1RBZA

Human gar tfase complex structure with polyglutamated 10-(trifluoroacetyl)-5,10-dideazaacyclic-5,6,7,8-tetrahydrofolic acid
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE
publication title Human GAR Tfase complex structure
rcsb
source organism Homo sapiens
total genus 65
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1rbzA00
3LOUA 2BW0A 3TQQA 4NV1A 3NRBA 5CJJA 2YWRA 4ZZ2A 1MEOA 1S3IA 4IQFA 4ZYUA 1RBYA 4ZZ0A 3DCJA 4R8VA 2CFIA 1ZLYA 2BLNA 5J9FA 1C3EA 4YFVA 4ZZ1A 4QPCA 1CDEA 3W7BA 3AV3A 4DS3A 1RC0A 1GARA 1RBMA 4QPDA 1CDDA 4ZYWA 4TS4A 3Q0IA 1FMTA 3TQRA 1MEJA 3AUFA 1ZGHA 4EW2A 1RBZA 1RC1A 3KCQA 2FMTA 1YRWA 5J63A 3R8XA 3O1LA 3P9XA 3OBIA 4TT8A 4ZYTA 1C2TA 3N0VA 4EW3A 3GARA 1ZLXA 3DA8A 1JKXA 4TTSA 1MENA 1RBQA 4ZZ3A 4YFYA 4S1NA 1GRCA 2GARA 4ZYVA 4ZYZA 4Q12A 4PZUA 4EW1A 4ZYXA 1NJSA 4ZYYA
chains in the Genus database with same CATH superfamily
2QK4A 2VXBA 4MAMA 1SU4A 2E7ZA 5GY7A 3E6AA 4GF5A 3ZG6A 3V9PA 3K5IA 3UXEA 3UWOA 4JGGA 4IZ6A 4EI7A 5LJIA 4M0MA 5EUCA 3V9AA 4D6PA 2EFGA 1P1JA 2I4OA 2I7VA 2M1XA 2R6FA 3IBTA 1FYEA 4XEUA 4YO8A 2ATEA 1ID8A 4Q00A 3ZGNA 2BR4A 1RU3A 1MQ9A 2AH5A 3VPXA 1I01A 1XE3A 3NKFA 1L6IA 1NURA 3GZTB 4IX9A 3AV0B 1WDMA 3D6NB 5EIOA 2Q28A 4HDKA 2VP2A 1CY1A 3I4CA 3LUCA 4HN4B 4NBSA 4LOKA 4I3HA 3RTGA 1G21E 2GF2A 3MWEB 3ONNA 4YY3B 1UEJA 3CJTA 4ASUD 4LIPD 3D5TA 4B7XA 5C7LO 4EUHA 2NZYA 2C3OA 4UAJA 4X20B 3OLYA 1RRCA 1W25A 3LPDA 4B2YA 3ZCTA 1KQ3A 3U4HA 4HGRA 2RGBA 1ZUD1 3OC6A 1DWOA 5KJCA 4R8LA 4QJ3A 1N7GA 1O95C 2F48A 2HHAA 1GPKA 3RTAA 4JUFA 2XVZA 3FMVA 2FQXA 1QUEA 2VPPA 1RTKA 2R8OA 2X0RA 3CX7A 4NH4A 5JPIA 3KQPA 2IS2A 3ETHA 1NNEA 4MRMA 2SNIE 5FAXA 1RKUA 4BNYA 2SBTA 1GADO 2CMGA 1V7CA 5HQJA 1JQ5A 2XTJA 3TQTA 3B1VA 3CX4A 8LDHA 3ENVA 2JIZD 2XTAA 3UJBA 3JAKA 3WB1A 4CKZA 2BFCB 1PYGA 4JLAA 1N2GA 1YQ9A 2ID8A 2QYHA 2MR5A 5HHTA 3F9IA 2WFLA 5DSXA 2FZKA 1QDEA 2EHDA 1Y4ZA 3WGHA 4DC9A 2ZAYA 1X70A 4HAUA 3SXUB 4EDHA 1PVDA 2CZQA 3M1IA 2EOAA 3MMXA 4UZFA 1ZJ6A 3IQEA 2BGLA 2WMDA 3L3BA 1TJNA 4C7KA 4EZBA 3GAMA 5MN6A 5TV2A 2VCEA 3Q6MA 3R3HA 2DERA 1QVZA 1J8FA 4NIMA 5DM0A 3VISA 4TTIA 5HW0A 1Q44A 3RF7A 2EEZA 1YL5A 5KWJA 2VUUA 5BSMA 2GEDA 1GL3A 1O54A 3N0TA 3SHWA 4CL3A 4X54A 5AVOA 1NJ8A 5LUAA 2NYVA 4L27A 3X1ZA 3WG9A 3HYLA 1U28A 2IX9A 2PZMA 5FFNA 3OLZA 4EB3A 1W36D 4RW0A 1D0IA 1P1BA 1ELOA 3NGLA 4IWXA 1ZCJA 3KKPA 3MGKA 3ORRA 4I0WB 4XARA 4OF4A 1VHDA 2BTOA 3BSFA 4G0UA 1D1QA 4WEQA 3GMDA 2MSKA 1XGKA 2E6UX 3AEUA 5AVUA 1N78A 4Q1CA 1QTQA 3R7FA 1Q74A 4JQYA 1MJGM 1XTJA 4PYRA 5LZ2A 2EG5A 3U7FB 5KQGA 4WMLA 4HWGA 1ITZA 4NARA 2NTNA 3HCWA 1EHIA 3T15A 3VPFA 3WLPA 4AM8A 2G70A 4QPPA 3I0MA 2R66A 2AOUB 4ZYZA 1E2DA 4OSOA 5ALTA 1BSVA 4RK1A 2X22A 2IXDA 1F6DA 4QUDA 4NMWA 3QKIA 5BXYA 3FHCB 5BSRA 3IPYA 4U5XA 2BD0A 1E2JA 1GLVA 5JSKA 1FFCA 3AILA 3HYCA 4LSZA 1VI2A 1GNRA 1F6BA 2ZSUA 4I5FA 4OMDA 2F17A 3SE0A 4IIVA 4LHYA 4Y2JA 2FR8C 1YKGA 1F8UA 3D0RA 4IRXA 5AHXA 3AUUA 2O8DB 2WUGA 5BPFA 3FVTA 1Z13A 3EAGA 4O4LF 2UKDA 1ZXBA 3GOHA 4MB2A 1ZAYA 4YMGA 1V8BA 1C1XA 3CNNA 4N82A 3RRYA 3TLGB 2RH4A 5DHUA 4C4AA 3EIWA 3H18A 1PS8A 3DDCA 3HFSA 4EG7A 5ALUA 1PTJC 1VHJA 4IEFB 3REOA 4UM9B 5KTRA 5B30A 3AG5A 1JDNA 1BE0A 4NYJR 3A06A 2ID9A 1YRYE 3FOCA 1VZ3A 3H75A 5CVEA 4C4PA 3UCEA 1KI2A 3WHLA 1ZNQO 4Y9UA 3RYFA 4KO3S 1N9ZA 5K51A 2I2FA 3IAUA 4XX1A 5ESDA 3SZOA 2JGAA 3SKXA 3B53X 3GYGA 3KU1A 5GGXA 3UJ6A 3LQRA 5HCIA 4BLWA 2BFWA 1R8XA 3OWXA 3P0FA 1FFAA 2VJNA 3PQ8A 5JHHB 4IG9A 3DEIA 3CNLA 4DPKA 1YE5A 2XYQA 2NUTA 1IK6A 1CYDA 2O0KA 1Y4AE 1KS2A 2QPAA 3JYLA 5ULLA 4DLAA 5JISA 1TO2E 4AF7A 4Q5IA 3F4KA 4ZICA 3L6BA 2QN3A 3PJFA 4FHZA 5H70A 4MUXA 3VR6A 2EWMA 4D9HA 4E31A 4QHTA 1GGFA 3D1JA 5ELLA 4FS8A 3PL1A 1XF9A 1STOA 1IFXA 1P4HA 1XZCA 2X77A 3BRWA 3K0CC 4CCWA 2OWDA 4X45A 1RZRD 3EWSA 3HA5A 5HKLA 3V8BA 2JIMA 4XVQA 3PE3A 1L7OA 1RWOA 3AERB 4G0WA 3D3EA 7GPBA 1BVRA 1RJGA 1F0NA 4PQRA 4E30A 1IVSA 2JHAA 1ETHA 1MW9X 1Y33E 2NXWA 2Q1TA 3T06B 3ZLBA 4JL8A 1K4KA 1AD2A 1OGJA 5IUJC 2ZFUA 4JBGA 1RBZA 1OH5A 4RPIA 1N75A 4YACA 1X1TA 2VSFA 3P9SA 4MDFA 5AUPB 2ORVA 3KL2A 1WUJS 3ZDYB 1M34B 2G0NA 3I2KA 2QTWB 3ICCA 1B23P 1VL6A 2OC4A 4ZOLB 3SK0A 1ULZA 2IZZA 1YQXA 4Z0NA 3QX3A 1Z5PA 3KHUA 3Q0EA 2DWPA 3F9CA 5E3JA 3IJRA 4P82A 1AQNA 1QLJA 1ULTA 4AKGA 4KQXA 3BQMB 2BUAA 4NC9A 4YAFA 2GB4A 1TZJA 2Q29A 4MV5A 3I8OA 2DR0A 4MW5A 3OE1A 4GBMA 4Z7NB 3KSAC 3SBOA 4KRGA 2HT6A 1Y89A 1B8PA 1O2DA 2DJ5A 4XD7D 3ZH9B 5CVDA 3SX0A 2A3NA 3NTRA 5CA0B 4ND4A 3H99A 2LDBA 3VFDA 3OZSA 2VUTA 5LM3A 5A4KA 1VE1A 1W19A 2VJBA 3DC7A 4ZVLA 3P9PA 1NX9A 2WKQA 2NPFA 4Y7CA 1VKOA 4X66B 1U1GA 3I39X 1E4YA 4ENRA 5BVGB 3QVGB 3RTCA 1CRPA 4A9AA 2JEYA 2QM7A 2X13A 2ZROA 3HO1A 1X38A 1I1NA 3CE6A 3R8FA 1NBHA 1YULA 5KNBD 3T5GA 4K0KB 4BU0A 4GBJA 3CUWA 1PUJA 1M33A 1XJWA 4Y2PA 5DULA 5EPOA 4BMCA 1TEVA 3TR5A 1EEHA 4FGLA 1JKJB 4CMJA 3HGMA 4R0NA 1YS9A 2Q0QA 3AFNA 4ZRNA 2OCPA 3FFWA 4Q1BA 1XTKA 4U7FA 3PFGA 1FXSA 1UBOS 3ZGVA 2ZE7A 4LF7B 2NLOA 2D1YA 5BQOA 2BW0A 1Q0PA 2VJCA 5L8VA 2O1XA 4NFLA 4NULA 5EA2A 1FB5A 4Q15A 1ECCA 4YJ3F 5AW1A 4Q24A 3VR2D 3JX9A 3S7ZA 4BLVA 4BL5A 4ZJUA 3JQDA 3B8HA 3FNHA 2WDZA 