1C7FA

D95e oxidized flavodoxin mutant from d. vulgaris
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
147
structure length
147
Chain Sequence
PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKVACFGCGESSYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FLAVODOXIN
publication title Crystallographic Investigation of the Role of Aspartate 95 in the Modulation of the Redox Potentials Of Desulfovibrio Vulgaris Flavodoxin
pubmed doi rcsb
source organism Desulfovibrio vulgaris
total genus 50
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1c7fA00
4LTMA 3KLBA 1FUEA 3NHFA 1B1CA 3OX2A 1YCFA 1J8QA 2F1OA 1J9EA 2FAXA 1CZKA 1FLAA 4FX2A 2FX2A 4YQEA 3ZHOA 2QX8A 1SQSA 1YCHA 4CF6A 4Y9UA 3ESXA 4GR9A 2R96A 2XODA 4ZVMA 4DILA 2OHJA 5LBUA 4GI5A 3GAMA 4ZVKA 1RLIA 2OHIA 3U7IA 1AHNA 1XYYA 1DXOA 1AMOA 2OYSA 3QFCA 5EAIA 4S24A 2BF4A 4QOFA 3F90A 1WSWA 2FZVA 1RLJA 3FX2A 4QOJA 2HNAA 5FA6A 3TZBA 1YCGA 3NHWA 2M6RA 3LT5A 4H6PA 4YAFA 1J9ZA 2V5UA 1D04A 4YAWA 1QBGA 1CZOA 1E5DA 3QFRA 3KAQA 3QE2A 2BMVA 1TIKA 1FLNA 1H69A 4XDHA 5F12A 1JA0A 4FGJA 4YAOA 3KEGA 3EDOA 1D4AA 2D5IA 1AKWA 2MWMA 4PTYA 2HPVA 1JA1A 1DXQA 4ZVLA 3K20A 4ICIA 1AKVA 4LTNA 4QOHA 4LA4A 1CZLA 4QOIA 1AKTA 3HA2A 4C0XA 3N3AC 2AMJA 1KBQA 4U7GA 2FZ5A 2Z9CA 4M0CA 4OXXA 2MTBA 5NULA 4U7FA 1ZWKA 1WSBA 1FVXA 4F8YA 3JSXA 4N82A 5NLLA 6NULA 2QMYA 1XT6A 3GFSA 3N39C 4J8PA 5FUQA 4N65A 3NHUA 2BPOA 4QOGA 3GFRA 2FLVA 3NFRA 3FJOA 2WC1A 4XDGA 1V4BA 1CZRA 1QR2A 2KQUA 3W78A 4Y9RA 4PTZA 3FNIA 3HR4A 5F51A 3KAPA 2Z9DA 3NHLA 4NULA 3TE7A 1OFVA 3FVWA 3U7RA 1CZUA 3NHPA 5LJIA 4FGKA 2FDXA 1D03A 3NLLA 3B6IA 3LCMA 2OHHA 4CETA 4DIKA 3FW1A 1C7FA 3ESYA 3GFQA 2MT9A 3L9XA 2ARKA 4YALA 1FLVA 5LBTA 2Q9UA 1AKQA 1OBOA 2BN4A 1YKGA 1H66A 2MOKA 1AZLA 3OWXA 3TEMA 5EMNA 1RTTA 3RPEA 3K1YA 5LJLA 3OWHA 1RCFA 3F6RA 4YAUA 2QWXA 1FX1A 4BMPB 5FX2A 5ULLA 1FTGA 5A4KA 2FOXA 3G5MA 3W77A 4N9QA 5JROA 4ESEA 1CZHA 3F6SA 1AKRA 2X2OA 1DX9A 3ESZA 3SVLA 5LLDA 1AG9A 3D7NA 4LAFA 1TLLA 4DY4A 3NHYA 3O73A 1X77A 2QX9A 4C14A 4LTDA 2X2PA 4FGLA 4HS4A 4PU0A 1ZX1A 3OJXA 3W7AA 5BUCA 1XI2A 1FLDA 1J9GA 1BU5A 1NNI1 2Z9BA 1CZNA 3UXHA 1T0IA 4C0WA 2Z98A 4QODA 2XOEA 2V9CA 4HEQA 3NHKA 5TGZA 2M6SA 3UXEA 3B6JA 5EA2A 4U7HA 3L9WA 5F4BA 3S2YA 2ZKIA 4QOEA 2FCRA 1F4PA 2QR2A 3W79A 3N3BC 4BMOB 1AKUA 3R6WA 1BVYF 2B3DA 4R81A 1YDGA 3P0RA 1QHEA 2Q62A 3ES9A 1VMEA 1QRDA 2V5VA 4ZVNA 5B3KA 2BZSA 4C76A 3NHRA 3HLYA 2FVXA 1OBVA 3B6KA 3B6MA 5B3LA 2R97A 2W5UA 1XYVA 2GSWA 1T5BA 2QX4A 1YRHA 1C7EA 5LMCA 1SG0A 3O2NA 5LVAA 3OX3A 1ZWLA 3OJWA 1I1OA 1KBOA 3F2VA 3NHJA 2QMZA 2A5LA 4D02A 2RG1A 3OX1A 4Y7CA 3NHSA 3EYWA 1GG5A 4GQIA 3OVMA 2QX6A 4H2DA 1YOBA 2KLBA 4NLLA 2HNBA 2N1MA
chains in the Genus database with same CATH superfamily
5BVHB 4GLJA 1MHPA 3U9SA 4WX2B 1GTL1 1TK3A 2GPYA 1R8YA 1ATZA 2I2WA 3UFXA 4DIDA 4LGMA 3PDIA 1K7FB 1N6OA 4Q3CA 1SZDA 5ES3A 4EQZA 1YCDA 1KJIA 1MAUA 3CZRA 1CP3A 3R7BA 3ZXSA 1WUTA 2FAXA 2ZTMA 5EUBA 2RMKA 3T06B 4DREA 5B4UA 2J3DA 1X8JA 1XVAA 2ZT8A 4DQKA 2VT7A 5EJ7A 1E0AA 3MOGA 2ZU0C 2HLHA 4DUGD 3MCZA 4Y6RA 1M0EA 3OF3A 2VUSA 1U31A 1US8A 2J08A 4KPGA 1MB3A 1E2JA 4FU0A 2YY6A 2FW7A 4ZV7A 2BDTA 3E3AA 1E1MA 3EA5A 4FONA 3ZE8A 4DR4B 2X1MA 4DMFA 2BELA 1PD0A 1GZVA 3ORQA 2G17A 4WXYB 3ZJVA 5BSEA 5AK4A 3L4KA 1HYHA 2XR1A 4O4JA 2XKKA 1T91A 4K46A 1SVUA 2DU8A 3KBBA 4CM7A 4D98A 2E6KA 4GI5A 4MS4A 2C9BA 1VRVA 2LR0A 1UZUA 1P72A 1T1GA 4E2FA 2ZUUA 3REQA 2OD2A 3W04A 2BKUA 3D6FA 1Z68A 2WA1A 3OTIA 2YZ2A 4UEJA 3TSYA 1FYXA 3PKJA 1DAOA 1P2DA 2HJVA 1QO7A 4FOTA 3X43A 2ZCJA 1UMCB 5LXTB 2BMAA 4D9KA 3D4IA 5D6OA 4QLOA 1U2EA 1JU4A 3IAFA 1NN3A 4RCVA 3WO1A 1I3KA 2DFKB 3P5SA 5AOBA 1W75A 3QLUC 1E96A 1XCMA 2FCAA 4NZNA 5CLHA 4RKRA 1EUDA 1WY5A 4JI1B 3B6ZA 3HBFA 1RM0A 5ALUA 5HM6A 2FF5A 1KO8A 2AF3C 1KOGA 4YJHA 4IFTA 4OBWA 4QTUB 4IQ4A 2O3SA 4LDJA 4Q00A 1Y3BE 3FVVA 1YQQA 2KMLA 2XTZA 3ZHZA 1CD5A 1J00A 1DBWA 4J07A 3WB0A 1ZRNA 5BMOA 5LLSA 5AXAA 2B92A 3MCUA 3G5LA 1F4LA 4HDMA 4IR7A 2RK4A 1VI2A 3X2EA 1F4VA 1K0FA 1BXGB 1EVZA 1YIOA 1XLWA 3DHEA 4M1KA 1EXMA 2JHPA 4BFSA 1TZJA 1ODCA 4BMNA 1N5KA 4FE3A 2QT1A 3N2ZB 4ZO6A 1ULZA 1MG5A 3HNPA 5FI3A 4B2IA 4MUKA 2YMLA 3D2BA 3A3KA 2I03A 3FYSA 2X3FA 2G4LA 3RBXA 3HDTA 1LW7A 1BXZA 1K7CA 2VZ8A 5DU2A 4D2IA 1N34B 2CJYA 1GPAA 3K9QO 3V4VB 4JI4B 5A9RA 1ZK4A 1H22A 4IIYA 1Y1PA 3JQBC 3TB6A 2UUPA 3RVOA 1CY4A 1VL8A 3LQYA 3LY5A 2M32A 4MIKA 5JXIA 4ZVQA 2WD8A 4BFCA 1TYDE 3B9PA 1G5FA 4J0KA 2Q99A 3M4JA 2IIQA 2QZ4A 3OWOA 4JR0A 1IWBB 3HU5A 3RQSA 4RABA 4BUZA 2X5KO 3LL4A 2FPUA 2BCEA 4BNMA 4M88A 4X61A 4E0BA 3JQDA 1NW5A 4GQAA 1BEZA 2HMSA 4IW3B 2ZTUA 4X8LA 4H0FA 4ZVLA 5CBKA 2VJQA 5CEFA 5AUNB 2JBWA 1SVIA 2H08A 3ZU2A 2P2ZA 2JJQA 1C8KA 4TS1A 1Z5NA 4TN1A 4UDXX 3Q15C 4UAGA 5JDIC 1QK5A 1AKTA 1Z6AA 5CA0B 2GBCA 5IANA 4S0XA 1Y4DE 2NYUA 2JFGA 3GVCA 4IJ5A 4JENA 5IYZB 2ZUTA 4UNRA 5LD2C 1J1UA 1Z5PA 1WVGA 4S1NA 1KL7A 1NVEA 4D8VA 2CCJA 1YUBA 3NEAA 1XZCA 2AMJA 3OOSA 1POWA 1O6CA 5AJZA 5ECWA 4ARBA 4U7GA 1NW9B 4NAHA 1JRLA 4OF4A 4U9UA 4B3HA 4C6HA 4WJZA 2VSQA 4P3XA 3OA2A 3TM5A 4F71A 1V39A 2F43A 3UENA 1IU9A 2UXDB 4BUJA 5IC5A 3M5PA 1DBVO 4KLNA 2J30A 2Q4BA 