4CM1A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
251
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
molecule tags Oxidoreductase
source organism Trypanosoma brucei brucei
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
total genus 93
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm1A00
3P5SA 4LRSB 3E48A 4PLFA 4YJDA 2Q99A 5JSFA 3WQRA 1M6HA 1EUCA 3IUPA 2BF7A 2QZZA 3IDSA 1PJCA 3ZNPA 5JAIA 4BO4A 3OA2A 3QWIA 4K28A 3K2EA 3RC1A 3EUWA 3C3XA 4I5GA 3F6YA 2YHIB 5K0ZA 1WMBA 4YRBA 2P91A 4AJJA 4RZIA 4JBGA 4K26A 3VHRA 1GUYA 5HS4A 1FMCA 2Q3EA 1ENOA 3MOGA 4EI2A 2EKLA 4P4LA 4IIUA 1JN0A 3OJOA 5I9MA 3VAZA 4OIMA 1P0CA 5JCJD 3H5NA 1VKNA 1RM4A 4GMGA 3JCZA 3OBBA 5C37A 1YJ8A 2P9EA 4IZIA 4FJ1A 2OHXA 4BB6A 5G4KA 5KJ6A 2I5PO 2GCGA 1K6JA 3INTA 3ZU4A 1Z75A 1NWHA 5KNLA 4J91A 1JKFA 1BXZA 2X58A 2Y0DA 4PLYA 2BMAA 4CLRA 1YB1A 1S7CA 2QQ5A 4YEDA 2VWQA 4YT8A 2OO5A 1T2CA 1ONNA 5A4DA 3QRWA 1RM5A 4EEXA 3JQBC 1HYEA 2NV6A 1RPNA 4JK3A 5CFZA 2Y93A 4NBVA 1PZGA 1HYGA 3WOHA 1U3WA 5KVSA 4PZDA 1GAEO 5AYVA 3E6AA 3COSA 3RU7A 4FB5A 3RC2A 2Y68A 3WBBA 4A10A 3DMTC 3G79A 4N18A 2CFCA 5I8ZA 3TJRA 4AJEA 3GVCA 2VHXA 4NBRA 3ULKA 1PZHA 3H8VA 1YL6A 4J90A 3VKUA 5EMHA 4CMCA 4KDEA 1HE5A 3EMKA 1WDMA 4XEHA 1R12A 5U4QA 1IE3A 1H6BA 4R69A 4BVAA 4OSOA 4U8GA 2WYVA 2OUIA 1M67A 3MCVA 4D46A 3EVNA 1R6DA 3DFZA 1OC2A 1VJ1A 4J1TA 3JQ9A 5JY1A 2VN8A 2DTXA 2J3HA 4O5OA 5IDXA 1LX6A 2HAEA 3HE3A 3ICCA 4MDHA 2GN4A 2J6IA 2X0RA 1E3WB 3HFSA 4GWGA 2ZKLA 3STHA 4B4UA 5I8WA 2B4QA 1DDOA 1DC5A 1NVGA 4ND5A 3ADOA 3F5QA 2BFAA 2RIRA 3WXBA 2AEFA 3AI3A 1Q7BA 4OGWA 3JQ7B 3IQDB 5DOZA 1OI7A 3DC2A 2C2XA 3C1OA 2FR0A 4Q3EA 4XR4A 1GTMA 1PEDA 4B7UA 4IZHA 3DOJA 1LBEA 1NPYA 3JYNA 4CQMB 4ZN6A 1E1KA 2YDYA 3W6UA 4AJ1A 1Y8RA 2X6TA 4CUZA 1J49A 1IOLA 4YQZA 1AN9A 3NX4A 2ZYDA 4M1QA 2VT2A 4F6LA 3FRJA 3OM9A 1ZK0A 4URFA 3TOZA 2RHCA 3V1YA 5K9ZA 4BNGA 2ZJ0A 3RAJA 3Q1LA 2DFDA 2AEJA 3HWRA 1BXGA 1F14A 4JXKA 1PJBA 4TZTA 4XYEA 5HM8A 5A9SB 1WP4A 1B0AA 3G17A 3I9MA 3QVSA 4IM7A 1PL6A 4YYZA 1TEHA 4FS3A 4LCEA 1UR5A 1P1JA 1UDBA 1DFGA 3SEFA 2BGLA 4E2ZA 4CM3A 4MVJE 1UDCA 2ZIZA 2W2KB 1GV1A 2IZ1A 1WNTA 1HE3A 1ZMOA 3K2BA 3QHAA 4BNZA 3QIVA 2AG5A 5AXCA 2FN7A 3CINA 3O4RA 1FF9A 2Q1UA 4TRRA 3RASA 4YB8A 4B8WA 4J2HA 1IB6A 1LU9A 4NI5A 4DL9A 2JCXA 4N5NA 4NBUA 4I5EA 2QG4A 4CMEA 5MGBA 1E7RA 2NADA 2B5WA 4NQZA 5B4TA 3NJ4A 3U5TA 2G17A 5EESA 1VM6A 2RHRA 5IN4A 1NHGA 3ZZNA 3INGA 3EVTA 4R9SA 4XJTA 2XF8A 4UEJA 1EQUA 4BO0A 3L0DA 4KUEA 2VHZA 3OQ6A 4MP8A 1YQGA 2WEKA 1LDMA 1NWCA 5A5FA 1S6YA 1G6KA 4U0JA 2FMUA 5CDYA 1E3SA 4Y98A 4GX2A 3KBOA 3DR3A 5DOVA 1KERA 3D0OA 4IMPA 2OGUA 3GA0A 3OA0A 5GZ6A 1MFZA 2GF2A 5KKCA 3BMQA 4AJNA 2B0JA 3MJCA 5EERA 1PQUA 2O7QA 1E1NA 4YT2A 1K6IA 2NU8A 4B7CA 5DT9A 4YAKA 3ZV3A 1A7KA 2D5AA 1B3RA 4BGEA 4Q3CA 4ZA2A 4BGIA 4D41A 1GEGA 3CKYA 1BW9A 2HO5A 3KYDA 4J0FA 4PFJA 2QX7A 4Y67A 4DMLA 4ID9A 3O8QA 1HDXA 4Q3NA 4R16A 5ES3A 3ZWCA 5A9RA 4WK6A 5L45A 3RFVA 1B8VA 4OM8A 4Z0TA 4EJ6A 2PGLA 3E5RA 3PFFA 4DMMA 2IEDA 2V6BA 1X7GA 4HFMA 3M1AA 3WGTA 1HT0A 3ZNNA 3OJFA 2ZYGA 4IGFA 3DMTA 3OF2A 1XHLA 4WE3A 2UYYA 1F17A 3ETDA 1IYZA 4A27A 4B8ZA 1EK5A 1VJTA 3OECA 2YZ7A 5AQ1A 1ZXBA 1ENYA 1I3NA 3OQ1A 2VYND 3ANNA 2JD1A 3HADA 5G0TA 3BTVA 2FPGA 3HZZA 1MLDA 1A27A 1X14A 3OFSA 2DC1A 3LT2A 1U9JA 1ZIDA 4O6VA 4DTIA 4TSKA 3C85A 3VZRA 1UAYA 1EZ4A 4E4YA 3L9WA 2JL1A 4ROSA 1NHWA 1CEQA 3RD5A 3RU9A 3H3JA 9LDBA 1H94A 1R0KA 3ZWAA 4E30A 3AUSA 3QWFA 3TPCA 1LDGA 1Z7BA 2JAHA 3DZGA 1ONOA 4FD3A 4QEDA 4I8XA 4DBVO 3B6ZA 3BYZA 1ENZA 4XYMA 3AI1A 3ZU3A 1EE2A 4CL8A 5IF3A 3LK7A 1SCUA 2I3GA 3WGOA 2GZ2A 1PX0A 2YV3A 3D4PA 1LSUA 2PZJA 3LLVA 1XQ1A 3DBHB 1NQTA 3JV7A 2P68A 3NT4A 3W8DA 4A0SA 4BNYA 4IJKA 4KQWA 1VRWA 5L9AA 3ZWNA 2Q1WA 3EHEA 2UV8A 1Y8QA 3DQPA 1ID1A 3I9OA 3GFBA 5IFLA 3B1FA 1PSDA 4BNXA 3LSYA 4WLNA 2GLXA 4HBGA 3BIOA 3ZCXA 3GOHA 2P9GA 5G0UA 3NTRA 4J1NA 3I1JA 5T8KC 4RVGA 2AA3A 2HKIA 4CLOA 1UP7A 3O8QB 3ITDA 1SOVA 2PKQO 3WTBA 4Q3AA 1K6XA 1DFHA 1I32A 2X9NA 3I4CA 3GVPA 3LDHA 1IHYA 1DC3A 2C59A 1RKXA 2Q4EA 4RCVA 3U4CA 1NAIA 2NLOA 2EKQA 3DBRA 3ANMA 4RVDA 1ADFA 1P44A 1X1TA 1EDOA 3BMOA 4OOFA 3LF1A 1PJSA 3EY4A 4QSMA 1HEUA 3DOCA 1A7AA 3ZN2A 5JDIA 1GFSA 3ZWBA 1I3MA 1E6WA 2WD8A 2X23A 4OYRA 4TVOA 5FI3A 4MVJG 2LDBA 4LSWA 4WLEA 5C7IO 1NNUA 3FTNA 4KDFA 4Q3DA 5ENVA 4OXYA 4HADA 3H4VA 1BDBA 5DCWA 1DJQA 1A71A 1WXDA 1Y1PA 3HFGA 1H6DA 1HDCA 1KVRA 4XB2A 3ONDA 2PH3A 3OH8A 4Z9FA 5LDGA 3ZWYA 1BWSA 2GSDA 5BSHA 1NAHA 4YAGA 5F1KA 4NZ9A 3IUSA 3ZW9A 4ZJUA 1LXCA 5A03A 4CLXA 2VUUA 4JJIA 2HMVA 2PK3A 4CMHA 3P2OA 1NVMB 1ZW1A 1XWFA 3PHGA 1U3UA 2GGSA 1DRUA 3PQEA 5A5EA 1D7OA 4PVDA 1GDHA 1QYWA 2Z1NA 1C0IA 3GPDG 4PLCA 3NKLA 5L4LA 4M55A 2FY8A 4L8VA 4HX5A 1YBMA 2HU2A 3GY0A 3QSGA 4NFYA 4PN3A 2RCYA 2YJZA 3DZFA 3WG9A 2OXIA 4E5MA 2H63A 3ICPA 3F4BA 3KHUA 1LLQA 5T67A 1ZO8A 5BNIA 4MVJF 2E6UX 3IP1A 4E32A 4CMEC 1UXJA 2QW8A 4G2NA 2GUGA 2X9GA 1TI7A 2PZLA 3DONA 4RF3A 1U5AA 5LC1A 1XG5A 2FR8A 3HN7A 3QE3A 3TDKA 3D5TA 1MFPA 3K73O 1BMDA 3AWDA 4LMPA 3SJ7A 2CDCA 1FJHA 2V6MA 5MDHA 3PGJA 3I23A 1R0LA 3IS3A 3N74A 2Y1DA 2I99A 1ZMTA 3PWSA 