19A 4HLNA 1X7YB 2H2WA 2O0MA 1RI2A 1K08A 3U4QB 1KJZA 2QMEA 1ID1A 1KSJA 1E1QA 3TPCA 4XGRA 2A0KA 3HCPA 1OI4A 3ZI0A 3SLGA 2XXBA 3TQHA 1YA6A 3HUDA 3VSDA 3Q3VA 4R2IA 5LUAA 4FR2A 3TAXA 5K6TA 2E4WA 3IQWA 1LGYA 4TN1A 4AJ4A 4TL8A 2QQGA 4AP6A 5I7VA 1YTUA 1GAWA 3T3OA 1ULTA 4YI5A 1CNMA 4HH4A 2EFYA 2JIZD 1IVNA 5ETJA 5GONA 2GH1A 5FLYA 2JFGA 5J4VA 3DE0X 3TKLA 1MX9A 4K28A 1DBIA 3UJCA 3B5EA 4P4NA 5CX4A 5DHAA 2SKCA 1QPBA 1T0HB 2XDWA 3GMTA 2OBYA 1E61A 1TM5E 1VPVA 4OI2A 3V7NA 1WLYA 2Q2OA 3ENNA 2FFAA 4JROA 2IP2A 2BDEA 4FFNA 2H9AA 2QN6A 5CDFA 4HH1A 2NYUA 3WGTA 3NHLA 1EM8B 5HFNA 3AI1A 4KZPA 4UQOA 2HMTA 5KQGA 1MOSA 2EV9A 1N0IA 4MRNA 2R5NA 3I30X 1BJKA 4IDPA 1HE8B 4P3YA 2HWKA 3W2TA 1UXJA 3W4IA 5FWYB 2EU8A 2PJZA 3P45A 1I1NA 1YQUA 4OHVA 3UMMA 5P8WA 1R6AA 2NXWA 1OV6A 5K4AA 3RODA 3VTAA 2QRGA 2I2WA 5JCPA 1HM5A 2OC4A 3RC7A 5E6UA 3WKDA 1TYBE 2ATEA 4JHLA 1R15A 1Z38A 1EVEA 4HPWA 1T2VA 1G18A 3CPSA 1U7UA 4U9HS 2CDAA 4FFLA 2FN3A 2QL5A 2WSSD 2Z83A 3JY6A 4HVCA 1DEHA 3BM5A 5A6SA 4IIFA 4BE9A 5HRUA 3C87A 3LC1O 1RJ9B 1M2JA 4RY0A 1RRCA 3L1UA 2O3UA 1Y33E 2HNBA 1ID8A 1UF9A 1WSWA 1XLUA 2VDOB 4JYZA 4IIXA 1R88A 2OV2A 5TQ0B 2XMPA 1JWAB 1J8FA 2IYFA 2Q41A 3AJEA 4BGIA 5L95A 3EPHA 3CZPA 2JI6A 3IOMA 4YRCA 5E8RA 3KWJA 4B4DA 2UUCB 3OMLA 2CYAA 4C06A 2O23A 4RVSA 3V5NA 4DW8A 5MN5A 1RE0A 4KQIA 2BFDA 3GCXA 5J23A 4EY8A 1J97A 3ORHA 2J41A 3ADOA 2HDNB 4MI3A 4C78A 4RHTA 2O0JA 3CURA 3GXBA 5JFGA 2UUBB 1USUA 2VNJA 3SM9A 1RCFA 3EZXA 4OJMX 3E4CA 2FN4A 2B0JA 1V3TA 4DWOA 5HIAA 2ZT7A 3NIBA 1QK5A 3I52A 1BQ4A 2J3EA 1TPYA 1UADA 3B2NA 2QWXA 3OF2A 1Y0BA 3E8MA 3JVIA 1FB5A 5H68A 2R0QC 4CTNA 3B48A 1WCXA 5THKA 4ZQFA 4MUMA 1OJLA 4MP8A 5AIBA 5H8WA 3V55A 3HGQA 3C1UA 1ZDMA 4FZVA 4G4JA 5TMPA 4BVBA 3BE5A 1YDFA 3N39C 2QLFA 2YNMA 1XYVA 4S0XA 1TVKB 1N6NA 4F4FA 2VN8A 4N12A 1XPRA 3CFYA 3EPPA 3ICEA 1HYGA 1RI3A 1T25A 2D0OB 2WINI 3OZFA 2M6LA 3P9SA 3SE0A 3COWA 4BMCA 3GGJA 5CCXA 3JARA 2JFUA 4IP0A 3OLYA 5HUJA 5DI3A 4DDVA 5DZSA 5IJAA 5AW3A 1BXRB 2FRDA 2C42A 2XWJI 1MNAA 1N0WA 4J16A 1F20A 2IYWA 2DSNA 4MRMB 1QP8A 2IOHA 2XE6A 2CXUA 2J31A 2VH5R 1QH8B 3MT7A 3R6WA 3GQBA 1BEEA 3EQ9A 3HM2A 2YWXA 1BKSB 4MQFB 4ZQGA 2G1PA 4GZ6A 2JS7A 4URZR 1VGRA 3TW0A 2AEEA 2JIRA 4FD2A 2A9KA 4A0HA 2VOJA 1QH1A 3SZGA 1QRTA 1KEKA 4EO4A 3FOEC 3ZJVA 4YJ2F 1BN7A 2CLMB 3TG2A 3ETNA 2B7BA 2WE8A 1U0SY 5ALIA 2HSEA 3X1YA 1LJUA 2IZ1A 3ONVA 2ZYIA 3LGSA 3QK7A 2IP1A 4D74A 4PW0A 2GMWA 1JJAA 2Z1MA 2X76A 2IIPA 3GZNA 1SVWA 4UTXA 5K6RA 2E89A 2HA3A 2J9GA 4AO8A 4W7IA 4PCUA 1I14A 4GXTA 5BMOA 4HDCA 1KGDA 5P21A 3D02A 4YV2A 3T7RA 2HW8A 4ZODA 1H5NA 1M2WA 1DMSA 1Q21A 1XA4A 4BRSA 5AWFC 1J42A 4ZAYA 4EG1A 4DTIA 2FTKE 3KXLA 1U7DA 2H65A 4Q9JA 3O3OB 4N5LA 5B3JC 3IPYA 3AY3A 1EK6A 2P78A 2MSLA 5JNRA 2EJWA 4Z1MD 3K1JA 3PLRA 1E2KA 5JBIA 1EX9A 3ONNA 5C52B 4TRMA 5TJ9A 2JFYA 3RTEA 1YGYA 3P9RA 3KAJA 1PQUA 1NJFA 1V9CA 1NURA 3OCWA 4UMEA 5LZ9A 1GU1A 4KB5A 1T2NA 3GN2A 3R20A 1KFBB 4FNGA 1AB5A 4MUKA 3S2IA 1E3TA 3HVHA 2PU5A 3ER6A 3NHUA 1P0FA 3TPFA 2XB9A 3B1WA 1JLHA 2A9QA 1B2RA 1IN6A 2P7IA 3WV4A 1SUSA 4X8LA 4C0SA 1E2PA 1MC1A 4BAUA 4Z3OA 3DXZA 4ZQEA 1E7WA 4WLVA 5LMCA 1EU1A 2FN9A 2PRYA 3QUQA 5F35A 5FTNA 4MS1A 3V4PB 4URXR 2QYHA 2H7VA 2F8LA 2PMEA 4DF3A 2JGNA 4NKRA 3OCYA 3BHJA 4D9KA 1KIFA 1GNLA 5T5QA 1T5BA 4LRSB 4AJ9A 2NZJA 5BW5A 4Y2YA 5EMKA 5BSHA 3NWBA 4EMSA 3PP8A 3ECSA 3L0DA 3H0CA 3TIIA 3PI7A 1Q0LA 1QFZA 3ZD9A 2NO0A 1M2NA 4FFVA 2VXCA 1KZ4A 2ZM5A 3CKYA 2YUTA 1Q16A 1K5DA 2PX6A 2QTRA 1EFCA 1SVOA 1CRZA 1WPGA 2BKXA 1NTOA 3AKCA 3DZFA 3TIVA 2CNBA 4ANFA 1JFFA 5BWLA 1QQ5A 3M3DA 3R9XA 3Q9NA 1OQAA 1UZUA 3KX2A 3OZBA 4RS3A 3E8SA 5AW5A 2XSZA 1O9BA 3BL6A 4BBAA 4KUGA 1ZOOA 1VG9B 1O7JA 1CZOA 1G20E 4MO2A 1CZUA 1R0WA 4EGCB 4ZHQF 2Z98A 1N9KA 3J7TA 1FRVA 1HTWA 2P2DA 2JDID 3EGWA 3CM0A 3JZAA 1Q7RA 4Q4AA 4KR6A 3HDQA 3D7LA 4M8KA 3SHWA 2ZGVA 2O6LA 3LZCA 5D84A 3WIBA 1XB2A 5F2EA 1M0TA 3NDPA 4BKOA 5CA1F 4YV0A 5M3BA 4BLWA 2PLAA 4X20A 2SHKA 3TTVA 4BV8A 1GFIA 4IS2A 2I6SA 2OZKA 3ZE2B 1OBVA 3NNDA 3K9BA 2QZJA 1N5MA 1ODIA 1XJ0A 2OZVA 3D4BA 5ALTA 1YUMA 4IIJA 2L69A 3HWX1 2QRHA 2PMKA 3D6UA 3I2IA 2R8YA 2RAUA 3SN6A 3C7CB 2FWRA 4R1QA 1Z3IX 1Z4NA 3WFIA 3TX2A 4EZEA 1SG9A 1USVA 4WBNF 1NSTA 1VI6A 4DV5B 2JCVA 3A2KA 1NXWA 3AT1A 1P6XA 1NDHA 1NVBA 3PUJA 1UBSB 3ABIA 3KE8A 1M1NB 5AHRA 5L7YA 2GHIA 2ZSFA 2AWNA 1XVVA 2R2AA 4HFNA 2JLVA 2PZGA 2W90A 4CVNA 5AXAA 5JBQA 3M6AA 1VSVA 4FT4A 3C97A 2VDJA 4O0MA 5EXEA 1G21E 1IULA 4N03A 1CQPA 2EQ5A 1MJGM 2PKEA 3KFLA 4QXPA 5LJIA 1CF2O 1UMDA 3AJRA 4HMQA 1V48A 2NO7A 1MRSA 2WDZA 