1C7FA

D95e oxidized flavodoxin mutant from d. vulgaris
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
147
structure length
147
Chain Sequence
PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKVACFGCGESSYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Crystallographic Investigation of the Role of Aspartate 95 in the Modulation of the Redox Potentials Of Desulfovibrio Vulgaris Flavodoxin
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Electron transport
total genus 50
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1c7fA00
5B3KA 4H2DA 1CZLA 4ICIA 4QODA 4YAOA 2F1OA 4C14A 3N3BC 1AKVA 3N3AC 4C0WA 1FUEA 1DX9A 4BMPB 1CZHA 3NHJA 1F4PA 5EAIA 3F6RA 4Y9UA 3FNIA 4LAFA 3OWHA 2X2PA 2FZVA 1J9ZA 4Y9RA 1AKRA 5LJLA 4GI5A 3ZHOA 1CZUA 3HA2A 3O73A 4ESEA 1RCFA 3KAQA 3UXHA 1FVXA 4NULA 2BPOA 4LTNA 1CZOA 4BMOB 3G5MA 4ZVMA 2V9CA 4YAWA 4LTDA 4ZVNA 4GQIA 3B6IA 1C7EA 2Q62A 1QRDA 2OHIA 1T0IA 4DY4A 4HS4A 1FTGA 2QMYA 3ESYA 4YAFA 1XI2A 2W5UA 1H66A 3OVMA 3TEMA 3NHYA 2KLBA 2Z9DA 4PU0A 4N9QA 2FAXA 4DIKA 5F12A 1H69A 1RLJA 1DXQA 1CZKA 4U7HA 1BU5A 3LCMA 1CZNA 5FX2A 2B3DA 1QBGA 1DXOA 5A4KA 4M0CA 3OJWA 4C0XA 5TGZA 1ZWKA 1V4BA 1WSBA 4N82A 3KLBA 1OFVA 3F6SA 2QR2A 3SVLA 2D5IA 2R96A 4U7GA 1SQSA 3ESZA 5LJIA 6NULA 3NHLA 1J9EA 3U7RA 3R6WA 4C76A 3N39C 1TIKA 4FX2A 1D04A 1AKWA 1FX1A 3NLLA 3L9XA 2BZSA 4FGKA 4D02A 5EA2A 4LA4A 3FJOA 2KQUA 4N65A 3D7NA 3GFSA 3K20A 4LTMA 4HEQA 3TE7A 5NLLA 5LLDA 4QOFA 4U7FA 1FLDA 1YCHA 2FX2A 2QX9A 2QX4A 1OBOA 2V5UA 1RLIA 1GG5A 2FVXA 4ZVKA 3NHKA 1D4AA 3NHRA 5LBTA 3B6KA 4F8YA 4J8PA 3NHFA 2HPVA 1X77A 2V5VA 2GSWA 3EYWA 2R97A 2WC1A 3HLYA 4H6PA 4CETA 2X2OA 3NHSA 1I1OA 1XYYA 2A5LA 2MWMA 3O2NA 2HNBA 3FVWA 1T5BA 5FA6A 1WSWA 2HNAA 3B6JA 1ZX1A 3GFQA 4QOEA 3NHPA 4Y7CA 2FZ5A 5FUQA 1AHNA 3QFRA 5F4BA 3ES9A 4NLLA 3EDOA 3L9WA 1SG0A 2ZKIA 1TLLA 3LT5A 4QOJA 2AMJA 2BN4A 1AKQA 1FLVA 1RTTA 1J9GA 3W77A 1B1CA 1D03A 2FCRA 2OYSA 3QFCA 3GFRA 2OHHA 5F51A 3KAPA 4XDGA 2MOKA 2FLVA 4GR9A 1KBOA 2ARKA 1YOBA 4YAUA 3W79A 2Z9BA 4R81A 5BUCA 1FLNA 4S24A 2BMVA 2Z98A 2FDXA 1YDGA 3FW1A 1KBQA 4YQEA 1CZRA 1JA1A 1AKUA 4ZVLA 1AMOA 4CF6A 2N1MA 2OHJA 4DILA 1XT6A 3HR4A 1AZLA 3P0RA 2M6RA 5LBUA 1C7FA 3GAMA 3FX2A 1AKTA 1OBVA 2MTBA 4FGJA 4QOGA 1BVYF 4YALA 1YCGA 2Z9CA 1QHEA 3F90A 3B6MA 3S2YA 1ZWLA 4OXXA 1YCFA 4QOIA 3OX2A 5JROA 3W78A 3NFRA 1AG9A 2RG1A 3F2VA 3KEGA 5EMNA 1VMEA 3NHWA 3ESXA 4XDHA 1YKGA 5B3LA 2Q9UA 2QMZA 2MT9A 4FGLA 2QX8A 2XODA 1J8QA 2M6SA 1XYVA 3NHUA 3JSXA 3OX3A 5LMCA 2QWXA 3QE2A 3OX1A 1FLAA 2FOXA 5LVAA 2QX6A 1E5DA 3UXEA 1QR2A 3RPEA 5ULLA 3K1YA 4QOHA 3TZBA 2XOEA 3U7IA 3OWXA 4PTZA 1JA0A 1YRHA 3OJXA 3W7AA 2BF4A 4PTYA 1NNI1 5NULA
chains in the Genus database with same CATH superfamily
3OHPA 1Z2NX 4X64B 1OV6A 1U2DA 3QSGA 3D4BA 2FEWB 3ZV5A 1QVVA 2I34A 4ALNA 3I2FA 2IHZA 4R9SA 5A03A 1N6KA 4CIAA 3K2IA 1ISPA 1S8AA 2WKQA 4J90A 3FPEA 4ER3A 1OZ0A 3IQDB 1VI2A 2GKSA 3K94A 5J4YA 2I71A 1CY2A 1W5FA 4AZ3A 5HIAA 3LP6A 4BNUA 4JSRA 5F5LA 1H2HA 3LBAA 1KJIA 4C0WA 3ACCA 4FYWA 1SAYA 1LZKA 5IHPA 3C5EA 3SQXA 2X3UA 3D3WB 1KAHA 3EGCA 5JC8A 4L07A 4L8YA 3OZUA 4LHWA 1NVBA 1F4PA 1U28A 2VJBA 1LW6E 3EFHA 3QJYA 1GQYA 1X8XA 3F6RA 4F96A 4TYNA 2PPLA 5BSVA 4Y0AA 4R84A 2XMPA 2XMZA 1W4LA 2C07A 1XEFA 2V6BA 1JE1A 1T0HB 2H85A 3QX7A 5KTRA 1M34A 2VP0A 3VJRA 5GM2A 2B34A 4ASUA 3FPAA 3MWKA 1S8FA 1ZIOA 2QTMA 4OXIA 2JIPA 4DCMA 2WMOB 4KL8S 1HDZA 2VHTA 1J9ZA 2MYTA 1Z2CA 2HTEA 2BKEA 5JDCA 2G4LA 5BNFA 2JJYA 2QUJA 1SVNA 1U8EA 4X1KB 1THMA 1VLVA 3LLCA 4DV0B 3M6VA 5AICA 1JZSA 3GIWA 3H65A 5C8ZA 3K2EA 2ZR7A 2HHAA 2GNPA 1PQUA 1LRKA 3NCTA 1T1RA 5CB0A 5EJ5A 4IXMA 4G0ZA 2R8ZA 4NK4A 1NDUA 5KWEA 3DZKA 3EVZA 4P98A 3U5TA 2I87A 3UENA 1MN6A 1IAVA 3WTCA 1MGPA 4QICA 3WGOA 4HH4A 2I80A 2WK1A 2O3TA 2XE4A 4DBLC 2JLWA 2DM6A 2EERA 3EH2A 3G89A 3L77A 2Q1XA 3E22A 1PDWA 1WEKA 5HFNA 1HDYA 4X71A 1R0ZA 4J0IA 3VBEA 3HCOA 3KQQA 1RXVA 1FP2A 5IYZF 2EW8A 1B2LA 1F2UA 2YWRA 3DQQA 1P77A 1LNQA 1VM6A 3OF3A 3PTAA 3AM5A 2VBCA 1A0OA 4KUEA 5BWLA 1MLDA 2P62A 1B00A 2CEKA 4RZQA 4LC9A 1JHZA 2VYFA 4LE2A 2OHIA 1E7YA 3F96A 5ILOA 4L2IA 2IKQA 3PEEA 4P2BA 4PNPA 3AR4A 3RUPA 4B47A 2PRYA 3HJTA 2V96A 3HB7A 2PV0A 4ISCA 3QXCA 3RBVA 3WBFA 4XYLA 2VRCA 3GV0A 4GICA 3KK0A 2ZB8A 4NI5A 3SQWA 5AUOB 4BKPA 3BGSA 3DV0B 4KQ1A 3STTA 5CHYA 1XWWA 2EWMA 2G88A 2ONYA 1GZUA 4IBOA 3SHWA 1I01A 4F5YA 4CKEB 1JDZA 3K9GA 3T5PA 1VHTA 2OHFA 2ZJZA 3CN7A 2NZYA 3NIFB 3UOWA 1Q3TA 3D6NB 1VLHA 3ZY6A 3F49S 1DZ3A 5HDBB 3FMOB 4A0FA 4K1XA 1QQAA 4CT4B 1ECFA 2QU7A 4D44A 1O9BA 1B15A 2DXIA 2I6XA 2A5GA 4IH1A 4M37A 4K0KB 5EMMA 2W6NA 5JJKA 1YA4A 5F23A 5AO9A 4E33A 2J9XB 1FUKA 3LX6A 2VP9A 1ZEJA 4LXYA 4N40A 1H23A 2AEEA 2FVYA 4UVHA 1CE8A 1TZJA 1ZBQA 3D9QX 5BVGA 3K3PA 5JCXA 3ZWOA 1B8NA 2CMDA 3FRHA 5FX2A 1KK0A 4EH1A 1IXKA 2J6HA 2GEBA 3JWHA 4IDNA 4KPUB 4HAWA 3R41A 3USZA 3KVNA 1FP1D 4CEHB 3BFJA 2Q3MA 1V16B 2XX3A 5K0JA 4IZIA 2DE0X 2PT7A 2R4TA 5JCOC 3E53A 1MO2A 1K5DA 2QY6A 1QGDA 4MP8A 1B6SA 3MAAC 4PV7A 5AJTA 5AYVA 4LOIA 4CMIB 3SSNA 2X9VA 2P9YA 1XMJA 3M1AA 4M7RA 4LXTA 2H4JA 4JKYA 4D25A 3VR5A 2JIOA 3P45A 2HQRA 4LKRA 5C51B 4FYXA 4RETA 4W7SA 