1RBZA

Human gar tfase complex structure with polyglutamated 10-(trifluoroacetyl)-5,10-dideazaacyclic-5,6,7,8-tetrahydrofolic acid
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE
publication title Human GAR Tfase complex structure
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 65
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1rbzA00
2CFIA 3GARA 1JKXA 4ZYUA 3AV3A 3AUFA 3TQRA 1RC1A 1RBZA 4ZYXA 1ZGHA 4ZZ3A 4S1NA 4ZYWA 1YRWA 4ZYTA 1ZLXA 2BW0A 3NRBA 4ZZ0A 4TT8A 4ZZ1A 1CDEA 4NV1A 4QPDA 1MEJA 1RC0A 3R8XA 4Q12A 4PZUA 2GARA 3N0VA 1GRCA 1MEOA 1MENA 4EW3A 4EW2A 3O1LA 4YFVA 4DS3A 4TTSA 4R8VA 1CDDA 1FMTA 4ZYVA 4ZZ2A 2FMTA 1GARA 2BLNA 3P9XA 4EW1A 3KCQA 1C3EA 4IQFA 4TS4A 1S3IA 2YWRA 3LOUA 3DCJA 4ZYZA 5CJJA 4QPCA 3W7BA 5J9FA 3TQQA 4YFYA 5J63A 1NJSA 3OBIA 1RBQA 3Q0IA 3DA8A 1C2TA 1RBYA 4ZYYA 1ZLYA 1RBMA
chains in the Genus database with same CATH superfamily
4BJHB 3E48A 3T34A 1Y8QA 1G98A 4GM4A 2QVXX 1JLRA 4O2AA 1E9AA 3DFUA 3L8HA 4QFCA 4B75A 4ZYUA 5HE9A 1CQXA 3TNDA 6ABPA 1KP2A 2IOFK 2ZYSA 1U7OA 3D3JA 3Q7IA 3WWYA 2DTEA 2B5VA 3ER9A 2PQMA 1Z0DA 2O2YA 2OAQ1 3DZBA 4QFDA 1CV2A 5DO9A 3DLPX 1T5IA 4URUR 1RR6A 4KSBA 2QRKA 4LOAA 1MFZA 1BN7A 4MWTA 1NNLA 2ZT6A 4RD4A 4RIIA 2Q5EA 1XDGA 5FOWA 1GTSA 2R65A 4S35A 3HSSA 4CQJA 4CKEA 1U7TA 3THYB 5DNVA 5L3SB 1MGOA 2O2GA 1HDYA 3KQLA 1R4ZA 3CWCA 3EIUA 3KPVA 4TV9F 821PA 1BEEA 5JWHA 3K2BA 5H9WA 2GTPA 3LC2O 4UAUA 4RFVA 1LS6A 2PKEA 2PTHA 2ZYHA 2N3ZA 5E9QA 2LW7A 3LBYA 4RKYA 3ZV4A 3H18A 2AD5A 1D2HA 1YOVB 3U0VA 3WI7A 2B3DA 3RVLA 3T6KA 3ZWOA 4EDHA 4RY9A 2BE7A 4N18A 4ZZ1A 4A2QA 5IF3A 3AF1A 1UZNA 5JSFA 4MLZA 2MDTA 3HFSA 2YX1A 3HJGA 3RS9A 3K1AA 3PA8A 4K9NA 2IH5A 4YI3A 5H68A 5KZMB 3N7UA 3CNHA 2QWXA 1EK5A 2QN6A 1DXHA 1V95A 1OFTA 4KNYA 3GFGA 3S7TA 1BW9A 4I3GA 1KY4A 2UYQA 5JV5A 1C8KA 1J8QA 1U5BB 2DU8A 2XE4A 4X97A 1XDWA 1F38A 1G63A 4MCIA 2R4QA 4NV0A 5TSDA 1KFEB 5L3RA 1IHYA 1SIOA 1A96A 1KVQA 3C48A 4AJNA 1P3JA 5E4YA 5EIBD 4DMFA 5BURA 2FN9A 2XBUA 4Q9NA 4OX9Y 1KI8A 2GBLA 3QWIA 1WRBA 2POQX 4KVFA 2YRWA 5EINA 4AWXA 2ZIWB 3QLJA 4FFLA 1QHHB 3DTYA 4U8GA 4B8YA 3UENA 3T4UA 3RVQA 3LECA 1FNSA 1YNSA 5DP1A 3RK0A 3NW9A 3ZHQA 5D87A 2QX8A 4H7KA 3TDNA 4BRZA 2C0CA 1I4WA 2JIMA 3FOAA 1CR6A 1PK7A 3D7MA 3DBLB 3F7MA 3MOIA 1LWOA 4XUDA 4BQFA 1LFDB 5EYPB 4DAEA 5AKXA 1XA3A 3PIDA 3PD0A 4RZ2A 4EUEA 3RS7A 4OMFG 2PYZA 1CUAA 2Y9MB 4OQDA 4MMYB 3FOEC 1R0KA 2VH1A 1IXKA 2VAVA 2ZSEA 1LQ2A 4JITA 4JLOA 4OGWA 5EN4A 1MGPA 3TYXA 5CYPA 4AG6A 2VYCA 4B47A 1ZD8A 4NHEA 3BHIA 5ALKA 3FOWA 1Q91A 2XLCA 1XZEA 3LP8A 3QTLA 4L4UA 2WD8A 1B23P 1JQDA 3STUA 4NAUA 1J8FA 4IAOA 3FRJA 2R00A 4CFYA 3NT4A 4LTNA 4TRJA 3UIEA 1P29A 5JJLA 3E70C 1B26A 1ZA1A 3DBIA 4LRXA 3AU8A 4ZI2A 2R6HA 4L74A 3WL4A 4F12A 2O8VA 1I94B 5EEHA 4YWHA 4A0QA 7GPBA 4TTVA 4L22A 2VQ3A 1CSEE 2QXYA 2RBEA 2Y1EA 3BRWD 3F1KA 2PWZA 2X4LA 3CUYA 3RT1A 4QTTB 4CLOA 2OCXA 4J1SA 3HE3A 4C7VA 1DMSA 3K9BA 2ILTA 4PS0A 3FMFA 4CM9A 4LJYA 4MV5A 3U40A 2ZI3A 3K0EA 2JIQA 1L5FA 2XKJE 2Z8ZA 3TW6A 3ZX5A 3HG7A 5E1MA 4IG9A 1BU8A 4PPNA 5CA0A 3OOWA 1HXHA 1FDIA 3IR7A 4MKFA 5D6NA 2P3QA 2PZBA 4WKBA 4G2NA 2WA1A 4DTIA 3I9NA 2FZVA 5KQRA 2R25B 3MAAC 3UANA 3NCHA 1SHJA 3SK0A 1O5TA 4MV9A 4US1R 1BIFA 3ICVA 1J0XO 2QP4A 3UBMA 4GKJB 3BGIA 1W47A 4CDNA 3I0MA 3KEFA 4RVSA 5AXCA 2WHQA 3F5SA 4R84A 4ZI3A 1NU8A 1RRKA 3GT3A 3MS4A 2DB3A 1CVIA 3VBEA 4YP9A 2ZBUA 5K3BA 5E2BA 4MRAA 2CBGA 3AJ9A 4IHJF 1OCEA 4PAOA 1TZMA 4N6OA 1FLVA 2CNBA 3CNNA 4LWPA 4QZVA 2BMVA 3BK2A 3KM0A 4FBLA 2TMGA 3F0TA 4JLWA 4FP9A 3A1CA 1NASA 4XM1A 3VKHA 1GR1A 4QSMA 3AI7A 1N2EA 4X84A 5EHZA 3VVMA 1IAVA 1QJCA 2FN3A 2ZRJA 3HJAA 2YQ5A 4GXQA 4EA6A 3RO7A 3FSGD 3IRUA 2FWBA 5HZHA 1C0LA 3UMGA 4BFYA 4D45A 5ETJA 1AUXA 1E7WA 2A5YB 1U7UA 1E3WB 2C00A 2ZJ0A 4MQLA 4ZCPA 3C1UA 5JZVA 5AKHA 4BLRA 1JLMA 1HE1C 3GJ4A 2X1LA 3QFTA 1K0UA 4NMWA 4OHXA 3FZYA 5FEUA 2R5WA 2I33A 3V7YA 4CZ2A 3T95A 5GIPE 1WY5A 1Y34E 5AHXA 1FBNA 1IXRC 1TK2A 2I3DA 2ZEJA 4MRRA 1UBTS 1W19A 2I2XB 4QPPA 4E70A 5IBCA 5DTJA 3PGKA 4REQB 1X1QA 4AKIA 4CXMA 2IX3A 2CMFA 2AE2A 1TYZA 2KSQA 2EF1A 1QH8B 4EUNA 2JFZA 4HQ6A 2FUKA 3LL7A 1XOIA 3MVEA 4OQNA 3TQHA 1ZKMA 2RAVA 2UVPA 3JW8A 1O9GA 3RVDA 3TNFA 3DO6A 5TMPA 3FPAA 5GOTA 2P0AA 2O4UX 4M0PA 2O0HA 2BR5A 4JUAA 4Z3OA 3UAXA 2C7RA 1VB3A 1HO3A 1JEOA 2Z2IA 3I9FA 3ZHVA 1WBDA 5CYOA 1O03A 1A69A 2GWHA 4EG7A 1WD7A 1GPBA 4PYKA 4DRXB 4JOQA 3KK0A 4PHHA 2NO9A 4DRYA 1WXHA 2VQDA 1TIPA 3OBIA 3B85A 2DWOA 5ICGA 2ECKA 4LJLA 1HL7A 1QAQA 2O1EA 4LMAA 2ECPA 5AM0A 1IRIA 2W4MA 3II6X 4MV0A 5DBHX 1U0JA 3ZJ4A 4A4DA 4OHZA 1J8YF 2XYPA 3D6TB 4RK6A 2RK3A 4RHYA 5CVEA 2XMZA 5A3JA 3F4KA 3L41A 5TQ2A 4FGKA 4KPEC 4Z4IA 3F5QA 3PQ3A 4QELA 5DPMA 2JIPA 3P8ZA 4IFEA 4K9MA 1M1YE 3OTIA 4MJ3A 4U3JB 2VQSA 3ZS9A 3QELB 3ZWYA 1Z29A 3QA9A 2MINB 2XCOA 2VF5X 3S1AB 3WLQA 4LRYA 4EYSA 2RB4A 2D62A 3E22B 1MB2A 4XRRA 5AXDA 3RFTA 3NVMB 2OP1A 3AUFA 4XKJA 4DG5A 1AZTA 1UEIA 2I78A 4IFIA 4RIFA 2NUTB 2OVBA 1NW6A 4DUZB 1U0LA 1R6AA 1UBKS 1VLLA 5MN5A 1ONSA 3O4VA 2JF0A 4MPJA 2WIJA 3G2IA 3TLGB 3E7FA 2FEAA 5ESRA 3PXBA 3SEAA 3O8RA 3RKSA 3IUNA 3UCFA 3V46A 1F12A 2C9CA 3FY4A 4QJIA 