4CM1A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 93
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm1A00
3NTQA 2PKQP 5TJ9A 5KJCA 2GRAA 1GZ4A 2NWQA 1BMDA 1N2SA 1LLUA 4RVDA 4ALIA 1NTOA 1HDGO 2JD0A 3FF4A 4IMRA 5I7EA 5JNLA 4E13A 1XG5A 4N5LA 4BNFA 5I9NA 3DBHA 1T4BA 4CR8A 1QYWA 2PGJA 2CDCA 3PVZA 3MOIA 2CUKA 1Q2XA 2HCTA 5AXCA 1LC3A 3GUCA 3GZNB 4RVHA 2OHXA 3H65A 3QSGA 4HUJA 1V35A 1Q7CA 3QW2A 4YJDA 1L1FA 4EEXA 4PRLA 3O03A 1X1TA 1LTHR 1LSOA 3V8BA 1MA0A 1Z75A 4E4YA 1LSSA 1Y6JA 4B4VA 4GAEA 3W8FA 4ZQFA 3WYCA 1E6EA 5A04A 2AE1A 4ZJUA 4CL8A 5CEEA 4TRNA 3SC6A 5JYDA 4TRJA 3TQHA 1EVZA 1M6WA 4AVYA 1I8TA 2VTEA 4YDRA 3K2BA 4LRSB 4DIOA 4PZCA 4DVJA 4KTVE 1P9LA 4CJXA 5A03A 3IKVA 1U4OA 1M2WA 1GU7A 1HF3A 1I3MA 3JQAA 4MPDA 4YEDA 4FGWA 3GR6A 3L6DA 3INTA 4BGIA 3IIEA 2NTVA 4TVOA 4Y67A 3H5AA 1PJCA 1GQ2A 3U62A 2Q1WA 3DFZA 4Z3KA 3DZJA 5JC8A 5IAAA 2AQIA 7ADHA 4ZGWA 3WYEA 3VH3A 3WS7A 3OJ0A 1XWFA 4J16A 5JPIA 1QYDA 2BFMA 3ZU2A 4B79A 4IDCA 3NYWA 4R5MA 3WGTA 1XYGA 3ZNNA 4YJHB 4FJ2A 4WLFA 1K6JA 1QYXA 3BMCA 3N7UA 9LDTA 4NBWA 3H9EO 3S2IA 2BGLA 3TZHA 4PG8A 5F5LA 4OL9A 4C4OA 2EG9A 5JBIA 2DTEA 3WGOA 1C0IA 2UUPA 3RJ5A 4CV2A 2NVWA 5LCXA 3WGYA 1YJQA 4AJIA 1A5ZA 5BQFA 4ZA2A 1YH3A 1GPJA 5JMWA 3AFNA 1F8FA 3VPSA 5JDCA 3TZKA 2C29D 3OA0A 2CFCA 3GOHA 4FFNA 3VTZA 5HBRA 2J5RA 1K6IA 1MG5A 4FW8A 5BNFA 3FBGA 4PLTA 1U3TA 3BMNB 5CEFA 1CIVA 2C7VA 2GCGA 3VZRA 1ZH8A 3IP3A 3UH1A 1XKQA 2EIHA 3KSDO 1YO6A 2QYTA 4HFNA 1A9ZA 1NNUA 4MVJI 4UUOA 3GAZA 4ALMA 4E6PA 2Q1SA 1NWHA 1UZLA 2X8LA 5K6AA 1PL7A 2Q99A 2X9NA 1DLIA 1ZK3A 1D1TA 4CV3A 4JK3A 2EF1A 2CY0A 2OOSA 1R0LA 4WCDA 1T1RA 3ADOA 4PVDA 3I5MA 2I66A 2J5KA 3PJDA 4E5NA 1CF2O 1XU9A 4LCJA 4D41A 4Z0HO 2VT2A 2PZKA 1UDAA 4RLHA 2VHVA 1A72A 2CSUA 1DO8A 4GKVA 1LLQA 2XXBA 4WUVA 3D3EA 3Q11A 3RBZA 3PFFA 1N1EA 4J90A 5COQA 1WLYA 3AUAA 3GZ4A 2YYYA 1HZZA 1P1FA 3WG9A 3TPCA 1H6CA 3WLEA 5TIIA 3CSDA 3FPLA 4OM8A 3RU9A 1TT7A 4D0RA 5JC1A 1WZIA 4DXHA 1N7GA 4GI2A 3Q3CA 4J7CA 2W4QA 1BG6A 2CD9A 3AU9A 3I23A 4Y98A 1E3WA 3NRCA 1Q0QA 4YVFA 4BKOA 4CMCA 3QQPA 4NNJA 4B3IA 3CPSA 3WGHA 1JKIA 1YL7A 3GNQA 4D43A 1P3DA 3FR7A 4LMRA 1E1KA 1X13A 1EZ4A 2X23A 3KXDA 3DBHB 3EHEA 5AYVA 3V2HA 3RI3A 4W6ZA 4Y6RA 2VUSA 4BNGA 4K9DA 4OJNA 1ZXLA 2GUGA 2YDXA 2HO5A 3IAHA 1T4DA 2NTNA 1IPFA 4PG7A 1NQ5A 5KVCA 4RVSA 3AUTA 3FTPA 4CMEA 1CJCA 4JCOA 4YAIA 3JQFA 3WX0A 2DKNA 5DBGA 2QIOA 4BNUA 4DC0A 5JS6A 2DVMA 3MEQA 3JD0A 3AY7A 4YJGA 1AXGA 4WKGA 1DJNA 4YRAA 3I9KA 3KYDB 1I5RA 3O9ZA 1DRUA 3HUDA 1FK8A 4E2XA 2GD1O 4KQXA 5CP8A 1WW8A 3NJ8A 4J49A 4QT0A 4Y8VA 4Q9NA 1KEUA 1NQTA 2W98A 4O1MA 4LSWA 3HDJA 3H6KA 8ADHA 1H94A 4WNIA 1IHYA 4EW6A 4PVCA 4NJOA 2PWZA 4CM9A 4WOKA 5DULA 4ONEA 1Y9AA 1GY8A 4HX5A 4B3JA 3I52A 4ROSA 2EJWA 4BNWA 5A9SB 4CQLB 3VHRA 3N58A 2FR1A 2IXBA 4U7WA 2RH4A 3CIFA 3QP9A 4DTIA 3ZWVA 1NR7A 4XQGA 3JQCA 4ZQEA 3RCBA 4D42A 4IDEA 2FPIA 5LC1A 3PWZA 2JCVA 3PP8A 3EK2A 4E2WA 3E9QA 3GA0A 2G1UA 2HJRA 3BMNA 3MOGA 4XX0A 1E3JA 2JD2A 1C0LA 2O4UX 1V3VA 1ENYA 5JDCC 2O3SA 1SEVA 3AFMA 4XQ9A 3WBBA 4MVJG 5LDGA 1LC0A 4NPCA 2DUWA 4RZHA 5KTKA 1XIVA 1PU2A 3RAJA 3I9NA 4YRBA 2GERA 4RO0A 4MO2A 3MCVA 1YB5A 1NWCA 4EI2A 2CVOA 1YDWA 1SBYA 3K5PA 1JQBA 1ZO8A 2V6FA 4UUNA 1NPTO 5B37A 3P19A 1M6HA 2TMGA 3LQFA 3BHMA 1LDBA 4C7KA 3U5TA 2YV3A 3KSZO 3U09A 1OAAA 1DHTA 1LRJA 1W8DA 1LSUA 3EZLA 4BO6A 4DLBA 4PLPA 4U5QA 4BNZA 3D3WA 4ND4A 4I9HA 3D3WB 1S6YA 4RCVA 3OF2A 4B4WA 2JFFA 1PZFA 2D5CA 1IPEA 3AUUA 2HQ1A 3OEWA 3BHJA 4HFMA 1PS9A 1VE9A 3JQ7B 5CPFA 3S55A 2VYVD 2BD0A 2YQ5A 1PQPA 3PQFA 3GK3A 4G5HA 4GX2A 5JSFA 3OHSX 4B7XA 1MX3A 3PFWO 3V5NA 1GCUA 4B8WA 2JCXA 1R0KA 3CMCO 3ITDA 3T4EA 2ZB3A 3D64A 1I33A 4L76A 4YR9A 2ZKLA 1T1SA 4CMBA 3OJFA 1AHIA 2OXIA 1R37A 1T24A 1Y8RB 3W4KA 3PYLA 4Q39A 4JP3A 3R6DA 2GASA 2VUTA 3LT2A 5JLAA 1UH5A 4NDNE 2EKPA 1UXGA 3IDSA 4A2CA 2H63A 3OBBA 4YB8A 2Q1TA 2NNLD 3O4RA 3RQSA 4E21A 1V6AA 3UVEA 1LLCA 1I0ZA 1PJBA 4AJJA 3QRWA 1IOLA 3I83A 2YQ4A 4RDIA 4JBHA 1VL8A 5COAA 3RU7A 1VKOA 1NQAO 2WD7A 3GVCA 1JAYA 3DB2A 3W8EA 2PD3A 2X0JA 3DBRA 4IZIA 5JAMA 4PFJA 2ZTVA 3F1LA 3AI2A 3IJRA 3GVPA 1PJ2A 2J5QA 4CL3A 2W90A 4CM6A 5EERA 4N5NA 3ICCA 3HN2A 1ZK0A 3LF2A 2BHLA 4YT5A 4BO8A 5I9MA 3AI1A 3C8MA 3K31A 5H82A 4GH5A 1H5QA 1YONA 2ZQYA 3GQVA 1DIRA 4DLAA 1W73A 5IZ4A 4IDAA 4WEOA 5KOIA 1C14A 3R0IA 4KOAA 3JQ8B 4NBUA 3JQ8A 3NDIA 2H1SA 1B3BA 5TF4A 3RBVA 4IY1A 3JQGA 1O8CA 4HXYA 1F8GA 1LQTA 2EKLA 2JD1A 1I2ZA 5TX7A 4YJGB 4UVEA 2OP1A 5TJHA 1GV0A 2D8AA 4J4BA 2B5VA 1KEPA 4U6SA 2EP5A 1H6BA 1HE2A 3BTUA 1ARZA 3PYMA 4DQUA 3H9GA 3Q9NA 3PJGA 3QE3A 4LK3A 4DMLA 4CM4B 1LU9A 4QO7A 4OSPA 3GFBA 1V8BA 2RCYA 2UUOA 1JVSA 4N7RA 4A7PA 1P0CA 1BXGA 4DUPA 3GHYA 3WJAA 1Z7BA 4AJPA 4UEOA 2C07A 2O3RA 4QXMA 3PIDA 3FI9A 4F6LA 1WMAA 4I5GA 4J43A 3BMOB 4O63O 4RF4A 3A06A 3DAFA 3GGOA 1RM0A 3P2YA 4MINA 4KWHA 3WGGA 3GMDA 1N9GB 1NAHA 2C5EA 5THKA 4YAGA 5ADHA 3S2GA 2HKIA 2PD4A 4RVUA 4XRGA 3EVTA 3HFSA 3E48A 4RL6A 3JD1A 3Q9UA 3C7AA 3M2TA 1UZMA 2NU7A 3DHNA 3OECA 1A7AA 4L75A 3UCXA 3W8DA 3KBOA 3VZSA 5BSFA 1DXYA 1T26A 4J1QA 2ZJ0A 4IXWA 1LNQA 1YXMA 5F1PA 4WCFA 