1E1QD 3ZQ4A 2UVPA 2HLPA 4YCMA 1SCJA 1U3WA 2XYRA 2XITA 4PYOA 5HMLA 4QHYA 5E9AA 4F6LA 4TT3A 5G0VA 2ZRDA 2Z3WA 2VDMB 3BF7A 4BXOB 1OT3A 2HSDA 3WHKA 1UK6A 3D7MA 3FTNA 1B3BA 3N8NA 4MYTA 2EJUA 3EK2A 4L7QA 5JWHA 1KEEA 4V1CA 2R7AA 5KOHA 5JDIC 4OUDB 2Q6TA 4YMTA 3UMVA 1KARA 4JDPA 3AJDA 4E4RA 1JGTA 2VQ3A 2WF7A 4AJJA 4QYIA 4JQYA 3DE5X 4YRQA 5HE8A 2B8TA 5FRDA 4HRAA 1M10A 2OZPA 2RK6A 4HUQB 4L8FA 4G0ZA 3FPEA 1XDSA 5JS2A 5FL7A 3KK0A 1USGA 1RWVA 3ROZA 2DQKA 5I7HA 4DVJA 3IP6A 2V74B 1JE1A 5JT1A 2PGAA 3FWNA 4GG1A 4Z9AA 3FFAA 2Z2IA 4NG4A 4RE6A 1Y1SA 4BNJA 3T4XA 1PEAA 5T8KA 4EMTA 1RXIA 4HTFB 2GHQA 4AMGA 1XDWA 3B1ZA 1EJ0A 3AV0B 1V47A 1BRMA 3WG9A 2LDBA 2CZQA 2ODTX 3HV0A 1KQ3A 4DLZA 1K7SN 1TEHA 3RS9A 1D2AA 5KHLB 1P4RA 4U3JA 1FFCA 2EZTA 2QVXX 3DD1A 4G67A 4PAOA 4X9XA 3HGMA 3GP5A 3E2PA 5F3RA 4CODB 1ISJA 1UP6A 1YR2A 3SDBA 2C4WA 1M7BA 3ZZMA 2BGGA 1G6HA 3N2YA 3NTUA 4V0LA 5JMOA 2W4IA 4BTLA 1XAGA 2GB4A 4LTDA 3A0UA 4QSMA 2JLUA 2HCRA 3H8VA 3LQ2A 4R54A 4JIMA 1JHDA 3OE7D 1OXKB 2ZKIA 4D81A 5JNWA 2NVWA 4G0NA 4QNMA 3RQSA 2AYZA 2SCUB 2XTZA 3RYIA 5KX5F 2E55A 1V5FA 2Q9CA 3M6LA 2VTBB 4LYHA 1EWQA 1N1GA 3DTYA 4BUCA 1MDBA 1TA0A 3S1AA 1AXRA 3QE4A 2K7FA 1JHZA 3OQ1A 1P5FA 1FU8A 2X3FA 2XXAA 1YKFA 3P32A 2B25A 4EB3A 1EXVA 1MH1A 1Z47A 2EWMA 1OASA 2XR1A 4TXHA 3OCZA 3MUNA 4ZVOA 3KOWA 3QU5A 4D99A 4D0LB 3D4OA 1O9HA 1T35A 4E1AA 1DG3A 3IMEA 6ABPA 1R12A 2NOAA 3DL2A 1Y37A 3A9TA 4MLDA 2IQ5A 1XELA 2F1OA 2VF8A 5G1PA 4IAOA 3VFDA 3GMIA 3KOXA 1HG1A 1XDBA 3A1VA 4OUKX 2B8EA 3F74A 2CN1A 2P3LA 4FOTA 4OP1A 4FE4A 1W7AA 3C7DB 3Q2KA 4K9OA 5G1NA 2F8TA 1BS2A 1WEKA 1EFRA 1UOPA 1JPVA 2J3LA 1AK1A 2J0UB 3MWJA 3AUJB 3G0DA 1OY1A 4TTQA 1F0KA 1II8A 2JI4A 3YASA 1R9NA 4OKNA 3C6QA 2W6NA 3HDVA 3HWRA 4H59A 1MG5A 1MRZA 1RMYA 3A25A 1X1SA 1J99A 1DJLA 1SIUA 2QVCA 3UJPA 4WXHA 3CBGA 2IHBA 4D92A 5I8WA 3CZMA 2JFPA 3IJPA 5LD2C 2D06A 4WL0A 4YT2A 5C5EA 1MZPA 1QDLB 2R60A 3GO4A 1RYDA 5A9SB 3V4VB 5PGMA 2VT2A 2AL7A 2NP7A 2XYGA 4DIDA 4CIDA 1XRQA 3I5MA 1IOWA 2K87A 4Q7QA 2H1FA 1VLZA 2C2HA 3MUOA 2OHHA 3G2KA 2I34A 4CDGA 3NBFA 1GOTA 4E4TA 3KKLA 2MSKA 3EIFA 2WPDD 3JYNA 3VQTA 4QWWA 4TZ6A 1FTWA 2ERXA 1CEQA 2XECA 3E58A 3HCDA 4FLFA 4DNOA 3RJZA 4C2AA 1HSOA 2J32A 4R2WA 5J43A 1Z7EA 2FN7A 3EBOA 4WAUA 3FTEA 4X65B 1ECLA 1BOFA 3B1JA 3P2IA 4G4IA 1EIZA 4AG3A 2YIVX 3PTZA 5KSYA 1WXHA 2QAIA 3DR3A 2D1SA 2I33A 4U1RA 4RH0A 3MQ2A 4CHTA 2KSQA 4UHHA 3RV4A 4UMVA 3SXPA 1CP2A 2NTYC 4IF6A 4TL7A 1ZCZA 5FULA 5IVIA 3VR6A 3MGGA 3NTRA 1K68A 1Z35A 4OQDA 4HWSA 4B0OA 5J5VA 2XUQA 2DBRA 2WUFA 4YP9A 1QFYA 2WIFA 4PEVA 3VDQA 4CM8B 1HSZA 1ADBA 2EKBA 2X1VA 2QHXA 2ZBQA 1W35A 1ML4A 1YUBA 2BHLA 2XODA 4MQBA 3PYLA 3TYXA 4BLQA 1WBJB 2QTZA 5C1PA 1KBZA 2ECOA 4PLCA 5FP0A 1NP6A 2C5FA 3VHQA 3KKEA 2ZS8A 4A4DA 1JUDA 3ZGLA 4X3PA 1PUXA 1LZLA 3TTXA 3LW7A 1IMOA 1BO6A 2I6UA 5CMLA 2OHXA 2EYUA 2JATA 3WICA 4TGLA 5KQLA 2IF2A 1IEVA 1NW8A 2H85A 4OM8A 1RLMA 3D4NA 4AUNA 4BNMA 1SKYB 4KDRA 3TQTA 1JR6A 3KB1A 1XK7A 3CKKA 4PC2A 1XRJA 2BT4A 1JG4A 2O2IA 2OL4A 3NFRA 3H16A 3WTBA 1I9CA 1Z4KA 2GN6A 3DTNA 1KAMA 4F2DA 1WUTA 2OC9A 5BW8A 4H60A 2C9OA 1TMGE 3AVPA 3ZGXA 2ZJ4A 3GIWA 2UZAA 4PX3A 1P73A 3WJ7A 5JH7A 5HNKA 4CM6A 3ADCA 2P9FA 3TUIC 3NT4A 1I80A 1IL0A 2EFCB 4IIEA 4QFBA 1RJ9A 4QO8A 5EJMA 1C8BA 2D5BA 3BBLA 4I5DA 3W04A 5L4LA 2QMUA 1A98A 5FPYA 3AK4A 3K30A 3X1XA 5FEUA 1RHKA 1MO6A 3F0TA 2Y1LA 3R7LA 3S3TA 1L8XA 1TTHA 3F1KA 3GZJA 4UHEA 5CFRA 4NCNA 1QK3A 4TT8A 3F4LA 2ZLBA 1K8ZB 2I6FA 3U7IA 3OJCA 1UBEA 1Z0ZA 3SPXA 3C8DA 2C2GA 5WRFA 1DAHA 4ZVUA 5ER6A 1VCOA 2VK8A 4TM8A 2KJQA 2LIVA 4MW1A 1U28C 4H3VA 1JFRA 5BWMA 1IK6A 1Q83A 1V6CA 3KHSA 2FPSA 5FPHA 3ECCA 2X0EA 3MGBA 4BKQA 1KI8A 1XF9A 4HQKA 4PYKA 3P7MA 2RBKA 1R4ZA 3T0FA 3FVTA 3SSNA 5ED4A 4MAMA 4CLXA 5CYPA 1JP7A 4TRNA 3NUGA 3RROA 4BO3A 4EHBA 5EJ8A 4IV5A 2VDVE 3WIUA 1G291 4DA7A 1NVXQ 2PL1A 4HLCA 1SKMA 2O3TA 3DNPA 1LPPA 2YVAA 2W00A 3QRWA 4JFAA 2Q5FA 4RZIA 4TMXA 4UD2A 3ZDFA 2OXFA 4B74A 4HNUA 3WGUA 1US8A 2AOTB 4HHEA 4Z9FA 1OR8A 3KUXA 1AO0A 3TR5A 3DAPA 4OQMA 2I5PO 1I5OA 5LLSA 4NC9A 4Q82A 4V38A 2MCFA 1G5FA 5JAMA 3H05A 4D6PA 4LZOA 3ZJTA 4CDRA 5KO2A 2JARA 1U94A 2J87A 3ICOA 1E5TA 2ZI3A 1N1MA 4R2MA 4KQKA 5DNWA 1G5RA 3TD9A 1RHQA 3E1GA 3NDIA 4H4DA 4IBOA 4B81A 2VAMA 4RUKA 4CCWA 1X14A 2JRCA 2PQ6A 5ECWA 2IXDA 3H7AA 1YOVA 1V8DA 1WKBA 1SBTA 1SCQA 4TTVA 4C7MA 2X7HA 1CRLA 1JFLA 4QARA 2EFDB 2CJXA 3OF5A 2R96A 5JD6A 1UUFA 1XE3A 1GCAA 3OCUA 3HN2A 2QRPA 2PCJA 1JAHA 3LSYA 4F4JA 2FKNA 3OFVA 3AF2A 3I5AA 2XUGA 4JITA 3OFJA 1WULS 3OPQA 3WQHA 2OFPA 2DT5A 