1HDRA 1CETA 1PQPA 2C07A 3DZBA 3SBOA 3X2EA 4BNFA 2HLPA 5CEEA 3D4NA 1YOVB 5BNFA 1MC5A 1GV0A 3KB6A 1M75A 2VWHA 3HDQA 3SXPA 5I9LA 1PWXA 4K6CA 1A9YA 2CZCA 1MUUA 3ETGA 2VCYA 3JD0A 3R0IA 3AFMA 2I6TA 1UXKA 3LT4A 3OJ0A 1FDTA 4EBFA 4CLOB 5CEFA 1GY8A 5ENDA 1PTJA 5JYDA 3X2FA 3FR8A 1K3TA 1CRWG 1DIGA 2Y99A 5TT0A 5B4VA 4JIGA 5JDCC 1YONA 3DHEA 1LDNA 4HKTA 4Q39A 1CDOA 2DTDA 3DBRB 3RKUA 3GUCA 4YRDA 3H9UA 2W90A 4BO7A 1TXGA 2PH5A 1KY5A 4GPD1 3L4SO 4IJWA 2B35A 4CM9A 4LVCA 4YTEA 4A2CA 1YS4A 1LC3A 2GD1O 1UUFA 2H5LA 4IDFA 4CLRB 1RYDA 1W4ZA 5DCUA 4R1UA 4MKZA 3JQ8A 4DREA 4GLOA 1J0XO 4DUPA 2E37A 2NTNA 2JFGA 1I10A 2V6GA 5HA5A 1DFIA 1X0XA 1AUPA 3IJRA 1LDBA 3DHNA 1X7HA 3GUYA 1GPJA 4TKLA 3VPXA 4JLWA 1SNYA 2VYNA 4IJVA 1N92A 4B79A 1PWZA 3AOEC 1YB5A 3LVFO 4QQRA 3VDQA 4KMSA 4RLSA 4IDDA 4R1NA 5TIIA 1Y7TA 1E77A 5TS3A 2Q2QA 1R37A 3D1LA 1HKUA 1N5DA 2YFHA 3EGOA 3GZNB 4I1IA 4JGBA 4BNTA 2FSVA 2X5JO 1P77A 4RL6A 3ST7A 5DULA 2YHUA 4RDIA 4D79A 1JAYA 4D0SA 3KOUA 3H7AA 4XKJA 1ISGA 3DTTA 3PEFA 4W6ZA 4YAIA 1GL3A 5H83A 4B4VA 1T25A 4ZHSA 1ZK2A 2X22A 3PDJA 2NSDA 3DB2A 3DHYA 4TROA 2DUUA 1DRWA 2ZB7A 4Z6KA 4HFJA 3WGZA 3MZ0A 1EK6A 1IL0A 4FGSA 4IXTA 4D3FA 4BOYA 4J1QA 4MPDA 4ZGWA 2D3TA 5JO0A 4G81A 1YKFA 4RPHA 1DLIA 1ZK3A 3PZRA 2Z5LA 5TF4A 1N9GA 3VKVA 3UICA 2QRJA 1LRKA 1WDLA 2F00A 2R2GA 2D1YA 3I3OA 3KSZO 3ZGYA 4ZVVA 4OXNA 1PJ4A 4F45A 4QECA 1VKOA 3F47A 3ZWWA 2OL4A 1Y5RA 5CDTA 2F1KA 1GYPA 2O3TA 1QSGA 1QRRA 3QW2A 4I5FA 4RLHA 3TFQA 3FI9A 4TRNA 4E5KA 3W4IA 5FYDA 2P9CA 5IG2A 5JAMA 4O0LA 5C5IA 3R6DA 2DM6A 5DCYA 3GQVA 1LTHR 1VL0A 2BGKA 2O4CA 2ZCUA 2ZJ1A 4AICA 2W8ZA 5KVCA 3W6ZA 2QIOA 4E33A 1Z74A 3I83A 1IPFA 1QMGA 5T6BA 2FP4A 2O3SA 3AW9A 4J16A 3TZHA 1HDOA 2NM0A 2B4TO 3WMWA 3KYCA 1I0ZA 3AM4A 4CJXA 1ZK4A 3P19A 1KEWA 2X8LA 5KCZA 1GQ2A 3QVXA 1QYVA 3SLGA 4FFRA 1MG5A 3GG9A 3E03A 2HMTA 4U0KA 5DNAA 2AE1A 5BQFA 1HZJA 1GADO 3IKVA 5IZCA 3DOOA 4XYBA 3BMCB 3TF5A 5JLAA 5A04A 1F8GA 4RJTA 2E49A 3RBXA 3INRA 1W73A 2AQKA 4ND4A 1H93A 4Z3DA 1XELA 3GDFA 1D1SA 4J7UA 3HDYA 1SOWA 3L07A 5KKAA 4BO6A 4JJGA 3WNVA 3Q0EA 3PGXA 3ASUA 2XPCA 4ZRMA 3S2GA 1WZIA 4NR0A 2VYVD 3ROMA 1NYTA 1CQIA 4AJOA 1SMKA 1ZNQO 5DBGA 3I9LA 2BRUA 1DEHA 4ZQEA 1JWBB 3UN1A 1DC6A 1GYQA 3H9GA 2OORA 5HS6A 4FCCA 4YPOA 1J5PA 1GQYA 2EXXA 4AJLA 2EHDA 1MGOA 3D3WB 3GNQA 3O26A 4OJNA 4BIIA 4CR7A 3CIFA 4JNKA 5L7YA 3VH2A 3Q6IA 4W99A 1YQDA 3PYXA 1TVEA 3GFGA 4R3WA 1DO8A 3U4HA 4EW6A 1LJ8A 4WCFB 3GHHA 3AUUA 4NK5A 5JCJA 3DL2A 2X5OA 2ZQYA 1N1GA 1B26A 3EZYA 4DPKA 3LYLA 3S55A 3TFOA 3FBTA 1U7TA 1I36A 2X0NA 3AM5A 4NH4A 4TWRA 1EUDA 1U3VA 2YQ4A 5J23A 1HE4A 1AE1A 4D42A 2AMFA 3AOEA 4GSLA 2UDPA 3FTPA 4KQXA 1B3BA 2EERA 3AI2A 5ITWA 4FJ0A 2AE2A 3GR6A 1GYRA 4L4RA 2I76A 4K1LA 3GGGA 3NAQA 3EAGA 3RKRA 5KIAA 2EW8A 2NU7A 1ISHA 1RM0A 3VTZA 2GRAA 2J5KA 4BMVA 4NBWA 4RPKA 1WAMA 1SEVA 2A92A 4BO9A 4FFMA 3BAZA 1K89A 2AQ8A 4BNWA 1R16A 2JKVA 4PRKA 2NNLD 2DVMA 2HK7A 3TN7A 4ZQFA 2GO1A 2JAPA 2GPTA 4Z9XA 3WGQA 1NM5A 4MO2A 1ZXLA 3GK3A 5AXBA 5TJ9A 4NHEA 3LQFA 4CM9D 4E0BA 1O8CA 4XWYA 2AEMA 2JCYA 4CMGA 1ZFNA 2D4AA 2PD4A 4L75A 1V3UA 2VRBA 3TZQA 4J3FA 8ADHA 3OIDA 2R6JA 2Y05A 4HFNA 4XD2A 2X7HA 4FN4A 4DGSA 4LISA 4J1SA 2PLAA 1YGYA 1Z73A 5IJZA 2CY0A 3C24A 5CHEA 5B4UA 4N5MA 4WCFA 1O9BA 1UP6A 4O63O 4DYVA 3EYWA 2WWRA 3FPCA 5CAEA 4GI2A 3WTCA 2BFMA 4WEQA 1WWKA 4QUKA 1CERA 1TT5A 4WNCA 4DQUA 5TGDA 2RBEA 4HWKA 1UP4A 2WD7A 4GLLA 3KETA 3FNGA 4RO0A 4W9NC 5A3JA 3LT1A 2EP5A 1R4MA 2UAGA 2PNFA 1ML3A 3UKOA 1EFLA 2DKNA 3OETA 2C5EA 1MA0A 3MJVA 1ISMA 4U5QA 3VPGA 3TOXA 2VZ8A 1UZLA 2O3RA 4WCDA 3C7AA 3G3EA 4U6SA 1KOLA 1LDEA 4TMFA 3CUKA 1EQ2A 1U28A 3AY3A 1YWGO 2O23A 4U7WA 1V6AA 2Q4BA 5FFFA 4XQCA 4BV9A 3VH3A 4U6QA 4FFOA 1GUZA 1K0UA 2VZ9A 4A73A 1G0NA 4EYEA 1ADCA 4WGGA 1GQQA 2BI7A 3UHAA 4CPDA 1WPQA 3OHSX 2Z1MA 1DHRA 2IODA 2G82A 1PS9A 2IXAA 4B7XA 4PVCA 1UZNA 3JYPA 3VZQA 1T1SA 4HFRA 3GAZA 1QP8A 3H2ZA 3GRKA 1I8TA 4PLGA 3QV1A 1LLDA 3HUDA 1QV6A 3JTMA 4YACA 4XGIA 4WLUA 1DIAA 4IUYA 1Z7EA 3JD1A 3CZMA 1BTOA 5U9CA 3DZJA 4J4BA 5JDIC 1NR1A 5ILOA 3BMCA 2HK8A 1PS8A 4LSMA 4TVBA 2BFPA 1H2HA 1TT5B 3K9QO 3PXXA 5T5QA 4Z9YA 1HDZA 5JFOA 1ZH8A 1BHSA 1Z6ZA 4D45A 4PLZA 4A7PA 3NDIA 2Y67A 2VHWA 4Q3BA 4DRYA 4L9RA 4D43A 3KO8A 1P1IA 2FRDA 3ETEA 1WMAA 3JQBA 4Z3KA 3TZ6A 2VOJA 1D8AA 1ENPA 5F5NA 3Q9UA 4J4TA 2OP1A 5F1OA 5TSDA 1DIRA 3B1KA 1MX3A 1KVUA 4XDZA 1X0VA 1U2DA 3F46A 2YFQA 1A9ZA 1Y9EA 3K6JA 1YBAA 2DBQA 2EV9A 3KXDA 3PHLA 3NGXA 7ADHA 3BMOB 1ZCJA 3WYEA 4BNHA 2DQ4A 2JHGA 3NV9A 1YH3A 4C4OA 4XX0A 3RIHA 4MVJH 3PHJA 5DZSA 1YL7A 3V1UA 2PZKA 2UUOA 3QWAA 1DAPA 1E7SA 3GH3A 2AW5A 3AY7A 5IDQA 1NBOA 1RYEA 4IGEA 4CR8A 1HF3A 3GEMA 2JD0A 3DBHA 4II2A 1T4DA 4A26A 4AJKA 1X1EA 3I6QA 4GKBA 1LLCA 2Q2WA 4QO8A 4P4NA 1QR6A 2EWMA 2V65A 2PV7A 3BTOA 2HRBA 5H81A 2JFFA 4BKRA 4EUFA 4CODB 3W8EA 4FJ2A 4DPMA 2YV1A 4XGNA 5JC1A 3HB5X 3OJLA 1QYDA 1YOVA 4MVJD 4NK4A 4UVEA 5I7VA 1ZJZA 4UVIA 1KEVA 2G0TA 4GMFA 4PRLA 5CEJA 1T4BA 3RCBA 5G0WA 3JQDA 1B7GO 2Z95A 2OOSA 3ZNOA 2QRKA 4F46A 1JA9A 4YT5A 1Q7GA 4CMIB 1MC4A 1PZEA 5ER9A 5DP2A 4P8RA 3VPHA 1OMOA 5AVOA 5JXWA 2POQX 2DAPA 1A4UA 1JDJA 