5C37A 4ALLA 4II3A 1CRWG 1HETA 2BELA 4OKIA 3I6IA 4EBFA 1AE1A 1JTVA 3RUFA 2O7QA 5ILGA 5IG2A 4GSKA 4WASA 5B1YA 3RIHA 3E9NA 3ULKA 3B1KA 1T2EA 5CDTA 3I1JA 1L7DA 1ZZEA 1X0VA 1U2GA 2TMDA 2Y1DA 4EEZA 5DNAA 1MFPA 2PNFA 5TS3A 1KERA 4A03A 1YQGA 2FY8A 1TT5A 3DBVO 4OHUA 5JCJD 4I5DA 1J4AA 5JDIA 4LCEA 1DHRA 5DN9A 4XYLA 1I24A 3HWRA 1X15A 4UVGA 2VWGA 3PYXA 1P74A 4HBGA 5JO9A 2WSBA 3CUKA 1IYZA 2PZJA 1Y8RA 2OFPA 1IULA 2EKQA 2ZK7A 4JLWA 3GDFA 3QVSA 4XZ3A 1UXHA 3TWOA 2EP7A 3AOEC 3JSAA 4NBVA 1NP3A 4JNKA 1GYPA 1BXZA 2PGDA 4R01A 4E33A 3K73O 3DOCA 4Z6KA 4CLRA 1X7GA 4J4HA 3PQDA 2J3IA 4D3DA 2HDHA 2D2IA 1JA9A 5IN5A 4BVAA 1SMKA 5CEJA 3M1AA 4NU6A 3BYZA 1KY5A 1LQUA 3CINA 3L07A 2C2XA 3FTNA 1VJ1A 4W99A 4GPD1 4HFRA 4CMIB 3U4CA 1PS0A 2E82A 5CAEA 2CDAA 1VSUA 4OH1A 5BNTA 2Z1MA 3IL2A 3MJEA 4XGNA 4YTEA 4UUPA 5JW6A 1XELA 1MG0A 2A4KA 4MOWA 5I7FA 3FSRA 3WLFA 2G82A 1BVUA 2JL1A 4U8GA 5JYEA 2IZ0A 3DHEA 5JMPA 5A06A 2O23A 1N1GA 4MIEA 4TKMA 2DFVA 2I5PO 4KUHA 4NZ9A 4YQZA 5AXAA 2NU8A 1NVTA 1J6UA 3OFSA 3NGXA 3ZWXA 2W2KA 3ANMA 4FFPA 4L9RA 4LISA 3C7CB 2D4AA 4CM1A 3D4OA 4J4TA 5ENDA 1B26A 4ITUA 3U3XA 4PLCA 3ZHBA 3DZGA 5EQFA 2PR2A 3IUPA 3DWFA 3K8ZA 4WEQA 4ND2A 4RLSA 4YJFA 3JV7A 3H4VA 5U9CA 1SO8A 4WLEA 2FSSA 3AOGA 3HG7A 1I10A 1YDEA 5L45A 2CVZA 2VZ8A 4QFDA 3V1UA 3RWBA 1YBAA 1FDUA 4EJ6A 1EK5A 1ADGA 1QLHA 4L4XA 3ZWPA 4IQ8A 4FGSA 1NBOA 2VZ9A 3ITKA 4AJ1A 3ZHXA 3U4DA 4PN3A 2PA3A 2PV7A 3RUDA 1NASA 2VN8A 2QZ9A 4EJ0A 3GHHA 1GZ6A 1WP4A 2DM6A 1C0KA 2HRBA 3D4NA 4NIMA 3N74A 4BV9A 1WMBA 2YZ7A 1JDJA 3WGIA 3UHAA 1PJLA 4CM5A 1C0PA 2PH3A 5F1KA 4YPOA 1ZEMA 2AEFA 3B1JA 1E77A 2JAHA 2DBQA 1B14A 4B7CA 1SB8A 2WYUA 3CEAA 3H3JA 1DEHA 4CM8B 3T4XA 1UDCA 1LI4A 1A7KA 4WLOA 5C5IA 5A9TA 3WFJA 4XQCA 1ZKMA 1GTMA 3ZHYA 5DBIA 1WDMA 1NPDA 1BW9B 4CM4A 3LT1A 5JAZA 4MVJM 3TNLA 2Q49A 3LT4A 4GLLA 4BKRA 3HDYA 3WIEA 2W2KB 5DBFA 4AICA 3WIDA 4B3HA 1KEVA 2F1KA 3A1NA 2PLAA 4BKUA 4BNNA 2VUUA 3L0DA 3EC7A 3WTCA 3D0OA 1NVMB 1PGJA 4PLVA 1P1JA 3LLVA 2CF6A 4BNYA 3VVCA 1LSJA 2NADA 4OXYA 1YL6A 1R6DA 2HLPA 4AJHA 4K26A 5KCZA 2YHUA 4WCFC 3MJ4A 1VI2A 1WXDA 3HB4X 1E1LA 3UGKA 5KJ6A 2GN4A 4RF2A 4IPTA 1XLTA 4BNJA 5ICSA 4EUEA 2FZWA 4M1QA 4MKRA 3DMTC 1FDVA 4YACA 4BNHA 2B35A 4Z9FA 5ENVA 4AJEA 3KB6A 1Y9EA 4GVXA 3PTZA 3QWFA 2G17A 4JQCA 5ICMA 1U1IA 4KZPA 3ZGYA 3WBFA 3LC1O 5EPOA 2VWQA 3KVOA 1PL6A 1X7HA 4DREA 1ULSA 2OZPA 1UAGA 4OYRA 1UXIA 2EGGA 1AXEA 3OICA 3BAZA 2CF5A 3S8MA 5FFFA 4CMJA 1P1KA 1QMGA 3JYQA 1ISJA 4M55A 1U5AA 4R1SA 1QYCA 3ORFA 1XR3A 4CMAA 4YAEA 1XA0A 3SC4A 3GUYA 4FFRA 4HNGA 3GGPA 4PLWA 1GUYA 2QZZA 4FR5A 5G0TA 1DC5A 4F46A 4A26A 1NFQA 3K30A 4Z9YA 4NFYA 5CDGA 3QA9A 4O5OA 1E7SA 2E49A 5THQA 3AWDA 1QXSA 2Y1GA 3WNQA 2Y67A 1ZBQA 1P1RA 3ZDFA 3DBLA 4QO8A 5DCWA 5CPBA 4JGBA 5AVOA 4R9SA 5JO0A 1DC3A 4BHTA 1Q7BA 4CM8A 1KVUA 2BGMA 3RUHA 2P68A 4OGWA 4JN6B 1YOVA 1XDWA 3I6QA 4R9RA 4DLLA 5IJZA 4R3WA 1SNYA 2NQ8A 2AMFA 4RV9A 1IL0A 1B2LA 1CYDA 1QYVA 3ZWCA 2O2SA 1HDRA 3ANLA 5MGBA 4JJFA 3SX2A 4DBVO 2AW5A 3MTJA 2QW8A 2I6TA 2EJVA 3V2GA 1AUPA 4FJ0A 3GGGA 2F00A 1A4IA 1I01A 3DBLB 3PDJA 1JN0A 5K9ZA 1O9BA 2GDZA 1N9GA 3A28A 4CM7A 4TWRA 3KRTA 5HTOA 4O6VA 1VSVA 4LMPA 1K5HA 5L95A 1LDMA 2GPTA 1D8AA 1XGKA 2DPHA 4TKLA 2UV8A 4MDHA 4NBRA 2VRBA 4XKJA 5HS6A 3F4BA 4J0FA 3CXRA 1ML3A 3E1KA 2X9VA 2BFAA 3OQBA 4BMSA 4ZD6A 4IMPA 1CDOA 2JAPA 1UDBA 4S3MA 3V1TC 3L9XA 3MJVA 2IZ1A 2DQ4A 2WWRA 4BMVA 3OETA 3OQ1A 4TRMA 5U1PA 4BO2A 1QP8A 2ET6A 3G49A 1GEGA 1H9AA 2I3AA 3L6OO 4O59O 1U7HA 2NVUA 4CQLA 2PH5A 2WE8A 4R1TA 3RC2A 5JXWA 1MC4A 3PHGA 5JE8A 2JHFA 2DBRA 1Z74A 1TLTA 4OSOA 2C5AA 4WLVA 4DA9A 2AEMA 3AI3A 3FWNA 3WQSB 4BUCA 1HL3A 3KYCB 4GX0A 2WJPA 3ZHZA 1E92A 4D44A 1QR6A 1BSVA 1UUFA 3WMXA 2XXJA 1VPDA 2DBVO 3CMMA 1O6ZA 4FCCA 1LDNA 3GZNA 4IZHA 1DFGA 1GUFA 1YKFA 2VZ0A 1K6XA 3K9QO 3WSWA 4Y9DA 2OBNA 3ON5A 2CZCA 1DSSG 3PJFA 4RVGA 3PGJA 1ONPA 2JCYA 2H9IA 6LDHA 3GRKA 2HMUA 1M75A 2IDZA 2JFGA 2BRUA 4GMGA 2W2LD 4ZQHA 3PI7A 4BNKA 3ETDA 3ZNPA 5IZCA 1FMCA 3WFIA 1FDWA 1ZCJA 3WR5A 4ND3A 3IP1A 4K28A 2ZTUA 3UXYA 1IE3A 1ULUA 4FJ1A 3KYBA 1N8KA 5DCYA 1ZNQO 2E48A 3RROA 3SVTA 1UZNA 3NAQA 3FR8A 4FDAA 4C7JA 3ETGA 3NX4A 3JD2A 1E5LA 3AY3A 3ONFA 4NK5A 4XRRA 3KV3O 1IZ0A 1VM6A 4L4SA 4CR7A 1H2BA 3E82A 3PK0A 4DQXA 1UXKA 3P5SA 2OP0A 1PJ3A 1U3UA 4PIVA 1MV8A 2PKQO 1YBVA 2X5KO 4CUJA 1N7HA 3RUIA 3CTMA 4ZQBA 3SXPA 1DJQA 2PFGA 4XQEA 2WE7A 5IFLA 4KQWA 3RC9A 4JBIA 1T2CA 4QUKA 1P44A 3DMTA 5TGDA 1MLDA 1PJSA 3QWBA 4UEKA 4QTZA 1A4UA 1M76A 2ZCVA 4GMFA 4CM9D 4XA8A 4AJOA 2PK3A 3DTTA 1WVGA 4PGFA 1SPXA 4QQRA 4LSMA 2XOXA 1KETA 1EE2A 1RYEA 4OO3A 3KETA 1F14A 1SB9A 4N18A 2R00C 5ER9A 3E8XA 3MJCA 3NJ4A 4E30A 1J0XO 4L0QA 1YB1A 3B20A 4JIGA 5T57A 2A94A 4DC1A 4HV4A 2D5AA 3G0OA 2GZ3A 3GG9A 4NU5A 3TL2A 3VDRA 4XEHA 2C59A 3CZMA 2GN9A 3TRIA 2WMDA 3RD5A 2J3HA 4BNMA 1LRLA 3PXXA 3AM4A 1F12A 4GL4A 1QRRA 2J3KA 1NFFA 1GADO 5JDIC 2AXQA 2VWHA 2FN7A 5T8KA 2Q46A 4YAJA 2IYPA 3L9WA 3VZQA 2JJYA 3I3OA 1WDKA 1PZEA 2HUNA 5L40A 2YFHA 3GG2A 1DPGA 1UP7A 1FDSA 4GKBA 4P4NA 3I4FA 2FPGA 2LDXA 3DONA 4XB1A 4CV0A 5J23A 3GPIA 3I9LA 1XSEA 