4DCJA 5IJ0A 4TQAA 1NVTA 4FJ0A 3FLMA 3LY7A 1XELA 1F17A 4NU8X 5TY0A 2VTBB 1GQRA 3U7RA 1RQ2A 2QN3A 1Y37A 1S9DA 1DC6A 2BZ1A 3GCGA 5LP6A 4M9ZA 1TIKA 2ZUTA 4JZKA 4ZEVA 1T8WA 1M8GA 4OAOA 4UHHA 3V4RA 1QHSA 3LLSA 5KHAA 4KREA 3DAGA 3Q5GA 2YVAA 5K3FB 2QMQA 2EFEB 1FX1A 1LGYA 3NLLA 3SJ7A 1J8DA 5ECDA 3BCUA 4L1KA 2G1KA 3THWA 1XN4A 3H5VA 4V02A 4HTAA 4EVSA 1K8XB 2JA2A 1J5EB 1I0IA 1PHPA 2IA5A 3RAPR 2ZJBA 1Y1RA 5T41A 4Q7MB 4M36A 3VU0A 2GCGA 3BD9A 3LCRA 3LMKA 4X20A 5CD9A 3INTA 4ZXFA 1H6DA 1NOIA 3D0RA 4ZV7A 2QEQA 2FWJA 3AW8A 5LLTA 4NJEA 2D3WA 3CIFA 2EHJA 5M7EA 3DDWA 2GGSA 3NOXA 1P2GA 4FNOA 3D8BA 5E1MA 1WW3A 3CW2A 4U2FA 1KXZA 3V97A 4K5QA 2OESA 4L8VA 1JFVA 2F9FA 5AJWA 3ZE2B 1BXKA 4YAKA 2I33A 1RIIA 4WIAA 3I92A 1KJQA 2IZOA 4ZHQB 1U0EA 2EZ9A 1BN7A 3OEYA 4OK6A 5L7YA 3MLAA 1GPUA 2NPFA 3RBAA 5DP2A 2BFOA 4BJ6A 2PUDA 1EM6A 5FV4A 3EBOA 2YRWA 4PSUA 4ZU3A 4EDHA 3JW8A 4KIFA 2QBYB 1E0DA 1VHWA 1Q20A 4M1TA 2OHOA 4WX2B 3PR1A 2FQ1A 2NZUG 4X95A 3ORHA 1IL0A 5DDIP 5E1BA 2GBGA 1JLLB 3DZCA 16PKA 5I8PA 1F2TB 3K15A 1DFIA 1N34B 3L7JA 4KOAA 4TRNA 4O4LF 1GUBA 1GQSA 1D4AA 1FS5A 2XUPA 2JIRA 3N28A 5KOJA 4GVXA 3MHTA 4DRYA 3ZHCA 2FQYA 2FEPA 3UJ6A 2HGZA 2ZI7A 5ER6A 5IM5A 4HQLA 4PZEA 3AJ8A 3LYHA 1ZLYA 1XZJA 4AMYA 1O8CA 1SRRA 3MOGA 1VJGA 2HPVA 4EI2A 1G41A 2CNBA 1SVSA 2N42A 2R1UA 1X1RA 2RHMA 5EP2A 1EVKA 3ZTWA 2WOOA 3HUUA 1PJCA 1MO6A 3GLRA 1E8NA 1T8UA 4X54A 4EHAA 4H7FA 1XL0A 2H4YA 5MDHA 5ALMA 4RVUA 1H6AA 3U3KA 2X9QA 1U80A 1O03A 3A6KA 3GHYA 3IAM1 3NHSA 2ID7A 3QUTA 2H31A 3DWIA 1BD4A 2W2MA 4Q1VA 1U5BB 1HT2E 3B5JA 4R41A 3P9IA 5ALDA 1A5TA 3WISA 3WOHA 1XRJA 1OYYA 5KOHA 1T36B 1JT2A 4V1CA 4JI4B 5IZCC 1NMXA 2D4AA 2PMFA 3MTBA 1WSWA 4GGOA 2O8EA 3TTSA 1KFBB 2BW0A 4M9UA 2BFMA 4IHJF 2F2TA 2LIPA 3MMSA 5E0KB 3ZE1B 1JSCA 3L2OB 2G9ZA 3Q98A 3I76A 5B3JA 4GOKA 3JQFC 1EEHA 5TGDA 1RT9A 2HEGA 4J76A 4DNXA 4LXIA 1MJHA 4NCKA 3BMCB 3JQBC 4IEIA 2QENA 3DL0A 2J0UA 4CMAA 5TQ2B 3UFXB 4E2ZA 5KMGB 3LWZA 4FCCA 2D74A 5LQCA 1YQ9A 1Y82A 4P54A 4DYDA 2NU9B 4NE7A 1WZ2A 4KN8A 4ZOLA 1WJGA 2V74B 3KJQA 2W6MA 4GVLA 4NF2A 5TLSA 1YQQA 5GJBA 3IQWA 1TC1A 3ZH9B 4CR8A 3H3JA 2ONKA 4UNIA 3DE0X 3SS7X 1EQAA 4UE3S 3ZUPA 1KVUA 5HCNA 1TTQB 4FE7A 4G2TA 2OKCA 5EXEA 1RABA 4TGLA 4AY4A 1V3TA 2GEDA 1PGPA 1MQSA 4R3WA 1K7YA 3IMEA 2WF9A 2DWOA 5J5AA 3GH3A 1D09A 2Q5QA 4QHYA 4QX6A 3AF1A 1DWOA 4WINA 2G70A 2WHEA 3HYTA 3G8BA 5CX1A 2BMWA 2QN9A 3QHPA 4GSYA 2CLDX 2RGCA 2Z3ZA 4MITA 4DIOA 4YCCA 5FWNA 3EGDA 4AKGA 2V0GA 1OFHA 2Q2VA 2H2WA 4IIYA 2ISCA 4MA0A 1HQCA 4UHKA 1J2JA 2QD1A 3SOZA 5SY6A 1IH8A 4MVJG 4KSCA 4XQCA 4W5JA 1CT9A 5T64A 4C7KA 3LS2A 2L2QA 4MPPA 4JXJA 1JB1A 2ENUA 1UKEA 2CXOA 1TEVA 3F9CA 4XZ3A 1HK7A 3QX9A 4MINA 4ZIRB 4W9RA 4QYIA 3VR6H 1ZN9A 2JFNA 4DZRA 4TOIA 4QXQA 3WWEA 1E9CA 4KJXA 1ZOPA 1T6BY 2FX3A 1Z37A 4XDYA 2IYLD 3DL2A 4KQ9A 3U3OA 1K98A 1JPJA 2OBBA 4K6MA 5COBA 3DUFA 2ANCA 1MOSA 1CRZA 5C5IA 2NUPA 5DBHX 3L8EA 1EVZA 4WNIA 2HJSA 5LIPA 1LBEA 1RQXA 5BNIA 1FBTA 1DXYA 1T6ZA 1LV8A 4YV1A 2ATEA 3RUHA 1CQIB 4KYVA 4MLCA 3KZKA 5F21A 2X0EA 3GAMA 4FOPA 4QLAA 2W2LD 3EBPA 3GD5A 5SZIA 1MV5A 1CDOA 4N5LA 4NBKA 1HR0B 4FI3C 4P22A 2JAUA 4CIXA 5FL7D 3Q3VA 1IBRA 4C1BA 4RULA 2H7CA 1NF3A 3T7TA 1PU2A 4F4UA 2JHPA 5DNUA 2YJ6A 1L3CA 3OOHA 1T6NA 4I7EA 4F45A 4EA8A 4UBJA 5HGXA 4Q9JA 1SXPA 2JIZD 2PJUA 4IVRA 3EVAA 3CW8X 4ZI7F 2OOKA 2WJZB 3U1VA 4Z7QB 2FW1A 1OLOA 3BJZA 4P4SA 5KQSA 2C4TA 2OBXA 4HOYA 1IJBA 2R4QA 1EIWA 1A1SA 3TQOA 2LCQA 3L49A 2BHLA 3EGXA 1XHFA 4TSFA 3SK0A 4TV8B 5CITA 3AVXA 3RUDA 3VI4B 1QLHA 4WKGA 5EG5A 2ZGVA 2AQ8A 4BNZA 4JROA 4A3SA 3IHKA 1WDTA 2IOYA 1EAMA 2Y1FA 2WW8A 2XTMA 4PFJA 1XZCA 4LBWA 4NYIR 3VXKA 4DIEA 5IVHA 3PV0A 2JIQA 3KEGA 4ZAVA 4E5DA 1P3DA 2QPTA 2PWBA 2XCRB 5EGNA 3UTCA 4CI9A 3O2SB 3DZDA 5I51A 4F11A 3ITEA 3P2OA 1EZZA 4OQXA 4R51A 2TMDA 4TS3A 1UJMA 4TROA 1BJKA 1T26A 4K9NA 3LP8A 1AQJA 3H13A 4ILEA 1YO6A 4GOMD 1UFOA 4C21A 3VR2D 2IOHA 2DOKA 2FXIA 3D1LA 1NVXQ 2AZ4A 3DVRX 2A6PA 4YB8A 4MS4A 4Y2GA 4OLJA 2MSDB 2WTEA 3P52A 3TSAA 1KH1A 3QVOA 2AN5A 4LK3A 2F62A 4DMUB 1TNDA 1Q74A 2C2WA 2ETXA 2IEGA 4X24A 3V4VB 4ARIA 1HZZA 1OFTA 2HBZA 2HK7A 3TLJA 4N41A 1FSPA 3STVA 3SBEA 3UJ3X 4IV8A 3V80A 2C9ZA 1M1NB 5C7OO 4Q19A 1RQNA 4K9RA 4ZK2A 2IH4A 3DLIA 1DARA 1P61B 1E58A 2IZ6A 4Y8VA 1KGDA 4J0DA 4ESOA 2CL5A 3QWHA 1JNXX 2OHGA 3U9LA 1T5TA 5U9CA 2CGEA 1V3UA 3R3HA 1R4MA 2PRIA 5AI9A 3Q1LA 5KYXB 3X1KA 6REQA 4TL6A 3OTOB 4HH0A 1CEEA 5EZSA 4DV3B 2NTNA 1M6NA 1EHIA 1Y63A 2R1TB 1IUKA 3AH8A 1F48A 3ASVA 1R12A 4QDOA 2KPOA 4ND6A 1OX4B 1S3IA 2OENG 3TQRA 1EJBA 1DPGA 4JK3A 2JAWA 5CRIA 4YV2A 2WABA 3GDFA 1L8LA 1PD1A 3OT5A 3F98A 3PC7A 3Q5EA 4GMHA 1WETA 3PQCA 1G7TA 3HCCA 1TJ3A 5EY5B 3TGWA 4CQMA 2AG0A 4Z53A 3RVKA 3ZQKA 4IKEA 5K05A 1Y3CE 2YICA 1I2MA 5HILA 4QNNA 4R8MA 3R6TA 4X00A 1X8KA 2YWFA 3JRXA 4WZBA 1ZD5A 2V65A 3CVUA 2OGUA 4JIGA 1YL5A 1OAKA 1N0HA 1N8KA 1BVUA 2GXSA 2HBYA 1RTKA 4Z86A 4I9UA 1KR5A 1O8BA 2R8EA 3OH8A 4Q03A 1BOFA 3T6KA 2PGOA 1R15A 3AY6A 2Q8NA 3TD2A 3A6JA 3IILA 4OM7A 2XD9A 1X1EA 4LOHA 3CPSA 2J33A 1Z7BA 2PKXA 2RIPA 2ZJFA 3PRHA 3ZU5A 4HB3A 4TN1A 3F9IA 4JSTA 2C3OA 2AXEA 3LKVA 3KQWA 3PLNA 4EKNB 1DG3A 1HYGA 4UNSA 4UTXA 