3DOUA 3ETJA 4F96A 3GFBA 1NBOA 4IWNA 4BTVA 1G98A 3U40A 1XHLA 3T9EA 4KR9A 3VH3A 4AO7A 2DKOA 2QEQA 3C98A 3CSDA 1F9AA 4R3UC 3MCWA 1XXHE 3TNDA 2BC9A 2AZ4A 3EWSA 1E1NA 4C2TA 3M82A 5H16A 3VR5H 1M1YE 1NUPA 1H6CA 1L7VC 1RHQA 3W8NA 3WRWA 1XFDA 3ZQ6A 1ZCFA 5ETJA 1U99A 1D5CA 4CTOA 3SXPA 1CQZA 2P9TA 2C1EA 1YRYE 3AYZB 4ZHQB 5LA6F 1HXHA 3A9TA 2NU9B 3ZLUA 2HGZA 4KV9A 1GTRA 4UAJA 4I14A 3NHUA 1WS6A 1MTZA 4RXMA 2QQ0A 5C35A 1ZNXA 5BR7A 4AY6A 2J46A 2PK3A 3RS9A 4FYMA 1SVSA 4GPEA 5JANA 4BNJA 3KOWA 1YQGA 4Y1EA 4AICA 1RNLA 3FDFA 2VHCA 4Q93A 1P2TA 4RETA 4LRUA 2Y27A 3L0SA 2WC1A 4MR9B 3JVEA 1JEJA 3HZZA 4KQ6A 1JKJA 5B7GA 1F2TA 5JT1A 4L74A 3L05A 5ECGC 5H80A 3TOXA 5GZ6A 3QF7A 4C0SA 2OCBA 4HNHA 3OP1A 1XZ8A 4M0LA 3R7FA 3PP8A 3PUKA 4WPGA 4ZOLF 5J59A 4PFKA 4F8YA 4ZZIA 3G7UA 2FN9A 4LWQA 3OC6A 4EHIA 2CK3D 2FX5A 5FI5A 1THTA 1PR5A 1L6IA 2NT3A 3CLTD 1G20A 2J9RA 3BL6A 4JP3A 3UEOA 1P8JA 4H3VA 4EI9A 1CF2O 2SCUB 3CUWA 2GTHA 3F0TA 3G49A 1EVLA 3EVGA 1FUYB 1P0PA 3MWGA 2JJ1A 5JV5A 1PEKE 3JAKA 2FPSA 2PG3A 1TYCA 3LG2A 5JMOA 3TAUA 4JP2A 4Z7NB 1MGOA 2WQZA 4N1AA 4S1TA 4TLAA 2YOHA 1BRTA 2WHRA 3PUZA 2WW8A 1YRWA 4QGSA 4J0EA 4K28A 2GZ2A 5MN6A 3QELB 1A9TA 2C98A 3FA2A 4K1LA 2WM9B 1RI2A 2PU5A 2ZIAA 1QLWA 4RVFA 1MGPA 2VSOA 2JKVA 3JVUA 2A0WA 3CUKA 1SUCA 4UQOA 4PO9A 3UJ3X 4O4IB 1DBPA 3B6IA 1JNYA 4I19A 1GDTA 1DFIA 1JPVA 2YNMC 2ODNA 4TKVB 4AMYA 3TRHA 4HNSA 4KFUA 1P75A 4OLJA 3LC0A 5HMMA 2GQ0A 4D4MA 3U56A 1IJEA 1IMJA 1EG2A 2C3MA 4NKRA 1A88A 1X7YA 3DEZA 3GGSA 4OHVA 4YALA 1B74A 3VU9B 3M1LA 4HWKA 1UXHA 3RABA 4H1TA 4LVCA 4BQRA 1BQ3A 4F04A 2AMLA 3L8ZA 1XRLA 2RC5A 3DBLA 3GIWA 3ORFA 3ZS9A 1XIVA 1QVZA 3EXEA 3FSJX 1NBME 4XFKA 3C3EA 3IMKA 2OK8A 2QAGA 2Z95A 4HAWA 3U17A 4P84A 1NAHA 2C92A 2ZYRA 2JLRA 1KOLA 1RZUA 3W9SA 3ZXIA 2ZJ0A 2CY0A 3DB1A 4R0VA 3SHWA 2PQ6A 3CPHA 1PRYA 2PWZA 1KDTA 2GPAA 2VYFA 3KZVA 2GT1A 4E3WA 4EY8A 5C7LO 3DAGA 5KX5F 4Q21A 5EHIA 2QN3A 3VO1A 1JP7A 4BLTA 3TLKA 1X1BA 2XTNA 3S70A 3M5WA 1XZIA 1AHIA 2RHOA 4AXBA 1LX7A 3K53A 2JGAA 6Q21A 5B1SA 1GUYA 1TOAA 3WYDA 3LK7A 4GPIB 4FKBA 3PX3A 3BFPA 3DXXA 4PYLA 2AA3A 5DCLA 1OLSA 4CL3A 1MA0A 2IDMA 3HFRA 4TMWA 2PH7A 2ET6A 2AK2A 2JI4A 2PS0A 3ETGA 4MVJP 4DGSA 1CRZA 4DMUB 3DWFA 1T1IA 5I9NA 1VMKA 2JHFA 4LKOA 3RQIA 4KXUA 3RSOA 2WFLB 1EQ2A 3DTYA 4UHEA 3LY7A 3H19A 5LFAA 4CKCA 4KLZA 2YIJA 1BE1A 1RD4A 4XPIA 3D6VA 1V7PC 3R09A 3SYRA 3UV6A 9LDBA 3ZZTA 1PSZA 3JZMA 1V6AA 3PD7A 3WFIA 2E4ZA 2B2CA 3GEDA 5DNWA 3GUYA 1UWCA 1H1LA 5FB3A 1L5GB 4B4VA 4CKYA 5B7NA 1LF0A 4FMDF 5GV8A 1K3UB 2DH6A 3AF4A 3SJZA 3WGJA 4MA5A 5HRCA 1B73A 1PI3A 1SKYE 3O2SB 4TVOA 3W5SA 2W93A 5FOUA 5JMPA 3TPZA 3Q9UA 1UBCA 2JA1A 3U13A 1XUOA 4EENA 4EZBA 1U2GC 5T8KC 2QRPA 4Q16A 1U1CA 2I78A 5L4LA 4MARA 4MMXB 1DDGA 3RNOA 1HZJA 1XU7A 2J59A 4YCJA 4QL3A 3I6YA 5EXDA 2D59A 4AJKA 4EJFA 4WKCA 2VOEA 4EHBA 4N40A 3DH0A 4D8YA 5K6RA 2G25A 1QFJA 2PRSA 3H5LA 4XD7D 3T7DA 3TLBA 3MGAA 5BV8A 4B6PA 5I8PA 1Y6GA 2VJKA 1S2GA 1H2FA 1UPTA 2G80A 3HJAA 4LRTB 3DVRX 5MF6A 5L53A 3OQJA 5E2IA 3OLVA 2ID8A 4RK1A 5KNCH 4R41A 4WY2A 2QMEA 4KYIB 1JB9A 2IODA 2OESA 2QENA 2HA5A 2EERA 4JWKA 5DM1A 2Y0BA 1W48A 5JCJD 4MGIR 1WQ3A 1KPHA 2DUJA 1Y7PA 2DBZA 3A27A 3TW8B 4R2HA 1QYIA 1VJCA 2XA2A 2FUCA 4ZI2A 3QJGA 2XOEA 1AGXA 1EINA 1JIXA 3CRNA 1KZYC 2ENWA 3NBMA 1A9RA 3FRHA 4MDHA 2W6JA 3GEBA 4HATA 4R4JA 3AHFA 1EFVB 4II7A 5L7YA 3TH5A 4WOJA 1WNFA 2BRUA 2PRKA 3H04A 5CW2A 3IOCA 2GD2A 3H1EA 1RI4A 3STVA 4YMTA 4IQ0A 1J23A 1DOAA 1XJ0A 4PANA 4DTCA 2G67A 2G9NA 3QEAZ 4LJ5A 3DL2A 2FOIA 2HJWA 3S2SA 3W1EA 1ZH6A 2YUTA 3DR3A 4RA6A 4CIVA 4K40A 5HKOA 2B5OA 10MHA 5JECA 4FM9A 3I12A 3NWEA 3S2ZA 5KHAA 1KNXA 1O5TA 2QXTA 3C48A 5I7OA 2AFVA 4N0PA 1EQUA 4QWMA 3LUDA 1EJ0A 1JTVA 3KPWA 3BE6A 4FYJA 1GCAA 1SCIA 2OZLB 3AO0B 1M67A 3FSGA 3IR6A 4I99A 1X86B 4LJLA 4X20A 5IFKA 1I7QB 4F56A 3S55A 3VC2A 2YVQA 3AI1A 1HV8A 1UP4A 2B3DA 3C7CB 4N76A 3N7TA 3P9PA 1YA8A 3TLGA 1LGYA 2ONKA 1P4AA 3PR2B 3H2BA 3UM9A 3U7EB 2CVPA 1YOVA 3D0RA 2IOFK 4MIEA 1B76A 1KJYA 1U90A 4QUJA 5HF5A 4B43A 1JR2A 5IG2A 5KSYA 4O1HA 3IT1A 5HF8A 5LN1A 1FDRA 2CUZA 1TEVA 2B30A 2PGDA 2QTVA 4N6NA 3LLUA 4MQEA 1ZCAA 2Q9AA 2X23A 2XMSA 1FS6A 3FIUA 1J1ZA 1VZ3A 3NH6A 4RULA 3NJ8A 3IS3A 4XYEA 3ZU4A 1RKBA 5LYJA 3HMQA 4ZCQA 4CMAA 2GF9A 1MW9X 1TDJA 2P9EA 4BASA 5D87A 4BLSA 3K2EA 1QH8B 3E05A 2E9SA 2IUEA 3CMMA 4YB8A 5HKLA 1VL1A 3KE8A 3KPUA 4B75A 2BFCB 2X9NA 1O57A 4K7JA 1GLGA 2JGMA 3QVOA 4LI0A 1ZISA 3QFSA 5EJ2A 5CDFA 3KOMA 4M86A 4ETWA 1FJ2A 5ALOA 3QVWA 3OTHA 1FVFA 4RFVA 2HA2A 5E3HA 4ZJZA 4RX1A 1GGVA 2H63A 3QU4A 4QBGB 1MAAA 3NTUA 3NHZA 1N5OX 3DL7A 3ASVA 3U4GA 3GIDA 1AKYA 3KR9A 2IJGX 1URPA 4AJEA 3DE0X 5IM4A 2D2IA 2W6OA 5D3QA 1AQYA 5JS8A 1EXNA 3OQIA 1CUFA 3LTNC 3K9FC 3IPRA 4OHRA 1VI5A 4X41A 4OJMX 3MOSA 3F74A 5AT1A 2JPDA 3UMVA 3D2CA 3BIXA 1Z3CA 4LV5B 4HHEA 3W34A 1VDMA 5TT1A 3WLQA 4FT4A 3OJLA 2D62A 3T9DA 3U37A 2W42A 1USIA 4HB3A 3GRYA 4MVJE 2HXGA 2PR7A 1E89A 5CT4A 5FPHA 3TMYA 3FCYA 1W19A 4MLDA 3GBSA 4EDHA 4HNUA 4YRCA 1H2WA 3S2IA 1NONA 1FPQA 3OX1A 2OQRA 1BMFA 3K0KA 4KQFA 3NHSA 1X80B 4BLPA 4O08A 3CXUA 5KNDH 2P9ZA 4K9LA 2WJGA 1N5LA 2XUQA 5C32A 1P45A 1Z06A 2D1FA 3FPJA 5JY6A 