4IJKA 4DQVA 2Y66A 2CMDA 3D5QA 1LRKA 3WB9A 3OJEA 2YY7A 4CM3A 2C20A 2VWPA 4G65A 1JAXA 3F9IA 1TT5B 1YS4A 2IEDA 4ZICA 2W8ZA 2B36A 1HDZA 1EVJA 1LDGA 1VKNA 1IY8A 1DIBA 3WOHA 1W6UA 2EW8A 2I67A 1J49A 4YT8A 1B15A 4RGBA 1Z7EA 4LN1A 3RUAA 4BGVA 2X22A 5IZCC 3PEFA 3OIFA 4Q3BA 2Y1FA 2VHYA 3UUWA 4BB6A 1RYDA 4J9UE 4DRYA 1DRVA 2DPGA 4IM7A 3E5RA 3IS3A 4PG5A 4FD3A 4ND1A 4W82A 3ZWYA 4CR6A 1HLPA 3JD4A 3WMWA 4BO4A 1DRWA 4PG4A 3GC6A 1IUKA 1GYQA 2HU2A 1LUAA 4TZKA 4XWYA 1KVTA 3ZW9A 1HXHA 5CG1A 5F3RA 1M67A 3BMCB 5BNIA 4N54A 4P4GA 5A02A 2GZ2A 3L4BA 2QX7A 2O3JA 5L4SA 2ZTLA 1WPQA 1B16A 3FNFA 1AGNA 1T2DA 3JYNA 3RFVA 2YV2A 1Z73A 1EQUA 1LJ8A 3L4SO 4YJFB 3U9LA 3Q2IA 2NACA 3TFQA 5A1TA 2Y99A 1GDHA 4RF3A 1JU9A 1HSZA 1E0DA 1E3WB 4FC7A 2NM0A 4A73A 1DC6A 1EFKA 3BMQB 4J2OA 1U3WA 5KIAA 2O50A 2ZB7A 1C1DA 1LX6A 1UR5A 3PHJA 3HQ4O 2DAPA 2A92A 5KJFA 2YUTA 3DXFA 4HADA 2VOJA 3B6ZA 4XIYA 1MXFA 3OMLA 1P45A 3K96A 4DWVA 1DFIA 3ANNA 3PZBA 3UKOA 1GQQA 4BQRA 4W9NC 1YVEI 3KHUA 1ZMOA 3JQGB 4FPXA 3PLRA 3C1TA 2OGUA 5IXYA 4FOOA 2R00A 3GVIA 1F17A 3AK4A 3ZZNA 4I9NA 1UP6A 1NPYA 2PD6A 4MP8A 4DYVA 1BDBA 1EK6A 3H7AA 3S1LA 1R12A 3RC7A 3INRA 4WJZA 4DGSA 4GWKA 5DF1A 4R51A 1W0CA 3E6AA 3Q2KA 4TRRA 3IUSA 3Q1LA 5BR7A 3AY6A 4D0SA 1WZEA 4Q3NA 4XYMA 2VNAA 1BXKA 5C3MA 4ZHSA 4TMFA 1RKXA 1E1NA 5TNXA 3VKUA 4GX1A 1B3RA 3B1FA 4GVLA 3RKUA 2OMEA 1UJMA 4CLDA 4O0LA 3KSUA 3DZBA 1ZUD1 3JQ7A 4FSHA 1R66A 5G4KB 2Z95A 1MB4A 3ROKA 2XF8A 1MXHA 3QVWA 1KC1A 3DDNA 3IQDB 4BO0A 3DR3A 1ISIA 4J1TA 4MVJA 3GEDA 1R4NB 1XCBA 2EEZA 5ITWA 2J6IA 3UOGA 2AHRA 1KYQA 3OJOA 5BSGA 2WTBA 3ROMA 3JQAD 4DL9A 5L53A 1OOEA 3C3XA 4MVJD 3GFGA 2D59A 2GNAA 1X0XA 4QEDA 3PHHA 1QKIA 4XR9A 3QVTA 3CE6A 1G0OA 5DP2A 2JKVA 3JQ6A 2AEJA 4H3VA 4D79A 5JAQA 4D3SA 1HDYA 2RHRA 3G79A 1IHXA 4RPKA 3U4HA 1QG6A 5H83A 1IZ9A 1BHSA 1ADCA 3GMSA 3RFXA 4AJLA 3FWZA 3NDRA 2JFHA 3ZV5A 3EW7A 3FD8A 2VOEA 1E6WA 4QX6A 3H9QA 4WE3A 4AJNA 1VC2A 1P1HA 2AA3A 3RSHA 1I2CA 1CEQA 4XIJA 4WPGA 4L4RA 2J3JA 1LEHA 3D7LA 2IRWA 1PWXA 3G3EA 3BHIA 2FHSA 5TSDA 3OJLA 1EUDA 4JJIA 4LVUA 5COBA 3X2FA 4ZN6A 1HKUA 3UCFA 4XD2A 3WGZA 1SEPA 4UVIA 1K89A 3GVHA 1ADFA 4J0EA 3JQDA 4R41A 1ZMTA 4TZTA 1GPDG 3ZNQA 4X54A 4WNCA 3COSA 4CLXA 4DYDA 2FR0A 2ZB8A 1HDCA 2H5LA 5JCXA 5T64A 1PGPA 4B7UA 3GH3A 2RAFA 3T7EA 4KTTE 3W4JA 1GR0A 1TEHA 4E3ZA 3I9JA 4ALJA 2WD7B 4CMGA 2ZATA 1E3SA 4BO1A 5TC4A 3TSCA 3O26A 5ES3A 3WQRA 1I32A 3F4LA 4D46A 3KYDA 4F3YA 3AM5A 3S2EA 3G1UA 4PLHA 1YJ8A 1CETA 1E7WA 4R3NA 1B7GO 1PWZA 4E5YA 1CQJA 1HDXA 4FFOA 4WK6A 5FI5A 1EVIA 3NTOA 3OA2A 2O4CA 3W6UA 3JD3A 4E5KA 1PQUA 3HHPA 4OOFA 1E3IA 3ZU4A 4YBZA 4I1IA 1QLJA 3DZKA 4KUEA 4UVDA 1NQOA 1C1XB 4IS3A 4J3FA 4TQGA 5GMOA 3DHYA 1Y8QB 4XCVA 4UEJA 3UICA 1SAYA 3SJ7A 3F5QA 1A9YA 3PZRA 4R68A 2B69A 1I3LA 1OFGA 4M89A 1ZK1A 4GWGA 4J1NA 4I08A 4XJSA 3FNEA 2B4TO 5KKCA 1C1DB 2HMWA 7MDHA 3KM0A 2Q4BA 4QFCA 4INAA 1ORRA 3JQ9C 4Z0TA 3RUEA 3ZWWA 5TT0A 2FOIA 4OKNA 5KJ1A 1HRDA 4H7PA 2HSDA 1PEDA 2JHGA 3BXXA 3BA1A 4DBZA 4KUGA 3PRJA 4NQZA 1ONNA 2V6BA 3E9MA 2Y0DA 1N92A 4GSLA 5JCJA 2HMTA 3JQBA 2UDPA 4U0JA 2BI8A 3GAFA 1HWYA 4BKPA 4EGFA 4E2YA 3RFTA 3VKVA 1QV7A 1RM4A 1U8FO 1ZVMA 1EDOA 1MFZA 2D1YA 4R16A 1R4NA 2EV9A 3UFXA 3WSVA 2VRCD 3H9JA 2WYVA 5MDHA 1T2FA 5L4NA 4HWKA 4WLUA 1NHGA 2O2YA 3ZWMA 1PJQA 4OOEA 3PGXA 4GLOA 5L7YA 1DIHA 2ZQZA 1U9JA 2EERA 2O3UA 1X14A 2DTDA 3IOYA 3Q6IA 4EITA 1U2DA 2UYYA 1E7YA 5L7WA 2I99A 2EGHA 3QY9A 4BMNA 3DZFA 5T5QA 4CLOB 3FCOA 3PQEA 2HAEA 2LDBA 3O38A 4FQ8A 3WQQA 5T8KC 1ISFA 2P5YA 2X5OA 3VPFA 2O3QA 2WDZA 3HN7A 3M1LA 1P1IA 2X0NA 1XQ6A 2Y1OA 1VL6A 3K2EA 3WXBA 1BGVA 1Y5MA 2Y0EA 3D1LA 5DP1A 5DZSA 1H2HA 1O5IA 1DIAA 1HSOA 1SZJG 1HEUA 3DAPA 4RPLA 4IQGA 1QSGA 2WEKA 4UUMA 3GDOA 3WWYA 3EAGA 1K3TA 2QHXA 4BS9A 3V2UA 3KEQA 4RQTA 4YAKA 2IXAA 1E7MA 3CH6A 2Y1EA 3SEFA 1DB3A 5LDHA 1ADBA 3GN2A 2VTDA 1WWKA 3V1YA 4UULA 2NU9A 4JP2A 4ZU3A 4CV1A 2YDYA 3U4IA 1IB6A 4P4LA 4NG5A 1A71A 2FSVA 2OL4A 5HS4A 1T25A 4XB2A 5IF3A 1OZAA 3ENNA 3ZWAA 3NV9A 3IMFA 4OQYA 3DBRB 1OC2A 3KO8A 1PTJA 1X1EA 3RBXA 1ENPA 3A14A 3W1VA 4AJ4A 2E4AA 3VC7A 2QRKA 1YWGO 1Y81A 2AG8A 4J2HA 4K6FA 1NHWA 4PLZA 5CDYA 5HM8A 3MZ0A 2FPPA 3GPDG 2AQ8A 5AOVA 4BOYA 5TRTA 1NM5A 1GZ3A 1SC6A 1WDLA 3PIIA 2BLLA 3Q0EA 2X58A 2P9CA 1PGOA 4LW8A 2UVDA 1M66A 2YW9A 3PDUA 5DOZA 4IGEA 4KWIA 3GEMA 4KDEA 1ENOA 4OXKA 3SJUA 3UW3A 3VOSA 3VPXA 5ITVA 1LBEA 2B5WA 3ZN2A 3DMYA 3TOXA 4YYZA 2FWMX 2Q3EA 3L6EA 2IZZA 2V65A 4AL4A 4NBTA 3VZPA 3C24A 3JQ9A 4GQAA 4XGKA 3JCZA 3LLSA 3QVXA 3RVDA 3PWKA 4B4OA 1UP4A 3TDKA 4HKTA 5KVSA 2DLDA 4EDFA 3H3FA 1DAOA 1EEHA 2NLOA 3JQEA 2B37A 2Z1NA 2J8ZA 3F6YA 4OXNA 4IJVA 1HYHA 1W4ZA 4AJKA 1D1SA 1BXGB 3L77A 1D3AA 2HJSA 2QG4A 4CODB 3EGOA 2PY6A 3JQAB 1O89A 1Y8QA 3ZV3A 3L4BC 3ZWNA 4XJTA 3EMKA 5G4KA 3LDHA 3NT5A 4RF5A 3TOZA 4B8ZA 2P91A 5I8WA 4P22A 4IDGA 4ALNA 4AG3A 1E6UA 3GLQA 4TROA 4NHEA 1YQDA 3DTYA 4J9VA 4WGGA 5AQ1A 4G81A 3UCEA 4IIUA 1E7QA 3IJPA 1P31A 1SOWA 4IDBA 1RM5A 5G0SA 3VDQA 1R4MA 4BO7A 3SLGA 4U0KA 1R0SA 3LT0A 1GFSA 3W4IA 2GR9A 3M2PA 3DQPA 4E5PA 2X9GA 1E1MA 1VLLA 3FNHA 4NR0A 4ALKA 3G17A 4R4JA 