3HXKA 3PFFA 3AF6A 1IY2A 2C2WA 4EYOA 2DUUA 1M67A 4O02B 2R48A 2I4NA 1GL3A 1XP5A 3QJYA 4NS4A 4UM5A 3LPNA 2PEYA 1IHXA 1L7AA 5CNJA 3GW8A 4COOA 5HA5A 4AKSA 4FYYA 3IV6A 3L4JA 3WGYA 2A1TR 1C3XA 2BEJA 1ILWA 4P7FA 2WYUA 3EDMA 2OZEA 1CEXA 3C48A 3G7NA 1VIAA 2GA8A 3ONWA 1IXSB 5H82A 4Z1OA 1NT4A 1XZPA 2WTMA 2RONA 1RVV1 3TE6A 5DHFA 5U4QA 5MFPA 1XDUA 3EG5A 3HKBA 1H1TA 4O4HF 3ZCUA 5BW4A 4FOLA 2QBYB 4DCJA 1I1OA 1M6NA 2HMYB 4H7HA 1ADYA 5KEIA 1RQ7A 1TJNA 1XD9A 3BSFA 3V6LA 5JRJA 1Z4JA 4RSHA 4KAJA 1E3WA 3KOYA 5EJ5A 3NU1A 1CJUC 2ACKA 4HQRA 4UE3S 4DV2B 4JYCA 5D86A 2PAFA 5FL7D 1UBRS 3WB0A 4C4ZA 2CCGA 3B8EA 3DB2A 3OZ7A 3PHHA 1GU7A 4BLUA 2ANBA 4ZZ1A 1PJ3A 7GPBA 2IPAB 1CUSA 2H8GA 5AVXA 2PMDA 5EE3A 3IAS6 1T8PA 3OM9A 2BMDA 3GDWA 1OTYA 1TZJA 2D59A 1VIYA 3EBLA 3DOJA 2Y1XA 3N3AC 1O95C 1SCUA 1YL5A 2QS9A 1KK2A 4L5AA 5K6AC 1W76A 4DDMA 2ZM6B 3GFVA 5BSFA 5C8VA 2DBQA 1UDXA 2G7ZA 4L8YA 1E1CB 1HXHA 1J22A 2OD7A 2W71A 3LM8A 4WLFA 1A2BA 4D2IA 3R7WB 1ZGAA 4CQMA 3EHDA 2H6EA 5IVPA 1O97C 3PQEA 4TSFA 3R3HA 5JZOA 2AZTA 1RQ2A 5D01A 5C46F 1FL9A 2VATA 3OP1A 1WP9A 5LQKA 2W70A 3PSAA 3E9ZA 2X6TA 4HAUA 2PKCA 1P8JA 3ZU4A 1Z4IA 1PJTA 3IJ5A 1VA4A 1W19A 1Y1PA 1CQJA 3JWEA 5G0SA 1DC5A 2J0VA 3QY0A 1ZK2A 1Y6GA 1FFGA 3BZUA 3ORFA 3FZEA 1UPXA 1EJBA 1KNQA 1ZH2A 4KNWA 3W8DA 2WFAA 4FHGA 4NE9A 2V6JA 3OEEA 1W5AA 1QCZA 2CNLA 1OOEA 4LJ6A 3SC3A 1EUZA 3NOVA 4PE5B 5DP1A 3WL8A 4LJAA 3IVMA 4PV7A 5B4UA 5DTMA 2PZEA 3AYXB 4X7BA 1T34A 1DLIA 2A88A 4ZARA 3VKWA 4XRRA 2X8JA 3A9RA 3FBGA 4HRYA 3SJ7A 1ZN7A 3DDOA 4LRXA 4QNRA 3V33A 3FDIA 3OZEA 4MQEB 5EPEA 1BU5A 2WVJA 1WUHS 1GTMA 2CLLB 1Y1KE 3RIXA 3V32A 3ZE0B 5HX7A 1NM5C 5BV8A 1RQRA 3S5UA 1NXTA 4IZOA 4TUYF 2JJYA 3EPKA 2UYGA 3C5HA 2IA5A 4XM2A 1FJHA 3LWBA 1CY8A 2F2TA 2JH3A 3IOEA 4BJHB 3ZLBA 2XB8A 1EFRD 3B12A 1WUJS 4PLPA 4B4OA 3UYLA 2NPIA 2GAOA 2YY7A 4KK3A 1GGJA 5EHIA 2D6FA 2ZVDA 2FLVA 2BKLA 2ABWA 5HXAA 2VKQA 4ZRMA 1NMQA 1U2RA 3DPUA 3JW8A 1FLAA 4DCPA 2D13A 4BY9E 3VUEA 1FQJA 2JCYA 3GJYA 3KYJB 4JBGA 1HQDA 1TZ2A 3CY6A 1D2NA 4TS4A 4UCQA 1ZH4A 3DBVO 3VNBA 1JHYA 1QGUB 1RT9A 2HK9A 4MIEA 2I03A 2G71A 2X22A 4YUVA 4C5BA 4C05A 3NIGB 2BMJA 1ZKDA 3PC8C 4X6LA 3LYUA 4ZOEA 1UWKA 2ZDQA 4DLKA 1FIUA 2HBYA 1XDZA 4N5IX 1MXHA 3HP1A 1U0LA 4LRQA 4QXMA 4HKTA 4HNAA 2NN3C 3IT2A 1AKVA 1KNXA 2AXQA 3IA2A 2NO9A 4JK3A 4X41A 2XBLA 2EARA 4EHFA 3N8KA 5TIIA 4YMVA 1LBEA 5LXTF 5EMJA 5FBVB 3GFQA 1EJ6A 3L7KA 1TUBB 4CG3A 4BXOA 1JDNA 9LDTA 1QIMA 3L6EA 4RY8A 4XQCA 4GE3A 1KI3A 3MJVA 5DE3A 4YO7A 1KPIA 1L0BA 3E22B 5KYWB 1R6DA 1ORVA 2HWWA 1E2JA 3LQ4A 5DW3A 4OUDA 3WMRA 2C5EA 2YFKA 3AY7A 5HQTA 2NTNA 2G36A 5DN9A 2GBIA 5EMHA 1X77A 5FI1B 5DYWA 4ZWNA 3BGVA 1MGPA 3LY9A 4A6XA 4MYCA 3TAHA 1DZ3A 1M7GA 2YIJA 4F5ZA 4Z9BA 2WSIA 1T9BA 5DK4A 5YASA 5M29A 5A03A 4DMCA 1W1IA 8LDHA 3DBLA 3GR6A 3I58A 4JD5A 5FPQA 3URMA 2GWHA 3DONA 4H6WA 1UC8A 3HBLA 1P19A 5CXXA 5ESWA 4KFCA 1J49A 4DA9A 4AKGA 4KX5A 3D8UA 1XMPA 2PK3A 2DPHA 2JEZA 2WU0A 5J1SB 3N87A 4J4BA 5DVZA 1JEJA 1QNFA 5JJ5A 5IMSA 2CBGA 1G3IA 3EXFA 3R7DA 5JR3A 4B3MB 2VQDA 1OZGA 4TWJA 2YZKA 1LLQA 2QN8A 3Q7PA 3FJOA 4WFIA 2QSJA 4LSGA 2V7VA 2QX6A 3WL3A 2B8JA 2D5AA 5KNCA 4S1PA 1OD6A 2IK8A 4G26A 5ICMA 2DH5A 1QYVA 4H1UA 3G8DA 1U65A 4D9NA 4F2PA 5K3EA 5HFAA 1PSWA 2I3ZA 3CNBA 1V8FA 4NYMQ 5C3UA 4PICA 3W2HA 1CF9A 5L3SB 1E3IA 1RXCA 2QTHA 4RH1A 3DE2X 2PM8A 2V0CA 4YXWA 4IL5A 4YR9A 2D2VA 2PXCA 2QUJA 3BWYA 3BIOA 4KOEC 2IUEA 1MO3A 1U8EA 1COZA 3DMGA 3ITEA 4JJZA 2X2EA 2JLXA 3HL0A 4G36A 1A97A 3A05A 4BZWA 3GD7A 1GPAA 2CUZA 2CHQA 1KMQA 2LR0A 3IA7A 5DTRA 3G2IA 4X1IB 4EEZA 4U2BA 3W2FA 2H2FA 3MQ4A 5IM5A 2ORVA 5IP5A 2G0NA 3BIXA 1UPAA 3T5CA 8ADHA 1P29A 1U6JA 3SFTA 4DSTA 2UYCA 3TBHA 4HDSA 3C4VA 4LYEA 2JF0A 3EQ7A 4WNAB 3VR5A 2C8KA 3U16A 2HEIA 5SY6A 1E69A 2DY1A 5C0OE 1D07A 3NHFA 4GOND 2HQRA 4JJ6A 4NMHA 3PJGA 1WMFA 3GLFE 2VT6A 4AL4A 5FWDA 4PC1A 3JQ8A 4DMUB 3QLVC 1L7XA 4X94A 3PPVA 5I8PA 4G85A 4ZVKA 3TTSA 2YHUA 1SJ9A 2RH5A 5DI9A 3VTKA 3IS3A 5ALWA 1Y6JA 5G53C 1Z8FA 1KOFA 2FEKA 3KEFA 3LQ1A 3JD4A 1M2OB 3DFKA 1S0UA 1XZMA 2WYVA 1VL5A 1WD7A 4KGVA 4PFKA 2AG6A 5I9MA 2VWGA 4FE7A 2DQ4A 2NMVA 4O4JA 1G64A 2FFJA 3KTDA 1ORTA 3AKYA 5F1PA 1CCWA 5G0TA 1Y81A 1R0YA 2NAPA 5IZCC 4KO8A 4PZPA 3NYRA 4FMCB 3BFJA 1M75A 3MT8A 2KBFA 4JVOA 4WACA 1SHJA 4JUBA 3TXYA 3TI7A 4H1WA 4I55F 1GV0A 1E9FA 1UXKA 2PX8A 1YDGA 3VI4B 2HMSA 1DKPA 1MB2A 3DKIA 3IQXA 3PQ7A 4MWGA 3WLOA 4C4OA 1Z25A 3DLPX 3N2NA 4Y67A 1BQEA 1NBOA 4GPEA 5L6MB 4DILA 3CN7A 5FOWA 3C7AA 5E3HA 4HVAA 4D0GA 1ZD4A 5EWJB 3F8WA 1W9HA 3AG6A 3ZNPA 1U2QA 2C7BA 