2VSQA 5C0OE 4J0JA 3GPLA 4MULA 1M72A 2LXNA 2OD9A 3NV7A 4K87A 4CF7A 1T5HX 3L0IB 2W93A 3L82B 1XQ1A 3A4TA 1YJXA 3WB2A 2DOKA 2W4IA 4TXNA 1PBNA 2A33A 4G4JA 1G0NA 3E0QA 1FRZA 2A3RA 3HB4X 4JGIA 2I3DA 4RWEA 5FNVF 3V1LA 5IK2D 1CU1A 4CEJA 3I5AA 1L6RA 5DWVA 4EJ0A 1RM3A 3FPLA 3IV9A 4FKMA 2WUEA 3O26A 3KB2A 1QYDA 4MS1B 5KYGA 1HF3A 2WJHA 4DS3A 1TCUA 3CF6R 4X1IA 4D57A 3I1JA 4C0WA 1SGWA 2A14A 1C0IA 3UMSA 3PR1A 3RC9A 3K0BA 4UDYX 3BX1A 1HORA 2LE0A 1I4DD 3G89A 5BQPA 3IDQA 3RM3A 5JAIA 3C8HA 3E9DA 3N7TA 4IIGA 4YNBA 1XA0A 4BTLA 1U0BB 1M6YA 4IX1A 4ACAA 1OFHA 4EA8A 3CLKA 2X1VA 4LF4B 5FYQA 3DAFA 2J3DA 2RAFA 4LZLA 2OGZA 1MZVA 4D9CA 5A2GA 1GSHA 1QAQA 2A5YB 2WC1A 4RPHA 5AJZA 3H0EA 2N42A 4IDPA 2TMDA 2ZUUA 1W34A 2CNWD 2WTEA 3H9EO 4DCGA 1L4KA 2ZT8A 3I3SR 4Z9BA 3SG0A 1N33B 4EEXA 4TSKA 4QAJA 4OAOA 1K6XA 4XW2A 5JSFA 3TR0A 1E2NA 2BH9A 2IPLA 1XA4A 5EGNA 3VAAA 4Q4CA 1E98A 2IKQA 1J70A 3R3WA 1ZX1A 2R47A 1ZKMA 1MQSA 3EGEA 1EBFA 1LRLA 3NHZA 2TMYA 4KO4S 4RFVA 4AY4A 1LI4A 3BCSA 3MJRA 2JCBA 3B89A 3GCGA 3O5AA 2C5GA 4HDKB 4R2JA 5WRFA 2IYOA 1J8QA 3QPWA 1XP8A 1BCSA 2R00A 2PKWA 3H9CA 2OD2A 4H7HA 4II7A 1X9HA 1YZLA 2WIAA 4F9EA 2EJWA 3EEYA 5CM2Z 4EKYA 2UU9B 1UP6A 3V4ZA 1XTTA 2WTAA 1FK8A 2DUWA 1QONA 2IYVA 2O57A 4Z9FA 2WINI 2XE8A 2Y0DA 4R8SA 1GXSB 3MMZA 1HZZC 1XXHA 3NVMB 4FBLA 1HQCA 2PVCA 4L78A 3ZWKA 4BX9A 1E3WA 1PU2A 4EO4A 4ETWA 3L05A 4QXOA 1AHHA 1SHLA 1YBHA 3BF7A 1WMDA 3DDZX 3NR2A 2OGSA 4GZ5A 3VDNB 2QU7A 1LUAA 2VWPA 2Y71A 3DO8A 1FP1D 1OFUA 3USES 3PTLA 1P7VA 1D2HA 2ZP1A 4TSRA 3ZPXA 1KARA 1A9XA 1YCHA 2P40A 3GQBA 2Q4OA 4KMRA 4OGKA 3MCAA 1M7BA 1L4LA 1EMDA 3E58A 3P9KA 1UMBB 3UICA 4C7XA 2XZLA 1G0OA 2TS1A 4K2AA 1H3FA 1MGOA 3K1ZA 3EE6A 1E5QA 1THGA 2X4LA 4BBAA 5LUBA 2EYQA 1MT0A 4RTQA 4TWIA 3OVMA 5T5QA 4AMBA 2FQQA 3QWAA 3Q85A 3PUZA 3O8NA 4HJRA 1OVMA 3TWOA 1WD7A 1KO5A 4DWJA 1SOVA 3QXGA 2IPXA 1SHKA 5LP6C 3FA2A 4JVNA 4PQFA 1SCNE 3N2NA 2H1IA 3B1ZA 3RUAA 1UBEA 2B69A 2YQ4A 3Q3GE 4Y2HA 4ZA2A 5G02A 4KXMA 4PYOA 4TRRA 3M4NA 1U9IC 1WU7A 2WW8A 2PA3A 2OBFA 4C20A 4EKIA 4U2DA 3GFOA 3DT9A 3JASA 4I8XA 4NPHA 3EMBA 2X7JA 4MS4A 1I10A 3WQHA 4TT3D 4Z3KA 1G8KA 1NQOA 4HDCA 1A96A 1Z37A 2C9OA 5F2EA 2H0RA 4FDLA 5AW6A 4R8VA 1T9ZA 3VUFA 4DJ5X 4OY3A 3P45A 1JU9A 2WVJA 2HMSA 4LX0A 2HNAA 1C1DA 4J0GA 2P35A 1Z6AA 1S2GA 2Q0SA 5ALDA 4MYHA 2X9QA 1N8SA 3HYTA 3U39A 1CR4A 3BIJA 2VZ9A 2NO1A 3ELWA 1C8LA 3B1WA 4QNMA 1CDEA 1X8XA 2J3QA 4YBRA 1QK5A 3UMGA 4D8UA 3AEZA 4E6EA 4JENA 2ZJOA 4CIBA 2HJHA 1RDFA 2X5JO 3ONFA 5ER6A 1U0JA 1U81A 3I12A 3FYHA 3RSQA 4EY5A 3GLHA 5F2OA 4FONA 5K8LA 2CLEB 4OPMA 1G8YA 3UH0A 1FQWA 4YYZA 3DVAB 4KIJA 5AQEA 2X8LA 2X3YA 3HCAA 1EFHA 1AN0A 3E7PA 4BWFB 3QUSA 4HMOA 4MS3A 1DHRA 1VYVA 4EHLA 4EG5A 1DFIA 4FGZA 3PEEA 5GZ1A 4LOHA 2GYVA 5IJ0B 2BGMA 4AK9A 5CPBA 1B42A 2ORWA 3EVTA 4PZEA 3D6JA 2CT8A 1VA5A 2IHTA 1J22A 2WFAA 4S2UA 3QE3A 1Z4OA 3ZD6A 3VNUA 2R9VA 3G0IA 3W7VA 1XCGB 2OSVA 1W9HA 4NJMA 5JS7A 2LUOA 3BN3A 1ORIA 1WQ3A 3ZU4A 1LDMA 1HV8A 4RL6A 2QAGC 4ZVNA 3KQNA 3EXEA 3H1EA 3PRKE 1PNOA 3WI7A 3WK8A 2YRFA 3ICVA 1V41E 2CLCX 4YXWA 1XZDA 4MV3A 4N5HX 3EDMA 2Q5CA 1Z2NX 3G7UA 3N2YA 4PPYA 5CFOA 2ZGVA 1C7EA 4OOEA 4AMUA 3AEQB 1KC1A 3NBXX 4R3NA 1GM5A 3RSZA 4DMUB 3NYRA 1QH9A 2B6NA 2PZ8A 3B70A 1BGVA 4YT4A 3K9HA 1Z34A 2FW1A 3PQFA 4LYHA 3LY5A 3SS8A 1CXZA 1ZM3A 4HY3A 5DHRA 1QV6A 2XXBA 4YMWA 4S2EA 3M7IA 3FPJA 3BYZA 1HLGA 4GPD1 4B6SA 3NC0C 1P75A 2PVSA 4KG7A 821PA 1LVGA 4XQ9A 2XODA 1KP9A 2G9ZA 3UUEA 3PFKA 3BORA 5LBUA 2YMMA 3RKSA 1KGDA 5DVZA 4ZTZB 4KUHA 2F8LA 4L2IB 4IJQA 4M99A 4ZO6A 1XNJA 4EMBA 3RSGA 4EIWA 5AVVA 4DQXA 3Q7PA 4RESA 1BA3A 1YVDA 2CVPA 5ENZA 1XV5A 5B1SA 4BWVA 5KWVA 4L0DA 4R2WA 4C21A 2A1IA 2GZMA 4P7JA 4OHWA 4YAJA 4MHTA 1VBFA 1EB9A 1O4WA 3PUJA 2C61A 1ZU5A 2V6FA 2RBGA 5HVNA 3CURA 1WMBA 1HE2A 2X8BA 2Y27A 3CLHA 3PNMA 4OA5A 4Z99A 2K2WA 3T5PA 2P0YA 1E0JA 1PR3A 2Z1DA 4BFZA 5BW5A 1LLQA 2FLVA 4N03A 3U3MA 1GG5A 1ZK1A 4YAIA 5K8TA 3R4CA 2P1ZA 1ESDA 1D0VA 1S4MA 2PXCA 2ZE6A 4EW1A 1SIOA 5IZ4A 3D7NA 2XBLA 2XGOA 4PRYA 1JQEA 3WFJA 5CA1F 1E59A 1NQ5A 4DUZB 4ZV9A 5BQ5A 4JI0B 2H5IA 3IFSA 4IDAA 3H6GA 3RKRA 1NW8A 5IMBA 2X7XA 2AS0A 4IXWA 1VLJA 1E1RD 2ZDQA 2V3WA 3Q15C 4OM8A 2BSQA 2IHVA 3PEFA 4JUIA 1RPZA 3JQ9C 5K0LA 4POOA 4S1OA 2GBGA 4AF6A 1J8MF 3VVCA 1T0HB 5G0TA 1V47A 3RF6A 4BBZA 3ZQUA 1IN6A 5KQPA 4AJ2A 1IZYA 4OYYA 1TMKA 1RAHA 2EP7A 1D1TA 3FMPB 2C4UA 4LA4A 2CY0A 1Z0JA 1AQ6A 3N7UA 3K4HA 4DA8A 2L42A 5LMNB 1P5FA 2QRZA 2FUG6 4ZTBA 5JBIA 5KDDA 1L5YA 2WK1A 4E2WA 1OPRA 2Z57A 4M1SA 1QQ7A 3NIGB 2JNWA 3A28A 5HE8A 4PX5A 4QXQA 5AVWA 2CMDA 2AG0A 1AB5A 4F9FA 4L5CA 1T2UA 3K94A 3WRYC 5B6JA 3QWIA 4JEIA 1Y6GA 1K8XB 4I6EA 4P80A 1GPWB 4LNUB 3ILSA 1E6MA 1VL5A 4NU0A 1VE5A 2JPDA 4HBGA 4YASA 1KJWA 1F8YA 2GM9A 4KQ1A 4R1SA 3UC9A 5ADWA 1SWVA 4WZAA 4DR6B 2P9HA 2V1UA 3EWAA 2EFCB 2XA9A 3NVDA 1SVIA 1ST2A 2AFHE 5A1JA 2DY0A 1YF3A 2ODAA 2VATA 4GYJA 4X94A 3RKUA 2I66A 3GUUA 2V6GA 2AR0A 2JD1A 2VI5A 4HH3C 4Q3LA 3WICA 4GWLA 3QTBA 1T0BA 5IAAA 1Y34E 4RQAA 3UQYS 3AUFA 5EIXA 1Y7IA 1PG5A 3FE2A 1OHHA 2ABWA 3EXHA 1HE8B 3JQAA 1SUPA 3KPWA 4BZXA 2B7CA 2A78A 4V0ME 2MINA 4IVNA 2HU2A 3EOBI 