3JD2A 3SJUA 4NU5A 2E82A 3PK0A 3WQQA 4FR5A 3PFWO 1OZAA 3GRPA 4KWIA 4MVJM 3DZIA 3FF4A 4FC7A 1AGNA 4ZQHA 3S2FA 3WQSB 5JYEA 1AXEA 5JW6A 2EKPA 2P4QA 4ALMA 4E2XA 4Y6SA 4D0RA 4E12A 4Y9DA 3FNHA 1T1RA 4CR6A 2DLDA 4AG3A 1EDZA 4E3ZA 4FOOA 5FEUA 2VOEA 4CV2A 2OBYA 4L74A 3FCOA 1XR3A 1JVSA 1M2WA 3BZUA 3MTJA 4BNKA 5ITVA 3MTGA 1XSEA 3WDSA 4RPJA 4HUJA 2W4QA 2W98A 4MOWA 2QRLA 5BSEA 2VRCD 1E3WA 2X9VA 3GG2A 4M8SA 4AJ4A 1ZSNA 2V6FA 3GNSA 2BFOA 2HJSA 1N7HA 3Q9NA 4BO8A 2H6EA 2VUTA 3PWKA 4PLWA 3TRIA 3ZHBA 1GZ6A 2Y0CA 3ZWPA 1ADGA 2XXJA 3E9NA 4TRJA 2GZ3A 4YT4A 3TL3A 4RF5A 3IIEA 5I7FA 1H9AA 3OEYA 3GN2A 2DPGA 2VNSA 1G1AA 4FFNA 4R3NA 3F4LA 3DO5A 1Y5MA 4N7RA 1V8BA 1LNQA 4WOJA 5EL0A 3O03A 1E6UA 2BLLA 1RWBA 5TJHA 3SC4A 5CP8A 1ZZEA 3V5NA 3QVOA 3H65A 4BGUA 2O7SA 4H15A 5B37A 1TA4A 1B8UA 4W7HA 1ULSA 3N58A 4M49A 5G4KB 4KWHA 2ZTLA 3IL2A 3PQDA 3G49A 5T8KA 4L73A 3W4KA 3GDGA 3U4DA 4CQLB 4J0EA 3ZWOA 5JCXA 2YW9A 3S8MA 3G1TA 1LLUA 3OP4A 4HP8A 4CM4A 2I3AA 3PLNA 1OAAA 2X86A 2B4RO 4P4GA 4WNIA 5JY6A 4DQVA 1HZZA 1O5IA 1Y9AA 3L4BA 4JROA 3QWBA 4CM7A 1ZVMA 4BV8A 1PS0A 1XCBA 2P5UA 3GEGA 4NDNE 1E3IA 2NUAA 3WLFA 1Q0QA 4PG7A 3DTYA 5B1YA 1MXHA 2WYUA 4YAEA 3L9XA 2WMDA 4IIVA 2FOIA 2DTEA 3I52A 3JYOA 3CZRA 1ULUA 1E7QA 5GZ1A 1E0DA 1MB4A 4WPGA 2XXBA 1MXFA 2HQ1A 1C1DA 2ZYAA 1ISIA 1QKIA 4TQGA 1XEAA 1KVQA 4PLTA 1E3JA 5CG1A 3E8XA 3FNEA 4DPLA 4LVUA 1X7DA 5G4LA 4ZD6A 3WBFA 3RQSA 5THKA 4AL4A 3ON5A 5KJEA 4OH1A 1NPDA 1E5LA 3DZHA 2C2YA 4LGVA 2W2LD 2FPIA 4HV4A 1PQWA 3UW3A 3NJ8A 1R4NA 2J3JA 3P2YA 5L4NA 4AJHA 3JYQA 3VPFA 3ROPA 1FDVA 5TC4A 4BQRA 4I9HA 2CUKA 3ONFA 2EW2A 4IQGA 3CTMA 4UREA 5T57A 1O0SA 2HMUA 5BR7A 1CWUA 3FWNA 3UUWA 4GGPA 3BTUA 2H1SA 4IJUA 4EUEA 3BHIA 4WLVA 4E13A 5KJ1A 4XYLA 2EF1A 3AOGA 3UVEA 2HJRA 3EW7A 5IZ4A 3RWBA 1H2BA 1BW9B 3C8MA 1E5QA 1EVJA 3Q2KA 3GDOA 4XB1A 5K6AC 1UJMA 3CMCO 4PG6A 4OXKA 4CQMA 4D3SA 5A06A 1GCOA 1PR9A 5L53A 4FIZA 4BNIA 5BT9A 1KVSA 3RVDA 3UCEA 4R51A 3GC6A 2OMEA 1BGVA 3NT5A 1DSSG 3G1UA 1ONPA 3RFXA 3A14A 3E9MA 4FGWA 5THQA 1VL8A 5A9SA 5G0VA 2EJWA 4C7KA 1D1TA 1BVRA 4NIMA 1DRVA 3MWDB 4ALLA 4UUMA 1KS9A 4R01A 1M6WA 2G1UA 1VE9A 4NFHA 1M66A 1OOEA 3VH1A 4XR9A 3WJAA 3JQAA 4PZCA 2AQIA 4JP3A 1AXGA 4XJSA 3RJ5A 3WWYA 2YY7A 2CVZA 1UH5A 3W8FA 4NBTA 4P22A 5JS6A 1FDWA 2C54A 2EJVA 1N2SA 1JKIA 1WDKA 3H5AA 5KWEA 3LZ6A 3NDJA 4J7CA 2J8ZA 1R4MB 1KEPA 3WJ7A 3B70A 1EFKA 1X13A 5CDGA 2DBRA 4EGFA 4RVUA 1N8KA 4HY3A 1XYGA 4A03A 1I2ZA 2DPHA 5F5LA 4GKVA 2B5VA 3UAGA 4G5HA 1MG0A 1JAXA 3FNFA 3H6KA 2FWMX 2AG8A 2PKQP 2CVQA 5JE8A 3A28A 3WB9A 1DHTA 4NJMA 1Q1NA 3W4JA 1JKJA 4B3IA 4XRGA 2NQ8A 3PI7A 5TNXA 3VH4A 4CM1A 3OEWA 3AFNA 2OZPA 4HNHA 1LEHA 1NX6A 3UGKA 1DB3A 3KLPX 5U1PA 1SZJG 1G0OA 2CSUA 4QX6A 1N1EA 3KSUA 2IZZA 3JQ6A 4GX5A 4Q9NA 3VVCA 2D8AA 3UCFA 2BH9A 3KYDB 3TZCA 3ZDFA 3H9JA 1B2LA 4EEZA 3ITKA 1CF2O 2VRCA 4Y6PA 3UCXA 1LQTA 3H9EO 4RGBA 3RC9A 3L4BC 5CPFA 3CPSA 3PIDA 1L7EA 4RF4A 1I3KA 3ZHYA 3A9WA 5JC8A 4BS9A 2WD7B 3WS7A 4IMRA 4K9DA 5K6AA 4CM6A 1UXIA 3HHPA 4FPXA 4FFLA 4Z0HO 1C1XB 3PZBA 3NGLA 4PCVA 3K92A 3CXRA 4CMIA 3OJEA 3GEDA 2CF6A 2HMWA 2O3UA 3KEOA 4R41A 4ZRNA 4JBHA 4YR9A 4XIJA 1SC6A 2HK9A 4M54A 3PJEA 3WFIA 2NQTA 2YDXA 2XAAA 1HDYA 3VZSA 2PWZA 4D3DA 4PLHA 4W4TA 1UAGA 5B12A 1SB9A 2QZ9A 3FN4A 1V9LA 4XDYA 2BELA 3VZPA 5JAQA 1VJ0A 3ZWMA 2J3IA 4HXYA 1L7DA 1GR0A 4RDHA 4RF2A 4OKNA 4ITUA 2VT3A 3WLEA 3NYWA 4R68A 3ORFA 4UUPA 4ALIA 1BSVA 4Y6RA 4RVSA 5JDCA 5L95A 2VHYA 4KUHA 1YJQA 1F8FA 1O95A 4XQ9A 3A06A 4XRRA 1MP0A 4NMHA 5JAZA 1DAOA 3K30A 1HYHA 2QHXA 3NRCA 4GQAA 1VSVA 3CE6A 3GVIA 1BXKA 1HRDA 3KSDO 1PZFA 4E21A 4CMAA 3GNTA 4R54A 3S2IA 3NUGA 4RQUA 3TSCA 5TT1A 4A5OA 3QVWA 4DIBA 1LUAA 3K96A 1LQUA 3W1VA 4IS3A 1PGJA 5G2OA 4DA9A 1HLPA 1PL7A 1PGQA 3EDMA 4UEKA 1P31A 2NVUA 1NTOA 3GVHA 3KLMX 3VTFA 2FSSA 4BO5A 4RQTA 2PD3A 2PKRA 1SBYA 1NFRA 4CV1A 2FR1A 1OBFO 4E6PA 1B8PA 4RZHA 3RUCA 1VPDA 2EP7A 2NTVA 3SLKA 4J7XA 1HLDA 2P4HX 5C3MA 1PJ2A 3M2TA 4LCJA 3ZV4A 1YL5A 5HTOA 3RC7A 2HMSA 3QLJA 1VLLA 2FZEA 1ZSVA 1C3VA 1QORA 1DXYA 1B14A 4BO1A 2VZ0A 4KOAA 1X15A 3OQBA 1E6EA 2E48A 3FSRA 2CNBA 1NR7A 1F12A 4YJHA 2Y1OA 1Q7CA 4P38A 3ZU2A 2AQHA 2LDXA 4RVHA 4CLEA 5EIOA 5EQFA 4OQYA 4PLPA 1GEEA 4X54A 3L6EA 3JQFA 2CD9A 4BUCA 5GMOA 3MWEB 4NJOA 3DAFA 2DU8A 4M86A 2ZTMA 2C7VA 7MDHA 2EEZA 1SPXA 4MIYA 3JQ9C 4AJPA 4BNUA 3JD4A 3LC7O 2Q1SA 3KRTA 4OL9A 2PA3A 4CUJA 1RM3A 1T26A 3H5RA 3PRJA 5HWSA 1IZ0A 2NTJA 4R9RA 1WZEA 2VWPA 3JQGB 1J4AA 1V35A 4J2OA 5A05A 4CM5A 2X5KO 3ROKA 5IAAA 1XLTA 4J49A 1KY4A 3V2UA 3ADPA 1I3LA 5A9TA 2UVDA 8LDHA 2PZMA 4OMUA 1PR3A 1ZJYA 4Y8VA 1CQJA 3HJAA 3LU1A 3GHYA 3ZI0A 3ANLA 3RUEA 3WWZA 5L7TA 3E9QA 1P1RA 2VWGA 1U2GA 3WX0A 4L4XA 3JSAA 3BMNB 4N5LA 2HSDA 4FDAA 3U9LA 1JQBA 3D3WA 2PGJA 1P0FA 3A1NA 2XOXA 2NVUB 4CM4B 3E5MA 3JQ8B 4MJLA 4H3VA 5TRTA 3EZLA 4B3HA 3HNPA 1U4OA 3GVXA 4XYGA 3MJSA 3EC7A 3RSHA 1PL8A 4KTTE 4PG4A 1YDEA 4UVGA 2Q46A 2D59A 4XQGA 3DBLB 3FHLA 4IQ0A 1KVTA 3DXFA 2AHRA 2WM3A 4BNVA 3WYCA 1NPTO 5KVVA 4IDGA 4I9NA 3LF2A 2DBVO 1V3TA 2GDZA 1O89A 4R5HA 3LC1O 3PYLA 5HRUA 3WIEA 4GL4A 4WASA 2C20A 1JWAB 2OP0A 4DC1A 1V3VA 4HNGA 3ZV6A 