1OC2A 2VDVE 5DHUA 3KTOA 4EGSA 5KDDA 2BMWA 4TMYA 1NUAA 3TQSA 5AW3A 3I2KA 4S1NA 5T8KC 3BMQA 1SY7A 5IVPA 3HABA 1XLVA 3QIVA 2JLCA 2FW9A 4BNKA 5BN3B 1EZ1A 4CU5A 2XNKA 3BBLA 4QGSA 5IU6A 3INGA 4JC5A 3KZMA 1Z68A 2V7PA 2HA2A 2KBEA 2GUGA 4BKOA 3LUBA 4L8WB 2VDLB 2JH3A 2Z43A 3O31A 2QZZA 5CH3A 3ZW9A 1H2EA 4CI0B 3SXUB 1SUAA 2IVZA 4CL2A 1PTJC 2C8KA 2R62A 4TXNA 2XX3A 3HJUA 5ALEA 2H29A 1C9DB 1Y4DE 1ONPA 1C9EA 4FOOA 3L0BA 3WQSB 1WDKA 1UWVA 5LYYA 4D4MA 3U9SA 2QRMA 1BDJA 2EFEB 1DBIA 3L43A 4EQ6A 1AZWA 4FW9A 5C53B 4Z0HO 4V2UA 2ZIXA 4Q19A 3EF3A 3HCCA 1M6WA 1FU8A 1UJBA 1J06A 2OKGA 1US8A 9ABPA 2YJNA 4ZAXA 1O6FA 3VKVA 2RJOA 1JSLA 1Z15A 3H04A 1JDPA 5KSPA 1CUHA 3WLLA 4BO0A 2QG6A 3LI2A 3O9MA 4IGIA 3DL4A 1XYYA 3L1HA 1V71A 3B8EA 3JWGA 5CLFA 1FJ2A 3PUKA 2AUNA 4YR9A 1NMSA 3V4RA 2DPLA 3OZEA 3DLCA 5DYTA 1PGNA 1ZO8A 4TKLA 4ZT2A 4ZCMA 3S6JA 2QD4A 4MWSA 5JIBA 1I7SB 3A6ZA 3TMAA 1BAPA 2QJFA 3BREA 1OD6A 3B52X 1XJWA 4HRAA 1UDBA 4MO2A 1KJZA 4J0DA 1F1JA 1ISRA 1OPXA 4F4CA 1YL6A 5LDDC 4OV6B 3WMFA 2C3PA 5HHTA 1WABA 2ZUTA 3VR6A 3LUGA 2YNMC 2AJCA 2R6AA 1ARZA 1ELOA 2UUPA 2PXAA 3Q6MA 5DLQC 3RD5A 3WGTA 1EM6A 1E2PA 1P7YA 1V16A 1LDGA 2BGMA 4H4EA 4RQAA 2HSZA 2Z09A 3CR7A 1BS9A 3CB2A 4KI0A 5BT9A 3CX4A 1LH0A 1KEEB 5LQNA 4QE3A 2YJZA 4LECA 3EUWA 1GLNA 1HC7A 1E4OA 1M7GA 1IM2A 1NV9A 1RWBA 3AFGA 2NAFA 4EMBA 3B12A 2X0KA 2X76A 2AUTA 5G4KA 4DIDA 1CJVC 5AW6A 2HCJB 4NRDA 4ZP1A 3C4VA 3DOHA 3CLRD 4BO3A 5FFNA 1E2NA 3AHCA 1X9GA 3PFWO 4FK8A 1NMYA 3NU1A 4F92B 2HR1A 2PZMA 3KYDA 1ZSVA 2JLAA 4P3KA 2C95A 2WHXA 4B3XA 2QMEA 3GUYA 5T4FA 3HN6A 4UM5A 1U2RA 5EVJA 3W34A 3FGNA 5H8WA 1GHTA 3F9RA 4FN4A 1XZCA 3LP6A 1GTJ1 3KT3A 4JAVC 1ZIDA 3IAS1 4BTLA 3EVBA 2SNIE 4PZYA 3BCUA 1AGPA 2BMAA 4Q47A 3DXYA 3DD1A 2BEUB 2F1KA 1Y8RA 3M5WA 1NRIA 4IOKA 4CCWA 4BB5A 1GPMA 3EG5A 1DTWA 3S44A 1YHNA 3AGPA 3MTDA 5LNK1 2X0EA 1GQQA 1JQEA 1LVGA 1TQDA 1NBIA 3F9IA 6Q21A 3WV4A 1LSSA 4ZVVA 5KJFA 3PDJA 2A59A 4HDNA 1GNRA 2B36A 2ORYA 1NI3A 3HLYA 4HRVA 2C1ZA 4RL4A 1SQ5A 5AIBA 3BERA 3H8JA 2XNSA 3R5KA 3UH1A 2Q3DA 2JGDB 1QGDA 3CEPB 4YJ2A 2B4AA 3BMNB 3QWAA 4MX8A 3IOMA 1X7ZB 3AYZB 4OBBA 4EJMA 1RAFA 2C29D 1QP4A 4F8JA 5IDXA 1K8RA 4BLUA 3GLQA 3UWPA 1SVSA 3HRHA 2G0NA 3D6HA 1BEUB 1T2DA 1P1HA 2ZE5A 3QU7A 4M1MA 4NG5A 1TZ2A 2RMKA 3TVYA 3JQFA 4PINA 4X1IA 4D9IA 5JDCA 3H11A 4FNAA 2D1TA 2B1GA 1YQTA 2W2LD 3VU9A 4BQNA 5ADHA 4QVKA 2GBGA 1ZM4A 4ZAYA 3RG2A 5TY0A 1U8EA 3I01A 4MV3A 5DYIA 1PR1A 4D9MA 3OVMA 4H15A 1KYIA 4J43A 1IQ0A 5LD2C 1HNXB 1RPNA 3DJFA 3C98A 5GV7A 2D06A 2PFSA 4AJKA 3W8FA 1VJTA 2VYQA 1VE1A 3G2QA 2ORIA 4BX8A 3PJGA 1SQ0A 1LA2A 5I9BA 3P4XA 1FMLA 5K99A 3OY2A 3I30X 4EI9A 5JAZA 1ODKA 2IUYA 3QF7A 2AMYA 1PJ3A 4WZ6A 1BS1A 3PEFA 4OYLA 1U80A 4W5TA 2XYVA 5KU7A 2VH5R 3SXJA 1LPAB 2ZJ8A 3DB2A 5I4CA 3BQMB 7MHTA 4CKBA 1LZKA 3O3MB 4F4IA 3CXUA 3ZYCA 3FYTA 4IXMA 2GSWA 2EHJA 4JJ4A 1J5PA 1E0DA 1RDFA 2IOFA 1WTCA 3U7HB 3AF6A 1H4VB 3EEFA 1CJCA 4FYXA 2CD9A 3VX3A 2UDPA 2O5VA 1E9RA 4C7MA 5GM2A 2FWPA 3E84A 1J09A 3QF4A 1X13A 2YIMA 4YRJA 4CMCA 4RIGA 4XX0B 2E4UA 4EG5A 2PKWA 3ISVA 1TMYA 5LQDA 4M46A 1J33A 3EGIA 2GK7A 4HN2A 1PFVA 3HH8A 2W90A 3TTTA 2UVDA 3FAZA 2V7TA 2C4TA 3TI7A 5KI6A 3T3IA 2I7DA 3NGXA 1Z0KA 4N3BA 3E4CA 3NXSA 3PTLA 1HYGA 3QOFA 1NW3A 1L5KA 2WMOB 5FV4A 2P0EA 3IIJA 3TLBA 1VMEA 5B4UA 4RMHA 4QUBA 1TU0A 2PU7A 3VBCA 2RGGA 3OMWA 5LPNA 1G6Q1 4ASUA 1GLGA 3ZQKA 4R83A 5AMXA 5JLAA 3OPXA 1MB0A 2UZAA 4Q3LA 4YHHB 1NRJB 4JWKA 1HY3A 1VKZA 3VVLA 4YJ3B 2WR8A 2YWBA 2A1IA 2D2IA 4HWRA 5JY1A 3BD8A 5BXYA 2QD1A 3OTHA 4EDFA 3EIOA 2C1XA 3GJZA 1UBLS 2VP9A 3GRRA 2BLLA 4E4RA 2HT1A 4DLPA 3DMHA 4RZXA 1XEWY 3PF9A 3S2SA 2PUFA 3UBTA 2C84A 4HPWA 5SZHB 1KEKA 4DEYA 3UMVA 1M66A 3T99A 2XKBA 3GFSA 3GLHA 1DC6A 4DTCA 2YOGA 1M2GA 1ULBA 2C88A 3D59A 3ASVA 1PJSA 3I2GA 3N0WA 4UUPA 4WSOA 1BXKA 4BMZA 3GQVA 1W87A 5GJCA 2HHLA 3A3OA 1C1XB 1ECBA 2YHSA 3G23A 4NF2A 1N1DA 1EINA 3EVDA 3EQ9A 4S05A 4O63O 1CXZA 2V6BA 3BCHA 2J0SA 1P8AA 2IL1A 3OPYI 5LKAA 1F17A 1GQRA 1NM5A 2QTMA 3FVVA 2PUEA 1DHTA 3DLHA 5BV8A 3RWOA 2OO7A 4UMVA 1N4AA 4LHSA 3ZGOA 1VOTA 2PGJA 1L5ZA 3HBNA 5K1ZA 4A2WA 3VR6D 4HAVA 4CLEA 3I5XA 1E5QA 4UU7A 2BKXA 3DV2A 1RRFA 3ETDA 3ZHBA 4BX9A 1GEEA 1NBME 4WXYB 1RZRA 3F2IA 4Z4CA 2JEOA 3OCVA 4PZPA 3MB8A 5JNTA 3GVIA 4O4JA 1K0FA 5AVOA 2REOA 4FMCF 3B78A 3HVIA 1RM4A 1RP1A 4O4JB 4RTNA 5KKCA 1RSZA 1JBKA 1MX3A 3HN7A 1QIEA 4F7DA 1YZUA 3EXG2 3MOSA 2YZ7A 4WJZA 4KHPB 5KYUA 4ZAGA 1MN6A 1OTXA 2GCGA 4GBED 1XQ1A 4WV3A 1HYQA 2BEWA 3MK31 4JHLA 5H3LA 2Q3BA 3OZIA 2BLNA 1R64A 1D2NA 3NHUA 4G8BA 5DWQA 3W4KA 1KU0A 1N0HA 3CBQA 2C4VA 2OM2A 2F8LA 2H5LA 3SLGA 1YBHA 3PYMA 1U7DA 4NBNA 5BPFA 3WWDA 5KJ1A 2OBLA 3CKYA 4IQGA 2WHPA 3UWKA 5KWEA 1I2BA 4F91B 1GTZA 4TMKA 5K6AA 4C4AA 3OD1A 1CS0B 4JYPA 3PFGA 4EW6A 2OSBA 3B7WA 3WGJA 2QB5A 4A6PA 1RU3A 1G1MA 1D04A 3OM8A 4AICA 1WMAA 2B2XA 4TLDA 5F21A 3HM9A 3DF9A 5F7XA 1LI5A 2QLNA 4IIJA 5KOJA 2ACEA 4I5FA 2F3RA 2X7XA 1OX4B 4FR0A 1NXOA 4XJTA 4R6WA 4YLGA 4MJLA 2P7IA 1M2OA 3DUFB 4RF5A 1VKHA 1E3EA 1T1GA 3BKXA 3GT7A 2WINI 4PYOA 3PVCA 5DNUA 2YMMA 3SQNA 3JWIA 5GJBA 1L5YA 2ZVDA 3FH0A 2YJGA 4MR9B 4QPZA 5IS2A 3I73A 