3OX1A 2C5AA 4PY2A 4AT1A 1CEQA 3T7KA 1SKQA 3TTYA 3BMQB 1M1UA 4WNYA 1KAMA 1B3RA 2BH2A 1IY1A 3L07A 4OI1A 3QEBZ 3TW4A 3DAOA 4MGKR 2AN4A 2XJ9A 4LZPA 1BU8A 2BGTA 1KJ9A 1U5AA 1PNVA 4RS4A 2AWNA 1NBAA 1T4DA 2RIPA 3ET5A 1DL5A 1R4NA 4MLCA 4N3AA 4TRJA 4PLGA 4AX8A 2PX8A 2R8XA 5KJFA 1VTKA 1Q0TA 1E4VA 4EK9A 1ZH8A 3L93A 3PQCA 4KYTA 4EHJA 4ZYTA 5K0JA 5J3JA 4XJTA 1UKBA 1TDJA 3COYA 3JSAA 3T9EA 1MTZA 1RI5A 3DBOB 1PT7A 4RVUA 2HV9A 1XNHA 3U3OA 3G0HA 1MIOA 1ECFA 2PPLA 1A69A 3KVVA 2OWEA 3BULA 5IS2A 4GIBA 1V1RA 4HH0A 2PRJA 4S1TA 3RTBA 3AF5A 3S29A 5FQOA 4F4IA 2JLZA 3DP9A 1JQAA 4RVOA 1T4CB 3AM1A 1RI3A 3TW8A 1DX4A 2H4FA 4WLFA 4YRCA 2C3UA 2RK3A 4MCHA 3EZFA 3FM9A 4R7GA 3U60B 3HK2A 4IJWA 2C5SA 2V6BA 1D07A 2ECFA 1JHDA 1R0RE 3HCPA 3TQSA 3VI4B 3SU8A 2F9FA 1VKHA 2FEOA 3QI2A 1EFUA 2B5VA 4YT2A 1NKTA 1BCSB 1K75A 3MJCA 3B1FA 4XVRA 4N12A 4Q7EA 4EYKA 4UHKA 1PWZA 3AVPA 4JJEA 3ITKA 4RMJA 5I7FA 5CEJA 2HA2A 3HJNA 3OH8A 4DLUA 4AXBA 3OZWA 5THQA 2C8JA 5JJKA 3QITA 3GZNA 4HG2A 5KREA 1E79D 4R2MA 4X6LA 2ZBPA 3TNFA 1T8RA 2E4ZA 4HV4A 2QW1A 1HFKA 2GUWA 1R7RA 1AF7A 1Z6TA 4QUBA 3T5BA 4BQSA 3M6FA 1B43A 1KBOA 2PD6A 2A9RA 2IKSA 4BMPB 6GPBA 1UWKA 4FILA 2GOYA 1IN5A 3T1QA 4NZZA 4DJDC 4CN9A 1W94A 3UMBA 4HWSA 1KMIY 2NM0A 4JJFA 3FIJA 4QGAA 2TMKA 3SQOA 4IKOA 4RZHA 5B1HA 1G20E 3I5UA 4ZOBA 1KWGA 2O54A 3L1IA 1DZ3A 5AJVB 1QE3A 3FNGA 1LXCA 1N2ZA 3QI7A 1ADCA 2Q3EA 3KSDO 2OB2A 2X0FA 3MT8A 2WA2A 1EX6A 1OR8A 5ES3A 4TZ0A 2HCTA 1RVV1 5JSHA 2WWIA 2KYRA 3K0KA 4QULA 3SYRA 4KRFA 3NJ4A 5KTSA 3W9YA 2I4NA 4U9HS 4WDQA 5JY6A 4NS1A 4FSHA 5K6AC 3JZIA 3S55A 3RBAA 2RCNA 1OA1A 2C4TA 4MW9A 2K4MA 5JHGB 1VJCA 3G8CA 5B64A 3ELBA 4LVNA 3LMKA 4IGKA 4RY0A 4L57A 1CQZA 4JCOA 1ZVVA 1FFBA 1XTSA 3HWWA 3MMNA 3P32A 5T7BA 4MS4B 4DF3A 1ZBQA 1M8PA 2HA0A 1HUQA 3ZWDA 2NVUA 4UQLA 3Q3CA 2FAXA 1IPFA 1V7ZA 3ZV4A 2R1VA 4CMEC 2XQVA 3R0JA 4EHIA 3BK7A 3AZOA 1RWMA 3R7BA 1EFPA 2YFQA 3V7FA 1U8ZA 4JYZA 3L6OO 4L95C 2PT5A 3OMXA 1TM2A 1C7FA 1QGZA 2G5TA 2XLBA 3L8ZA 2KS6A 4TZKA 5CTAA 1Q84A 3WWYA 3FMFA 4OGWA 3MTIA 1GGMA 3ISVA 4FCTA 4QGGA 4TN5A 1KOFA 4A73A 1Z4MA 2YWBA 3O2SB 4GC9A 4TX1A 4ZVPA 1Y63A 4ZQIA 4Q4JA 3GLHB 1O8CA 2F3RA 1Z4JA 4KQMA 4TWRA 3B6JA 1ZIDA 1BOFA 3P0IA 5IAEA 2F3TA 4HBZA 4KR3A 2BJWA 1HDXA 1Z07A 2PXHA 4MV6A 2NO0A 2OFOA 4S1PA 5ER9A 4BFUA 4NMLA 1EUCA 2GEKA 2Z9CA 5KB3A 2ZQYA 2QGNA 4BASA 4TV8A 3TRIA 4CM7A 1RKVA 1YT5A 1T35A 4TYMA 1V5IA 3PIIA 2IOYA 2RG1A 5I5GA 4J0IA 4KOEC 4WKNA 3ZTYA 3U4AA 4OLJA 2C04A 4PNHA 4B4OA 5LL6P 3R9XA 3VPAA 4X7MA 4TS3A 2Z4RA 1SKYB 2XB9A 1YIDA 3EXEB 5DGCA 3M34A 1VGVA 2Y4NA 3C1OA 4KSYA 1O94A 1W87A 3ESXA 5JZMA 3SLGA 5HKKA 3CHYA 2QZPA 2WVGA 3F71A 1J8YF 1DP4A 2PMBA 1NZDA 1P1KA 1PLJA 3H4IA 3QPAA 5JMWA 4PN3A 1W5EA 2EYUA 3FWYA 4JJAA 4YHBA 3B7PA 1U0FA 3BGSA 1RWBA 5CJ2A 2XDWA 1ORHA 3QYPA 1NXVA 2JVJA 3LBIA 5AKGA 3GRKA 4EMUA 4ZK2A 4W6QA 1GAXA 3MTAA 4BAUA 1VKNA 1ODJA 1E0AA 1V43A 4YJKA 3KCNA 3OUUA 4V3BA 1RD4A 4OP1A 5KCMA 4DSAA 5AW7A 2NP6A 1EXMA 2AA3A 2X9LA 2OUIA 4MV0A 4WZBA 2HQRA 4RIEA 1C2YA 3NTUA 4IUYA 4MK4A 4RZUA 5JQGB 4D9MA 4HDMA 1LTQA 2BI4A 2ADFA 1TJ3A 3ZQJA 4F3RA 3HJGA 3UJDA 1AM4D 2CHGA 3A4IA 1FX0A 2ZIUB 3MGGA 4MQLA 2AOTA 3TEFA 1UBMS 3A1TA 2IZ1A 1SPBS 4F91B 1K9VF 5DLYA 2VJDA 1KI6A 3H2IA 2OHFA 5DPMA 1YFLA 1MB9A 2EZ4A 3FETA 4GI7A 4WY5A 3MD9A 3S40A 3JAMA 4FD3A 3NBQA 4HWTA 3QRWA 1CPYA 2VR1A 5EEHA 3L77A 1XDGA 3EVAA 3RTEA 3WTBA 4BO3A 4F12A 3RRFA 4MWGA 1NXWA 3IV6A 1G2IA 3BXGA 2DBVO 4P4SA 4Q03A 4BN4A 2IUTA 4YRNA 3V4LA 2H2AA 4EGFA 1L4MA 1PHPA 4LGYA 1IUKA 1V48A 1PKEA 2XRZA 3PWTA 2PKCA 3VR5A 1P29A 4EKEA 1U2GA 3ZEAA 2Q46A 3IHWA 1UQTA 1ZKDA 1Q1BA 2CYCA 1QRAA 4MUHA 1GQOA 1LW7A 4AJHA 2BZSA 5G53C 2FDCA 3S27A 4ALJA 3MK31 2EJTA 2Q0XA 2PGLA 1C8BA 2OVFA 3ENZA 1P7PA 1XEWY 3CZPA 3OIGA 2XWQA 1AU9A 3G0CA 1XTBA 2GKOA 3FDXA 1WZNA 1KY4A 2ZIEA 3FTFA 3DNFA 4C78A 2DBZA 4PAMA 1MOQA 4UFPA 3ZDEA 4DSNA 4KQFA 4XRRA 4CBVA 3HCBA 3R8XA 4AYWA 1RAAA 1WHSB 2ZIXB 3AM5A 1E3LA 4P3OA 3QG1A 4WLEA 4A8HA 3G79A 1AOXA 4UHJA 1K27A 3RU2A 4JLWA 2JANA 1YSCA 4Q1VA 2IDKA 3CRMA 2VG8A 3BMCA 2UYQA 4B6GA 4LISA 4X92A 1VPTA 1JQLB 4B7AA 2Y9MB 3DMTC 5K8JB 2GHTA 3OPNA 4KAJA 4LCBA 1CFJA 2QJRA 4QBHA 3RD5A 2ZR7A 3VHXB 3E0XA 4B2LA 1ZLXA 5IP5A 1OREA 4LMAA 2PU7A 3IVXA 4EA7A 4N39A 3IMFA 2VSOA 4B8WA 4F86A 5KWSA 4G5SA 1Y6RA 3CXUA 4Z1MA 3W0LB 4LI3X 3OQ6A 2DP4E 2B4QA 2DQYA 2ID7A 3L7LA 4JLOA 3ZXYA 2PX2A 4BCCA 5K0SA 3NC1C 2JS7A 3C6MA 2IS6A 2KMLA 4BV2A 1VCNA 1DUSA 3QE0A 5FTKA 1G5HA 2IHUA 2VK2A 2RKOA 4JC5A 2JHGA 3P94A 3BK2A 1P7CA 1U11A 2XI4A 3NWPA 1JFVA 1P3JA 3IAM1 1H0HA 2JLUA 3I28A 3GDFA 3N5CA 3ODGA 2C99A 2IF2A 2ZATA 1NXQA 2N47A 1ZI8A 2ZTHA 3HCDA 3QVXA 4NRDA 4Q05A 4S1WA 5A4DA 4YV1A 2DC1A 2Q3DA 3SX4A 4ZC1A 4HGYA 3N3BC 4WD3A 3INYA 1X7ZA 4IUBS 4BQOA 1QCCA 1SU6A 2ZQZA 5DM70 3JQ6A 2NTJA 4TTPA 2ZXEA 2F7SA 4KQCA 1V7QA 3FPCA 3P2OA 3RIGA 5FBKA 3L1UA 2WD7A 4ECAA 2LRHA 4FDMA 3H8WA 4B6OA 2B7BA 1FJ2A 1YJAA 1XAIA 3EG5A 1QF7A 1Z83A 1OB2A 3WWEA 1VBNA 5F12A 1UMDA 1GKLA 4R7TA 1S3SA 4KPEC 1D6NA 4GRIA 1K2WA 2B21A 4I08A 1SC6A 1JJIA 3OF3A 3WGKA 4JCCA 3U4QB 2DH5A 4M7WA 1UK7A 3VUEA 5IAGA 1UBCA 3R5KA 1V1RB 4PPFA 