1WLYA 3I5MA 4ALNA 2UUPA 2SCUA 1HL3A 1CJCA 3IJPA 2IYOA 4UUNA 5EINA 4BGVA 1FDUA 4BB5A 2YUTA 1ZKMA 4FW8A 2C29D 2WYWA 5KOIA 4JCOA 4OKIA 2NVWA 3I9NA 4OO3A 4BQPA 1ZSYA 1EVZA 3D7LA 2GZ1A 4ZQGA 1LI4A 2IZ0A 5LCXA 4J9VA 3T7EA 1Y81A 2Q2VA 4OQZA 5LDHA 2GN8A 3AJRA 4YJGA 3JQCA 3GGOA 4RPLA 2ZB4A 1ARZA 1PGOA 2JFHA 4RV9A 5EPOA 3AU9A 3F3SA 4J4HA 1DLJA 4CQLA 3CSDA 3KEQA 2X0JA 1YDWA 3KUXA 5F3RA 5BSGA 1DJNA 5JPIA 4MP3A 1R15A 1AHHA 4CMJA 3WICA 4LN1A 4ALKA 5CDSA 1KC1A 3SVTA 5IXYA 3A4VA 1NQOA 1A72A 4D7AA 3E1KA 3BHMA 3QP9A 1T2FA 2P2SA 2QYTA 3FD8A 4KUGA 1ISFA 3U4IA 3OIGA 3GF4A 4EITA 1ADBA 1C0KA 1HSZA 4H16A 1LDYA 3RUDA 1RJWA 2I67A 2IEBA 2PD6A 3I9KA 4QO7A 1IHXA 1PJ3A 1SB8A 2VHVA 3ZWVA 4DLAA 3GMDA 1EMDA 1PJTA 3NEPX 1A4IA 1XKQA 2FZWA 4N54A 4J6FA 3NTQA 4PZEA 4DVJA 4CLHA 1D4FA 5HBRA 3IP3A 1HDGO 2FPPA 3ZH2A 1KETA 1TT7A 4I9UA 1H6AA 2TMDA 3DAPA 2FHSA 5ICSA 1E92A 4MVJI 4JN6B 3IC5A 4Z0PA 2Q45A 4UAGA 3ENKA 1P1KA 4RVFA 4FQ8A 3GT0A 4ZQBA 1SEPA 2CF5A 1YVEI 5TLSA 3B20A 4EDFA 3WR5A 1C0LA 2DFVA 1UDAA 1XA0A 3F9IA 3DEYX 1NP3A 2B69A 3MJ4A 3U3XA 3SX2A 2YQ5A 1IUKA 3I9JA 3GMSA 2P5YA 3AU8A 4GSKA 5GY7A 2ZQZA 3TL2A 5A1TA 3IAHA 4ND1A 4CL3A 5JMPA 2ZK7A 3QY9A 5DBIA 1E3LA 3N7UA 5KJFA 3OICA 1FDSA 4K6FA 5IN5A 3I4FA 1HXHA 4KP7A 5TX7A 4BMSA 1GU7A 2HDHA 3Q3CA 4GX1A 4E5PA 2A35A 3Q2IA 4AJIA 4FSHA 2PR2A 3IMFA 3FPLA 2D2IA 3HQ4O 4IDEA 1K5HA 5A3VA 3MJTA 1Q0LA 4BKQA 4IY1A 4GGOA 4PG5A 4NPCA 1A5ZA 4JQCA 2J3KA 1XQ6A 4UVHA 2GNAA 1KYQA 4OHUA 3WIDA 3PIIA 1R0SA 4WJZA 2G76A 4YDRA 4BKPA 4E31A 5C7OO 4DXHA 4LK3A 2PY6A 3RI3A 4NNJA 2NACA 5H82A 1UXGA 3PJFA 4IXWA 1Y8QB 1ORRA 1HE2A 4YWJA 2E4AA 5JBIA 4DIFA 4CMKA 4E2WA 1VL6A 4IDBA 4J9UE 4PLVA 2O3QA 3CMMA 4TKMA 2HRZA 4AFNA 4XIYA 2RH4A 1MV8A 2ZATA 1VSUA 3DDNA 3DMYA 3KZVA 4WUVA 2YHIA 4DLBA 3LC2O 3BHJA 4OSPA 5DBFA 2OFPA 4IPTA 1NASA 2D5CA 3QVTA 3DWFA 4S1VA 4L0QA 4FFPA 2A9FA 4DWVA 3PHHA 4FOSA 1LRJA 1CIVA 4YXFA 3T7CA 3NT2A 1F0YA 1U5CA 2ZTUA 1Q2XA 1ZUD1 1DPGA 5IDWA 3KYCB 3MJEA 1C14A 4JBIA 1NQAO 2QYSA 3EK2A 1JW9B 2VQ3A 2VUSA 2WDZA 2TMGA 1YB4A 1P1FA 1LC0A 3CH6A 1L1FA 1P1HA 5BSFA 5COAA 5F21A 3WGHA 3FWZA 1PGPA 1SAYA 1P33A 1U8FO 2X4GA 4YJFB 1NFFA 2GASA 3L77A 2Y1GA 4IQ8A 1IZ9A 3OIFA 2I65A 4EZBA 3P7MA 4BNLA 3K31A 2CVOA 1BRMA 5GZ3A 3F1KA 4XA8A 4L4SA 1LSOA 4YAJA 3WGIA 4BMNA 1XDWA 2DUWA 3JQ7A 3PYMA 3UF0A 5CG2A 3H9QA 5JMWA 2IYPA 4I5DA 3SC6A 2W2LA 2JCVA 2Q49A 1QXSA 1QYCA 2VTEA 2A94A 3E82A 4NG5A 4DBZA 3GN1A 2X0IA 4INAA 1W6UA 1WW8A 2NVBA 4B3JA 1YO6A 3R3SA 3UOGA 5EN4A 4GWKA 5KTKA 4ZU3A 4JJFA 5AXAA 1EE9A 1T2AA 2CDBA 1YQXA 3QQPA 4CV3A 5F1PA 4BNNA 4EUHA 1ZEJA 1XIVA 5JNLA 2JHFA 4ND2A 3RROA 1H9BA 2BD0A 1H6CA 1I2BA 2R00A 5EQDA 4IS2A 4MKRA 5A02A 4ZICA 3DBVO 4JX8A 4O59O 4PGFA 2IE0A 3T4XA 3JD3A 3UFXA 2I9PA 3AUAA 2CDAA 3ZV5A 3TWOA 1HTBA 1EBUA 2O4UX 4YA6A 3VOSA 4EJMA 3HB4X 1GD1O 4C7JA 3L6DA 4FC6A 3M2PA 5FF9A 1LRLA 1DBVO 1YXMA 1NXQA 4F6CA 4MIOA 2WTBA 4YJFA 3C7DB 1VC2A 3LT0A 3RJ9A 4B4OA 2O3JA 3M1LA 4QTZA 6ADHA 3TNLA 4CM8B 3ROQA 2G5CA 4CV0A 2NU9A 1B16A 1I30A 4LMRA 5AOVA 4GVLA 3ASVA 1E7WA 3VC7A 1K2WA 3RUIA 3ZWXA 1PU2A 2RH8A 1I24A 4ILKA 4GAEA 4MP6A 4OOEA 4QFCA 3WGGA 3JQEA 5C7LO 2HCTA 4KZPA 3AM3A 2PTGA 4QT0A 1IULA 2YYYA 4BO2A 1AHIA 1QLHA 1R4NB 4NJMB 1J6UA 4BO3A 4M89A 1FK8A 2RAFA 3L6OO 1QYXA 1IPEA 3JQGA 1C1XA 2Y0EA 4CMBA 3BA1A 3FR7A 3U62A 3V2HA 3KYBA 3S2EA 3TZKA 3PWZA 1B15A 3O38A 2BKAA 1NQ5A 1M76A 5ADHA 9LDTA 5EJ2A 2GYYA 1PJQA 1WVGA 6LDHA 2B83A 1U4SA 2Y1EA 1YE3A 5JO9A 3WSWA 2IXBA 3BMNA 2X1HA 5CPBA 4BHTA 1Y6JA 4ESOA 3HSKA 1IY8A 4IDCA 3HG7A 4ND3A 3IOYA 2DT5A 2ZTVA 2WE7A 4IBOA 4WECA 2D0IA 2WJPA 4IDAA 2ZCVA 3OSUA 3QJ5A 3QWHA 3LLSA 1ISJA 1F06A 5KVQA 5KJCA 3MEQA 1NFQA 4MIEA 4G65A 1P9LA 4MINA 5L40A 3Q11A 4GX0A 4AJ2A 1VI2A 3DBLA 3PLRA 5TQVA 4XQEA 1Y8RB 5L51A 3GZNA 3PQFA 2BHLA 5L7WA 5ILGA 4XGKA 1I01A 3AUTA 1E7YA 1BXGB 2Y1FA 3GLQA 4W7IA 3JQFC 4BL5A 4XCVA 2ZB3A 2R00C 4DYDA 4YRAA 3HDHA 1TB4A 1I5RA 2Y1CA 1D3AA 3JYLA 2BGMA 1O94A 4DIOA 3WMXA 4MVJP 1JVBA 3NDRA 1XGKA 3ZHZA 1P3DA 1N7GA 1W8DA 1XU7A 2Q1TA 3JQAB 3M6IA 2B36A 3ZHXA 3U09A 1Q0HA 3ENNA 3ZNQA 3D4OA 3BTSA 4KTVE 1ZK1A 4WLFA 2GERA 5DP1A 3V8BA 1ZBQA 4ONEA 4W9NA 3GGPA 3G0OA 3RUAA 4WOKA 1KC3A 3FBGA 3TQHA 3KVOA 2BI8A 1YRLA 1OFGA 1Z45A 2WE8A 4M87A 1BG6A 2HUNA 4L76A 2NU6A 4NU6A 5COQA 4DC0A 2EGGA 1CYDA 1W0CA 5DN9A 1EEHA 2CMDA 3KV3O 5ICMA 2JD2A 3C7CB 5L3ZA 5CDUA 2C7GA 1JTVA 4UEOA 2C5AA 3PP8A 2PFGA 2O2YA 2I66A 1GCUA 4YJGB 5L4SA 5COBA 3S1LA 3IKTA 3PDUA 3R3JA 1TLTA 2O50A 4JP2A 5ER6A 1YBVA 3WNQA 4BNJA 3RUHA 3WYBA 3R1IA 1E7MA 3E18A 4PG8A 5I7EA 4MVJA 1U7HA 4WLOA 3GPIA 4BNMA 3ONEA 4WCFC 5IXSA 5AXDA 2EIHA 2V7PA 3KM0A 3U0BA 5FWNA 2ET6A 1I2CA 2C0CA 2H9IA 4RORA 4YCAA 4BKOA 5DDIP 2Y66A 3BMQB 4EJ0A 1T2EA 4I08A 2VTDA 1GUFA 3ABIA 4S3MA 2NWQA 5FI5A 5G0SA 3V1TC 3H3FA 1P74A 4R4JA 3D5QA 1PIWA 4WEOA 1O6ZA 1KBZA 4UUOA 1N9GB 2IRWA 1H5QA 3PJGA 2WSBA 1BDMA 4UULA 4TRMA 1E1LA 3K5PA 2GR9A 3WFJA 4DLLA 1T2DA 3T4EA 2W2KA 5I7SA 3RUFA 4BKUA 4F3YA 5DF1A 2GN6A 4GBJA 5BNTA 1KEUA 3NTOA 2J5RA 3C1TA 1NVTA 4GVXA 3RBVA 2Q50A 1QLJA 3D3EA 3DFUA 2AXQA 3H2SA 2PGDA 1QG6A 4R5MA 4DQXA 3B1JA 