1NR1A 3D4PA 4LVCA 4GBJA 4NMHA 5CDSA 3FNGA 5KWEA 3NEPX 2ZYAA 1F0YA 4M54A 4PLFA 3ETEA 2P9GA 5GZ3A 1Z82A 3OIGA 2H6EA 3E5MA 4RDHA 4IJWA 3EDMA 1K2WA 5C7LO 1PL8A 3NDJA 3VAZA 2HMSA 5I8ZA 3BZUA 2VRCA 2BI7A 1G0NA 3DZIA 2I65A 3GF4A 4AFNA 3ST7A 4YT2A 2C82A 3LK7A 5BT9A 4Z0PA 3PHLA 1FXSA 2RHCA 1LDYA 2GN8A 4FFLA 1AHHA 4BL5A 5DCUA 1U8XX 3MJSA 4BGUA 1BRMA 1L7EA 3KLPX 5EIOA 4CLRB 1JVBA 4MVJE 1U4SA 3R3JA 4MJLA 1H6AA 1HE3A 4F6CA 2IEBA 2QYSA 4M8SA 1I36A 1HYGA 4CLHA 3K6JA 1T2AA 2BFPA 1WNTA 2A9FA 1PZGA 2I3GA 3FBTA 3WJ7A 4OIMA 3TN7A 2D3TA 3EUWA 1Z6ZA 3EVNA 3FPCA 1GL3A 2PGLA 3GNTA 5T6BA 3KZVA 1LLDA 1ISHA 4HNHA 3RKRA 4GGOA 4QSMA 4L73A 1LDEA 4H16A 3LF1A 5IXSA 5B4UA 5KKAA 1I2BA 1KVRA 3GEGA 1ISGA 4Y6SA 1HTBA 1DLJA 4CLOA 3H5RA 1XEAA 3LU1A 1Y1PA 1TB4A 4PRKA 3BMOA 1BVRA 3OSUA 1RWBA 2DC1A 5F5NA 5ILOA 3ZV6A 3DZHA 2NSDA 2O7SA 4PZDA 2NVUB 4I5FA 5JAIA 1V3TA 3X2EA 5JY6A 3O8QA 3NUGA 5DOVA 1R16A 4IIVA 4IQ0A 2SCUA 5FYDA 4XR4A 2DFDA 4P8RA 2V6MA 4CUZA 3KUXA 4XDZA 3JTMA 4FS3A 2AE2A 2WD8A 2NV6A 5HA5A 1PS8A 3ZU5A 2X4GA 1GQYA 3PHIA 5ER6A 1EMDA 1GD1O 3I4CA 3HZZA 1VJTA 4IGFA 4YXFA 1VRWA 2NTJA 3AM3A 3HNPA 3TF5A 1E5QA 5L51A 5EN4A 3GVXA 5IN4A 4CPDA 1VJ0A 5BSHA 2B0JA 3ONDA 3BTSA 4RZIA 5EINA 3TFOA 1TI7A 4WECA 1KS9A 2ZYGA 3GN1A 4W9NA 4KP7A 2DT5A 3BTVA 4KMSA 1K0UA 2C7GA 2X6TA 1ZSNA 3JQFC 4A10A 3QJ5A 5L9AA 2OO5A 3DC2A 1H6DA 2OBYA 4XDYA 4R54A 4BV8A 2X86A 1R4MB 1Q1NA 3QWHA 1YL5A 4UVHA 3AUSA 3R1IA 2GN6A 1H9BA 2VT3A 4URFA 1H93A 2G76A 1BTOA 4CMKA 4BNIA 2EXXA 1S7CA 2V7PA 5TT1A 2B83A 1NYTA 4M49A 1B8PA 2NUAA 5DDIP 4JBGA 4RJTA 3ZWBA 1GCOA 5KVQA 3MTGA 4CQMD 4NJMB 1EVYA 1N5DA 1U28A 3H9UA 4W7IA 4BIIA 5L7TA 2HK7A 2Q2WA 4Q3EA 3F5SA 1PGNA 2IODA 3OIDA 4BNTA 5A3VA 3ADPA 3TL3A 4FFMA 2W2LA 2RBEA 1TVEA 3FRJA 1U7TA 6ADHA 1HT0A 2DTXA 4NH4A 3SBOA 3JYLA 4M87A 4YWJA 5EJ2A 2PZLA 1HYEA 4IINA 4J7XA 4YCAA 2C54A 3HE3A 1JWBB 2Q2VA 4OMUA 4YQYA 3WNVA 1R15A 2DUUA 2X1HA 3GDGA 1C1XA 5HRUA 1E3LA 1MP0A 3ZNOA 5FWNA 4XYEA 4MIOA 3ZW8A 1OC4A 3KOUA 3TJRA 1Q7GA 4MIYA 4BQPA 4BO9A 1DBVO 2D0IA 1U5CA 4ID9A 4A27A 1O94A 4G2NA 5I7VA 1CERA 1P0FA 4PLYA 3HADA 3ENKA 2R2GA 1PSDA 3R3SA 2VQ3A 3JYPA 5AXDA 1ZFNA 2B4RO 2Y68A 5A5FA 4RVFA 4TVBA 5A5EA 5B12A 3ZH2A 2P2SA 5G0WA 5CDUA 1ZSVA 4ND5A 4A0SA 3EY4A 2YJZA 3P2OA 1KBZA 4P38A 1DC4A 4PCVA 3C1AA 4PZEA 5HWSA 1NX6A 2E6UX 3ROQA 2BFOA 3GRPA 2VCYA 5FI3A 5KVVA 1Q0LA 2FR8A 1EBUA 3P7MA 2O48X 1B0AA 4RORA 3BMQA 5H81A 3PWSA 3C85A 4H15A 5L4LA 1OBFO 2C2YA 4Q3CA 4R1UA 2NVBA 4BNLA 2YHIB 2Z5LA 5IDWA 2YHIA 3E18A 2ZCUA 1UAYA 3AU8A 3QV1A 4PG6A 4UREA 3VPGA 2Q2QA 4J7UA 4XGIA 2Q1UA 3KLMX 5C7OO 1LXCA 3NGLA 3DO5A 1ZSYA 2ILTA 3I9OA 3MJTA 4MKZA 3BIOA 4J91A 1XHLA 3JYOA 4FB5A 4RPJA 4ILKA 1CWUA 3DEYX 5A3JA 2EW2A 2PTGA 1HLDA 3WYBA 2GLXA 2IYOA 1D4FA 2EHDA 4DPMA 1EDZA 1ZJZA 1P77A 2P9EA 4K1LA 5AXBA 2DBZA 1FF9A 1Y5RA 3RC1A 2Y05A 2Y0CA 1V9LA 5BSEA 4RQUA 1HZJA 3VH1A 3W6ZA 2EWMA 3CKYA 2GZ1A 1YOVB 4E31A 3DAGA 3LYLA 2AG5A 1JW9B 4E32A 1YB4A 4UAGA 4EUFA 1KVSA 5GZ1A 1ZXBA 3VTFA 1C3VA 4F45A 5FF9A 4OAQA 2ZB4A 3EZYA 1GV1A 4MVJH 1JKFA 1V3UA 1FDTA 2DU8A 4BB5A 1EBFA 2GF2A 3A9WA 4FN4A 4D45A 5L3ZA 3TZ6A 3C7DB 1ZIDA 4CMHA 3F46A 3STHA 1EFLA 5KNLA 4JX8A 2G5CA 4RPGA 3H8VA 1PQWA 3K92A 3LC2O 4YRDA 1RPNA 4BO3A 5FEUA 2CDBA 4DIBA 2VHWA 2BF7A 3G1TA 4HP8A 4IS2A 9LDBA 1EE9A 4E0BA 4R5HA 3O8QB 3S2FA 3ONEA 3RUCA 1YQXA 1RJWA 1QORA 3DOOA 3RJ9A 4ESOA 2PZMA 2OUIA 1KIFA 4J1SA 2UAGA 2QRJA 4B4UA 1AN9A 5A05A 2VHZA 2Y93A 1G1AA 4DPKA 3MWEB 3A4VA 2A35A 3T7CA 1KEWA 4GX5A 3I9MA 4W4TA 3ZU3A 4FIZA 4WCFB 1EUZA 2GYYA 3NTRA 5EESA 1SCUA 5I9LA 3GT0A 3IC5A 4IDDA 5I7SA 4IJUA 1A27A 2P4QA 4E12A 4EYEA 4DIFA 8LDHA 1DOHA 3B70A 4I5EA 1I3KA 3GNSA 3MWDB 2G0TA 2VYND 3TZQA 4CMIA 1ISMA 3DFUA 3DOJA 1HDOA 2I76A 1OMOA 1PJ4A 1PGQA 3WDSA 1YE3A 4CMEC 2V6GA 2RH8A 1X7DA 1DFHA 2ZYDA 4I9UA 1ZJYA 2CNBA 5JY1A 1SOVA 1E7RA 3RASA 4JROA 4ZQGA 4Q3DA 2ZTMA 1DDOA 4JXKA 2C0CA 5A4DA 3HDQA 3ASVA 1XQ1A 1Y7TA 2Y1CA 1JLLA 1JWAB 1MC5A 1ZK2A 1GYRA 1NFRA 3HJAA 3HFGA 5G2OA 4MVJP 1E3EA 4PLGA 3CZRA 3E03A 2XAAA 4Y6PA 1U3VA 3C1OA 1EUCA 4KDFA 4WLNA 5B4VA 1KOLA 3ZI0A 1ONOA 5A9RA 5B4TA 2BGKA 4YT4A 3PJEA 2Q50A 2QRLA 1ENZA 3EYWA 5EQDA 5F1OA 3LZ6A 1TA4A 1GAEO 4QECA 1ZK4A 2FP4A 2WYWA 2NU6A 4Z9XA 4BKQA 4BO5A 3FN4A 1BW9A 4E2ZA 4N5MA 3VPHA 4W7HA 1P33A 4BNVA 1GUZA 1ID1A 4NFHA 1EQ2A 4XYBA 2FMUA 2QQ5A 4ZVVA 1NXQA 4LGVA 3VVBA 4CQMA 4D3FA 1I30A 2B4QA 1PX0A 4FOSA 2HK8A 3GY0A 4NFSA 4Q3AA 3AW9A 3UN1A 1TXGA 2X0IA 1MGOA 4IXTA 1I3NA 4IBOA 1KVQA 1NVGA 5CG2A 2X7HA 3F3SA 4EJMA 4TSKA 1XU7A 1PR9A 3BTOA 4MKXA 5CHEA 3INGA 2PKRA 2GO1A 2P4HX 3AOEA 3QHAA 3QWAA 5IDQA 4AJ2A 4CUKA 5JFOA 4ZRNA 2GSDA 2OORA 3QLJA 1YGYA 2XPCA 2O3TA 3ROPA 1PR3A 5GY7A 5K6AC 2RIRA 4D7AA 5CFZA 3KYCA 1FJHA 2AQHA 3ZWOA 1OI7A 4J6FA 1O0SA 2POQX 1QV6A 3WICA 4FBGA 1ZW1A 1KY4A 4XYGA 1CQIA 1PZHA 1Q0HA 2WM3A 4K6CA 3OH8A 3WGQA 4IDFA 1V0JA 2IE0A 2VYVA 3FHLA 3NT2A 3OEYA 5EL0A 4Z3DA 4NK4A 3M6IA 5IDXA 4EZBA 3VH4A 4E5MA 1PIWA 1O95A 3H2ZA 2HRZA 4GGPA 5TLSA 3OM9A 4WOJA 1MUUA 4BNXA 5TQVA 3NT4A 3HB5X 5U4QA 2NQTA 4FC6A 3VH2A 1YBMA 1LA2A 3PLNA 4A5OA 