2BHTA 1KYQA 3N39C 3FNRA 1QV7A 2QD5A 3FCXA 3NIDB 4CFZA 3BJEA 3M5DA 2FZVA 2ZAIA 3WYGA 1WW2A 4RXUA 5FOTA 2YUIA 3A3NA 4OI0A 2C9MA 1JG2A 3F7OA 2JH8A 2QXUA 3ME5A 1SRRA 4DLNA 1CJVC 1P3Y1 2XOKA 2WFMA 3G3EA 3UT5B 1JI3A 3WQQA 1FXUA 2PKRA 4ZVOA 2YJ5A 1E62A 4E3WA 5K0BA 2JCVA 4EY3A 1OIWA 2ROQA 1BW9A 2GH1A 2VUSA 4UE3S 3SDZA 3W2TA 5LQCA 3ZTTA 4FT2A 2O8VA 3QKTA 5AP9A 3EOAI 1J49A 1M73E 2ZEJA 3WNDA 3NBZC 5L53A 1EWYA 3T5DA 1D7OA 4RSRA 2Y68A 4G4SP 3ZGZA 2WSBA 4RELA 3KUXA 1Q7EA 1XF1A 1S6YA 1ABFA 1Y5NA 4MVJH 5U4XA 1N3YA 1NYRA 2ZJAA 3VQTA 1IK4A 2Q2NA 1ZSYA 1GA4A 3ZXXA 2M98A 2P91A 2X41A 1P74A 3ED5A 3KNZA 2UVPA 1GP2A 2NVWA 1SOUA 3AB3A 4NCIA 4PZLA 5G40A 1EYZA 2V54A 4AMZA 5A4MS 721PA 2ZZMA 3NOVA 3O82A 3LY9A 4ZEMA 2ILTA 4UBMA 3RBZA 2I4IA 2W6MA 3O9VA 3WQRA 3MCVA 2FJUA 4WJZA 3GH3A 3G2KA 4IF4A 1NSYA 3E15A 3RS2A 5IAOA 1G6Q1 2H1HA 3E53A 4ND3A 3X2EA 2CLFB 2C83A 2ZB4A 1IPHA 3K5WA 2JH3A 2EBFX 3V2IA 3SVLA 3AHJA 3T3EA 3QKWA 4FXPA 1SVNA 3RQSA 4ENUA 1GSOA 1I9GA 1W581 2J33A 1NBWB 4O02B 4TT8A 3QKRA 3WLEA 4AS1A 4II3A 3EN0A 4CM4B 2JCSA 1GFZA 2CMKA 2RB4A 1ONPA 2UUOA 2WNIA 2WYOA 5CH3A 5DMHA 5EXTA 4D3DA 4D9JA 2ODQA 3HDTA 4BZZA 1OXUA 4GLLA 1T8WA 2QHXA 3RT7A 3FYCA 4YYEA 4CCYA 3R76A 3G2IA 2HBQA 4UOZA 2HR1A 4QBGB 5JS1A 3OU2A 2CJXA 2BTQA 2HRZA 1WV1A 2BBSA 3J80A 4QBIA 3FNFA 3P26A 2XD9A 5KNCD 1DTWB 1ORWA 2ZIVB 3P2KA 3RAFC 1XNQB 1EWQA 4ZO4A 1P45A 5LBTA 4RDXA 1OAOC 2HJ9A 4Z7OB 3IEMA 4MUAA 3DQPA 1GAQA 2EP5A 4EG8A 1C3LA 1FFXA 2BFDB 3BE5A 1OT5A 2NVUB 2NU8A 1KYTA 2I6TA 3AOEA 4BJ3A 1EK2A 1E6EA 5IBRA 4J8PA 2R6HA 2CNKA 3AF1A 5JUWA 5ALXA 1A72A 1Z5VA 3F5MA 4Q6BA 4WSOA 5CVCA 4ZU3A 2UXBB 1KXJA 2CJWB 1RJ9B 5BUZA 4CDRA 1K7YA 3A25A 4WXHA 2KM1A 4UDXX 1XMJA 3B9PA 4N41A 1GZ3A 1HT1E 1K6IA 1RCTE 3EHDA 4BO8A 3H9BA 1ZNYA 2XMRA 1QGUA 3LCMA 3ZD9A 4PAOA 1QRTA 4R9VA 4MYSA 5DW0A 4CT0A 4DHEA 4JUBA 2PZAA 4JWKA 3WY9A 3CG0A 4BO5A 1B0PA 3ZW8A 1XCMA 2Q99A 1I2MA 2FUCA 3IDZA 3L4BC 2H06A 3SQDA 1EDDA 2O3RA 1RFLA 2QRGA 2CF6A 4HNQA 4YDQA 1XZFA 4JMPA 3KZNA 2QGFA 4XRGA 3PF8A 6YASA 4RLSA 1G5IA 4P98A 5ECDA 4ZU1X 2OHOA 3S2EA 4C4RA 1SCUB 4D0GA 4AP6A 4CQNA 4XIGS 1RWPA 2AOXA 3MCZA 4P1ZA 4EVIA 2OB1A 2AXPA 4RH0A 1H5NA 1ZNWA 2DM6A 2FVYA 2PL1A 1Z74A 5EIBC 5BQFA 4G67A 4EFLA 2O7VA 5H4HA 5J5AA 1KDRA 4CHGA 1LBQA 1WZCA 4ZJZA 2ZUEA 2JB9A 4QICA 4L0MA 1HFEL 2X4IA 2GO1A 1WMAA 1HQYE 5AW3A 1TQHA 1A7KA 3GLIE 1NOJA 4ITRC 3RVDA 2YY6A 3FLEA 3BERA 4Q1EA 5TC4A 2JLVA 4JSTA 4E22A 3O84A 4QU9A 1MO4A 2Q1SA 1KAOA 4OV6B 4W8GA 3N2GA 4ZAZA 4D8YA 1A27A 3TBKA 2C1EA 1W88B 2M1ZA 4UM9D 5BWOA 4UHBA 2C92A 5BSEA 4CKCB 1TCCA 4G0QA 4K86A 4R69A 2OFPA 4UUNA 3TMYA 4RANA 3OF5A 1XJ5A 3ZZUA 3D7RA 2MU1A 2Q3FA 1SQ6A 4WAUA 1G98A 1Y1PA 1FUUA 2ENWA 1O9GA 2JI9A 3H1PA 4IIDA 2CXPA 4WZBB 3VYVA 2EJUA 5F2KA 2P9JA 2H1CA 4IHJA 2J3KA 1S2OA 3TKAA 2P6PA 4L51A 4M1TA 2DFLA 1FX0B 3ANSA 5ICFA 4MVYA 2P4SA 2BRUA 3AJDA 3GRAA 1AJEA 1L9KA 1OY1A 1P6XA 4L9RA 1K4MA 4XX0A 3H8SA 2PWPA 5FBWB 4EH1A 2PUGA 4CEIA 4WOPA 5L3RA 2VT3A 1KIMA 5IW8A 2V1XA 2IWHA 2ORYA 1FFEA 3QELA 2VXCA 3O38A 2R8BA 4OBEA 1XTIA 4BRSA 4BYMA 3LD9A 1FLDA 1LFAA 2NVBA 4D46A 1RIFA 1XMXA 1H3NA 1HSOA 4EW3A 3M6WA 1UIRA 3U9TA 3C3JA 3HO6A 4MV7A 1PI3A 5AM1A 3OCXA 4CZ2A 3GJ0A 3O4GA 2IV3A 3DV0B 1ESEA 9LDTA 2BI8A 3FHLA 1CUBA 4LZZA 2X14A 3KSZO 3WMRA 5JROA 1K7EB 3H2SA 4GOND 5BT8A 4RVSA 1TRHA 3HXKA 3VR4A 4C0BA 2C5EA 4ZMBA 3DOEA 2C31A 4H31A 1KFKB 1BS9A 4OHVA 4V24A 2YWFA 3EC1A 3VPHA 4CUZA 3O4VA 3RYCA 2FSVC 3ZR4B 4C87A 1MXHA 1JU4A 5AI5A 1XLTA 2ZSJA 4JVMA 3QFRA 2AUTA 5EVCA 4ENSA 3F90A 1XRQA 1V6SA 3W8NA 1QRRA 1QGDA 2CCGA 2ZI3A 4MTCA 2W70A 2ZJ5A 4AMYA 1RXUA 1EDOA 1H4VB 5HF6A 1L4YA 1SXJC 2QJOA 2XQKA 5IF9A 3OQJA 3KYDA 4YQFA 2WE7A 1YUMA 2CFTA 3CINA 1GV0A 4N9WA 3TEJA 5IDWA 1OI3A 5IVDA 5HCUA 2HLDA 3LPAA 3TKYA 1DNPA 3BMCB 2H0AA 1RYBA 2DFTA 4Y2XA 1SC3A 1N2CE 5DCYA 1JBQA 4Z7JA 4QU8A 2XVXA 3DJYA 4LYFA 4OL0A 1QM5A 3PUXA 4G0PA 4RK0A 3VVBA 3LX8A 3WVNA 1OASA 5KYNA 5M04A 4H16A 1YR3A 1HYBA 1TM3E 1X0XA 4M87A 4R01A 4R2IA 4FFPA 3WBJA 3AV3A 2FCAA 2OOKA 4I9HA 1N5OX 1TNDA 4EKDA 1EVIA 2FPMA 3EQ2A 3R7AA 3AUJB 4EPTA 1RZVA 2B2XA 3FCEA 3LDGA 4I1RA 1JXQA 1KDVA 3AF6A 5FPTA 4FZVA 2Y6UA 3F97A 1MVOA 2ZBEA 1SVWA 3GI1A 4RMNA 3FZQA 4D81A 2Z2XA 5CDFE 2ECPA 1YBVA 3I1YA 5BW4A 4HPJB 1V3QE 3EJ6A 1RP7A 2PUEA 2XNCA 3L01A 4URFA 4BX0A 3E84A 4MIOA 4BPRA 1CY7A 3A3YA 4ZOEA 3LP6A 1TTTA 4JLKA 4B3BA 3GN1A 4IYJA 5DX8A 2DFDA 5FTWA 1H69A 4RK6A 2C7GA 3D8SA 2P9QA 2X9VA 4MVJI 5L7YA 3TLJA 4EUNA 3O31A 3BEDA 3CVJA 4X93A 5AXAA 3WGNA 2G8NA 4LMBA 3P2EA 5EKXA 3DPSA 3OOSA 4WA7A 3BRQA 1M0SA 4ZDKA 4RHFA 1BGXT 3STUA 3DMYA 3L9WA 4NXNB 1QR6A 3EQ6A 1T1SA 3GPDG 1V4BA 3SZGA 5K01A 1Z45A 3L7MA 2V3VA 1GKIA 2V5VA 1CF2O 4F97A 1UMDB 5JVDA 1L5GB 2L19A 3QVSA 4U39A 5K2MA 5CCXA 1KE1A 2PY6A 1CVLA 2PX5A 4IIJB 1KIAA 3P0HA 2BEJA 3EUAA 4U7WA 3S7TA 2XSZA 4F2HA 5EI5A 3QXCA 2W8BA 3CUUA 3G8BA 3GA5A 3GRRA 3L7JA 3GNSA 1T36A 5E9WA 1DBQA 3QEKA 5C7IO 3RADC 2R6AA 5T4BA 2P0AA 5EUBA 4A0GA 4UVHA 4PGHA 1TLTA 3S0JA 3SGLA 4YMHA 3QNUA 3NBKA 3RVBA 5L4LA 4QXPA 2P8JA 4O2BA 4H4CA 4DA0A 4U2GA 5JLAA 1W8DA 3ABRB 3LP8A 4QEKA 3OMLA 5EFOA 