3RADC 4N03A 1FSFA 2Q41A 4JOQA 3H65A 2D1QA 4KXFB 4DCCA 2C2MA 1KI4A 4A8JA 2BGKA 3OTQA 1BCRA 2BE9A 2Z6QA 3GYBA 4BZZA 3KQHA 3TGWA 4YT2A 4ZJPA 5B6JA 3BPSA 3HFJA 3TVTA 5JH7B 1ONSA 1QFXA 4MWDA 4XX0A 5CVDA 2YH2A 3VTAA 4DGQA 1MIHA 1PBTA 3F5MA 3INTA 4G4JA 4YFYA 2AFHB 2OD7A 2YFHA 4J6FA 1KOJA 4GXNA 3CX3A 4HDRB 4TT3A 3H7AA 1XWWA 1IWPB 2Z8ZA 4CTKA 3SX0A 1QQ7A 2H7CA 3VUEA 5H8WA 4ENSA 5K51A 3D02A 3EVAA 1ZICA 3FM9A 1R4AA 2IYXA 3AFIA 3BKWA 2QPLA 2B4YA 3PNSA 4G0NA 5REQA 4RLQA 4FHDA 2O0HA 3MT8A 4D3YA 2D2EA 4RGBA 4BBZA 2GLTA 4WK6A 1PV2A 3GZJA 2WLTA 4GSYA 3MJ4A 4N8SA 2R6GA 3VSDA 3G59A 1RXEA 3CUVA 1VFNA 2Z2KA 4LQLA 1DG1G 5LIRA 1EX7A 2VJOA 3NXKA 2PPLA 3L2OB 3L82B 3OZRA 1GPYA 3L77A 4G8CA 4HLUA 2D2VA 4ME6A 3VC1A 1RAGA 3CKLA 1RLIA 2WU4A 5SYAA 5EHQA 3F4BA 3TLMA 4DNFA 1RHJA 4AIRA 2VDKB 2V1UA 3AFOA 3ETNA 2BGGA 3AEKA 2ZJ5A 4W8OA 1Z25A 3F96A 4X91A 4BBJA 2FPGB 1CIJA 2H54A 3QMPA 1SQGA 2H1HA 3MWEA 4XQEA 4MEBA 4MKIA 2HSZA 4YCDA 3U49A 2C0QA 5HKBA 4MHOA 4BFZA 1R0CA 2B4RO 2DGDA 2GPJA 3ILSA 4MYDA 1FYFA 4QOJA 2W2OA 4IIJB 3I45A 5AXBA 8ATCA 3UAVA 4CDRA 1MAVA 1TADA 2C7QA 2OUIA 4OXRA 2EFJA 2P75A 4BB9A 4WNIA 5FNVF 3D3EA 1FC0A 1VFPA 2EOAA 3ABRB 4DBZA 1QO0D 3BK2A 1LCIA 1W2GA 1KETA 2BFNA 3L0CA 4CLEA 4D41A 1DJOA 3VZCA 2Q27A 2Y1EA 3OTGA 2NX2A 1TZ2A 4FVTA 1LQUA 2AHOA 1NQWA 1M34A 2Q6IA 2YHBA 3B38A 3HEMA 2FSSA 4BZWA 2WHPB 3OPNA 4B17A 2WJZB 3RU3A 1Z2AA 2I6QA 1JH8A 1OX5A 2YWXA 1KY3A 2B4TO 4REMA 4AWBA 3O93A 3P9NA 4UTVA 4AK9A 1YHNA 4GT1A 4N39A 4OYRA 3S5UA 2FDCA 3CG4A 3NALA 2EBHX 1HUQA 2ZBQA 5DYTA 1Q0PA 2RFLA 2CJFA 5FORA 4ZJUA 4OFWA 5IAKA 4G0ZA 1D2RA 3TTYA 2D0IA 3UAWA 2EKLA 2ZBPA 2QT0A 2VL7A 3C8ZA 4BC1A 3UAOA 1PEAA 1KI1A 1NM5C 1ORDA 1E4YA 3WIDA 2WBLC 4I08A 4G4SP 5AUPB 4P3YA 5KYXB 3PWSA 4FGJA 1V4NA 3FJYA 3ELYA 3OOHA 3KQYA 1QHIA 2ZUCA 3TDNA 3DC2A 3DZDA 4TLDA 4EY4A 3UF0A 1YZHA 3JWJA 2ACEA 2QVGA 2X6QA 4F3CA 4MVXA 3A04A 2VC2B 3WS7A 1W0CA 2QTTA 2QPAA 5TJ9A 3UYKA 4P7FA 4EQ6A 1B8VA 5AI9A 3RUFA 1P2GA 1TEZA 3ZWOA 9ATCA 5I7FA 4U1RA 3E3MA 4IJQA 3FPEA 4REQB 3KSBC 2FRXA 3ZQUA 2PUCA 1U0BB 4LTNA 3AR2A 2J7PA 3LAWA 4RQBA 1PS8A 1XEXB 1FNSA 2LTAA 2YW2A 4ZI3A 3CWZA 3I2HA 2QUBA 2ZVPX 4BKQA 3K9CA 1Q95A 3QQ5A 4MQ5A 3I9JA 3JVDA 4N5IX 2A57A 4ND8A 2XRYA 1O54A 1NQUA 3VNSA 4ZKDA 1PS0A 5CB4A 2A6PA 2AMFA 3MAGA 3GPCA 1GUBA 3E8SA 1SPXA 5TGTA 2A0XA 4WLUA 3R1IA 1NF2A 3N8IA 5GONF 5BN5A 2BGTA 2IY7A 1V95A 1B43A 2YX1A 3H5TA 1ULHA 5JSZA 1ZGBA 1YXMA 2WJAA 3SM9A 3R5JA 4JEIA 1ZNWA 3KQTA 2BGLA 2AW3A 4G5OA 1JEAA 3BD7A 1A1SA 1FUKA 2YXDA 1QMGA 2WM8A 1VKJA 1Z35A 3ELUA 4G85A 1EJBA 3WYCA 1TEHA 1C9DB 1U4NA 1FVXA 3R9WA 1LSUA 3A37A 1QGDA 3MRSA 4Q7EA 2HA0A 3LF1A 3MD0A 1TFUA 3P52A 1CUBA 4K1XA 1B41A 4FB5A 1EX1A 4Q6WA 3SS9X 4WCFC 4RV4A 4I4TA 4I55F 4H1HA 1MJ5A 2REBA 3F7TA 2X3UA 1E1RA 1I33A 3UJDA 3PJFA 5U9CA 5K8CA 4ZAGA 2BPOA 3VKGA 4K9DA 3WRYC 2QYOA 2W98A 3CEPB 5AVZA 4RHFA 2ZE6A 4X3PA 4JELA 1W47A 1PLJA 1I5OA 3NFRA 4C7VA 5HM8A 1FOEB 4Y7DA 4G0XA 3SC2A 4B9EA 4E5DA 2FLKA 1PLLA 3EW7A 3K2BA 2Z58A 3FZGA 2X2EA 1U2RA 4YJ3B 5EKTA 4X97A 1TQ8A 2BTQB 3GLRA 2CEKA 4DJAA 2XUIA 1SXJB 5TB5A 4V0OA 2C00A 3DMDA 1U6JA 2FZGA 2QIOA 1CW2B 2NVWA 3H3FA 4M6WB 1LRKA 4FE4A 3NATA 1E18A 3PQ7A 1H9BA 2CMFA 3H2SA 3OFKA 1UWLA 5KWIA 2V3WA 2Y68A 5TMBA 4W82A 2BF7A 3NETA 3TD9A 3EN0A 3EGDB 2EF1A 2P4EA 1NJGA 2JLSA 3OPMA 3AONB 1R9JA 3HSYA 4LSWA 4XIFA 3HXMA 4DC1A 4YV0A 3UGKA 1WBBA 4Z5XA 4BNUA 3AWDA 1F14A 2VRBA 4HMPA 4NU6A 4Y6SA 2HT1A 4GZLA 4Y2TA 4MQFB 5FYQA 1FDVA 2V0CA 2BKVA 1H8EA 1NF8A 3CRMA 4ZQCB 3F5SA 3ILXA 2F55A 2P9FA 3RNLA 1XNHA 3AFGA 4BO4A 5TPWB 3LCJA 4K6CA 1BG6A 3JPYA 4N0MA 5JXHA 1L7PA 4QA9A 1DJMA 3DO6A 4WXHA 4F5YA 3AU9A 4FFLA 1JS1X 2P1RA 5DTJA 5C5CA 1MC5A 2RGNC 2ZSHA 2BGJA 2I5PO 3BXZA 3OJEA 5AJVB 2IV7A 3VYWA 4ZCMA 3QEOA 1QAOA 2H2DA 2MSKA 4NC9A 5HX7A 3RAJA 1VHJA 1NSTA 1W85A 2QJTA 3IEIA 3WQQA 4HLDA 1VP3A 1ZXBA 4M0MA 5ARBA 2IEGA 3ZJTA 3F3SA 4NOKA 3KUCA 2AZTA 1A9OA 2A33A 3IVMA 3LPLA 3HXTA 3I2YX 1W93A 3SEAA 1P60A 5HRAA 2V6MA 1N0UA 1YC5A 4GFDA 1BX0A 4UD6A 1X7WB 1AN0A 4Z2YA 3UJNA 3MJVA 3HKBA 1KQOA 2I4NA 3FFTA 4OP3A 5LQMA 4F86A 1FP2A 4EPVA 2UUAB 1DCMA 4CMIA 4DLTA 4URVR 4U63A 4DT1B 6REQB 1ZMXA 3COJA 2W6IA 3FBGA 1LBSA 5D00A 1Y6QA 2XMDA 1P9OA 3E15A 3GJSA 3SM3A 2Z3WA 3Q3VA 1XMVA 1YQEA 4L9RA 1AS0A 2G82A 3MQ4A 3U3ZA 1XA3A 3MIZA 3LCVB 5HGJA 3ZXUB 1M8GA 5ULLA 4ZI7F 1QFSA 1KS9A 2VPIA 1YZTA 2WYOA 1B7GO 2LW7A 4RK4A 2PGNA 1UAYA 4JL8A 4BNHA 4DWJA 1U7TA 4LZJA 5GIPE 2PSFA 2NAFA 2RI1A 4OPMA 3ZLVA 1M6HA 3OCVA 7ADHA 3VSEA 1WE2A 4FZVA 5J2TB 2HJHA 3ZGVA 1FQKA 2MHCA 2IXDA 2H00A 3EIQA 3GNLA 5KJCA 1MPTA 1C9JA 4UZFA 3W6OA 1YAJA 3QXSA 4PQYA 1QVAA 1TTPB 4FGSA 4KO1S 1JEQB 3A6HA 3HRKA 1GQSA 4J0DA 5K03A 5CFRA 1OC4A 3ESZA 4Q82A 3SVLA 1FFEA 1VKZA 3RT1A 2HW8A 1XD9A 3M0EA 2V97A 2X41A 3X1DA 5L3QB 3B36A 1R6VA 4FFMA 3AVUA 3QSGA 3U7FB 3JD2A 5B1YA 2XF8A 2BR4A 4ZGBA 1UIRA 2IU4A 2W71A 5A5DA 4N3GA 4TKUB 1AY0A 5LQAA 1UBNA 2H8KA 2YUIA 3INYA 1SURA 2P9CA 3QEKA 4C14A 2XBLA 5KTPA 4GOLD 4QYIB 3URKA 2J9FB 1WOMA 2VAXA 3K94A 1FX0B 1AHPA 4H3KB 2RCNA 4ENPA 4DNPA 3ET4A 2W6PA 3CB2A 1PTKA 4PG7A 4NDZA 1JJFA 2ZRJA 4EG3A 5JNTA 2JH9A 3FFBA 5F64A 4BFLA 