4EY8A 1OLUA 3GJRA 3OJLA 3O1JC 4EVIA 4JYBA 3KJHA 3BORA 4FSDA 3VDXA 1AF7A 4NE9A 1WF3A 1Y8CA 3BGWA 1G8GA 4GZLA 1FDTA 4AJLA 1GADO 2WJYA 1HF3A 3FBTA 2LD4A 3IA7A 3V2GA 1A97A 2HSGA 2OEPA 2JI8A 5LBIA 3CF0A 4UHBA 2HTEA 3ZVRA 2GF2A 2YIVX 3KFLA 4P2GA 3UKJA 3V4FA 4Z4QA 4A27A 1ZRMA 2QMOA 4ARZA 4V1CA 4NYJR 3LDGA 1E1RA 4ON9A 5FUWA 4JI3B 3H1PA 2PKQO 3TQTA 5IT5A 2FN4A 1SWWA 4PXAA 5TLSA 2KS6A 2YV2A 3HP1A 2D1RA 2FOIA 1M1NA 1HH4A 1WXGA 2FUEA 2ZUDA 3LVFO 1BQEA 4YS6A 4I1PA 4CMIB 3BA1A 4YAIA 3ZJYA 4W63A 1NDQA 3R5HA 4D74A 1YQDA 1QE0A 3OCUA 4K9SA 4K8RB 3ZGNA 3HB5X 5TGTA 1K5GA 5J47A 5MDHA 3TJZA 1UWCA 1YKSA 4K0RA 4R5HA 2RJNA 4ZEVA 1EDDA 3IH5A 3MW8A 2B98A 5L7TA 1MX5A 1DKOA 3DYVA 3RS3A 2PD3A 2IY8A 3EEIA 1E1CA 1IOWA 2FPPA 4Z9YA 1SAYA 3JD3A 1MH1A 1Q0HA 3IHWA 4MYRA 4ND4A 1DKNA 3PXAA 4H6WA 1Z5UA 3BZBA 1Z45A 4IXDA 4ZAFA 4ZKEA 4FM9A 2XUZA 3UT0A 4MV1A 1RWPA 4LYYA 2C7GA 1IHPA 2V6IA 5BOVA 4CM8B 1GU0A 1T5HX 2VT2A 3KJGA 4IHJB 4YH1A 2EKLA 4B84A 1TEHA 1PAUA 4BMNA 3RB8A 1X1BA 1O54A 4KODA 3T5BA 3ZQ4A 2P40A 3SNHA 3JWEA 4B6QA 4LZJA 3VYVA 2JAOA 1WCIB 1K4KA 3LBAA 3KB1A 1A4IA 2YFYA 4MUEA 3GOHA 3WNZA 1QIGA 2I99A 2Q2WA 4YY3B 1A8PA 2AF4C 2K2QB 1NJ1A 2FQWA 2CVFA 4NK4A 3OT1A 4MW0A 5AK6A 3SEZA 1VYTA 2AXPA 2YIJA 3BWVA 4OG2A 4BEBA 2O06A 1RWWA 2R7AA 1Z8NA 2DECA 3KKNA 4QJ4A 5FNVB 2Z4TA 4DA0A 2IXAA 3KOUA 3MCWA 3QX9A 1KVSA 4IBOA 2BAGA 1JG4A 1FU4A 2K87A 3PUWA 1TCCA 1N6OA 2AFHA 3MQ4A 4HLCA 1UKEA 4TL8A 3UK6A 4JK3A 4AN0A 1RJ9B 5CEJA 1IY2A 1XF1A 2BD0A 2Q3EA 2WFZA 2ODPA 3G17A 1VKRA 3MIZA 2WB4A 5EL0A 5BPHA 2ENUA 3KQOA 3MIIA 4QDKA 4WOPA 5CB4B 3BA6A 1V2GA 2ZIEA 1D2GA 4CM3A 1IHXA 2VAPA 4XGQA 1A50B 3AESA 4M22A 3U19A 3O0TA 3DCJA 2JJ1D 4DT1B 3L49A 1L7MA 3QITA 3D3NA 4HX5A 3FTFA 5ITWA 1NQXA 4DZTA 2GFQA 2LNDA 1BX3A 1JV2B 3IXMA 1ZDMA 4JEMA 5KJCA 1T2EA 3DVAB 5A5VA 1NT4A 1XMQB 3HC7A 2ZRDA 2WU8A 3P96A 4A8TA 1ZN8A 2L42A 2H4FA 1NVGA 3FF1A 5HA5A 2I1LA 4OHVA 4BNYA 5JARA 2A5FA 2FPIB 2P5UA 4YK7A 3ZDFA 1SBQA 3FE2A 4CT5A 1I6KA 3LIPA 2GD6A 2JK0A 2VP4A 5CNMA 5GONF 4WXRA 1KQFA 4TZKA 1NPDA 3SHTA 3ONNA 4BFLA 1GN8A 1EEXB 1HEIA 5CPBA 2X1MA 4B3JA 2PO7A 4NULA 1QVRA 3HSYA 3LH5A 2ZJOA 2KMLA 5EKUA 5FF9A 5C2JB 1Z0JA 1CNEA 1Y1QA 3B3GA 4PICA 1HQYE 5GONB 2CUTA 3RYHA 1A2QA 1YZQA 2QORA 4MPDA 4EM6A 1RZRD 1T36A 4FEGA 1FMCA 1PR5A 1PWXA 5IBQA 3ECSA 5HQJA 2XUQA 2H9AA 4ZU6X 3HA7A 4RJLA 4LY0A 4BNZA 3C3EA 1E0JA 4YLEA 2XI4A 4JEIA 4GRDA 1ZFNA 3USES 5TPWA 3K53A 3PSAA 1HDZA 3QG5A 4FI3F 4HLNA 1E2IA 1IONA 3UEOA 1RD4A 4BMYA 5FFFA 2IXBA 3GGGA 4RF3A 4RHFA 3H16A 2ONZA 2WYIA 1FQOA 1YVUA 3O7WA 4MYDA 5AVVA 3IMKA 3PC7A 4OREX 1ZGHA 2BDUA 2D13A 3P9PA 3P9IA 4F3YA 4X62B 3NGMA 3ZN2A 2IF2A 3B8HA 4BNUA 5GZ3A 1H2YA 1XAHA 4INJA 4HFMA 4N12A 4NZZA 1Q1ZA 1ZPDA 2I1WA 2WP0A 4RE5A 1KWKA 3ND5A 4YYZA 1T4CB 1W1WA 3DL2A 2RKOA 4S12A 4MGEA 3QEOA 1O87A 5AI6A 4M89A 2XECA 2QENA 5LVAA 3QX3A 1C7IA 1V8BA 2GSDA 2QP9X 4TYNA 3K20A 2ZTLA 3EUFA 5ES4B 4QHSA 2EX4A 1OI2A 1OZGA 3EAFA 1I3MA 4IO1A 2JFGA 4L5AA 1XD2A 2WY2D 3CZ5A 4UBIA 3ZOZA 1DV1A 2GESA 2QV0A 4PC6A 1L7EA 1R0LA 5KTPA 1YBVA 3NVKI 1Y5RA 2DJIA 3FNIA 3HHPA 5DHSA 3V1UA 1MNQA 1SCKA 1UJ4A 2C8VA 3NTUA 4L3OA 1RLTA 4O2RA 4RCVA 2H0AA 2FPWA 2G7MC 3CUKA 3KIPA 3OZBA 1Q6YA 1LV7A 1QV7A 2PJRA 3EK2A 3DOEA 1GSOA 1ORTA 2DR3A 2K6GA 1VLHA 3K73O 3LGAA 3ROEA 4O2BA 5BVHA 2QAGA 1SFRA 3RAFC 1YFLA 1R7RA 1QQBA 4KITB 4RV9A 3ZD9A 5JYCA 4NJEB 1B3BA 1E8NA 3RE1A 3H1EA 1F7VA 2C82A 2WMNB 5D7NA 3L4BA 1TAUA 4GLBA 4Z1OA 2OCBA 1AA9A 1SBZA 1SUSA 1UXJA 3GYBA 1RHJA 3OOEA 3OY7A 4BO8A 5BMVA 1ORDA 3AO0B 1XRQA 4C29A 3DEJA 2J4CA 4TXMA 4NCAA 5EUMA 4BWGA 2BI8A 4OQFA 3WGYA 5TMDA 3LCJA 2BTEA 4XOIA 1WY7A 1OZ0A 4L1KA 5JSUA 3FVRA 3A3YA 2PBLA 1E8DA 1U1IA 3M0EA 1HT1E 4MDHA 2FPSA 4KFRA 4CUZA 5DM70 3V97A 1QKJA 2VJQA 2WUGA 1E1RD 1CQWA 2OC4A 3H1FA 3DL0A 1I6MA 1RLJA 3K6JA 4QQRA 4V0SA 4ZYZA 5A9SA 3KQTA 3NBKA 4C30A 1RYHA 3F49S 4GYJA 3GBSA 1BGVA 5BMOA 4G1UC 4DG8A 1RJGA 2PGDA 1BOOA 2F6RA 1GZ6A 2RKBA 4JP5A 5DKFA 1CK4A 4AUMA 3VHQA 4EOGA 4F2WA 5JNWA 2EERA 1RRMA 3ADKA 2IC5A 4HPXB 1ZGAA 2PQ2A 3RYCB 1R5JA 2RBKA 5HQ3A 3DF7A 5KKNB 2DHRA 4B6PA 4DCNA 4UBLA 2Z56A 1T2FA 3N5CA 2P6PA 4ITVA 5SYMA 3CFYA 1M1ZA 3O82A 1JHRA 1JDBB 1K7EB 2FTKE 2IP4A 1VP3A 3C3DA 3NHFA 3O91A 4HZIA 4MMZB 3C6ZA 2PZKA 1MOPA 3FR8A 3PKIA 1YRQA 4GPIB 3B7GA 5AW4A 2VPWA 2GEJA 3K1ZA 2ZRQA 4ZCIA 4MR7A 4HKTA 3A4TA 2H2AA 5JQGB 3DHNA 1VRWA 1G5HA 1RFGE 1PR2A 1IQPA 1ZUHA 2BBTA 3AV3A 4N8EA 2BHTA 2KPOA 2R6JA 4CHTA 7ABPA 1ZG3A 2H0RA 4IFTA 1YU6A 1DIGA 2NNLD 3SZMA 3ZDQA 4HNUA 2BHLA 1GSIA 2QLJA 1DNPA 3G5UA 4MARA 4BQEA 5J2UA 2LCFA 1RXVA 1XPUA 4AG3A 1Y63A 5EHGA 2XITA 5K09A 3KWFA 4ZU3A 1QU2A 4IH1A 1GYQA 5DLYA 4EH1A 2Z9BA 2VF2A 1WKBA 4MROA 3HEAA 3AHEA 3VUEA 3EUEA 3L1KA 3B6IA 3HY4A 3KPUA 3K70C 4OK6A 2WV9A 1F6WA 3WYNA 4GOJA 4MUGA 2VUSA 4KQ2A 1UFRA 4MQ5A 4PSUA 1O3YA 1USVA 4KMOA 4G09A 1JWLA 2ZS8A 2J41A 1BDMA 2VJBA 2Z8YA 3NFRA 1YASA 2FB9A 5I9IA 1P4GA 2WIBA 1PVVA 3V4SA 2ZETA 3B6EA 1Q1AA 1VSBA 3ZZTA 1USUA 2H59A 3IQDB 1G5PA 2FR8C 4CF4A 5EKDA 3PPWA 1Z07A 3N0VA 3NEYA 4UZEA 5G53C 1EVJA 4NMLA 5AW5A 3QLUA 4DABA 4DUGA 5B57C 2IU4A 4U7FA 4MI9A 5HKBA 