2RG7A 3U16A 1KOLA 5HKBA 5EJFA 2C94A 2F9LA 4JN6B 1Q0PA 3UAGA 1BWQA 1XWIA 3WRXA 3HCAA 5CG1A 4MWSA 2VTEA 3H0CA 4INOA 1ZR2A 4P7GA 5HRCA 2QD5A 1QH8A 1YDEA 1FP6A 3RV4A 5LQKA 2EC5A 4ZZIA 1BA2A 1KAQA 2DY1A 2IVZA 4MW7A 1OSNA 5E4YA 1GLGA 2DZDA 1P19A 3IMGA 1L7BA 4XM2A 4WLVA 3FLAA 4ARUA 1QZTA 1X15A 4FE3A 2WAAA 2JJ2D 4V0RA 3SBDA 1DBWA 4BO6A 7ABPA 4WESA 1LJUA 1NNSA 4HLUA 2FPLA 2KYRA 3BXGA 5EAIA 1BU8A 1H1LB 2AEMA 4MPDA 4RF2A 2VJCA 3EMBA 2RJ3A 2WJWA 4LAFA 3VU3A 4JUAA 4YREA 4D9CA 2Z8YA 1P1KA 1X8LA 3BD7A 4JGBA 4PLGA 1P0MA 1R6UA 4YAJA 4LZWA 4UUAA 3BWMA 4W5WA 5DJ5A 3SJAA 4CVNA 4NXNB 4MAFA 3TL2A 3A1DA 1V96A 4B6JA 1SUAA 1PQ4A 1YUMA 4FUQA 3VVCA 1CKEA 2H4HA 3M1YA 4YP0A 5IJ9A 1D4ZA 1BE8A 2D5LA 2HCTA 5C8YA 4JLOA 4U6SA 2J31A 2CF5A 2EFDB 3TGPA 2GF0A 3ENNA 3SEAA 5TSDA 2HMTA 4MRVA 1TECE 2YXLA 1TYZA 3PGLA 4MW4A 2B5OA 4Q9IA 3ZHOA 3D4LA 4BLWA 1YZGA 2G1JA 2ZBRA 1A7JA 1AUPA 2ZS8A 4BVFA 5JCPA 4LFBB 3KL2A 4GQBA 1ZNZA 1Z6GA 1N77A 5J5VA 1QS0B 3IIKA 3M6MD 1EQUA 3BCHA 4QJBA 4Q9AA 1FMTA 1N2CE 4OFBA 3FGOA 2R84A 4XR9A 3X1MA 2PD3A 1PFKA 1GR0A 5FTJA 5ALZA 1GLVA 4Q4HB 4RVFA 1A71A 1BXRA 1V1MA 4ZQGA 4IQGA 2DGDA 1WDLA 1CZOA 3HKDA 4IJMA 1NF2A 5ECGC 1JIUA 3WNVA 4MCHA 1T3SA 2XCQA 2X6RA 4A91A 1WUJS 5J4HA 5JYCA 5FTMA 4BX2A 1RLTA 3Q85A 2J3LA 1RWWA 3EBLA 4YUAA 3DE7X 5DYGA 1MB3A 5LOVF 2VYNA 3K6JA 4QARA 1KYVA 1D9ZA 3WFJA 1QYXA 1XCGB 3BXHA 4NATA 1YQWA 1H0RA 1ZVJA 2FPUA 1RBYA 3IAUA 1C0KA 1ZCZA 2IYXA 2OZLB 1FTGA 2P9ZA 1WIWA 3OPYA 3H5NA 4M1EA 1TMOA 2ZPAA 4HJRA 3TXYA 2O8CB 1ISRA 1DFHA 1BDMA 1JILA 3O90A 4ZT6A 3LE8A 3A4IA 1WTAA 2C1XA 2LKCA 3LY8A 2YC4C 1U5AA 5CVJA 1YZHA 1TD1A 3C8HA 1R0YA 3KWFA 5HJ7A 2C7RA 3EPHA 4URFA 1RXIA 5H02A 1SCUA 5GZ6A 3T7SA 4A6PA 5BWMA 2GRUA 1E0KA 1E7MA 3O3CA 1R0KA 2ZIZA 3MJRA 5HHTA 2MDTA 3ENKA 3E8XA 3T7RA 5SZJA 3C1AA 2BFNA 3EAQA 2BY4A 4EHNA 4B3BA 1QH1A 3R4CA 4GR4A 3V8MA 1U3GA 3MBKA 4M49A 2RMKA 3NORA 1CZNA 2VXBA 1SCBA 3RT1A 1C2YA 4HSEA 3QPBA 4KAFA 2XB2A 3DLCA 4D98A 3R0XA 1BXZA 4FGZA 5DLEA 4ENUA 4X6YA 1LY1A 3D2CA 4Q7EA 1II9A 3ADBA 2F8SA 3X0DA 3BZUA 4MKHA 3BK7A 1L4UA 521PA 4OH7A 5CYPA 2ZRLA 1F1JA 4LYDA 1XDGA 3PYLA 3SVLA 4GSLA 1RHMA 3IOMA 1YTLA 1GFIA 1UBJS 3V2HA 3ZWVA 2GFHA 2NUBA 1XQ9A 4R2IA 3PNBA 1TUGA 2QTBA 3H4IA 3JYQA 2BEVB 4L73A 4EX7A 1E0AA 2V5AA 5LXTA 1DMRA 4Q4LA 4FOLA 1GKLA 2K87A 5GIOE 3INGA 4XSGA 1N9KA 5D87A 4F38A 2ZYRA 1Y5RA 1PT5A 4KODA 5IAKA 1HRKA 1YOVA 3Q7PA 3WKEA 4JVOA 1QTNA 4E6EA 1N7IA 2YZGA 1KZYC 4IDCA 3TVYA 2VNHA 1DOZA 1LBTA 3D7LA 4D02A 5ADVA 2UZ4A 1OH7A 1RAEA 2G5PA 2YXBA 2WHXA 5A0VA 3NRCA 2F00A 2VP2A 1GUAA 5JSUA 4L4YA 3FYSA 1ODTC 4UXIA 2WHRA 4RPKA 1ZA2A 5TJ9A 4JQYA 3VOAA 4EI8A 3DMRA 3KQUA 1CERA 5EIEA 3JQGA 1S96A 2I6TA 4JJGA 4HDSB 4NY1A 3TS1A 3EXG1 1J39A 3PJFA 3I0MA 3ML1A 2II6A 1CS4C 5TEVA 2RC6A 3AR7A 2HRQA 1N3IA 4M1WA 4B87A 4M88A 4EX6A 1QJCA 3RVBA 5NLLA 4BVBA 1KZGB 1P2DA 2BHTA 2WVHA 4A2CA 4PXSA 1BJRE 4Z7OB 4GWLA 5M29A 5C34B 3AT1A 4EUEA 2GN4A 3GG9A 5JVDB 4PSVA 5I9TA 3T4XA 3W90A 1UMKA 4HO1X 3R3ZA 4D8WA 1Q17A 4CEJA 1NI5A 4BRZA 4PLCA 1YB6A 1ZU4A 4L8GA 1PIWA 3EXHC 1T5LA 5C3MA 5JYEA 2WG0A 4IXNA 3BERA 4RX1A 3TM5A 2GNOA 5AHKA 5E7IA 3HMQA 5DHSA 2JA1A 3OTGA 2I6QA 4Y98A 2W2QA 2B1RA 2NSHA 3VVBA 1Y1QA 1B42A 1JLRA 1RLIA 4II3A 1TM7E 3PR3A 4I66A 3WMEA 4AO8A 621PA 5CDSA 1W36D 4P5EA 4PNEA 2RHGB 4MW9A 5GONA 4TMZA 2NUTB 3S55A 5KPJA 1KYZA 3O9MA 2WVAA 3FAZA 3W9UA 1N1GA 3ZWKA 5K4HA 2P6UA 4ZMBA 3CRMA 2XW6A 3U4GA 1R0LA 2IQ5A 3KTFA 3RDPA 4G37A 2R11A 1YBHA 4PLYA 3C70A 2C82A 4C4TA 3RM3A 4XYGA 3R44A 3IMCA 4BMYA 3EZNA 1MMFB 4O5AA 3E9RA 5GQSA 3H1PA 5LN1A 3FYDA 2Q2WA 5HQ3A 3U44B 2IPNA 3S8YA 1HDGO 2HO4A 4TMTA 4Q93A 4B3JA 4G1CA 5CFLA 4YLGA 2H0RA 3NM5A 4W6QA 3TJMA 4Q02A 1SUCA 1LWOA 2VHCA 3W05A 1NUTA 5D3MA 3VR6D 4MMZB 3MFQA 1NXWA 4LC1A 3G9ZA 3F3KA 2WHPA 3WBKA 1E6EA 3HO1A 2EU8A 4F3NA 4NCBA 3PITA 4MMXB 1DIRA 4CL8A 1IATA 2B4RO 2YCLA 3W9BA 2NX2A 2HNBA 1OMOA 1PSWA 2FPPA 1IRIA 1T1IA 3AOGA 1A5AB 2JI6A 4X0EA 1T35A 1JR3E 2C2XA 4YJ2A 3G0DA 4E94A 5K6AA 1M6WA 3DDHA 2J48A 1NXPA 1E5TA 2CLCX 1E9VA 1PV2A 3LFTA 3WIUA 4NCJA 1JLSA 5F5NA 3SWWA 2XGSA 1K8YB 1R5BA 1UJBA 3NHPA 2W98A 3DOHA 1GLNA 4FEAA 4K6HA 4L27A 4TXNA 5AI4A 6LDHA 2IXAA 4LKOA 1FQWA 1CTQA 3WLRA 1MIHA 1IZ7A 1QLJA 1ZJ4A 3GJ0A 4IINA 4MLPA 2A0WA 1GUFA 2A30A 2QTHA 2NO4A 5FKJA 2JCVA 3RH0A 2O50A 1U1IA 5IG2A 2X0DA 3WL6A 5AQ1A 5KDOA 2YV2A 2PMDA 4FKMA 4MS3B 4IIBA 4YCSA 1QANA 3L7YA 4DEVA 2OM6A 1WZCA 2O2DA 4DDTA 3RRJA 3DC2A 1IZZA 2FFHA 3EHDA 5FL3A 3NYIA 4O4HA 1Z39A 2EXXA 3FZNA 3QEKA 4HRAA 4GVPA 4XSHA 3SZUA 5A4DA 3CISA 3JYPA 1AKQA 4ZAYA 1UXHA 3HBFA 5C81A 3RS2A 3MQ2A 4NEGA 4R9UC 5LZ8A 4U3JA 3DEYX 3W77A 3DBLB 3P4UA 1NJFA 4RK0A 4WOCA 3B1FA 3TOCA 4RTSA 4D4GA 1KK2A 4YH1A 2H9YA 1Z28A 1WCWA 2D0IA 4ZYTA 1S6YA 4JQSA 2B6HA 1QTQA 1NN5A 5BVHB 3KXDA 1O1YA 1L4HA 2PAFA 3U7FB 4MW2A 2ZRQA 3FMVA 4KWCA 4GR9A 4RK7A 3EIUA 2A9VA 1DBSA 4O0MA 3SKYA 2ARKA 2R1ZA 4F71A 2CNDA 3JWJA 3PHLA 4RQBA 1BMQA 1LPSA 3K0FA 3WHPA 2ZR0A 2J6IA 4EQZA 4D9FA 1XA3A 2WIJA 4GKVA 4XPIB 5TQ0A 1M2OA 4QZVA 3R77A 5C46F 2AG8A 3SHTA 3PGJA 5HF8A 1B0AA 1OBFO 1Z5NA 2GD2A 3QVTA 3EXEB 4KRYA 1CWUA 2KBFA 3O2QB 4QTZA 4XD7D 3ZLVA 