4CM1A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 93
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm1A00
2PGJA 4YJHB 4DC1A 3QJ5A 2TMDA 5T67A 3NEPX 4E2ZA 5LDHA 1NVMB 2P5YA 4O59O 2XXBA 4PZDA 9LDBA 4CLHA 1XU7A 1ZW1A 5HTOA 1E1NA 4S1VA 4ALIA 4DQUA 4UEJA 1SEVA 3AUAA 1VC2A 2RCYA 4P4LA 3I52A 4B4WA 2I67A 1ENYA 3DHYA 4OIMA 1T2EA 3TN7A 3ETEA 5G0UA 2GN8A 3H2ZA 1NX6A 2WE7A 3FPCA 4RGBA 1YBVA 4DRYA 5L53A 1B2LA 2HO5A 3T4XA 1RWBA 1NP3A 2EGGA 4G5HA 4LRTB 4E5YA 5MGBA 4URFA 3TSCA 4B79A 3U4CA 1QMGA 5T6BA 2PD4A 3UUWA 5I8WA 3C1AA 1EVZA 1ADBA 5AQ1A 4CM7A 4JN6B 1Y8QB 4W99A 4MO2A 1A4UA 1NQAO 1KEWA 1QG6A 1M2WA 1MXFA 1BXGB 4HNGA 1R37A 4XQEA 1YKFA 4U0JA 3GEGA 1K89A 1GDHA 1QYVA 3I9OA 4ALMA 2X58A 4DYVA 1YL6A 5CDUA 3HADA 4CMKA 1PJBA 4UUNA 1YO6A 3NAQA 5CFZA 2EG9A 4FOSA 1Y81A 1ZNQO 4ALKA 4RPGA 4XYMA 3PDUA 3KRTA 1BW9A 3WIDA 1D7OA 3JQCA 2VYNA 3GAZA 4XQGA 1M67A 4NJMA 3AUUA 4DC0A 1NAHA 3UVEA 1I33A 3PIDA 1QYXA 2C54A 2P9EA 3DZIA 4MVJP 3KSUA 2ZYDA 2X5JO 1JU9A 2GNAA 1V3TA 4B7CA 3WSVA 3TRIA 3H5AA 2HAEA 4BO9A 2D3TA 2AXQA 4M89A 3W4JA 4IQ8A 2Q3EA 3P5SA 4WCFB 1PJTA 1U5CA 2NACA 5B1YA 5JCJD 3RASA 2GRAA 5U9CA 4CQLA 5H81A 4MP8A 3NGLA 3GH3A 4DIFA 4J3FA 4K26A 2O3TA 4E0BA 3KYDB 3E8XA 4F6LA 1UDAA 3NX4A 4PG4A 2CNBA 3VZPA 4A7PA 3G0OA 3K2BA 1E3WA 1LQTA 3A1NA 1KOLA 2QYSA 4FGSA 3E9QA 3Q9UA 1ISIA 1VRWA 1X1TA 2BHLA 3E03A 4AJPA 4CMIA 5JW6A 2PGDA 2H6EA 4Z0PA 2GDZA 2OORA 1KC3A 5JSFA 3U62A 1LNQA 3L4SO 1GCOA 4TROA 2DBZA 4TVBA 3QV1A 3OICA 4RF4A 3JCZA 5A03A 3PEFA 5C7OO 4W82A 1C0IA 1I3NA 4M1QA 5L9AA 5ILOA 3DAFA 5DF1A 3WIEA 3OQ1A 5F21A 2D4AA 4RVFA 5KJFA 3DZBA 3NRCA 4LRSB 4PLYA 1IULA 5CAEA 3B1KA 3WGYA 1Q0LA 3V1YA 4HY3A 3LDHA 4RV9A 2YUTA 4KWHA 2DQ4A 3GRKA 2ZQZA 2DVMA 1Y1PA 2IEDA 4OXKA 2Q1TA 1P1RA 4N5NA 3W6UA 2B0JA 4YAJA 4BKPA 2X22A 3D3WB 1PGPA 4EJMA 4CR6A 5CDTA 1LRLA 4LK3A 3JQGB 1D4FA 4GPD1 4ITUA 4XR4A 3DBHA 1H94A 1KVSA 3H3JA 4CV1A 5JDCC 4E30A 4BKRA 3OQBA 4PG6A 2CDBA 2OL4A 1N1EA 1E77A 3NTQA 1R0KA 3CH6A 5EQDA 3NDIA 1ZXLA 1U1IA 4PLWA 1I2ZA 4IDGA 2WYUA 1RM0A 4AJOA 4YDRA 2J3JA 1O94A 3KLMX 4NR0A 5FI3A 3OF2A 1AHIA 4II2A 2FPIA 4CQMD 4XD2A 4LCJA 4KUGA 1YBMA 5THKA 5COQA 1PWZA 3AI1A 3ZWBA 1QR6A 2FPGA 3RUFA 4CMEA 2NQ8A 1X14A 2BGMA 4KZPA 3Q11A 5KCZA 1KVRA 3CEAA 3G79A 1BTOA 5BNTA 1P1KA 3GUYA 7MDHA 4WLFA 4BV8A 4RVGA 4LMRA 5IDYA 2IXBA 3UCXA 2EP7A 2NUAA 2VOEA 1EBFA 1JKJA 2X23A 3OA0A 3SXPA 2VZ8A 1Z82A 2W4QA 5CPBA 3ZN2A 2ZCUA 1F8FA 4L8VA 1JQBA 1P1HA 3BMOA 3PHHA 3QQPA 4HBGA 2I9PA 2EXXA 5AXCA 1Z7EA 1JKFA 3WGQA 4YAGA 3PGXA 5L7YA 2WD7B 4JBIA 1RM5A 4CMAA 2JD2A 1CDOA 3EAGA 3KEOA 2YQ5A 5G0WA 3OJLA 3GG9A 4BNUA 3GN2A 3P2YA 4KUEA 3SBOA 1BGVA 2VWHA 3ITKA 1TT5B 3GLQA 4J2HA 1PZGA 2WTBA 4RF3A 3I4FA 3ZU2A 1LEHA 2P68A 3C1TA 4J7UA 2RIRA 2E82A 1PS0A 3I9JA 5DBGA 4QTZA 2PGLA 2DT5A 2EKQA 3JQ7A 1LJ8A 4CM9D 2Z95A 4DLLA 5DULA 1VJ0A 4BNXA 3VHRA 3BIOA 2VRBA 3ZHXA 1WDMA 1GAEO 1YVEI 3DONA 1HDYA 4HFNA 1LDGA 2P9GA 4JLWA 4W6ZA 2O3QA 2HMVA 5ER6A 5H82A 4F3YA 1Y9AA 4QO7A 2FRDA 2PKQO 5IN5A 2I3AA 4IBOA 3W8EA 4YJGB 3MCVA 1X15A 1V0JA 3STHA 3I9MA 3PQFA 2X4GA 1U2DA 3JSAA 2POQX 3L4BC 5BR7A 2YV1A 2WMDA 4XX0A 4MJLA 6LDHA 5I9NA 4FFRA 4RVSA 3RIHA 2C0CA 1SCUA 2PLAA 2ZIZA 5DDIP 1NXQA 4I9NA 4D45A 4TMFA 1A4IA 5TJ9A 3ADPA 4D3FA 1ZK2A 3AY7A 4J9VA 3L6OO 2IRWA 3KO8A 4IDCA 4LCEA 1LLUA 2QZ9A 4QSMA 5JDIA 1ZVMA 2VQ3A 2VZ9A 3AM4A 1ZJZA 4BNHA 5CEFA 1PGJA 1RPNA 1TB4A 1UZMA 1ZK0A 4GVLA 1Q2XA 2ZKLA 4XRRA 4DBVO 2YY7A 4JX8A 2BELA 3V2HA 5FWNA 1NPTO 3F4LA 3K9QO 4XYGA 2P2SA 1UDBA 3O8QA 3OJFA 2RBEA 4YAKA 3I5MA 4BNMA 4K1LA 4OXYA 4F45A 3ZHBA 5L4LA 3DWFA 1CF2O 2VHWA 1GV0A 1VI2A 1UXGA 3VDQA 2NVUB 5KKCA 3HNPA 1SB9A 4BB6A 1CWUA 4YJDA 2VHYA 4YQZA 3RD5A 2J3HA 1J5PA 4EUHA 4HFMA 3AM3A 2QIOA 1OOEA 3F46A 5A3VA 2FWMX 4QX6A 4BGVA 1DRWA 3PFWO 3ZI0A 3DTYA 3W6ZA 3WGOA 4BKOA 1ML3A 3GDGA 4CM4A 5JYEA 1DEHA 1GFSA 4IM7A 4DYDA 2P5UA 1NR1A 4YXFA 5B4TA 4OOFA 3R6DA 4XR9A 3QVWA 3ZWMA 1RKXA 1R4NA 3ZW9A 5B4UA 3JYPA 3ROPA 4WCDA 3G1UA 4AJNA 2EHDA 3ADOA 4IY1A 5GZ1A 1E1MA 4D3DA 3INGA 4MVJM 1IZ9A 4RORA 1DOHA 4BNIA 5JDIC 4FFPA 1UXHA 3AOGA 3BXXA 4HWKA 1XU9A 2XAAA 3BMQA 1H2HA 3C3XA 1MGOA 4A03A 4CLOB 1TXGA 2Q2VA 3RFTA 4ZQFA 3WGHA 3ZHZA 3D0OA 3RCBA 1E3EA 4YB8A 2DM6A 4YPOA 2P91A 2ZATA 2X5KO 4L4XA 3KYCA 3D4NA 4M87A 4RDHA 4II3A 4E2WA 4GKBA 3PYXA 1FDWA 1EQ2A 4GWGA 5EINA 3ZWCA 1UZLA 4D3SA 3O03A 4MPDA 1QXSA 2JHGA 5ENDA 4I5DA 2OBNA 4DPLA 1UP6A 3H3FA 1IB6A 4RZIA 3F3SA 1KVUA 1ISGA 2E37A 5HS4A 2IZZA 2AE2A 4O1MA 2BI8A 4OJNA 2E49A 4MVJG 3DHEA 1QYWA 1IPEA 1DIGA 3OP4A 3UKOA 3LT4A 3RFVA 1N7HA 5C7IO 4PVDA 2HDHA 2PR2A 5IXYA 4XDZA 2YHIA 4I1IA 3E9NA 3IUSA 3PIIA 3VKUA 3V1UA 1GZ6A 5GY7A 3DMYA 2RH4A 2W2KB 5AOVA 2V65A 3FR8A 3ASVA 1ZCJA 4GBJA 5LDGA 2QW8A 4WKGA 2JAHA 1GADO 3W4IA 5TC4A 4HNHA 3AU9A 1NQOA 2CMDA 1HLDA 3WNQA 5KJ6A 4W9NC 1DC3A 1C1XA 2WYVA 1UR5A 5U4QA 5A9SA 5L45A 3KSZO 4NFYA 5A05A 4BO8A 3ZU4A 3MJEA 4NU6A 1TT7A 3IDSA 4Y8VA 3LF1A 1E3LA 3N74A 4TQGA 1ONOA 4W7HA 4B3JA 2WWRA 3NDJA 3WJAA 2Q4EA 1BDMA 1Z6ZA 4XRGA 5FFFA 4RO0A 1YB5A 3U5TA 1EVIA 4KDEA 4AJ2A 2WSBA 4FIZA 4B8WA 3GVXA 