4J0CA 1SXGA 3LQ4A 4ZVNA 5HCIA 3TBHA 2C3YA 3MTBA 2B0JA 3VU3A 1L2TA 3UCXA 5ICEA 2I80A 1N6PA 1P7VA 5T64A 3TZQA 3P52A 3AVPA 5EE0A 4GI2A 1QIIA 4ZI7B 4L07A 1D1PA 1YWGO 4QDZA 5AJUA 2PO5A 1BXRB 3L7DA 1HLGA 5DK4A 2YH2A 1GNSA 3ZX4A 3DEKA 4QOHA 1W6UA 3DZIA 5C9ZA 2GCNA 3QUAA 3TE7A 3V7WA 1NVBA 1VCIA 4DYHA 4RTPA 1JE1A 2R85A 5EXEA 5FWDA 1WSDA 1RXIA 2GASA 3PWKA 3A2MA 1I1NA 4HEJA 4F9GA 5GINE 5EHIA 2D2FA 3OO0A 2IS2A 3OQIA 3K0BA 3CRQA 4HK4A 4LX0A 3K09C 3HU1A 2YVKA 4UE3S 2PMFA 2OD2A 4HGRA 4TQUS 4UCFA 2JATA 4EO9A 3TUIC 1SC4A 4WINA 1TK9A 2A9RA 4L7VA 3T7DA 3G02A 5HRAA 1OIXA 4WT7A 5JAOA 3R7AA 1RWXA 1JHUA 3SIRA 5IARA 1BVUA 1ZRNA 2C7OA 2X9VA 3ONVA 5CVJA 3RSZA 1BWRA 1K4YA 2ZTSA 5BW4A 5BXQC 2CNNA 1VIDA 3D4LA 3OPQA 2AG1A 4FCCA 5KNDH 5EE9A 1OT3A 3WC4A 1P81A 5BWCA 2V54A 2ZJBA 5KOHB 1EJ2A 4M8LA 1OAAA 3Q0IA 1NJ2A 2IHVA 3AHIA 3DPIA 2Y1LA 3EWIA 2YVQA 1CRLA 4L15A 5IH3A 3DAOA 2GTHA 1XDSA 1FYEA 3NHYA 4PWYA 1L6IA 3V4PB 4I3HA 1TW3A 1H8HD 4DJEC 1OTHA 2FPGB 4L4XA 4UAVA 4NZMA 3R5SA 4MWZA 1FK8A 1ENZA 1W36C 2H1FA 3RVMA 4BQIA 3Q3VA 3H99A 2ZPAA 5AJYA 2A9VA 2P78A 2AC2A 3OEWA 4JJEA 2GPAA 1G3RA 4DV2B 1KPGA 3HK2A 4E5UA 2C2YA 1AS3A 3OZRA 4RXMA 2N42A 4JASB 1C30A 4LN1A 1GDTA 1AMOA 4KIUA 2AKEA 4N7BA 1P2SA 3JALB 1ZBDA 4JLDA 4K9KA 4LJSA 4R0MA 3PT9A 3S5JA 4BDTA 2ON6A 4YAGA 3BQNB 1ISIA 4CVNA 4JP8A 2PEZA 3CUEF 3JASA 4N4AA 4P3PA 2DSNA 2GD0A 4LW8A 4N65A 1U2TA 1P17A 3ENVA 4LRWA 1FZQA 2QSYA 3CLUD 4GVXA 4N0DA 4RS4A 4TROA 4KQ6A 4CM4B 1YR8A 3THWA 1JQKA 4P93A 3Q3CA 1SRRA 2AMJA 2QN7A 1A95A 3DWGA 4CLXA 1DARA 2WT4A 1WR8A 4DEXA 4POOA 4DLBA 1FMFA 2ONJA 3BGVA 4Q1FA 3HBMA 1GFIA 2F17A 1CEQA 2NZXA 5CW2A 2P30A 5ALNA 4GOOD 4NPAA 4B6JA 1IC6A 1OWLA 1MEJA 4F3NA 1I24A 1AQIA 1GUZA 1PZEA 4M38A 3WB2A 3F5MA 1IY9A 4L9RA 4DMGA 1O77A 3W1WA 3GAMA 1M1YB 2JCBA 1NZDA 1PZHA 4X1KB 3RUEA 4ANFA 5KVQA 3GF4A 2F62A 3AVYA 4DZZA 1T4DA 2OK7A 4UEOA 5CM9C 1QOPB 4TPKA 1YAJA 1I5OA 4M87A 1H0HA 3EZLA 4ESEA 4N3NA 2B69A 5EHNA 1USKA 1P5JA 3MCAA 4KR7A 2XTJA 1UM9B 1FU7A 3IO3A 4AD8A 2BM8A 4UNPA 2WUFA 4TUYA 1NJ6A 1UDXA 3DWEX 1YQXA 2IV7A 2VDNB 3R23A 4JT9A 2WFLB 3WRVA 1IUNA 3DV0B 3FWZA 2IYWA 2PIDA 3DMFA 3HWX1 4K9RA 1X7YA 2IIPA 3KJFA 3HB1A 2WVHA 2X3UA 4I9HA 5JO9A 3UUEA 3GUZA 4KLNA 5IX8A 3A6DA 2P77A 1ULHA 4TV8A 5JBIA 1O8CA 2OCIA 1M6YA 1U0TA 1OOEA 3DQPA 1QNFA 3PIRA 1XU4A 3KV1A 1Y5NA 4JLNA 1LF0A 3VOSA 4UPEA 2GYVA 2C5HA 2QZ4A 3EAGA 1SCUA 1YDEA 4Q82A 3W06A 1EB8A 1QGUA 1S3IA 2J6HA 2YWRA 3CR8A 3FDZB 4ILEA 5CCXA 3TOXA 4M98A 2XB2A 5HKAA 1R4MB 1RKQA 1PIWA 3IEXA 1YZ3A 3ELUA 3Q4GA 3C43A 4NYMQ 2R8RA 4P31A 3OU2A 4EYKA 1FP1D 4INPA 5LP6B 3FCSB 2EL7A 4KMRA 1Y42X 3O73A 4JR2A 4TMXA 4A3SA 4F45A 1ZCFA 2H17A 1KDZA 2ZUEA 1GU1A 1WG8A 4PZEA 3FD8A 3TKAA 3QVXA 1K4MA 4AFNA 4EY6A 1GA1A 2O8BB 4YRNA 4WWHA 1Q5PA 4ADSG 1ZW6A 3N8KA 2GYWA 3W5SA 1Z2NX 2V0NA 4KBYA 5I7OA 3DO5A 4FYIA 4ND8A 4EUFA 4NS1A 4IWNA 3A9UA 2W11A 4MS1B 1PNQA 1S8FA 5B3JA 4DIEA 4F38A 1X1AA 4ND8B 2BN4A 3UVEA 1Z4NA 4YCSA 1DI0A 4BBPA 4G0QA 4FBMA 1PGJA 2P9FA 3TW8A 4DUGD 3BGDA 2B5WA 1CFZA 3RYFB 4UM7A 5C37A 1JAYA 3L5OA 1QK4A 2EWMA 4LZAA 2IIBA 2XW6A 2V4MA 2FFBA 1QAMA 1CUZA 1E5VA 2AOTB 2GPJA 3KFXA 1C4WA 2RJ3A 3IAUA 3SICE 2ERCA 3WLHA 3G8BA 3JD2A 3FCAA 3A6GA 3M82A 1JLLB 5HUHA 1MC4A 3F6CA 1E3LA 2H1CA 2O1XA 3MA0A 4Y9RA 3OX1A 3NOVA 4OK3A 5DM0A 5B1IA 1H2XA 5DSTA 2WJ6A 4E5DA 1KK3A 2GQ0A 5DB4A 3E9EA 3WYEA 4XE5A 3QXHA 4BN5A 3KSBC 4WFKA 4Z53A 3RRNA 3B3FA 4O4LA 2GI4A 3AIOA 3NC1C 1U81A 3O2QB 4NECA 2W6IA 5ALFA 5JR3A 1XU9A 2BHNA 4F1KA 3PXGA 4HYYA 4LYFA 2GO7A 4QPDA 3ND6A 3TTVA 4NG4A 3MJRA 1L7XA 2X9NA 1OH5A 4OA8A 3OI7A 2EJWA 3RROA 4XGKA 4YACA 4AURA 3CZPA 3R0ZA 5DJ5A 1J97A 5BR8B 2R5NA 3T4PA 3FFTA 3GJYA 1TECE 4AX8A 3EULA 4LA4A 1HUQA 1THMA 2EKZA 5LMUB 4Y2HA 1XTVA 1L8XA 2AEMA 3LW7A 3L8ZA 4FMDB 4V1CI 3IJEB 3CH5A 5AKEA 4LXGA 3HO8A 2C5EA 5IJZA 3RF6A 4UFOA 1DG1G 1R16A 1VHQA 2Q6IA 2O7RA 2CVOA 1QRRA 4JL5A 1NLMA 2JFFA 1E6KA 1U2DA 2B4KA 3DKRA 1M7HA 1U0RA 2SCUB 3GFBA 4N6GA 2ZRNA 1Q15A 1J9GA 3W77A 1PK9A 1DFGA 2J45A 3T5MA 3AV0B 1GGKA 2OGWA 5GVRA 1G4AE 5DHFA 1GTRA 1U9IC 1E98A 1PHPA 2IZ5A 3B5JA 1P6UA 3Q3IA 5KEIA 3VNVA 4CM7A 2YV1A 3LHFA 5K51A 1HLPA 2EBUA 2IYUA 3L93A 4C4RA 5ERYA 2V55B 2YWJA 1XU7A 3ETJA 1UBFA 3MCVA 1JTFA 1OFUX 1H1TA 1NN0A 1PF7E 3E2MA 4C4OA 2JZCA 2P41A 3A9TA 3KU4A 1W85A 2WAOA 5ED0A 4BNTA 1OWPA 1RBQA 1YRLA 5EJEA 1CZHA 1N2JA 1QV6A 3LQKA 3SX2A 6AT1A 3JWPA 3W9UA 3S0JA 1OFIA 4EAQA 2VZ0A 1AKTA 1E79A 2F7SA 4YP6A 4X90A 5BYBA 4CRWB 4BCCA 1SHKA 3QKTA 4QU8A 5A5GA 4Z1MA 4CTMA 3RUAA 4PW0A 2IY7A 1T1EA 3DT8A 5A6SB 3BC1A 2AG6A 3A32A 4F6RB 1KORA 2A9QA 2Y71A 1ACJA 1K1EA 4Q9JA 2Q3MA 3ZGYA 3RLFA 4CLDA 3E23A 3LRTA 3ML1A 1BXGA 4KFTA 1CUYA 1JMYA 4G84A 3ADCA 3QU4A 4XCVA 2J9YB 3QPWA 4FT2A 5EP2A 2PV7A 4A6DA 1ZH2A 5F76A 2DFNA 4UTOA 4F97A 2FPLA 5A3SA 3GNQA 2MMGA 2OO3A 4UDXX 1F9AA 1GO2A 1U3DA 3NHWA 1ST3A 1EKXA 1PJTA 3T5CA 1EFPA 1S1CA 2CXUA 3SC2A 1SZDA 2O1SA 4ZZ3A 2D4AA 3NATA 3PDHA 2XNJA 1KS2A 1O0SA 1PZXA 2GCEA 3MBIA 5AHOA 3RAGA 5JSQA 3EBPA 3ZU6A 2CV0A 4DYVA 1YRWA 1CDZA 1GV1A 2MMCA 5C8YF 2QJRA 2RC6A 1O0BA 1GSAA 3NRBA 3BMCB 3EZFA 1U2GA 4D6XA 4EFLA 