3D6VA 3CZ5A 4X44A 5G2OA 4LCJA 1TKBA 3A0UA 5BSUA 1Z6ZA 4DIFA 5IVPA 5DXFA 2X1VA 4Z4CA 3DF9A 2O20A 1AMOA 5B1IA 1UT5A 3LT4A 1EDOA 3MIIA 4B3FX 4KQWA 4BFVA 5BNWA 1M67A 1SU4A 2G0TA 3RTDA 3EGIA 1XRSB 3A9TA 4HDRB 1Y7LA 2R5WA 3L82B 4O4IA 4UCQA 5LBIA 3PX2A 3W04A 3C97A 4PW0A 1G2IA 1P1CA 2V4ZA 4TQ9A 3P19A 1C7FA 1T2AA 3F5QA 1FQOA 4KWIA 3BEOA 3DGEC 2DFTA 4P53A 1GTL1 4YHHB 1U0FA 3A4VA 2Z1DA 4JYCA 5L3QA 1UK8A 3E82A 3DAPA 3L6DA 2B7LA 5IP5A 3D7MA 2QZZA 4WKPA 1SXJE 3VAZA 4RABA 2E5LB 5L3ZA 2WU0A 1VHQA 2CBZA 1RXCA 3UCFA 3DNMA 4J0FA 4NX2A 2CUZA 2JK0A 4H4CA 5J2UB 1HM5A 2EATA 4C03A 1KK1A 1NW7A 4C7VA 4BNJA 2AFRA 3A25A 1DC4A 4GFDA 4JJ8A 3S2YA 3A9VA 4V0LA 5BNZA 1DAIA 4NRDA 1CUGA 4EA7A 4W63A 5MFPA 1Y0BA 3A05A 4EY8A 2XCIA 2Z57A 3BL8A 4LX8A 4X7PA 1LPBB 2AYYA 4E14A 2Z1MA 3WB0A 4TM8A 3J81k 2VT2A 4FDMA 1O0BA 3EARA 3I6ZA 5JXIA 2HJGA 4KQGA 2OV6A 5C4MA 3MS7A 4J07A 3I0NA 3UMFA 2OBLA 1RYFA 1XD2A 5ENVA 3E5NA 3WKDA 1O6CA 2CFRA 1VMEA 4N5MA 3S2GA 1DS6A 4WFQA 2XCSB 1KDZA 1A50B 4W6ZA 3QZUA 3VDQA 4EHBA 5B3LA 1RMTA 2I54A 1JXOA 5B3AA 4UBOA 1D1SA 1EM8A 5CPBA 3U13A 4ZEWA 3MJTA 2IHTA 3LLVA 1TZBA 4BLQA 4EQ6B 1KF0A 3QF4B 1COWD 5LZ7A 5IYZB 3RHTA 3SLRA 2QL6A 3GGSA 2IPXA 4H7JA 1LF0A 1EFRA 2VVTA 3ULKA 1HLGA 3P4YA 3C8MA 3G59A 4WXRA 4B3IA 3EMVA 3JZDA 1K7EB 2XADA 1E79D 3TIVA 1NL3A 2CVFA 1O89A 1PT6A 1MP0A 2E5FA 3BA6A 1EBBA 1YGYA 3FSGA 3CSUA 3LUGA 2OAEA 3JSXA 5L6MB 3IELA 1OI2A 1OKKD 4NP6A 2G7MC 3UPTA 2IH5A 4QPZA 1JEAA 3SD7A 4L02A 4BQOA 1Y7IA 4HFMA 3IPYA 1QP7A 1N5MA 1Z4OA 1JEQB 3AF0A 2H52A 3CH7A 4IIVA 4MR9B 5AJXA 3F9RA 3CH6A 1SPXA 3T94A 4QBIA 2IYFA 5KQLA 1HGXA 1WBBA 4WVFA 3ZEAA 1OIXA 2QX6A 1R10A 2WIKA 3A6LA 4INAA 4PG7A 5EWMA 2B21A 3VUEA 1U8AA 2RCYA 3R9XB 1E7WA 3C7CB 3KOUA 1JBEA 4I9FA 1TUBB 1IRXA 5IARA 3ILHA 1AIPA 2GYUA 4V0NA 3IERA 1QR6A 1WCIA 3A9CA 5F3DA 3D7RA 3SC4A 3O21A 1UBEA 2KB0A 4PO3X 4U7PB 1UBCA 2OPBA 2NSJA 1Y9EA 2RB4A 1M1ZA 4MH0R 3LXXA 1A9RA 1YMUA 1FUUA 2V7PA 3EQ9A 3JQEA 4J9UE 4K6KA 2WFZA 4OKSA 2JJQA 1UF9A 5U4QA 3FPHA 1BKYA 5HTOA 3TFOA 1Q1ZA 3OT4A 1P7PA 1I32A 2V7QA 5J2TF 3T5GA 2D1YA 3PVCA 3FKSA 2LCIA 2GOYA 3N2KB 3DHWC 3PGXA 5DCYA 2NU8A 3V8QA 1Y6GA 2WD7B 2F7SA 1KI7A 2YNMA 2RHOA 3FDZA 3QE0A 2WTBA 4OBWA 3TEJA 4GXRA 4LRUA 1SIWA 1MCZA 5IDXA 3ET4A 4GZ3A 5C4IA 4C4SA 3PFKA 4N12A 2O7NA 4HPXB 1A8QA 1K8ZB 1OAAA 1U8TA 4B74A 3OQOA 2O19A 1F06A 2C2ZA 4NXMB 2Y77A 3SR0A 1ANKA 3I9LA 4C4AA 3R24A 4HVLA 2X0KA 3LHKA 3IT0A 2XQIA 1ZM4A 4HFNA 5B3KA 1AQNA 2VJOA 2UXBB 2SNIE 2CSXA 3NZEA 4NAVA 1N2ZA 3EWAA 3KHKA 1RFGE 3ZQ4A 3OEHA 4AUMA 3VUFA 5DV9A 2F1JA 4XB6B 3RSHA 2OOSA 3TG2A 2QA5A 4WY5A 1FRQA 1U7WA 3JASA 3ZDEA 4AJ4A 4PYRA 1CJSA 1EFHA 1FXWF 1Z4NA 2K4MA 3QFHA 4BIIA 3ZLJA 2H1RA 2BJVA 2VQ3A 4LDNA 1UWVA 3CMCO 1BE0A 4QTXA 1Y4ZA 2WTNA 4UQPA 4PZCA 3TNLA 4PPYA 4TS1A 4ZYZA 3OFND 2YHIA 3G2QA 4EO9A 1RLUA 2NYUA 3MUNA 1XMXA 1UBFA 3T5AA 3ZDXB 4AQDA 5IJAA 1O4VA 3AUUA 3GDWA 3H42B 4MGZR 4PAWA 4RH3A 5TT0A 3P9CA 1GCUA 4A5SA 3DNPA 3TVDA 5CG2A 1NBIA 3H9BA 4BASA 1PSDA 3I2GA 3PYXA 4DPKA 4CM4B 1PK9A 4J1TC 4IOJA 4ML3A 3R8FA 2ZW9A 3GJXC 1ZD2P 3WIDA 5FWYB 4KMOA 4QDKA 3CGWA 1K5HA 2RGWA 3L3BA 1LCIA 2Y05A 4DHEA 1CIJA 3V3TA 5A9SB 1B8UA 1R6AA 4E5VA 1HNXB 2D7JA 2BYTA 1YU9A 1ZI9A 1IULA 3ONFA 4OREX 2OC9A 4HMPA 2WIFA 2IV2X 1PYDA 2CSUA 3HWX1 3Q6NA 5KNLA 2F6RA 4KNVA 2Q7XA 2Y4OA 3RYCB 2QTCA 2F1KA 2HLDD 3HCBA 3BA1A 4BE7B 3PCRB 1WXGA 2OZVA 2VO1A 1E6CA 4H6WA 4RMIA 2AHOA 2CLLB 3M89A 3VNAA 3AQ4A 3VM6A 5K0CA 3DKKA 2ZIFA 5JRDS 3RVDA 4CN8A 2QW8A 4LFAB 1D0VA 2I2XB 4NAHA 4O4LB 4CG3A 3ZE6A 1SUWA 4KLAA 1ZA1A 5BT8A 3ROTA 3BX1A 1RZVA 3G5MA 3H2ZA 2PLNA 3NAGA 3OD5A 4G1VA 3U09A 2ZI3A 2Y2UA 4ENPA 3GA0A 4ZDKA 4BVGA 1AB6A 2RAVA 3Q0EA 5LYJF 2ZXUA 4UU7A 4UHDA 1NRIA 2LPMA 4O0LA 4XXHA 3FM9A 5H9VA 5TC4A 1OT5A 5SZKB 3H2BA 3R5HA 2F8MA 1ZK2A 4L9WA 2GLUA 2EFHB 1TUIA 4I4NA 4UM9B 3ZD6A 1UZNA 3V8NA 2WM8A 1ODSA 2QW1A 4PC3A 5EVJA 4A6XA 1H94A 3AXSA 2NP7A 2CW5A 3A4MA 3RC9A 4D74A 3UV6A 5ALLA 3Q3GE 3T9CA 1MUUA 1ZQ1A 2W8BA 1N2CB 2A1UB 2AS0A 2GPYA 4UJ5A 1JXAA 4Y2SA 3T9BA 3UHFA 5IAOA 1VMIA 5FPYA 3PEWA 2NG1A 1Q3KA 2Y1GA 4DJAA 4JVMA 3K35A 4Y30A 2VL7A 4EPWA 2ZUEA 4RFLA 2DP4E 3CNQS 4IZHA 5JEEA 4Z9FA 5FAXA 1RI3A 2IEBA 4IDPA 2PK3A 1WVMA 1HY3A 3QKSB 1WDWB 2ZU0C 3BHIA 4TTQA 3S1AB 4EEZA 4HVCA 3DFKA 4XGKA 4JEHA 1Q1GA 4N9QA 5LQAA 5F1OA 5FLXA 4WK4B 5AW8A 5CFRA 4CHTA 2UZ3A 4IHJB 4Q9NA 5IBRA 2FKNA 1F2DA 3HJBA 5E6SA 1QIJA 1T6YA 1I3OA 4Z4QA 1QWOA 1XDZA 4QE3A 2HDOA 1JQBA 1IVNA 4Q6WA 2QHXA 2PS1A 3Q1KA 1GZ5A 1QYDA 3CZMA 4PY2A 2VBIA 1RI4A 4M0CA 3OJWA 2C1ZA 4RS3A 4TKVA 1D7AA 1XCLA 3GB9A 1CUAA 3ZW9A 5KNBH 4KNYA 4AT1A 3WQQA 3AQIA 2IYWA 4KO2S 5D6OA 2YC2C 1UMBB 4US2R 5AD1A 1P7ZA 2OLKA 1C0EA 3KLBA 2DKOA 1EUCB 1YULA 3PT5A 1ZH8A 3ESCA 1R6TA 1K08A 2SKEA 1SOWA 1DKRA 2V0CA 4N0DA 3TSZA 1A9TA 1FJXA 2HX1A 1I4TD 2YV5A 4FEEA 4NSNA 4O2AF 3A2NA 4RH0A 5THXA 3CLRD 5HUQA 4EBBA 5AHWA 1W25A 1QFJA 3VVMA 1NUQA 1RNLA 2Y1LA 4BXOB 3RASA 1T5SA 2JFVA 2VNJA 1NE7A 4FYMA 1R74A 3UCXA 2VOJA 4LYHA 4COOA 4M60A 2BI7A 3LL7A 4M1YA 3W1VA 2RK4A 1Q6ZA 1R0CA 3D8UA 4E5UA 2Z6AA 2M2IA 4RYLA 2I9KA 1HTTA 1PQWA 1UFKA 2ERXA 2JFOA 3CUSA 3NALA 2G1PA 4E1AA 2CYBA 4D46A 