2ZIZA 2VYCA 4V1CA 4KN8A 1HYQA 3KYDB 1F8GA 1HL7A 1TU3A 1UKAA 2NSHA 3IHLA 3KZXA 3FUWA 4U0JA 5GOZA 3T12A 1QFZA 3II6X 4A7PA 2O19A 1CYEA 1YASA 1U1IA 2AF4C 1TQ4A 2DHCA 3FUVA 3T7SA 3ZXYA 5CMLA 4D6YA 2P9HA 3G88A 3FRIA 2EZ9A 5EUQB 3O1IC 2ZT5A 4MUFA 4AS2A 2CT8A 3RBVA 3WYEA 1TYEB 1M1NB 2HAEA 3FKQA 4EG8A 1X1SA 4UVHA 2R1ZA 4C5AA 1C50A 5CXSA 4JEHA 2XX3A 4G1VA 2V9CA 2DQYA 3R20A 4GOKA 1ZPDA 3OCYA 4UVGA 2PIAA 5A0FA 1E3TA 2CNOA 3NEYA 5ED0A 4A16A 4DUPA 2B98A 5DW3A 4WFQA 3KBOA 5HUQA 4HLNA 4MWZA 1UMBA 2Q8PA 2VAWA 3LYHA 4W5JA 1ZJ6A 5JD4A 2GA9A 5T7BA 1M6WA 1U0RA 3CZQA 5FXMA 2AHRA 4H08A 3L9WA 4ZVRA 4D4KA 1OA0A 2O8EA 5EWJA 4B4DA 1NZJA 3FAKA 2C2HA 2OBXA 1QM5A 1EGHA 3P2JA 3RYCB 1PZFA 2Z3ZA 4LJKA 1LS1A 1HNXB 4BYMA 1EIWA 4RM2A 4KKVA 4NNOA 1X70A 1U7DA 4BXOA 3GXBA 2WIBA 5A4JA 3W79A 3P0JA 3G7SA 1S3SA 4DNOA 1NZFA 3I6IA 1UK8A 2VCYA 4PNZA 5L3ZA 1W73A 1HA3A 4FKMA 4MJ3A 4PLZA 5K3DA 1P3JA 4DUYB 1E1DA 1TKRA 5AI6A 1OKKA 3R3ZA 1D1PA 1UBRS 2WSMA 5FR1A 4BY9E 1DFGA 3NC4A 2IUSA 1W0JA 2ZE5A 1IZ7A 1HLGA 2ZQ5A 3BORA 3P0FA 2HR1A 2DQSA 3OQBA 2MINB 3HUFA 4G5YA 2O54A 2O8DA 2IQ5A 5L3SA 3H9GA 1VIMA 4XGIA 4JB0A 4F1KA 4KR2A 3KDAA 2BEJA 5TQVA 3OBIA 4MHTA 1KWKA 5CYOA 2J4DA 4ZU1X 5K05A 3M2TA 1Q57A 1CSEE 1RLMA 4R1LA 3GROA 2MYPA 1CP2A 1XROA 2YBEA 2ZBRA 3P2KA 5CPFA 5AHXA 1OH7A 1JH9A 3ZNOA 4LK3A 4BNIA 3SC4A 2ZTSA 1YJBA 1L4UA 1DKNA 2PCLA 4C4PA 3O9ZA 4JB2A 4XYMA 2P3QA 2IK8A 4HEA1 1N2CE 3H9CA 1XRMA 2XDQB 1L8AA 3JASA 2GCNA 2Q1WA 3KVYA 1U8FO 4GM1A 3EQ2A 5C31A 3SU8A 5JALA 1RR6A 1ABFA 4ZGGA 5K0JA 5LP6F 4JI3B 2JGNA 1KRWA 2MSDB 2V7QA 2HWUA 2QG4A 2Z4SA 5HJ7A 4Q39A 3BMXA 4HQRA 3SMVA 1JT2A 2QUIA 3TUIC 3K4PA 4IDHA 4XA8A 5LMCA 1FFAA 5LU9A 3DLPX 4ZMBA 5IS2A 2HB6A 1K2WA 1ZWLA 2K7FA 5CH3A 4KXWA 2C2WA 1I1OA 1UDXA 3B6EA 1EP1B 4XCXA 5EKUA 2G07A 2AKAB 2D4AA 2VHYA 4G1FA 4LRYA 5AKYA 4D3FA 2HRDA 2DWOA 3NS7A 4F9EA 3M7IA 4HTAA 3O8LA 1XU9A 4AJIA 1CXZA 1HETA 1A0OA 2ZI3A 2FSGA 3EG9A 5DTEA 3BMQB 3DV2A 1NWHA 2BFEA 5ER6A 3S99A 5HVNA 5DSZA 1TKAA 3ZDRA 4BN4A 3Q9SA 4EEZA 2C4KA 1US8B 3OLWA 4LOKA 1O3YA 3A05A 1N57A 4L85A 2Q9CA 4R5MA 1QHGA 4D02A 3GMTA 3O3NB 4QEZA 4BWYA 5DW0A 1NVVQ 4CFSA 5K4HA 2H1LA 4I1SA 1QE0A 4FBGA 3VV2A 1GLVA 1R8JA 1Z62A 3CF6R 5KYYB 1WL8A 4G1MB 4MS4B 1XXHA 2ZR0A 4K2AA 1V16A 1E9RA 1NC3A 1Z3IX 4OIMA 2RAUA 4PCLA 2HEIA 2QROA 3H0CA 3N87A 3H9UA 2BFMA 2VDPB 5DGXA 2A8YA 1T9GS 1KC3A 1G5IA 3X1XA 1PK8A 3OOEA 3O4IA 5JWOA 3M4NA 2VJDA 4CQMB 2CYAA 1AXEA 3KK0A 4RJTA 4AKGA 4P7GA 1P7VA 1YE5A 3R7AA 1PR2A 5JYCA 2P4SA 1L4EA 2F1OA 3ENQA 3K8YA 1XMXA 2NP7A 3HMKA 1PNVA 1N3BA 4CF7A 4YJDA 2O7NA 1A9XA 2RSLA 4MRRA 3S27A 3MTJA 3IBFA 3TR6A 1GKYA 4YQEA 5LXTF 4JLVA 1R8QA 3BD9A 1P3DA 3VH4A 2QHXA 4Z7OB 4NF2A 2EHJA 4U3JB 2Y0EA 2SBTA 2WAYA 3JQAA 4DARA 3SVTA 2H4ZA 3UMBA 4EY3A 2IYQA 2JLQA 1CY1A 2XA1A 2HA7A 2UYHA 4DZTA 4HDMB 3BK1A 3LKBA 3OKFA 3VR6A 1TC1A 2R96A 3DVSX 3PA6A 4DILA 5IK2A 4FMPA 5IBRA 3RJZA 1C9YA 1PZMA 4QDTA 3KSUA 1S2DA 2X7JA 1T5SA 3NP9A 2W4QA 4RLFA 3JQ9A 1A9XB 2AX4A 2VAPA 3HDGA 4X7PA 5KHLB 2AXNA 3N6VA 4OCZA 4FSDA 5CIWA 4KR0A 1JHPA 2ANCA 4IFBA 4DW8A 2DPXA 1ZSVA 2C58A 2N9UA 3IESA 2GGSA 4GI2A 2OYSA 2C07A 3QFCA 4KIFA 4N01A 5CJJA 3DVQX 1OTYA 4TMYA 2M6LA 5BY2A 4A6DA 3GPDG 4JLMA 4Z9AA 3TVDA 3BOSA 2AYXA 1NVGA 5E1BA 1PGJA 4QOSA 1K8YB 4EZIA 3MAJA 4XUCA 3MLBA 1SVLA 1HRDA 1UFKA 1YS4A 2FEKA 3ID6C 1YRQA 1NSYA 1VPEA 3NIFB 4M4SA 1XDUA 1WEHA 2H0AA 2VTDA 3QKRB 4NV0A 5EEGA 4DDMA 3FX2A 1AGPA 3FNHA 3U7JA 3TZBA 5LDHA 4CM6A 1GQ2A 3VR2D 1JTEA 2VQSA 4GMFA 3O84A 4KZKA 4P32A 1KKLA 3GWGA 1PIWA 1OFUA 1AUOA 2PSHA 1TW2A 2G8LA 3CCCA 4KFTA 5TPZD 3JQQA 2AEEA 4MV9A 2HK7A 1CNEA 1ZS9A 2EFHB 2H5IA 2Z5FA 1EFLA 1EM6A 4WAUA 3IFSA 2RAFA 4RACA 5CLFA 2CFOA 2C5BA 3VDRA 1QH0A 1Y7HA 3FZNA 1IM2A 5ARDA 4ZAZA 2OL4A 2VK1A 4YAWA 3U7QA 1IOWA 2D2XA 3ZWBA 4E88A 4JBNA 1RYNA 1XA0A 4F5EA 4NCKA 1U5BA 4EITA 2QTWB 1GITA 3S1AB 4MJLA 1JFLA 5C52B 4NRDA 4S12A 5ILGA 4EG7A 2H2WA 1B0PA 3HU1A 5GZ3A 1YTUA 3O47A 4UOQA 5J1SB 4Q9NA 1TIKA 2B94A 5ALKA 2QAGC 1S2NA 2XCUA 3KTOA 3N2YA 1E2EA 4K9RA 1KY5A 4KVFA 3OI7A 1NP3A 3AJ9A 2YMMA 1CJKC 1U0JA 3OX4A 4JU8A 1TT5A 3O91A 3AV3A 4BU0A 1JBEA 3ZKWB 4ACBA 1SXGA 4IV8A 3FB4A 3C6KA 1ECFA 3PL1A 4CF4A 4O4HA 1Z5OA 3ZCSA 4YXWA 2A5FA 1FJGB 1ZQ1A 3KPVA 2UDPA 1EM8A 1AA9A 2MWMA 3HR8A 3SIRA 1T5IA 5G3ZA 2JIBA 3B2EA 4JKYA 4JYZA 1JA1A 1ISIA 2OQIA 2GHRA 3X1ZA 5KEIA 1A04A 4NMXB 4DV3B 1VJ1A 2QXUA 2H7XA 3U4QA 2RGCA 5AW7A 1TX4B 2VQ6A 1A3CA 1GAQA 4LJAA 2NZVG 2PRZA 5LZ7A 3UJHA 1E59A 2H11A 1FQWA 1T2FA 3L01A 3RKRA 4Q0MA 1FNDA 4HQ6A 1A8QA 2WD7A 4HVTA 1EBFA 1PK9A 2FYTA 4I9NA 3K92A 4B5LA 4N5HX 5ALIA 2FJPA 1MHTA 1UC4B 1MDFA 1SCUB 2G88A 4TXMA 4AKIA 1F2TB 5BXQC 4DC9A 1I2AA 4YYZA 1FTQA 3Q7TA 4KLRA 4AROA 2FK7A 3AB8A 1Z4LA 1R9NA 2ZSJA 1SBZA 1YBHA 1DJPA 2BFBA 3G02A 4URUR 4MUYA 1ONBA 2R6JA 1N6KA 3FGPA 1RYYA 2IYWA 3PD0A 2I91A 1AQ6A 1ZWKA 4LOHA 3C5WP 2PX2A 4IINA 1L7AA 1W46A 2R6ZA 4BLUA 4EB8A 3CH4B 4JUIA 5LB4A 4Q7QA 5J1TB 1YWGO 3KR0A 1OH6A 2QTRA 4L4YA 5NLLA 3UGQA 1K1EA 4KODA 3BZBA 1F8YA 4XM1A 2BFDA 5AW5A 3T3GA 1N77A 3JAKB 1JECA 2QRGA 2V98A 3UKDA 4X94A 4D9JA 4ZTZB 3IHWA 3Q9LA 4XSGA 5TQ2B 2POQX 1XPRA 1PCXA 3G79A 