4B8ZA 3PDJA 1PL6A 2VYVD 3I9NA 3SC4A 1DLIA 4DMLA 1IE3A 2Q2WA 1E5QA 1M6HA 3JQFA 3AI2A 3C1OA 3GMSA 1JTVA 2Y1DA 3BHMA 5TF4A 4BV9A 2J6IA 1NHWA 3SVTA 2AHRA 4BNNA 1UP4A 5A3JA 4FR5A 5JAMA 4IJKA 1OC2A 2AW5A 2X9VA 4LMPA 1XWFA 3KUXA 4IUYA 4CLEA 2RH8A 1HDOA 4BNLA 1XQ6A 3ANNA 4FD3A 2W90A 3O9ZA 3DFZA 4HX5A 1HZZA 5JO9A 1SZJG 3GVIA 4WASA 1JW9B 1RYEA 3B1JA 5A4DA 4EUFA 5C3MA 4A73A 2X0IA 3CINA 1IUKA 2VN8A 3DBRA 4MVJI 2F00A 1HLPA 1YJQA 3DEYX 3RU9A 1ORRA 3BMCA 4GGOA 4N18A 2RHCA 5JBIA 3JQAB 3E9MA 3WQQA 1ONNA 4IINA 4W4TA 4CMHA 4UULA 3KVOA 1GYQA 3SJUA 4D0SA 4DGSA 2GR9A 4PZEA 1VE9A 3IS3A 4DVJA 1BHSA 3KXDA 3JQ8B 2HU2A 2D5AA 2AG8A 4EITA 4NZ9A 2Y93A 2FSVA 1PX0A 5FEUA 2A94A 2CDAA 2JFHA 5F5LA 1MFZA 3BTVA 3MTJA 1A72A 2PH3A 3I9LA 4E2XA 5IZCA 1E5LA 2DUWA 4WECA 4XGKA 1E7WA 4E13A 2GZ2A 3HN7A 1BG6A 1FMCA 1ZEMA 5THQA 1BXKA 4CM3A 2EJVA 3TZCA 3ZWNA 2Y0CA 2B35A 2EWMA 4QQRA 1BXZA 2O50A 1JDJA 3OSUA 5DNAA 3RUDA 4AJLA 4BO3A 3VZSA 4TRNA 3PJDA 1FXSA 1C0KA 4K6FA 5CEEA 1WZIA 4X54A 3QSGA 4XQCA 2BD0A 3IL2A 4L9RA 2EF1A 2NADA 1IPFA 4NH4A 1LA2A 4TWRA 4YA6A 3DZKA 3K8ZA 2IEBA 4FGWA 1HWYA 5I7EA 4OKNA 1LRJA 1N1GA 3QHAA 5BSGA 3C8MA 1SPXA 2ZTMA 4ZRMA 4ZGWA 4I08A 1YE3A 2HMTA 2YQ4A 4QEDA 4L76A 2JCVA 4UVHA 4BO5A 4GX5A 2QRKA 1NFRA 1ZSNA 5TGDA 3QWFA 5U1PA 1P31A 2FZEA 2OOSA 1H9BA 1ZZEA 3SJ7A 1A71A 1DC4A 2BGLA 1GU7A 3BTSA 1W4ZA 3BAZA 3HB4X 3K2EA 3RUIA 5L51A 1Y5MA 1MB4A 4BUCA 2JFGA 4BGUA 5HM8A 4ID9A 1MLDA 1WDKA 3AFMA 3AUTA 2BMAA 1ENPA 3CE6A 5DCWA 3GEMA 3UF0A 1NQ5A 3U9LA 3U4IA 1EQUA 3FNGA 4MOWA 3EHEA 3ZNOA 1KS9A 1K2WA 4NBUA 5IG2A 1IHXA 5L95A 2JKVA 3GRPA 3S1LA 2G5CA 4NI5A 2E6UX 4UVEA 4G2NA 3JTMA 1I0ZA 1EVYA 2I6TA 3LU1A 4FJ2A 2NVBA 4XWYA 5BT9A 1LDMA 4UVGA 2UUPA 3LZ6A 3W1VA 3U09A 2W98A 1I3LA 3IC5A 1GUZA 4TKLA 3RKUA 1JVSA 1KEPA 4OM8A 5LC1A 2GN4A 2HUNA 4JK3A 1YQGA 4UVDA 2YV3A 4OL9A 4N5LA 4WE3A 4DUPA 4BB5A 2V6MA 4DPKA 3A06A 5BSEA 1C1DB 1E3SA 3X2FA 1QYCA 4EYEA 4IJUA 2DTDA 1I3KA 5TNXA 1KETA 3ON5A 1MG5A 5IAAA 1B3RA 1EDOA 2O2YA 3WTBA 2H1SA 2OO5A 1HDGO 4WUVA 4WCFC 1ULUA 2Z1NA 1VL0A 3WMWA 2PZMA 1PJQA 1XCBA 2XF8A 2O3JA 4R9RA 2Q46A 1N9GB 2VTDA 4DWVA 1T24A 4EEZA 2I99A 2Y1GA 1F14A 3GQVA 3PFFA 4YAIA 4IDDA 2D2IA 2VUUA 3IQDB 2EIHA 3FBGA 1E7MA 2JCYA 1M75A 3BA1A 3HFSA 2OP0A 3NYWA 3RBXA 1Z73A 4S3MA 1BVUA 3Q6IA 2ZYAA 4OO3A 4YTEA 4FS3A 2BGKA 3DOCA 1NYTA 2D59A 3CXRA 3Q1LA 4O5OA 4TRRA 3HDHA 1LC0A 4MP3A 3S2FA 1I36A 1IOLA 1I2BA 1A9YA 2X5OA 3IIEA 4XYEA 1E0DA 3HUDA 4CUZA 2J5QA 1Y7TA 1U8XX 1I8TA 3CZRA 3DZGA 3NJ4A 4ZU3A 3GHHA 3UGKA 1DFHA 3AJRA 3GT0A 1R15A 3FCOA 3DC2A 3MOIA 4JCOA 4KTVE 5G4LA 3ONFA 1DJNA 3F47A 3S2IA 4NHEA 4TVOA 2X0NA 2I66A 3GC6A 3ONDA 4UAGA 1YL5A 5F1PA 1HKUA 3ZW8A 3RROA 1YS4A 3I6QA 1M6WA 5L40A 1HETA 2A92A 3F6YA 4EZBA 3JD3A 2VCYA 4ZQGA 5AXAA 5H83A 4H15A 2AQKA 1VL6A 2X0JA 4NQZA 3ST7A 1ZSVA 1I30A 5DP1A 4CMCA 3RJ9A 1B8UA 1EFKA 3K31A 1XKQA 1YB1A 4CV3A 4XQ9A 1YB4A 2Q49A 4PLZA 3T7CA 3TZKA 1UP7A 2FN7A 3CMCO 1W0CA 3BTOA 3PPIA 4FJ0A 4WK6A 4WJZA 3PLNA 4XYBA 4GX1A 5ADHA 4NFHA 4CLXA 3EC7A 3OIGA 3AI3A 5DCYA 1IHYA 2PKRA 1PS8A 2HMSA 1PQUA 1XQ1A 1EE9A 1R6DA 1L7DA 4E32A 3ITDA 4D79A 3ETDA 1HL3A 4WPGA 2GERA 3W8FA 5JDCA 2JHFA 4O0LA 3PP8A 2PTGA 4FBGA 5G4KA 3GGPA 3RVDA 1K6IA 4A2CA 3JYLA 3DBVO 1EUCA 2EP5A 4IMPA 3R1IA 4BQPA 3GVHA 1YGYA 4GH5A 4RPLA 3E5MA 5DCUA 1QV7A 5KNLA 4JP2A 1K0UA 5ITWA 4YJFB 4IDAA 1E6EA 1UAYA 1Y8RB 4MDHA 5DP2A 4QO8A 3V2GA 4A27A 3DHNA 2EJWA 1LDBA 4RCVA 4BO0A 1LSSA 4EBFA 5BSHA 2NU9A 3MTGA 1B8PA 2AQHA 1RYDA 4IDFA 2HRBA 4B4VA 2CD9A 3P7MA 5ER9A 1NWCA 1B7GO 3GEDA 4C7KA 1PS9A 5KVQA 5ICSA 3WS7A 2NTVA 2QHXA 3RC1A 1L1FA 1LC3A 1CEQA 1U3UA 2VTEA 4PG5A 3K92A 4RQTA 3I4CA 4E31A 4Z9FA 5JNLA 4CLRB 4IGFA 4R51A 2OZPA 3IOYA 5JMWA 1DIAA 4CR7A 5JCJA 3H2SA 3OM9A 4PLPA 9LDTA 1YQXA 1WAMA 5CEJA 4TZKA 3C24A 4FN4A 4H7PA 2CVOA 3DBLA 3C7AA 3GZNA 3QVOA 3MWEB 4NJOA 1DAPA 1FK8A 1AE1A 4XEHA 3CMMA 1GTMA 3UAGA 3PI7A 2JD1A 3FNEA 4WLUA 1OAAA 2QZZA 3WYEA 6ADHA 5AVOA 5TQVA 1YOVB 4BNFA 3HB5X 4DREA 3R3JA 1YWGO 3DDNA 4NFSA 2IXAA 1UXKA 4CM6A 1H6BA 5EMHA 5L7TA 1BSVA 1VKNA 3ZV5A 1XG5A 2FR0A 2DC1A 3QY9A 2DPGA 2AG5A 2WYWA 3GVPA 5I7VA 4U6QA 4NK5A 1LBEA 2C82A 4WEQA 4NK4A 2IODA 1LRKA 4ZD6A 5FI5A 3QWBA 4J49A 3AY3A 4ZQEA 4I9UA 4NG5A 2OXIA 3VH4A 5KVVA 4IGEA 3WXBA 4J0EA 3BYZA 3KTDA 2Z1MA 4JJIA 2JAPA 1N8KA 2CZCA 4R54A 3IJRA 3L4BA 1G1AA 3ZWPA 1F17A 3K73O 4MVJE 2ZQYA 4TKMA 4EEXA 4Z6KA 4TSKA 5HRUA 2UUOA 1NBOA 5TS3A 3FR7A 3VVCA 2CF5A 1C0PA 3ICCA 4L75A 1ISJA 2V6GA 2PD6A 2GO1A 3NTRA 1DB3A 3PYLA 3JQBC 3N7UA 2A4KA 2H63A 1E92A 3D5QA 4OOEA 4NPCA 3GGGA 4FOOA 3EYWA 3DAGA 1NQTA 1G0OA 1ZO8A 1U7HA 1WXDA 2B4QA 3D7LA 1GR0A 3IJPA 3GDFA 3OJEA 5B37A 4ZJUA 5J23A 3KETA 2DKNA 2O2SA 3CPSA 2D1YA 3INTA 2HMUA 3TFOA 1HE4A 3FWZA 3ICPA 3L77A 3PZRA 4CQMA 1GYPA 4UUOA 3UH1A 2OUIA 3WLFA 1HDCA 5B12A 3RUHA 3EGOA 2H9IA 1BW9B 1LLQA 1H6CA 4WLVA 2WM3A 4ONEA 5KWEA 3CIFA 2J8ZA 2V7PA 3QVXA 4OSPA 2NU6A 3H9EO 2BI7A 4MINA 3GR6A 1CYDA 4I5EA 4YWJA 1ZK4A 1HXHA 5IZ4A 3WWZA 3RBZA 3VOSA 1SAYA 1EBUA 2HK7A 5I7SA 1UXJA 1YL7A 4KTTE 3WGZA 4CM5A 2AMFA 1E6UA 4KMSA 4E12A 