4RIGA 5HUQA 4C4SA 2J9YB 2BFBA 1THGA 2NXJA 1Z4PX 5JQWA 2C4KA 2JZNA 2PKRA 2V45A 4KBGA 3G0CA 3KZ1E 3EG9A 2IDZA 3IKJA 5A4FS 2WTUA 4MR9B 1W46A 1CW2B 4REQB 1BRTA 1LSJA 2DHRA 3O3MB 1FFDA 4K6KA 5EJ4A 3DGEC 2G09A 1RZRA 2QX4A 1HDOA 1ZCJA 1KP9A 4R1NA 4RTJA 3MAGA 3SK0A 3S29A 1HRKA 5IH7A 4CMIA 4YQYA 4EWLA 5C1BA 5K51A 5BNFA 3M2TA 3UGQA 5GZ3A 2A9PA 4K8OA 3UB2A 2HYIC 1SBNE 4CKBA 2J3IA 1NNEA 2JEOA 2NYVA 4HN2A 3ZKWA 1E0DA 4HOYA 5FWXB 2GEFA 3BH7A 4CM8A 1B15A 1QV6A 4RVDA 2OYRA 1CJTC 1GSHA 2XUPA 3A0RB 4OJKA 2Q5LA 3GLUA 3S55A 3WLNA 2XV1A 4GMFA 5LDDC 4GYKA 2VHXA 3ICCA 1WOYA 3EYWA 4MYUA 2VSQA 2QJFA 2R8XA 3BIFA 2NP6A 1H2EA 1L5ZA 3G02A 2NYAA 2J3HA 2N46A 5CG1A 1HFJA 2O2DA 2R7MA 1C50A 1FDSA 1XZCA 1K1EA 1PE0A 4QUGA 3RHFA 1R00A 4D1YA 2PNFA 5JE8A 5KNDD 1FBTA 1IUKA 1ZPDA 2I6XA 1LDGA 4M0KA 4MKZA 4RQAA 1TZKA 1QQ6A 4I1UA 1CDEA 1Z2DA 3K09C 2X40A 1DQZA 4NBNA 3IUPA 3MRVA 4FJ2A 4N5HX 4QDJA 1WMAA 1CE8A 1YKSA 1Z7BA 5REQB 2B1IA 3V7UA 4HDOB 4CQMD 2WWWA 4TSFD 1QOZA 3ODPA 3H5AA 2IV7A 1P72A 1WVIA 2CWWA 2FZWA 2IIQA 3D6JA 3PG5A 4RDHA 4ZQIA 3TZLA 4O29A 1IIBA 4G1VA 5KKAA 1CUBA 3R7SA 2VF7A 3FCXA 4JB0A 4QQFA 3QVGB 1V4VA 1R8SA 3LC7O 1ZXXA 3H5OA 3WIOA 1EDBA 1SA0B 1TF7A 1ZWLA 1JJBA 1XSEA 4KP7A 1A9PA 1QHEA 2ZWAA 3PNKA 4WZ6A 1R3UA 4F4HA 3T7EA 2M6RA 2EW2A 1KVTA 3RNLA 3H97A 4HYTA 3HY4A 4I3GA 4DTCA 4P98A 3WOVA 4RTMA 4KMSA 1NQOA 3AHDA 5BORA 1PHRA 2YINC 2IY9A 3H2JA 2ZVQX 2AKEA 2BHNA 4HATA 4QYSA 5DPMA 1F6BA 5J5CA 2R1ZA 3CW2A 3OEED 4LBZA 4HAXA 1QSGA 4BEVA 3NAZA 4MS4A 1SHZA 2VHTA 3WX0A 3MJHA 2BFPA 1INLA 1MTZA 2FW6A 4HWOA 4WZAB 4CCSA 3NTLA 4YRZA 1A9XB 3STTA 3MERA 1TOAA 1A04A 2Q5QA 1CUIA 2YFYA 4KRYA 1W34A 3CEHA 4IQ8A 5K8TA 2FPPB 1T5SA 4HAVA 5EWLB 3T3EA 2ZJAA 4ZVNA 2OCAA 2Y4NA 5HK9A 2A9OA 2QW1A 4I81A 4LY9A 5FBQB 3VR6H 1V9LA 3N7TA 5SYMA 4CKXA 1NXVA 3AINA 3ZGZA 2GPYA 2XNHA 4QTUB 4UTPA 1I8TA 3MSCA 1PR1A 3UK7A 3CRZA 4KQHA 3WRYA 2WJHA 3KDAA 4RPLA 1JKXA 1XRLA 5TE9A 1ATZA 3R9KA 1ONBA 3OE1A 4ND1A 3ESCA 1NQXA 1C9MA 2CUTA 3QF4A 2Z1NA 5T4EA 3WK9A 3TBKA 1DBRA 3Q5EA 3E35A 4ZALA 4ZCQA 3U4GA 3RBAA 5GOZA 4MI6A 3W9SA 5CM8B 3UPUA 1X13A 2RI6A 3BRSA 4B3CA 4DMLA 1V8OA 3PUHA 1AMOA 2VZ8A 5EXXA 4X64B 4RTRA 1THZA 1I1QB 4XYBA 4EB0A 2G06A 3G17A 3CF4A 2ZYDA 5AICA 4D43A 4L9WA 3DDNA 2X9GA 2ZFUA 3D4IA 3IAM1 4NFLA 4XWOA 2COEA 5EIHA 3GBPA 4ZJYA 2RGDA 1XRNA 4L8GA 4DXAA 3K96A 2EFGA 4UJ3A 1H2FA 3MT0A 3QU2A 2VHYA 4MQ6A 4QRHA 7ABPA 1E2BA 5LIPA 2FJ0A 4JEMA 2Q99A 3RVDA 4E4YA 5KYKA 5AI5A 1RRKA 1DUVG 2OXRA 3WFZA 4AO6A 3ORQA 1XMSA 2DQSA 1YAHA 1RKUA 3WK8A 3WTCA 4ZGBA 4M88A 4PS1A 4LF4B 1DGQA 4CI0B 4NXMB 4JLMA 1H2HA 3FIUA 3JQFA 3ZYCA 3PWKA 3IILA 4KFRA 2MDTA 4H27A 1KYTA 1TAQA 4B73A 1RKBA 2YMMA 4NENB 2CVPA 2BGJA 4UHJA 2V9PA 1UT5A 2R8RA 2HCJB 1F2UB 2R8BA 1AMUA 3RB8A 3RKUA 4MVCA 1JPNA 3ON5A 4XZ3A 4DG8A 1UJMA 3BHNA 6PFKA 3U09A 3VHXB 1XT6A 3L9WA 3ONDA 5LM3A 3I01A 1XF1A 1P91A 4QFMA 5J59A 4FGLA 2F4NA 4FNMA 1JIIA 5IRCD 1U8AA 1UBLS 4WZBA 5M2QA 4LJ5A 2IYUA 1Z7YA 2BGWA 2I2CA 3R2JA 1THMA 2O1XA 1M72A 4G8DA 4YMHA 4TVBA 3U44B 2I6TA 4TKUA 3G5LA 2MSWA 1K6EA 2NU7B 2YMQA 2ZYSA 4FC7A 3WNZA 3HKCB 3UJNA 4I9FA 3OZIA 1RHMA 1E5LA 2XNDA 3C1OA 3I9V1 3ZGOA 4BLPA 1CG6A 1HE4A 1KA9H 1SGWA 3BE6A 1K8RA 2P41A 2V5VA 3EE6A 1PJ4A 2H1IA 3GLVA 1ABFA 1KC1A 4LVUA 1OLSB 3DWEX 1XZKA 1FFEA 3AIMA 4Y3UA 3UJ7A 3ZZ0A 4AZWA 1GFWA 4DA0A 1C9KA 2JD2A 3DWFA 3CG0A 3F2VA 4RJKA 1SQGA 2YDYA 1E1CA 1Z74A 3ZIAA 3TWOA 4EQ6B 2F55A 1T91A 1LTQA 1GZDA 2BEKA 2FZEA 3AHCA 2DSTA 3E1KA 2XYVA 2YJZA 2QU8A 3MAJA 2ZULA 4FHFA 2DWUA 2E5WA 2TECE 2VWQA 2GM5A 4GDMA 4OA5A 1EVJA 5J4HA 4NNJA 4R2KA 4P32A 2NWQA 5ALNA 5LUBA 3AFHA 4ZMBA 3DTVB 5ELLA 2OUIA 4POOA 3CWCA 2Z30A 1VL2A 3D8TA 2CLFB 2DECA 3LUFA 3D8SA 3EIQA 3NB0A 4ZOLF 4UEOA 1GSOA 2GFIA 1CQIA 3PVCA 4D9IA 3KD2A 1YS7A 4R6XA 4AKEA 1MQSA 2J9XB 1IHPA 1NBIA 3TOSA 4PM4A 1FE8A 5EP1A 1JVNA 2WUWE 3FNGA 4IDCA 1IB6A 3AVWA 1PTJC 4G89A 1UKVY 3AB7A 2OOSA 2WMDA 2D1QA 4N76A 2G8NA 4JGGA 3T9BA 3TNDA 5AKEA 1WQ3A 2QY6A 5CFNA 1ZITA 3QEAZ 1RVDA 3NQ41 2V5UA 4HBGA 1AZSC 3PWZA 3CVWA 3O8OB 3ZHQA 3HCAA 1Y8RB 2GTHA 5AHXA 3ZW9A 3WMXA 3PGMA 5AKHA 3T34A 3K5HA 3DPSA 4DXDA 1ECBA 1GQFA 5EI5A 2WHXA 4GSKA 3LOPA 3BFKA 1J70A 3JQ6A 3FCEA 3UM9A 4AURA 5E7MA 5JJCA 4XJVA 1QV9A 1XALA 1VZ3A 3S8EA 2VAXA 2J0EA 4W9NC 2AN5A 1LH0A 5BNTA 1FYVA 4GC9A 4YECA 3AI2A 4DWVA 1RZ3A 4M37A 2FXIA 4UCXA 1X1TA 2GZMA 3EXEB 2QJOA 3QKTA 4MPPA 5U1PA 1JEQB 3E82A 3QW2A 3KQOA 5FOUA 1XEWX 4A23A 4EB8A 5JAHA 4BYMA 1EXWA 5CEJA 1NG1A 1Q1GA 3FYUB 1JQEA 1MOPA 1R3DA 3F3SA 4WJLA 5LVAA 4ZKEA 2GF0A 