2B7LA 2D5CA 4TWZA 2G4CA 2HPAA 1T91A 3KJFA 4QU5A 5FPQA 4IIFA 1QFZA 5C7YA 2P2DA 1QQAA 4R1LA 1ID1A 3X1WA 4HQNA 4HX2A 3VOTA 3PVCA 4TXJA 3U7QA 3LNTA 1L7VC 4AWXA 4MUGA 2WA1A 3FSGA 5JPDA 3RVPA 5A5DA 1YS1X 2KE5A 3QWFA 3NUZA 4BEWA 3HUTA 2DT5A 1K68A 2FR1A 3INNA 4EPXA 1PNRA 5EFZA 2J30A 2A0KA 2EHJA 5AW4A 1FYDA 1NUHA 5JI3E 2FUEA 3TFWA 5C5CA 1ENZA 1DC5A 3DT8A 2E18A 4NWIA 5E6UB 2K2QB 5H68A 2D1TA 4ACBA 5A03A 5GGYA 2Z8XA 2H48A 2R8PA 4ARCA 1W93A 3TJMA 3AJ9A 4PG6A 3KBBA 2NW6A 5IDYA 1H4QA 3MBIA 5D6NA 4UEOA 4HADA 1EE1A 1NY5A 3KFLA 5BVHA 3F3YA 5AK0A 2EZ8A 4WVLA 3QKRB 4KI0A 2B4KA 4X91A 2CV0A 2KQUA 1XWFA 4OHPA 2X8JA 1RTTA 1OCEA 5TMDA 1ODTC 3FPGA 2HRDA 3RWBA 2H4JA 1JE1A 4BJ6A 2O8CB 2PX0A 4CLHA 5E38A 4R4JA 3BCHA 2PH5A 4R2KA 1FRVA 3EZ7A 3IP9A 1RBMA 3MG9A 4RZIA 4JV5B 2VN8A 1Z08A 2FX5A 4C3UA 3QBTA 2JLCA 3PX2A 3LC1O 3R8CA 3LL4A 4M8NE 5ALVA 2EF1A 1GPAA 3H2HA 4FOLA 5EWJA 3WYAA 3S8MA 1QG0A 1N0UA 2VYNA 4RU1A 2ZRLA 4WUVA 2PZFA 2DPGA 4EYEA 2YWCA 2OXFA 2Q6OA 3CWZA 1V45E 4ALKA 3C3KA 1YRLA 1TYCA 5DMXA 1QIIA 4KNVA 5H59A 3SCZA 3HVKA 4YP0A 1SY7A 3R44A 1J8VA 4BTVA 4Z86A 4ZTUB 1F60A 3WC4A 2WIKA 1HTTA 2C2OA 4GQBA 2IH5A 3WGUA 4B45A 3N5KA 1LK5A 4HQFA 1SU7A 5JDCC 4AZ0B 3TGLA 1RJDA 2IHBA 3EPKA 3M6XA 4OA8A 4FZRA 5LZ7A 2JBAA 1E1NA 3QVTA 2XUKA 4QQNA 5LIRA 4IPTA 3JQ7B 1BIFA 1FDSA 3LPLA 2XBUA 3PPIA 3WL8A 1ONSA 2XV1A 3F6YA 3QHQA 5BYBA 3GMIA 3TIXB 1FW6A 5IC5A 2DHQA 5FPHA 4BRUA 3O3CA 4LYJA 1U0LA 4HTFA 1CRLA 4NQZA 4HYQA 3S1LA 2XX3A 3ETGA 3IQFA 2IUUA 2EL9A 1NFFA 2NV6A 4FC7A 4N6GA 3CLVA 4C6SA 1L3IA 1PV1A 4OGLA 4PVCA 5ICCA 5KJ6A 4ZIRB 1V25A 3DVSX 2F1KA 4PO3X 3I9FA 3L0ZA 2C88A 3I1IA 5KX5A 1CVRA 3WWOA 4DV5B 3VZSA 4MPDA 3M5WA 2GI4A 1UBLS 1VBKA 3GUYA 3WRWA 2FG5A 3EIUA 1SBCA 4JQOA 2KWIA 1QP8A 4R54A 2LIVA 4AG6A 4HFNA 2KLHA 1EVYA 1GG2A 2PGNA 1PT6A 2BR3A 1M6VB 1VPVA 4ND1A 3ROQA 3CEJA 2R6JA 3W6UA 4DCNA 1D0SA 1IXSB 2TECE 3TLCA 1KP2A 4UOEA 2GILA 4NZNA 5JJBA 4I55A 1JBKA 3JRXA 4CT5A 5LN1A 1NVXQ 1MAAA 3O8QB 3L8MA 2XT0A 1NN0A 2OTCA 3ZI0A 5DP1A 1J0CA 3FBTA 4IMJB 1L5RA 2NYAA 2LKCA 4J2OA 1NM5A 4IHJB 4I4TA 4QO8A 5DTEA 3DZBA 2MCFA 1D1SA 2H92A 5HKOA 2A57A 1Q1NA 2OG2A 2W8ZA 2QZZA 1VC2A 3L0PA 2C00A 5BSFA 2OD7A 1H6AA 4KSCA 4B76A 3X1MA 4RKRA 1I6KA 3ND7A 2Y1EA 1LCIA 3B6EA 1G8SA 1GPMA 2XF2A 2A0UA 3C43A 5EMLA 4DSZA 2PV0A 1W2HA 4IUCS 4G8DA 3BL5A 4UQOA 2MT9A 3VR6D 5CXSA 4W1RA 5BWLA 2ONKA 2FYTA 5JV5A 1G4UR 3H6KA 4F8YA 2V4ZA 3AHDA 221PA 5CFLA 4O08A 3T3IA 2K87A 2FW8A 3BRWD 1I7NA 1XVVA 2C78A 3V5NA 4HQ0A 3E8MA 2VJLA 1E3DA 1JSCA 4LWQA 1BDMA 1BN6A 1L8QA 3G5MA 1IQUA 1V16B 1EVEA 2DR3A 3HLTA 3O4HA 3PC8A 1NF3A 3VJLA 1LU9A 2C2KA 1SCQA 4YJGA 5J2TA 2Y3IA 4E1BA 2HD4A 3EF3A 1BQEA 1A2BA 1CHDA 3QLVC 3DP7A 3E70C 4CLXA 4EEZA 5JASA 3D0QA 4L4ZA 2OOSA 2FJ0A 1JFRA 1EQUA 4TS4A 1GU1A 3UHOA 1JGTA 5EUQB 4MRPA 3WDMA 3QPDA 2RHMA 3MTEA 4O2AA 3X1YA 1AS2A 3CRRA 3ZU2A 2BFFA 4QGFA 2ZCJA 2L82A 2ISCA 4J7UA 3WYBA 4DMGA 3ETNA 1EX9A 3N70A 5GONF 4IY1A 2JKVA 1QFSA 2DHDA 3D81A 4O4IB 5AUNB 2QWXA 3EDQA 4LDPA 3I01M 4YEDA 2XGGA 4RIFA 2NU9B 3USZA 4B3CA 4CIAA 5M2QA 2FE1A 1XQVA 2PJDA 1X19A 5L40A 1G6OA 2GTPA 1FMCA 1PR6A 4AN4A 4BC0A 3OO0A 5IT9A 1RM0A 1YI8A 3K9BA 1QE0A 2O2XA 4YP6A 3G8AA 3OCWA 1F17A 5AXBA 1YB2A 3WYNA 1VPDA 3CRZA 4D74A 4P0QB 4KIUA 3F3MA 2HMUA 3HCRA 5FOWA 3VU9B 3IE1A 4AW9A 1UC4B 2OHJA 4DYHA 4DDUA 5EJ8A 3T4UA 3LWNA 1S5PA 3C3PA 2DRIA 3FCUB 1U6JA 4BOYA 4P0TA 3OZCA 4YRSA 3AP1A 2Y1LA 1REQA 5B5SA 1G18A 4M8IA 2Q27A 4FLEA 4INOA 4NOMA 4RMHA 1RQPA 1EP1B 1RLIA 3IQDB 3ZV6A 1JG3A 2P11A 5BW6B 4Q93A 3KLNA 1WUTA 1BYUA 2IL1A 4NYMQ 3LTNC 4MDEA 4ZQCB 4IDBA 3GCXA 1O95A 1BEZA 1TVKA 1JFLA 3IEKA 2GLTA 1NRXA 5EP4A 5C8VA 1LX6A 4HMQA 5A4AA 3MTGA 2W9XA 1ZN2A 4LF9B 2ZYHA 4Y9RA 2FPIB 1D4ZA 3LYHA 4QEDA 4WXYB 1E9SA 1TZBA 2X5XA 1SCKA 2ZB8A 5GOZA 4LBZA 4QWWA 4C0SA 5DK6A 5K8IA 5KTPA 1BRTA 3CPJB 5KWEA 2DSTA 3VX3A 2E5LB 2GJAA 3QF4B 4IWNA 4JU8A 1AO0A 2FPOA 3C7AA 3QFCA 4KXUA 2QBYB 1WPQA 3MIZA 5JVDB 1IH8A 1PTKA 4XPIA 2B1RA 2Z2ZA 5FWXB 3K20A 1MC8A 4BEVA 5IF3A 4ZHSA 3THXB 1N34B 3WGTA 3LUBA 3VDRA 2II6A 1DV1A 1UFKA 4LCJA 4GM1A 5GVSA 4Q3EA 4E1AA 4J9UE 3A9SA 2YJNA 4BZWA 5J2UA 4UMVA 3TVYA 3CB2A 1P61B 1T36B 3DE3X 4B09A 2GZ3A 3B3QA 1PJCA 5FI5A 5H4GA 1YHYA 3HP1A 3C7DB 3DW3X 4Q21A 3FNQA 1WM1A 2DULA 3TL2A 5EWMA 1UK8A 1WVMA 4JROA 4O2BB 3RJZA 3DL4A 3UWSA 3V4FA 1J25A 1NUTA 1WKVA 3T7TA 4RQBA 4URWR 3QU4A 2JGLA 3OSZA 2PTHA 1TF5A 2ZIWB 3QBDA 3M3DA 1UUFA 3ID6C 1AY0A 3C15C 3U7QB 1MOSA 1G1MA 2YN2A 3TZEA 3PNYA 1ZJ5A 5CURA 1U7PA 3EBPA 3SF8A 1VJGA 4YP9A 2I7XA 3AR7A 4M1ZA 1GZDA 1QO0A 1JH8A 2OHIA 3GF4A 2RHOA 4CLDA 4E7OA 2JCXA 4PR0A 1G9TA 2GN2A 3CF0A 3AQ4A 3ON5A 1Z63A 1CERA 4MQ5A 5IX8A 3PNVA 4V0OA 4KODA 3HSSA 3LLUA 5E0KB 1Q20A 3A9VA 3FCSB 3I2HA 3QYFA 2Z8YM 3FB4A 3FWNA 4WN9B 4WLUA 1U6IA 1H0KA 2PZGA 4GNRA 1BHQ1 4WGFA 2ZAMA 1P44A 2PUTA 4L8WB 5BVHB 3FKQA 1ZHHA 3V7NA 2PK3A 5J43A 4K7JA 3A10A 1XEFA 1AHNA 1U5CA 1PTJA 4L4YA 3PNQA 3AB7A 2X8JB 1FW8A 4LC1A 5L45A 1QQTA 2VP3A 5AUQA 1Z4IA 2I2BA 3OO1A 5KAPA 3BSSA 1H2HA 2Q4BA 4C4TA 3GGPA 3D6UA 1W1UA 3THYB 3OEEA 4LBYA 1U3GA 4AZ3A 2IYLD 1FE8A 1IJBA 1JSZA 1YUNA 3C3YA 