3BBPA 4CQMB 4PYJA 3JQ9A 2F3PA 3LY8A 1J90A 4X7PA 2OT3B 5E7IA 1AQ6A 2M9MA 1R8QA 4HOYA 1MOQA 4LDZA 4N47A 4EI2A 4MIEA 2F1OA 1JJVA 3RADC 1CZNA 3R7WA 1S8AA 4V0ME 1I9CA 2CMKA 4EJ0A 1GDDA 3FROA 2IYVA 5IKMA 1ZRHA 4DIMA 3CKKA 3S2IA 2ZRAA 4LI3X 4R4JA 2CFCA 1SURA 2JJ2D 4BKMA 3QKRA 1GRRA 2CLMB 2GVNA 2RK4A 2GUWA 2FW7A 3GPIA 2HUPA 4IIUA 3DDNA 3U1BA 2YMPA 1Z2PX 1VLMA 2RG1A 3N59A 5BN4A 3EHEA 2X0IA 5ILOA 3WLNA 4H6XA 3GNSA 2JCGA 4Q9IA 1JX6A 2JFVA 2WJHA 1ZD2P 3FSEA 4J8PA 3GFFA 4LHYA 4KQIA 4X54A 2GX6A 1E66A 1DKPA 1D9XA 1KEZA 1YA4A 1KK1A 4Z2YA 4LY9A 3ZDEA 1GQYA 3HVHA 4F6CA 3A4YA 1LX7A 1WMFA 4KDEA 1G2IA 1SBTA 2EU8A 5CAEB 1RQLA 5DTMA 1PVOA 4HNHA 3MWJA 3TCXB 3KVVA 3RDPA 4B40A 4F8EA 3LLCA 3SOZA 1DP4A 3DEZA 3ZE2B 5HFJA 4I66A 3FFWA 3T9DA 1MZPA 1PKXA 4F5EA 1STOA 3UJ6A 4BDSA 2XNDA 1LPMA 4HVLA 2HWWA 1D1TA 4FQ5A 4M0LA 3W4IA 3U5TA 1FDVA 1JA9A 1NBMA 2X13A 3R7SA 4E22A 4FJ1A 4LQ4A 2YBDA 4D0LB 5CDTA 1H8EA 5HE8A 2AK3A 2AYZA 1CUSA 1YI1A 4H0FA 2P5TB 3FSJX 3ZWNA 1JFFB 1U3FA 4CTNA 4JFAA 1QC5B 2AIRA 1DQPA 3M6WA 1D0VA 5TS3A 5DHAA 1N8KA 2XHEA 3CNOA 4PO8A 5GV8A 3S4YA 4DAOA 1EXVA 1PSDA 1Y0BA 5BVGA 4CEJB 1ZCJA 3CVJA 5DTEA 3UMJA 2PMBA 5E7MA 2W6ID 2DXIA 3BB4A 4R2JA 3KE9A 5FWYB 3ADDA 3NBXX 1YCGA 1Q84A 2Q6LA 2FK7A 4EFNA 4AKTA 4JIGA 3WTBA 4HTFB 1UH5A 3B51X 1VL6A 2CNKA 3MCUA 4DLTA 2ZRCA 1R6DA 2QUAA 2ZIAA 5B58C 1HDGO 1HSZA 4Y1GA 2GNAA 4UMEA 1RAHA 3Q85A 3VJLA 3HWSA 1X3SA 3IIEA 2BFFB 1HNNA 2MYUA 1WHTA 1DEAA 1SZJG 1T34A 3DEYX 4RY2A 5DYNA 3TL3A 4BMXA 4Z54A 3E5HA 1GVHA 2IYFA 3FF4A 4IFBA 1VL5A 4KN8A 2ZM6B 1ZN7A 3ESDA 2V6MA 2FN7A 3BF7A 1Z3IX 3OOYA 4L57A 2GZMA 1KI9A 4RA9A 2VR1A 3HP7A 4B71A 4WKPA 1QZXA 2A67A 2HCBA 3WQHA 1GJRA 1F2UB 3H2JA 3L4EA 4OL0A 1KYXA 2W2XA 1TCUA 3CYFA 2AQ8A 3HYSA 3KSZO 2VJMA 1TXGA 2EBHX 2W6MA 3K9NA 1MQ8B 1RKUA 3VISA 2C61A 1X8JA 4LF6B 4GP9A 5A4FS 1QHEA 5I9TA 3ENKA 1L4MA 4Z0NA 5LQAA 4G0NA 2VAMA 1WZIA 5DOVA 3WYDA 3QBVA 3KD3A 2Q4DA 3O4GA 3VYTB 5BP7A 4RFLA 4EY4A 3LUDA 1JHMA 2E2WA 3ANNA 1XZGA 5EP3A 2OENG 1IJBA 4TTRA 4WHMA 5TMEA 2WYUA 1EGMB 4K1XA 3WLRA 1KYZA 2ZTVA 5CLQA 3DDHA 1NX9A 3K9WA 1IH8A 1VE9A 1N3YA 2R6R1 3I1IA 4X8HA 4LC9A 4ETNA 1HEUA 3IESA 5SY4A 2UYYA 4KNWA 5IN5A 4JBXA 5ICSA 1C9KA 1R9MA 1H5NA 1Q1NA 3ID6C 3JD4A 5BN1A 4CHGA 1MTZA 5JYEA 1E79D 3AIKA 1MB4A 1X87A 5BSWA 3AR9A 3ZY5A 4XYEA 4G9BA 3ZV7A 3DBHA 4DMCA 4Z1MD 3DBOB 5BN5B 2G1KA 1LPSA 4L75A 2JCYA 3NJRA 1BE0A 3WYCA 3UGKA 3GJ5A 1RTKA 2FA9A 5ITSA 4XDHA 3VR4A 1PU2A 4J90A 4KZPA 5AKYA 5FJIA 4JYMA 1ZH6A 2BKUA 2MSNA 2OPBA 3FJOA 3IB3A 4Q3EA 4CL8A 4G07A 1E6EA 4MUNA 2MIIA 3VH3A 1HE8B 4Z3KA 1CY7A 2ZBEA 3V4LA 1UK9A 2OGSA 4J91A 4OAQA 5A4DA 3TUZC 2JI7A 3EXHC 3ONDA 4KXFB 1N2CB 1P4AA 1YSCA 3KLNA 3M2PA 4UOQA 3A36A 2Z58A 4G97A 1KAOA 4P84A 1M9NA 4CCYA 4WJLA 1JI3A 1ZW1A 2H2HA 2XD9A 3CH4B 1GPKA 2GXAA 2C4KA 4ZTUB 1QUFA 1BDBA 2PDAA 5J63A 2ZRKA 3ITEA 1CUIA 2R97A 4M76B 4QNRA 4EVRA 4QG3A 1O94A 2H85A 2QNBA 4G1MB 4J3FA 4D5GA 2VP0A 2GZ1A 2IOYA 3JYLA 2FSSA 4YJDA 5EFZA 5JZMA 3Q0TA 3QE2A 4WEQA 2J9ZB 1CVRA 1NI4B 1HFKA 3T1YB 4RKWA 4G9EA 1LJUA 5FQOA 1A04A 5LXTA 3FOFC 5LA6A 3AUAA 2J3DA 3DLAA 1V3VA 2O59A 1RAGA 2QTNA 3TOZA 2FMFA 1JKXA 1QPBA 3R41A 1I14A 4LWZA 1SD2A 2RIRA 4L0QA 2DAPA 4OBWA 2PX5A 5DN6D 2V0GA 3E3OA 3D8SA 2B34A 1H6CA 3HFRA 1HTWA 2PU5A 3EE6A 2D3TA 4HDSB 1EBFA 1UOPA 4DCPA 3R9XA 2X6TA 1ITZA 4PPGA 3RYIA 1ATIA 2HA3A 4BAZA 2XF2A 1E1LA 3TVDA 2HD4A 4GO1A 4B9AA 1H4QA 3K31A 3W4JA 4TWZA 1G18A 3VHLB 1TYCA 5F78A 3IPLA 4I9UA 2KJQA 1EP9A 1BWPA 4QEZA 4UEWA 4FCVA 2BMJA 5KAMA 4ZDWA 5HZKA 1ZLXA 5G1NA 2D5IA 1NXXA 1UF9A 3H5AA 4ZZ0A 4G5YA 3FPSA 4CIBA 1PFWA 4D9JA 1LU9A 3QPBA 4BU0A 1LBQA 2PQ6A 3HB7A 4I5IA 4UHFA 3FPFA 3H2YA 4YRMA 3JR3A 2IPOA 1NRWA 2HLNA 1YRHA 1CDOA 2XRFA 4EITA 3SBEA 1TO6A 4MW1A 5CB6A 4F4FA 1MB9A 1XZLA 1AN0A 2VK2A 4Q4HB 1IEWA 3F97A 4FX2A 1QLWA 3FHJA 2I2DA 3WIBA 3I32A 2XNDD 2W58A 1K9VF 1OHHA 1ESNA 4QXRA 1DADA 5T3UA 1PNRA 1NBMD 1ZKDA 2FSVC 2V9CA 2VNIA 2SKCA 4GWLA 4CMKA 2Q3LA 3KTFA 4INOA 1RLOA 1JQAA 3DV9A 2AF3C 3GQBA 1Z4KA 4U8HA 4ARVA 3IMEA 1NY5A 2AR0A 2A92A 4CIVA 4PAMA 3V8MA 2DUJA 1WUTA 5K5EA 4QDJA 1C2YA 1EG2A 1SNYA 2AFVA 3NALA 4TQGA 1W29A 5CHYA 2MYPA 5DYGA 4LYHA 3ZNQA 2KLBA 3ZY3A 3KBOA 1NJGA 2GERA 2HW8A 5C7OO 2VCEA 1ZOPA 1E4YA 3WYAA 2JGMA 1Y3CE 3PBKA 4O59O 3G5MA 5FI1B 2Q5LA 1JDZA 2FCAA 2OYRA 3OOHA 4LF9B 1RWOA 2ZXFA 3JQGA 4R9SA 1FRFS 3DE7X 1U2QA 3VPXA 2NUPB 3JQGB 1W5AA 1UZUA 4GZ6A 5LZ5A 4E3WA 4U5QA 2VZ9A 1KOFA 1WAMA 4PNZA 3MXOA 3S28A 2CF6A 2OR3A 1A9OA 3MT8A 2Q5FA 4X8MA 2V4UA 4RDIA 3H4IA 2ZYIA 1GZ3A 1PG5A 3CNQS 1Z08A 3SZGA 4W82A 1H3EA 3U3DA 1NBEA 3LHIA 5F3DA 2W9XA 3B89A 3WGHA 5C5EA 1N1MA 2QUJA 3DE5X 2P2YA 4NEGA 3R0JA 2HA4A 3VSEA 3I09A 1JAZA 4N41A 3LO8A 3K30A 3K0SA 4BX2A 2HWUA 3C7DB 4KRXA 2Q5QA 3DT6A 1ZGBA 2H1SA 4D79A 3T4XA 1O5OA 3A37A 5HSGA 1ZH8A 2WSSA 2WJ4A 4RTSA 3DE2X 1NVTA 1EZZA 1PG2A 2J67A 1QCCA 1ZN2A 2HQBA 3IILA 1Q50A 3HBLA 3FM9A 3TWOA 4DSUA 4DQVA 3HCWA 4J6FA 1IWOA 3ZVNA 3DR3A 1AKYA 3IV6A 1E0KA 1T1IA 3OZAA 4IF4A 1UJMA 2HU7A 3TLYA 1O7JA 1D2EA 1H66A 2A30A 3O4RA 4J2OA 3L5KA 1BH2A 2PRZA 4FHCA 3SHWA 3IBSA 2FQXA 3D1LA 4WFJA 1LBTA 4RNDB 