3ISVA 1U6KA 5EXPA 3AIKA 4ICIA 4YK7A 2FUKA 3SNKA 1SZDA 1V6AA 3D43A 5G3YA 5FUQA 3HNOA 2OV8A 1HA3A 2BGUA 3K9HA 1GQRA 4NYJR 4X90A 3D1JA 4O4IA 3ZUGA 2A1UA 2Y71A 3LPCA 3SHOA 1ZCAA 1ZJJA 2AV6A 1KSGA 4IUCS 4HAOA 2D4HA 5K3FA 4N0EA 2CWDA 3JYPA 4KVZA 3R3VA 4MINA 1UT8A 4C2UA 4LFCB 4HY3A 3LOQA 2A5FA 2XAAA 3ZWMA 1L7MA 1CZKA 5C8XA 2P7HA 1T6YA 1FNMA 2OO5A 3BTVA 1YE3A 2HUNA 2V54A 4G5SA 4JP1A 4MMZB 2A0UA 1S01A 1B2LA 3UMRA 3A1DA 3N8HA 1E6UA 3I3OA 1P4JA 3L5KA 3PFGA 3W6ZA 4XQEA 3ZN2A 3A1EA 4ILKA 2M2IA 1IWBB 1PR0A 5AJUA 1JI0A 2QZZA 3EZFA 5MHTA 3LFHA 3FOBA 3W5DA 1VJTA 2ZIFA 2D5IA 3W9YA 4OI4A 1TM7E 2F43B 5CLIA 2H8KA 2GBPA 3FSJX 5AW6A 4RK7A 3N75A 4MWBA 3OU2A 3DUFB 2W2NA 3E9CA 3KHUA 1KPHA 2A86A 1YK0A 2AD1A 1C2TA 4RMHA 3S2EA 3FPBA 5ERGB 3RYCA 3ZD7A 3KUUA 2C0CA 4HJRA 3X0DA 5FD8A 2ZSKA 3ABQB 1O08A 3QVSA 3WAKA 1AQJA 3QE0A 4FTWA 3DLBA 4C04A 3IE1A 3II6X 3TB4A 2OV4A 4ARVA 2ZSAA 1OFUA 2QPLA 3HB1A 3D7NA 4D4JA 4J6EA 4KVFA 4DQDA 4EBBA 4GWLA 1O0CA 3GVXA 1HDIA 3L7CA 4QXOA 4XYLA 1I33A 3KXDA 5CHYA 3ZDXB 3WWPA 3NT2A 1I2CA 2OOKA 3C8UA 4IGIA 2BLLA 2FPLA 3W9UA 1M6HA 1GXSA 4Z7NB 2QN3A 1KYWA 2V6BA 3F67A 5FQNA 3EXHB 1ZNQO 2A9RA 5CBKA 3N2KB 4DQUA 1SEVA 2AG1A 3JRNA 3TH5A 3WGGA 5L7TA 3WC4A 5FF9A 2XOKD 1RTKA 1WPXA 3OU6A 4HB4A 2GTPA 1DQYA 2WWVD 4INPA 1K89A 1RQLA 2EYQA 3INNA 3B8HA 4GECA 1YR8A 4DLYA 4HP8A 3IP8A 2I4RA 3GFOA 3P4YA 4IDBA 3DHEA 1AB6A 2BM9A 2WWGA 1B7GO 2BEVB 4TUYA 4AZ0A 4PNEA 1JLMA 1O6CA 1YCGA 2REXB 1S8NA 4YJDA 2OE2A 3LOUA 1KPGA 3GH1A 4K9SA 4TTJA 4ND5A 1O9GA 1QLJA 3EB9A 3PB3A 5FI3A 4M89A 4ZC1A 1WD5A 4MH0R 4E1VA 5I47A 5I6DA 2GVZC 4G37A 4ZP1A 2Q5OA 1URPA 4WKOA 3MINB 2BBOA 4TTIA 4MDFA 2OXIA 3L0BA 1N57A 2NU9B 3H1AA 4GLBA 5CBPB 5EUQB 2PMFA 3R0ZA 1C1XB 2QJWA 1U8ZA 4WNAA 3RARA 3D8NA 2YXBA 5JTUA 3CU5A 1PL7A 3A6DA 2CXNA 3Q9SA 4JENA 4ZEOA 3WBKA 1PFWA 4IKPA 3F8SA 1D09A 2WIKA 4RADA 1F60A 4IMIB 3LRXA 2YBDA 1ZXLA 3B36A 3ZH2A 1F2TA 2AYYA 4DXHA 5LZ2A 2ZUFA 2QD4A 4LXYA 4Y98A 2J9ZB 5EL0A 1RIIA 4DYVA 4AYXA 4A1OA 3K6KA 4Q37A 1ZNWA 3NVAA 2VPWA 2YQZA 1T0IA 3SSMA 4CV2A 1F4PA 3LGAA 1OH5A 5GOTA 1O0SA 4YRKA 1CUAA 1M83A 1GITA 4JYPA 5F77A 3ZOZA 2X5JO 3UT5A 3L8DA 2COKA 3WXMA 4HMPA 2QPTA 1PR4A 1NZDA 1AZTA 1POWA 4IUBS 4OK6A 3TAUA 1JILA 4KQGA 3U40A 4A26A 1EQUA 4CJXA 1KSFX 1NVKA 1UBKS 4DRXA 3A6FA 2C4HA 2H4FA 3QBJA 3I8SA 5EE9A 1YJXA 3GA0A 3GFSA 1YCFA 2PZKA 4DVGA 2VT3A 1P0MA 2B1RA 4FPXA 3TQRA 5C2JB 2ZJBA 2PYIA 1P2VA 3QU7A 5KNCH 4KIGA 4WFJA 4EI2A 4M1QA 3NBUA 2JAUA 3T54A 1ZZGA 2PWZA 5AK6A 4FYJA 4MW9A 2JHAA 1XXHA 5IKXA 4Q7JB 3NBXX 3QOWA 2RC6A 3L79A 2EDAA 2ID4A 3Q87B 4HGPA 5ECDA 2XCRB 1QRUA 2O8BB 2G9VA 2YCLA 2Q29A 1NYQA 1LK0A 5BW6B 2O3JA 3DBRB 3B52X 3O2SB 3RTBA 1B8PA 1JDBC 3VV2A 4EATA 3T5BA 1OC2A 4EPTA 2W0SA 1CETA 1GG8A 2JLSA 4BO4A 1GZSA 1ODFA 3R0VA 1E6EA 2CZGA 4LXTA 5L45A 2G8LA 5DO9A 2VS1A 2MMGA 3GLHA 4HDQB 1RP7A 2A14A 1RMTA 2I2FA 3H1BA 4IMPA 5FA6A 1L4UA 4P4GA 4WTOA 4F45A 1Y3BE 2AZ4A 3PBKA 1SQFA 1L5OA 3MWFA 5HIMA 5HCUA 4BEBA 2NXCA 2XB4A 4FJ0A 4MVYA 4KIUA 1PQPA 3ZHCA 3EZ6A 4QPDA 3VR5H 3BMCA 3CR8A 4RTLA 3T52A 4PZZA 4J0EA 4MSUA 4B32A 2VF5X 5AOVA 4UE2A 4OX9Y 1IZZA 4WLUA 3EXIB 4QGGA 4V24A 3A1NA 3EZ7A 4QOSA 4GYJA 5CLGA 2XNDD 4CG0A 1Y8QA 2DKOA 4K40A 4WFQA 4QPJC 5JSYA 1KMNA 5LR6A 3WLHA 3AJ8A 3G68A 3QY9A 3DP9A 4PHFA 1UJ6A 2XD9A 5H70A 4CR6A 4TLDA 1HURA 5BSTA 4X6XA 1KI9A 1SBIA 3HZHA 5JS1A 4KSYA 1C1DB 2WYOA 4Q6WA 3G2HA 3ZIAD 1I0ZA 2IHYA 4LVCA 1PDVA 1XTVA 5E6RA 4QTXA 3VPHA 2ZUEA 3M34A 3HKEB 3V80A 2QRUA 2H2IA 3JQ7A 3BS4A 3DHNA 221PA 5A0FA 2HJGA 3QMMA 1BHJA 1TQ8A 1GKLA 4PZ0A 1JR2A 1KR5A 1ICEA 1SFRA 3H5LA 3ILSA 4N6NA 1Y48E 4B40A 5TVKA 1BX1A 1W73A 5JFTA 5D5QA 4F3KA 3L0OA 1GTRA 1TUGA 1N6PA 1HO3A 1UMBB 3O03A 2FG6C 4F56A 4DAOA 4B48A 3COYA 3E3OA 4V3CA 3VZPA 4L27A 3SD7A 5DTQA 4AZ3B 1K2WA 2NZ2A 1TK9A 3CT6A 4DLNA 3O1IC 4YAKA 4E2XA 3LY7A 3M6XA 1V1RA 5FR2A 1OTXA 4II3A 2VXOA 4AJ2A 1MC8A 1V41E 4YJ3F 2ZQZA 5EKTA 3P4XA 2XH8A 3KVYA 1CC1S 1XTQA 3CGGA 1SCIA 2DZDA 1PS0A 2KYRA 1R2QA 1GZUA 4P3PA 3WYBA 3TECE 2DP4E 5BUZA 5EJEA 1G8YA 1SD1A 2R25B 1PJLA 5IARA 3GT7A 4PQFA 4YJGA 5ENZA 1B8NA 4M99A 4RYDA 2ZI7A 5ALYA 3P27A 1U2EA 3PNPA 4L9RA 3MPUA 2FI1A 2F1IA 2P69A 1K6IA 4JI1B 4ALMA 3K4QA 3FJYA 4EUFA 2PYZA 4INZA 3CZ4A 4GPTA 4M1EA 2GJKA 1LV7A 5JU6A 5A3QA 1IQUA 2FPPA 3TB6A 1NIPA 3FWZA 1P33A 5AVYA 5HUHA 5LN1A 2MYUA 2JD0A 4KR2A 3HP7A 3EGIA 3PX3A 3UUWA 4TRJA 2ALJA 2PQ0A 3KOMA 1QRAA 4M6WB 5KB3A 2PBLA 3L5OA 3IAEA 5BURA 1GGMA 1JKMA 4QEDA 3ISTA 5KQRA 4G8CA 1TK2A 2AVNA 1XMVA 4JT9A 5FUWA 3JALB 3FCSB 1T5HX 