4Y9DA 3GHYA 2J5RA 4ZA2A 4D0RA 4DBZA 3TFQA 4Y67A 3PGJA 4CQLB 2CVZA 1F8GA 1U5AA 2ZJ1A 2C2XA 1XHLA 4L4SA 2EERA 3H9UA 1LU9A 5A5EA 4WNIA 3RSHA 4JXKA 3VH3A 3WSWA 4LVCA 3ZWAA 1NVTA 1P1IA 3JQAD 2HJSA 2HLPA 1ZIDA 1GPDG 1H6AA 1LSJA 1E3WB 3L6DA 1I10A 3MJSA 4JQCA 4R69A 3RFXA 5A9RA 3DB2A 3VVBA 3WGIA 3A28A 3TJRA 1Z7BA 4CMIB 4QFDA 4ILKA 4HV4A 4J90A 1JN0A 5JXWA 3NDRA 3WG9A 3OQ6A 4CM9A 1ADFA 3U0BA 4MKRA 1O5IA 4XGNA 1N2SA 1T2DA 3ABIA 3IAHA 1PTJA 3NV9A 4GL4A 3PRJA 4JNKA 3JD4A 2HSDA 2DBQA 3VPXA 3OHSX 5EJ2A 3ROQA 7ADHA 3W8DA 5LCXA 1C14A 2ZCVA 4F46A 4BO6A 4AL4A 5L4NA 2GASA 1Y5RA 1TEHA 4NBRA 4Y6PA 3ZNNA 1R66A 1LDYA 4UVIA 3H65A 1ISFA 3A4VA 4XKJA 1DFIA 3PWZA 4IIVA 4ZHSA 5HWSA 2EKLA 1U8FO 3HE3A 1K6JA 2IYPA 2ZTLA 1ULSA 3H9QA 3O4RA 5CHEA 1W8DA 2AEJA 3OEYA 1H5QA 1ENOA 2PNFA 3DBHB 1P3DA 3H7AA 4NIMA 1QKIA 4L73A 2VWQA 4ZN6A 1E1KA 4W9NA 1E6WA 4LW8A 1PJ2A 4EDFA 2G0TA 1WNTA 3B70A 4OSOA 3P2OA 5L7WA 2C59A 3GMDA 1T4DA 3PVZA 1SBYA 3ASUA 4RL6A 1JAXA 3AM5A 3TL2A 3GY0A 3ZNPA 4KP7A 1DRVA 3GGOA 4PG8A 2X6TA 1O9BA 4FB5A 2Q1SA 1I24A 1E3IA 1OC4A 4JBGA 3FF4A 3WYBA 2VRCD 1J0XO 4YRDA 3ROKA 5FF9A 3WLEA 4BMSA 1GQ2A 1U3WA 4YVFA 3SLGA 1PJSA 3IMFA 3TQHA 4K28A 4M54A 4P38A 4L4RA 5KJCA 3ETGA 4XB1A 1TA4A 5C5IA 3RC2A 2PK3A 4YACA 3QP9A 4B3IA 4AJ4A 4MVJD 2P9CA 1LI4A 4IS2A 2BH9A 4MVJH 3ZWVA 2C5EA 4G81A 2VUTA 5IDXA 3I1JA 3S55A 3DOJA 4GGPA 1PJ4A 4JGBA 4QFCA 3BMNA 4HKTA 4IJVA 4NMHA 3I23A 1XDWA 3BMOB 1PEDA 3QE3A 5F5NA 3NT2A 3GFGA 3G49A 1R16A 2W2LD 3LT2A 4N54A 2AE1A 3H4VA 1EK6A 1JWBB 1U4SA 2NM0A 3OIFA 2YHUA 2ZTVA 1T2FA 2HJRA 1A7AA 1WZEA 1UXIA 4J9UE 2ZB7A 3FTNA 3Q3CA 1HE3A 1WDLA 1QRRA 1Q0QA 4KUHA 3FD8A 4P22A 1K5HA 3K6JA 1V8BA 1JLLA 2WDZA 2EGHA 2NLOA 4EJ0A 1FF9A 3UFXA 4YAEA 4IQGA 1GQQA 1P9LA 4XCVA 4GMFA 3H9JA 3M1LA 3PJFA 1QSGA 2ZTUA 4HXYA 1GEEA 4RF5A 4F6CA 3JQ7B 4Z0TA 3PWSA 4J16A 4PVCA 1T1RA 2YDXA 5IFLA 5BQFA 1PZFA 1H93A 2H5LA 1Q7CA 3BTUA 2C7VA 4OQZA 4BNZA 4WLNA 5A5FA 3G1TA 1DXYA 3NT5A 3PLRA 4INAA 4MVJA 5JAIA 1E3JA 4IQ0A 1PSDA 3K5PA 4Z9XA 3WFJA 3I9KA 1O89A 4NNJA 1IL0A 2FSSA 4H3VA 1MA0A 3KBOA 4R3WA 5F3RA 2B37A 1MC4A 1DIBA 4YJHA 3OFSA 3X2EA 2PFGA 3D3EA 3MJVA 5JPIA 5AXDA 4UUPA 1UUFA 2VNAA 2O4CA 2B4TO 3IP3A 4FJ1A 2OGUA 3DR3A 4BNGA 1KYQA 1DC6A 3L9XA 2ZJ0A 3TZHA 2DFDA 1OI7A 3LYLA 4M49A 1HEUA 3DFUA 4Y6RA 4QT0A 1A9ZA 2FPPA 3KEQA 3OEWA 1C3VA 3JYQA 5G0SA 1VPDA 4ND2A 4BMNA 1P44A 2OP1A 1E7SA 1LSUA 1P0FA 4CV0A 2BFOA 3EVNA 3B6ZA 1ZBQA 1Z45A 3HQ4O 4IPTA 2ZK7A 1IY8A 5T8KA 4E5PA 5T57A 4RPHA 5JO0A 1B14A 1NTOA 4GVXA 1BVRA 1PJLA 2YYYA 3EZLA 3HG7A 3O8QB 4ND5A 3V1TC 1AUPA 1DO8A 1Y8QA 1KY4A 3EK2A 1VLLA 4R1NA 1SB8A 2VYVA 1DFGA 3TOXA 3WGTA 1BXGA 4R1TA 4BMVA 3ZU5A 4DXHA 1V3VA 3RC9A 3KB6A 4YT2A 5G0TA 1YQDA 2VZ0A 4B3HA 1NPDA 5A04A 3VPHA 3LVFO 1BRMA 5CP8A 4GLOA 4GAEA 2B36A 4QECA 2JL1A 4BKUA 4CM4B 5KKAA 4R01A 4HFRA 2VHVA 2WEKA 4R1SA 3KV3O 1GYRA 5DN9A 1J4AA 4A26A 4BS9A 3GK3A 4E33A 4J4BA 4J2OA 2BF7A 2DTEA 4QUKA 4IS3A 4D44A 4U0KA 3DAPA 4AJIA 2BFMA 2NTNA 2I3GA 5HA5A 4AJEA 5TLSA 5HS6A 3GNTA 4E5MA 3ZV6A 5GMOA 3BMQB 1AXGA 3SC6A 3VKVA 2FOIA 1L7EA 1FDTA 2QQ5A 4WCFA 4P4GA 1JVBA 2GLXA 1WP4A 2HCTA 3DMTC 5T8KC 5I9LA 3UOGA 1UZNA 2IZ1A 5JAQA 3BHIA 3ZDFA 3KYCB 3KYBA 4D42A 2V6FA 2HQ1A 3KYDA 4RVUA 3B20A 2HMWA 1EEHA 3Q9NA 4ND4A 1X1EA 2GZ1A 1LX6A 4U6SA 1HE5A 3UCEA 4CM1A 4FSHA 4DIBA 5CG2A 3HSKA 4R41A 5KJEA 4WOKA 4Q3DA 1FDSA 1XIVA 1GZ3A 1OZAA 1R4MB 3TL3A 1P33A 1NR7A 5TT1A 1X7GA 1WMAA 2AEMA 2YHIB 2DU8A 2O23A 2OBYA 5ENVA 1YDWA 2LDXA 1WPQA 2JD0A 4Z0HO 2GN6A 4AJKA 4BO4A 3D64A 2OHXA 1DHTA 1DIRA 2Y68A 1PGNA 1F06A 2NU7A 1GCUA 1SNYA 3PQDA 4G65A 3RWBA 3KHUA 3PHJA 3ZWOA 3H8VA 1T26A 3ENKA 5JLAA 3T4EA 1C1XB 1QV6A 5C37A 5A9SB 1ZK3A 2CVQA 5L4SA 4DLAA 4R1UA 1HZJA 1XLTA 3DO5A 3CKYA 3DZHA 2Y66A 3E5RA 3GVCA 5CDSA 2R00A 1CQIA 2YV2A 1G0NA 3FN4A 3RAJA 4BNYA 1NHGA 1MUUA 1X7DA 4BQRA 4IZIA 3NTOA 4U7WA 3DZFA 3D3WA 3JQ6A 3SLKA 4E5NA 5ICMA 3LLVA 5TIIA 3AOEC 4NBVA 2C5AA 3JQGA 4J7CA 1NFQA 3WJ7A 1HDZA 5G2OA 4PIVA 4JJFA 4RZHA 3R0IA 3AY6A 5A06A 4ZVVA 5K6AC 4D7AA 4CM8B 5JFOA 3U3XA 2CDCA 3VDRA 3T7EA 2DFVA 5T5QA 1GD1O 1OFGA 1KVQA 1PR3A 2VWGA 1KIFA 3K96A 3DQPA 3F1KA 1H2BA 3MJTA 1ZJYA 3MOGA 1H9AA 4ZQHA 2J5KA 4RPJA 2V6BA 5DBIA 3GUCA 3D4OA 4KQWA 1IYZA 1EK5A 1J6UA 3QW2A 2Q99A 2VYND 3U4HA 3UW3A 4RLSA 4BNJA 4PFJA 4FPXA 4AFNA 4HADA 3I83A 4CR8A 1UAGA 4IMRA 3WFIA 2NQTA 3RI3A 2WE8A 1ZH8A 4BVAA 3DBRB 1LXCA 2GZ3A 3BMCB 3P19A 3QWIA 2EW2A 4A5OA 3AW9A 3I6IA 2WD8A 2R00C 4ALJA 3JD1A 1HYEA 4R68A 5IDQA 1EE2A 1KEUA 4WLOA 1QORA 1KERA 2WD7A 3WGGA 1ZXBA 3LQFA 4BHTA 4RPKA 1LLDA 5HBRA 2HRZA 5KJ1A 1KY5A 3GN1A 2GSDA 4MVJF 2BFPA 1WWKA 4YYZA 5BNFA 3LT1A 4GQAA 1U4OA 1WVGA 2J3IA 3ULKA 1TT5A 4CL3A 4WLEA 4J43A 3FSRA 1A7KA 1MC5A 1N92A 1ADCA 4UEOA 2QX7A 3BHJA 3LC1O 2PZJA 2PWZA 1O95A 2D0IA 4AJJA 5TRTA 1F12A 4BGIA 3OJ0A 2C20A 2NTJA 4YEDA 3WX0A 4OMUA 1OBFO 4LGVA 1JAYA 3W4KA 3PHLA 4EJ6A 4K9DA 4OXNA 1DJQA 2QYTA 4CMGA 4DMMA 4EI2A 2ZB4A 1CIVA 3D5TA 5BSFA 1DC5A 3SEFA 1B26A 1NM5A 2Y1FA 3F9IA 3HDQA 3M2TA 3FWNA 3H5RA 4PZCA 4YJGA 3F5QA 2D8AA 2O3SA 2QRJA 4TRMA 3H5NA 3VH2A 4PG7A 