1Y5LA 2C83A 3DGEC 4W9NA 5AKLA 2IBMA 3ZK8A 5BR1A 5EIBC 5J58A 2FWNA 5I45A 4MRMB 2E5WA 4G0ZA 5IYZB 1U0FA 5FBWB 4AYWA 5KTTA 5ECYA 3QKSB 2CL0X 3TMYA 1BCSB 3C6MA 3FTCA 2BT4A 1BROA 4R2MA 2OFXA 5HF8A 4CF6A 1J23A 4AZ3B 1HSOA 3I1YA 2CCGA 3ZQ6A 3RUFA 1AU9A 1FY2A 4M1EA 1IK4A 3X1KA 1VXRA 3NIGB 4QUAA 1IZ0A 3OZCA 1KJJA 1V1JA 1FUYB 2F3TA 3PWSA 4GR4A 4IDDA 3ZBUA 1DPFA 3ZU2A 2H9YA 4EBBA 3VPFA 4RORA 4EFDA 1KL7A 1JTEA 1LI4A 3COJA 2OZLA 2X2OA 3EMVA 2C97A 3GLIE 1BMQA 2AB0A 2ODNA 2ZWOA 3HPQA 4Q1BA 3WNDA 5I9NA 3F6BX 3SQXA 1TVMA 3LP5A 5T6BA 4HYTA 1E1DA 1HEYA 1ODCA 1AS2A 3PUIA 2YN2A 4BRWA 1AMUA 4IDHA 4B82A 1ZY2A 2A35A 4AIRA 1HDRA 4JSYA 4BNDB 4WJKB 3LOQA 2DHCA 3SE7A 3B82A 6GPBA 2IU3A 1VHJA 2BF4A 3HUDA 2I5PO 2BMFA 5JOQA 2C1EA 3VTKA 5JTTA 1AKEA 3SBOA 3ZIUA 1F2TA 1E59A 1W4AA 2R2GA 3N2GA 4ISBA 3W8DA 4EVQA 4EY3A 2NSHA 1Y33E 5TEWA 2HC9A 4HZGA 4R0NA 5MHTA 2DPYA 1Y6FA 1KO8A 3C8DA 1GCGA 3COYA 3U13A 4DKJA 4OB8A 3SIWA 1YR2A 5IXJA 2O8FB 6REQA 2BTQA 2O6HA 5CYFA 3W1EA 4X3OA 4Y2RA 2OYCA 3RT9A 4BMSA 5COBA 4RV5A 2HLHA 3HDVA 3WBBA 6REQB 2PH3A 4YB8A 4G0VA 1E5TA 1TQ8A 3TD2A 4YV2A 2VPPA 3KOZA 5JEEA 2X2FA 3RODA 1PJZA 2CWWA 2OCGA 2W2PA 5IBRA 2W6CX 3HV0A 3RCBA 3ZR4B 1U3GA 3WLMA 5AI4A 4LISA 4NU0A 2ZR7A 2YS7A 3NRJA 3PL1A 4KAJA 2J9GA 4L6IA 1P1CA 4C6HA 4ZMSA 4XW2A 5B1EA 1F8GA 5JDIA 1B1AA 1YR3A 2ISCA 3EVFA 3Q7RA 1XQYA 4MQEA 4OEHA 1UEJA 3O2NA 5FBKA 5A3RA 4PVCA 3G2LA 1DDIA 1A2KC 1B6GA 1E9EA 2Q4EA 3GL9A 4KUEA 4LV8B 1SG6A 1YR6A 3P45A 4M86A 2AYXA 4C1NA 4D9GA 4N9WA 4BLTA 2C2HA 3VR4H 4F8YA 3F78A 3JTEA 1PL6A 2C03A 3NWPA 4NMMA 2TECE 4WA8A 1GEGA 3OZTA 1UZMA 1XDDA 4NXMB 1R6TA 1D0SA 1VLZA 1ATZA 4FZRA 2P9GA 4U9UA 2IU0A 5A7GA 1T25A 1WW2A 2X0NA 3UJ8A 3CE9A 2W8BB 4KP7A 3A0UA 4MUBA 2A1UA 1DT3A 1OJ7A 3BTOA 3BICA 4LZZA 5DCLA 3RIMA 2B7BA 1WDMA 1YMUA 2ZP1A 4HJXA 1UPFA 2A1UB 4JXZA 5AESA 1NN5A 1P62B 5CCDA 1MAUA 4QIHA 5CA1A 4EUHA 2VI5A 5THKA 1YS9A 5H7XA 1WSAA 3NUGA 2NYUA 2HSDA 2VBCA 4MVJE 1IK6A 3LLSA 3T7JA 1J9ZA 3L7CA 1M2VA 4AMBA 1ORRA 1W0KD 1KZHA 2PK3A 1UAAA 2C7PA 4F3KA 5D6OA 2OCDA 1Z2EA 1OHHD 4NWIA 5BOSB 3M3PA 1EA5A 3PDIA 5G1OA 5HEKA 2BEVB 1SBCA 2E37A 2HUNA 4YQEA 4C20A 3EXFA 1S8OA 2P9TA 1HYHA 1BMDA 4YI5A 5IUJC 4E21A 5LOVF 5I7AA 4R54A 3ZJVA 4KGVA 3EXFB 4G41A 4TMFA 1V1RB 5DLPA 2VYFA 5KYXB 3UFBA 1XELA 4CLRA 5K2OA 1U2ZA 5ED4A 2JGIA 3L6CA 1RI3A 1C29B 4I50F 5CRIA 3UXMA 3AXTA 1JR6A 3KWLA 5KBYA 4CR8A 1TQ6A 5J4YA 4JC0A 1LK5A 2J87A 4Q15A 1KIFA 3B3JA 5M7EA 1SH7A 1EK0A 3A6HA 4G1FA 3LSTA 4KAAA 1LV8A 2GMWA 4CU2A 3HB4X 1Q3HA 1RI5A 1RQGA 5JASA 3PQ5A 3GLUA 1VC2A 2VK8A 1JECA 1FP4A 5C8YB 2CXTA 1R0RE 2H92A 1OXSC 1X2EA 3OTOB 4BV2A 1XV5A 3KQQA 4H1VA 2QN9A 2X4IA 1M5TA 3F98A 3QV1A 4HAWA 4YLYA 1XZ8A 3N0TA 1XNRB 4DVGA 2FCRA 1G7CA 4MEBA 4BKRA 3AP1A 1EFAA 4HNVA 3VO1A 1R50A 4M9XA 5HCNA 3TE6A 1SUIA 4C3ZA 4BFSA 3EEQA 2GBPA 4IDAA 2IHYA 5JJBA 4PPQA 2HIMA 4BNJA 4TWBA 2GN6A 3BTUA 3U62A 4IDEA 4D3SA 3WWOA 2P9CA 4KI7A 5A7HA 1U4NA 5KYTA 3WOVA 1DCKA 1Y6ZA 2IHJA 4RESA 2CB0A 1M72A 1SQSA 4DFDA 3PJRA 4UASA 2RHDA 1BKSB 2G09A 3LUJA 4KXNA 1C80A 1DDOA 1IY1A 1XE3A 3B2EA 1PS0A 3DYIA 4NFSA 5DV9A 4C03A 2HPZA 3V8NA 2VJOA 4J7AA 1WZEA 2AR9A 1FTYA 2XNHA 3UMBA 4DNPA 3ND8A 2XUFA 1P4HA 4K9OA 3LCUA 4OXXA 2IXFA 3RRXA 2WJAA 3C7CB 1F3LA 1Q21A 2HA7A 3WNBA 4HZUB 1UDCA 1EJ6A 3AF3A 4N7RA 1H0RA 3ORYA 3W5BA 4GICA 3OKAA 4UBKA 3RWMB 4RD1A 1KSGA 4EPXA 1TL7C 3W5UA 1H0SA 4MP3A 4ZQEA 2A33A 1J2UA 2CLEB 3LUHA 1H1LA 3O4JA 2WWYA 1UDWA 1EB9A 2XWQA 2I9PA 1EUCA 2Y9PB 3OURA 3R0VA 1Y6RA 3JYQA 4TV9A 2QUZA 2NOAA 4PV7A 5A6VA 3EDCA 5ITZA 3AVVA 4GGPA 4PFQA 4IUDS 5BQ5A 2C3OA 4KBGA 2GM4A 4X7RA 4L3WA 1GUDA 1TUGA 2WM9B 1HDEA 1VE3A 1FBTA 1ZICA 3A6LA 3CH6A 3I6QA 4JQCA 2QAIA 1SD5A 4CEIB 4D80A 2G4LA 2FSIA 3CLHA 3Q7PA 1NBOA 1FB5A 2X3YA 5EHXA 4RWEA 3VM6A 1CRWG 1EFDN 5C8VA 1GGFA 1IZ7A 2GNPA 4JOSA 5MGNA 2RGDA 4ZOCA 4GI5A 1UJCA 6CHYA 2H0QA 3RU3A 1PNOA 5E9AA 1X9IA 4ZVSA 2P9QA 4QXPA 3TJMA 4Q66C 3HEBA 4XVUA 1P44A 4N3GA 1E3DA 1JDJA 3C24A 4KQWA 2LXNA 3NIDB 2G07A 5DGCA 4DSNA 2Y76A 2HGZA 5HOQA 2JBAB 1O8BA 2R00C 4GW3A 4HXEB 2I7TA 1TCBA 3INTA 5AOAA 1VGQA 2B99A 2Y66A 3TPCA 3RVBA 4D3YA 3GLSA 3ZZMA 4MS3A 3UB2A 3PNOA 2YYAA 4NOMA 2QSUA 5FA8A 5B6JA 2J5QA 2PWYA 3VGPA 4W5RA 2YZ2A 3RHZA 3TRIA 2W4IA 1G9SA 2AJTA 2NYRA 1RHKA 2P9HA 5GJVC 3QBJA 1X7DA 2HT6A 4DIBA 3G82C 2YFQA 5IK2A 3KZVA 1KDPA 5IAOA 2VYNA 1YUNA 3P2EA 5JUWA 4PRZA 3X1WA 1N5RA 1Q77A 4D3DA 2KYRA 4WN3A 1YHZA 3F6EX 4U7DA 1LZLA 2GXSA 3LLVA 5JD6A 3G8YA 2FPOA 2UUAB 1EQUA 1QH9A 2HK9A 2C2WA 3L7IA 3GH3A 2C2KA 2IUEA 3N2LA 4KXXA 4DBLC 3EZ2A 2AX4A 3GLGB 2G77B 3HCAA 3N3BC 2IHNA 4IZ6A 1HLFA 4FXPA 2NXCA 1CR1A 2G70A 1C41A 2Q5JA 2CHEA 5JBNA 1SU6A 3VNRA 1SK9A 2BFEA 2FZKA 2QQFA 3H9UA 1HT0A 1SKQA 2CJPA 1KC3A 3N76A 1NOKA 2BEJA 1T5SA 2CXQA 3X1JA 3ZHRA 2FF7A 1AM4D 1AKMA 1YDWA 4D4JA 2HU8A 5IDWA 2LCQA 2OXFA 1MW9X 2WTUA 2W6OA 3C6XA 5AD1A 2ZR0A 4C2BA 4R01A 1FJHA 3MERA 3IL2A 4C0SA 1E2DA 3LX8A 2QAJA 3KVOA 4ZHQA 4KPUA 3I64A 4BRUA 2GKSA 1R0CA 1BCRB 5F23A 2R0QC 3DULA 3JQEA 2XE7A 3HUTA 3IUEA 2JVIA 3HVKA 1GGJA 1RQNA 4J4BA 3U60B 4MTLA 1DZ3A 3KVYA 3WK4A 3JQ8A 3NBAA 3F4LA 5DDIP 4RA6B 