1LDYA 2HM7A 5E7JA 3VSBA 1KU6A 1IBKB 4K0KB 1KRWA 2VFAA 2F17A 4BZQA 3I9KA 2GK4A 2XJ9A 4H4EA 5K3CA 1ISHA 1K8YB 1UQUA 2GYUA 2ZRQA 3KPWA 1OPXA 3B6KA 2IZ7A 4NV3A 3KLMX 4AJIA 3D0RA 3ZIDA 1R5OA 1Z62A 2IZOA 2V8BA 3DAOA 3L4EA 3N8GA 2BFFA 4DDUA 3HFGA 1NAHA 1YB2A 5A3SA 3IH5A 3ADPA 3BJRA 3LUDA 2BELA 2G25A 3ELUA 1CB0A 4FXOA 5DCYA 3SZ3A 3N2EA 3IKVA 4Y7CA 5HYVA 3NEJA 1AV6A 3MWKA 2CF6A 2W2KA 1KMCA 1ONNA 1WW3A 4X1YA 5F73A 2H5IA 1FNCA 3HRIA 1ZP6A 3QOFA 1DRUA 2HA5A 2XTJA 4IWNA 3Q0IA 1P17A 5IT4A 3NVKI 2JK1A 3AESB 5HQ3B 1N9GB 2BOVA 2VQ6A 1D6NA 2WC1A 2ODEA 4JT2A 3GUUA 4TXNA 2ZJ1A 5K8JB 1SZCA 2C3UA 2H1LA 4GR5A 4EECA 5GGXA 2IE0A 2WZQA 1IN5A 1P9RA 2WUVA 1TC1A 1R18A 2ZU0C 2E4AA 3HMKA 3MWGA 4AMUA 3UG7A 5DRYA 3UEOA 3UGTA 2ACWA 3OLWA 4XWTA 2QSUA 3QX7A 4BLSA 3I2YX 2ATXA 3OTHA 5C3MA 1YI0A 2IZ5A 2VHWA 2WB4A 3O2JA 5HM8A 4FS8A 4X95A 5SZIA 3CJQA 1TM3E 3N3BC 3C5VA 5LDGA 1Z5WA 2HPAA 2JA1A 3PEEA 5FNVA 5JSZB 3PF9A 3FVQA 1YCDA 2ECKA 2QW8A 3DAYA 4EG3A 4J03A 4EPWA 4LF6B 5KAMA 3HKCA 1G20B 2I4OA 2NV6A 2XQGA 1VL6A 2GSDA 4S1VA 3RWOA 5A5DA 2Q3FA 3V9AA 1T24A 3NWPA 5JDIA 1C30A 1DJMA 4UHCA 2Y0EA 2IC5A 3HJNA 2CNDA 1ES9A 1NPYA 3ED1A 3IXMA 3OTIA 2OUKA 3OC6A 3AH8A 3LVRE 4J3NA 3UWSA 1QS0B 1WX1A 4EQ6A 5FR1A 2ID7A 1T0JB 1RIFA 2EFJA 4MIOA 2Y66A 1QIJA 1KYVA 4Q3CA 4N18A 4D9CA 5C37A 3O74A 1VGVA 1W0KD 4XDHA 5CCEA 1ESZA 2V6FA 2XWQA 5CTJA 4WK2B 5CDTA 5JOQA 2G0TA 3ZV6A 3T9CA 1FNBA 2NTJA 3O8QB 4MLCA 4AN0A 3QW4B 3SS8A 4UEJA 5DM60 5HF8A 2GYYA 4EYSA 3A7EA 1N2SA 1YXMA 5AM1A 1EUQA 1F3OA 1PJBA 1UC5B 1Z28A 3F5SA 5K4GA 3N2GB 2DY0A 1C81A 4BAZA 2D4AA 3C3YA 5B64A 4XW2A 3ZWCA 2QM0A 1CDOA 3OOEA 4NP6A 1X9GA 2VQSA 3SR4A 1ZHFA 2JFVA 4GPD1 2C7RA 3PL1A 3JATA 1L5RA 5IT0A 3CZCA 3EA5A 3QBTA 4C6HA 3PLAE 4KQWA 2FQ1A 3B9RA 1Y9ZA 1G21B 3A9UA 3G0HA 2VK2A 3R3SA 3EGDB 1QQAA 2XZPA 3HZZA 5JJKA 2JIMA 5EIWA 2CJWB 1Y4ZA 3MAAC 2MSCB 3GGSA 4U0KA 2WF9A 5AJXA 3B9BA 1GKKA 2VDQB 2Z5GA 2PZAA 1WOMA 4B8ZA 3HJHA 1V5EA 3DG9A 5SV2A 1Z13A 1PFUA 3SX2A 5JS6A 2AIRA 2PZLA 2BM1A 1EG2A 1KAQA 2ZPUA 3HU3A 2B8WA 4EPYA 3QKUA 3RF7A 3SYKA 1UBMS 3MF4A 2Z1DA 3EOZA 1B0UA 1JN0A 4LNHA 1AQIA 1NW5A 3WADA 1QK4A 4RAQA 1RSZA 2MINA 3Q98A 4DQKA 2XADA 4MTCA 1KE2A 2D54A 5CB4B 2BEWB 2H7XA 2JBAB 1IN4A 2ZIXB 1MD9A 4N0DA 4XA8A 2PUVA 1M1YA 1SULA 3KUDA 3AL0C 1HK7A 3B9QA 3DV9A 4TYPA 4Z8YA 4DDTA 3JWIA 1YQQA 1V11B 4PTLA 3CKMA 3RS2A 5HVNA 3C8ZA 2HV8A 3IQGX 2B4RO 1WV0A 1JEQA 4HH3C 5IF9A 2Z95A 3DL7A 4RIEA 1IWOA 4YPFA 3R3ZA 2O2CA 3R6LA 4LHSA 2QP3A 3UMJA 4HFRA 1HMYA 3VPAA 1U8TA 5ALGA 2I3GA 1UKYA 2NAFA 2FUNB 2E1PA 3P9KA 3WVNA 1DXHA 3Q85A 4DC1A 1WSAA 3L7MA 4GVLA 5B6IA 4YDQA 1DTEA 3NTOA 4L57A 5CFMA 5FBLB 4MRPA 2IDKA 2PS0A 2H0AA 5HZGA 3QXXA 1PW5A 4ECEA 3A14A 1GGKA 2EX1A 4QPNA 3SDSA 4EG8A 1DPGA 2A0FA 2H5EA 3GGGA 3WWDA 2FKAA 2ZZKA 4EX6A 4JBHA 4YT5A 1QZTA 5DEIA 3BN3A 3L7YA 2NQTA 2P2NA 3O75A 4OXKA 2QRLA 4UOZA 1YC5A 4EYQA 1EGHA 1XRSB 2CD9A 1L8AA 2KPOA 1L5MA 3NR2A 1WCIA 3Q3JB 2FR1A 2XUDA 4NDNE 1A3CA 3K05A 3EVAA 2FWAA 3NHJA 3UZUA 5JTTA 2CLCX 4O2BB 3GNSA 1UEXC 1TKRA 1VDZA 1ELOA 1ZNYA 2RI1A 4UQPA 1T26A 5FO0A 3SS9X 5BSUA 4C4PA 3CF4G 1WA5A 4JC4A 4U9IS 3IQDB 2GEBA 2PUFA 4N0MA 5CXQA 1PNQA 1G1MA 3N8DA 4HB3A 3LT2A 3ZR4B 1WXXA 4BQSA 5K3SA 1N3LA 3WGJA 1I7LA 5K1ZA 3T4PA 4BQRA 3MWDA 5LU9A 3N9IA 1KAGA 3LWDA 5IF3A 4E12A 2H48A 3OA0A 4DR2B 5CA1B 4EG5A 1P8AA 3V1KA 4EEKA 1GNQA 1KY4A 1VE3A 1RC0A 3DVLA 3KLBA 3NEYA 4R9VA 4UC0A 3GFRA 5DTIA 1T2EA 3BDAA 1JR3A 1MNQA 4JZKA 4KXLA 4FUQA 1R6BX 1BSVA 2P9GA 4PRLA 1P4AA 3KQYA 4CF7A 1TKAA 1L7BA 2NO6A 3VPBA 2IF0A 4NYIR 4XOUA 5K0NA 3PHGA 2AS0A 3CX6A 3HI6A 3WXBA 2GPTA 5J2TA 5INTA 5T67A 1PDWA 1WKVA 2DQZA 4R2HA 2YWEA 3PUKA 3MTQA 1NV8A 5DBFA 4WBNB 1M2GA 2PIAA 3K0CC 4HNHA 3RSZA 1X80A 3BD9A 5IYZF 3OLQA 1TM4E 1OZ0A 3MCWA 3MTEA 1B8OA 1GL7A 1HRDA 2VDRB 2X23A 3KB2A 4QUAA 4WECA 3REGA 1DI0A 1N2CE 1X6VA 4L16A 4CNBA 5IXJA 4EHLA 3WYGA 2PX3A 2HMWA 3X44A 1ZCFA 3LCMA 4FS3A 3V97A 4KJXA 3UO8B 3AM4A 2XYHA 4ACBA 2XOEA 1DIRA 3UGJA 1KJIA 5KSOA 1M2VB 3EDQA 4A6DA 2HRQA 1FTQA 4IHQA 1HDYA 1BXGB 2XDAA 1M6VB 2SECE 1FFWA 3CVOA 3EXG2 3RT1A 3AUFA 4I1RA 2P6UA 5LZ5A 2Y1GA 3RNOA 2ZROA 5ALOA 5KVAA 2CNKA 2UDPA 1V7QA 3I4LA 1XD8A 4N3NA 4UQLA 1UBOS 4BN4A 1Z0SA 1NLZA 4OHUA 3PGA1 1VKJA 4MHSA 4R7ZA 3RRYA 1N6KA 1I0LA 2M6SA 3VTZA 5LMUB 2VP6A 3MINA 4LVOA 4O4LA 4QG3A 5CM2Z 3E2IA 1TMOA 1XTKA 3LUBA 1A5ZA 1BWSA 4QT0A 2RGCA 4R9NA 1CUEA 1F06A 1Y7TA 4FZJA 4TQ9A 4DG9A 1C1XA 4YHBA 3RS8A 1U6IA 3AJ9A 4YRLA 4PZUA 3VR4D 4OHKA 2H2DA 4DY4A 1LBTA 4JX9A 3L7JA 4BYGA 3QPDA 1KFKB 1QUFA 