4TLCA 2AE2A 2E3JA 3AJDA 3V8BA 4NDNE 4D42A 1ISIA 1U1FA 4FDLA 2C2HA 2F3QA 4NAUA 2CHGA 4DV4B 2G6TA 5BW6B 3Q72A 2Z5VA 3N8KA 1DTEA 2AJCA 2JEYA 3EIOA 4O2BA 4RU1A 3NVKI 4YMTA 1VMKA 1P0FA 1Z2AA 3SLKA 3IKTA 4E46A 1TM4E 1OLXB 1WCXA 1LJ8A 4EEXA 5JNVA 1ZGZA 1TVKB 4G4SP 2F3UA 4G1FA 3JZIA 3Q3HA 4TPKA 4S2UA 1FU7A 2X0RA 1XNRB 3HADA 4RANA 2X58A 4JC5A 3MS4A 3WA6A 3AY7A 3U4CA 2R6GA 1NU6A 1E3JA 1P9OA 4LC0A 3V6MA 5UKDA 3KUUA 1DWUA 1X42A 4G2NA 1JQAA 3EF3A 3GJ7A 3LUKA 1AX9A 3HXQA 2ZZMA 1VCOA 4HFJA 2IYRA 2J3QA 4PGAA 1MRSA 1W30A 4XUCA 1PF7E 3D6UA 1ZOSA 3BICA 4LF9B 5IK2D 2G1UA 2ZUFA 4MW5A 1XK6A 1G291 3EW7A 4S04A 3QVKA 3EQ8A 1NQAO 3U5ZB 1I7SB 3ITKA 5F64A 4PRKA 5HJ5A 4MB2A 3X3HA 7AT1A 4YK7A 2OQVA 2WE7A 5CFOA 4F85A 4O4JA 4NCIA 2R79A 3OIWA 3JCZA 3Q11A 4JQOA 3VGJA 1U6IA 1F0KA 5BOSA 2XH8A 1T8YA 3AM4A 4B79A 4H7EA 3DZBA 2PZ8A 4GLLA 1KR2A 2BELA 1I0ZA 3IJEB 1EUZA 4LWQA 2V6GA 1FNNA 2MSNA 3V2GA 2H07A 5I8WA 1RSZA 4Z1MA 2FP4B 4D4HA 4ZI7B 2BTQA 1QZXA 1AA9A 2AV6A 3UEOA 3ZNPA 1PNVA 3F2IA 4F56A 2OV8A 3UIEA 1H0SA 3B6KA 3RF6A 5H3LA 3VPFA 4AUKA 5HP4A 1HYHA 4WA8A 2JFPA 2NIPA 1Y7TA 4G3XA 2EVWX 5C52B 2V5VA 3GFPA 4AJ1A 5LU9A 4OJKA 3OLZA 3I09A 3QI2A 3D3QA 5EHXA 2AFIA 2CD7A 1YU6A 3N70A 4WEOA 2AC7A 1T0JB 2R97A 2PFKA 4HDKA 3K9FC 3KB8A 2C5BA 4YRZA 1X1DA 1TTTA 3LF1A 3NNNA 4I46A 4PNHA 4JT4A 5FHQA 3WLQA 4MKGA 3W5SA 1EDDA 3LLMA 1Y33E 3O2NA 3PPYA 2OPHA 3C1OA 1JYEA 3PDCA 1E1RA 3AEUA 1ZW1A 3I58A 2OE2A 4CKCB 4HD8A 1OU0A 1XF9A 2OFWA 3NVMB 4MUAA 5I3ZA 3M9XA 4ROTA 2C54A 2VDWA 4B3GA 2CUNA 1VGQA 1E2NA 1CRWG 1TFUA 1TO6A 5DE3A 1YKFA 1SKAA 1VJTA 1ZESA 1XZ8A 2QAJA 3JQAA 3NPAA 3EZ6A 4Y7CA 1HDOA 2WAMA 2BEUB 2R6R1 4AYXA 3BL5A 3WI7A 3KQVA 4ALKA 1U04A 5HR5A 5IAGA 2KM1A 3UAOA 2UUCB 1YR8A 4GBMA 2JZOA 4B35A 3EDOA 4OVKA 5ALEA 1E3LA 3QXSA 4R7TA 2VG8A 3C16C 1OV4A 1QIEA 1ZL2A 2X9NA 4MPRA 1RRKA 4E2FA 1USGA 5KVAA 2UZ0A 3HZRA 5JJIA 3MTEA 1HH4A 4D2IA 2HIGA 1RWPA 1YR7A 1H8HD 1NXTA 3OHSX 3VSBA 3QTLA 2AMJA 4JLKA 1DJOA 1P1JA 2VF5X 1S2NA 3DM5A 3HBJA 3M6WA 4HGNA 5CJ2A 3GLGA 2R8OA 2NPOA 2I3BA 3O91A 3BH6A 3TTYA 3RS0A 2FSIA 2DAPA 1OBHA 1RI5A 2HA4A 2PX4A 3CR3C 5A4JA 5C1IA 2AX3A 2W0MA 3A1SA 3AX6A 3DEJA 3KQTA 2QS9A 2RH4A 3K09A 4G0QA 1T25A 1THZA 4Q05A 4WOPA 5CJJA 5FLYA 3SAJA 2OO5A 1MEOA 4XVUA 1EGQA 2L69A 1QG6A 3EA4A 4UAJA 1N4AA 10MHA 4R2HA 2YFKA 1QHFA 4LVOA 1GXSB 4MQLA 4OMUA 2CXUA 3UB2A 4DR5B 4XIFA 2Q8PA 9LDTA 4YT8A 3SMVA 1TZMA 2QYHA 4AVYA 1I5OA 4AECA 1P9RA 2NXJA 3EPKA 1JALA 1N1DA 3ER8A 4CKBA 1FLNA 4BX8A 3QUQA 3O4RA 2E4WA 4MQBA 4QEKA 2C84A 2QT1A 4IL5A 4L74A 4BMSA 3PRJA 1XJCA 2BSQA 4ACAA 4KR6A 3IA2A 3KLOA 4L6CA 4RD4A 4YQEA 1SVWA 1E4EB 5LD2C 4TV9F 5B7QA 1J99A 2BUCA 1V11A 1IC6A 1NN3A 4RNDB 3TB6A 5JC1A 1L6IA 3ORQA 3LY5A 4TKUB 2E4AA 2ODAA 3PXBA 2JRCA 5ALPA 4Z9YA 1PX0A 4WN3A 4ZO7A 3W2HA 1RXUA 4QVIA 4M1SA 5LP6C 2HT1A 2C8KA 4BNDA 2P91A 2OO7A 5IF3A 4HAUA 2PXCA 3KDPA 1WP4A 4V3CA 2JFUA 4OJQA 2W6ID 1F6WA 1W581 2CVZA 2F4NA 4BO2A 1RC1A 1WBDA 3ONNA 3G82C 4JMLA 1OXTA 1QAQA 1Z4PX 2AMFA 3B1JA 3QWIA 4FFNA 4NDZA 3ZY2A 4XWKA 5KJ1A 5IJXA 2R60A 3HV2A 3TW6A 4G5SA 4XX0A 2Z2YA 4RE6A 3UK0A 3O6VA 2ZAGA 1G8YA 4JH0A 1EUQA 5LQSA 2PUTA 5DM4A 1B73A 3PE6A 4GKAA 5EWJB 4ER0A 4DR1B 1X7YB 1Y3DE 3GEPA 1URPA 3H1BA 4D8XA 4KPEC 2XRZA 1SXJD 1N2GA 1VJ0A 3QXGA 2RJOA 4JC4A 1K5GA 5AKEA 2VHZA 3I9NA 4UAUA 1J0EA 4ZANA 1RE1A 2D5BA 3HUFA 5GOTA 5LZ4A 1JGTA 4FXPA 3OIYA 3SKVA 4FFWA 4I1SA 3UA4A 3OUZA 3DOOA 1GPLA 4X45A 2JLYA 1TL7C 3I01A 4MV5A 2GCOA 4ZOEA 5K3AA 5KDLA 3L5KA 2F43B 4G5OA 3AR6A 1TW2A 2GSDA 5IJWA 4ARSA 3I6IA 4GPEA 4AZ0B 3DSRA 4IIJA 4KN9S 1R1DA 4KXWA 4PPQA 3EFOA 3T4UA 1F7VA 1R8XA 3HP1A 4IGFA 4PYJA 1SZPA 3H2IA 4F1JA 2XGOA 1U8ZA 3CUEF 5D5PA 2EW2A 3KKLA 1OTHA 3ETEA 2Q6LA 3TINA 1PVOA 2V1UA 5KX5B 1SXJB 4MWOA 2WWYA 4PTLA 2DB3A 2PNFA 3HQ4O 3K0EA 4GECA 3R5SA 4RVNA 3L0PA 4MI1A 3DPIA 1TKRA 5BW4A 1C1XB 3NATA 4PX3A 2BZ0A 3DG9A 4MIYA 1TFRA 3B52X 2I4OA 4UOQA 5DT9A 3T8YA 3COSA 3T15A 3W2GA 3ZLTA 5JMPA 2ALJA 1C7IA 5LOVB 5G0TA 1E8MA 4Y67A 4CTJA 1L5VA 4DREA 1L4GA 1N5RA 3BRWA 1CU1A 1JYSA 1QE3A 2F9MA 4FONA 4GP6A 4LMPA 3UH1A 3ZZTA 3ZK8A 5K0BA 3EX7C 2G3YA 1JG4A 3GRFA 2B0CA 5L4NA 3GLKA 5E9AA 2PYIA 1JR4A 3ROXA 2D2FA 4ZAXA 3X43A 2IYEA 1XLWA 4G0WA 2AG5A 1CS0B 1R5NA 3TM4A 1S4QA 2BCEA 1KKLA 4X1OA 1QIGA 4L6AA 5HF9A 4UTOA 2QWXA 3ETLA 4LSGA 5CNMA 4C6SA 4KKXB 3OIFA 3ER9A 1FNBA 4FN5A 4DV6B 2M1ZA 2EKDA 2JAQA 4JU9A 4CM1A 5KSOA 3T06B 1L8QA 4Z4IA 2HOQA 2Q6VA 4OL9A 4QPPA 2AJLI 3LUJA 3QHAA 2J5BA 3HKEB 3PUJA 3QKRA 4J1NA 3A1CA 4I3HA 1Z33A 5ABPA 4HN9A 1DIBA 1PEYA 1YASA 3HJGA 1R6BX 1S7GA 3WP1B 1U4OA 3G5TA 4YJ3A 1BXGB 3FSJX 4KN5A 1NVAA 1E3QA 3K1YA 2DQYA 3PE3A 4XKJA 2VUHB 2D1FA 1QF6A 1BWPA 4L0CA 3B1KA 2XOXA 2FR0A 2PBZA 2X8LA 3R5JA 5A05A 4BMCA 1Q91A 4BNLA 2ZRPA 4U2BA 1ZCJA 2PFGA 2P9CA 3GP5A 3OLYA 2O8BA 2PJZA 3UUFA 1DP4A 1G4UR 1SUDA 3FLBA 4GZ5A 1Q15A 3V4LA 4PBSA 2FDRA 2IZZA 3HR8A 4G5XA 1BCSB 3OCXA 5DIFA 2C9MA 3E9CA 2IRWA 5BXQC 2BF4A 1MABB 1Y34E 2PXXA 1QB8A 1W73A 3GEEA 4Q01A 3UT5A 4LJRA 1WXQA 3IXQA 1N7GA 4OQDA 5EE1A 1N7JA 2QZSA 2ATVA 3H9QA 4A8JB 4G5FA 1K6XA 2I91A 1L5WA 4O6VA 3L8FA 2Q6IA 3MERA 3ZU2A 5B4UA 2H29A 2V7GA 5K5EA 