3LC7O 2AQKA 2HMVA 3HDHA 5EMHA 1BWSA 4M86A 2HK9A 5DT9A 3D5TA 3F1KA 3OP4A 2Q4EA 3OQ6A 4RPHA 4L74A 3ZCXA 3LVFO 4CQMB 4DMMA 3ABIA 3AJRA 4YJHA 2GGSA 3H2SA 4MVJF 2FRDA 3ZV4A 4CLEA 4HY3A 4IUYA 1HE5A 3U49A 3QVOA 1B8UA 5G0VA 5G4LA 4S1VA 1D7OA 3ASUA 1GEEA 3H5NA 4BGEA 3PPIA 3UAGA 1JKJA 1BDMA 3QIVA 4I8XA 2P5UA 4NJMA 4R69A 2VHXA 1DAPA 1PJTA 3NKLA 3ICPA 4II2A 4HFJA 4L8VA 1NAIA 1Z45A 5KJEA 1HE4A 5A9SA 4JJGA 3WWZA 3DL2A 3KEOA 3SLKA 5GZ6A 3TZCA 1J5PA 1F06A 2ZIZA 2I9PA 3KTDA 2VNSA 1VL0A 5K0ZA 4R1NA 2BMAA 4EUHA 2E37A 4U6QA 4NI5A 2YFQA 5G0UA 1RM3A 2X0RA 1ZEJA 5F21A 2VYNA 2Q45A 1DIGA 4LRTB 3QWIA 5T67A 1B8VA 3IKTA 1YRLA 2BKAA 4MP6A 3HSKA 1KC3A 3WTBA 4DPLA 3U0BA 2ZJ1A 4OQZA 2FZEA 3UF0A 1H0KA 2BH9A 2CVQA 5IDYA 4ZRMA 3F47A 2YV1A 4MP3A 1G6KA 2X5JO 4YA6A 3LSYA 5C7IO 2R6JA 1WAMA 1UXJA 3JQBC
chains in the Genus database with same CATH superfamily
1MU0A 4B7AA 3UMGA 4TLDA 1OROA 2GRAA 1GZ4A 3D3KA 3NVDA 4A9AA 1LVGA 3NGMA 2BDTA 3CUYA 2PMFA 3IUBA 4KWCA 4OG2A 2OV4A 1EX9A 2SCUB 4G0PA 3WLPA 4CKYA 4ALIA 1Z5GA 4UAUA 4ER3A 3D3QA 3V8VA 4YRMA 1DAIA 2EARA 1UBCA 4PO3X 2GZSA 1E3MA 4JYZA 1XG5A 3CRNA 4XJXA 4PO9A 1Q2XA 1VJRA 1LC3A 2Z2YA 3NHSA 2GQ0A 2JGDB 3GZNB 4XWOA 4PR3A 3QLEA 1NI5A 3S27A 4HUJA 1V35A 3PLAE 5T7BA 4YJDA 2NO0A 3ISTA 4PRLA 2B92A 5B3LA 3KB1A 1I7DA 2NXCA 1BDIA 3FSEA 4ZK6A 2P2ZA 5JQGF 4MQUA 2PGAA 2WAAA 1KYWA 3M4ZA 5AOAA 1TVKA 4XUDA 5IX8A 1MOQA 2CMGA 1R0RE 1EFRA 3ELBA 4O4IA 2FG6C 4B4VA 1OH5A 2DULA 3LXUX 3MT9A 4GAEA 4MQEB 3R74A 3W8FA 3GJ0A 2AUMA 2NXWA 5M5BA 3DLIA 3CY6A 4ZJUA 2AE1A 2Q3CA 2WIFA 3M6UA 2P9ZA 2QTGA 3SC6A 1Q3TA 1QIEA 1XAIA 1J70A 1MAHA 3IAM1 5D7NA 2Q0XA 1I8TA 5ALWA 5FBKA 4GZ3A 3OOJA 3EPHA 4O4LA 1NY5A 4PZCA 2F90A 2V1UA 3D8NA 3W6NA 1R7RA 1U4OA 4L57A 3I2KA 4PONA 3SZOA 3T7DA 4DMKA 4FZ5A 3UMMA 4ZTZB 2FETA 2WUDA 3O1LA 4LDNA 2NTVA 4TVOA 3RS8A 5SY4A 3FOWA 3HXQA 3H5AA 1JJBA 3IMCA 1GG8A 2FF7A 2LVBA 2CLFB 3NHFA 2Q1WA 2GAAA 4UNIA 1AV7A 3DZJA 1EP3B 2QTAA 3ZDEA 1RBQA 2C03A 1LF5A 2XF2A 4M21A 1JJVA 1I4WA 3KALA 7ADHA 1MH1A 3A05A 3VR6A 1XZMA 1XWFA 3QBVA 5HK8A 4C1BA 2GFIA 5F35A 2AMVA 1II9A 2OC9A 3BJZA 3KLOA 4G0OA 4UFOA 4GI7A 4AKEA 1QYDA 5IBCA 3BHNA 5B1IA 1PUXA 3H5VA 1YFKA 3NYWA 5BQ5A 3TLEA 1QQBA 3WGTA 1XJ5A 4RH0A 1Z18A 1T9ZA 4WLFA 4ENVA 4F71A 3Q3JB 3A1TA 2WF8A 3BKXA 3N7UA 4HRXA 5KTPA 3SQLA 3P71T 3ZHOA 1F38A 4Q00A 1ELOA 5F5LA 4HSEA 4OL9A 2UVPB 3BRSA 4Z4QA 4D02A 4O4JB 4BVKA 1NJFA 3TD6A 3FY4A 3GMTA 4LHEA 2NSYA 3AR5A 5KX5F 3WGOA 3HABA 4FMDF 4JR1A 3RJ5A 1FYXA 4F4IA 2NVWA 5JSZB 3WGYA 1YJQA 2X8BA 1ZIPA 4U9HS 4AJIA 4YFVA 2CL6X 4M0UA 5BQFA 1ZHFA 13PKA 3OMWA 1SUFA 4LOLA 3PNSA 3KLBA 1NBHA 3ZWDA 1L8AA 3HMKA 3LS2A 5E6RB 3DE1X 1W2WB 3OA0A 5H1YA 3SXJA 5DN6A 2ATEA 3OLCX 1MG5A 4WZBE 1L4HA 1C9NA 3GLTA 4PLTA 3HPRA 4ETNA 4D9KA 2C7VA 2GCGA 3CUUA 3U80A 3IP3A 1OXKB 2EIHA 3HBNA 1Q15A 2JIBA 5CURA 1ESCA 4OBBA 3U81A 1RBZA 4A8JA 1J00A 4BY9E 2QZ4A 1CNFA 3MUFA 1NWHA 2X8LA 1OV4A 2X9NA 4MQLA 4LF6B 1D1TA 4L8GA 4JK3A 2EF1A 5IKPA 2V4UA 2JKYA 3BC1A 2OXFA 3TOSA 3SZGA 3CVWA 3VDMA 1U0JA 2YMMA 2A3NA 2G67A 1YK1A 4QYMA 3MTQA 2Y9PB 2I66A 1XU4A 2GBPA 1P73A 2P6MA 3SQNA 2ZT8A 4RTLA 1CF2O 1CW2B 1Z0DA 5BV0A 1XU9A 1NXTA 4D41A 1BE1A 2WWYA 2AC7A 4FFSA 1G38A 2FX5A 5E7JA 2V0GA 4MDEA 1FPQA 1UDAA 2NZJA 1XZJA 2Z6QA 1CUBA 3QFTA 4L5YA 5HKOA 1UIRA 2PWPA 2RONA 4US0R 4ZYLA 3P26A 1E1RD 4KSBA 4O4JF 2DFPA 2FW6A 4TX1A 1J0EA 4ADSG 5BR1A 1RYYA 2OFOA 1RWMA 4TTVA 4TXLA 5COQA 1WLYA 4JC0A 4HQ0A 3N5KA 2JIMA 3KJIA 4TGLA 3GZ4A 2YYYA 5K0JA 2L19A 1P1FA 2NXEA 4XLZA 2F43A 2BY4A 5EQJB 3IOEA 5F4BA 3FPLA 5CK5A 1N6LA 1NYQA 2H1RA 5LU8A 2BC9A 1ECLA 4G56A 3S2YA 3B51X 3GCWA 1E61A 2C2HA 1F4LA 2CXPA 3H5WA 1L4GA 5CNMA 3HGQA 3B5JA 4HDRA 4TN5A 3EEBA 1F5SA 4R2LA 3R3ZA 1FDRA 2QY9A 4PTYA 3I6YA 2OV8A 3CPSA 4TTRA 1JKIA 2KPOA 1NC3A 2YVKA 4QBTA 2ATXA 4LDZA 4LMRA 2AWOA 2X23A 3TQFA 3MUNA 1IEWA 3AIKA 3EHEA 3LMKA 4I1RA 2GB4A 1Y5NA 1JQ5A 2VUSA 4NP6A 4OJNA 1WQ1R 3VR4A 2GEFA 2V54A 2UKDA 1D2GA 1T4DA 2NTNA 3QKRB 3QX9A 2J6CA 4LJ9A 4PG7A 1KDZA 3HVKA 5EAIA 2I6UA 4EO9A 2I2BA 3F4KA 2YRXA 1WSDA 5F77A 4KFCA 1CJCA 1UPXA 2HA3A 2OZLB 3S6JA 4Q5IA 3I01A 4YAIA 1ECPA 4TZ6A 2DKNA 1YBFA 2QIOA 4DC0A 1WS6A 5CGZA 2E21A 4REOA 4BX2A 3AY7A 5JHHB 1DRJA 2XLBA 2D7DA 1V1JA 3R4CA 1EVLA 4BBAA 3O9ZA 4A2QA 2IH2A 1UZAA 4Z99A 1FMFA 4P81A 1ZD4A 4DKJA 1FK8A 4E2XA 1KEKA 4B48A 2VHEA 5SZJA 5T6MA 1YR6A 4M9QA 1QU2A 3RKSA 2C61A 1I6KA 1GPMA 2HU5A 1E4EA 2VBGA 4U2KA 1C3EA 4Q9NA 2VNHA 2EG5A 4MICA 1DP4A 4PQEA 2WFAA 1KO8A 1KI6B 1ZWKA 2XMZA 3F3YA 3O0DA 4LSWA 4FB4A 2GZAA 2PUAA 1GZHB 1WXWA 1H94A 2P41A 2CYBA 4MW1A 5DLDA 2P3LA 2G9VA 2PWZA 5K09A 3OZCA 3WO0A 5KTOA 1IIBA 3JATA 4B3JA 4L3OA 3EQ2A 4Q21A 4H4CA 4CQLB 2BISA 3LPLA 3H04A 3N58A 3VHRA 2FU5C 2FR1A 2P9JA 3OVMA 4GPIB 4MLDA 4COOA 4GMKA 1XRQA 2OZKA 3QP9A 4JD5A 5EC8A 1Z4JA 1SUEA 1U80A 2J9FA 1NR7A 2GEDA 2J6HA 2NGRA 1K8RA 2OFWA 1NW5A 4XQGA 4ZQEA 1ZMXA 5LC1A 2JCVA 4M3NA 3WMGA 2PBZA 2AKYA 4BP3A 2G1UA 2H11A 5B58T 1QB8A 3DE2X 4GR4A 1KJWA 4XX0A 1GNTA 2JD2A 2QOEA 3R7WA 2PX4A 1Y48E 1KSGA 4ZKEA 4E88A 4OGGA 2O4UX 1ZJ4A 3K2QA 4EW2A 5JR3A 