1FYDA 3FCUB 1H2ZA 1ZGJA 4M9QA 4QDZA 2Z2IA 1M2HA 2G06A 3KNZA 2HCTA 4B8ZA 3GLFA 1L5QA 4RO0A 4OHCA 1OFTA 4MITA 4V0KA 2I99A 5IEJA 1FFWA 4XAQA 3W5AA 5GJCA 4LFBB 1QF9A 4TYYA 2PS1A 4LE1A 1D1SA 3FPFA 4LYYA 2J5KA 3OH8A 3OFJA 2VHEA 5JADA 1U1DA 3KTAA 2LVBA 1XF9A 1BHQ1 2M1ZA 3UXMA 2X6RA 1SPBS 2P6PA 4TTAA 2CL0X 2JGJA 4M8IA 2H7YA 2AQKA 4C4OA 2JDID 2YZGA 3E9NA 4DLBA 3DS8A 1GU1A 4UCFA 2X22A 3UC5A 1G3RA 1MZPA 2PYDA 2RH4A 4YRJA 1NBIA 3UJ9A 1ENPA 2BRUC 3QU7A 1F7UA 3IBTA 3EC2A 4I1UA 4UM5A 4BX2A 2ZYDA 4IFEA 1NUHA 4EG5A 3QKSA 3AEQB 3GP5A 1M73E 1YE3A 3SE0A 1KPGA 2QAGB 1ZU5A 3IR5A 1CEYA 1Z2NX 4F5DA 1JPNA 1FCJA 1DZ3A 3EDMA 4YMHA 3LCUA 5B30A 1YJCA 1LI4A 1X1EA 1XNRB 2ZYVX 4M22A 3GFPA 3U3DA 1VSTA 3NHPA 3SKXA 2PWBA 2R4UA 5BORA 3OETA 1JLKA 4EB6A 1E2KA 2D5AA 5A03A 3U31A 4UREA 2CZQA 2W2TA 2LDBA 5LQSA 3SOPA 4ZO9A 4A8PA 1WO8A 1C29B 1B8OA 2FWMX 1D03A 3AESA 1OLSB 3BN3A 2DUWA 4WHMA 2G40A 2I7XA 2RHLA 2Z5LA 4CMHA 3OZTA 2ZYAA 1R15A 1L5VA 1NW3A 4H60A 4RKQA 4XUGB 2VHUA 3EPHA 4UUBA 4DIKA 2JFQA 5DYYA 3UUWA 3VU1A 4IDEA 2E5FA 2O3JA 3WL5A 3PNQA 2XGGA 4I6JA 4OM8A 3ROEA 4KK3A 2MMGA 2VPPA 4LMRA 1SB8A 1FU7A 4G5FA 3VFDA 2WG2A 5C18A 5DYIA 2PJZA 3UYLA 1YKSA 3DPUA 5CDGA 1U11A 3A6PC 1Q16A 1PL6A 3KJGA 4NU8X 2BGNA 4PZYA 3PVCA 3WIUA 5AW0A 1SUBA 1AKQA 1Y7IA 3IE1A 1Y5NA 3DLHA 1G5HA 3LRPA 3A1TA 3V6LA 4ALIA 1QCDA 4B82A 2QI9C 4UDNA 1CQPA 1NJFA 2AWNA 1KYIA 1T9HA 1WCXA 5JRDS 1L4HA 2LGJA 5KAMA 4HP8A 5K6AA 4IEEA 1Z8FA 2AOUA 1FBTA 1CEEA 3PVSA 3WDMA 4AJPA 2EKBA 2PTHA 4LYAA 3H05A 4PLTA 3D7KA 4QJBA 3MXOA 1SMKA 3HB1A 5D6NA 3GCZA 4AZVA 1T29A 2ROQA 3BGSA 4RJKA 1PP4A 2GUGA 3UHFA 4UATA 3HXOA 3D6TB 2ZUFA 1FTGA 2FUG1 2I1LA 4JJGA 4EHHA 1BC5A 2IIPA 2OXRA 2YFQA 3PEUA 5BW5A 4OLAA 3TNJA 1Q84A 2YDXA 4A2CA 1UADA 1W4ZA 3JARA 2C7GA 5IVDA 4J1NA 5COAA 3TI9A 3EGXB 3LA8A 4IKEA 3V8EA 4DM4A 1B8NA 4NBUA 2E5WA 4EW6A 1K75A 4FQ5A 3ESDA 4W1QA 2O0JA 1OYOA 1S7CA 2ZATA 3LBHA 3EPLA 1E2FA 2P11A 1B8UA 2HCBA 2V6JA 3BBPA 5HDBB 4J0HA 3WGHA 1I80A 3ZUPA 4CU5A 3M33A 2PZAA 1TK9A 1YB7A 3BHJA 1W8DA 3Q8WA 4GYWA 4MKZA 4MIOA 2QNRA 5PNTA 4TSFD 2VJCA 3S44A 3D7NA 4ZQIA 1KTIA 3ZJ5A 2YRXA 2I4TA 1Q7RA 3FTPA 2K7ZA 1N9GB 3A6LA 4IMPA 3E2PA 2YY7A 3OM0A 4PZLA 3FR7A 1LWNA 5CU7A 1LU9A 4JBHA 1CUIA 5DX0A 4BO2A 4EHJA 1UBUS 3HN6A 2GFQA 1MF7A 1PWYE 2E4XA 2BSAA 2X2PA 3EFOB 3R77A 5DXAA 3EQZA 3V2GA 3H5RA 4HD8A 4TL8A 3PE6A 4A8JC 3AQIA 4RA6B 3C87A 3QWFA 4JVSB 1SHUX 1J9GA 3R5TA 2V6GA 4GBGA 3DZHA 1JXOA 1BWPA 1U3DA 1RWPA 3HXPA 5T57A 1F38A 1XZMA 1OY1A 1XNGA 5EJ5A 2A5DA 5E7MA 2GK4A 3L1HA 3AIKA 5AM4A 3UPTA 1G2PA 1NNI1 2HV8A 4JBLA 5F73A 2E4VA 3O75A 2OGUA 3DONA 2E6UX 4JUDX 3FBWA 4LF9B 2VYND 1CB7A 2V9ZA 2WVHA 5FWXA 2VZLA 1IUKA 2AZDA 2VZ0A 4FINA 5G41A 4UPDA 3WBJA 1UANA 2XCSB 3ZCVA 3IOMA 1KYWA 4LF8B 1ZNYA 1WG8A 5GM2A 3DEHA 3H5VA 1T8SA 4JWTA 2QJOA 4PSDA 1F2VA 1O6BA 1M5RA 3AVTA 2Y1XA 3ZZ1A 1I4TD 3UN1A 3VPFA 5ERXA 2IS6A 3C3BA 1IOZA 2CLMB 1DWPA 4ND5A 2IRWA 4CDNA 2IYVA 3M5CA 1WPQA 1J99A 3T0FA 2GZ3A 3K0CA 5G53C 3DR5A 1B14A 1KERA 2W90A 2REQA 4HLUC 3C3WA 2ZRLA 3KETA 2BM1A 1HF3A 1XMIA 3HR7A 3EZXA 1G9XA 1Q15A 3K4HA 3RYHA 5GVRA 3MOIA 1T9KA 4PX2A 4GKKB 2BM8A 4GPZA 4JODA 4XQ0A 1OXBB 1F3OA 4QPZA 3EOZA 4QUBA 2RIRA 5DF1A 4A0RA 3SFZA 4EI7A 1QHXA 2VRNA 3NBXX 3OCZA 2V6IA 2XXJA 4Q6BA 4OI1A 5KWSA 1Z6TA 1P1KA 3MRTA 1KU6A 2IYLD 1LBHA 2O3QA 3V6MA 4G2NA 3Q11A 1FK8A 1ZH2A 2A5GA 5F76A 3G8YA 4NBLA 1EXWA 1X9GA 2G1AA 2JEYA 2BH9A 3L4EA 3R2JA 4GS5A 4MYCA 4ND3A 3RRXA 4BX9A 2XOKA 1L8XA 3TSOA 3FJ1A 4BLOA 4CM8B 4ER6A 1AT1A 4AB1A 2FFRA 1M54A 4A92A 4F4HA 1ZH0A 4EFLA 4CLRB 1VTKA 4IVQA 5EP3A 1AF4A 3SD7A 2C4VA 4R1SA 4C4RA 5AW4A 3URMA 3A11A 1BX1A 3EX7C 2EZUA 1DGQA 1Z16A 2XZDA 1UBKS 3U3XA 3OQIB 4UNQA 3FGZA 3Q3IA 3FVRA 2Y1DA 4WBNB 5JXJA 2Y1LA 3K5IA 4HGPA 4PLHA 4X3OA 3NHRA 4MWTA 5ALLA 1P1BA 2CMGA 3BQMB 1RDFA 2J6BA 1PR1A 3DZGA 4S1VA 1QHFA 3PEFA 4M1SA 1BH2A 3TRFA 5DCYA 5F21A 5AVUA 4EX7A 3WLSA 2AG8A 3JD4A 4GGOA 1EE1A 4JI7B 1IZYA 2Z5VA 4D9CA 3Q4GA 4DUZB 1SZJG 4HX2A 5IU6A 4MWCA 2C4WA 2GJSA 2X8LA 2Q6LA 4DV1B 5JD5A 4RVHA 2WWYA 3K9LA 1N6IA 1X8XA 3EC1A 1AC5A 4IYJA 5C8VA 7ABPA 5JLJA 1IHXA 1UPCA 1I7DA 4E2YA 4MPTA 1GAXA 1TYAE 3OHPA 1YDMA 1P4HA 1ZUIA 3FDJA 4A8JB 2XUZA 1TI7A 2VVTA 3MJTA 4EEXA 5LVAA 5A4DA 1A97A 1Z7EA 5EMMA 4L8VA 4GR5A 3RYIB 1WW8A 4LWPA 1EFPB 2IF2A 2QDXA 4OHPA 4XX0B 2NZYA 4XWYA 3P94A 1L5NA 3VZSA 1LLCA 4RHYA 5DSXA 5AO9A 3PGJA 4BATA 1TF7A 3GB9A 3GG2A 5AI5A 3U60B 3I72A 1VL2A 3KFLA 3KQWA 5DE3A 4DQDA 3N0VA 3CZCA 1M76A 2XUKA 5DK4A 1RM4A 4RXUA 1TM7E 2AQIA 2GLUA 3WGOA 2IYAA 1FUIA 4WN3A 5T64A 1I2CA 2C0CA 1AJEA 1OIWA 2GDJA 1VLQA 3IL2A 2H2AA 1BHJA 2AXPA 3USES 1MNQA 5REQB 4NYIQ 4U02A 2DPMA 4JJFA 4L4ZA 4X45A 2ZPTX 2YYZA 4Y7CA 3CLRD 3RKUA 3V46A 3BRQA 4Y2JA 4G67A 3L5KA 1KEUA 2HK6A 3WK7A 3WGVA 2A59A 4B8YA 1JIQA 3PUXA 2WWRA 3WK6A 2YNMD 6CHYA 1J8YF 2BMJA 5KTRA 1IDOA 4GP6A 2PYZA 4NQRA 3WQRA 3JTMA 4ZANA 2WSIA 4MQLA 5HKKD 2C94A 3ZWMA 2BEWA 2XQJA 2BONA 3B8EA 1UPAA 1LBEA 3PSAA 3QUAA 3QY9A 3RIGA 1FUEA 1KSGA 5B58T 4EJMA 2WMYA 1B1CA 3LUBA 1B4DA 3L6CA 2IX3A 3T5PA 2REOA 1ULBA 1D0VA 2HRBA 4DAOA 1XVUA 1PX0A 4HH3C 3ABSB 2Q4EA 4OFZA 4GX0A 3V8PA 3T9BA 3B78A 