4NCAA 2VJMA 1AXGA 2J7PD 2YVKA 4KR9A 4ICIA 3A4LA 3QY9A 4CCAA 4QODA 4JJZA 2VCYA 3O3MB 4PFSA 5HIJA 2ERYA 1GGNA 4YAOA 4BMNA 1MZPA 2LVBA 1AUVA 2YS6A 3NEYA 1XDSA 2P6OA 3P71T 4OI4A 5CVVA 3N87A 4TXMA 4H3SA 4RD2A 1KEWA 2JFYA 3ZD7A 1AKVA 2JLCA 5FAKA 1CVLA 4OQFA 4JC8A 1XUOA 2FJ0A 4ZOCA 4BMPB 3HKBA 3EQZA 3HDGA 4IDFA 1V6AA 4P4GA 4F6LA 4UBKA 4COKA 2EYUA 4PVDA 5H5JA 4EHJA 3I83A 1FDTA 4RE5A 4EB0A 1AM4D 4XIYA 3CJQA 5D6NA 3DWFA 2XY4A 4J1QA 4AUEA 2WKWA 3GL9A 2CVPA 3PQ5A 1MO3A 1DIGA 1ZMBA 2M9MA 3Q8MA 1W46A 3ND8A 3SJUA 5AUNB 3WGTA 3OG9A 1ZYUA 1KDTA 1US8B 1F9EA 1V3QE 4KK3A 3SQMA 4AAYA 2ZVPX 5HFJA 3REFA 4LK2A 1II8B 2JS7A 4RTQA 3RCBA 1N2IA 3M6IA 4PXAA 1JIIA 1G3QA 5KNBD 4BPRA 3BJEA 3K8ZA 4UTPA 4DLUA 2H8KA 2OORC 1W0JD 1JQJC 5LYYA 1J4AA 1USWA 1D2RA 2CJPA 5EIBC 4Q7QA 3MWDB 3R23A 1M10A 4EJ0A 2O5CA 3O73A 1TXGA 5EQTA 3UT0A 1ZC4A 3D2LA 3GUHA 3O3OB 1E4VA 2A57A 4OSPA 1GKUB 3SQNA 2DFVA 2E4ZA 3LFUA 4LF8B 1RZUA 1RCFA 4JWKA 4ZCRA 5GADl 2AFHE 1NYQA 2P9QA 3DOEA 3I1JA 1L7RA 1R66A 2WF5A 1JKJB 3GMTA 2MSLA 3LIIA 1FSFA 2J3JA 4FFSA 1CQJB 2PSSA 4ZREA 5F7ZA 1EX6A 3HGTA 1DV2A 4II2A 1VYVA 2WPDD 3K0HA 2C2YA 4FGUA 4O5OA 2X7XA 1LLUA 3WV4A 5BR8B 3IBCA 3M83A 1A9XB 3HXMA 1B6TA 1BX0A 3I1IA 1WXFA 1EWYA 2QRKA 3IEXA 5CH5A 1BQ3A 4J6EA 3V1LA 3GBPA 4ENQA 3DB1A 1TYDE 3ELYA 4U2EA 5B36A 2JAXA 2WB2A 4NV0A 4EBFA 2O1XA 4TTAA 4YIKA 1EK1A 1RZRD 3LSYA 3IKMB 1OI3A 3QPCA 1Z4KA 3HHPA 3VAAA 1GTZA 3CKKA 3ETCA 1KA9H 4JBIA 4BKMA 1PKEA 1N6PA 2H17A 1TAGA 3NAQA 4YO8A 3VDMA 4ENSA 5KJCA 3GN1A 3COJA 1U02A 3CO0S 1KDRA 5K3CA 4JY7A 3WIEA 1P8AA 4Q4JA 4M0DA 2HMWA 1LS6A 5E7QA 3NHYA 5AM1A 4KYTA 3JTMA 3I45A 3KYDA 3EDRA 4UTRA 1IB6A 2HT6A 1ZAKA 3FSEA 3HMKA 2JCBA 4OYYA 1PT7A 2O4CA 1J70A 1UM9B 2IITA 4YCJA 4HNAB 2BGUA 1IWPB 4QC2A 3D5QA 1NUPA 3I4CA 1FK8A 2DUWA 5H81A 4L50A 2ZVQX 1I24A 4W7HA 1C7JA 3V8RA 3NV9A 1K3FA 1ZJ6A 1IOZA 1EJ0A 5H68A 2Q45A 5FPKA 1G16A 2PH3A 1QBGA 2CY0A 1HZZC 2IIQA 1OLUB 5BSEA 3WC4A 4GAEA 3X1DA 1DHTA 3VZCA 1VHLA 4BNFA 4BVAA 5CB4B 1ZJWA 5HW0A 3TJZA 5AFSA 1IQRA 2TSYB 2VAPA 1R64A 3GRUA 3EDCA 4LVUA 4HZUA 4C0XA 4HNUA 1ZWKA 4HDNB 4DBVO 2Z43A 4XX1A 3QMMA 3K0KA 1ECGA 1TYAE 3AP1A 3RI3A 3V7FA 1EP9A 1QHYA 3U81A 4IXTA 2BMEA 3UJ9A 4RKEA 3KQMA 4AJEA 1Z9BA 3L4BA 1QNLA 1Z88A 1JKXA 3TRHA 4GOJA 1CK4A 1EK2A 1F1BA 2Y67A 1X7XB 1VE5A 2N0SA 3CZ9A 2LWIA 3QNWA 3NHLA 2L82A 2PKRA 1ZUNA 1ZI6A 3OKPA 2PGJA 4ZT7A 3OM9A 4XB1A 5EIOA 3A1EA 3H11A 4MJXA 1K68A 3UATA 4QUHA 2W2TA 4B8ZA 5FPQA 3CUWA 1BH2A 2EQ5A 2L17A 3OKFA 5LZ5A 1BQ4A 2JGIA 1H2AS 2LZ0A 3H5TA 3OE4A 1GDDA 2RH5A 2D2IA 2BJWA 3CRVA 4BN4A 4UQOA 3RK1A 2GVDC 2QLLA 4FQ5A 5GJCA 3M3DA 1GU1A 5B55A 1DRKA 1FYXA 3BWYA 2BM8A 4UZFA 4OTZA 2A5JA 1JBQA 1UBKS 2R44A 3QY0A 1QF9A 4MK4A 3SZLA 4Q37A 2CNLA 1EFVB 2WYHA 1L3IA 2EKZA 1P6UA 2PIAA 3PT9A 2RJNA 2WJJA 2LV8A 3HV0A 1W88B 2CLOB 5DXAA 1E7SA 2XWQA 1XN1A 4QNRA 2BFFA 4CEIB 5FWXB 1EVIA 5AI5A 4Y2RA 3BRSA 4EHHA 2ZTVA 2QTRA 4MQEA 5JOQA 3MUEA 2QD3A 1D3AA 2BM0A 2NU7A 3BK1A 3K5IA 4ZO9A 4AN4A 4AWAA 3K8QA 2NSYA 1A97A 2JH8A 4G84A 4XB2A 4K8RB 2EBHX 1C30B 4DIUA 1NXSA 3BE8A 4HF7A 5DNDA 2ZYVX 4BGDA 3KSAC 4F2PA 1PTKA 3F73A 1TM1E 1KI1A 3C6BA 4YRTA 5CA0F 3H2KA 4DXHA 2R6JA 3A9SA 5H4GA 2JFBA 5DNWA 3JQ7B 3BVPA 3DKIA 3MGAA 5C1OA 2K7ZA 1XALA 1ATZA 2PGLA 1M74A 4JBGA 4P7BA 1EE1A 3GLIE 3I5YA 2DPHA 3VTFA 2JZCA 2EX1A 2HA2A 2ZROA 3JARB 4DWVA 3G0IA 3LC1O 5JUWA 1Z13A 1XTTA 3DEAA 1O54A 2VYVA 1PSZA 1JIJA 1ZMOA 4R01A 4QU8A 4P2GA 4P7JA 4P0PB 5HKOA 2A78A 3FYUA 3WLSA 1H2RS 3L1HA 4EG6A 4BGVA 5CNJA 2O5EA 2GZSA 2CT8A 4UMFA 3M8KA 4PNZA 4YRQA 4YVFA 2DTDA 4E51A 1ZM3A 4DCPA 4TMFA 1J24A 5JCJD 2UYYA 1UEXC 2QSZA 3KQLA 3PDUA 1DKUA 2Q7OE 1NBMD 2ZYDA 4TWZA 3ZTTA 1N0VC 3QX8A 3ZLUA 5JV5A 4F2GA 1M2HA 1TEXA 3AUYA 2QLFA 2HU7A 4YP6A 4R0MA 3TLAA 1OXMA 1ZUHA 1PO7A 1GA6A 3CSSA 2YZKA 3GD7A 2D8AA 2X2OA 3HJFA 2R751 4NZMA 1PWXA 1H1DA 3VTKA 1X13A 5E9WA 2NV0A 3INNA 4BKRA 4UCFA 1KL7A 2FF7A 4AI6A 3TZKA 4BTLA 2YBDA 4IDOA 4N03A 4YGYA 2FUCA 2R7LA 3F74A 2WUEA 4A6DA 1EGAA 1EPUA 1X7ZB 2VTVA 4PM4A 2NXNA 5HTKA 4EZEA 3BDAA 3OICA 3FOZA 4MUKA 5FI5A 2C5HA 2Y99A 2DJ5A 1VP3A 2IIVA 3WLJA 3ZIUA 2JATA 4DV7B 1G8MA 6CHYA 4F86A 3GRCA 5J58A 2C2BA 1JEYA 1SMKA 1I6LA 2BEWB 2OB1A 1BE1A 1NBHA 3QBJA 1KDYA 3ZU6A 4A0HA 3H5AA 3UJ7A 4AMGA 1I94B 4MV3A 1JWLA 3PCXA 1JMKC 2GESA 3CO5A 5FUQA 2C0CA 3RYFA 3AHCA 3WGGA 1U94A 2CKMA 4JBYA 3ES9A 2YBEA 5LQRA 4M9XA 4A82A 3FZQA 1PGJA 4KUGA 1TO1E 2A59A 2XMQA 4WCFC 2EBFX 1GPJA 2RGAA 3LUFA 3N86A 1U2PA 2HA7A 2X3YA 3PNSA 2PZKA 1Q7CA 2HF8A 4OJMX 4XSVA 1K6MA 1G21B 1GRRA 2J67A 4OQQA 1L5OA 1B0PA 1EB9A 3S1LA 5CH8A 4AG6A 1RKBA 1EI9A 1T8SA 3B8HA 4K6CA 3MJEA 3BMQA 1JAHA 1EMDA 4L76A 1C3XA 5EXXA 1QTRA 5D3KA 1CEQA 1TGYA 4GC9A 4EG3A 1SVUA 4I2NA 4ZVTA 1FDIA 1P1HA 4C3UA 4D3XA 1V5GA 1Q2XA 2UUPA 4B6GA 4OMDA 4LF7B 1KJNA 3E7XA 2ZWIA 2R6ZA 4JQZA 5M3BA 2A9PA 4YRAA 1OXUA 2QZPA 4IQ0A 2H16A 2QN1A 1WZNA 3S4YA 1M34E 2QL7A 4X91A 2VNKA 2I1WA 2J08A 1DAOA 1E9FA 4Q3OA 4B4UA 5FDFA 1VSTA 1B2RA 3L7BA 4AJ9A 1KFCB 5T57A 1I51A 2GB4A 3NHBA 3AHEA 3AESB 2A0UA 5JJLA 2ATXA 1G20A 2EKBA 2X0JA 1Q50A 4P31A 3SF8B 4EY5A 5CB6A 2IYNA 2OCDA 2IUTA 3FNEA 3A1WA 1FFXA 2IUSA 