3K0SA 4PQYA 2O3SA 1SEVA 4XQ9A 5JDCC 4ARSA 5LDGA 1UANA 4G1EB 4DSNA 1N2XA 1XIVA 2XB8A 4LJ6A 4LJRA 3I9NA 3M5WA 4C7XA 3K6SB 3ES9A 4QEKA 3QQ5A 2GKGA 1KGSA 2HA5A 1V95A 4UQPA 3RK4A 1YDWA 5EIAA 1SBYA 3R8XA 3T9FA 4L02A 1JQBA 1XEXA 1Z83A 1ZO8A 1FU4A 2OGZA 3R5KA 3P19A 4PQGA 5B37A 2UU9B 4IVRA 2Y2VA 5BW6B 1Y6QA 3CX4A 2ZT7A 1JEOA 3BHMA 1LDBA 2QR3A 5EJMA 2RGWA 2YV3A 4C7KA 2PQ0A 1O6FA 1L7VC 2QGZA 1DHTA 3U09A 4Q4AB 4DLBA 1YQTA 2UXCB 5FWYB 3DA8A 4R2XA 3OF2A 4LXXA 1WZUA 2WILA 1T3TA 3HR7A 1PZFA 3K0CC 3TRHA 5ALYA 1A98A 1Z2NX 2BN4A 3KSAC 3BHJA 4LRYA 3TQQA 3HTXA 1H1DA 3JQ7B 2HPHA 3OAAD 3ZI4A 3HV0A 3S55A 3VISA 4BQQA 1XDZA 1ZGCA 1FBTA 4KSYA 3I5YA 3D54D 3PQFA 4IGAA 1XDDA 3GK3A 1EZZA 2EX1A 4G01B 4LOJA 4ZAZA 1D7AA 3ZWKA 5JSFA 1GU0A 2HLDA 3CURA 1MX3A 2GZDA 1HPLA 3EOZA 1MRNA 1GCUA 2VK4A 3GT7A 2JCXA 2YJ4A 3CC8A 4P7BA 4OLAA 3PQ3A 1USIA 3LUGA 2AN5A 1USWA 3EVAA 3K9BA 3W5JA 1OIWA 2ZB3A 1N1MA 3C43A 1CDEA 3LDGA 1ZOOA 221PA 4WZAE 4XIIA 2HL6A 1MRZA 4NU8X 4X85A 4MUGA 3FDJA 4IKOA 3G9UA 2I91A 1AHIA 1RI1A 1RI5A 1T24A 1Y8RB 2OUKA 1OLSB 5EUQB 1VJ5A 4Q39A 3MUEA 4BQEA 5BOSA 3GFSA 2H1VA 4BLTA 3O2SB 1CR2A 2ZI6A 4JMLA 3SICE 2AI3A 1FRNA 5JWRA 3DFKA 3Q5GA 1WIWA 4YB8A 1JEYB 3AILA 4P7JA 1H2XA 2NNLD 2FEAA 3IDQA 3UVEA 1FB5A 1X7XB 4DA4A 3QRWA 5I9IA 4Y6OA 4WN9A 3QTTA 3N2IA 1EU1A 2HN9A 1N2HA 2H2GA 2PYIA 4HDAA 1ZHOA 2P6OA 2HIAA 1NQAO 2Y9MB 3ZU6A 2PXAA 1LPAB 4G63A 3DB2A 1Q1ZA 4EKIA 4X1IA 1XKXA 2X0JA 5FO1A 1HEYA 2RHTA 3UUEA 4OI1A 5KOHB 2IH4A 1E8DA 3IJRA 4EHJA 2EJTA 1K98A 1VLQA 1VGQA 2J5QA 1B42A 2IPAB 2W90A 1V48A 5AHWA 3N5CA 1AKNA 4D6PA 1ZISA 2NXNA 2ZAGA 3HN2A 3LF2A 3WNBA 1UMDA 3T3HA 4BO8A 4BLVA 2OHGA 1GCGA 2VDNB 2AL7A 3K31A 3HJGA 5B7PA 4IJ6A 1I3CA 2WHRA 1VOTA 1Z4LA 2CJYA 1TYAE 1W73A 3AF5A 2JI8A 1OAKA 3TQOA 4PX3A 3UM9A 4KOAA 4MB2A 4ZVLA 1OLOA 2J48A 3DCJA 1GWNA 2FZKA 2RGEA 3NDIA 2H1SA 4B3BA 2F3TA 3GD5A 1V11B 5AW4A 3ZD9A 1LQTA 3GO4A 2PMDA 3TR0A 2REQA 4MAMA 4Q03A 4YJGB 2JS7A 3ZXXA 2NN3C 2OP1A 4Q3KA 1WLSA 2B5VA 2FV8A 2KI5A 5ECWA 3KB2A 1NF8A 3NI2A 4DV0B 1ARZA 5BYJA 3OO1A 4OGLA 1NT2A 4PFSA 1Z5WA 2JK0A 3Q9NA 1SHTX 2Y92A 3HYSA 4CE6A 1QG0A 3OFNA 4DMLA 1H65A 3HZRA 4B2LA 1WXIA 1LU9A 1O6GA 3CE9A 1Y7HA 2HCBA 2IY7A 2W2NA 3BWYA 3FJ1A 3P0HA 1C9EA 3TD9A 5ICCA 3DR5A 4JDPA 3PHBE 4TV9B 4KR9A 3GFBA 1WUJS 3R5JA 2C4KA 1L7PA 3I0MA 1JVSA 5K4AA 1U63A 1V5IA 1QNLA 3NUZA 4YRSA 1UKAA 1GNQA 3AR9A 2AFHA 4DBLC 1Q19A 4DUPA 4CI9A 4DLPA 5GM2A 1ISSA 1Z7BA 3M33A 1SQ0A 2R62A 1MAWA 4D9GA 4QUIA 3HMQA 3DHVA 1N2EA 1N34B 1VE7A 5DNVA 1TKBA 1JI0A 4D98A 4F6LA 5DTMA 5EJAA 1FXWA 5AKHA 4O63O 2ZI4A 1S89A 1AF7A 4EKYA 3A06A 3DAFA 2V7EA 1A9QA 3TKAA 4YV7A 5LBIA 1RM0A 3P2YA 1FZTA 4KWHA 3KHSA 1SA0A 5IBPA 2Q5EA 1NAHA 4DCGA 5FWXA 1XDUA 4IIDA 4FQ5A 1UIMA 3BCUA 2HM7A 1KAMA 1VIDA 4L15A 3A27A 4RL6A 3L0CA 1M7GA 3SR3A 5FAKA 3Q9UA 1D09A 3Q8WA 1UZMA 5KNBA 4L75A 4E4TA 5LUBA 2QDKA 5AM2A 2Z58A 5K8IA 3VUEA 1DXYA 3ED1A 1T15A 4PV7A 3UOAB 2Z43A 1YXMA 2VYCA 1BCSB 3HKEA 4GDMA 5C37A 1E9VA 3F6RA 1XA3A 3MILA 4K03A 1EAMA 1CRWG 5DHFA 5JWOA 3ILVA 3BSFA 1GL6A 3LD9A 4EBFA 4BCCA 1RLMA 1PFYA 2VQEB 2ZP1A 1YR3A 3E9EA 1RWOA 3HGTA 4ZC8A 2BZ1A 4CDNA 3L0IB 3DVQX 4X24A 5B6JA 1QIMA 1QP0A 3AF6A 1QZZA 3ULKA 2H1LA 1TZCA 2XB2A 4HYEA 4WXPA 3FTFA 5DEOA 4KYUA 1Y33E 4B2YA 1ZG3A 5JJBA 1T34A 4I99A 4X61A 1IM8A 1BS1A 1TZKA 2DFNA 5D01A 3M5CA 4I1SA 1IQRA 1HUQA 2E1PA 1VYTA 4GKAA 3SSNA 3VZDA 4FCWA 3AKDA 2CFIA 1QMPA 1TW3A 3V6LA 4NY1A 4LJ8A 4MW4A 5A7GA 4K6KA 3GPCA 2H8GA 1TYEB 2MDTA 2M6RA 1JHRA 1DU4A 2GF0A 3MRVA 4MPRA 1Z3CA 2ZIUB 1NZFA 5JDIA 2QI9F 2WHPA 3ESXA 4W6QA 1TADA 2GDJA 4QLAA 3HDVA 4RH3A 1OW3B 2ZRMA 4JUIA 1NW6A 1DEAA 2BJWA 1PNTA 2AMYA 2TECE 1X15A 3GARA 3VV2A 3GGSA 2VWGA 3HJBA 1U4NA 1EX7A 4AZWA 2W2MA 3E53A 5JG7A 5JO9A 2BHSA 2WSBA 2VDMB 2J9ZB 3CN7A 1KQGA 2I2DA 1AQLA 1SCKA 3SS9X 2OFPA 1IULA 5LMCA 4I2VA 3GDFA 3I58A 2GVNA 1NI4B 3QYJA 4CEJB 3NBZC 3EZ6A 1GYPA 4JNKA 2Z8YA 1BXZA 2PGDA 3C3PA 3CX6A 1XMIA 4R01A 4Z6KA 1U1CA 4B9AA 1YKSA 4CLRA 1JNXX 1X7GA 1QH1B 5AWFC 5KBYA 3A0UA 1B1CA 2IUEA 3M4YA 4UQOA 5HFNA 5LXTB 1WXFA 3VZBA 4D3DA 2PZEA 1CUIA 1U0GA 4EYQA 3BXPA 3NR2A 4D2IA 1PJRA 2RBKA 3TIFA 2R7AA 3SXUA 1YZTA 1SBZA 1GKUB 4NU6A 3ELDA 1Z33A 2RGNC 4FZRA 4PYRA 3D9QX 2V4MA 3NPMA 2NZ2A 4BX0A 2AZDA 4F38A 3OM1A 2G4VA 4CMIB 3LUCA 3IKJA 1VI5A 3TR5A 1TX4B 1PZNA 4OHCA 2V3CC 4G67A 4H1VA 3PL1A 1ZH2A 3EGXB 3ONVA 3MJEA 4XGNA 3IL2A 3ABQB 2CFSA 3L8MA 4PSDA 5JW6A 1GAXA 1MG0A 2ALJA 1A2BA 4I14A 5TQ0A 4ZMSA 5J9FA 4U8GA 4QARA 2IZ0A 2OCIA 3DHEA 1G5FA 2NQ2C 4KRGA 5ED0A 5FCDA 1N1GA 1EEXB 3B1ZA 1YASA 5KX5B 4MIEA 2DFVA 2I5PO 3B3FA 4UE2A 2ZSIA 4P0TA 1J6UA 3OFSA 3NGXA 4FFPA 3ANMA 1BE8A 3B9QA 3ROGA 3WLKX 4LISA 4WKBA 1FTNA 3C7CB 2HBZA 4WN9B 1Q14A 3PFIA 3RDPA 3ZHBA 1C8BA 1XCLA 3DZGA 4LHVA 2P8SA 3K8ZA 1NOJA 3O8OB 4ND2A 2BCJQ 2XV1A 4L3WA 1UMKA 3JV7A 3EDRA 5JXIA 4KGDA 5U9CA 3OOWA 4EKEA 4H35A 3NAZA 3AOGA 1VFPA 1NRJB 3H2BA 4I9GA 4JH0A 3G89A 1QPBA 1C9KA 2MSEB 3PA8A 4QFDA 3UBMA 1OLSA 1YBAA 4EMTA 5C5DA 1GL9B 1R0BA 5FR2A 4UTVA 1U7WA 1S8AA 5LQDA 1CK4A 1RQLA 1QLHA 2OM2A 4IQ8A 3RVBA 2ODQA 1BH6A 3HA5A 