3I9LA 3NPAA 1V25A 2PWPA 4RADA 5J59A 3RRJA 3WIDA 1FF9A 3NTLA 5CXUA 1TEXA 3ZDCA 1JJ7A 4MI1A 3AL3A 3OIVA 1N75A 3NTXA 5LSAA 4TMTA 4C7KA 1U9ZA 4YRIA 4KREA 5DLDA 1DRVA 4C6TA 4KV9A 3EGCA 2WTMA 4B73A 4FOPA 4OI4A 1CQZA 3OJFA 2H31A 1J4AA 3AHDA 2PSEA 2B6NA 4L16A 4FYJA 2ZSBA 2VCHA 2X9QA 3L0PA 4L8LA 1D1QA 1Y82A 4L02A 3TTXA 2P27A 2ID4A 1YBMA 3H2ZA 5A0FA 5B30A 1XTBA 2QI9C 4XYGA 4RMJA 4DA6A 2OV8A 1P2TA 3G6WA 4JJZA 3WXBA 3SVZA 5L3QB 4ENRA 1CR2A 1FYDA 1RIIA 1QWOA 2FNAA 2EYQA 2ZSFA 1CZOA 1NMZA 4GH5A 4IS3A 4P6VF 5F5NA 5B58T 3A70A 4MRVA 3MFYA 2DBZA 2GDZA 3OU7A 4RH0A 2WTEA 4RQBA 1M34A 1RPAA 3LYHA 3NCTA 4QSHA 4CKCA 5JCZA 4UPDA 4AY3A 4EIWA 1JDSA 2JD2A 5IPFA 3KQNA 4HNAB 3AJ8A 1Q1QA 4OU4A 4AUKA 2Q3CA 3K5WA 3HKCA 3SZUA 3OAAD 1TGYA 2EP7A 3HZHA 3L79A 3R1IA 4JNCA 5JAIA 1JNXX 1X8KA 1CUGA 1JHOA 2C5AA 3HCOA 1WTAA 4N8DA 4P4LA 1WLSA 4C78A 1UODA 4F56A 2LPMA 5FTLA 4GPBA 3TKYA 2C0PA 2J5RA 3DFIA 3OA2A 4U7TB 3WZ2A 3FKSA 4D44A 4DPLA 1NF2A 2TSYB 3EXEB 4BXOA 2HK6A 3TECE 4YMTA 5LD2B 5C34B 1VIAA 1FFXA 1JZQA 2NSJA 4X85A 3CF2A 1XMOB 4YJGB 2XKKA 3S99A 3OE7A 4PG7A 4OUDB 4BAGA 1OZAA 4A23A 1NVDA 1LLFA 4CNQA 1WJGA 1K7XB 1E7YA 4ID9A 3B1XA 3I3SR 3H4TA 2E87A 3IUPA 1OLSA 3WHIA 1YIOA 3E1GA 1VIMA 1MA3A 2J3IA 1P7WA 4V03A 2FVXA 2JRLA 3UT5B 2XWPA 1VBKA 1MABB 3LBIA 3PPYA 3S1LA 3M49A 5TQ0A 4QDOA 4Z3DA 4MVCA 4IV5A 3ZVMA 5L4NA 3GEBA 3ISTA 3R0QA 3L6DA 4JHXA 1VYUA 1J99A 1H69A 1M6VA 4Q12A 1MKYA 2KW5A 3PXDA 1T8WA 4Q9HA 4DLLA 3HXPA 4L5IA 3WFZA 2WT9A 2PZAA 5H0IA 3YASA 3HP4A 3BE8A 1FVXA 3BAZA 3EOZA 1N5IA 5ALJA 3WSTA 1XQXA 3MWGA 4U7PB 3E1KA 1DXOA 2QUKA 5HZMA 1OMOA 1LVHA 3P9YA 2R9VA 4BNXA 4DMRA 4FX5A 2Z57A 4P92A 4IDCA 1MMFB 4DEVA 1F8XA 2G9RA 1RXEA 4FC7A 4GYYA 1QX4A 3HBJA 4R8SA 4CKWA 4OD0A 3LVQE 1JEYB 5F33A 3H3FA 2DBYA 3ZHXA 4PFJA 4CG3A 4ZOQI 3N2YA 2BCEA 1R18A 1XG5A 3TJRA 1A72A 4AKGA 1OKKA 2PY6A 4R9NA 1QVVA 5BSHA 4R68A 1QH1A 2DSTA 5IAEA 4F9FA 4L9AA 1OJLA 3PFBA 3PDCA 4IUBS 2RAPA 1AK1A 4GR5A 3VVCA 1R12A 3CWQA 3W6NA 3T54A 3WJ7A 4W8HA 5BW8A 1X7XB 3WLSA 5B6IA 2FOXA 1P2VA 3DH0A 5EAIA 1PJ8A 2NVUA 4KSCA 3PRKE 3GNLA 4N0PA 3M6UA 1ADJA 4MSUA 4EGFA 1D6SA 4ZAVA 5LM3A 1E7MA 1L7NA 3IURA 3PNYA 1S3GA 2NU7B 4TRRA 2ZAOA 3H3JA 3QVKA 5JWRA 2B30A 4QPCA 4DV5B 2IXGA 3U3MA 2QJWA 2QLFA 1FSSA 3N9IA 3U7GA 4P5DA 1N5OX 4YWJA 5JC1A 2YN0A 4FBGA 4HY3A 1TTHA 5IK2D 1T24A 1LB1B 3KB8A 4NNJA 1FW8A 2LDBA 2LWIA 4R69A 3U9TA 2GF9A 3MMXA 1EFCA 4ML3A 5HK9A 3OLVA 1ST2A 2CV2A 2ZI5A 4GHWA 3H42B 4MI6A 3ESRA 1RC8A 2DTDA 2DFVA 1ZLYA 5FO1A 3ZGLA 3WWPA 1V4NA 1X39A 3DVLA 1C1DA 1S02A 3PWZA 2JLZA 3H9CA 4DR6B 4BWYA 2ZUCA 2NNWB 1L5HB 1ZIPA 4HH0A 2IHUA 4ID3A 4MUFA 4OHUA 4R1QA 3VHRA 4XLLA 1EXDA 2LKCA 4BP1A 3R4CA 1JH9A 3D7NA 4IKOA 4WOKA 4PYQA 3A1FA 1NA5A 1Z0UA 2VHQA 2W48A 3DFZA 3GGSA 3QI2A 5DMXA 4AIIA 4ZIRA 5E4FA 4E33A 1IDOA 1ADCA 2YJ4A 5E2IA 5AUPB 2PKRA 4G1CA 1P60A 3DOIA 1IEQA 5CIWA 4Y9UA 4QVIA 4LX8A 3RC3A 2D2XA 2EIHA 4K8OA 3T1HB 1QK5A 1P18A 2OHXA 3FLAA 2V65A 2A7XA 3F8WA 4MKXA 1ISFA 3GFVA 3R3UA 4HUQB 5AVYA 1QVZA 2FRVA 2Q9AA 3C4QA 4LY3A 4X20A 5SICE 4Z6KA 5JHGB 3X1DA 2XB8A 3NS7A 2XB6A 3I0NA 1Y9ZA 2ZI6A 2FJUA 3UMRA 2FKAA 1X2BA 2NO4A 1Z4PX 2VTBA 3DE1X 3OC6A 5HUJA 1CF2O 1EFLA 1Q0LA 3ENZA 3W5AA 1QS0B 2H5IA 1HG1A 2D0DA 5DWDA 2IRWA 6LDHA 1B76A 3O6VA 4LOKA 4L2IB 1M2WA 2RHWA 3AU9A 2ZI4A 2UV8A 3CPJB 3P9RA 3TM5A 4BLPA 3JQ7B 2ZYTX 4HGPA 2WHEA 1MO2A 5DW0A 4F84A 1JB9A 4E0BA 3IFSA 1MENA 4U2GA 3AF5A 1GFWA 2YV4A 3WYFA 3PX2A 1JHXA 1CJTC 1JHYA 2C54A 2VK1A 4PXSA 3SZRA 4BIMA 4EKIA 5LB4A 3FDIA 1V6CA 2BP7B 1TFUA 4I55B 3V1YA 1ZU5A 2ZRGA 1KR5A 3S2ZA 1I4DD 2EFJA 5JCJA 1WDTA 3OCXA 3S2UA 1P77A 3IQEA 3JQFC 1YS4A 3U4GA 4B3DA 4DCJA 1N7IA 4G9GA 3Q1LA 3DE4X 3HN2A 2IHBA 1OYVA 5JDCC 3BHNA 3F8SA 4QRIA 3SOPA 1Y80A 2NUAB 2YWFA 4L7QA 2FK8A 3W1VA 1U2EA 1NMQA 2JAPA 3ZUPA 3KUDA 3VHXA 4DUPA 4UZSA 3QXJA 4I19A 2V7XA 4R1NA 5AOVA 3QE9Y 4C6SA 1KAGA 1NQTA 4R7ZA 5KMGB 4Q7KA 5G3YA 1PGPA 1ZMRA 2WMDA 2XVXA 4I6JA 4XWAA 4UM9D 1OQAA 1L4HA 4KH0A 5KSYA 5EP4A 5IKEA 2EDCA 3Q5GA 1KBZA 3BIOA 4IX9A 3IUSA 4LJ4A 2JLQA 3TX6A 3PFNA 2JLBA 3UUWA 4DLZA 4A92A 3GMSA 4EG4A 1WZ2A 4KHZA 3WMXA 1JAHA 1PL0A 1U2SA 4ZREA 2V8OA 4DG9A 3J7AC 3IR5A 3D6MA 1NSYA 5HM8A 4DV3B 2DP4E 4R0VA 3GXBA 1XTTA 1UZAA 3GPBA 2B9VA 4P4GA 5ALPA 4UNIA 4KFCA 2B8WA 2IEGA 1WMSA 1BFUA 3AP2A 3BWDD 1CUJA 3FNGA 5IC6A 4UHKA 5CITA 5CBPA 1ZGZA 4JBGA 4NP6A 4UDYX 1E62A 1G2PA 1S9HA 2DY0A 2J7PA 3C5WP 2X0FA 5K8LA 4D3ZA 3ZY2A 4HDMA 1WVGA 4DQ0A 4WVFA 3PU6A 3QW4B 4JOCA 3A6PC 1SVOA 2FXIA 2UKDA 2ORED 4ODIA 2RCNA 3GJ8A 4I81A 2A3NA 4E5VA 4WASA 2XGJA 4JUIA 2ZZKA 3SF8A 5IULC 2I3AA 1PVDA 1YB7A 4FD2A 5AO9A 3VPGA 3MAGA 1YS2X 2BFMA 4XDGA 1SG0A 1SEVA 1QF7A 3ONFA 4E7OA 5AM5A 2I4MA 5JNLA 4FFPA 2MOKA 3O92A 4D9EA 4B8ZA 2ONCA 4C0JA 2NVBA 4TWRA 4IJKA 2HDNB 2WIDA 3BWCA 4HG2A 3CLKA 5AQ1A 3T9AA 1V5IA 3GJTA 5EJ5A 1UMCA 2I3BA 4K40A 4RC9A 3O93A 1N7HA 5AOBA 3CRVA 1KQGA 3GIWA 4IOJA 1J5EB 2KLHA 3KG2A 4CT0A 4GEKA 5LOVB 4ESVA 1JWBB 3K16A 3FHLA 2B4TO 2OBXA 3H87A 2DWCA 2ZRHA 3JZMA 3LQ1A 3W8RA 4D97A 2UUBB 3ORQA 4KACA 5ALQA 1C81A 2XQFA 3RK1A 3T3DA 2NMVA 2IYTA 3HLTA 3PTZA 2Z1NA 3SIXA 3LBHA 