1ISHA 1B16A 3A14A 3LC7O 3MWDB 1V35A 4YRAA 4ZICA 4R5MA 4R4JA 5GZ6A 4R9SA 3JD0A 4PLHA 3JQDA 1BDBA 3HN2A 4EW6A 1Z75A 3MEQA 4ND3A 5F1OA 3ZH2A 5KIAA 1NWHA 3FRJA 2B4RO 3MJ4A 2BRUA 3NT4A 4DL9A 3WOHA 4BO2A 5TSDA 1YJ8A 3F1LA 4PCVA 1AN9A 2GF2A 2NNLD 4JJGA 4C4OA 3PJEA 5B4VA 2EV9A 2PY6A 3PK0A 3TF5A 1SO8A 1N5DA 4GI2A 4ZQBA 3TZQA 3ZU3A 1T25A 2LDBA 2I65A 3HDYA 1B0AA 3JQ9A 3JYOA 3O26A 1NVGA 1P74A 2A35A 2G76A 4Q3BA 4E6PA 4P4NA 1P0CA 2R6JA 1UDCA 3JQBA 4JP3A 1HRDA 1MFPA 4J4TA 5TJHA 2VUSA 1QLHA 4UEKA 5IXSA 3HFGA 2X0RA 1I3MA 1M66A 3Q0EA 1A27A 4FFMA 3TNLA 3WWYA 5KTKA 3COSA 8LDHA 5DZSA 2NVUA 1HSZA 4XIYA 5EESA 1X13A 2VT3A 3ZV3A 4XDYA 1E7QA 2JFFA 1PL8A 4XGIA 5I8ZA 1HYHA 2CF6A 2EW8A 2VHZA 4GX0A 3QA9A 2GUGA 1DPGA 1KVTA 3GNQA 4LISA 3SX2A 1PIWA 2NWQA 1O6ZA 1Y6JA 3GOHA 2W8ZA 4OAQA 3PTZA 4A10A 4FCCA 3L9WA 4FFLA 5JCXA 4UUMA 4XJTA 4BOYA 5KOIA 1DRUA 2YDYA 5DBFA 2G1UA 3E48A 1Q7GA 4L0QA 1BWSA 3WTCA 2AQIA 2JCXA 4RJTA 4E3ZA 4FFNA 3RC7A 3TOZA 3VC7A 1TI7A 1NAIA 2YW9A 3OIDA 3QWHA 2X7HA 1NFFA 1UJMA 2JJYA 4ZRNA 3EVTA 4IJWA 4BNKA 1HSOA 1MV8A 4Q39A 4Q3CA 3PHIA 3V8BA 1U2GA 3JQ9C 5BNIA 5A9TA 4CLOA 3EDMA 1U7TA 4D46A 4IZHA 1W6UA 4XJSA 2PZKA 2X1HA 4GSKA 2DLDA 3L07A 2EKPA 2Q1WA 4J1TA 2ZB3A 5CDYA 1QP8A 4RLHA 3NGXA 3PXXA 1X0XA 1ADGA 1DLJA 4DTIA 4RVDA 1QLJA 2J3KA 5DOVA 3GPIA 3OH8A 3PQEA 3EUWA 4FDAA 4IDBA 3PYMA 3TWOA 3WQRA 3ZWXA 2XXJA 3U4DA 2Q2QA 2Y1EA 4OYRA 3NUGA 2VNSA 1VJ1A 3ZHYA 1XSEA 4XA8A 5A1TA 4I5GA 1Y9EA 2A9FA 1XA0A 3Q2KA 2Q1UA 4I5FA 4NJMB 3EMKA 2GCGA 3K30A 1U9JA 4BL5A 1P1FA 1EMDA 2W2KA 3DXFA 3I3OA 4GKVA 5IJZA 4CPDA 4J6FA 3VPGA 2UVDA 5ES3A 2PH5A 5COAA 4TZTA 1P77A 1ZKMA 4YQYA 2YZ7A 4MKXA 1GEGA 2GPTA 2AQ8A 3L6EA 3OETA 4GX2A 4KWIA 3VAZA 1B3BA 2YFQA 4M86A 4Q9NA 1ZK1A 3ZWYA 2B5WA 4YRBA 5ILGA 1PGQA 3S8MA 1GZ4A 4CODB 1LDEA 2CSUA 2X86A 3C85A 4NBWA 3RUAA 1O8CA 3FI9A 4M8SA 4W7IA 5DOZA 2NSDA 3ZCXA 4J7XA 1GV1A 3JD2A 3AWDA 5G4KB 2GYYA 4CMEC 1DIHA 3ENNA 4FQ8A 5JAZA 2BLLA 2Y1OA 3HJAA 1PL7A 4YBZA 4IXWA 4DQXA 1PR9A 1P1JA 2VWPA 4DIOA 2X9NA 1PU2A 1ZFNA 2CFCA 4TRJA 4J4HA 1NPYA 1FDVA 2IDZA 5JY6A 4I9HA 3ANMA 3EZYA 1MX3A 2DBRA 1GL3A 2O3RA 4D43A 4NBTA 2ET6A 3A9WA 2O7QA 2F1KA 2C29D 1PGOA 4J1SA 3GFBA 4GSLA 4NU5A 3BZUA 1MG0A 2FZWA 4B7UA 3ORFA 4XB2A 3ANLA 1N7GA 4PLFA 1O0SA 3KOUA 3N58A 1T1SA 4AVYA 4WGGA 1CJCA 1MXHA 4PLTA 1P45A 4BO7A 4CUJA 5COBA 4UREA 3S2GA 1EFLA 4LSMA 4OH1A 2I5PO 2ILTA 4R3NA 3V5NA 1YBAA 3DBLB 4Z9YA 1SOVA 2Y0EA 3GZNB 2GGSA 3RBVA 3WICA 3M1AA 3PWKA 1LUAA 4K6CA 3JQAA 5F1KA 1TLTA 3QLJA 5AYVA 1T2AA 3OBBA 4WEOA 3CZMA 4Q3AA 3PHGA 5KVSA 2SCUA 2O3UA 3PZBA 5TX7A 1PZHA 2WJPA 5K0ZA 2IYOA 4ALLA 1CETA 1HDXA 1R0SA 2CY0A 1S7CA 2RHRA 1VM6A 1AHHA 3JQ8A 1D1SA 3ZZNA 3AUSA 4C7JA 3GA0A 1XGKA 1RJWA 3UICA 4ALNA 3CTMA 3TDKA 4PRLA 3KLPX 1DHRA 2DTXA 3E82A 3G17A 4BKQA 1Q1NA 5EIOA 2XPCA 1HT0A 5DT9A 1HDRA 4MIOA 4DLBA 1GUYA 1Q7BA 1WW8A 1M76A 4PLCA 2DPHA 1ZSYA 2C2YA 3NKLA 3GG2A 1ENZA 3RKRA 5KVCA 3GZ4A 1DAOA 2B69A 3B1FA 3C7CB 4U8GA 1Q0HA 2B83A 4Y98A 4PLGA 3RJ5A 1I2CA 3UCFA 3ONEA 3RUCA 2FY8A 3D4PA 3LK7A 4J0FA 1W73A 3GPDG 1PJCA 5JE8A 4D41A 2GD1O 1E7RA 2O4UX 3WMXA 3RQSA 1GUFA 1U3TA 1JKIA 1QYDA 4XYLA 2E4AA 4PLVA 1F0YA 1DDOA 4AICA 4JBHA 4KQXA 1D8AA 1SEPA 1FDUA 4HFJA 3FPLA 4GMGA 1JA9A 4NDNE 1U3VA 1E1LA 3WQSB 3C7DB 1V3UA 4FFOA 3WBBA 4PN3A 3OECA 2Y1CA 4IDEA 1XR3A 3FNHA 1V9LA 4BO1A 3FBTA 2B5VA 5JC1A 3S2EA 4RVHA 1SOWA 2GN9A 3QIVA 4Z3DA 2C7GA 2UAGA 2FHSA 1K6XA 1VJTA 5TT0A 1Z74A 1ONPA 2EEZA 3OJOA 3D1LA 2FR8A 2Z5LA 1I32A 4CQMB 3M6IA 2PZLA 2PA3A 2UDPA 1GQYA 1SC6A 2ZB8A 4YT8A 4RF2A 3WDSA 1PZEA 4CL8A 4JROA 2VRCA 1T2CA 3HDJA 4BGEA 3EW7A 3ROMA 1R4MA 2Y99A 3IKVA 3G3EA 1WLYA 2HK9A 1TVEA 3ZWWA 2Q45A 1YDEA 5I7FA 3WR5A 4GLLA 3LT0A 4HUJA 5CPFA 1B15A 1AGNA 3O38A 2QRLA 1LDNA 4IXTA 5FYDA 4BNVA 1HTBA 1I01A 3F4BA 2VHXA 4A0SA 4YT5A 4CLDA 4CJXA 3VPSA 2W2LA 5A02A 4PRKA 4Y6SA 1AXEA 3FHLA 4MIEA 4MIYA 4Q3NA 1PQPA 1CRWG 3LC2O 1C1DA 4LVUA 4CMJA 5IF3A 3EY4A 4FW8A 3GDOA 4CMBA 2Q4BA 2RAFA 2D5CA 1VKOA 2O7SA 1E7YA 3VTFA 5G0VA 3ZGYA 3VPFA 3VZQA 1EZ4A 1EUDA 2FR1A 3MJCA 1CERA 1CQJA 3PJGA 1IZ0A 1LSOA 4ESOA 4AJHA 2Y05A 3WYCA 1JWAB 1PQWA 4HP8A 1N9GA 3GF4A 1I5RA 2QG4A 4E4YA 5JS6A 2VT2A 1HYGA 4DPMA 1RM3A 3HWRA 3CSDA 4CM8A 4R16A 1VSUA 2PV7A 4XIJA 3U49A 2NVWA 3AFNA 5C7LO 3DMTA 2DAPA 3R3SA 1U28A 5CG1A 4KOAA 4AJ1A 3AU8A 3QVSA 4I8XA 3QWAA 4J1NA 3MZ0A 1SMKA 4KDFA 4PGFA 4B7XA 2P4HX 2PD3A 3FTPA 5ITVA 2XOXA 1YRLA 2NV6A 4RQUA 4RDIA 1OMOA 1K3TA 1LLCA 5K9ZA 2CUKA 2IE0A 4Q3EA 4CUKA 1R0LA 1NNUA 4O63O 3AK4A 3V2UA 1MP0A 5EL0A 3VZRA 4O6VA 5JY1A 3JQEA 4BNTA 1ZEJA 4LN1A 3LLSA 1KBZA 3KZVA 3IP1A 3NJ8A 1D1TA 3TZ6A 1YONA 1XYGA 2C07A 2X8LA 4MKZA 3H9GA 4Z3KA 4R5HA 1XEAA 1EUZA 3QRWA 4L74A 1PJ3A 1H6DA 1EVJA 3UN1A 5IN4A 4WOJA 3GAFA 1R4NB 1GY8A 1ZMTA 1PWXA 3RU7A 3DL2A 1NASA 1KC1A 2P4QA 4OHUA 3H6KA 4E2YA 4YCAA 4ND1A 5I9MA 1X0VA 4FC7A 4DA9A 2FP4A 1LTHR 2IZ0A 1ISMA 3WB9A 3JQFC 3HHPA 3Q2IA 2UYYA 4GWKA 2AEFA 5EPOA 1ZUD1 3AOEA 5CDGA 1HE2A 3E18A 3HZZA 4H16A 1X7HA 2HKIA 3JYNA 1HF3A 5EQFA 4EGFA 2YJZA 3LSYA 3QVTA 3UXYA 4YT4A 1ZMOA 8ADHA 5T64A 3IKTA 3CUKA 