4UVDA 1ZEMA 4YQYA 1U3TA 3D64A 4GH5A 1C1DB 4QFDA 1V0JA 2IDZA 1H0KA 1Z82A 3F5SA 4CM8A 4D44A 4O1MA 2C82A 4E2YA 1DIHA 1PGNA 3O9ZA 3PJDA 4E5NA 1GPDG 1QV7A 2B37A 2O48X 2GN9A 3UXYA 5I9NA 1JU9A 2JJYA 3DZKA 1DOHA 5IDYA 1E3EA 2A4KA 1SO8A 1FXSA 4II3A 4WKGA 3PVZA 1U8XX 4R1TA 4IINA 3QA9A 4E5YA 2OBNA 3AK4A 4R1SA 3HDJA 1JLLA 4RPGA 1UZMA 4NFSA 3K8ZA 2ZB8A 3V2GA 1LA2A 1XU9A 3VVBA 4YVFA 1C0PA 4MKXA 3BXXA 1I33A 1P45A 3RFTA 4ALJA 1DIBA 2VNAA 1E1MA 1OC4A 4QXMA 3F1LA 1R66A 3I6IA 2O2SA 3OMLA 3PPIA 3U49A 2YV2A 3WGYA 1HWYA 1U1IA 2EGHA 3AY6A 4OAQA 3KTDA 4CQMD 1T24A 1UXHA 4FBGA 4AVYA 4CLDA 1GZ3A 4CUKA 3GZ4A 4TZKA 4LRTB 1HETA 3DAGA 4XZ3A 1HSOA 4W82A 1DC4A 1EBFA 1LSJA 3UH1A 3RBZA 2DBZA 2ILTA 4H7PA 5IZCC 3ZW8A 3GAFA 3VDRA 1GZ4A 1LSSA 1PJLA 1EVYA 3JQAD 3VPSA 1EUZA 3CEAA 2J5QA 5T64A 3MOIA 4LW8A 4PIVA 4YJHB 3PTZA 3C1AA 2VYVA 4B4WA 4J43A 3PHIA 1KIFA 2EG9A 3HN2A 4YBZA 1EVIA 3WSVA 3ZU5A 1BVUA
chains in the Genus database with same CATH superfamily
4Q9LA 1U7PA 2E7ZA 3E48A 1TU4A 5C34B 5C8VA 3D8TA 3FMPB 4OLBA 1YR6A 1G8SA 2LCQA 1LNSA 2YC4C 3ZE8A 3B82A 1RI4A 3E53A 3NO4A 5GJCA 2WIGA 1AV7A 4AWBA 4ENPA 4A82A 5F5XA 1W52X 2FE4A 4E22A 1DV2A 3IQHX 5CX4A 3DJFA 5JAIA 4N3CA 2P0YA 1M10A 3EVAA 3OA2A 1CDZA 3QWIA 4C03A 3MPOA 4KYIB 4IGIA 1TA9A 2YHIB 1ZHFA 3ENVA 4XCQA 1DBPA 2PWBA 2WHPA 4FDLA 1RTKA 4N40A 5B7QA 1D6NA 2P91A 3ZG6A 1II8A 4RZIA 5IULC 1GUYA 3PFIA 1FMCA 2XSZD 3MRVA 3I5UA 5I9MA 2UUAB 3LX5A 2AXPA 2Y6VA 1NE7A 3VAZA 5BMVA 1YZKA 3SC3A 2RKOA 1Z5WA 3RS8A 1RYHA 2UXDB 2VF4X 5C37A 1YJ8A 1U0FA 2OCIA 2A1TS 4LHYA 3VU8A 2OHXA 3WK4A 3RRFA 5KQLA 3LUJA 2ZYRA 3L40A 1SCIA 3EF3A 5H4GA 3VHQA 2HBYA 4L3WA 1JZQA 3INTA 1QHSA 2YFYA 2YW2A 3LTEA 2J41A 4GPBA 1N3YA 4WZ6A 5HEKA 3S1AA 5LWHA 4X3CA 2Z2XA 4YEDA 3ODGA 2RHJA 1ONNA 1TC2A 2QPTA 1JXAA 2ORED 2X8JA 3GJ0A 3KXPA 3QRWA 1TW3A 4IJMA 3WNDA 2ZYUX 3GJ5A 4RMJA 3HV0A 5IUJC 4QYIB 2NV6A 4M0FA 1RPNA 4OAOA 2EBFX 1NGSA 2Y1XA 2CFTA 1DX9A 2NIPA 3FTFA 3F97A 1EK1A 1UBGA 4L16A 1O57A 2Y71A 4PZDA 1C7IA 3HP4A 5KNDD 3K4QA 2DR2A 3QLTA 3ACCA 4QGBA 5AYVA 1XMVA 4FB5A 1YI1A 1EFPB 2VKTA 3RC2A 3HYTA 2G72A 3FPBA 3T8YA 3L92A 4DMFA 4A10A 3DMTC 4CKZA 4N18A 5I8ZA 1Z26A 4AJEA 1VPVA 4NBRA 3ULKA 1OV4A 3GEEA 5DXFA 3TW0A 3HLYA 2F1JA 3ONNA 3L7OA 1PZHA 3K05A 3RRYA 5FWYA 1E18A 3H8VA 4DIMA 2X4LA 5EMHA 2XVXA 4G0VA 5F9HA 3ZGZA 1PZXA 1HE5A 1POWA 3EMKA 3HJRA 2I0FA 1KKLA 2Q3CA 4X6UA 5U4QA 4YWJA 4BVAA 2JBHA 3EPLA 1FRFS 4HDQB 1B41A 2WYVA 1M67A 3MCVA 4MR8B 4POAA 4WH0A 4EZIA 1G9TA 4M60A 2JJ2D 3KG2A 3SOZA 5KTYA 1GUDA 3ABRB 3JQ9A 2ZR8A 5CTJA 3IEVA 5ALVA 4EF6A 2FEXA 5IEBA 3CSSA 3QUQA 4AP6A 1RLTA 5KOHA 3G5LA 3HE3A 3ICCA 2A9PA 1WSAA 2GN4A 4F8JA 2J6IA 2X0RA 1JEEA 5LZ9A 3P45A 2F8TA 2ZG6A 4EYQA 1FZTA 1DV1A 1TZMA 3HXQA 2VJOA 3GCXA 2BEJA 4RTJA 3STHA 1GPUA 2DUMA 1AKMA 2PGXA 2Y8EA 3C8DA 4LZLA 4RK5A 3V7WA 4ZOQI 2B4QA 2OHOA 5F64A 1DC5A 4ND5A 1H2ZA 3ADOA 4BP9A 2RIRA 3WXBA 3AI3A 5JT1A 5KQRA 2FLKA 1Q7BA 4OGWA 1ZONA 3HEMA 2I3DA 4LXIA 3IQDB 1E2NA 1ZPDA 1E1CA 3SS7X 1GITA 3C1OA 2FR0A 4Q3EA 1WNFA 1NRJB 3W34A 3FPEA 3CT6A 3VO1A 3FOEC 1EUCB 4B7UA 3QLEA 3DOJA 3JWIA 1LBEA 1NPYA 1TTPB 1TAUA 2YDYA 3N5CA 3LYUA 2X6TA 5LYJB 2A3NA 3T12A 1W1WA 1GA6A 2QJFA 4OUKX 4ZYXA 1BX3A 1WEHA 3GRYA 1KP2A 2ZYDA 5K3FB 3O90A 2OAP1 2EWVA 1BX0A 3FCSB 4URFA 1BU8A 3CWQA 1TYZA 2OCBA 2W83A 3PGKA 2DFDA 2ECKA 2O0MA 1YRQA 4V0OA 1F14A 4XYEA 3IV9A 4OFBA 3BGVA 1X8KA 3X1XA 1D04A 2ACWA 2GJSA 3FAZA 2FK8A 2ONZA 5DVZA 5BPFA 5F23A 1J1IA 1JLHA 3O31A 5M29A 2VL7A 3C6MA 4UBOA 3JQQA 4DN6A 1F60A 2EZUA 4E2ZA 1VI5A 5A5VA 3JATA 4HYEA 2K5UA 2JIRA 1YFJA 1YIOA 3EVZA 2JIZA 3EIHA 1ABFA 1UDCA 2QN8A 4Q7LA 1WQ4A 1Z39A 4B2IA 4B6PA 2QAGB 3DPUA 4JUDX 2IZ1A 3L1VA 1WNTA 2GCOA 3L8ZA 4BNZA 2NUAB 4BFTA 2AG5A 1MOPA 3P20A 4QQKA 4AUMA 3FSEA 4YB8A 4J2HA 4CGYA 1L4YA 1RYBA 1IB6A 1DKUA 2PL1A 4NI5A 5C1BA 4DL9A 1MVLA 2O2ZA 2W6IA 3COPA 4N5NA 1J2JA 2QG4A 3GLFE 3RC3A 2NADA 2AX4A 3PFGA 4DY4A 4PZAA 2J9XB 3D3JA 4LYDA 5EESA 5ECDA 1TLLA 2BZ1A 2GLUA 1P5RA 2P1RA 1T15A 3LI2A 4L1KA 5JBNA 1M9NA 2H4XA 3EVTA 4R9SA 3NHKA 1XI2A 2I54A 4XJTA 2XF8A 4NYJQ 1IEQA 4UEJA 4BO0A 1ZGGA 3EEYA 3RSCA 1TD9A 2AG6A 2QRMA 3OQ6A 2C92A 2PWPA 4MP8A 2WEKA 1UFVA 3ZCTA 4F9EA 3AXSA 1LDMA 1NWCA 4JLUA 5CVDA 2VXBA 4NQRA 4R2IA 4K8RB 2AD1A 2BEUA 1FU8A 1MENA 2IT1A 3HL4A 5K3BA 3F7NA 3RF7A 5CDYA 4JASB 1E2EA 1RYFA 2PCLA 4DHEA 3DR3A 3G5UA 3BK2A 4IEEA 4NZYA 1EUDB 3D0OA 3TKAA 5LU8A 4QUHA 5EE3A 1HGXA 1VE7A 3GELA 2BR4A 1NDHA 3W5BA 2OPHA 2B0JA 4BJ3A 3FDIA 2CK3A 3BCUA 3EUFA 3LCVB 3MJCA 1CPYA 1QHXA 1V95A 1PQUA 3I72A 4H1TA 4DMCA 2NU8A 4DJTA 5ICFA 3T7KA 5JJCA 1E2GA 1EHYA 1UBOS 5DT9A 3ZUGA 2ODBA 4BN5A 2NU8B 3NC4A 3ZV3A 2D5AA 1B3RA 3LDAA 2H59A 2JA1A 4D41A 2XA9A 3DLHA 3A4LA 4ZEXA 3EMBA 4PFJA 1S7GA 3VZCA 5HJ5A 3K70C 1OWOA 2QX7A 5A1JA 1UOQA 4DMLA 4URYR 5JALA 1FJGB 1IN5A 4L07A 5E4YA 2R751 5CT8A 1EXNA 1HDXA 5HNKA 4R16A 4J3NA 3EC1A 3G2HA 4X60A 3NHAA 2PWYA 2ZKIA 1IU9A 1NT2A 3KHKA 3NHBA 1GCGA 1W4BA 5F33A 4ZXPA 3RFVA 1B8VA 3OX1A 3U7RA 4OM8A 1U8UA 1FDIA 2H9YA 1GKUB 4Z53A 2D1FA 3ZIAD 3VJRA 4JEUA 2IEDA 2V6BA 1X7GA 1FSZA 6Q21A 2RHLA 4Q3KA 1HT0A 