2J4FA 2RSLA 2IEIA 4PHHA 5CBKA 3WXBA 5LQNA 2B4YA 4OH1A 2FRXA 2WJPA 1GRCA 3MNFA 3I1YA 4Z3DA 4C05A 3FHOA 2YHAA 1P2TA 3EGWA 3CLTD 4IUYA 3VU9B 4CTOA 5JAIA 2CFSA 3I0ZA 1QRTA 5HYVA 2BMFA 3P9RA 4AF7A 4OX9B 3OZFA 1IHOA 4BX3A 2FPRA 1RPZA 1FQKA 4RMHA 3CEAA 1JIVA 2J0VA 5DCWA 5BPHA 4QTYA 4ND5A 5DN6D 3OY2A 1RYEA 2WF7A 3SHVA 3ZBQA 3RADC 3D81A 2H1IA 3DOFA 3SHOA 4KITB 5D3ZA 2PX8A 1J22A 3L1JA 4R1SA 1ECJA 4H9GA 4CV0A 5I4IA 4FEYA 2IP2A 2BFEB 4HNHA 1ML4A 4RKWA 4EG8A 1AKTA 1ADGA 3FPJA 2YHBA 2BCGY 3TQQA 3PG5A 1BCRB 4CM5A 1G5QA 3PKJA 4H6VA 1U3UA 2PWPA 3KAKA 3LBFA 4QBHA 4QOGA 2J46A 3HM2A 5HRAA 4HNQA 3PXGA 1OWLA 3H5LA 4QFBA 4JLNA 5I7FA 1PJQA 2ZZKA 4NMWA 1PJTA 2H11A 3KYCA 1Y8RB 4YDRA 3NDPA 4YWJA 2Q6OA 1OI4A 4GW3A 5C4GB 3PFFA 3CQ9A 2OP0A 2WV9A 4CBVA 1C2TA 2XVXA 5PNTA 2ZB2A 1BMFA 1S5PA 1VG0B 1QK4A 4QGGA 5AK5A 5G3ZA 3PD1A 1PFUA 1ZVQA 2BD0A 4LQ4A 2XB4A 2RKOA 4QDJA 4XEUA 3CF4A 4B1FA 3PF8A 4FHGA 4JYBA 2Q6TA 4XEHA 2G07A 4PWYA 1VDMA 2C83A 3PQFA 4TSRA 2WJVA 2QSJA 5EIAA 5HMMA 4AIIA 3EUFA 3ZEIA 4AZTA 4RQTA 3IP9A 3KJNA 4BN5A 4YMHA 4RVGA 1T1SA 2E2WA 2I2FA 3LPDA 2NV2B 1KBZA 5AQEA 3F2VA 5AW4A 4U9UA 2XF8A 1KMCA 3HL0A 5DPMA 1HLDA 1I2ZA 1YZTA 2P1RA 2WR8A 3DCIA 4KPFC 1QP4A 3FWNA 3AJRA 1Q0HA 5DHFA 3ADCA 2HWYA 2NTEA 2G72A 4GSKA 2AKAB 3KPUA 3OTHA 2YS7A 4AB1A 3N2GA 4KDEA 5IAAA 1JDBB 3KX2A 1KJWA 3OPQA 4KU4A 4MGYR 4OK3A 1Z0IA 1Z15A 4R1OA 3KPYA 3IUJA 1DQRA 1T4DA 5LYJB 5HXAA 3NTXA 5H1YA 3TW8A 2Z8XA 3U0BA 4XIGS 3URKA 2OCAA 2XYPA 3A32A 5BYBA 2A35A 2RI1A 4LJ5A 5E2AA 3M2TA 4HNTA 2X5KO 1UPFA 5EJAA 1Y5LA 2P90A 5AT1A 1VSVA 2IPMA 5HCIA 5EJ6A 1JHVA 4M8LA 4D92A 1YFKA 2QAGC 3FPLA 1RC8A 1P18A 1DBRA 5KNCH 3G2HA 5GY7A 2AD1A 4HDMB 3EA5A 1JYFA 3U3JA 2PJDA 3UN1A 3GROA 5K8UA 2DBVO 1RXSA 2YY5A 5LVAA 1KY2A 2PUJA 3RIHA 4TSKA 4JLMA 5JS6A 4GU5A 1KSHA 1FRZA 3LFHA 3P5SA 3PFWO 3VX3A 3TF5A 3BKXA 3G8YA 3GLTA 4IHQA 2WYIA 5JSYA 1OIWA 3VZQA 2O05A 3OM1A 1E5DA 1U9IC 2NWQA 1ESNA 4X6XA 4ZCPA 4QSMA 1DRJA 4YQFA 2XXAA 3S2IA 1K7CA 1LTQA 1BA3A 4J0EA 5DGCA 1IZ8A 1IXYA 3MELA 2VWQA 4RA6A 3WP0A 1PZGA 4C3OB 4XW2A 3K92A 3RC1A 3AEKA 4BV9A 5JD6A 2CKDA 2AOVA 3T99A 1KY4A 1P0QA 3QTBA 4EZIA 4Y9DA 4B0OA 2WTUA 2AW3A 3K1ZA 4HQOA 4B3XA 4RTKA 4BNYA 2FPXA 3QU5A 1YMVA 3OLVA 1ONSA 1E2IA 1LQ2A 4S05A 4RWZA 4B7ZA 3UJAA 3BGOS 3QLVC 4Y6RA 3SY8A 3K70C 3IOBA 1GJRA 3NBUA 1MB9A 1NSFA 1JQLB 1XKQA 2P5YA 1XXHE 3OFKA 4HG2A 4HGQA 1EEXB 4D9KA 4F12A 5K0ZA 1IEQA 4BLRA 4Y6QA 1CUHA 3FRIA 3OA0A 4O2AB 2FU5C 3DC7A 1DLIA 3GMSA 3Q6IA 3WICA 1TMGE 4EHKA 4MLDA 3T7CA 4NWIA 4RTMA 4W9MC 2CDRA 4H2DA 4DADA 3CLVA 1L4KA 2AWOA 3ANSA 3R3VA 1BHO1 2VCHA 3I23A 4MDFA 4PCAA 4Y6OA 1HDIA 2JVIA 2D8MA 3OZRA 2G04A 2H51A 1Y6FA 5FIUA 2I2WA 2XRFA 2ADFA 4B44A 4C14A 4J7CA 3CNEA 1Y4UA 4Q7KA 2A0KA 2O2HA 4GMGA 4Z0TA 3N3BC 2HBRA 2OV2A 1NN0A 1M5UA 1X9HA 4R16A 4KSBA 2IXEA 2O8NA 3JVDA 4EGAA 3HVIA 2WIBA 1P3JA 4HWGA 1G2QA 5I4BA 2EAUA 2JJ1D 3AIMA 2Y0DA 3P9KA 3NHJA 3ZI0A 4M2LA 3QVSA 1XZDA 3KTDA 1YQTA 4MQFA 1Z4QA 1SWWA 1QWSA 3MD0A 4X7RA 5AJZA 1GNQA 2CXRA 4Q48A 1Z6PA 5GWXA 3SX4A 1W75A 1AK1A 3ANNA 1T0PA 4FCWA 5TF0A 5H83A 3DD1A 4BZZA 2GK6A 3CXUA 4IDBA 1CULC 3NBQA 1QC5A 2VEDA 2B30A 2Y1DA 3GMIA 3LHSA 3X2FA 1EFUA 4F97A 3VYTB 2X8WA 2VBFA 2D59A 4O33A 2IDKA 1MTOA 2VT3A 1JU9A 2X4IA 1Q6YA 1AQYA 5IU6A 4PGFA 3L7OA 2AK3A 3Q4GA 4N76A 1JTFA 3S29A 1AE1A 2ORIA 2O2XA 2WHYA 4I8XA 5KBYA 4D79A 4OX9Y 1GNLA 1NZDA 2MINB 3OFJA 1IBSA 3MTIA 1ILWA 5AK4A 3DHEA 2VAMA 3L8DA 3QNMA 1JAZA 5ALQA 3MTGA 3QPWA 4BCDA 5BSFA 3UXHA 5IFKA 1RWMA 3W4JA 3VZSA 5LIRA 2IXBA 5CCBA 1H2ZA 1V7ZA 1FRFS 1NMEA 3FUVA 3GJ5A 1CYDA 1P2SA 2E4UA 1JAYA 1PR4A 2LCFA 2AYZA 2AEFA 1ONBA 1XAIA 2H57A 2WDPA 1LDNA 3LC2O 2WTXA 4YAWA 5K3BA 2Q7DA 3WADA 4Q0MA 4CCSA 3BHNA 2E1RA 3O4JA 3Q2IA 4X41A 3DBRB 1OXVA 4E31A 1GEGA 4MVCA 5JE8A 2DHQA 3VYWA 2DVMA 4LSWA 4QUBA 1ZRNA 3BK2A 5EQJB 2J5XA 3THXA 4WLNA 4YRFA 2VH5R 4WE3A 5EUQB 1E2QA 4WXYB 3VR0A 1XDWA 1NNLA 2AQHA 3GFBA 3Q88A 4L72A 1T1EA 1G8SA 3AEXA 3NCHA 4OMCA 3PNMA 1ULHA 4POAA 2HV9A 5EZYA 4P38A 2LXNA 1SY7A 4DC1A 5K99A 2QQ0A 1WUHS 2VK1A 5TV2A 1AXRA 2DPMA 2FV8A 1Q7BA 5LA6B 1OIVA 4NMXB 4F9GA 5L6LB 1KVQA 2ZCVA 4JT8A 2AFHB 3DVQX 2ZCUA 4KO8A 1MF7A 2FA9A 1CUXA 1UJ6A 3WX0A 3ZHBA 4AXXA 2ORVA 2I3ZA 2JLAA 1WOMA 1BDJA 3VH2A 3TGLA 2IEDA 2V7XA 2Z9DA 1TT5A 2JGDB 4EEKA 4E4TA 1ZDMA 3QH4A 1QTIA 4BUJA 1NYTA 2ZBVA 4REMA 5HUJA 3E03A 1Z7WA 1YCDA 2QDXA 3I1FA 3E3AA 3OE7D 4TT8A 4XLTA 4AJPA 1EZ4A 4EF4A 4U63A 4F4CA 4D4KA 1AV7A 5KWSA 3IYLW 2WKSA 1BGWA 1HL7A 4OD0A 4OUDB 4XGIA 2ZE8A 3SFTA 1KI2A 2WSYB 3FI9A 3N1UA 1A9QA 3G2PA 3OKAA 1CBUA 3BSWA 3SIRA 4UPVA 4EW2A 1NLYA 4D9HA 5I5GA 1WVGA 1Z29A 2DWUA 2ZJ6A 3I9V1 1DE0A 1MV8A 4GYJA 1GGVA 3W9YA 3CLUD 1M2VB 4NMHA 5WRFA 5FBVB 1QIIA 3PNQA 2OBNA 4LNUA 2IEAA 3SYMA 4ZZ3A 2D5IA 3L0DA 1MAWA 4CQLB 4U7GA 2UDPA 1XRNA 1DRVA 2JL1A 3ESZA 3F5FA 4W8GA 2F4VB 1C3OB 1COZA 4LYGA 4LMAA 3GLHA 4RL6A 3TZ6A 2DH6A 5CTAA 2R62A 2P2GA 1R0XA 3H2HA 3I37X 1HOXA 4B6QA 1I7NA 2AN9A 2PO7A 3DTTA 4CKZA 2YV3A 2F1IA 2GARA 3OTIA 1TQ2A 2OLJA 2X8BA 4TKZA 4KR7A 1NV8A 4M1ZA 4DGQA 5LPNA 1GG2A 5BN4B 5DT2A 3L92A 3AHGA 3P2KA 3WK5A 4WD3A 1PJ8A 2UUBB 1EJ6A 3FN4A 1Q77A 2YDYA 2H59A 