3RUEA 5K6AA 4B4OA 4OQYA 3WBFA 4CV2A 1XELA 2E48A 1BMDA 3JV7A 1A5ZA 1T4BA 4B4UA 5JYDA 3GNSA 3WNVA 3INRA 1DSSG 3BMNB 4N5MA 2DBVO 5AXBA 1G6KA 4DQVA 5GZ3A 1WMBA 2OFPA 2BFAA 1ID1A 1ARZA 2Q50A 2YFHA 5IDWA 4YJFA 2O48X 2FMUA 1Y8RA 1YXMA 2BKAA 2G82A 1YH3A 2R2GA 4YR9A 4M55A 4XZ3A 4ROSA 4E21A 4MP6A 2DUUA 3E1KA 2Y67A 1H0KA 3OMLA 1VL8A 1VSVA 4BIIA 1UH5A 3DOOA 2X9GA 2UV8A 2NU8A 4J1QA 5L3ZA 3DZJA 1KEVA 1FJHA 4J91A 1V6AA 2ZYGA 3F5SA 4OGWA 5EERA 3M2PA 3KSDO 1J49A 1S6YA 4CLRA 4P8RA 3E6AA 2G17A 4FC6A 2OMEA 3OA2A 1DBVO 1B8VA 4OKIA 3VTZA 1LQUA 3ZNQA 3LF2A 5EN4A 5MDHA 3ZV4A 2I76A 4QXMA 4N7RA 3FNFA 4AG3A 1GPJA 1EDZA 2AA3A 1C0LA 1D3AA 5IZCC 4BNWA 3VH1A 2Y0DA 3IUPA 4WNCA 2TMGA 3TPCA 1R12A 4JIGA 2VOJA 4IIUA 2PKQP 4LSWA 4U5QA 5JMPA 3L0DA 5JC8A 1RM4A 3UHAA 1YOVA 3KM0A 3DTTA 4EUEA 4E5KA 2HK8A
chains in the Genus database with same CATH superfamily
3W06A 4YIKA 2YYSA 1ODKA 4XE5A 2EFYA 3QJ5A 4AY3A 1DUVG 3NEPX 5EJ7A 3QI7A 4E2ZA 1TTPB 4GYKA 4O59O 2Z2KA 5EWMA 3T61A 1U7WA 4PZDA 4XUEA 4HWPA 3TQCA 2OCBA 3UJ6A 3QMWA 4JDUA 5I4CA 1EB8A 4CF7A 3O2SB 4BEWA 1SXJB 4I36A 4NEQA 2VR1A 5ALGA 3NVDA 4S1VA 5IYZA 3K20A 4UEJA 1TCAA 1VC2A 1Z2EA 2RCYA 2VDWA 3FNBA 1Y1QA 3I52A 3K9CA 4ZAVA 5FIUA 3DHYA 1XTZA 5ED0A 2H9AA 4Q21A 2WWTA 1UJ5A 2BDTA 5DM60 4LTMA 2FB9A 1SQSA 1W85B 3FPCA 4OXQA 4ZO4A 1XZFA 2OPHA 1I5EA 2HO5A 4DR1B 2EGGA 2V55B 4XVRA 4ZEXA 4EJSA 1A5SB 3V6LA 2V7XA 3ZTTA 5A7FA 5KYGA 3I28A 3OFND 1Z47A 4EO9A 2W6IA 3DO6A 1E9DA 2Q0QA 3C1AA 5BN4A 4CM7A 4LY6A 1BX1A 3ZTWA 1Y8QB 3WO1A 1J70A 1RDFA 4FHGA 1ZGJA 4MO2A 1P0IA 3E2IA 5KTNA 3RF6A 3D2AA 2B3TA 2RGGA 2P35A 4FVTA 4FN5A 2PO5A 3U37A 1YKFA 1ORDA 2YWHA 2PKYX 1W0KA 1ESCA 4LJ8A 3F4KA 3QPCA 3B36A 2I2FA 5CA0B 1RAFA 3I9OA 4ZT4A 4C7MA 5CK5A 4KACA 5FUMA 2X58A 3GLHA 1Z0FA 1YL6A 4E88A 2YMMA 2GRUA 2VT7A 4O4IF 3HADA 4PZZA 3SMQA 4CMKA 5CDUA 4JAVC 4GG1A 2V5UA 3C1UA 1XTRA 4RD0A 4ZK2A 1WUTA 4HMPA 1CS0B 4L4UA 3ROTA 1MQ8B 1NVFA 1SN7A 4B40A 1QH0A 3G8CA 2RHBA 1WSDA 4DR5B 2IY8A 3DCJA 2XTMA 1JHQA 4UOQA 2ZIWB 3DTNA 1ZNQO 5E6UA 3ZUGA 3PU6A 4EHAA 3T38A 3LPDA 4Y9TA 1D7OA 3DDSA 4KRGA 3U7GA 3X3HA 2VYNA 4NJMA 4MLDA 3RVSA 4IO1A 3CVVA 4QODA 5FWXB 2OO5C 2XAUA 1RJFA 2P9EA 3DZIA 2DP4E 4V0ME 2FPUA 2GNAA 1IVNA 1RVDA 4BFZA 5ADWA 4M9ZA 4OAOA 3IP6A 3W9YA 3PXGA 5CCEA 3IALA 1HOXA 4BO9A 1XP8A 2VQDA 2PUCA 1VLVA 2ZRNA 2QP9X 1JX6A 2N1MA 3RRYA 3LM8A 4LQDA 1QE0A 4IQ8A 2AKYA 1T9KA 2EFHB 1B6RA 4FEEA 4X94A 3OURA 4GC5A 1L6RA 4QEZA 4DARA 3L79A 3GJSA 1ZNYA 1WEKA 1DKRA 3B5JA 4CQLA 4MP8A 3CWCA 3R7WB 2UZAA 4MW9A 3ZE1B 4DIFA 5LQUA 4RFLA 2O3TA 3I5YA 3KYDB 4FI3C 2ZR7A 1J90A 3CHYA 1U9ZA 1UDAA 3NHSA 4OFBA 2CNBA 1M83A 2NXWA 2QLJA 3G0OA 2JBAA 4A7PA 3PUJA 4DW8A 3HCFA 5ECYA 4E5UA 5CA1B 1E3WA 1LQTA 3A1NA 1U98A 2B1JA 5AKEA 4F7WA 1E94E 2PKWA 2NO4A 4FGSA 1ECFA 5HQJA 2I4MA 3Q7SA 3TVDA 2IDJA 3Q9UA 5E7QA 4AZVA 2DUNA 1EQAA 2QPOA 3NHZA 3VR1A 4XASA 3X44A 3NOVA 1KC3A 1XJQA 4BFUA 2YV5A 3OCJA 4ITVA 3K0AA 5CB4F 4F5WA 1Y4ZA 2ZM5A 1JA1A 1VGVA 4XLLA 4NV3A 4TROA 2DBZA 5CNIA 3GJYA 2RGWA 1YC5A 3TXXA 5JAPA 5A03A 1MB2A 3EFBA 2VPZA 4EK9A 4FZ3A 4HJXA 4M1QA 7ABPA 1J2EA 1BMTA 4D9EA 2ZVJA 3DXZA 5GIOE 1XTIA 4FZ5A 4MJXA 1CC1S 4GPZA 3OQ1A 4OK5A 1VKZA 2FKNA 2OB2A 4A91A 3MJRA 5JCOC 1C3OA 3PPYA 2QP4A 4ZI5A 4LRSB 3B1KA 4OXXA 5GINE 2YWBA 1OV4A 1UBEA 4HQLA 4G8CA 2YUTA 4RV9A 4UU0A 5SYAA 3SLRA 2DQ4A 3T9CA 3GRKA 3WDKA 1SKYB 2MINB 2IEDA 2Q7XA 4M6WA 5BORA 2Q1TA 3LY5A 2DR3A 3W6UA 1R5NA 3TFWA 3ESRA 2K2QB 3CRRA 1EEXB 4QL3A 3M33A 3T1NA 4BJ5A 1LRLA 5CDTA 3JQGB 1D4FA 5M5BA 1JSRA 1INLA 4ITUA 5CCXA 4I6JA 5JNWA 1KVSA 5JDCC 4PSUA 4BKRA 1SUEA 4FOLA 1HC7A 1M2GA 5HE9A 1AN0A 1GG8A 1ZXLA 1U1IA 3NDIA 2X0FA 4IDGA 2BFWA 2W00A 4B85A 2DHCA 3GUVA 3RQIA 4CT0A 2ZSEA 1B76A 4B3SB 5FI3A 1Y3CE 4EG7A 2GZDA 3MWFA 4FDVA 2OE2A 1QG0A 1NL3A 2VNIA 2Y92A 3NBKA 3STYA 1YOBA 2FPGA 3T9FA 3W78A 2B2NA 3SXUA 5TQ2A 2ZRIA 2NTEA 5KDDA 4KZPA 3Q11A 1FZTA 4LBYA 1N3YA 1SD5A 2BGUA 1I80A 1BTOA 3JWEA 4WJLA 5BNTA 3EVBA 1Q3KA 1VCIA 1PRYA 3KU1A 3EIOA 4R3UC 4XOUA 3HCRA 3QX3A 1CRLA 2GCOA 1JG7A 5IDYA 2IXBA 1VLMA 4CG3A 5LPNA 2WF5A 1EBFA 1BMFA 1JKJA 3QEMB 3ICEA 1SK8A 1N1DA 3QNWA 2BZSA 3GWZA 4B6FA 3HY6A 3IBFA 5DNWA 3JARA 4JJ4A 2GQ0A 3V1MA 3HWX1 5BYKA 2HLHA 1EM8B 2NSLA 4EHNA 5CGQB 4QUHA 1FBNA 1RI3A 3S68A 2UYOA 5JWHA 4EP1A 1U0BB 2I9PA 1K66A 2MOKA 3R75A 1G20A 3NDPA 5AXCA 1Z7EA 3PXAA 2R9VA 4Z53A 1M1UA 1YJAA 1JG6A 2WD7B 4GOXA 1Z25A 3H75A 4V3CA 5A3SA 5EZ6B 4ZZIA 1QTQA 4C5BA 2Y1KA 1OY1A 4CMAA 1JHZA 1CDOA 2JD2A 3KKPA 4GR5A 5EZYF 1I9CA 2YQ5A 1NKSA 2ZUSA 4J0QA 3P0RA 5DSXA 1NRWA 5AI0A 2X8BA 3I2KA 2IHUA 3SBOA 4R6WA 3QH4A 1VHWA 2RH9B 4PC2A 1TT5B 2OXCA 1K75A 3SX4A 1BFDA 2RI0A 2ZYUX 1SQ6A 2XQVA 3EWNA 3GLQA 4MRNA 1FTWA 2NNWB 3I4FA 4JZYA 4RIIA 3B6KA 5TGZA 3ZU2A 4XCQA 3C1TA 5FYQA 1EJBA 4JB8A 4RSMA 4MB2A 3IURA 3W8NA 3BUSA 4WFKA 4G36A 1LJ8A 4CM9D 2Z95A 4MV7A 4UBNA 4B6RA 4BX3A 1VJ0A 2ZWMA 4BVJA 5HFAA 5KREA 1Q0SA 3I09A 2P9GA 5J2TB 1L4BA 2WHPB 1G9TA 1N7JA 2W71A 5C9ZA 5H82A 1F0PA 1ONBA 1Y9AA 4LY3A 4NJEA 3VR0A 1E1QD 1BH2A 2FRDA 2PKQO 4G9BA 5FT9A 3W8EA 2CNWA 4YJGB 4LRXA 3CNBA 