2WJ6A 3NYIA 1GADO 3F1KA 1WXHA 1NMEA 4H18A 2H9IA 2CUNA 2HH9A 2V74B 2GPNA 4W9RA 2J48A 2Q1YA 1GTG1 2PFGA 1OTHA 2Z57A 2FXIA 2RGAA 1UPUA 2CZGA 2OY0A 4EJ0A 1FFXA 3A7DA 4DA6A 1U9IA 3HFSA 4WY5A 3PEVA 3IBCA 4IIUA 2E21A 1L4NA 1OAAA 3BQNB 1MABA 1KDRA 2BL4A 3G2MA 3I9LA 4KC0A 4QU9A 5TXGA 1M34B 1OROA 1INLA 5EZYF 4JXJA 1NBHA 2B21A 4X90A 5ITSA 1AKMA 1NX9A 1P0FA 1OJ7A 5DZSA 2F48A 3MGBA 4TROA 1CK4A 2PLAA 3WGNA 1Y4UA 2NVUA 3QVLA 2JB9A 3KV1A 4NZ9A 1SXHA 4F8EA 5FWYA 1NR1A 2JVJA 1YJXA 4PS0A 4YR9A 2C9MA 2F8LA 4BNWA 3HXQA 821PA 3EUEA 5FAKA 1TUBB 3H5NA 3A9UA 5I45A 3TGPA 1CQIB 2NVBA 3E6AA 3E53A 1J0CA 4CCSA 3EIWA 5EMHA 2VG8A 1RJGA 5U4QA 1U2QA 1EDBA 4ND6A 4TMKA 2YJGA 4Q4HB 3TR5A 3RHSA 3FWHA 3C3DA 4HGYA 2Q7DA 2BAGA 2YVAA 5BNIA 4ZYWA 5JCPA 3DAPA 4ZOCA 5HE9A 2AN9A 3LKZA 4J75A 2AC2A 1UZMA 2FN8A 5CVVA 4IS2A 4EMUA 4EQ6B 2EATA 3O92A 3GLTA 2SKEA 4GHWA 4M9UA 2RGXA 4YO8A 1QWOA 2O2IA 2FH5B 2XF2A 3B60A 3G2OA 2NU8A 4DMCA 1AV7A 1OUMA 2IYPA 5JMWA 2JEZA 1ORHA 4YQZA 2ZROA 2WFMA 1VA5A 3CLSC 5B7PA 4IHQA 1L5LA 4YMUA 2VTBA 3JAWB 3MG9A 3BEDA 3RV3A 4EZEA 4CM4B 1E5DA 3AVWA 2AC7A 1EVQA 2A94A 4B45A 2O23A 4DBVO 3LNTA 1CLEA 3L1KA 1U3FA 5CB4B 5BWLA 4L02A 1TT7A 3I30X 4FXOA 1YQTA 2K87A 2AJTA 1HDOA 2FP4A 4UQPA 4YROA 5LA6A 4H1WA 3D8HA 2AI1A 1N2GA 1T6BY 5AKXA 2FTKE 3IQIX 2XQFA 3GU3A 4LJ8A 2BZGA 3UMRA 1E2DA 4DQXA 1XK6A 2E87A 4IH4A 4H7JA 5FPPA 5BN5B 5ISMA 2WTNA 2G1PA 4E12A 4XDHA 3ZDAA 4YAJA 1TNDA 1PQPA 1TVEA 1UKVY 3OU7A 2KI5A 2AUMA 1S3IA 4L6CA 4MB0A 3QLJA 4TUYB 4M0DA 5AW2A 4YAOA 1N4AA 1J2UA 2FSUA 3WFZA 2H3HA 3LM8A 4K5QA 3PUYA 4J1TA 2OPHA 1Z47A 2R8RA 5TQ0B 3I04A 2OG2A 1OF1A 3M8KA 4J2OA 4CBVA 1QHHB 1R4NA 1IBCA 4Z4HA 1QV9A 2NUPB 4QPDA 3HN2A 2GESA 1DNPA 1F6WA 2NACA 1G8SA 1QJ4A 2IW3A 2YQ5A 3OIDA 3P9XA 4I4TB 4NENA 4Z9YA 5G4LA 4ZOLA 2VP0A 2JLVA 3QYJA 1H2HA 1R5NA 1UT6A 1CZLA 1GN8A 3O95A 1A7AA 3C4VA 3R9XA 2FMIA 4BFVA 2ZS8A 2RARA 3B12A 3VTKA 1OILA 3K9GA 5JHHB 1M74A 2V4ZA 3OUZA 1T2AA 2JASA 3J7AC 1JDUA 4B85A 1F5SA 2PT7A 3V33A 4R1OA 3NKFA 2OV2A 5C8YB 2Q29A 3N2NA 3OPXA 5ESRA 1CCWA 4Y9TA 4PSVA 3N2KA 4EFKA 1X6VA 3I04M 1IQUA 4C1NA 3WK9A 3A4LA 2O8CB 3JQ8B 3OZGA 1I14A 3NI2A 2C7OA 4E33A 2AQHA 2FRVA 5IUJC 3R9IA 2X8BA 1JXQA 5IJWA 1L5HA 3G1WA 5GY7A 4GOOD 3JSXA 3L0BA 1PD1A 2IGBA 1ULAA 2O0MA 2BV3A 1V3VA 3HJTA 2RGGA 1LXCA 2YFKA 2QMYA 3F47A 3M4YA 5DTMA 3VU8A 2GEDA 3C0KA 5M7EA 3HUDA 4IXNA 4EVRA 4ZEXA 3LX8A 1CS4C 3MGCA 4IUCS 1C0IA 1JHDA 2WKRA 3I73A 5DN6A 3VPBA 4HVLA 2BOVA 5F7ZA 3PQ3A 3SCZA 3BH6A 4RL6A 2C7RA 3AL0C 2BSQA 2I2FA 2OBMA 2P2GA 2F59A 1EUZA 1X7ZA 2X58A 4UMVA 2LV8A 3B85A 4QULA 2R7KA 3IIMA 4DPLA 1KJNA 3H8VA 3DTVA 4WXEA 2PXCA 3WL3A 1M8PA 4AT1A 3RWMB 3H75A 4JIGA 4GWLA 1JDZA 3AF0A 4UHCA 3BH0A 4PONA 5JZMA 2A1TS 2IHUA 5KX5A 3CE9A 1H8HA 4X1KA 2W37A 3QKTA 1W85B 1GFIA 1XAJA 3MBIA 1WUHS 3TE6A 2E1PA 1R4ZA 4HAXA 4PZEA 3D5TA 2RGRA 2VJNA 3HR4A 3P2EA 4X1YB 3EMKA 3MUNA 4ZCPA 1YTLA 3BZWA 1P80A 4ZZ2A 4PIVA 4YQFA 5IP5A 3BTSA 1AZTA 2RJ3A 2PD4A 1LLQA 5EOVA 4AY2A 4X8OA 2N42A 4BQQA 3P32A 1QRAA 3C7AA 4DB2A 4D4LA 1BKDR 1T2DA 5A6SA 2BE7A 1L4MA 2ZW9A 2ZAYA 3D3WA 1NOIA 2M9MA 2C9DA 2J07A 2OHFA 2ZYIA 2ZAMA 4B33A 4C7OA 1EAYA 2PLRA 3FWNA 4XGRA 1WW3A 1TK2A 5JCZA 4GWKA 4NBRA 1G59A 4NSNA 3O8QA 1AXRA 1T1EA 1RPAA 4FDVA 4WN9B 3P2MA 2NLOA 4GKAA 5A5VA 3KB8A 5A4IS 3I2JA 4IJUA 4K0KB 1KRHA 2OKCA 3RIYA 1II9A 5ESXA 5K7SA 2XBMA 4PIMA 5J4LA 1JDSA 1Z4JA 2RB4A 2ZSKA 4J0CA 2Q5JA 2Q5FA 1ZAYA 5SZIA 1D4OA 1U0SY 2L19A 3V4PB 2AFIB 2MIIA 4LNUA 2ONJA 1ZVVA 3IBYA 1LLUA 1ZN2A 2HIMA 4C6SA 4CYMA 4ZO7A 4E07A 4EHFA 1NASA 3S7TA 4JV5B 3A4YA 2AFRA 3UQZA 3COSA 3ISVA 3R5SA 4QPPA 5FJJA 2GVNA 2CZCA 1KQ3A 1DDIA 1DADA 1WMAA 2Q0SA 3HADA 3ONFA 3DD1A 5CLIA 5SZHB 3SSOA 3WYGA 3USCS 3OICA 3EBLA 3FYDA 3SNHA 3FYHA 1OBOA 3AERB 3O82A 1SQ6A 1N2CA 2PUHA 2Z8YA 3DP9A 1U28A 3EAQA 2P8JA 3BHNA 4RA9B 3RIHA 4EG0A 2VUHB 1AZLA 1JILA 3D6HA 5AJWA 3AR8A 4CMJA 1E62A 1YR9A 2CHEA 2ORYA 1JFTA 4ECAA 4OGWA 5FBLB 1RABA 1RXSA 2P2CA 1KEKA 2WAMA 5LU8A 2EL7A 1FEZA 1XRNA 1WCIA 2GCOA 1GSHA 2FDRA 3GRRA 3SYMA 3FOCA 5EPOA 3PPVA 1J2JA 4V24A 3RYTC 4IPTA 2EKPA 2J1LA 1K86A 1H2EA 1EPUA 4FEGA 1OYWA 2OV6A 1ISGA 3WSVA 1GUFA 1XJ5A 1XZNA 4XWAA 3HJUA 1C4XA 4P5DA 3WK4A 4MUHA 2QVZX 3LW8A 3WLJA 2OFWA 3G5MA 3NDIA 5K8IA 2WILA 4RWZA 2ZJ1A 5BMVF 1MB2A 3F73A 5D3MA 1MG0A 1VPWA 1U9YA 3C2QA 2XB2A 3W5VA 2QD5A 1YBVA 2QP4A 3D4PA 4EP1A 3RS7A 2XXBA 2JJ2A 2QLLA 2XDWA 3QM1A 4PCVA 5F2EA 1KK2A 1FXUA 1GXSA 2NAPA 3BRWD 1UPBA 2Z8YM 1T3GA 2PKEA 4HX9A 1ISJA 5ECDA 3GJXC 5K4AA 2HSDA 2I6TA 3EF0A 1QTIA 4OHMA 4QJIA 1XHEA 4D79A 4OOEA 4EA8A 4BAZA 4DQVA 2DQKA 4CQNA 3NIBA 1GTJ1 4Q4DA 2CC2A 1DCFA 4M1OA 3DDUA 1E2UA 3GFTA 1LV8A 1PJ8A 4RZHA 5A4FS 4Y8VA 2HXSA 3U3OA 1NQVA 1EEHA 4I9UA 1D9XA 1QLHA 2EXXA 3RGGA 2ZI5A 1WUIS 2WF7A 2CFSA 2GCPA 3HCAA 4OHBA 1XGKA 4XLLA 4DF3A 3NC0C 4EPYA 2OHVA 5FUWA 1G5QA 1KAQA 5L6MB 1BN7A 1D0IA 1ZUNA 1SUDA 1U1GA 3EVFA 3N9IA 3D0OA 4HS4A 4TTIA 3D4NA 4YK7A 5B3JA 3B1XA 5LNK6 1Q0ZA 3FPBA 4KQJA 3NR2A 1D5WA 3OMXA 1VG8A 2UYYA 4BBAA 3OMLA 2AMVA 1FLDA 4PAWA 4DXDA 3OHMA 1QDLB 2ZUDA 3A3YA 3QUBA 4KMOA 5EIXA 3UK0A 3ST7A 2FPLA 3HC7A 4LYFA 2P62A 1RAFA 1TJYA 4HGQA 