5ES4B 2NU7B 3DMTA 1WKCA 3BHNA 3NH6A 5HFJA 3IDFA 1IOVA 2YJ3A 4YO8A 1F17A 2ZSUA 3D7MA 1AZWA 1IYZA 2R68A 4M9XA 4PEVA 3UC9A 5ILQA 3H5IA 5GONB 1CZLA 2YZ7A 3A2KA 4B3SB 3GLGE 1ENYA 2H9AA 3KQWA 3ICWA 4NAHA 5ADVA 3D0QA 3ANNA 2GJ4A 3KQPA 4G0NA 3HADA 1OSNA 2RGCA 5AIBA 1DQYA 1X14A 1A27A 3AHCA 3RTBA 1IFXA 5GGXA 2XMRA 1H42A 2DC1A 3RVBA 3E1GA 4BVKA 3DEHA 4WFIA 3C85A 4YMGA 1UAYA 1ZW6A 2XUDA 5IABA 1CJTC 4ROSA 3BJMA 1NHWA 4GC9A 4LDRA 3CNHA 4I55A 3C3WA 5K3DA 2HXSA 4X8HA 3RU9A 3SXUB 3Q6NA 3RFCA 3K9NA 5HKLA 1H94A 1R0KA 3EOBI 3GJ4A 4HXEB 3JZMA 4J0HA 4EH1A 2ZPTX 3JQPA 4FD3A 4M0MA 3BYZA 1ONSA 3D8HA 4XYMA 4GMXA 1VG0B 1IRIA 2DEUA 5IF3A 1NUQA 2H3EA 5ITSA 2D3WA 5FYQA 4D9CA 1DEXA 1R7RA 3CUYA 1UJ4A 3PJRA 1NXXA 1AB5A 2YV3A 2R6CA 3D4PA 1VHDA 3LCCA 1SOMA 4F60A 2PQ0A 4G9BA 3LLVA 3SBDA 4FDVA 4ITRC 3VU1A 3JV7A 5LJLA 1I14A 2P68A 1NVAA 3NT4A 1AY0A 3L82B 3W8DA 4D9GA 2PLFA 4ZI7A 5K0GA 1EP1B 4HZUA 1FX1A 2ZIGA 3HNOA 1WHSA 2PRYA 1IEWA 1JJIA 2IV2X 2Q1WA 4FZJA 2QRHA 3WMGA 1KSHA 1TO2E 3ZWQA 4ZJZA 4W5QA 1HDIA 3GFBA 4IHQA 3B1FA 2ZVPX 2HTEA 4RULA 1YHYA 3MBIA 1OLUB 1KIMA 1UMDB 4QARA 5EMMA 3BIOA 3HGTA 4YJ2B 4Z2YA 3T4PA 1YS6A 3I5XA 4J1NA 3PQ3A 5LA6A 3K6KA 3I1JA 5GOTA 1P2GA 4RK4A 1ULAA 3D8BA 4RK7A 4F9FA 4CLOA 4IV0A 3UTDA 5K03A 5TR9A 3O8QB 4BCDA 3D6JA 3UAZA 3L8HA 1RRVA 2PKQO 2WHRA 2X0KA 4WERA 4OI1A 3U81A 1U8YA 2W70A 3DNPA 3I4CA 3GVPA 1IHYA 3HUEA 3U4CA 1XK6A 4MS1B 2QRZA 4QJIA 3KS9A 4GOKA 1ADFA 1P44A 2RK3A 1EDOA 2NO5A 2WNSA 4GEKA 1DGQA 2FMHA 3BMOA 2F3QA 4G97A 4OOFA 5EQJB 3EY4A 4YP9A 2I91A 1OD6A 2ZI7A 1HEIA 1BVYF 1RR6A 3GJTA 4LC9A 1Y8ZA 5JDIA 5K0BA 4QBIA 1GFSA 4PANA 1VE3A 3ZWBA 4BEVA 1NXOA 1I3MA 2WD8A 2X23A 3LPMA 2BFEB 3O4IA 4OYRA 5FI3A 1KDYA 1XMIA 3CLUC 4RPCA 1H8HA 3C6ZA 3D54D 3PV0A 3VR4H 3T35A 4IICA 2BFEA 2AOTB 2RGEA 1HV8A 3L46A 4IIJB 2BEUB 4OXYA 3RT7A 3SOPA 1ZUNB 3ZS9A 1Q95A 1BDBA 3VNUA 3DOIA 3Q6MA 2ZAGA 4HDMB 5E6SB 3V32A 3HFGA 1EG2A 1PNTA 2PKWA 4UNQA 3UT5B 3C97A 5KKNB 3OKCA 4BRSA 3ONDA 1G4AE 1MTOA 1P4GA 1U6JA 1BO6A 3PTLA 1LX7A 5LDGA 2F7SA 1MB0A 3FPJA 4RJLA 4HWSA 5F1KA 4NZ9A 3ZH9B 4MH0R 3IUSA 1FFEA 4QJ5A 4OF4A 2X2OA 4EG0A 3IPYA 3PNPA 5BN3B 3ZVKA 1V1JA 1PUJA 2ATXA 1XZPA 4GPEA 1AGXA 4JJIA 5E8RA 2DPLA 3T5TA 1E94E 3H4TA 3R77A 4QUGA 2NOAA 4I66A 1D0SA 1XWFA 3PHGA 2QKYA 3PQEA 4RFLA 4N3BA 1BDJA 1L4KA 3TLMA 4F6RB 4ENRA 2ZRJA 2O1WA 3QUBA 5A5EA 3A7EA 5IJAA 1HURA 3L41A 4ROTA 4PFKA 2VPQA 4UAJA 3TZEA 1C0IA 3FVWA 3NKLA 2WFAA 3FWKA 2H1VA 4HX5A 1GAXA 1DZ3A 1Y9JA 4IRMA 3CA8A 2QVXX 3WG9A 4OI4A 2O2GA 1W44A 5C32A 4NTZA 1OJ7A 1XDZA 3DOHA 1CVIA 3HRKA 4Q9HA 2J3DA 1ZO8A 5BNIA 3EZNA 4MVJF 4XWKA 5IS2A 3QFTA 4G24A 3IP1A 3Q8XB 1T6ZA 4L6AA 3QEOA 4QPCA 4RF3A 5B6JA 1Q7EA 3DEKA 2IYRA 3DONA 5DYWA 1T13A 2AJBA 1W4RA 3EXG1 1ZITA 3QE3A 1Z4NA 2C61A 1SFRA 3D5TA 1MFPA 4M8NE 5AKJA 4LMPA 3HGQA 4TMVA 3SJ7A 2PLNA 2DY1A 4WY8A 1Q6ZA 4JUBA 2CDCA 5DGTA 1ESCA 1URPA 1NVFA 2F8LA 2V6MA 2EL9A 3NM5A 4UBKA 5AI9A 1R0LA 2KS6A 3IS3A 4ENSA 1QKJA 5GONA 3WRYA 1G66A 5EJ8A 1FP4B 1R5NA 1CETA 1CC1S 1FS5A 4GOJA 3SBOA 1ZP6A 5CEEA 13PKA 4ACBA 3D4NA 1XCLA 1MC5A 3KB6A 3HFRA 3MWLA 3K2IA 2X2FA 1O0CA 2H29A 3G5TA 1ZIPA 1X7XA 1Y89A 1A9YA 3E22A 3IQXA 2ECFA 1TTHA 1XEXB 2E1RA 3FPKA 3PUXA 2PMEA 2OC4A 3JD0A 3SZRA 1SOUA 1QUEA 3R9XA 2RIPA 1EK2A 1DAGA 2XF2A 3VHLB 4CFSA 4GT1A 4ABYA 4OUDB 4CN9A 1NLUA 3LFUA 1XZBA 1PTJA 3MQ4A 4AIRA 1Z0JA 1MRNA 2ZE8A 1G5QA 1FYEA 4FYYA 2FETA 2GJ9A 2GOYA 2P6OA 3MGBA 3KZXA 3OMWA 3OLZA 4ZKDA 4PCUA 1YF3A 2CXRA 4NCBA 1N57A 5H3LA 4YLYA 1KNXA 1OZFA 2F62A 1VMIA 2PMWB 1CDOA 3DYBA 2DTDA 3MFQA 3QHQA 4HKTA 1A76A 1CE8B 1OI3A 1IZ8A 2H4FA 2ZJ4A 3DHVA 3H9UA 5G02A 5T41A 1PT9A 2MDTA 1ZVVA 4ZVLA 3Q87B 1L8XA 3PUHA 4IJWA 3ZZ0A 1FTSA 1WKVA 1FX0A 4LVCA 5ALIA 4YTEA 4YDHB 1QRAA 1YS4A 4A2CA 4CM9A 3HMKA 2ZSIA 3C6KA 4I4TB 4CLRB 1RYDA 4Y7CA 4EVSA 1W4ZA 1ZUIA 3C3AA 4O4LF 4R1UA 2JLCA 3AJDA 3CH7A 2IH2A 5EHQA 1HT2E 4ZI3A 3UMJA 5KSZA 1EX1A 1I10A 2FZCA 2V6GA 2VCEA 1DFIA 1JHUA 1SCUB 3D3QA 2GFHA 4MWTA 3NTXA 1LDBA 3BGOS 5CK5A 5AM4A 4ZFNA 3DDSA 1I7DA 3VPXA 1Q84A 1T1JA 4C7OA 4KO1S 5KYVA 4B79A 1S2GA 1TVCA 1YB5A 3AOEC 1B0PA 4KMSA 4RLSA 4W1SA 2ZSEA 5KEIA 1YMQA 3E35A 1H23A 3L5KA 3HCWA 5P8WA 3UK2A 3WLLA 5TIIA 2VQSA 3W5UA 5A0TA 1R37A 4KXYA 2YFHA 3EGDA 4GDMA 3S70A 4G8JA 1XAIA 2KYRA 1G19A 5ALWA 2ORWA 4W5OA 1FIUA 3FCCA 5DULA 4D79A 5KSYA 1C7RA 1RP1A 7GPBA 1AMUA 3F5DA 2XTMA 4Z4CA 1NXVA 1CDEA 2CLCX 3DBIA 1D0IA 1XJCA 1E2KA 2YOFA 1SUCA 4QBHA 3FYCA 3DTTA 3MHPA 4G4GA 1CP2A 4H7FA 4C22A 3MTQA 3PFBA 4NL4H 5CFMA 5LQDA 2G7MC 1AZTA 2JIMA 3UTCA 3FCXA 4XLZA 4HRVA 4HWGA 1IB0A 4JJ7A 4NULA 1D03A 4FMDF 1ZK2A 3IEKA 4IKOA 4V24A 3TMAA 3PDJA 1S3SA 3OZTA 5JBQA 2DH5A 4FFSA 3DLTA 2YTZA 4XX1A 1C3OB 1KJ8A 1NA5A 2ZB7A 4HFJA 1JIQA 2A78A 4N6NA 4FGSA 2JIOA 3LQRA 4C0XA 4KFRA 2AS0A 1YDFA 4IIBA 1J39A 1QGDA 2J4CA 3BDAA 1PX2A 1DLIA 2H5EA 1BGXT 2Z5LA 5TF4A 3V4FA 4A23A 3VKVA 3CVOA 2WHEA 4XXHA 4ZVUA 2NZWA 3E8MA 1SBTA 3W05A 1BEZA 1Z4IA 2F00A 1FFWA 1RQLA 2D1YA 2R2GA 1IPHA 1RLOA 3I3OA 1PJ4A 3MCAA 4FLFA 1SR8A 3IVGA 1CY1A 1VKOA 2OXRA 3ZC3A 2WWIA 2EDCA 2OL4A 3F47A 2WWWA 3ZWWA 3LZCA 1FFYA 1Y5RA 2XYQA 