1KI4A 1NBOA 3WLNA 3HWX1 3LX4A 3ICOA 3RRZA 1R6VA 2MINB 3ITKA 5MHTA 4WI1A 5KNBH 3KTAB 5DU2A 4PN3A 1KYYA 2PA3A 4CHTA 4U7TB 5E0OA 4QDTA 4MUYA 2IOFA 2FSIA 5DH9A 3VR2D 3QEAZ 2ERYA 4I1YA 4YRRA 5BN5A 2R25B 2HIHA 3N74A 4PGAA 4D8XA 4DSAA 3HLTA 5HCNA 3I2GA 1CE8B 1JDJA 4RHYA 5G1PA 5EGSA 4CM5A 1N2JA 3T3DA 4IEEA 3EEQA 2LBPA 1QHFA 4F21A 1WB5A 2AEFA 3B1JA 5IVKA 5CYGA 1B14A 2XDWA 1IU9A 3L7BA 1CIPA 1NXWA 2QP9X 4B7CA 2ZYIA 1YRHA 2WMOB 5AESA 1UDCA 2YUIA 3BWBA 2ZRPA 5CT6A 3VI3B 3RIGA 1JG7A 2D0DA 5HJ7A 2DB3A 4XD7A 1W4CA 3D8SA 3EQ9A 4L27A 1EB8A 3B2EA 5DBIA 2NU6B 4Y2YA 1NPDA 3DGEC 3UW1A 4MVJM 3TNLA 4KXVA 3B1YA 5D87A 2XT9A 3A32A 5JBQA 3HDYA 1Q7RA 2W2KB 3DQZA 3WIDA 3IPCA 3NM5A 4KXXA 1WF3A 2VUUA 3COZA 5BN3B 2ISQA 5TF0A 3WTCA 3D0OA 4GNRA 1PGJA 4JSTA 4JVNA 2QNIA 3L7JA 3SDBA 1YVRA 2CF6A 4C14A 1P2FA 2BF4A 3B6KA 2IEZA 4EIWA 4E46A 3WXMA 4FYWA 1QH8B 4LHWA 1LPOA 1AKQA 3GROA 4ER0A 2YHUA 1QTRA 3AF0A 4LNHA 3GEPA 5CVDA 1QHHB 5PGMA 1T9AA 3LWZA 1UWCA 1I7PA 1GPUA 2ZE5A 4EJSA 1EK0A 5IKMA 2G36A 2G83A 1Y1TA 3GWGA 3KT6A 4IPTA 4RF2A 5K8VA 4B9EA 2PUHA 1I94B 3I0ZA 2QR2A 3K9FC 2FWRA 4CKEA 2YQZA 3HA7A 2WI8A 1V1RA 2PFSA 5LDDC 1MMFB 2FZWA 1HBJA 2DCMA 2VSXA 3TXXA 1AB5A 1NQUA 4YACA 5IKEA 4HAXA 3CKLA 4PZLA 2O1SA 2C4WA 5ENVA 3E3MA 3HN6A 3KB6A 1ZESA 4GVXA 4P1ZA 4AJEA 1BXRB 1NVBA 3FWKA 2AFHB 3OD1A 3PTZA 1O95C 2O7VA 2WDPA 3X1JA 4CTKA 2VTBA 3LC1O 121PA 5C46F 4X8HA 4KQ6A 1PL6A 5FBRB 1DE0A 1G8GA 3SVZA 2R6HA 2E5FA 1UAGA 5ABPA 2SKDA 2AN1A 1LJUA 3P2IA 1CQPA 3G7NA 5EUBA 4MITA 4AVYA 1RRPA 1G2PA 3FWHA 4P2BA 4GQBA 4FWBA 5FFFA 4CMJA 1NJ2A 3JYQA 5FDFA 1MRSA 3HLYA 4ZARA 3DPSA 1Z8DA 4M55A 3WYDA 1NVDA 1RLIA 1XR3A 2AYYA 2QP3A 2WJ3A 4JUDX 1L5KA 2FN4A 4YAEA 1KSFX 4OFXA 3RSFA 4RXUA 3SC4A 3CRQA 1KU6A 2I03A 4HLNA 4RMNA 1GG9A 2G06A 3GGPA 3IJEB 5G1OA 3K9GA 4GZLA 4OYLA 2QVLA 4H1TA 2IF0A 3PQ4A 4HB3A 1SBQA 4NFYA 4AP9A 3AHIA 3M9XA 4CKBA 1C41A 1XTUA 4O5OA 4CG2A 3KEGA 4J2TA 3E0XA 2ODTX 4NARA 4U9IS 2UYQA 3LHIA 1N2GA 1E4OA 2Y67A 3R3VA 4D0LB 2IUSA 2BTQB 5H16A 1L1RA 3PEEA 2PKEA 4NMWA 2QXYA 4JL8A 3TQTA 2FMTA 5EVJA 2RHWA 1FLAA 5FHQA 1UBGA 1ZLYA 4JGBA 1I9CA 2CVPA 3IB3A 4Q4LA 3ZY4A 5FOVA 1I7QB 2RSLA 1SCDA 4YCNA 3IERA 4FOLA 3U3JA 4KIFA 1UM9A 1QIDA 1WX1A 3RUHA 1SKYB 1P2BA 4L0MA 3RYCA 3B3GA 1Y1KE 3KYJB 4P3PA 3HCWA 3UJ7A 3L40A 3EVGA 1OYVA 2GHTA 5TGTA 2PZGA 4DSOA 2ATCA 3I6QA 4B81A 2P2GA 2P2DA 4PSCA 4WY8A 3I73A 2AYXA 3N3AC 5ALGA 4D57A 5CLFA 1CYDA 3B1XA 4C4RA 3VNAA 2Z2IA 2ACVA 1GGMA 2OA0A 4C7BA 2GXAA 3FW1A 1ORIA 1V96A 3QPCA 2DRIA 3BFJA 3QUSA 4M2LA 4MQ4A 4PWYA 1RYBA 1BS2A 2PRZA 4JJFA 4PO1A 2AW5A 3ROEA 2I6TA 4MRSA 3HA3A 1EQAA 1XVTA 1NG1A 4QFMA 5DXAA 2A5FA 2RHBA 3N86A 3FLBA 3DBLB 1HK7A 1DV2A 5JQWA 4EM6A 1L5VA 4AXXA 4ZCTA 1AZTA 1O9BA 3ESZA 3M7IA 3UHPA 5IKXA 2FKAA 1JR6A 1N9GA 2FXIA 4JBNA 5KWIA 1MB2A 5HKKD 2C7BA 5JADA 3CM0A 1L2TA 1KR2A 4B3XA 5BVHB 5HTOA 2DYKA 1DKRA 1DKNA 4LMPA 2JLZA 4HDSA 1CUZA 4NQRA 5IK2A 5JT1A 5L95A 4Z0NA 1DKQA 1VJDA 1XGKA 2UV8A 3T3GA 3U0VA 1A04A 2C5GA 1N3IA 2DUJA 3CLTD 2CNNA 2VF5X 3WHIA 3WP0A 3F4BA 4J0FA 3K05A 5DYGA 1QK5A 1UKZA 2BGJA 2ZSDA 1ML3A 1TIKA 3BK7A 3E1KA 3OQBA 4Q3LA 3N76A 4U7FA 4S3MA 3FMIA 3V1TC 4BMSA 5DGDA 5T3YA 1ZBDA 4MQBA 1R9GA 4B46A 3PC8C 4BMVA 2CVHA 3GPBA 1J2JA 1E9EA 3OQ1A 2FAXA 3SSAA 3TI7A 1ZL2A 2GXSA 2ET6A 1GEGA 4DNXA 2CDRA 2D5LA 2ZBDA 1RC0A 2BFNA 1GGKA 4DIKA 4ZI7A 2GVDC 2R1VA 1ODCA 4M1TA 4UD2A 2W6JA 4GPAA 4DRXB 4EBBA 3PWTA 3RC2A 4AI6A 1DTWA 3H1TA 4MV1A 4LSGA 3EXHA 4KR3A 2ACEA 1KJ8A 2VVTA 1DTSA 2DBRA 2A84A 3O9VA 2HW8A 2YJ6A 4OSOA 5DI3B 4D99A 3U7GA 4DA9A 1AURA 1PEKE 1OFVA 3FWNA 2IJGX 5CLLA 4QQFA 4CIDA 4DTCA 3CQ9A 3W77A 1QUFA 3KYCB 2B1RA 2WJPA 2IK8A 4KPUA 5EE5B 5HDQA 3ZHZA 5JFGA 1DBSA 1EKXA 1QR6A 1UUFA 2XXJA 6REQB 3ORSA 4OQNA 4BRWA 1E1YA 2Q3LA 2X8JB 2YIMA 3S2SA 1W2GA 4DWWA 1U1EA 3GZNA 1SQ5A 4NV1A 1YCDA 3R24A 4B6RA 4EW3A 5HUJA 1WVMA 5DX8A 1WZCA 3FNBA 3PFKA 1YMUA 4AZ0A 2FEMA 1IC6A 3L79A 4QNRA 3PD0A 2XVMA 3JR7A 5NLLA 3SKXA 3WSWA 2OBNA 4JU8A 3C4QA 3OY7A 1DSSG 5KTSA 6LDHA 2R1VB 1P4GA 1EM8B 4KQGA 2HMUA 2ZB2A 2BRUA 2FWBA 3O3OB 3W3ZB 2W2LD 1XOIA 3PI7A 4BNKA 2HF9A 4KKXB 4ARUA 1W36B 1JHXA 4RCZA 2VF2A 3BRCA 2ZJYA 3K9NA 3IP1A 1K5PA 2QXUA 3QI7A 2ZTUA 3NC0C 4X7PA 3UXYA 3INYA 3F90A 2CFRA 4FJ1A 5DCYA 2Z30A 1ZQ9A 1OFUX 3U3DA 4F5ZA 1ZNQO 2E48A 4N0MA 3NAQA 1W4LA 3FR8A 2C2BA 2YR0A 4C7JA 1W0JA 1M5UA 3JD2A 4UDYX 1I4OA 3BL8A 3OM0A 1H2BA 2IXDA 2NYUA 2PT6A 3PUWA 1RWWA 1HV8A 2VSFA 1UOPA 2OP0A 1PJ3A 2R85A 3RK1A 1ZH4A 4RHTA 2PKQO 1WHSB 4BUZA 1KMIY 3C8DA 4MDYA 4A0RA 2DSTA 5CDFE 1CBUA 1HC7A 1UT5A 3CYFA 5IFLA 2WE7A 5K8LA 2F1IA 1DL5A 2BBTA 2Q9CA 3JVVA 1J0AA 3RC9A 3ZJTA 2VSOA 4BLUA 5FUYA 4L16A 3MGAA 1T2CA 3DMTA 5TGDA 2CN1A 2YMQA 1M76A 3CF6R 3BN3A 2RGXA 3NBQA 4D4KA 1IEQA 3R20A 4JASB 4Q18A 1RI3A 3L0PA 4PGFA 2AOXA 4U1RA 4QQRA 1IUNA 1TC2A 2XOXA 4G1UC 1ORTA 3SIPA 3D1VA 1FVXA 2JLUA 4LHSA 4HATA 3RVQA 2O0JA 5DX1A 5B30A 1A5BB 3E8XA 4OFBA 4QOEA 9MHTA 3JXEA 2QI9C 3FOEC 4JB2A 5F7JA 1V1MA 4C7MA 3QMMA 4HV4A 1ZR2A 4NU5A 3GG9A 4DN6A 2H16A 3VDRA 3GYGA 3DBIA 3VTAA 3ZWXA 4LE2A 3UMSA 1BH2A 2J3HA 3HCCA 