4P3KA 4PZYA 3TTXA 1XTVA 4FMPA 3CGWA 4C4OA 1TIPA 4F0JA 4TLMB 1YH3A 5L7TA 4BXOB 2E87A 3DXZA 4ZOCA 2ZBDA 4Q02A 4OMUA 4IEEA 4AXXA 3A8TA 1C4XA 2RHGB 2NN3C 4TOIA 3AZQA 1OUMA 2HHJA 2PAFA 2XEDA 4NLLA 4UTZA 3U2QA 2HKIA 2CSXA 5F1KA 1OAKA 3FI0A 5IJWA 4BMSA 4BNZA 5FI0B 3TW6A 1DXHA 1E7SA 2H08A 2IU3A 4XVHA 3VRHA 2X8WA 5G2OA 4XA8A 1YBFA 3RU3A 2MDTA 3K0CA 4A1OA 1NC1A 1T1RA 1L9XA 3O8DA 3VSCA 4FFMA 4JFRA 1FLAA 1EFKA 3DV9A 1GN8A 3GRZA 1UBRS 3ZIDA 5FOQA 2AMVA 2EJCA 3AHHA 2GN9A 1EE2A 1KJNA 3NDIA 3AY0A 2UDPA 2VDKB 2YH2A 3OZTA 2EBHX 3DHEA 3SKVA 4DCUA 3NDPA 3K70C 3WHKA 3FY4A 1E0KA 4YDHB 2HQBA 4C7OB 3PICA 4CMKA 4LJ8A 2EKBA 4P84A 3AI2A 5DLQC 3HI6A 1NE2A 3QGMA 1L7PA 3E9YA 3EW7A 1Q15A 1IJEA 1XCBA 3G59A 3TTVA 4TV9A 3M89A 4DA6A 4DMFA 3CF4G 4EG4A 1NVWQ 1G21B 2PRIA 1HDGO 2CKMA 3EXFA 4HC4A 1JEQB 1H5QA 2AC2A 2OSBA 1I3KA 4TRNA 3V46A 4RM2A 3ZQ4A 5CB6A 1RXSA 4BLTA 5K0ZA 2JL1A 4COOA 4RDIA 1QAOA 2BMFA 4H7FA 2G04A 4NE2A 4BMVA 2N1BA 1XSEA 4WCDA 1NW3A 5K1ZA 2AMFA 1IEXA 4NICA 1NW5A 4KFCA 1PJAA 5TPZD 1Z0FA 2Y1KA 3B8EA 3U4IA 2LKDA 4MZDA 2QLLA 1ZA2A 5DYWA 1IYZA 1Y3BE 2G1AA 1VG9B 4B0OA 3UJ7A 3LBFA 4K9RA 3WLMA 1WU8A 5LOVB 3N59A 3GCWA 1NGSA 1ONBA 5CDUA 1AXRA 4HXFB 4U4AA 1P80A 2W2OA 4BQIA 4YXWD 1NN5A 5JS2A 5DTQA 1TM1E 1JSXA 1R64A 5LDHA 1OU4A 2PWBA 3UOWA 3GJ3A 5TX7A 1E9BA 3NEAA 1KETA 2A0WA 3CLRC 1PFKA 4KO8A 4MA4A 1QSGA 1PQ4A 2FF5A 2XHZA 3CZQA 4I4LA 4K6CA 5EKUA 3AVWA 1RLUA 2UYCA 2VDVE 4F93B 3THSA 3PXAA 3FFXA 1ZGHA 1KYWA 1RYFA 4IKPA 4HS9A 2P6NA 5IEJA 2C2BA 3H1TA 2AL7A 1IXRC 1E3SA 3A9CA 3UK0A 3A6JA 3H5RA 4R9UC 9LDBA 5AXDA 3Q3VA 1FU8A 2O7NA 4C06A 1MX1A 1PR1A 2DKFA 4EPVA 1G7SA 3CFYA 2WU3A 3KCQA 2XDQB 4B8ZA 2D2VA 5IJ9A 1Y81A 2VVTA 3DE2X 2WHEA 3G9TA 1M8JA 2RJNA 3U13A 4TSFA 2VYFA 4LOAA 1V5EA 2BKUA 4DR5B 3HCNA 1S1CA 1TC2A 3DF7A 2QQEA 3UK1A 4DV1B 4HR7A 3UEOA 1MA3A 1Q1ZA 4Y6OA 1Q7RA 4HSEA 2HY7A 3WSTA 3ZNOA 4CMIB 1GQSA 1OIXA 2RI1A 5KVSA 4UZSA 3MSXA 3DG9A 1N1GA 1MW8X 1EX7A 3R6DA 2H1SA 2JGDB 3INGA 4EGQA 1E0SA 2P2SA 4TL6A 1F0PA 4DDWA 1QRSA 2F1RA 4QYMA 1SURA 4IRMA 3W05A 4ZDJA 3WAKA 3ZEIA 3BGWA 3GLRA 4KPUA 3DFIA 4OQFA 3FH0A 4DUGA 2CZGA 3EB9A 4M98A 4O2AB 5JFGA 2C98A 4DV7B 3C7TA 5KINB 1FSFA 1F4PA 2AD1A 1Q0UA 5FTNA 1QQ5A 3ZWBA 3TSZA 4CQLB 3NBMA 4ZMSA 1N5JA 2WIGA 3WWDA 3EXAA 2WDPA 2OMEA 5JO9A 3ICEA 3AESA 4JQSA 5CFZA 2C9YA 3LXUX 1K89A 1IQPA 3ILYA 3LQKA 4IXDA 5ICEA 3PVSA 1W59A 3E9QA 2ATVA 1UMCA 3Q40A 3QFHA 4RYDA 3ROEA 1OT3A 2CYBA 3EZGA 3GEBA 4DLXA 4ERXA 3TI9A 4MEBA 1PJQA 4EUKA 2IWRA 4UVGA 3GLGE 3A11A 3V6MA 2Y92A 3D02A 4LFAB 2WAMA 2I80A 1NKVA 1NTRA 2JLAA 1E1YA 2CB9A 1NFRA 2PT7A 3F6SA 2NZXA 2G77B 3BWBA 3RWOA 4BEJA 4D3YA 4LX8A 5L3SB 5BSGA 3ISJA 2JAPA 1M6NA 4L76A 1G3UA 4DCTA 1T3LA 4DVGA 1QV9A 4IDCA 1IE3A 5REQA 4E03A 4A8JC 4E15A 3FWZA 5TPWA 2OECA 4M9RA 2VAWA 3C0KA 4IM7A 4OJTA 4BGUA 3RFUA 1Y3CE 3ZGLA 1C4OA 1I32A 4GVPA 1VMDA 1KSGA 1D6MA 2Y77A 5A5FA 4PS1A 4TV8F 4EVRA 3OKAA 2D2XA 1E2QA 1VLZA 3OZAA 1GUDA 3GAAA 5BV1A 3SOZA 3TZHA 2BGUA 2COUA 4R1NA 1R0YA 1XRRA 2DE0X 1I4WA 1TVKB 2P90A 2PZBA 1I30A 3DFUA 3H1FA 5CP8A 1JIKA 1TVMA 3AF0A 4PTYA 4Y9TA 4AP9A 1EIWA 1E7RA 3NANA 1JHPA 3ZHTA 3GJ8A 1N2BA 1OXVA 1OHHD 3UFXA 3JQAD 2V03A 1J2YA 3ILXA 3BE4A 5FOUA 1L5HA 2BWJA 4IQ0A 1EK0A 4M1OA 4MAFA 1C8KA 3FROA 4YJHA 3C6QA 1CUCA 2ADOA 1VE3A 3OQHA 2IXBA 2DCUA 3ZWPA 3ADOA 1HNWB 2BAGA 3T9CA 4NV3A 1XZLA 1ZR2A 4ZI3A 4L8GA 3SJ7A 3FLAA 2M2IA 3WA6A 3OT5A 3C5WP 1PNQA 4JJIA 1D09A 3IT1A 4PC1A 1KBQA 4UEWA 5LP6A 1MRNA 4GEGA 1NNUA 2X3UA 3A1DA 4I50A 1RQLA 4XCXA 5DXFA 5EAIA 3TVDA 4FT4A 1Q1AA 2PS1A 3Q8LA 3TTSA 1U9IA 1HO3A 2ZRAA 3VOBA 2MSNA 2V8BA 1F8FA 2ESRA 2X0KA 2ZULA 3M0EA 3OCUA 3MJHA 4JBIA 4L3WA 3H7AA 5HIIA 1HFWA 3VNBA 2QLTA 1Z5GA 3KFXA 1ZISA 2WJIA 3ABQB 4RCZA 1VKRA 4YQZA 4F38A 4TYNA 1A7JA 4M38A 1J5PA 2NYRA 3DO5A 3OPYB 3L1VA 4A6PA 4AO7A 4LTMA 2O19A 1P91A 1XCOA 5PNTA 1G16A 4WESB 1DKQA 1S2LA 1VYTA 3MBKA 3WYDA 3ODPA 2AOVA 2QTMA 4MW0A 3RJ5A 2PRYA 2CVOA 3ZJ5A 1E89A 2WNSA 5K3BA 2NTYC 3THWA 2BTEA 4NE9A 1MH1A 5HXAA 3K92A 1NFQA 1QYXA 3KQWA 3L8FA 1TZKA 1JTFA 1J21A 1AA6A 1JHMA 3KRTA 5I7HA 1VRCA 1TT7A 2VPXA 5F5XA 4DMMA 2RBEA 4WJLA 3IOMA 4YQYA 3HYNA 2EKPA 1P2FA 2AFRA 3FSEA 5BMVF 1DBSA 2E85A 1M6WA 3FIUA 4LRYA 4G8CA 5CUQA 2N0SA 3L1KA 4UUMA 2GZAA 2OORA 2AFHA 1WJGA 1NBEA 1TEHA 1HE4A 1DFHA 1K4YA 2CFSA 4ZO9A 4RHYA 3L0BA 3VMMA 4IINA 3UW3A 3VI3B 2E89A 1HYHA 1CIVA 3FBGA 4UBNA 2QAGA 3CH7A 4YO7A 4CXMA 3CZCA 4GOKA 3PHIA 4YRPA 3S8YA 4N5DA 2JAWA 3E7FA 5DHFA 2R6R1 3IDOA 5I01A 2DY1A 2H17A 3RS8A 1KK2A 1PZFA 3D1LA 4P5PA 3K0SA 2ZI6A 5LA6B 5LPNA 1SVKA 4AZ3B 1E18A 3E2MA 3R5XA 3U44A 3DTVA 2FPPB 2WU4A 3MRVA 1NW4A 1DCKA 3NMUF 2QTTA 3DCIA 3KLBA 3C3AA 3SICE 3AFMA 2GS9A 3BEOA 2V59A 2PM8A 1U8FO 4XUCA 1DEAA 2FCRA 3KJXA 4DYVA 2HADA 1B00A 2C54A 3PNBA 4JFAA 2CF5A 4D9NA 4JBHA 3QEJA 2CMFA 4GU5A 4QDXA 1PJ4A 2O5EA 2X86A 3HP4A 1ZIOA 2PZJA 1VSBA 2C8KA 3PUHA 3R09A 4ZQEA 4Z0TA 1V9SA 3FGPA 3QUQA 1DU4A 4JHXA 3RLFA 2WYUA 2V45A 1E1QA 1IIBA 1CZNA 1ZK4A 2NZWA 4HK4A 2QAJA 5LR6A 3T95A 3KFVA 2F9LA 2XCLA 1RP1A 3Q5DA 3M4XA 3IQWA 4D0LB 2OCGA 1GDTA 1KL7A 5IHXA 1NHWA 1OLXA 4K3VA 3WZLA 1WUIS 