4EO9A 1FJ2A 3A4MA 2XZPA 3I2YX 4KH1A 1QSGA 2QT0A 3KJXA 3AHHA 4G1BA 4W1RA 3PUKA 5LUAA 3AERB 3DAYA 1JHZA 5K6TA 2FK7A 4RLHA 1Y1SA 3FI9A 4JYPA 1RAEA 4RETA 1FQOA 3IBTA 4PZ0A 1SXPA 2VUHB 3W4IA 1MVNA 1AA9A 4YJ3A 4UKDA 5FYDA 3VX3A 3HRIA 5JAMA 4FMDB 1LBTA 1NUUA 4JHXA 2DM6A 3AVOA 4R1MA 5HMLA 4DLPA 3QVGB 1P6QA 2BGKA 1VL0A 3V8NA 3EDQA 2ZCUA 4ZI7F 4CZ2A 1ZS9A 2QQ0A 4E70A 4Z1OA 4E33A 1ADYA 1C7QA 1VSTA 5T6BA 4Y2HA 2FP4A 2O3SA 2Z6AA 3L0CA 4J16A 4OQFA 4DLNA 3WMWA 5ALRA 3CZ4A 1XDBA 1TJ5A 4P54A 4P2BA 3P19A 3AVWA 1KEWA 2X8LA 4EGQA 1UQRA 2WTXA 3QVXA 1SK9A 1DAFA 2BZ0A 1QYVA 4FFRA 4ZZ3A 5BR8B 2ODAA 3JR7A 1KF0A 2UZ3A 3P9IA 5DGCA 2HMTA 4RA9B 4U0KA 5DNAA 3T3DA 4CL0A 5BQFA 1NV9A 2E4UA 3L7NA 3TF5A 2OSVA 3G7UA 1LV8A 2C78A 4UU1A 2BMWA 3INRA 3PQ4A 1DCTA 2B61A 3GLHB 2OUKA 3DVQX 4XJVA 3QXJA 1XDGA 5AICA 5EIFA 4Z54A 4Z3DA 2MYPA 3GDFA 1JMVA 1Q77A 1ZWKA 4GPAA 1S2OA 3HJTA 3LUDA 4JKOA 4OQLA 3HDYA 3AKZA 2Y0PA 1SOWA 5KKAA 2V55B 2FRVA 3AKEA 3RRMA 3OZGA 1AK9A 4BUZA 4B5KA 3A2MA 4QREA 3EXEB 1US8A 2XPCA 2ZTHA 1XAJA 2X3UA 1P7CA 2RGUA 3PNBA 1NJGA 1WZIA 4NR0A 3O1LA 4H7KA 4N0QA 2YY6A 1TX4B 3L0YA 3FOBA 2OLJA 3OQNA 1JWBB 4CEIA 2FRDC 3DV0A 4MWDA 2I22A 2WMOB 1KHHA 4MLDA 5EJ9A 3N0VA 1E0AA 4I1OA 1U7XA 1N8TA 2QEQA 4PS1A 1GQYA 2NZ8A 3I0NA 2VNJA 4OGFA 1USGA 4AJLA 3I04A 2H17A 3D3WB 5KYTA 3GNQA 1UC9A 1W0KA 4JNKA 3DT6A 5L7YA 4MS4A 4XX0B 3KZKA 1LJ8A 3MD0A 3CLRD 2VA8A 3TAHA 4KHPB 4IFTA 3DL2A 3EQ2A 1Y4DE 2BV3A 2O0HA 2QDKA 4RELA 3GPLA 1BEUB 2P2CA 3A3KA 4N9QA 4HQOA 1B6GA 5GJWC 3HXOA 3LYLA 2UZAA 3TFOA 3FBTA 1U7TA 1I36A 4Q7KA 2ZSFA 3PU6A 1Z0FA 3D6UA 3I5AA 1O94C 1GGKA 1QFJA 2YQ4A 4XW2A 5JARA 2Q21A 2ERYA 2WF9A 4YJKA 1FYVA 4M88A 3BXEA 2YJNA 5CYFA 1JG1A 1O97D 2J32A 4OFXA 3AOEA 1YZVA 2UDPA 3HDVA 4BUJA 1S1CA 1HQCA 1W4AA 3EGDB 1E5TA 1QAOA 3FTPA 3QXXA 4F21A 3GR6A 5ITWA 2VJMA 1G9XA 1ZYUA 2DBYA 3GGGA 3CE9A 3JX9A 1WB9A 2FEPA 1OQAA 4AI6A 3DHWC 2VDOB 1BMTA 3E0QA 1RRPA 2RBGA 5EWJB 4DV4B 2GF0A 3UANA 3VGJA 2Z9BA 4XVHA 4KREA 4DFDA 4ENUA 1SEVA 1VYUA 4KW7A 4MW1A 4UDYX 2Q27A 1U8CB 1DKQA 4HZUB 1ATZA 2GK4A 3SQMA 1ZA2A 4JJ6A 4BNWA 4I99A 2IOFK 1DT5A 4C4RA 1CULC 1FS4A 2NNLD 2DVMA 2HK7A 4FFVA 4PRKA 3TN7A 4MV8A 2YWCA 1VIDA 2JH9A 2O20A 4G0OA 3ZDBA 1NM5A 3A6KA 3K9GA 4YP6A 1SHTX 1Q0ZA 2C1XA 2P9YA 4NHEA 4AB1A 1U0GA 4EGSA 1YZNA 4FOTA 3HB0A 1DG9A 3M6FA 4XWYA 3U2QA 3VSCA 2D4AA 2PZ8A 4CMGA 1F4VA 3GWZA 4HN4B 2QTVB 3TZQA 4OGGA 7YASA 1RXUA 2PZBA 4Y0NA 3SXJA 1AJEA 4S2UA 3TCKA 1N0IA 4XD2A 4HUQA 4DGSA 1YS2X 2OFWA 2DFLA 4IX1A 2EX1A 1YGYA 4KK4A 4S24A 3ZJYA 4RE6A 2CY0A 3REQA 4EHBA 2CE2X 2DXIA 2FH5B 4WCFA 1O9BA 4O63O 5TE9A 2YQZA 1CUDA 3EVCA 1KZ9A 1JDVA 4KQKA 2IUTA 1YJXA 4OLAA 1OFTA 3HXMA 4L8LA 4PY2A 3ZDQA 1GQFA 1UP4A 1JIUA 2XWSA 3BICA 3IV6A 3NYIA 2BEVB 4GLLA 3KETA 4IQ4A 5A3JA 3LT1A 4MQBA 3M81A 1R4MA 5KOIA 4GWLA 3RIXA 4I19A 4BX9A 4MHTA 2HL6A 3UKOA 5E2IA 1EFLA 2BW0A 3IT3A 4WXEA 1JQDA 2ZWVA 2IVFA 1R2QA 1EX7A 1YI0A 2FDRA 1M0EA 2VYCA 2OB2A 3DVLA 5A0FA 3TOXA 1G18A 2VZ8A 1UZLA 4UW9A 3G3EA 4JAVC 3DGEC 2HA0A 5CYPA 4ZEWA 1QG2A 1EQ2A 3A27A 1U28A 3VYUB 5KBYA 1J8DA 4P36A 3T1VA 1YWGO 5FL7A 2O23A 5FFFA 2JRLA 2XOKA 3NFRA 4E2FA 3G7NA 3FCYA 4PNHA 1I2AA 2YOHA 3P9NA 4LDQA 3VH3A 1KEKA 1WF6A 3L0BA 5JI3E 1X9HA 1K0UA 1MV5A 1YMVA 3LUAA 3BJEA 1XTVA 1IBRA 2Y1KA 2BI7A 3WA6A 4Y2RA 1E61A 4AY4A 1MNQA 2R79A 3PX3A 3IVCA 4J76A 1PS9A 2IXAA 3N9IA 4L4ZA 4MUMA 2GEUA 2Q4RA 3GBVA 4G84A 1EP2B 5KWJA 4TXJA 1KQ3A 3GRKA 4PC2A 1I8TA 1PUIA 2G5PA 2WU8A 1QV6A 3AB3A 1A5SB 2ZJ5A 1JALA 3G85A 3JTMA 1UK7A 2GCNA 2J4FA 4XGIA 3IPXA 5AKEA 1OY1A 5L3SB 1Z7EA 1NW5A 2VPIA 3FNBA 4G1CA 3HA2A 4RABA 5GADl 2JIDA 5A5GA 1L5ZA 1VYHA 2AJLI 4UATA 2Q3LA 5JDIC 2JI6A 5ILOA 1RXWA 3PFCA 2FUEA 8ABPA 4LF4B 1QFXA 4N3AA 2CL5A 1BNCA 4Y1EA 1TT5B 4JUFA 4PFSA 4Y2TA 1IQ0A 2G6TA 1R74A 2D62A 4KPGA 1C8BA 1GGMA 1ZH8A 3W3AA 3B2EA 3DV0B 2XBMA 3B5EA 3G2MA 2BR3A 4IIDA 2YBDA 4R8KA 2VHWA 3UC5A 3UJ9A 4BC0A 4QNMA 5CB4A 4OM7A 4DRYA 4L9RA 3KO8A 1P1IA 2FRDA 1IK4A 1WMAA 2CLKB 2P9QA 2VG8A 2ZTSA 2ZT6A 4OQDA 2I3ZA 4Z3KA 4KAFA 1D8AA 4J4TA 2OP1A 2JLVA 1EGHA 1W0JD 5TSDA 1JRLA 3STUA 1MX3A 6AT1A 5EKUA 1O95C 1E60A 2V7QD 4ZZ2A 2YASA 1A9ZA 4AG5A 4B6OA 2I80A 1X7XB 4I2NA 3KXDA 4EATA 2FPWA 2ZUFA 3ROEA 5ALYA 3M0EA 2YOGA 3EDYA 3B1WA 5JS7A 4OHCA 2DWUA 5C1OA 4QGSA 4C4OA 1KZGB 3A9SA 1E1CB 5DZSA 3MINB 4LJRA 4ZYYA 5CCBA 1DAPA 1E7SA 2DFTA 3GH3A 3BZWA 4OQQA 4RY8A 2AW5A 5DWQA 1DKNA 2UYOA 1KH1A 3AY7A 2I78A 2XNCA 4DNOA 4IGEA 3VXKA 4IDNA 4BEJA 2VJMB 1H9CA 1O5OA 2XCUA 2AUMA 2YN2A 4CR8A 1YZQA 3LDGA 2PUFA 1XXLA 4A26A 1ND6A 5LKAA 1GXSB 1P2SA 3F96A 1LLCA 3G1WA 1Y3AA 2EZTA 4QO8A 1P4HA 2JGLA 3U4QB 1P0PA 3B5IA 2HRBA 4E07A 1NOIA 1VGRA 4DZTA 3JAMA 1CXZA 4CODB 3W8EA 2AN9A 1Z5PA 2IC5A 3LECA 4KN8A 4DPMA 4ZIRA 5CJJA 1I4OA 1XU4A 3RHTA 3WRYC 2VQEB 4NK4A 5FTKA 3O1HB 1OJLA 2FUNB 1X87A 1CJBA 4GQIA 2VYFA 4F3TA 3CLTD 1Q2UA 4I50F 1B7GO 3ZNOA 1XTQA 3GLIE 3O9VA 1K9SA 4YT5A 2VDVE 4TV8B 3FJOA 3GJ8A 1P2TA 3V7YA 2ZI3A 2NU9B 1AKWA 4MV5A 3MTBA 2XZOA 5AVOA 1KL7A 2EW1A 3ELBA 1W48A 1H1LB 2NZXA 1PL0A 3I9V1 3JD2A 4KDRA 5LQCA 2PUGA 3NBQA 1MAAA 2FG6C 3U9TA 2AK2A 1VRCA 4UXIA 