5GIOE 1EGMB 4Y6QA 2WM2A 3HDQA 4XWTA 3E9DA 2WIFA 4CEHB 1KJJA 2GNPA 3CX7A 2VSFA 3TIIA 1Z75A 3FOZA 1XZKA 1GPUA 5LQNA 1CZNA 2TMDA 4HPWA 1IG0A 4L7VA 1BEUB 3MERA 1IAVA 1Q17A 4FFPA 4GEKA 2FGKA 3JD3A 3TLYA 4AQDA 1PV4A 2F2TA 1AZSC 5CDHA 3O0DA 1XTJA 1Z45A 3LD9A 1X9IA 4PN7A 1N7IA 3JV7A 4CR6A 4TMZA 5KYTA 2JGLA 2Q5QA 3K73O 1KHHA 1C8LA 1PBNA 1ODSA 2YZNA 4HGZA 5DLYA 3KOUA 3T1QA 1NGSA 4B0OA 1SBQA 1MV8A 2M6SA 2AIRA 4AY4A 4FFBB 4E31A 1WKBA 4ZHSA 4QARA 3JQ9C 1Z0UA 4ZU6X 4LJYA 4PRKA 2GKOA 4DCTA 1XRRA 3LHKA 4QT4A 1I3CA 2DPYA 4FWTA 5HCUA 1KVSA 4LNAA 2X4GA 3QA3E 1TZMA 4E5MA 4YIHA 4HPJB 1ZVQA 4CT0A 4FJ0A 4XQCA 2F1IA 3Q2KA 3SHTA 3I64A 1EYZA 5CNJA 1XTRA 3Q1LA 3SJBA 3SZ3A 2C03A 5JD6A 1XPUA 2EW1A 1CX9B 2VYQA 3TLAA 1T34A 1BEEA 1TCBA 1LDYA 1ZIPA 2P90A 3HZHA 1NRIA 5IPFA 4JNKA 4LOJA 3SX2A 1QU3A 1PO7A 2BTOA 2WABA 3B7WA 3SYNA 3VBEA 1WXGA 3G9TA 4DXHA 1BVUA 3I52A 2XJ9A 4KK4A 1N78A 4JI5B 3GC6A 1SC4A 1AKUA 2HY7A 4QEDA 1AV6A 3JQPA 3U4CA 1S96A 4IZIA 2CVZA 3AKDA 4CLXA 4GMXA 2YTZA 2VJMA 5AW8A 3LQ4A 1L6RA 3GO4A 3CVWA 1DI0A 3WGYA 3UBTA 4EUFA 4ASUD 3LUJA 4BV2A 4W7SA 2B1QA 2IC5A 3THXB 4DS3A 4HDNB 1N1DA 3O31A 2VPXA 5CLGA 1PZHA 4E4TA 5JJ5A 3KWJA 5DSTA 2UYCA 3SR4A 2BFEB 1UINA 4BS9A 3OT1A 3MT7A 4LZZA 4R68A 4KEAA 2ZR7A 2YR0A 4P36A 2G6BA 3U0VA 5FBZA 5EN4A 3GNQA 5EYPB 1A82A 3AHIA 4ZOEA 1XQ1A 3CJRA 1DQYA 3NVMB 4HVAA 5DXJA 1JDVA 3B6KA 2JGIA 5J23A 3LVBA 4LY9A 1LDNA 2CXNA 1E3DA 2RI0A 4FJ2A 5J43A 1G7TA 1R0YA 3E5MA 3FUUA 3DAYA 2WG0A 4W6ZA 1QTNA 5IH3A 3G2JA 2V7WA 3DFUA 3C8DA 2WDPA 3IQZA 4MP3A 3GOHA 4ED9A 1TA9A 1XXHB 1QS0B 2X0KA 1KEEA 4G8JA 3VISA 2WWIA 1PWHA 2PDAA 3CIFA 4G0MA 3VO2A 1M1YB 1LPOA 8MHTA 4PSAA 1AUQA 4WIAA 5CFQA 4OP2A 3ER6A 1E7SA 4YCLA 1F1BA 5TMDA 4LOAA 3SJ7A 1EFCA 2ZXUA 2UVPB 3E5NA 3K1AA 2E49A 1VHDA 5HW0A 2XQVA 3GI1A 4GDFA 1NRJB 5ECYA 2RHCA 1CUVA 2F1JA 3F46A 2HDNB 4UBJA 1EHIA 2AUNA 3B1JA 3DOHA 5AP9A 4NQZA 4BO1A 1GD1O 3BMNA 1E0KA 3OZUA 3D8UA 2PHZA 4NYMQ 2P3OA 1CJSA 2DBQA 3IPXA 1DC4A 3ZEIA 2G3YA 2P5SA 3QKWA 4AULA 3JQAB 2DQZA 1P7PA 3TW4A 3LT0A 4WD3A 2B1RA 1B00A 4QGBA 3W6ZA 4YRBA 5DBOA 1M9NA 3EWAA 3ULKA 3UMSA 2GK3A 5CNIA 1GR1A 2ONCA 1IBSA 2RHJA 5E7QA 3NM6B 3R41A 4H7HA 2QM0A 5JAPA 2C4MA 4Y1RA 3WICA 4HB4A 3CV3A 5AESA 3KKOA 3ZDFA 1N8TA 4J4BA 4IDCA 5HF6A 1HE4A 3H6GA 5G1PA 1JU9A 2YJ3A 7REQA 3OCWA 1NXPA 3A9WA 4R2WA 3PTZA 4O33A 1C7QA 1OAOA 3FNGA 3T0GA 3UHOA 4AG5A 4B4WA 1VPLA 2NTNA 3KQOA 4II3A 2XAUA 2AJDA 1WABA 3EGWA 1ZSNA 2G4CA 4WXPA 1GCOA 4DPKA 2P5TB 4EHDA 1YCFA 3MUEA 1J8QA 1NXQA 4UFNA 2FN4A 3C1OA 2OYRA 3S1LA 3Q7SA 1HM5A 2EW8A 4QAJA 3WJ2A 1SUWA 2FGJA 2I62A 3TLJA 4E21A 1CUCA 2VQEB 1L5SA 1CLUA 1I6LA 4PPYA 4KRFA 5ALJA 3FNRA 4MVWA 2NZXA 5J40A 2XZLA 2TS1A 4G09A 4I46A 4MTLA 3U0BA 1YGPA 1DEOA 4V0SA 4I1YA 2IZ7A 1MDBA 4KWIA 2QS9A 1KBZA 2DTDA 4PAGA 1ND5A 1SQSA 1VJRA 3JS5A 4MLCA 3R7LA 4ZYXA 1ACMA 1GRRA 2FLWA 2RHDA 3K0AA 2AZXA 7MDHA 4MWGA 3V42A 5IJ0A 1WZUA 2YIDA 3LYAA 1IG3A 1XTPA 5KTOA 1Y3FE 2JZOA 3WE7A 2VN8A 2ZRPA 4M49A 4Q05A 1G4AE 5DYNA 1JSZA 5DHFA 2OBNA 3GAMA 3VRHA 2QJWA 5AXDA 4DVJA 5JC8A 5KYGA 3GQVA 3CX6A 4PGAA 3RVKA 5ICGA 2ZJOA 4RMGA 1JG3A 3RVNA 4EJ6A 1F1JA 1KZGB 2C9YA 3WXBA 1PEYA 3A3PA 1CUWA 2SICE 3FPLA 5E38A 5HMLA 1LJUA 4XE5A 3DPIA 3HKEB 2OCKA 4K3VA 4A27A 3ZI4A 5D84A 1LNSA 1TW3A 1NSFA 4AZ0B 1TT5B 1NBWB 2KHZA 3BIFA 4Q4AA 1CEXA 1GNQA 4H1UA 4QNRA 1AX9A 2HBQA 3PHJA 1HZZA 2NYRA 1ILWA 2H1WA 4FBLA 4MHSA 5CGZA 2WYVA 3RW9A 3VMFA 4B3DA 4XVCA 2VATA 1YUMA 3UAZA 1Z7WA 1ZN9A 2NSJA 3Q1KA 4Q02A 5IN5A 1SNYA 4W5QA 2HNAA 1E1YA 4KJZA 1HKUA 1NVAA 1F48A 5GONA 4FGWA 1D2HA 3LUPA 4W7HA 1U0FA 1PYOA 2QTAA 2ZANA 4UMEA 3A4TA 3GBVA 4FI3F 4F60A 3JR3A 4C4ZA 3CC8A 4MRSA 1XALA 2QM8A 1P2BA 1G7RA 1T8UA 2O5CA 3CEJA 4EDFA 3JZDA 3V55A 1ZP6A 4Z0NA 2P6UA 5EQFA 3QFRA 1Y7TA 4BB5A 3REGA 2PUAA 4LWZA 4YBZA 3E3OA 1QB8A 4TN5A 4I55A 4B6SA 2BMDA 3QVMA 4XIIA 4LDPA 2I65A 4IXWA 2IOQA 1SKYB 1CKEA 4HDKA 2GXSA 1UK9A 3CPEA 4MAMA 1EK1A 2WA2A 4AIIA 1N6RA 2J0QA 5KYVA 4QUIA 2WB2A 5A2QA 3VZRA 2H4WA 5KYWA 3QEMA 1G18A 5JNUA 1JSXA 2FPPA 3CEHA 3GRKA 2F8SA 5K6AC 1YA4A 1ZAKA 3MMZA 1P91A 2GZDA 4L07A 3RR2A 5IVPA 1MQSA 4LGVA 1KVQA 2D5IA 3MC1A 1AQJA 1VYHA 3LBNA 3OZWA 4J6EA 2APJA 5DT2A 2XUFA 3S29A 3VR3A 2HPVA 5KOJB 1WMEA 1BFUA 1W581 3PWTA 3ANMA 1D1QA 2BFDB 2PKXA 3WISA 2VXBA 1A69A 3PJEA 4YJGB 3AJDA 1AKVA 1R3DA 3C4QA 3T8YA 1V8ZA 3IIIA 2AG6A 4QOHA 1KH3A 4X95A 1ODIA 5TIIA 3K6SB 1W4AA 3D81A 3Q85A 1T43A 2JD1A 2QN9A 4EGSA 4I5EA 5BURA 1N1MA 3DOOA 1R0SA 3U62A 1KAGA 3PDHA 5F5XA 2CV2A 2NU6A 1LLFA 2D54A 1K06A 3IV9A 1WBDA 2QYSA 5KYUA 4DLKA 1XMSA 2DR2A 2XWBF 1RAIA 4I50F 2YJ6A 2VTKA 4PYOA 2AOWA 3L02A 3UUFA 3V9PA 4E08A 2IPAB 1W94A 5K0SA 3CVVA 2Z6VA 1KAOA 4RAOA 2JRLA 3UMCA 3NOQA 2BR5A 1E6WA 3DZBA 5LZ5A 1CG6A 1E2QA 3ED1A 2ZIFA 4K6HA 4MUEA 2PL1A 4CE6A 3L18A 3AM4A 3CE6A 4QBTA 2O2DA 2WQ7A 3ICOA 4G0QA 1EBUA 4AP6A 4BTLA 3RRYA 4DCPA 4FFRA 1KQGA 3JWEA 4NECA 1RLTA 2PL5A 1ZMOA 4ZI5A 1T35A 2C7VA 4TM8A 1NVBA 3UJPA 4YV7A 1RCUA 4FFNA 1LVGA 4CKEA 1OGJA 3OEEA 4FR2A 1H6BA 3MTQA 3QGMA 4LQ4A 3T5DA 3W06A 2A35A 4MULA 1UJBA 4DFDA 3C97A 3CEMA 1SBYA 2QLNA 2QGZA 2ALJA 2ZJ2A 1W5AA 3LWDA 3T1NA 2AN1A 2Z6AA 5ELXA 