3E2MA 4CFZA 3SZMA 4U9IS 3STHA 1OTHA 2QSUA 3PX7A 2JAQA 2NO6A 1OVMA 3B6IA 4N8DA 5TE9A 2C0QA 2ETXA 1U2DA 2X4GA 3QLUC 5C80A 3GLGE 1WMSA 2GS9A 1NVXQ 3D54D 3GNLA 4BRZA 2POQX 2AFHA 3FDXA 4BVLA 2AJDA 1J8QA 5LQRA 2LW7A 5BW8A 4FFRA 4UXHA 4BFVA 4L57A 2C0CA 2WD9A 4KE9A 1TKRA 4MV1A 4NH0A 3SG0A 5JD4A 3UMYA 3DMHA 5D7BA 1NXQA 5DDIP 4KRFA 2EX1A 4W1PA 4CDGA 3KWLA 3B3FA 2WOJA 1RKVA 4D3FA 4YUYA 1GQRA 4EY8A 3EHDA 4KE8A 3AY7A 2DWUA 2QVGA 4WGFA 5E8RA 4X64B 4NDAA 2IRWA 5LL6P 4MYTA 1OHHD 3KO8A 4IDCA 1LLUA 4QSMA 3BQNB 3TAHA 3CZ4A 3UXHA 3AESA 1FNDA 1ZCAA 3CY6A 4C76A 5JDIA 1CR6A 2GHIA 5I6DA 3AM4A 1G5HA 4MS3A 3SYTA 1RPAA 5H4HA 1GARA 2CLCX 5CEFA 1RLJA 1UZMA 1ZK0A 3Q7QA 3VU8A 1YAHA 2ZYWX 1JR3D 2BMJA 3OY2A 2HZBA 4JX8A 4CFSA 1FB5A 3V2HA 1L8QA 1VG1A 3LHFA 1NPTO 3F4LA 3RYTC 1J7JA 3O8QA 2IP4A 1RHMA 4C29A 2CCKA 1IN7A 1JXMA 1F2UB 3K9BA 3M1IA 4JIMA 3KUCA 5E1BA 4WBNF 2W93A 1FBTA 2GCPA 1CF2O 2XNSA 1GV0A 3ILHA 3U4MA 4EZIA 1SVIA 2CNNA 1E6CA 3ZQ6A 2O5CA 5KKCA 2WWHA 1U7XA 1YI1A 4MUBA 4M1ZA 1RQGA 1ZISA 4HQNA 2BM8A 4K9NA 3PFBA 5D51S 2HXYA 1KAOA 3E3MA 4EUHA 1F4VA 3PNPA 1NJ5A 3MQFA 3LUPA 5LA6A 1OOEA 1AUXA 1RJ9B 2ZUVA 1W5SA 1XAIA 4RXMA 1RPZA 4F97A 3RYIA 3KT0A 4QELA 2YY5A 2W6OA 1DRWA 2GD0A 3C8HA 3KKMA 3PXCX 3UAXA 1SH7A 1TA0A 2XKKA 3VI3B 3GDGA 3S3TA 2VDUE 5JYEA 5GIPE 2FG5A 2CV1A 1B23P 4F2HA 4IM7A 4OA5A 1TZKA 9ATCA 4RD4A 2P5UA 3N2EA 4KMOA 4YXFA 1RRFA 2BZ0A 3R6DA 4XR9A 4Y1RB 4ZC8A 3WWCA 1ISPA 5HJ5A 1GPLA 4KEAA 1R4NA 4TTIA 2XRZA 1B74A 2VSXA 3CJRA 4Q9AA 4Q4HB 4ROTA 5B4UA 2KPOA 4UQPA 3JYPA 4RMGA 4WCDA 3G1UA 1GHTA 1EDDA 1E5VA 1GRRA 1T6NA 4BP1A 5BUSA 5L3QA 1O3YA 4IY1A 4LHZA 1E1MA 3DQQA 4D3DA 1GKLA 3MRVA 3INGA 1IZ9A 5EZ5A 3SC2B 3T5AA 1DOHA 2AF4C 3IAM6 1SG0A 1U3FA 4EL0A 3BXXA 4HWKA 2XA1A 4Y2HA 3QJYA 3BMQA 3OHMA 5FQNA 1XP5A 2IHVA 1DZIA 1TXGA 3H13A 2ONCA 1WBBA 1QGED 3ZHZA 1K92A 2H2HA 3D0OA 3SYRA 1I6MA 2A84A 2G77B 2VJKA 1RQNA 2A1IA 2P91A 2A3RA 2ZATA 3Q8WA 3THXB 2X5KO 4MDFA 3KYCA 1BA2A 4BDTA 4E2WA 1ZUNA 2HX1A 3IAS1 3KFVA 3LP8A 4GWGA 4KWTA 3ZWCA 5I9IA 5KWSA 4D3SA 2OYSA 4MPDA 1QXSA 4I5DA 2OBNA 4DV0B 1UP6A 4H6XA 2QI9F 1KVUA 2X77A 3O5AA 4PX5A 4YFVA 3BKWA 5K6TA 3ROZA 2ZPAA 3LZCA 4OJNA 4N82A 3BWMA 3IMCA 1UT5A 3I04M 1TM5E 2ZCJA 3DHEA 5TMEA 1DBQA 1E63A 1QYWA 1DIGA 1VKRA 2VAMA 3OP4A 4GZ6A 4HH1A 4HRXA 5EXSA 1RD4A 5C7IO 4WIAA 1YR9A 5CD1A 1FFYA 1W19A 3CLSC 3HYRA 4OHMA 2ZRFA 1S2IA 3ED5A 5ESDA 4CKBA 5IXYA 1WW2A 4E3WA 1YC2A 2YHIA 2I22A 3Q7EA 1DCKA 5BWCA 4J94A 3IUSA 5AW1A 3NB0A 2OV3A 1JU4A 4RULA 1QB8A 1S2NA 5AOVA 5A0VA 2P2YA 1IEXA 2VZLA 4O2LA 3FMVA 5F1YA 2NUTA 5KB3A 3EDCA 4TKUA 4W5TA 3P2KA 2L69A 1L5WA 5LDGA 1AMOA 1LD3A 1L4KA 5SZHB 3W4IA 4DIDA 4U2GA 4XX1A 2ZSJA 4HNHA 3AU9A 5KJ6A 1HLDA 1T34A 1AGXA 1DC3A 3IVAA 4D3XA 1DQZA 1SU8A 3KSZO 4H1VA 1C4XA 3IR7A 3OQIA 1EFRA 4NCXA 1ZICA 5EMMA 3ZU4A 3I2HA 3MJEA 4BO8A 1D0SA 1G8PA 1HT2E 1TT7A 2QAIA 7YASA 3ZJTA 3LF1A 1E3LA 1RYNA 4TQGA 1AUQA 1X2EA 3LY8A 3OE7D 2WWRA 4O4JF 1CJVC 3NDJA 4Q19A 4DNOA 4BAGA 4EHBA 2ZSKA 3OLCX 4J07A 4RZXA 4HMQA 1MAUA 2A0KA 1NY5A 1D7AA 2DPXA 3U5TA 4G86A 3QELA 3WGKA 4AJ2A 2BE7A 2IU6A 3THRA 3MJHA 4US2R 1OD6A 4G1MB 2JGFA 4R0VA 3E3AA 2YINC 4Q6BA 3VYUB 3BBLA 3WGVA 3PDJA 1PL6A 2VYVD 2ZIFA 1R10A 5HKKD 4DMLA 3G8YA 1NBIA 4R84A 1AQ6A 2OTCA 3PX2A 4JX9A 5J4VA 3GP5A 4EX6A 2PRYA 3EAQA 1E6MA 1QZUA 2JJ1A 1JTVA 1O97C 1W4LA 2NZVG 1JSCA 3KCQA 5CK4A 3GLFA 2PX0A 2FZLA 1LF5A 3DOIA 4I8DA 1NVVR 4H1HA 1E1YA 4LAFA 3MTEA 3EDYA 1YFKA 2J6IA 5TF4A 4BV9A 2FX5A 2QY9A 2AHRA 3U1BA 4TMWA 2R6CA 3GLUA 1SVOA 2ZG6A 1G98A 1TMOA 3B6MA 4HRYA 3AX6A 2PSHA 3G2NA 1TIPA 4ZIRA 1MRZA 1Y34E 3D7RA 3TI9A 2G4LA 4LMPA 1BJKA 4XUGB 5KX5B 4KLNA 3PL5A 1TMKA 4IUYA 4YAFA 1DAEA 4L9SA 1XQ6A 3FCUB 2D5BA 4LZJA 3A3OA 3WZ2A 5JO9A 3LPLA 3GCZA 1RYEA 2Z58A 3B1JA 2O2XA 1GKKA 5U4XA 4Y6LA 4BBJA 4WKPA 7AT1A 2ZAMA 4ANFA 6GPBA 2WTNA 2XV1A 4AULA 5KYWA 4OJKA 4HZUA 2PS0A 5E2IA 1HLPA 5LWHA 1YJQA 1IG3A 3FTCA 3WLIA 3BMCA 2VSNA 5JBIA 1JALA 2W6CX 3E9MA 1NW6A 4AKGA 1ONNA 2QK4A 1C7RA 1A9XA 1Y6RA 3JX9A 4J16C 4IIHA 4UULA 3KVOA 1GYQA 3ZZTA 3B3JA 3OZEA 4L22A 3SJUA 1BDHA 3T7KA 2I2XB 2JH9A 1VE9A 3JALB 3BD9A 2ZRAA 1WCIB 5FTKA 2AVDA 2IYUA 2CJYA 5BMVA 3LPAA 4EITA 1RMTA 3GBSA 2FSVA 3HHEA 1RR6A 3OZRA 4IFIA 4LMAA 4NZ9A 5AT1A 5FEUA 3KEMA 3UTCA 4LZLA 4LXIA 5AM0A 1M34B 2Q4DA 4X84A 2W42A 4PV7A 1MX5A 4OHWA 4ER6A 4KZKA 2HV8A 3EGCA 4JJ7A 5IZCA 2PH3A 4BX8A 4E2XA 1E5LA 1F6BA 4WECA 3FWPA 5A6SB 2FG6C 3S5UA 4OQDA 2G36A 2NUBA 2PL9A 4EI9A 1BXKA 4E2FA 3R3YA 2EJVA 4MGHA 4CG0A 3ZWNA 1DAHA 1GGNA 4GBMA 4CM3A 3MK31 1PFKA 3N2KA 5K0JA 1WKVA 1BXZA 2C03A 3A6DA 1R27A 1ABFA 3FFTA 1U1GA 3EXG1 4MUIA 3QIAA 1RC1A 3VZSA 3PJDA 1C0KA 5HPYB 4N3NA 4F9GA 2AJ8A 3BA6A 4E6EA 3TCKA 2PRIA 4AZWA 1C80A 1N6IA 2HUPA 4K6MA 2BD0A 3FSEA 1FIUA 4KH1A 5AVSA 3DJYA 1W94A 2BKLA 3FLEA 4N7JA 3NLLA 1FUKA 2QEQA 3ZXYA 4DCCA 4HNVA 4H7FA 1QPBA 3COJA 2L18A 4OKNA 2IP2A 3ZWKA 4JMPA 1ICIA 1TTQB 5D3QA 4I08A 2WB2A 1IZYA 1ZA2A 2YQ4A 2ZJ3A 3A05A 1QGZA 2IT1A 4L76A 3HNOA 1SUBA 4BO5A 5FV4A 1A8QA 4H3HB 1P31A 2OOSA 4TLEA 3ZHCA 1OX6A 4YI5A 3FG9A 3BTSA 1LVUA 3K2EA 2B8NA 