2B7BA 3PXXA 3AM4A 4GL4A 4PYLA 5FADA 4I50A 3SEAA 3WK9A 4F84A 3GLGB 1KMNA 2XCSB 1LBSA 2FN7A 2Q46A 4HZUA 4OI4A 3TOVA 2E4WA 3FJOA 2Q5LA 4CG1A 2VAPA 1PZEA 3BT7A 3GG2A 1UP7A 3UHFA 5AVJA 5JHGB 1QRUA 3A9CA 1AH2A 4GS5A 4JUCA 4R0VA 2O1WA 3I0NA 3IPYA 2DPXA 3LM8A 3KPYA 1IOZA 1CQJB 1KHHA 1U6KA 2Y66A 3NU1A 4XX1A 3D5QA 3QX3A 1QRDA 3TL6A 3NBAA 1CY4A 3MG9A 2YY7A 1VHLA 4P7FA 1JAXA 3F9IA 4KDCA 1TT5B 2IYZA 3CRW1 2GPJA 2WM9B 3A7DA 3JW8A 1EVJA 1HDZA 1SCUB 1ZNWA 5FB3A 5HZMA 3C3BA 5ALUA 5T4BA 3LDAA 3MSCA 3DAOA 4B31A 2EW8A 2YC4C 1B74A 1GNRA 1J49A 3ZZ0A 4BN0A 2YWGA 3CZPA 4YT8A 1Z7EA 2K2QB 3AH8A 4LN1A 1CY6A 2V7QD 2X22A 3ZJUA 3NVAA 3FTDA 1C9JA 3V1LA 3LCJA 2EKZA 4B74A 2Y1FA 4MWTA 3UUWA 4F9FA 4BB6A 4OBWA 3K09C 3QLVA 3JALA 4ZT6A 1W44A 3R5HA 2UZ3A 4JI2B 2JASA 1MPTA 2CCGA 5B7NA 4FD3A 4ND1A 1YHNA 2QSUA 3K5HA 2VC2B 3LCCA 5JWHA 4YUYA 1FMTA 3K3PA 4CT5A 1DRWA 2KYRA 3GC6A 1VA4A 5H9VA 3TMAA 4TZKA 1ST3A 2ZVQX 3ADBA 4KO8A 4C3OB 2WV9A 5I7OA 1YZKA 3OZSA 3RTDA 1M67A 3IAS6 4IDHA 5K4HA 1ACMA 2IYUA 3L4BA 2Y1XA 2ZR8A 2IL1A 2R79A 4QGHA 3TX2A 1M9NA 1RC1A 1GT91 1OY1A 5KOJA 5JAPA 4LDJA 3PXDA 4Z9AA 2FUNB 3RFVA 1I13A 5FFNA 3MK31 1KI7A 4RW0A 5AIBA 4YJFB 3H2YA 3U9LA 3ZDXB 4C5CA 3OEHA 5IJ9A 3Q2IA 2HGSA 5E6SA 4ZU1X 4RF3A 1QH8A 3RGGA 5H02A 4Z1OA 3U60B 4GKJB 3CGWA 2IU6A 1E3WB 1H9CA 4A73A 4J2OA 3BMQB 3W1EA 1AQNA 5AKGA 1U3WA 3L1VA 5KIAA 1ZN7A 4F60A 3IAS1 4DSUA 1UR5A 4QJBA 2DWCA 2Z5FA 2R6GA 3GGJA 1ZVKA 4CW7A 5JCZA 3P97A 1L5QA 1N3BA 3QIAA 1M6EX 4EATA 1ETHA 3B85A 3JTEA 2ZSUA 2XWPA 2ZSFA 3OMLA 3L0OA 3K96A 4OHRA 4EFKA 1DFIA 1WNFA 1OH8A 4EW1A 2OHOA 4ZOBA 4BQRA 3KHUA 2PRKA 3JQGB 5CVVA 3RS0A 3WJ1A 2I8LA 1QCYA 4FPXA 4C29A 5IXYA 5LOVA 5IAKA 1YFZA 2Z57A 1KOFA 5CIQA 4GR5A 1G5RA 1JUDA 1EGAA 2OHVA 3HVHA 4ME6A 4US2R 2DQYA 2RGCA 2CJPA 1BDBA 5AM5A 2QN3A 4G3XA 3ZHVA 1T3LA 2IT1A 2QUHA 3EGEA 4JS0A 1JLKA 1JDBC 4GWKA 5DF1A 1SU8A 3W04A 3BAFA 2W6CX 3D8UA 4Q1DA 5JH7A 3TBFA 3FDFA 3N1UA 1DTWB 3Q2KA 3E7DA 4Y2QA 1CUDA 4A1OA 1O9HA 3OD5A 3RF7A 4G1CA 5E4FA 4V39A 2R1UA 3FYUA 3ITEA 4FGKA 4NAUA 3WGKA 3WGVA 1V7CA 3QMVA 2EDCA 4GX1A 2ACWA 1XQWA 4DIUA 5J2TF 2VAMA 3CWCA 3B1FA 1QVVA 1UJNA 2ATVA 1UJMA 2ORYA 1SIBE 4O0LA 4AC9A 4RTKA 3MN1A 2DH6A 1S0UA 1SXQA 1U1GA 1ZUD1 2Q5HA 3PICA 4HYTA 4ZZ1A 2J07A 4FSHA 3IUJA 4URYR 4HGPA 2QUIA 421PA 3UENA 2Z95A 1MB4A 1M6VB 3BWXA 4I0WB 3SQXA 3QVWA 3FB4A 4EJSC 2IYVA 3C16C 1M1ZA 3DR3A 3CF4A 4FHZA 4H7IA 1RZRD 2C5BA 5LB4A 5TVKA 3SE7A 4HTAA 2MTBA 1OIXA 1L3CA 3V4LA 3OJOA 1KWGA 2VP4A 4RX1A 2N42A 2W83A 3ROMA 3JQAD 3WLIA 2I4OA 3C3XA 1BEZA 2J4FA 3RS3A 3TW8A 5AVTA 3T12A 2P0EA 4WZAA 4RZQA 1X0XA 4QEDA 2XSZD 5I4KA 4RMIA 3NONA 3QVTA 1G0OA 4UE3S 2D7CA 3KPJA 4TQUS 4GC5A 5MN4A 3MMPA 4RTSA 2TRSB 2XEXA 4RPKA 3IV9A 3LZDA 1AO0A 4D8YA 2VEDA 2A6PA 3GMSA 4X1OA 3TLKA 2IUYA 1U2PA 1Z28A 5CJJA 5EMMA 1V6SA 1TZJA 2JFHA 4NHOA 3EW7A 3AINA 3GJQA 1DO2A 2Y6UA 1KRHA 1P1HA 4CG3A 3TECE 2X13A 1IQ0A 1CEQA 1QIKA 1RRFA 1P4JA 2IOFK 3L1UA 4YQEA 3LUHA 5KYWB 2H2AA 2ZDHA 3SEZA 5K0NA 5IT9A 1E0KA 3IEVA 4AW9A 2WSSD 2J9GA 3BHIA 3O47A 4PYMA 3T7RA 4M1MA 3SDSA 1X1BA 3TW8B 3X2FA 2CJWA 5EG5A 1P7PA 4ER5A 2XZOA 1W75A 4ZN6A 1HKUA 3BE8A 4NEHB 3UCFA 5KSPA 2ONKA 2JJ1A 2WAYA 1JL3A 5EQTA 3WGZA 4BMXA 1R50A 3ABOB 4TKUA 4E1AA 4UVIA 16PKA 3ZGZA 1XRJA 1ZMTA 4NZZA 1JIUA 1KDRA 5H80A 4X54A 3R0XA 3HYRA 5KTMA 2A1TS 2X3FA 3VU0A 4CLXA 2FR0A 3H87A 1HDCA 2R87A 5HG0A 3NHKA 2H85A 4JLSA 2X0FA 5IFKA 1JXOA 2WKRA 2ZPAA 2BE9A 2GILA 3IAEA 3U7EB 1YSCA 1D2EA 4DV3B 1TJNA 2WD7B 3QMWA 2JK1A 1A97A 5AK6A 2HU8A 4D9FA 4KH0A 3IVAA 3WQRA 1YUMA 3IE0A 5E38A 3KYDA 1GP2A 5HMLA 4YRZA 1CJTC 1T9CA 4PLHA 1E2IA 1UJ5A 2A9RA 2FPUA 1HDIA 1B7GO 1PWZA 2HT6A 3BWEA 4KODA 4U6NA 5KO2A 4JYMA 5LA6F 2J0EA 2EYUA 2QLBA 4ZOAA 5FI5A 2O4CA 3KDSE 1MO5A 2FUCA 5FPQA 4E5KA 3FDZB 1MJGA 4X3OA 5I5GA 5CT4A 3AG6A 4OOFA 1E3IA 3AXSA 4LTDA 4D80A 1L5HA 1XPUA 4I1IA 2P9QA 3CUWA 1G7TA 2FPWA 3P0RA 2C5FA 1C1XB 4IS3A 2W2OA 5GMOA 4BU1A 2GM4A 4XCVA 4YX9A 4H6PA 2NPFA 2OGSA 5DGTA 4LVNA 4LMBA 3DOEA 4N7MA 4U5XA 4J0JA 4KNVA 3PZRA 4CF7A 1N57A 1OFGA 5AJZA 1HZZC 1AKUA 2VR1A 3GRRA 2VATA 4MMYB 1W46A 4M1YA 3IIMA 4XWAA 4IQ4A 1KTIA 4G5OA 1GPH1 2J9FB 3ZUPA 1SUCA 1XZCA 3GUHA 1PT9A 2B4AA 2Q3BA 2HMWA 2Q4TA 4X44A 3KM0A 5L3SB 2Q4BA 4LQDA 4C05A 3HVUA 4P5PA 1T8SA 3K0KA 4INAA 2ZRCA 5K3CA 3JQ9C 4LXHA 4HAIA 4QDKA 1COZA 4EF5A 2FOIA 1RI2A 4OI0A 1DARA 4TL8A 3A9RA 4L7VA 2HSDA 4M9ZA 3RH0A 1QGOA 4ARZA 5BNWA 5EJ6A 5IYZA 3BQMB 3EW9A 3I8XA 4PC1A 4N0EA 4Q9AA 1EFDN 5FNZA 4P92A 1N92A 2VXOA 3Q98A 4B4DA 5GM1A 1T0IA 1N33B 1Z5OA 2O52A 2EKDA 3I2YX 1AKMA 2JIZD 4BKPA 3RYFA 4EGFA 4B6OA 4E2YA 3QTBA 4R16A 2L0XA 4BVEA 4XDGA 4UOQA 2OK8A 2EV9A 1XWIA 2RD2A 3ZCRA 4LA4A 1E5VA 2WYVA 3D0QA 3FVVA 4HWKA 1ZGHA 1NHGA 1EWYA 5I9TA 3ZX4A 2JFYA 3PGXA 3DE5X 5L7YA 2LD4A 1X38A 3I01M 5IDVA 1IEXA 1FFYA 1U9JA 2ZQZA 1Q5PA 3Q6IA 1A4XA 3SAJA 4FR0A 2EFGA 3EE6A 3SKYA 3NKVA 3QEKA 1K4KA 1L5WA 3DZFA 3KAJA 2IDKA 3QY9A 3VM6A 1XNRB 3FCOA 4Y1FA 2CE7A 3PQEA 3VR2A 2UZ0A 1VPLA 2CYAA 1S9DA 1RE0A 2LDBA 3N8IA 2I1LA 3O38A 4FQ8A 3WQQA 3O21A 1QZ3A 2P5YA 3LGXA 5IVIA 1ZGAA 1T4CA