3WI7A 4S2EA 3OZXA 5JISA 1JX6A 4OQZA 5ELLA 2R7MA 2NG1A 2PCJA 3QP9A 4FYHA 1VBFA 3LGXA 3N70A 5AK6A 3D8BA 3UY4A 5B7QA 5BRAA 1UPFA 2NN3C 4ZRNA 4R01A 3BMCA 4RADA 2V9PA 5EZSA 1Q83A 3IT3A 5CK4A 3WJ7A 1AO0A 3VHXA 2IS4A 3A58B 1G21A 2GK7A 5F9FA 1KS2A 1REQA 1QR2A 3BDAA 3LXUX 1U5AA 1UM9A 3U48A 3AP2A 1RE1A 3EZ2A 4D46A 4FUTA 2DB3A 1CTQA 1GY8A 4HYTA 4HFRA 3GLQA 3ABZA 5BW8A 1Y9AA 1WVIA 3K0CC 1XLTA 3VR5A 3QTTA 1IBRA 2ECQA 3KXPA 4QFCA 2UZIR 5B5SA 1BXRB 1HE8B 1N7HA 4URHA 2NNWB 4D0SA 4BKOA 1AHHA 5CAEB 1LFAA 4O0LA 4FYXA 4INPA 1E6UA 4MSUA 4FEEA 2HFKA 4J0IA 1T2VA 4MI3A 4QHTA 4BKRA 2ZIWB 1NJ2A 2ZLBA 3B1YA 1V5GA 5KB3A 1Q2UA 4DNXA 3AKYA 4DRXB 4DLSA 4W99A 4GRDA 3BFXA 3EXAA 4BZXA 4BLVA 3KJIA 421PA 2W2VA 3PFGA 4TVSA 2O07A 3QW2A 4Y3UA 1ZK2A 4LPSA 2ECOA 2OO3A 2A0YA 2OGWA 4J9VA 4X44A 3HJHA 4F5WA 1G42A 2B7BA 3DE1X 1DO8A 3M3HA 1DAPA 1T0UA 3K5WA 3DKVA 3MJFA 2GAAA 3ETLA 3P4YA 4H4EA 1GGHA 3RUDA 1JHAA 3UT0A 3ZE1B 4COOA 4WBXC 2OGZA 2IFTA 4N9WA 1JXMA 4RENA 2B4AA 2DVMA 1ST2A 2QE7D 1RHUA 3H4TA 1BJRE 3GA0A 3I1FA 4TQAA 5K0EA 2QQ5A 2QP9X 4NZYA 4WZBA 4ECEA 1P7ZA 4C1BA 1JQ3A 3HH8A 3ESYA 4E14A 3UCFA 1EZ1A 5FOVA 3IP8A 4B35A 5JNWA 3NBAA 4BO9A 1AGRA 3H2JA 1WB5A 1QGED 5JZSA 3SKYA 5DNDA 1G64A 3CNNA 1NIPA 1FLVA 3I9OA 2WNHA 2LP4Y 3QQPA 4YIKA 5TV2A 3ZY2A 4A9AA 1G0OA 1QX3A 5H7XA 5GVSA 1CY0A 3GJ6A 1DWOA 1WHSB 1RHRA 2IW1A 2R84A 3DBVO 3OZCA 3PQEA 4N5MA 1XAHA 3D3NA 3WMGA 1FTWA 1RRKA 1QUEA 1V26A 3FTCA 3ILHA 4QGHA 5SZKB 1V5WA 4CMEA 2IV2X 1O5IA 1T25A 1W0KA 3O8DA 3QVSA 1WDTA 1Y1TA 3MIIA 5EI5A 1JAZA 2QD2A 1EKXA 1ULTA 3SICE 3GRFA 1P0IA 4R31A 3PFFA 5CHYA 3MTIA 4ENWA 5M04A 2P4QA 1T26A 2IHKA 4R1MA 1C3LA 1MOZA 1PUJA 2JI6A 4J3FA 3RIEA 1EGQA 1WM1A 2IP2A 2VOJA 2E37A 1BVRA 1YNOA 2ZIXB 3LECA 4P4GA 4PHHA 1X9HA 4HQNA 4F4FA 5K0FA 2G9RA 3H0KA 2C54A 2HNKA 4FXPA 1LPBB 3P9QA 4KW7A 1ABBA 4P54A 4K9MA 5H3HA 5EHZA 5HTOA 4EPRA 1ST3A 1Y8RB 3OE1A 4ZK6A 3EMVA 1WXIA 5BSUA 2JLCA 2IITA 4QWWA 4FP9A 4J0GA 4JSRA 3RS3A 1LVHA 3VYRB 3IUPA 4XASA 1HNNA 3IODA 3M34A 4P2BA 1Z9BA 3WGUA 2JJ1D 3EVEA 3GJRA 4W8HA 4IXTA 4E5PA 2XKJE 3HRIA 4QRDA 5FWXB 2ZVDA 4JHXA 1ITZA 3IVAA 5COBA 2CSXA 2E4AA 2L0XA 1MO2A 3C3CA 4YMWA 3ZDYB 1XQXA 2DKFA 2NTEA 3DHYA 3GLGA 3F4LA 3MUOA 2H8GA 3NBKA 5I9MA 3PQCA 5EKXA 2RH9B 3ORRA 1DAMA 1ZW1A 2UAGA 1N2SA 1NYTA 2GAFA 2RGBA 4HBZA 4DG5A 2GPSA 2B0JA 3CNHA 4MI9A 3HCFA 5DBFA 1VM6A 1FZTA 2UZ1B 3CU5A 3OCJA 3SQNA 4EARA 3K3PA 2PZKA 3OQOA 1EFDN 4UTNA 1QIMA 4IYRA 1SC1A 1V8DA 4H77A 4GYYA 2DEUA 2KWIA 1TEXA 2VWQA 3QNUA 1G8YA 1LSJA 3WQHA 4ETMA 2CD7A 5K0GA 3WTBA 2CNDA 3RREA 1KYQA 4KLAA 4MVJI 4QU0A 3NVAA 5DM2A 2XUJA 4R69A 1Y8QA 4NK5A 2GJ4A 3HNRA 3O8OB 2HJ9A 1ZFNA 3JATA 1MJFA 2B6NA 2CGEA 2AZMA 2HMAA 3R40A 1W5FA 1FB5A 5C1BA 4FCVA 2NQTA 2H4XA 4RVOA 4UFOA 5BYKA 3FYTA 2JI7A 5DI3A 4OQYA 7YASA 5FBKA 1S1CA 1UR5A 3S4YA 4JQSA 3UXHA 1V9LA 3D8TA 4OXQA 2WHEA 4ZT2A 3KQPA 1L7OA 2I3GA 1MX5A 4D8XA 1V7QA 2FEMA 4A2PA 1VSVA 1VHTA 1HYEA 1H4QA 1Y1KE 3RASA 4EBFA 5LP6A 2F9FA 1NDQA 3LLVA 3DE5X 3L84A 3IA2A 1U9IC 5LYYA 4CKWB 1ZDMA 4DPMA 4J4HA 3J81k 5CDYA 1ACLA 3HP7A 3E3NA 3KQSA 5EWLA 2GM9A 1T0HB 1U80A 1NVDA 2XWQA 2YVUA 1JHOA 2IPLA 2YJ4A 3P0HA 2OO5A 3UV3A 4JI0B 3UH1A 2OBFA 4KFRA 1GFZA 3INNA 3OLYA 4UASA 1L8QA 1Q7EA 3UMJA 3J80A 3O4RA 2EYUA 3BQ9A 5FAXA 1EG7A 2LZ0A 2ONZA 4EEKA 4LUCA 3A06A 3LCCA 4MCIA 4RTRA 3N86A 1T8TA 4XR9A 1GSIA 2IP1A 1KP3A 1GPDG 1OXTA 3UVEA 5BVHA 3BIJA 1RAHA 3KAJA 3AF6A 2ZK7A 5F4ZA 4PINA 3VX4A 4OLBA 4RWEA 3R7SA 1L7XA 1JLRA 1P1JA 1Y4ZA 3KQKA 1OT5A 2OT3B 2JIDA 1UCFA 2VBIA 5JLAA 4C89A 3K2IA 3DLCA 3HCBA 1I8TA 3VDMA 4IY1A 5FOQA 3RHFA 1CRQA 1QZXA 4Q03A 1VGQA 1XZHA 3F7OA 4MW2A 1V1MB 2Q0XA 1Y1QA 2W0MA 3A3OA 3GX1A 1FRZA 2Q4OA 2ZXEA 1NQTA 2R751 1TAGA 4QD3A 3TCNA 5IT0A 4FIDA 4BMVA 4EGAA 1LD3A 1E9DA 1Z26A 2Q07A 3LUFA 4FCCA 3T5CA 4D25A 3QLVA 2BZSA 4E30A 5TGDA 5KKCA 1IM8A 1J25A 4HH4A 4KQGA 3ZHSA 5GZ1A 1P77A 4GPTA 3BA1A 3CSSA 4HZGA 5H5JA 1YACA 3T5GA 1L2TA 1PUIA 4AU1A 1IN7A 1PJ2A 1JN0A 2WF5A 2ZRIA 4JITA 4CW7A 2X40A 2WPNA 4BZQA 2GXQA 1QF7A 1FFSA 4FGZA 4ZPJA 1XYVA 2JAHA 5H68A 4XLTA 3U4AA 4YR7A 1TZKA 1G2IA 4IHKA 1YRHA 3UW3A 2VKQA 1JSRA 3QUCA 4G9GA 4B40A 4ZYTA 2OCYC 5LXTA 4DQ0A 1WEKA 1KY4A 2YV5A 3BF7A 3HCEA 1MQ9A 4PXYA 4TKLA 1E2BA 5IZCA 4J1TC 2C1ZA 2QUJA 2X15A 4E2ZA 4K6MA 2PSJA 5BT8A 3LPMA 2PMEA 2Y2VA 3KPYA 4IUDS 1GGJA 3CFYA 2W6JD 3T1VA 4DSUA 4NCJA 3V2IA 3DMFA 3A6DA 3AVPA 2VPWA 4GSKA 2BSXA 5BYAA 4C9BA 3OCCA 1ZIYA 4GI1A 4ESHA 3LC1O 3OO1A 4R9UC 3EISA 2F3QA 2G63A 2C3YA 2YRFA 3CISA 3D7RA 3DEJA 3E82A 1CU1A 4A6PA 2K2QB 1CY8A 4A6EA 3TOCA 5FLXA 2AJ8A 1TM2A 4O4LF 2QLTA 3ZCUA 4C21A 4FUQA 1Y6JA 2O7VA 3AHCA 2EV9A 3NIGB 1FU8A 5I7UA 3QHPA 1YJAA 2QL9A 3AYXB 3AHEA 1DOHA 1EH5A 1DTSA 1J24A 2O6LA 3L8FA 4UDOA 1J4AA 1PG2A 3BJZA 1BOFA 4C2BA 4FR5A 3DLBA 2SNIE 1FFXB 3ITNA 1X38A 2RG1A 1WCYA 3D6MA 4WJLA 4PSUA 3FSGD 3GLHE 1B26A 4AY5A 1VMIA 3RRFA 3ZX5A 4ZQHA 3LZCA 3I2IA 5CXQA 2ZDHA 1UT5A 4FC6A 5JG7A 3ROMA 4PSCA 4HEJA 4RS3A 3LOQA 5MHTA 3W1VA 4RDCA 1G55A 1FSPA 5FR2A 2NVUB 3WZLA 2FPIB 3GZ4A 2ZULA 2FOLA 2JVIA 4HQLA 2P2NA 1ZW6A 3Q40A 1KZ1A 5EG5A 4LTMA 1D7AA 5KJ6A 1IY2A 1K08A 1WMDA 1DXYA 4OMDA 4U0KA <