3L0OA 2X8JA 3DMDA 4BUCA 1T8YA 4F8YA 4ID9A 1MLDA 3DVRX 1WDKA 2X1LA 3AFMA 4QOJA 1SKUA 4ZQIA 3W79A 1C9YA 1FLDA 2EJCA 1G1MA 3GEMA 3T3EA 5LQKA 1TJ4A 4LA4A 1NQ5A 3U4IA 3FNGA 3H0EA 2X5NA 4D92A 4ESHA 4IIJA 1KS9A 1QVRA 1CJBA 3EMDA 1BGWA 1KDPA 3ZK8A 4Q03A 1IHXA 5L95A 5LA6F 2A5YB 3EXFA 3P20A 1F20A 1YIOA 2G5CA 4NI5A 2LV8A 2QD3A 3ORSA 4G2NA 4ZMRA 1L4GA 3ZEIA 4BJ1A 3LU1A 4XWYA 3FH0A 1LDMA 1RBMA 2L17A 4N39A 4D98A 3K6RA 3TQRA 1P81A 4GLJA 1R4ZA 1I3LA 3FAZA 1XWWA 4DCGA 3NVKI 3A6EA 3GI1A 1JVSA 1KQ3A 3C45A 1CVRA 1IBKB 4DDVA 1A76A 2GN4A 1KRHA 4JK3A 1YQGA 1I0IA 4UVDA 5CX1A 2YV3A 1CZUA 4OL9A 3ZJYA 2W2MA 2YJ3A 2WJWA 4TTJA 4BB5A 1U0LA 3L0ZA 4DPKA 4KQHA 4OQNA 3A06A 4GOND 3II6X 1C1DB 2E9SA 1UFOA 1TM2A 2IYWA 2QN1A 3LWDA 4MUFA 4EY6A 2XCUA 3ESAA 3EGDB 4MDYA 3HR4A 4DM3A 4ZYWA 2MINA 5FWDA 3A6PC 1ORTA 2DTDA 4JLNA 3VSDA 1QGDA 3EWAA 3WMGA 4MR9A 5G3ZA 3FYHA 3EPLA 1E4YA 4G5OA 5IAAA 4X7BA 1F0KA 2ZSHA 2OO5A 3D6MA 1ODSA 4WCFC 2E18A 2AJCA 1ECGA 4HDOB 1VL0A 1BGXT 3A2KA 2H1VA 4R9RA 2FPMA 4ENTA 2Q46A 1N9GB 4ZKEA 1VKJA 3A3YA 4CRWB 4GECA 2JLXA 2I99A 2FV8A 3HY4A 2CBGA 5HZHA 3VGJA 1N3BA 3CVUA 2JI6A 3YASA 2AFIB 4QGGA 2EIHA 2Y77A 3FBGA 1RRMA 3BA1A 3MC1A 3NRBA 2OP0A 3NYWA 3ZDQA 5HZGA 5CFPA 1UBNA 1BVUA 4RTQA 1YZYA 2WLTA 2VH2A 3A9VA 4FS3A 2COEA 5KWJA 4I55B 1DG3A 2MSEB 3ITEA 4NYIQ 4JYBA 1CZKA 2JEZA 1ZRNA 3G5UA 2PUFA 2PUDA 3ZDYB 1A8SA 4GO1A 3ZTYA 2JGIA 1I36A 1I2BA 1O95D 1A9YA 2AOWA 2ZT5A 3OX3A 3UW1A 3ECAA 1GDDA 3P0EA 4LF8B 1PR6A 4QTYA 2WQ7A 2I0FA 2DUMA 1V8OA 2FWJA 3HUDA 1GDTA 1SUWA 2GKSA 1FW8A 3O8BA 5EQTA 3ZY3A 3CZRA 3P45A 3IUMA 4TV9A 3RTDA 2JLWA 1DFHA 3HU2A 2BJWA 2TECE 3W3AD 2GH1A 2VF8A 3PC7A 3WL3A 3NC1C 2RAVA 2H00A 3QKIA 4DEVA 4KTVE 1N6NA 3ONFA 2R8YA 1NVUQ 3S2IA 3WWDA 3KQLA 5BSEA 2I66A 1YMVA 1XLTC 3ZW8A 4DSOA 3IPCA 2ZS7A 4GZ3A 4MQEB 4OBXA 2IH2A 4BMCA 2J7KA 2H52A 3K3PA 1AO3A 3LBNA 5FA5A 4YRGA 1KXZA 3EEIA 2XNCA 4MGEA 3ZDEA 4MKHA 2VCYA 2YXLA 3MT9A 5H83A 5BO5A 2YHAA 3P9KA 2HN9A 3A8TA 5LIRA 4PS1A 2JGDA 3N2GB 5FTWA 1M2HA 4CMCA 1SHKA 1QUEA 3RJ9A 5IWAB 1YQUA 3EF0A 2XUAA 4XQ9A 1AKRA 2EFGA 2Q49A 3F71A 1Z2OX 1KO7A 1QKKA 2FN7A 3TZKA 3CMCO 2FP4B 4FFBA 1ZI9A 3BTOA 3OQHA 4CL2A 1ZL2A 2GBPA 1NNI1 4WK6A 4WZZA 2F3RA 4OP3A 4XYBA 1RWQA 1KWGA 2ANBA 3Q7PA 5ADHA 1RWOA 1QX3A 4TUYA 1CUAA 5ECWA 1GZUA 1JDPA 1W47A 1B1CA 2QB5A 1JEYB 1U7PA 1PS8A 4NNOA 2HMSA 4WL0A 1L7DA 4E32A 4C4SA 4C4ZA 1F2TA 4DM4A 4Q37A 1A1SA 4WUTA 5CXSA 4HB2A 2JFBA 2GERA 2AMJA 3QEAZ 3N8DA 1O9HA 3D7MA 4GLFA 4MW1A 4TV8B 5CVUA 5F2OA 5PNTA 3PP8A 4BB9A 1QIIA 1CNMA 1YF3A 1KRWA 2Q6VA 2XA9A 5G4KA 3USES 4EB6B 4IZ6A 1D0IA 1STOA 1EUCA 4XJXA 3LW7A 1AGPA 5KS2A 1QCZA 2FLVA 3R1IA 4C0WA 5JV5A 2CWDA 3IO5A 4QSHA 2HHLA 4MJ3A 1Y80A 1ZCZA 4I4IA 1S1CA 3A4YA 2H85A 4KVAA 3CEHA 4OHFA 1QV7A 1YI0A 2XUQA 4UFNA 4B6GA 1UJ2A 4JGGA 3DUWA 5DP2A 4QO8A 1ATZA 1RS0A 4GXNA 2EJWA 3RG2A 1AJEA 1ZY2A 2AB0A 2QT1A 4FGZA 2J3EA 1T8SA 3RODA 4EBFA 5FLKA 3BC1A 1JHPA 1T8TA 1P9WA 2PIDA 3UAOA 2HRBA 5ER9A 3NETA 5FH9A 2XQJA 1H2YA 1NT2A 3FOCA 2XZTA 4UTNA 5KVQA 5TARA 3QI2A 4YLGA 1PWEA 3K9FC 3RC1A 1L1FA 3VO2A 3RU3A 4RQTA 4PG5A 3CT6A 3K92A 3NHMA 1K86A 4DM7A 2QVLA 3NXSA 4OJQA 4Z9FA 5JNLA 1MNAA 3IJ5A 5DGHA 4IGFA 4R51A 3IOYA 3RABA 3SEAA 4CLRB 5CFRA 4ZANA 1DIAA 4ZDKA 2X7XA 3NAGA 3W5IA 5F2NA 3KQKA 4TYNA 3MUOA 4IV8A 5CEJA 4TZKA 3S1AA 4H7PA 4NCKA 4DCVA 2CLLB 2AJTA 2YJGA 3C7AA 3EXEA 1B41A 1X1QA 4KX5A 1V25A 3DOEA 1DAPA 4XEHA 1JHVA 3RNOA 1CHNA 3CZ9A 1VFNA 3EDRA 4HTAA 3Q3GE 4BP8A 5K8JB 2JD1A 3FNEA 4WLUA 4R0MA 2QGZA 2AOXA 2MCFA 1RKQA 1MX9A 2QZZA 5E6SB 4I46A 3DEJA 3L18A 5FFNA 5TQVA 4CKWB 5KYKA 5EUMA 4HX2A 1XRLA 3NTLA 3PFHA 4E22A 3WIUA 2V3VA 4DVGA 4ZZ2A 2IXAA 1SBNE 4IHKA 2XUGA 1F0NA 1FP7A 2G9RA 1WEHA 3CH5A 1UKAA 4OQ4A 3HABA 2DC1A 3KZXA 2R8EA 1SCKA 3TW8A 5AUNB 2BN4A 3EEQA 3JATB 3A2LA 2A9VA 3CRZA 1U0EA 4NK4A 2WYHA 1KI8A 4P4SB 5IJXA 3UGJA 2RI1A 1ZRSA 1WULS 2YHSA 4MMYB 5FI5A 4ZD6A 5I5GA 5D84A 2G80A 4YWHA 3MCAA 3QWBA 4AO6A 2O0LA 2WFZA 3VYRB 3ZHRA 3V3TA 5IH7A 1J8FA 2JS7A 1USGA 2FXIA 2FFHA 2PIAA 4IMJB 4ZQEA 2H92A 2OXIA 3VH4A 5DBHX 1PNTA 2PU7A 2H17A 4QOSA 3HVRA 3D1VA 3UYLA 1WB4A 5DNUA 5JDCA 1P8JA 3QLUA 2OBMA 1HYQA 3ET5A 3SI7A 1FXWA 4KIJA 4W1SA 2DERA 1UMKA 4GM0A 4B87A 4EEXA 3K73O 4MVJE 5BRAA 2VTKA 5HRUA 1HDEA 2UUOA 2B98A 1JIKA 2V7EA 4B0OA 5I51A 3FR7A 1UC4B 1Z5WA 2FOXA 1LPMA 1I9GA 4L75A 3TUJC 1ISJA 4HAIA 5DYGA 1D2NA 5FTMA 2GO1A 3PYLA 4BX2A 5J4KA 1R0RE 3JQBC 3PCTA 2C7QA 2A4KA 2H63A 3HKBA 5BSTA 1E92A 5JPDA 1GLVA 5HDBB 3BD6A 2IL1A 3GFPA 4HQKA 3Q6NA 2D1SA 1DV1A 2OV6A 3C4QA 4UJ3A 3ZG6A 1Z3IX 5ALVA 3ID6C 4ENQA 1XD9A 2B4QA 2GUWA 2VDPB 3GFTA 3KC2A 2Z2ZA 3GDFA 4KB5A 2P11A 4D4LA 4EYQA 4ZJUA 5HCUA 3TE7A 3FWZA 4ZT5A 2H4FA 3EULA 3GOQA 2ZE8A 2YQZA 1RRVA 3PZRA 1I51A 2QRNA 3V9AA 4ZARA 1AMNA 3C97A 3W05A 4JC5A 2WNHA 4IDOA 5CFNA 1WR8A 2PT7A 1NBHA 1U02A 2BKEA 4TS9A 1BW9B 4UUAA 2PRZA 3C6MA 4HLUC 4WLVA 3HWWA 3BQMB 4GPBA 4LJ5A 4CTMA 5KWEA 1SQ0A 5LZ4A 4DHEA 2GJ4A 1HL7A 3QVXA 5KYNA 1UKVY 3ICWA 2IIPA 1X7XA 4MINA 4MUXA 1CYDA 4I5EA 3E7DA 3IAS6 4QBTA 5FPHA 2GSWA 4YWJA 3LS2A 3QVMA 4WDRA 3VMMA 4AYTA 