1LSOA 4D92A 3TQRA 2YMPA 4ZHQB 4H2DA 4B83A 5KHOC 1JAYA 2JLSA 3SZMA 5IBPA 2R60A 1CR0A 2O06A 3ESQA 3LWDA 4MVJP 3TOSA 1DX9A 4ZGWA 3F2VA 3GAFA 1CS4C 1SUEA 2QRVA 3QF7A 2WTNA 4PONA 3HUFA 5KYKA 3VDXA 5AT1A 2D0OB 1G59A 3HACA 2VPYA 2O8FB 3P19A 4DZZA 1T4MA 2WNHA 1GRRA 3LECA 4AKTA 3EXFB 2BFOA 4MUJA 1P1CA 1EDZA 1QTRA 3QW4B 4PG8A 3MRSA 1PF7E 5KVAA 1XDWA 4F8EA 1SAYA 4DUYB 3LPNA 4JYAB 5BRNA 2A1UA 5JD3A 1M6EX 3R24A 4ZVMA 3TMKA 4MQFA 5C1DA 1Q92A 2PGAA 3HPQA 3I9V6 4G1UC 4E3ZA 5IWAB 1KRXA 1HDYA 1S2DA 4M76B 2DMRA 5ALMA 1J2UA 4HH1A 2J87A 2CXSA 4WKOA 5AHOA 4DMHA 3G2NA 4YV0A 2YMQA 4YJFA 4Q3OA 4ND7A 3OJLA 5D7NA 4C01A 4BZQA 1IY9A 2I4TA 4IGIA 1W48A 1O94D 3SIPA 2Y1GA 3RC7A 5HKKD 4NBRA 3N05A 5C81A 3AGQA 4GGOA 1G20A 4GR4A 4Q3KA 4JL6A 3WRYA 1RRVA 1WVGA 3BMNA 3RV4A 1SCAA 2A9VA 2O50A 3ZE1B 1PWHA 4UC0A 3QUBA 1GZHB 1YZGA 2OFFA 3VR1A 5C8YA 2BMAA 4DB4A 3A0RB 4MR8A 1KPHA 3OY2A 1KP3A 1P2GA 3QU2A 1MFZA 4CM1A 4NFYA 4OQDA 1IN1A 4REMA 1W6UA 5BWBA 1DAPA 3IP7A 2WIBA 2GBCA 2VDUE 1OU0A 2FMUA 2O3TA 5HS4A 1JXAA 1Z17A 1XKQA 1FLVA 1QZ3A 5JNUA 1CF4A 3A1VA 2P27A 5E4TA 1N5DA 1JHXA 3BH7A 4WQMA 4DDKA 4OLAA 4WK0B 1C50A 1GD1O 1TADA 1GPDG 2WKSA 2OBMA 2B3DA 3AM4A 1SN7A 1VHQA 3U9LA 1WXEA 5B3KA 2WJYA 5DHSA 3ZLJA 1RZUA 1WXIA 4ROTA 2GCGA 3EDRA 3QUCA 4EJSB 2Y1OA 1VG1A 1YDEA 3A6DA 3JVIA 3LV8A 3O90A 4HWKA 1XDBA 4ZOQI 3LYUA 4QL3A 3RUEA 2D0IA 1BAPA 2GCPA 1KJZA 2YHIA 1JA9A 2IZ0A 2J3JA 3ZHRA 4TLDA 4H60A 3R0VA 2HK7A 3HJAA 3OIYA 3QXHA 1W9MA 3W1EA 3DD1A 1C0PA 4UMFA 4QHSA 5TXGA 5EN4A 3ZY4A 2I2WA 3TLKA 2QVCA 4UU0A 1G55A 4IILA 4GPTA 3VR5D 1AGPA 3JYPA 4LG1A 3A32A 1IOZA 3G2PA 3QTLA 3AKEA 4PANA 4UMEA 2Q6TA 1J0XO 2J46A 3A7EA 3NT4A 2VK8A 1A4RA 4OJQA 3EA5A 3BWMA 5LQUA 2C96A 4LWOA 5DCLA 4AKIA 1MD9A 3EUFA 3VM6A 1D03A 4KR0A 4FP9A 4OP3A 5DNCA 5EKTA 3V33A 3COWA 4JX9A 5AI9A 3UUGA 1UMCB 1CS0A 1RRMA 4E11A 4KBFA 1OQAA 3PXBA 4B3XA 5B57C 3MAAC 4BTEA 4DR4B 1WNFA 1EK5A 1QG6A 4KAAA 3V8QA 4Y1RB 4UNNA 2DCMA 4B7UA 2I8AA 2GPSA 1VLHA 2IRWA 5F76A 3F9RA 4PWZA 4Q48A 1VJ0A 2PUHA 5TQ2A 3RG2A 3RRJA 5CDYA 5EVJA 1Z6QA 2ZB2A 1V2GA 4BCBA 2PA0A 2J3IA 3NNSA 3D7SA 3CUEF 3BHJA 3IHLA 1ZL0A 3MVEA 2AR7A 4KI7A 4PW0A 1PR9A 5J59A 5BSKA 1ISHA 1PD1A 5IJ0A 1CUYA 2VHUA 1ICEA 2CL6X 3N28A 1I5RA 4D42A 2QVBA 3MJVA 4U9UA 5ILQA 4EG6A 4YRLA 4FR2A 3WLRA 1I3NA 4XOUA 1PZEA 2HRRA 4WOJA 4RPGA 2QEQA 5JJLA 4MDHA 1ZK2A 4N7MA 2PMKA 4J4BA 4YAUA 2QRJA 5FEMA 3AETB 3KTFA 4BFSA 1PG2A 5DBGA 1LI7A 3LF1A 1Z8DA 1YR7A 2Q2OA 3C4VA 2VAPA 2H3HA 1ZD3A 2ZUSA 4BO4A 2UVQA 2EGHA 1OX4B 1Z6GA 2X0DA 4CI0B 1KK3A 3OM8A 4YP1A 3AVOA 1MN6A 2OCBA 3O83A 1NYQA 4A91A 4MVJF 4YJHB 3Q1LA 1KQNA 1U9CA 5LMUB 1OI4A 2POQX 2BM9A 3S44A 3ZXSA 7MHTA 1F12A 1BH2A 5CCBA 2C0PA 4MWCA 5CM8B 4CNBA 2UV8A 3RS3A 3WGQA 3QLJA 1VGRA 2B30A 2NU7B 2VHWA 2AF4C 3GA7A 1X8JA 1BQ3A 1E7WA 3WNCA 1FDUA 4F1JA 4QDUA 1IEVA 2XMPA 3TOCA 1J1IA 1FEZA 2XQIA 4BNUA 1N8NA 1Q19A 4DEYA 1WSBA 2FE4A 3O7WA 5JTTA 1ZRHA 3N0RA 4P3XA 1TEZA 1Q11A 3BC1A 4CKEA 2WWWA 5JFOA 3L8CA 5K3FA 1WUYA 4BWGA 4QREA 1RKQA 5IYZA 3SQMA 2Q3BA 1MVLA 1K1EA 1BXZA 1V11A 3D54D 4RJTA 4K26A 4KRYA 4ZEOA 2B4AA 2UUAB 1TE2A 3PU6A 1V9CA 3E81A 3FVRA 1YE3A 1HK7A 1JVNA 1QYRA 2RI0A 2QLMA 3LS2A 5TJHA 5LLDA 4MUKA 4RA6B 3ZCXA 2Q6IA 4U3JA 2X4GA 5D1NA 3WXMA 1XZJA 4PZ0A 1XQYA 4CE6A 3C74A 2JFGA 1CETA 4JKOA 5DNDA 2QQ5A 3R74A 1BWRA 4BFLA 2YV1A 2ZIZA 3P9QA 2XOKD 5M3BA 5EQJB 1DC3A 1Z22A 2W2LA 4BO6A 5CEEA 2BJHA 1KKLA 4AYXA 4OP2A 3GGGA 1EDBA 2WLTA 4KN5A 2W22A 4QDOA 2ZTUA 5EPEA 2VBGA 4GDFA 1LEHA 2JIPA 1UOEA 3FBWA 3CZRA 4FKBA 1JEYB 4ONEA 4R5HA 1UQRA 2HXGA 3D7LA 6LDHA 4TYYA 2MMCA 2FUKA 1N2IA 5KDLA 3TOVA 3BTVA 3F6CA 1X9GA 2FPLA 2QP3A 1YACA 1VIYA 1WVIA 2AFHB 1WCIB 2YJTD 2X6QA 3L8YA 3R3ZA 4FE7A 5DFAA 1FQOA 4YREA 3IA2A 1FSPA 3JRNA 4JA2A 5EJFA 1XTPA 2IDZA 2JJ8A 3KHKA 1QG2A 3IDFA 1U2EA 2IT1A 1HXHA 2EW8A 2OR3A 2ZYRA 1UXIA 3NBAA 5DOVA 3UHPA 3VNAA 1CKEA 1QHGA 4BVJA 4L7VA 3IAXA 3MW8A 1K63A 1UOQA 2Q50A 3DXFA 4M7RA 4UTOA 1B15A 1UZMA 1F3OA 4LXHA 5GJCA 3V1YA 4ALIA 3GD5A 3LNCA 1RCFA 2FDXA 3C3EA 3EARA 3FVQA 5ES4B 3JD3A 4A10A 1UAAA 1RAGA 4HB3A 1H2AS 3U44B 3LFTA 5A3VA 3OWOA 2O2EA 2FHSA 4C3ZA 2PUWA 1Q0RA 3NXKA 2BHSA 5KOIA 4C30A 2VNIA 1WHTA 1T1GA 3MM4A 3QU9A 1N3BA 4ZT5A 1QORA 1BXRB 2R4QA 3RYTC 3D64A 1JG4A 2Z30A 3BH0A 5FPPA 1Y1RA 4HT3B 4KMOA 2B2CA 2EQBA 4P81A 1SNYA 2OENG 4OI4A 3TRFA 2G63A 2ZI7A 1A2QA 5C5EA 3D43A 3RRNA 3RS7A 1DDOA 4LDRA 4B4DA 2ORIA 1PGPA 1M5UA 2OCLA 3L46A 3LPCA 1PWEA 4K40A 1VJDA 3FTQA 2HTEA 3TM4A 1IVNA 4F06A 2DFNA 2I3ZA 3CKMA 4H1UA 4J2TA 4MV8A 3IKMB 3HKDA 2IY8A 1HEUA 1WPGA 2CNBA 1YJQA 1FMLA 3A9TA 3AKYA 3GUZA 4OI2A 3Q98A 3W5IA 2VTBA 4YUZA 1LDNA 3KWJA 2R25B 4PG4A 5IEBA 3TLYA 1PLLA 4J76A 5HFJA 2XUFA 3L6DA 4GX0A 1NVTA 2BN4A 1G8GA 3IOEA 4D44A 2ZVDA 1E3IA 3DZIA 1UDBA 3JARA 3URMA 5EJ9A 2XOXA 4IDQA 1AK1A 4KSBA 1BX1A 4JC0A 2QRVB 3VGJA 2ZBGA 4JXJA 2NZUG 5BN3A 5JI2E 1UJMA 1EINA 2QRUA 4EBBA 5C4MA 2PANA 3SS9X 2ONYA 2QTHA 2YICA 4ZO8A 3Q3EA 1OTYA 3J7AC 3C1TA 1R16A 3EC7A 1CR2A 5M5BA 3HZZA 4BLPA 1TJ4A 4DAOA 1T0PA 4P32A 2O7SA 4EHDA 3MSCA 1DEKA 2RHDA 1KZYC 2WV7A 2GPAA 3NB0A 1MJGA 3L7OA 4EY6A 3FNIA 3SHQA 