3BIJA 3MMSA 4KQXA 4DM7A 3FKQA 1VJ0A 4RSMA 6ADHA 1GPJA 4ALIA 4D41A 2V0GA 2H51A 1GGFA 3V8BA 3ZNQA 2XUKA 3AERB 3PFBA 2PFSA 1CFZA 1VG8A 3T1QA 3QEMB 2XE7A 3WB1A 1YVRA 4NI5A 3VZQA 3QEKA 1U28A 4D9MA 1WSBA 3OKAA 3EY4A 2PFGA 4EYEA 5L51A 3GG2A 3SX0A 3H1GA 4YT4A 2AJ8A 1OU4A 2VG8A 1NAIA 2Y0PA 5BN5B 4OSOA 3LT5A 2WF5A 2YIDA 3ZTWA 2ZZMA 1ATIA 5DFAA 1Z17A 2FRXA 2OQ2A 4YO8A 1I30A 2XYPA 1EUDB 2N9UA 5CGZA 4F9GA 3WMGA 4CKEB 1KQGA 1VDMA 2XCUA 2P4QA 1CERA 3UVEA 5AHKA 1KHTA 3TJMA 4BMOB 1ENPA 1LJLA 3THXB 4CLOB 4RYLA 4EENA 4ZEMA 2VSYA 1MF7A 4ND7A 3KDSE 3MMPA 3J81A 1M2FA 1Z3CA 1PV2A 2WDPA 3IP3A 3V1MA 4DIFA 3SQWA 3C3JA 3RU3A 3PEVA 5E4YA 3ZKAA 3RREA 2I7VA 2R4TA 1CUVA 2O2GA 3OTGA 4OFXA 1W48A 1RPTA 1P77A 2P1RA 821PA 2YQ5A 4AUKA 1MG0A 2FK7A 2OQIA 2WYHA 4TROA 4IV0A 3WKEA 4LXXA 2YWDA 2P2LA 1OXMA 3DBRA 5KPJA 1NP3A 2VBFA 3HBJA 2X4GA 1YZNA 2OV1A 2PSFA 3GUHA 2RAVA 3OJ0A 5CAEB 5FFMA 3PEFA 1XCJA 4NBVA 5AQ1A 4FW8A 3KJHA 1Q1NA 1K3FA 1TJYA 3JRWA 2IWHA 3JYLA 1D1TA 1UL1X 4RHFA 3VDXA 2C7OA 2I54A 4F85A 1BW9A 1L7EA 2I2DA 3OEWA 4KLZA 3SC2B 3BG5A 5GTDA 5F7ZA 4DBLC 3HL4A 4PXYA 1FSGA 1BE1A 1JSCA 4CEIA 1TAUA 2OP1A 4ENPA 5K8LA 3IL2A 2C00A 1HT0A 1OZFA 1VZ2A 2JASA 2OLEA 4KWCA 5AKXA 5DMHA 3UV6A 4RACA 3O82A 2R6JA 4KN5A 1YRYE 2VT7A 3ZWDA 3KPYA 3GYGA 1R4NA 1KYXA 1CLEA 5IDWA 1XCBA 1NZFA 3WJAA 2HBQA 1KWGA 4BVEA 1Y7PA 4BUZA 1EFHA 1XL1A 1ULZA 4XVCA 1PR6A 1ISIA 1YV9A 3EXIA 5ELMA 4E46A 3ROGA 3NETA 4PVCA 2JFWA 3GCZA 2ZJZA 4R9SA 3DGFC 4DS3A 4MIYA 1P60A 4ZVRA 3E05A 3M1AA 2VWPA 3U7HB 1NJ5A 4O33A 3VU8A 4GOOD 5ALHA 3OFKA 1BYIA 3H5VA 1F5SA 1E4EB 1RCTE 4KXQA 2VBGA 4G1CA 3A4MA 4HEHA 4ITRC 1YBMA 3NGLA 1IWPB 1GT6A 3HKEA 4HLQB 3U3KA 4F91B 4DUYB 1EKXA 4LTMA 4EGAA 4Q9NA 3BK7A 5KYYA 2WIBA 4C7BA 3F49S 5ARDA 1ANKA 5F3DA 4LHVA 3OPVA 4BPRA 1L7OA 1T5TA 1G2QA 4DKXA 4YWHA 3DTVD 4Z4HA 2ZAOA 1J07A 1UMBA 3GA5A 3S99A 5B37A 2WM8A 3H9GA 1TQDA 1RYFA 2BFEA 4GXNA 1L7PA 1ZUNB 4AZ3A 4C6RA 4LGVA 3T7TA 5K6AA 1O95A 4BECA 3T3PB 3R4CA 3GRVA 2X0DA 3QPBA 1W0JA 2CHEA 5FYDA 3GEPA 3KYDA 1T6ZA 2ZBDA 4KE9A 3AX6A 1N2GA 1IJBA 3IQFA 4C4YA 1E5VA 2C2ZA 4CCAA 5LJLA 2NSJA 1A9ZA 5I9LA 3ZDBA 1QF6A 3V7WA 2HQOA 2AKYA 4AJNA 1QHSA 3N2IA 3CH5A 4NH4A 2CFCA 2OVFA 2WWTA 4PWYA 1TCBA 1SY7A 2MU1A 4HVTA 4XFJA 2B61A 2JB9A 2Q2NA 4HDMA 4C0WA 5BNIA 3ASUA 4Y6RA 3GC6A 4QLAA 4BX2A 1E2HA 5C4IA 1KEVA 1KK1A 1TE2A 3Q1LA 2QD5A 2KQUA 5DH9A 5BVGB 3H1FA 1PEYA 3CTMA 3R5FA 3IHWA 3TEMA 2AN1A 3NH9A 5BOSA 3TSOA 3WWCA 4IQ4A 1NONA 3PRYA 3PT5A 2PH3A 1JDJA 2PMCA 3PNBA 5EXTA 3RVJA 4V02A 4J43A 1YULA 1ETHA 1GU0A 3P0RA 1QHHA 3UN1A 2JI7A 2ZB8A 1ONSA 1G4HA 2QDXA 2F00A 4KI0A 1ULHA 3ESBA 4IDFA 4PPQA 5G41A 1KEPA 2XCOA 4FLEA 4A73A 4B2LA 2IU6A 2XA2A 3BE4A 4UDNA 1GPDG 1NBMA 3ZS9A 3CLKA 1KDYA 3I0NA 1YD7A 3PXBA 1VP9A 2J4DA 3QELA 3JVUA 3E4DA 4BVKA 2WJVA 3FOCA 5K9ZA 2QMYA 1Q7EA 1PJZA 2UKDA 1NM5A 3K0AA 2OTCA 2PVSA 1W36B 4MVXA 4KNYA 4ZMSA 4N7MA 3F5DA 3TINA 1T1RA 1FBNA 4IVQA 4MQLA 1PGJA 1RXYA 3LKBA 4B44A 1M76A 1RWMA 5F12A 3ICPA 3P52A 3HFRA 2ZYGA 1LF5A 1OIXA 4NU8X 4PZEA 4QEZA 2C31A 3PICA 1HLFA 1KH2A 2JGRA 4L0MA 3HO8A 3W06A 2JLCA 3OIDA 4Q3EA 2IU4A 4WCFC 2Z5FA 5FPPA 2H57A 1Q2XA 2Q5IA 3G9XA 3KEOA 1G42A 1Z16A 4I19A 3VPGA 4DR5B 4DT1A 5I7UA 2HB6A 4S05A 3OOYA 3N2LA 2VDWB 3SHQA 2FQQA 4RQBA 5JVDA 1TYEB 3N6RA 2ZT6A 2VCHA 4BOYA 1PV4A 5AVJA 1RBMA 4DCUA 3HACA 3RAJA 4MGYR 1DVRA 2EHDA 2D2XA 2CYBA 1C3LA 1WM1A 3PC8A 2AG8A 3RVNA 3FB4A 4MW7A 5EE1A 2I2BA 3QXGA 2WTEA 3NUZA 3EQ2A 4GSLA 4J49A 1MX1A 4DARA 2HV9A 4IY1A 5ITSA 2EG5A 4LXGA 2AGVA 4LZWA 2GERA 4IINA 1IJFA 1MEEA 1MH9A 3ISJA 5H16A 5DMXA 3O91A 4DN6A 1GARA 5JSZA 5JLAA 1YS9A 3WOHA 3SYNA 2Y3IA 2W6CX 3V9PA 1DWUA 5F33A 3CCFA 3Q88A 1KJQA 1S4MA 4H7PA 3S8MA 3X1JA 3EAQA 1XRMA 4DABA 2EKDA 3HKDA 2GAFA 3QXCA 3GNTA 3DC2A 3U3XA 1VHLA 2ZCVA 1FFHA 1OFVA 2AEMA 1E3LA 2J9FB 2ZPAA 4JMPA 3BA1A 4HDRA 4UNPA 2X2PA 4KE8A 3Q9UA 1VP3A 3TRJA 2M1XA 4DJ5X 3T9AA 1XWWA 3KKNA 1DNPA 3KU4A 5ERYA 4ZVLA 2O8FA 2FSVC 4YJ3A 4ZI5A 2FMUA 3P9PA 3ILVA 4PCAA 2J85A 1O6GA 1BMFD 4B80A 1YQGA 2ZRLA 3ENVA 1EX1A 5D3ZA 4NPCA 3S44A 4BDTA 5JI2E 4D8UA 1MV8A 5FT9A 1SOUA 2IEBA 1G8SA 2Q4EA 4NBUA 3FPLA 3K9WA 2P4EA 4UAVA 3I53A 5SYNA 1D4FA 2PGIA 2R7NA 1W85B 2BAGA 4M1OA 2QXYA 2XQVA 3BMQB 4D45A 3RUPA 4RZ3A 4GU5A 4WKNA 1LLCA 2I3AA 3OCJA 4HQFA 4JSYA 3IVGA 1A5BB 3MMZA 4PHGA 1EZ4A 4J0DA 5L9AA 4TRRA 1DG1G 3FDJA 5JSKA 1O87A 2VP2A 2I71A 3AFIA 4PYLA 5DX1A 3B51X 2D2EA 2ZWMA 1P5HA 3TQOA 3CHYA 3ELYA 3H1EA 4FKMA 5AOBA 3W90A 3UICA 2BMAA 1O96B 3CEPB 2PDAA 2XW6A 1IK4A 4CI9A 4GW3A 4DLLA 