2CNNA 2RH9B 1NFRA 1RIFA 1V6SA 4MDEA 3EY9A 3SE7A 8ABPA 2DFNA 1P1BA 3JY6A 2UZIR 1L8XA 1MX3A 2F59A 1RPJA 5CLHA 5AK6A 1QYIA 5G0VA 4AP9A 1CHDA 3HB4X 1E5QA 1NXOA 5TPZA 2YNMC 1X2BA 5DK4A 2IEYA 2GM5A 4BX9A 1EE9A 1GN8A 1HKUA 3C3YA 2H1LA 3JQCA 4TV9B 2FPGB 1U2EA 4R1LA 4FHFA 3D7NA 2PO5A 1EVJA 4S0XA 4XVRA 3MZ0A 2AT1A 1GUZA 2BDTA 2LUOA 1RCTE 3TE7A 3NNSA 4B17A 3QLEA 3DMHA 3Q9UA 3WIOA 2IELA 3O83A 2AFVA 3KKZA 3SP1A 3ENZA 2Z08A 2XMCA 4PX5A 1K2WA 4JVNA 3C4JA 4NIMA 3GXBA 6AT1A 5JIBA 2X2EA 4I4CA 3I5MA 4M0UA 4QEZA 3QV2A 2GPJA 3N0TA 1D1QA 4N3BA 4DR3B 1FFSA 3JQDA 3BQMB 1YK0A 4EY6A 1HMPA 3NXKA 4PFQA 3B6EA 3MB8A 2Q5EA 1IEVA 3DW1X 5KEIA 3ILVA 3BFKA 1ISJA 2D4HA 1QUEA 1VIYA 2Z2JA 3DZJA 3PX7A 2ABWA 2JLRA 2XE8A 2NO5A 1E3WA 4MV0A 3UW1A 1GAQA 1O6FA 3LDUA 1B3BA 2W4IA 1AVTA 2NT4A 1GL6A 2B1JA 4I19A 2ECOA 4UD2A 4DJTA 1MA0A 1XRRA 5IBPA 1LK5A 3TSOA 1G2OA 5IPFA 3PEFA 2XQFA 5FTKA 1E20A 1SA0A 2BP7A 1EFAA 1PEDA 2H2HA 2H06A 4JODA 2BFDA 3VPCA 3I32A 5AIBA 1JJIA 2F3TA 3L1KA 4A0RA 3G88A 4RHXA 3T41A 2CLMB 2XCOA 4XGNA 1F0PA 1CFZA 1EUDA 3A9UA 1OJLA 1E59A 4PC6A 2G9VA 2B8EA 1B14A 3ABSB 3PFHA 4U6QA 1R18A 5HM6A 3GX1A 1ZNQO 1Q1BA 3IAAA 1TYEB 5E6RB 3C5WP 1PT8A 4CKWA 1XL1A 3W1EA 1KEVA 4CNQA 2ZWAA 1BDIA 3RARA 3KZXA 4CZ2A 2IU4A 3FHCB 3QU2A 3GLIB 3KOZA 1RJ9A 2GAJA 3IUMA 1JN0A 2MIIA 2BGJA 1DCKA 1VL0A 4NV3A 4WW0A 3UMSA 4HV4A 1XQ6A 3VC1A 5KYYA 1Q83A 3ZGYA 2HDHA 4HNSA 3AUKA 1SIBE 2JK1A 2RIRA 1MA3A 2PEYA 2PWZA 4GOND 1IZYA 4DY6A 1KDOA 4DTIA 4XI9A 1LBQA 2C99A 2MU1A 2XLCA 3GA5A 4WKBA 1ZRMA 2J7KA 1Y8CA 5DLDA 5A7FA 1YRWA 3O84A 4OXQA 1G63A 3E5RA 2WP8J 3FVRA 4UKDA 5JCOA 2WSMA 3B9RA 1QGUB 2XGGA 1NI3A 3E84A 3E9ZA 3HXTA 1J1IA 1NW3A 1VLLA 3ZV7A 4Q9HA 3AFMA 3D6TB 1U7PA 2GVNA 1EUYA 2CXHA 2ZJ5A 1ITZA 3E1KA 4YR7A 5F98A 4EJ2A 2PKCA 5ADHA 3U7JA 4JJ7A 5FBRB 2HQ1A 1SG0A 2PKQP 5FP0A 4J91A 5IWCA 1Y48E 3BD8A 1OZFA 5AJHA 3D8HA 3LUCA 1HDRA 1I8TA 4D43A 5DLQC 3HRIA 5AM5A 1OXKB 2BM1A 5JD5A 3MCVA 3PDIB 3E35A 2BN4A 1NKSA 3BREA 3JQ8B 2V97A 2IS6A 1R6DA 1JVBA 4RKFA 4BAZA 3QQPA 1FSGA 3O7WA 1IN6A 4UDOA 5AVYA 3B3JA 1TJ4A 4QDUA 4F9FA 3E58A 3GLGB 1IPFA 1ULUA 2ONCA 4ARZB 2BGRA 1E18A 2REBA 4BFZA 4R7GA 3E4CA 3RRNA 4V0QA 1OD6A 1XX6A 1NFFA 3WG9A 1E2PA 2VP6A 2GEFA 1IWBB 3RS4A 1CUWA 2MOKA 3COPA 4MGKR 4QO8A 1JHPA 5FQOA 4DR4B 4DUGA 4ASUD 1L9XA 1EGHA 3EW9A 4IV5A 1ZN7A 2JCGA 1Y98A 2TECE 1WCYA 1HYQA 1MJFA 1XA0A 4QXMA 3C7DB 4H1HA 1E8DA 2ZYAA 2BMVA 3E23A 4AZ3B 1OLSB 1TA4A 1I1NA 2PCLA 1DQYA 1Z6QA 3CBQA 3OZAA 4KCGA 2EFGA 4ZEXA 1XQXA 4EKDA 2IHYA 1NF8A 1Z18A 4IJWA 1CRLA 4MA4A 1U81A 3HN2A 2XXJA 4B2IA 2C4NA 4PC1A 1DEXA 1VB5A 2M6LA 5C5CA 1SBQA 3QEMB 4ER6A 1S1CA 4BP1A 4HWRA 1E92A 4QSHA 1ESEA 3G0CA 1M34B 3DD5A 3TOZA 5CDTA 3CKYA 4FHEA 5KNCD 3WL4A 2R87A 2OMEA 3TX6A 2Q29A 3D3WA 1PNOA 4YXFA 4FYIA 1IXZA 1NW8A 2XCLA 4OGGA 3EEYA 4U2KA 4EMSA 4X62B 1E2GA 1FYWA 5JS7A 2YV1A 1SHKA 2ZJAA 1HDXA 2UVPA 5E2IA 1BVYF 2GWHA 2JDIA 1UPTA 3M6FA 2WNSA 4YALA 1YIDA 3HDYA 1F8XA 1Z75A 1HT3A 4NJMA 4IO0A 5EKUA 1L4NA 2KWIA 1NVEA 4E1VA 3EQ7A 4JLBA 3OJOA 3DTYA 3G2NA 1HF3A 1IONA 1RHQA 3D3EA 4IG9A 4XA8A 5SY9A 2GFIA 5AIAA 4X1KA 3BL6A 4G8DA 4MWZA 4AP6A 3C1TA 1FPQA 4QTUB 4U0KA 2B2XA 3PVSA 4KAJA 4CF5A 4Q1CA 3T7DA 2ETVA 2PX0A 2ES4A 4OHOA 1JHAA 2PDAA 2OCLA 2QOEA 2ZSJA 1TJ5A 4FDVA 1F2UB 1FTNA 3QJ5A 4YROA 1GPH1 5C32A 1C4XA 2RKWA 3OTWA 1ZH2A 2HXGA 4ETMA 2GM4A 3WK6A 3O4IA 3FCXA 1IEWA 3R7NA 3STXA 2WA2A 5HE9A 4ZJZA 4C29A 2LW7A 3VVLA 5I7RA 3N2LA 5LDHA 4L2IB 5BMVF 1GPYA 3W1WA 3EIFA 4YA6A 3MMPA 2JAOA 1YQXA 4ZC8A 3X2EA 3AL0C 1WQ3A 1D6JA 1V48A 3JQPA 3PPXA 5E2BA 2QVCA 4NH4A 2FUNB 3I5UA 4X1IB 3C3EA 5B64A 2IZ1A 3IEIA 4OJTA 3JQFA 4FBLA 5FBQB 1QX3A 4QRDA 3MIZA 4OHFA 4EI7A 2FE4A 3NOOA 2CNOA 2I7XA 3JQBA 3BM5A 4UE2A 3AR8A 1RKVA 3DZ8A 5FOQA 1C9MA 3CT4A 4C22A 1VJ5A 2VBGA 4V03A 4BY9E 2BTEA 4WN9B 3CX3A 3PDHA 4KJZA 5HEKA 1M54A 2CDNA 5JZBA 3EEFA 1Y4AE 4RZ2A 3HU3A 2DPXA 4RDCA 4LZZA 3QOYA 3EFBA 1ORVA 4RJIA 1CE8B 1EXNA 4MOWA 4RW0A 2WIGA 4WCVA 4BX0A 4DEYA 3COYA 3GLIA 3ECAA 1PL6A 4BO9A 1NTOA 3EVTA 4M21A 4CQJA 5C35A 1JZQA 4ALLA 2P2NA 1GTSA 3KDAA 2PLAA 1P0CA 1DEOA 1G8FA 1KFJB 2GFQA 1K7XB 1C9YA 3LH5A 3KZNA 4WADA 1E3MA 3EXFB 5FUBA 3D6AA 1YAHA 3RKUA 1YGPA 3K2QA 1P2BA 1TK2A 2O07A 3AO0B 4GBGA 4DJ5X 4E15A 5FOTA 3KNZA 4DQKA 1O95D 1EFPA 2NZXA 4GMFA 1I4WA 3C3BA 4GPD1 4OHKA 2Q9CA 7REQA 1AS3A 1GUYA 3UF0A 4JEMA 3Q15C 2B8NA 2FSSA 4HUJA 4J2TA 1V16A 4LJYA 1K3TA 4OGFA 4NYMR 2CV2A 5CA1A 2SKDA 2WSBA 4KP7A 5JS1A 4L4UA 4KLRA 3ZHYA 3ZE0B 1B43A 2E5WA 1FFAA 3LKDA 2WFLA 4OQPA 4XH9B 1A2OA 3Q6MA 5D1NA 5DMHA 3KCNA 3VYVA 3O4HA 1GTVA 3MWEA 3STYA 4KFCA 1PG0A 3MUFA 4V38A 4AWXA 1M9NA 3CF4G 4MV1A 3QPVA 1NNI1 1Z25A 4BRSA 1Y1PA 4BVKA 4EJSB 2VTBA 2VF2A 4U8HA 2JFWA 3W2TA 3H1AA 2E1PA 3GRVA 3YASA 3NOQA 3DAOA 1C80A 1RI2A 3AUJB 4OQMA 4X20B 3EJWA 1KH2A 3A1TA 2IKSA 5JW6A 1VGRA 4NJEB 4KVAA 3ADPA 1YB2A 2H7VA 2YDXA 4EP1A 1D1PA 2KI5A 3U4IA 4Y6PA 3EOZA 1WB4A 3GUVA 1V35A 4KXNA 1ZGBA 2QIOA 4JL8A 5K1ZA 1A96A 3H7AA 3ABIA 3DTVA 3U4DA 2ZJ7A 3KWLA 4QKQA 3C6MA 4HGOA 5HPYB 3WB2A 5BN5B 1ZOLA 5ARCA 2ZS7A 2OFOA 5LQUA 1GKIA 2P1DA 2J9RA 1OTXA 1Z35A 5DX8A 1XXHB 1SQFA 2JBAB 3CUKA 3E7PA<