1N1DA 3LSTA 4ND8B 3B3JA 5EJIA 4HHEA 4C76A 4GM0A 1HDRA 2FLKA 2UZAA 4RA9A 2E4UA 1NF9A 4CGYA 1IZZA 4N6NA 2PUBA 4P08A 2NVOA 1DTSA 1DAFA 4QDJA 2NAFA 3DCJA 4POAA 2F59A 1ZSVA 4UNQA 3VNVA 1E2BA 2GBIA 2HSEA 2O07A 5HJ5A 1T24A 3IB6A 4OK5A 3HQ4O 5SY4A 2QL5A 1BS2A 4B8YA 3CMCO 2PIAA 3KOZA 3OHPA 3H5NA 2DPXA 2RGDA 2QN9A 4OATA 1D2RA 1G20B 1ZRSA 4H3HB 5LD2B 4A23A 4RX1A 1H22A 2HH9A 5EQTA 2Q0HA 2PSFA 2EKLA 3OTWA 5KHLB 2RD2A 2C9CA 3DMTA 3A36A 3KBOA 1OXSC 4ZFNA 5C8YB 1EBBA 1RWVA 2W2QA 4DJEC 2ZK7A 1O89A 2CNNA 1SKAA 2BV3A 1E3MA 3PJGA 5LWQA 3K71B 2ZANA 4WN3A 2Q1XA 1CHNA 4M7PA 3W4JA 4RAQA 3ZI7A 3JTMA 3CRQA 5JCJD 5L4NA 3ADDA 2ZU0C 4QT4A 3PDWA 2O05A 3IVGA 1RCUA 3NYIA 3OM0A 4UEKA 5L3ZA 4LZOA 3S3TA 3CIOA 1RC8A 3UB2A 3ZHYA 4X3OA 2QVZX 3BA6A 2F43A 5FD8A 1Y9JA 2A0XA 5DHQA 3DFZA 2REOA 1G4AE 3STYA 1D9ZA 2VRBA 5KSPA 3B7GA 2Z43A 3VPGA 1KTIA 4XSGA 4HF7A 3H0KA 1SXPA 3EA0A 5CLQA 1WKBA 3W7AA 4DXDA 4K8RB 2AMYA 5GPBA 4EGAA 3NAGA 1VG0B 4IZOA 3JQCA 2AEMA 2R7KA 1U9YA 4DTCA 2GJ9A 3R7DA 5DXAA 4AY3A 3MQFA 4PO9A 1EUZA 3MFQA 2GFIA 2NUAB 1YAHA 3DHYA 3WV4A 3M1YA 4YDSA 1F1JA 4ZT7A 1YRWA 5TMEA 1CUGA 4ARUA 1DBRA 1ULAA 5IDXA 3DE6X 4EUFA 2Q41A 1H66A 1ZGZA 2GEJA 2ZRMA 3CNBA 2P3OA 2AHOA 4X90A 3VR4D 3WHIA 4DBZA 4F1WA 2QT0A 2IJGX 4JKIA 4HNVA 5BSWA 2B94A 5BV7A 3ABSB 1AG9A 1ND5A 3CRNA 2NQTA 2BKAA 4JT9A 2CL0X 2HMYB 3SLKA 1ORRA 4KL8S 5IC6A 3JYQA 1C3JA 4YCCA 1BX3A 3L7AA 1PYDA 4V1CA 1TC1A 2QYTA 3GWGA 3HBFA 1Z18A 4IUDS 1OYVA 5LQSA 3S5JA 2OCKA 5HK9A 4GXRA 3PPWA 1NU8A 1INLA 3IV7A 4UNPA 3A7DA 2OL4A 4FSXA 3H1GA 1ILWA 1EM8B 4PGFA 2ZKLA 2RGWA 3TRKA 4Z2AA 4ZZ3A 1B26A 3VGPA 3QSYA 2IYTA 3FPEA 4BKRA 2NNWB 2NZVG 1YS7A 5EZYF 3RUIA 3UHJA 1CE8B 2HLDD 5FH9A 1UF9A 1TPZA 2H4HA 5D5HA 1DRWA 1KDPA 3LVFO 1QBGA 3STXA 3VTFA 3GLIA 3HPRA 1BE6A 1HQDA 1XXHE 1AGNA 2IY7A 4BX2A 1GT6A 1LA2A 2O1WA 4GR5A 3BRSA 3NKLA 4QUIA 4WXEA 4A4DA 5GVRA 4E12A 3UGJA 4WXRA 1F38A 3W3AA 3P2MA 1PDWA 2ZSBA 3CT6A 1GAEO 3HGTA 3GO4A 2YOHA 4LE0A 3BD9A 2ZS8A 1EFDN 3GXOA 3OCZA 4CF3A 1YB7A 5EP2A 5L6MB 3ZUGA 5KX5F 3UGQA 4UE2A 4AJEA 2H2IA 1WCXA 3LZ6A 4HMPA 4OYHA 5DM2A 1IZ8A 3BREA 5F51A 4GE3A 3OJWA 4PX3A 1FFHA 1CLUA 1J33A 3OUZA 1E92A 2JLWA 4JB3A 1SBQA 3C3DA 5IK2A 4R84A 3T0FA 1P2SA 2OZLB 2H59A 3JRWA 1RRKA 1XYYA 3R0IA 2AYYA 4KK4A 4BNMA 1XG5A 3S1SA 4K9OA 1COZA 1GU7A 3R2JA 2X1LA 1CBUA 3ECAA 1JEDA 1QCYA 2OV2A 1IM8A 1PNTA 1QC5A 4FEGA 2OXIA 3FG9A 3UWDA 2ATIA 2DSNA 1TJYA 3CNHA 1WCWA 1WIWA 5A7FA 4I55F 3S1AA 2V6MA 1XJQA 3G5LA 2A5FA 3G5AA 4NEHB 2W5UA 2GKSA 4Y0AA 3RT1A 5JBQA 1IIRA 2EFHB 3F2IA 1J4AA 1M1NA 4B4UA 1V26A 3R9WA 1XVAA 1PSZA 5BOSB 4QTUB 2EERA 4GOMD 5EG5A 3BFXA 1HX7A 1RMTA 1DCMA 1GITA 1XRJA 1M2EA 4FYIA 2PMWB 1HDCA 3CISA 4I4TF 6ABPA 1E7QA 4ZK6A 2QUZA 3EWNA 2VDRB 4BO2A 2VFAA 1E69A 2HJVA 3DYIA 3SC4A 3NWJA 5IYZB 1OAOA 2VNSA 3VPSA 5LCXA 1L5NA 4IQGA 1F48A 5DYNA 1OIVA 1YMQA 2Q5OA 3G82C 3K0FA 4PSDA 5SZKB 3TI7A 1QZZA 3ELYA 2P9FA 4L6CA 4NZMA 1AKVA 4N8EA 4OCZA 3EY9A 3KOMA 3AI1A 4Q19A 4U3JB 4BVAA 5TLSA 2XSZD 3JZMA 4C2UA 4QTYA 3ETCA 4MYRA 2C82A 4OHUA 4AO8A 1HTBA 4Z4FA 2G0AA 1WDTA 4K9NA 3WGLA 1SUFA 2BYTA 1UPBA 2YMLA 3EUEA 3M1LA 4D7AA 5E4FA 4V2UA 1KAGA 3O4IA 5ECWA 3T4PA 3UK7A 1V8FA 1GLGA 2P9BA 3COZA 4B44A 1BD3A 3E4DA 4L5AA 4ER0A 5KU7A 5FADA 3TK1A 2WWFA 1Y7TA 1RC1A 4G8BA 4XIFA 3JYNA 3LZDA 3RHTA 3KB8A 3ANLA 3L4JA 5K5EA 3TRJA 4F96A 3CGGA 5J2TF 1B7GO 5DWQA 4Z3OA 2IYQA 2HO4A 4JH0A 3RS4A 2XZPA 4HGQA 1N2CA 4PSUA 1IXKA 3T4XA 2BUBA 2SCUA 2WZBA 1VM6A 3KB6A 1Y6FA 4C6RA 3J7TA 5AKXA 1IRXA 3G8DA 2HU5A 2PUVA 3FSGD 4Y6QA 4PC2A 4NAUA 3Q8MA 2JFPA 1LKZA 2G6BA 2I9PA 3N6RA 4QGHA 2Z08A 2YDXA 2AT1A 3IRVA 4FCVA 3JY6A 4EPWA 1TK3A 1CZHA 2JD0A 4UD6A 3C1UA 4WX2B 1AUOA 1UBHS 1ZN9A 4E46A 2XCUA 2AX3A 2C0CA 4QOIA 2IBTA 1IWPB 1ACLA 3L43A 1IUOA 2P79A 3IPLA 1ZY2A 3ZHSA 4IS3A 1XCPA 2PUJA 4E2YA 4M0EA 5B3LA 1PV4A 4Q4HA 1IOLA 1XK7A 2I2XB 1H2RS 2XYGA 3P96A 4CTNA 4EY7A 3L6EA 5BR8B 3L4KA 4KGVA 4NEQA 3KYJB 3T9BA 1KF0A 5LXTA 1U5BA 1LDEA 1WABA 1VGQA 1BD4A 1QH1B 1YA4A 5ALQA 2MYUA 2GN1A 5IM5A 2DUNA 3H4VA 4HNUA 3OCCA 2GCOA 1O97C 2CB0A 3ND8A 4LKOA 2YW9A 3K0AB 1EK6A 4OH7A 4RD1A 5I7AA 1VPEA 4C22A 2EIXA 3SSMA 1WCYA 3SDSA 1L4GA 3PA8A 4C08A 2R62A 1LPNA 1GQQA 1U3TA 3REQB 1P0PA 4CUKA 4OMFG 2IYWA 2PMCA 2ODTX 3PLNA 1QZUA 2C0QA 5E7IA 3V48A 1A2KC 4CF6A 3QVMA 1W36B 5IHPA 3EBOA 3FFTA 3C87A 2JFFA 3G2OA 4ER6A 5BUSA 4KK3A 1TTQB 4XQEA 1C7IA 3REFA 5JXIA 1NQAO 3K1JA 5TS2A 3GVXA 1ZINA 1EXWA 1U2QA 2VT2A 2XAAA 3CCCA 3U3DA 3SE7A 1TYEB 3CTPA 2VYND 1SKMA 2OGTA 5CNJA 1QFMA 2PR2A 3DEKA 1M2JA 5FR2A 2WILA 3VVLA 4PYJA 2GCEA 4GLFA 4ZVKA 3F73A 1PD0A 3I6ZA 1I94B 4Q7KA 2QN7A 1XMQB 4YWJA 2XGMA 1IG0A 1DWQA 2FOXA 2GA8A 1QRDA 5AKYA 4AD8A 4MGYR 4PSCA 1NHGA 3WOVA 1EXVA 5I9LA 2ACWA 1YBMA 2GSDA 4P8RA 3QIAA 5TF0A 1V1MA 2IYSA 1P0QA 1PHRA 2P9ZA 3C8ZA 3VOAA 2EFEB 4ZYWA 3FOEC 1TYBE 2P4HX 1FDWA 1H6CA 3GG2A 4W1QA 4FYYA 2FSVA 4KE9A 1FRNA 3TLBA 1YQTA 1U0NA 1UJ5A 2LNDA 2FG6C 5J2UF 4PFQA 2OXEA 2VLIA 4DCJA 4MI6A 4BP3A 1RPNA 1NI4A 4KXNA 2IGBA 2OUKA 3KP1A 3K6KA 1L3BA 2OT3B 4L07A 2HWWA 4Q66C 3VDQA 3NEYA 1IC6A 4TMFA 1CUXA 1SXJA 4ZREA 5EIWA 3F98A 4UXHA 1W85B </