1A5ZA 4MUJA 1DOZA 3UGTA 3EZ6A 3STVA 1RADA 1TQ2A 3MJHA 2ZJ6A 3WLAA 3N2NA 1C3OA 3O8QA 1LVUA 4TT8A 1PO7A 3V1LA 5CVCA 1TRHA 2QG9A 4MKRA 1MRSA 3N2KB 4FDUA 2MJLA 3ROZA 1Y5MA 5AI8A 1Z9BA 1QB8A 3KSDO 1QRUA 1Q92A 2G4VA 2IYLD 1XEXA 3OTWA 5IUNC 3PQ2A 3KKZA 4NYMR 3ZLBA 3AK4A 4XDYA 1QO0D 4H17A 3IAS6 1Z3CA 1LW6E 1NM5C 3ZE8A 5F1PA 3EN0A 4RBNA 5JD5A 4NQZA 3ZG6A 2C5BA 2DRIA 4ZT3A 1E4EA 4KK3A 4KQXA 5SZIA 4ZCTA 5BQFA 1U3TA 4DV7B 3KOXA 3NX4A 4YT4A 3B1YA 2V4ZA 5DNAA 1P1BA 3OCZA 1B2RA 5LNK6 1GPUA 3NR2A 1IJEA 1F0KA 1ZVMA 1GLVA 1KFBB 1GPYA 1IY0A 1X86B 2W2TA 3CS3A 5DTRA 4HC4A 4I4TF 3VJKA 1EVIA 4J0JA 4D4HA 2J0QA 4LHVA 4QBHA 4JQSA 3IVXA 4TOIA 2WF5A 5TPZA 1JQLB 3TRDA 3K9FC 4N5HX 5IFKA 3HJNA 2V5AA 2QVZX 4TSFA 2C99A 5EMHA 4UUMA 1WVIA 3GEDA 4OMCA 2RAUA 4C4TA 4GRAA 4R2KA 3KDSE 3QK7A 1O97C 2PMCA 1A9QA 4S2UA 5KVCA 10MHA 3I9JA 4DIUA 3BEDA 2G88A 2X19A 3HRKA 4O4IF 3VAAA 4G0OA 2PA0A 3KT0A 1VG1A 1C3VA 3H19A 2VJCA 3C14C 1AKQA 4CMJA 2HJWA 3C3KA 3D7SA 5M3BA 5K3OA 2PS9A 5KHOC 4GX1A 1AQYA 1EDBA 1IXZA 2DUWA 1TVKA 2JK1A 3P4YA 3PF8A 3R0XA 4JJ8A 4LCEA 2QTVA 4OIFA 2V5UA 1DO2A 5CJJA 2QTGA 4A16A 5BYAA 2RGWA 4EENA 5EJ8A 2PKXA 1JR4A 1NATA 1VZ3A 2HPHA 2PMKA 3CKLA 5D3MA 5BUSA 1T8YA 2FVYA 4ZJUA 4X6XA 5JH7B 3NHJA 1YMVA 3ZCUA 1B6SA 2GH1A 3DAGA 4MPTA 4I2VA 1ZJ5A 3L7NA 4W5HA 3UW1A 2LIPA 4J0HA 4X7BA 3UXHA 1CUWA 5K0FA 1TZJA 4TYWA 1RBYA 1GOTA 2VKQA 4JLSA 1LTKA 2Y1CA 2ZATA 2EHDA 1R6BX 3HNOA 2JIZD 1DELA 1T4MA 2BGJA 3G0DA 2JD0A 2F43B 3O8LA 2PX3A 5ERXA 3CE6A 3H4VA 3OIYA 4EKEA 3WAGA 3R5FA 3QE4A 3A1NA 4OGGA 3L40A 5LN1A 2WKWA 1M54A 1JLSA 5GVSA 2HCFA 4ZV9A 4EGQA 2JA1A 1SBYA 5GQSA 1CJBA 3M8KA 2ZB7A 4EGJA 1W94A 4HQNA 5J5CA 4WN9A 4H0NA 4NR0A 1W76A 1YDMA 3N58A 3P2YA 4CMHA 1MQ9A 1GTVA 3GK3A 4CIDA 2AEEA 4IQ8A 4WIAA 1IHOA 2BFOA 2NU6A 2V7UA 1B7GO 1CG6A 4Q4DA 3RSOA 4L0CA 3UYLA 1FTSA 4BATA 4EL5A 1S2OA 1NP3A 1WS6A 1TE2A 5JCJD 1SPBS 5BNWA 1H2AS 5EJ6A 4GLOA 1IFXA 1PX2A 3G7SA 2V3WA 4M1YA 5TEVA 3I05A 1ODSA 5KX5F 3O83A 1UPAA 4QOGA 4TKVB 1PDOA 3ZV3A 3VKWA 4BLQA 2B6HA 2C9DA 1Q7TA 3VJMA 1CUDA 3QMVA 4HDKA 3ZU3A 3F47A 4B48A 2C9MA 5K8JB 4XX1A 5AWFC 4NFHA 4F5ZA 4G3XA 4X41A 4CUKA 3AJRA 2J3MA 3LXXA 1J7KA 3HNRA 4GKBA 4YCAA 5UKDA 3GGOA 3RJTA 2DFLA 2V7VA 4KGXA 3PSHA 3B3AA 4GF5A 4FONA 3I76A 3ROPA 2ZDGA 4C0QC 4MWDA 2YDYA 3X44A 2ZJ1A 2AOVA 5EA2A 2QUHA 3G49A 4HGYA 2D7JA 4EG1A 2WIGA 1ISPA 4GL4A 1EWYA 2D54A 3B9QA 4TYQA 1OGJA 4RVFA 2QQ5A 4G2TA 2XA1A 1I5EA 1YB4A 2Q49A 3BDAA 5FLYA 2HPVA 4UFNA 2EFHB 2NZWA 2POCA 2YS6A 4I1YA 2QMYA 4ME6A 3B9PA 2JG3A 3OQNA 3DM9B 1VHLA 4JYCA 4XUGB 5CEEA 1ZUWA 3DL7A 1Y1LA 2PLWA 3K0FB 4GPAA 2VHTA 5FI3A 1JHDA 2X77A 3AVOA 4PE5B 2HMUA 3OP4A 1SA0A 1Z35A 2W8ZA 4UC0A 4JMLA 2PVSA 4FN5A 1NUTA 3LPCA 4II7A 1E94E 4TLCA 1CDDA 1FDUA 5ALOA 4A5SA 2VHWA 3PLNA 5MN6A 1KMIY 2XB9A 4E32A 1DG3A 4KFUA 4JI6B 1JMVA 2EX1A 3RNOA 1FVOA 1KKMA 1VI5A 4H7EA 1CRZA 4WGGA 3C6YA 1GAEO 4JNKA 5TB5A 3OQ1A 1PT8A 3BRQA 2OUIA 4FHGA 4W99A 1P74A 1G6HA 3GLIB 5D3ZA 3A1SA 3TEMA 4KQEA 1UWKA 3CV3A 1QX3A 2Q1UA 5FOXA 2ATCA 3EODA 3S2YA 5B3KA 4EJ2A 2FV8A 4TSKA 4EECA 1Q19A 4CPDA 1N7JA 3K9LA 3ABIA 3IVAA 3JAWA 2VPIA 5H80A 1F9EA 1DAKA 4JDUA 4CIXA 3VKUA 1M33A 2OILA 3VPAA 5JEDA 3HU2A 4LVUA 4XD7D 1E2BA 2R66A 3NB0A 2FSUA 2QPTA 5JWOA 4RGBA 3IC5A 1QIJA 3W7BA 1T5LA 4HBZA 2CJWA 1EA7A 4L51A 4RM2A 4CMEA 2DPGA 3T0GA 1Z8FA 4ABTA 1AZLA 4FFWA 3PXEA 3PDWA 4MVXA 3K70B 3ROXA 4QRDA 1U98A 1QYIA 3PTAA 4KX3A 1EM8B 3Q3GE 4N5NA 5EPEA 1R6UA 4U6QA 3SSOA 3A0RB 3QUQA 2EG5A 3D3WA 5DCWA 2R1UA 3OU6A 2IZ6A 2DT5A 2OV4A 2RB5A 3QYAA 2FR8A 2PRKA 4W7SA 3RVJA 5BWMA 2PX8A 5F64A 2Q27A 3RC9A 3VTAA 4FYKA 4QM7A 4GPZA 1N2SA 5FJJA 5C32A 1NMEA 1ZK2A 3AERA 2GOYA 3KP1A 4IV8A 3P0FA 4NPCA 4RSGA 3IODA 5G3ZA 1NW7A 1GXSA 2QBYA 4X9XA 1IBSA 2VXCA 4US2R 3DTNA 3AERB 4LJ6A 4R7GA 1KJQA 1LLCA 1SCNE 3DE0X 4Q7MB 5EWJA 4M0UA 3QEMB 2OQRA 3AEYA 3T3OA 2NACA 2QUIA 3DC2A 4OI2A 2D4HA 3MUNA 3ZCXA 1A5AB 3C0KA 4WUVA 4DMLA 4FZ3A 1RCUA 4II2A 1QGOA 4H3KB 3K0AA 3V8VA 1ZIYA 5EQDA 4O4HB 5TPZD 4MDEA 1UBGA 2X5JO 5AIAA 2DZDA 4PHCA 1GPH1 3FVWA 1B6RA 1QZUA 1SVUA 1F6BA 2YWHA 3AMVA 2AL7A 4HDRB 3OWXA 3CHYA 2HLDA 3DOJA 3ZWAA 2QYSA 3MINA 1RKVA 1AURA 2E4ZA 2IY9A 3EZ7A 3QNMA 4GE3A 4P34A 1JSRA 5FUBA 5GY7A 1EFVA 5BYJA 4P7JA 1H6BA 2LBPA 4F1WA 1V43A 3FCXA 3PR1A 3NFYA 4WEOA 4QYWA 2OGZA 2EOAA 4E5PA 1DBRA 2XQVA 4FFBA 3D8NA 3MLEA 3K0KA 4U39A 1KXZA 2CGEA 2W0SA 1G2QA 1YZLA 3CUWA 2ID9A 3O1LA 3PICA 4LEIA 3W04A 1A2OA 2HZ7A 1JW9B 1JHAA 2O20A 3G0BA 4H1UA 5B1DA 4YUVA 3U4AA 2JIOA 2FMHA 2Y92A 2CDAA 3IQHX 4JB2A 5DXAA 3RC2A 3T5TA 1TTTA 1L4NA 4PLCA 4Q1VA 1HT3A 4C4PA 3SMVA 3FN4A 3ECCA 1QTNA 1LGYA 2C0QA 4BJ3A 1I32A 4IIEA 5JW6A 3IP8A 2R8YA 3N07A 421PA 4ZEOA 2BELA 1RQXA 3F7OA 4KVGA 1TD1A 1AT1A 1OPRA 3EEYA 1AGYA 4QULA 4RY8A 3LHSA 2J85A 3JQBC 2VPYA 3P9QA 4Q3OA 1JKMA 2QAGC 5AFSA 1KA9H 2ZT8A 2NTJA 4GMXA 2AEJA 3L4BC 3I4CA 3DTVB 1I0IA 5HRCA 1X3LA 3CLUC 3P2IA 4DR4B 3FZGA 5EESA 1RQ2A 1SXJA 3PKJA 2C7QA 1U7PA 4O8ZA 3SU8A 3ZZUA 2W00A 3CEHA 5LZ2A 1P9LA 4WY5A 4D9NA 5A4MS 1C7ZA 3BWEA 3SQWA 3BXHA 1UKVY 4RAOA 4TKUB 1XRLA 2X0RA 2D3WA 3CZRA 3OMLA 2GHTA 4QAQA 1VCMA 4R3NA</