4M98A 4PZYA 4BWYA 4XIJA 1VPEA 3SEFA 5IJZA 4GX1A 1AN0A 3L7DA 4RVCA 2E82A 4IFIA 3JU3A 3ZJ5A 1OAKA 2ZUSA 4P3OA 1TLTA 2FFRA 2HBRA 1XYGA 1HFEL 3AWIA 4ZXFA 1XPUA 3EFBA 1R0LA 4ZCTA 4ZZ0A 1E3MA 4GBMA 1KKMA 1IJEA 3LPLA 2EGUA 3ORYA 4Q4HA 2Q1XA 3EGEA 4CUZA 3KKQA 4MGEA 4RA9A 2GGSA 1FSSA 3C1TA 4L5CA 1R8QA 4L3OA 2WUGA 4WN9B 3TGLA 2YMPA 5ALEA 4PR3A 1UPUA 2P3OA 3D6HA 1ZNXA 2JBAA 4JLVA 4CF3A 2CGEA 2ZIXA 4Y2QA 4DQLA 1MB0A 3SIWA 4CL8A 1BNCA 4N47A 2IXFA 3C14C 4CFSA 3CC8A 4MULA 1GYPA 2RHOA 2QMOA 3AEKB 1K6JA 3I72A 4KREA 4EFDA 2PHZA 4KRGA 3RK1A 4PZ9A 1DX6A 4MROA 3DZIA 4NONA 3F9CA 4YAWA 3I39X 3DOFA 1CR6A 4QPCA 1PZEA 4BBZA 1AUOA 3KPUA 5COAA 3AL3A 3HA3A 5FHRA 1MAWA 4LQ4A 4PS0A 1GAJA 1USIA 3MZ0A 4A0GA 3GNLA 2JD1A 1NSYA 2AKAB 1PQYA 2ECPA 3HR8A 4HZUB 1YIOA 2NM0A 3OQHA 4DLUA 3QX9A 5I3ZA 4N8EA 4EDFA 1P4GA 3S5JA 2FPGA 5KAPA 1JDUA 4I4CA 2GD1O 4PFQA 5JMTA 1ZSVA 2A30A 3TW8A 3VAZA 3I1IA 3IT0A 3T4EA 5TY0A 2OR3A 2YRXA 3PFWO 2W8BB 1RAFA 1PVDA 4PSVA 1X86B 4Y1GA 1T4CB 2NU6B 1PLJA 1Z75A 3FNIA 2QVZX 2AG0A 4HBZA 4LJ4A 2P4HX 1RAEA 4O2BA 5CX1B 1PZXA 3OSUA 1Z2AA 2WHPB 1Z39A 1SK9A 4BVGA 1A76A 5HRCA 1PR9A 1ZO8A 3HVUA 2Z3VA 4MVJI 3SZUA 3DMYA 1HX7A 5BVHA 3TLZA 1KK3A 3ASYA 5CD1A 1Z2OX 1HDXA 3EXG1 4WV3A 4X63A 1KQFA 3D6NB 2GM3A 3U0VA 2J3MA 4I9HA 1SOWA 5JG7A 1TC2A 4PSAA 2QMZA 3Q15C 5EWMB 3ZJYA 1PYGA 4EITA 1KMHB 1VCMA 4S1WA 2EIXA 5F52A 2H52A 3TKAA 2WWHA 4D8WA 1CRPA 3L1IA 1CVIA 2DJIA 3Q3EA 1SELA 1JFVA 3W3AD 1GPLA 1K2VN 3LCRA 1G38A 2P35A 4OXXA 2V7QD 4BNZA 3KL2A 3OECA 1OI2A 3MLBA 5CTAA 4EHDA 2QAGB 2AUNA 4JCOA 1HORA 1USKA 1Z6GA 2C98A 2G07A 2R85A 3O9MA 4GP7A 4QBHA 4WESA 3T3IA 1WLSA 3L18A 4R8VA 1NKTA 5CA0B 5H5JA 1EFVA 3W5JA 4EJ6A 4RZHA 5JDCC 2XMBA 4XVHA 1FFXB 3HB7A 4OBEA 2AYXA 5I4IA 3GLFB 2ZVPX 4JWTA 3ZS8A 2R8PA 4L3VA 1UFKA 3B60A 3H3JA 1RI5A 1LV8A 4BVFA 3IUBA 5FPKA 1MO4A 2Z43A 4IXTA 4RDXA 4WY5A 1LLFA 1C3OB 4YDHB 4C4TA 1QKJA 3CONA 4Q18A 4IJMA 3ZLTA 2A1IA 3DZGA 4HI0E 3TVDA 3UAYA 1REQA 5B7QA 2CLKB 2QK4A 2KW5A 1KTVA 2ZR9A 2HI0A 1QTNA 3HSYA 3MJRA 4FLMA 4WW0A 4DLVA 4ZJUA 5JNUA 5LFAA 3B53X 3W5CA 4ARZB 3IVRA 2QRJA 3GJTA 1R4AA 1G3QA 1WNFA 4M9UA 9ABPA 1S4QA 2FMFA 3G8AA 3M9WA 3FNEA 5JZBA 2O2XA 4F2HA 4DEXA 3K09A 1NG9A 3NI2A 5IEBA 5AFSA 4LCEA 1M8PA 1ESDA 4UW9A 1NLFA 3N59A 2E7ZA 3OQIB 4KBYA 2RGGA 4ROSA 2XXJA 1X3LA 2L2QA 4D0NA 4PSUA 2J67A 1A9OA 1CXZA 3H5NA 4FONA 2BGIA 4WFKA 4Y30A 4ZZ2A 2VCYA 2IPXA 4I0WB 1DIHA 3AC0A 1Z0AA 3L02A 5ICEA 3VNUA 5FBWB 2PRIA 3NKFA 2CFSA 1E7RA 2OP0A 3LMKA 1V39A 3PUVA 3MRXA 4I8IA 1J2UA 3G5AA 3QWAA 1WMSA 3VBCA 1GGHA 2HFJA 4IXWA 4FMDB 3B1KA 3RFUA 5EGSA 1A50B 3EVDA 4CMKA 5LYJF 1AQ6A 1V1MB 2EKQA 3SFVA 4B3FX 3A4IA 3JXEA 3GI1A 1SNYA 3K5IA 4NOJA 1P0PA 4KQ1A 2FEPA 2UUOA 3OHMA 4LK2A 1ZMOA 3SZOA 3HB0A 4CM4A 2QIOA 4MWZA 3GU3A 1ECJA 3E3MA 3FCOA 1N2XA 1QQ7A 3GLKA 3G1WA 1SMKA 1H2WA 1U99A 4RF4A 5J58A 3D3EA 1AC5A 3FPJA 2XCTB 4X00A 1CLUA 3PHCA 4QUBA 5AVUA 3OZVA 4OGFA 2Q6IA 3T3NA 3HJRA 3KEGA 3OFSA 3OQPA 5HHTA 4Q9HA 1WVMA 1AMNA 3V7FA 1GCGA 4CKEA 3TR6A 1JMYA 5AW1A 5FIUA 4JLUA 3F3MA 4V03A 2FRDC 3RKRA 4RTNA 3RM3A 1PNRA 3ESRA 5G4KA 2P9CA 3IO3A 3F97A 4GOMD 3VSAA 2W48A 3T3HA 4FJ1A 3U49A 4QTYA 4YCSA 4K9LA 1Z0DA 3JD0A 5G4LA 1GDTA 2PZMA 1B23P 1SPBS 5BOVA 2OA0A 5AM2A 3L0IB 4HGRA 4QECA 2PLFA 3KPVA 5ALMA 3AF0A 1E9VA 4NEHB 3OIWA 5KDDA 1K8XB 3IMCA 2VQFB 2JBWA 4PYIA 2OKCA 2V3CC 5AKKA 4Z4QA 4J90A 2CKDA 1D2EA 3VPSA 2FEMA 2UXCB 1W59A 5FA8A 4IRMA 1KKLA 2VYND 4P7GA 5ITWA 4MLPA 2I1WA 1R16A 1QGOA 1ORRA 3R24A 1GUAA 1NKVA 4AJLA 2Q1YA 2GN8A 3SICE 2J0QA 2PQ2A 3T1OA 1R0SA 2Y27A 2DMRA 4UULA 4JLJA 4PGMA 2G63A 4PAWA 1KGSA 1WB4A 5J4KA 1F7VA 2WA1A 3CZ5A 2YC2C 3EHEA 1Y4SA 4K86A 1W581 4WXEA 5ECYA 1MVNA 1XD2B 3V8MA 3UB3A 1Q0RA 4LC0A 2BH2A 4KITB 1F6WA 2Q5JA 2OBFA 1LNSA 2BVNA 5H9WA 3KTFA 4GF5A 2ZSJA 1JJVA 2PSHA 4Y1RA 1Y4AE 1V4BA 2FW8A 3ND5A 1R37A 3OM8A 1TO1E 4BO8A 1QQBA 3CBQA 4NECA 2FG7C 2ZAYA 4F9EA 4JU8A 3TW6A 3KD3A 4ZDJA 1F0YA 3B2EA 3K9GA 4K6FA 5K0ZA 1Z4QA 1QV7A 1HGXA 1X8XA 2DCMA 2WAXA 2QTAA 4AWBA 2QKYA 1YVDA 1G17A 2GCNA 5KOYA 1RHRA 1LX6A 3F46A 2IBTA 3PL5A 3I0ZA 5H3CA 5CVUA 2GD0A 2PGOA 2VUUA 3D2CA 1M6EX 2XYQA 3GJQA 4PYRA 4X92A 2GZ1A 5KSPA 3Q8LA 1U5BB 1HFWA 3IQEA 2NZYA 4Y9RA 2NSHA 3GXOA 4FX2A 2H4YA 4C01A 3FUVA 1GKIA 3PXGA 1IY1A 1GY8A 1ZVMA 4BNDA 3G59A 4I55B 5FJJA 4ZCPA 3OTOB 4R3WA 4B7AA 3R3YA 1HYBA 4NCXA 2LBPA 2VKTA 4UU1A 1CJCA 2VLIA 3SHTA 1YZQA 5JNLA 2C8JA 3MHTA 4C3OB 4XPZA 2JKYA 3PSHA 4B3SB 1ZUNA 1NNUA 2RH9B 4MS3B 1S1MA 2PUBA 4JGIA 1X15A 1SCKA 2VJLA 2XDQA 3V8RA 4LPKA 2J07A 3IV7A<