3MAAC 2QUZA 1ZK4A 1JXOA 4DJFC 4BLRA 2VDRB 4X0EA 4YRRA 2X2PA 4LQLA 3LG2A 3RBZA 3O4FA 1SAYA 1JJFA 3WWZA 3ZXSA 3RLFA 1ZUHA 5AUPB 3HH8A 4QJIA 4MWOA 1XALA 1PHRA 1V96A 3M6XA 1PG2A 2WZQA 3QF4B 2HWKA 5FD8A 1E6UA 3U40A 1JTFA 4ZA2A 4DBZA 2I4RA 4L4SA 5LD2C 2EERA 3QKWA 4EM6A 2BFCB 3OE4A 4WNIA 4BYGA 1ZM4A 1E61A 3SBEA 5MF6A 4HSGA 1J33A 4LVCA 3ZWAA 1NVTA 1P1IA 2IHYA 2ZBRA 3I5AA 3K9GA 4PHTA 2HJSA 1X7ZB 1N0IA 2HLPA 3N28A 1S1MA 4Y1EA 1LSJA 1PYOA 2G8NA 1CY2A 4JQCA 3L6DA 3JS5A 3MJSA 2DULA 4YP5A 5A9RA 1RFLA 1SVLA 3VVBA 2W0SA 3L7CA 2XTJA 3TJRA 3HS3A 1NI5A 5A0FA 2P2ZA 3VR3D 1H2WA 3A58B 1OW3B 5IT0A 4ILKA 3OT5A 3V97A 5I3ZA 3KJZA 1Z4LA 2IE8A 4IR7A 5DM2A 3OQ6A 3L5KA 5ALHA 3EZFA 2LD4A 2I4IA 4MARA 4DQKA 4XJVA 3P9IA 4KV7A 1DIOB 1N2SA 4MKRA 4TN5A 1T2DA 1L7OA 1OTYA 4B3XA 4C0KA 1WB9A 1OH6A 5DM1A 3BX1A 3FRHA 3KG2A 1CUVA 4V0MA 4QYSA 5F3DA 1P4JA 4GL4A 2WWXA 1NTRA 2P3QA 3SYMA 2O0JA 4A23A 4JNKA 2DFNA 3KKZA 1TRKA 5TMBA 4AN1A 3A04A 4D9JA 2HSDA 1ND6A 2FWBA 2Q5OA 4H59A 2H2AA 3SQWA 2HA2A 1U9IC 3NWPA 4C0JA 1P0PA 1U81A 1C14A 2VAVA 1OXXK 2VJAA 3NRJA 2P6MA 2DG2A 4JEIA 4RZUA 3EF3A 3FMFA 5CAEB 4HPXB 1QQTA 1BS1A 5L4NA 4R9VA 1RRKA 3AQIA 3TR6A 3VMFA 1QZ3A 1DEKA 2QN3A 3H0KA 3RSGA 3UK1A 3UB4A 1H1LB 3LZDA 2IEIA 4B6EA 1DFIA 4ZHSA 4DF3A 5B7PA 2VUHB 4HC4A 3O3MB 3ZCSA 2EKLA 4DV1B 4QXPA 1O6GA 4TUYF 4B76A 2FTKE 3M0EA 3O4RA 3PUXA 5CHEA 5BNWA 2AEJA 1RXYA 1WSBA 4MI1A 5HKLA 4R8MA 3DBHB 4PAOA 4ZVQA 5L3SA 1TO6A 1P3DA 5KKNB 3RRZA 1QKIA 3JALA 4K05A 5I48A 2OQRA 1JKMA 2VWQA 4O4HA 2GN2A 4TYQA 1JEQA 1YNSA 5KNDH 3J81k 4LW8A 5LOVB 1HURA 4I2VA 3VNSA 3B70A 4MV0A 3UOAB 1KU6A 2XCRB 3L01A 4AQYB 1F9EA 1T4DA 1Z0IA 2WUGA 1ZUWA 1JAXA 3LBFA 3TJZA 3TL2A 3ZNPA 5B2FA 1DRVA 2B1QA 1S2OA 1J0AA 2IOQA 1QG2A 4G23A 1I24A 3KFXA 7REQA 1IVSA 1PN3A 2I78A 3F6PA 3RU2A 5LU9A 5MGNA 3FF4A 1J0XO 3LWZA 4J03A 1XVTA 4G5FA 4BMSA 2YWCA 1GQ2A 1JEDA 2QF7A 3LFHA 1VCHA 4YVFA 3SLGA 5A6VA 1B00A 3CF0A 3NHPA 3OE5A 1UOOA 3TQHA 4M54A 2BCJQ 2GJKA 4QFBA 1FX0A 5B5SA 4IHQA 5KPJA 2I55A 1M10A 1SXHA 3MYYA 1RAIA 5AVVA 1L5MA 5K0GA 2X8AA 2NUAB 4AJ4A 4EHHA 4N5IX 2P9CA 1C9MA 1B8OA 1LI4A 4MVJH 3O95A 2C5EA 2MJLA 2VUTA 3JTEA 1MO2A 3I1JA 3X1MA 5IDXA 2AKAB 4MW7A 4GGPA 4B2PA 4QFCA 4F71A 3NIGB 2HYDA 1XDWA 4YC7A 4FMBB 2BGIA 2PM8A 4BCCA 5CBKA 3FCXA 3G49A 5GM2A 1KQGA 4JYZA 3CEMA 4U3JB 2OAEA 2AE1A 3NBXX 1U4SA 3AMVA 3OMXA 3X1KA 3LQ2A 1DBRA 1FNSA 3U3ZA 3PR3A 3P27A 2IPOA 3F8WA 1A7AA 1XXLA 4BBAA 1UXIA 1PBNA 4ER3A 4JB2A 3OCWA 2ZB7A 4OHVA 1JBKA 3M9LA 1M5RA 3ZDCA 4HNAB 2YJTD 1Q17A 1Q0QA 1Z0ZA 2DY0A 3PHBE 4KUHA 4BVKA 2C92A 2I6FA 2WU0A 4D6YA 2AOUB 4MROA 2WICA 5ECGC 2AYXA 1RI5A 1N2EA 4YAEA 2GEUA 1J1IA 1MIOB 1P9LA 3AEUA 3KWFA 4GMFA 4IEFB 3PJFA 3WLLA 2XKJE 2ZTUA 1GEEA 4DA0A 3JQ7B 1FEZA 2OB1A 4J16A 4PVCA 2QMYA 4AY2A 1T1RA 3EXHB 3Q12A 2HQOA 5BQFA 4B83A 1NMSA 3QPWA 5BQPA 121PA 5AVXA 5KCMA 2A0FA 3WXMA 5A5FA 1YZNA 1SWWA 1NOIA 3SM3A 3AR9A 4RY2A 3STTA 4ZYUA 5CFOA 1DXYA 2IZ7A 3H17A 4K86A 4UFOA 2ERYA 4P5PA 3V8NA 3AJ8A 2ADFA 3CLUC 3CRVA 3WFJA 3K70B 2NSHA 1KMCA 1GA4A 4YCNA 4TM7A 1C7IA 4H3VA 1MA0A 3KBOA 2B21A 4I50A 3IKLA 1J42A 1G60A 4LJSA 3E4DA 4NXMB 5FPPA 3M70A 2JAWA 1EXNA 2PFGA 1BEZA 1DX4A 3A9RA 1DAFA 3AKEA 4L50A 1SA0B 4Y6OA 5G1OA 3G2KA 4UUPA 2IYLD 2VNAA 3SYLA 2FK8A 4DA8A 2Y71A 2W6QA 2B4TO 5BV7A 4NZZA 3AF3A 4H1UA 1N1MA 3OPYB 4HDKB 5HZKA 2OGUA 1DUIA 5D3ZA 4RNCA 3AEZA 3ZJUA 1I3CA 5FI0B 4CCSA 4JUDX 1NOJA 1XLVA 2P5TB 3LL7A 1JFTA 4B3MB 3E3OA 4P3PA 4C2BA 1K8QA 2PL1A 1Z29A 1ZS9A 2NXEA 4ML3A 3NHLA 2YW2A 5LB4A 5GGYA 3UAVA 4BMNA 2OP1A 1LSUA 1GKIA 3ZJVA 5FV7A 5AVWA 1Z45A 4OVKA 4EG4A 2CT8A 4D26A 5CB6A 3ZVRA 3IBSA 3QEBZ 2WMNB 3UHJA 3PGLA 4K9SA 4KBGA 2FZKA 2VHEA 3ENWA 5ALOA 5LQNA 4A36A 1Z4MA 4I55A 1GGEA 5FDFA 5EJ6A 4N6GA 2V0GA 4Z1MA 1LBIA 2GK4A 3EZLA 3V1TC 1HG1A 1TZ2A 3BHNA 1DO8A 1IN1A 2SKEA 4L08A 3FOFC 3KQVA 4LE2A 4ND8B 2QJFA 4QAJA 10MHA 4REQA 1FUEA 3RJMA 1VLLA 5EXEA 3IULA 1QS0B 1N5RA 3JASB 1TCVA 4RTRA 3GLGA 1V3VA 4GPEA 5E38A 2PRSA 1RYZA 2WDPA 4GI5A 4NYIR 4R40A 1NPDA 2ZQ5A 4TGLA 4XI9A 5J3JA 4HEA6 4TWIA 1VSBA 4YRJA 2WWVD 3RJZA 2NG1A 2E4UA 3VPHA 5A04A 5CP8A 5BQOA 3QUAA 4AZTA 4EB8A 1SZCA 3IRVA 2EX4A 4HDMB 4LZAA 6REQA 5LYJB 3NIBA 3H7IA 4U02A 4CM4B 2ZDQA 1GFIA 4BYMA 3DEAA 3GZJA 5IJ9A 4US0R 4A26A 4BRSA 2KX7A 4IG4A 5EJEA 2HRDA 4E33A 2QLBA 1KZGB 1UMDB 1WUKS 3BXZA 2Y4OA 2ON6A 2P2DA 2CKMA 3PNOA 4R2MA 3W2GA 4LKOA 4DEXA 1TJ3A 3K1TA 2H8GA 4U0KA 5BP7A 5DYTA 2BFMA 2RJ3A 1RWPA 2CHVA 2ZJ7A 1QYIA 1ZJ4A 1CR4A 3GT3A 1G9XA 4BFLA 1O8BA 3C43A 5DGCA 5IKOA 4S1NA 3PD1A 3BD8A 3RS7A 3N0RA 1TJNA 4M1SA 5GMOA 1Q1ZA 1AXGA 4ZYYA 4ISBA 2VQEB 4ICIA 4UOZA 4MO9A 4WCFA 5M04A 1UBOS 2CXSA 4JASB 4Q93A 4MQBA 4O4LB 4F84A 4W5RA 2HCTA 3IUYA 3K4HA 3P2IA 3OQPA 1U28C 4KNWA 1NW7A 1W5FA 3ZDFA 3EODA 3O4IA 5IKPA 1ZM2A 1OH8A 4CEHB 3LL4A 4LXHA 7MHTA 2HQ1A 1WV0A 3TLZA 3B20A 1P2TA 3O2NA 1S8AA 5BWLA 2E4VA 5KX5F 1LBQA 1NXWA 1WP9A 1R0BA 1XZQA 3Q9NA 5DWDA 1KE1A 2Z8YA 3O9MA 3QW4B 5KMGB 1HE5A 1U1EA 2JVKA 4FSHA 2J0UB 5EIEA 5JJKA 5CG2A 3HSKA 5BQXA 4WFQA 2ZRGA 2A0XA 5K8LA 3T7SA 2OAP1 2N9UA 1FDSA 2LKCA 3C15C 5DK6A