2DMRA 3LWBA 3GFTA 5G1OA 4HYYA 1XXHB 5DBOA 1J0DA 2ZI9A 3COZA 3T1HB 4D0LB 4NCNA 5LU9A 1X8XA 5CNKA 3CNBA 1GNTA 4D0RA 3I1YA 4MQUA 5IBQA 3TGWA 1T1RA 4XFKA 2VBCA 5E4TA 4FOOA 2GVZC 4GU5A 4HNAB 2KWIA 1QH0A 1OVGA 2OBYA 2RJOA 4ITVA 5E2AA 5ECGC 2I55A 3EBPA 3MTJA 1Z5UA 2ZT7A 1QE3A 4BMOB 4EJSC 4MXDA 1RVV1 1Y1QA 4HUJA 1M7HA 2W4QA 3F7TA 3NIWA 2GWHA 3ENZA 4K3UA 2H92A 2QRLA 4BMCA 3UXHA 3SJCA 2E4ZA 3RKUA 1TZJA 2CHGA 2HDNB 2ZYHA 4E4TA 1BXRA 3AY0A 2XKBA 1G55A 2YUIA 3G2QA 1N7HA 3KR9A 3Q9NA 2H6EA 3ZHBA 5JFTA 4PLWA 3TRIA 4QWMA 3JARB 1ADGA 2OPBA 3HVIA 4YT4A 5LOVA 2OQIA 5KX5B 3TL3A 2DWCA 3W9YA 4RIFA 3OEHD 5I7FA 4PHHA 1HLGA 4YPVA 3NRBA 3OEYA 4BMPB 3GN2A 2C2GA 3QFRA 4IR7A 4K46A 4WN9A 2O8FA 4JD5A 3FYSA 4OBWA 4R3NA 3F4LA 4KRXA 1T9ZA 3BCSA 3DQQA 3D7KA 1V8BA 3Q98A 4KQ6A 2Y9MB 1L4MA 1E6UA 2TRSB 4Y7DA 3FB1A 1KI8A 3QU7A 3AF0A 4BPRA 3A10A 4LVOA 2XWBF 2YMLA 3WGLA 1K5GA 2L18A 1Z6TA 5CB8A 3A25A 4K9MA 4RC9A 5HF9A 4QDUA 2NN3C 4F86A 3L7CA 1AKQA 1TM1E 1GARA 5ALLA 4BE4A 4O4IB 3VR4D 3ZGXA 5G4KB 4KWHA 4Q1AA 2ZTLA 1HYBA 2C95A 2PRKA 2HGSA 3C70A 1XYVA 4KH0A 4G07A 3NJRA 3W4KA 5LIPA 1NBEA 1E3TA 2QTLA 4MWZA 1LZLA 3QEMB 5IEJA 5K1ZA 5BMVB 1LLUA 1OBOA 1P2BA 4TWBA 5E0KB 5K20A 1H2YA 5J4HA 4WNIA 1KI1A 1OXTA 2MR5A 2R1VB 3TTUA 1RJGA 3VSBA 4DQVA 1B0UA 1ZJ4A 3H0CA 3LC0A 2VBFA 4CT5A 1ZR2A 1R9NA 2NNWB 2Q8QA 1GL6A 4FHCA 1ZVMA 4PX5A 4R9VA 1JS1X 4QYWA 4R8SA 1ZI8A 5B3LA 4G3XA 1P9WA 1WW3A 3PX2A 1QTNA 2BUAA 4LZNA 3ZEIA 1BE6A 1HI9A 3FSJX 4LNHA 3WGMA 4D9JA 3UMMA 4B3RB 1CUZA 3L8EA 4H4DA 3IR6A 5CCDA 1KE2A 1Q0QA 4YQFA 3DTYA 5AKLA 821PA 1G8AA 5HF8A 3L9XA 4ZREA 4IIVA 5I9BA 3HJBA 4HC4A 3TXAA 3JYOA 3N2GB 3GBSA 2GPBA 4QQNA 4A5SA 1KE1A 2PQ6A 4PX3A 1E7QA 3IPLA 4MMXB 4BU0A 4Y2GA 2QAGC 2BGTA 4FR2A 3WLPA 1MXFA 1TEZA 2WR8A 5SY6A 2I6FA 1ISIA 5F9MA 1L4UA 4U2KA 4EY4A 1KVQA 2IOQA 3JZDA 2JVIA 1E3JA 2Y1WA 1RBQA 5KAPA 5CB0A 1H8EA 4NHOA 1X7DA 4OUDA 4AKHA 1KK0A 3LOQA 5THKA 3NYQA 1P39A 2P6UA 3IPCA 3FNRA 4OH1A 4D9MA 1VIMA 3S29A 5DHTA 5LXTB 1VLVA 2C2YA 4KV7A 1BGWA 2CZGA 2W2LD 3ORYA 1VJ5A 4Q4JB 1MABB 2COUA 3B38A 3B52X 1PQWA 3DULA 2J3JA 1GLVA 3KQHA 2AJCA 1FDVA 5HKBA 1RPJA 3U31A 4CE6A 5TC4A 4BQRA 1JFTA 3A9TA 3LWDA 1U11A 3CX4A 3ELWA 4B9EA 1OGYA 1QP4A 3Q8MA 5FV4A 2A3RA 2NG1A 3VNQA 1G291 1WMSA 2GA9A 4GGPA 3B7WA 2H1SA 3BE5A 1H2AS 4YY3B 3BHIA 4HX2A 4PNEA 4IIFA 5F7JA 5KJ1A 2Z0MA 2EF1A 1F8YA 1UKAA 3VDNB 4EB8A 1Z36A 2HJRA 3UZUA 3WKCA 3NBMA 2WWHA 4BY9E 1REQB 2HHCA 1OX5A 5CDHA 4XB1A 2OYCA 2CYCA 4QDJA 1MOQA 3IURA 4CQMA 1NNI1 1OLXA 5IXJA 4TUYF 1F6BA 3EB9A 5CJPA 2PUAA 2L2QA 4I4TF 2ZDHA 2BBTA 2NSHA 1ML4A 2XNDD 5ALKA 4PAOA 1K6MA 4REMA 1M1NA 4RK1A 5FQNA 3A9RA 2HDOA 5GAJA 1QIKA 5K0TA 2XUJA 4B40A 3D4IA 1VL8A 3OZIA 1DQRA 3TDMA 2JPDA 2I7VA 4DUGD 4LF6B 4C7KA 1BVRA 3IMKA 2IHNA 1T0PA 1DRVA 1YDGA 3CY6A 3K1ZA 1M6WA 4HCJA 1VE9A 1U28C 4NFHA 4JP3A 4JBNA 3B6JA 2YY7A 3M6WA 5JH7B 1X7WB 5JS6A 3GOQA 1T8TA 3ROXA 3ETHA 3I39X 2ODNA 3SZMA 1MRZA 4GS5A 1FLNA 4ARVA 4ILEA 3RYIA 4C1NA 3G8AA 3ZLVA 3TLZA 3HK2A 1WA5A 4HLUC 3ZDDA 5KC9A 3DCYA 4J7CA 3REQB 4BTLA 3JZAA 1T6XA 4YQEA 2Z8ZA 1YULA 2R4QA 3HVJA 5IVKA 5JU6A 4BBJA 1O94D 2IBTA 3OJCA 2DE0X 3PC3A 1MQ8B 2PYZA 3B70A 4OP1A 3MMSA 1X13A 3CLSC 3RHFA 2VCHA 1MJGA 5B1EA 5CDGA 1O97C 2XYGA 3LMKA 3E2PA 4S0ZA 3K1YA 1N8KA 3I32A 4HY3A 1ELOA 4A03A 2WB4A 3CCFA 1EFVB 1ZL2A 1J2TA 2IA5A 4LHWA 1TRKA 3FNFA 5BSWA 4HXFB 3H6KA 1R9JA 2C04A 4YLGA 4ZALA 3VO2A 2YIDA 1MQ9A 3GMTA 3GXOA 1R64A 4OLHA 2GVDC 2CVQA 4O4IA 4Z9BA 2Q0QA 4NOJA 1Y6RA 3WWPA 1KWKA 1QTRA 3G8DA 3P26A 1FNCA 1GKKA 1ZH2A 4N5IX 4V2IA 3W4JA 4B3IA 4DA0A 4AKSA 5TNXA 2QTTA 3Q3HA 3R5KA 1ZG3A 4CM1A 1HE1C 1JECA 2OZPA 3DCNA 1OF1A 1NX6A 2ZBQA 2J3QA 4PM4A 5FTMA 3FOCA 1PO7A 1FFDA 3KLPX 3UGKA 4G86A 1SZJG 3RVQA 1D8TA 2J0EA 1G0OA 3SWWA 4OBEA 4PCLA 3OQHA 1NM5C 3KSUA 1VJGA 3HUUA 2IZZA 4IXDA 4J3JA 4M8IA 5DHRA 3VR2D 5KQGA 5C4GB 2R1VA 3UCFA 1HQYE 4G1UC 3EEBA 4Q12A 3ZVLA 1BU5A 3L18A 3DMGA 4RIIA 4CF7A 1B2LA 1JSZA 2JW5A 3CXUA 5AJZA 1CF2O 2WVAA 3ZD7A 4RKYA 1PW5A 2ZRIA 5KYXA 2A2ZA 2EVWX 1LQTA 1VLHA 3RC9A 3U3DA 3UCXA 4JI4B 4YRPA 4JI2B 1KPHA 3INYA 4YGYA 5J43A 3F0TA 5KSWB 1P60A 4WVLA 3U7GA 2MJLA 1MJHA 3D9QX 3Q2OA 2G07A 1BEEA 1P17A 1BMFD 1PAUA 3WS7A 4HAIA 5HCNA 5K6AA 2H57A 3CO0S 1FCJA 4RKRA 1OKKA 1SCDA 2AJTA 3ZK8A 4PCVA 4QEZA 3ZCRA 4C14A 3GEDA 3WHPA 4Q21A 5TF0A 1MJ5A 4R41A 4ZYUA 3EE6A 4WQMA 4RD0A 4D4HA 1T0BA 2FSVC 1SC6A 1ETHA 4M54A 4PXYA 2I4NA 1MEEA 4QOSA 3WFIA 2NQTA 4ZAVA 1HDYA 2NUTB 2PWZA 4OREX 4EW3A 4PLHA 5B12A 2IU3A 3OZWA 3PDHA 1N0WA 2QZ9A 3AZQA 3W3AH 3VZPA 2BELA 1XJ0A 3TZLA 4FEAA 1L7DA 2PU7A 4EBBA 3O5AA 1RJDA 2FOXA 4RDHA 2EFHB 4L9AA 4RF2A 2VT3A 1B74A 4YECA 4R68A 4V02A 4UU8A 4KI0A 4LJ9A 4UUPA 4W7SA 3HC7A 3W3ZB 2AN5A 1J8QA 3ORHA 2VHYA 3T3EA 5JDCA 1YJQA 1UPUA 1NBAA 1EJ2A 1JG4A 4C4PA 1H4TA 4XQ9A 2O7NA 3QEJA 3OCVA 4FGKA 1MP0A 4NMHA 5JXJA 1DAOA 2AFIB 2AOWA 3K30A 1UMDA 3NRCA 4ZAFA 1E3MA 3T0IA 4JELA 1W34A 4LY3A 4ZMSA 4BVLA 3KSDO 4UMVA 3FSGA 3ND8A 3GNTA 5LD2C 3OQIA 3WGJA 4F9GA 1WULS 3FI0A 4RXMA 3R76A 5AW6A 4KXXA 3L6BA 2V7WA 4Y2UA 3K1AB 4PN7A 4XEUA 1E2HA 3TSCA 5TT1A 4DIBA 3K96A 2G9NA 3LQ1A