4CM1A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 93
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm1A00
5ILOA 3KZVA 4PG7A 3DZJA 5BNFA 1B26A 2RHRA 1T4DA 3RIHA 1YRLA 4XX0A 3E9QA 1LC0A 1M6WA 2O3TA 3H7AA 2Q1SA 4XEHA 4EZBA 1JAYA 4DQXA 1NQOA 1A27A 3D4PA 2VHYA 2HK8A 5A5EA 1E7MA 4R9SA 4Y6PA 4ESOA 1YS4A 2P4QA 3U62A 1CJCA 4ALNA 3K6JA 4E30A 3DMYA 3E9NA 4XGNA 3RKRA 1U8FO 3CKYA 2VUUA 3P5SA 4YCAA 4L9RA 4OXNA 3ROKA 1HF3A 1HDCA 1H94A 1KY5A 4J4HA 4JNKA 2ET6A 3F3SA 1ID1A 4BNUA 1NASA 4HBGA 1ENPA 3ZU4A 4NU6A 5A03A 2EHDA 4J3FA 5T8KA 5C5IA 2WYWA 3NJ8A 3KYDA 2DC1A 2D5CA 1QV6A 4WPGA 1U2DA 3JQ6A 4HKTA 3ZNNA 3KUXA 4BMVA 2A9FA 2YDXA 1H0KA 3B1JA 3QY9A 4GAEA 1ADFA 3V1UA 1JDJA 2JFFA 4L4RA 3UAGA 1E3LA 3WR5A 1YL5A 4YJDA 3GC6A 4BNTA 2HDHA 3FSRA 1XHLA 2RH4A 3GFGA 3PDUA 2CZCA 2IYPA 3RUIA 1RM5A 3UGKA 2WD7B 1YB1A 4IJWA 3I3OA 3H8VA 3VH1A 4BV9A 3PYMA 3GN2A 2I3GA 5JDIA 1I10A 4CM9A 3HDJA 2DTEA 3PWZA 1A9ZA 5IG2A 1K89A 2DVMA 4ILKA 1OI7A 2PV7A 3PWSA 5B37A 5IZCA 3SVTA 3OICA 4B8ZA 4NBVA 1MXFA 5CDUA 4PRKA 5ER6A 1EQ2A 4BV8A 3U3XA 3FHLA 4NZ9A 1DEHA 4BNVA 2OFPA 4IBOA 1QSGA 4M55A 3ZWMA 5BSGA 1CEQA 2Y1FA 4GKBA 4KMSA 4E5PA 3TJRA 3ZHBA 2VHXA 5BR7A 3L6OO 4DGSA 3RC7A 4K26A 3LYLA 1YH3A 5C7LO 1X0XA 4PZCA 1IB6A 4WCFC 4XJTA 5TGDA 1HLPA 3AY3A 1PS8A 5JXWA 1KOLA 5K6AA 2HAEA 4FQ8A 4CQLB 5T64A 1ARZA 1MX3A 4IJVA 4J16A 4YXFA 3R6DA 2FR8A 2G76A 4EYEA 2DBZA 3W8EA 5T6BA 2NU6A 2EWMA 3EC7A 1VLLA 3WSVA 4YDRA 4BNJA 2DPGA 3DAGA 4CMEA 1I30A 2D8AA 3WJAA 4M1QA 1PR3A 4PLFA 4UUMA 4D0RA 2FR0A 3WIEA 3W4KA 2Q50A 4NQZA 2PFGA 4RZHA 3RCBA 4H3VA 3NGLA 1JAXA 2QIOA 3NV9A 1FXSA 3BMCA 1MUUA 4AG3A 2V6GA 1JLLA 4OXKA 1HLDA 2TMDA 2GDZA 2FMUA 4IJKA 3TOXA 4XB2A 2NVUA 4M87A 4BB5A 5JO9A 1GY8A 2YV2A 1UDBA 1Y8RA 2SCUA 2QZ9A 5DDIP 2B4RO 2CVOA 1GEGA 4NBUA 4DYVA 3VZQA 4BO7A 1T2EA 3PP8A 2O7QA 2VYVD 5JAZA 4ZQGA 3LC1O 3GF4A 4R16A 5KJEA 3E5RA 2NVUB 2OZPA 2ZJ1A 4YRAA 1U3UA 2AQKA 4WE3A 1QR6A 1F14A 1QYVA 1LXCA 3NT2A 4OQZA 4YAKA 3OMLA 3L07A 4GKVA 3AM5A 2BH9A 4TZKA 1DIBA 5IN5A 2YYYA 4BHTA 5KNLA 4NI5A 2W2KA 1RM3A 1CRWG 3IP1A 1Y7TA 3WB9A 4CLOB 4OL9A 8LDHA 3CZMA 4DC0A 3D4OA 2GZ3A 3ZWBA 2DUUA 3AOEA 3ZI0A 4C7KA 1C1DB 1ZEMA 4YJHA 4I08A 2W2KB 3Q11A 1ZFNA 4J1NA 1QLHA 1HZJA 5DF1A 2JL1A 1DBVO 4FJ0A 1PWZA 3OJFA 2FP4A 2E82A 4I5GA 4BB6A 2AE1A 2B36A 4GX0A 1GV1A 2IYOA 1BMDA 4WASA 2BD0A 2X6TA 4YJHB 4CM4A 2OXIA 1B3BA 2IE0A 2VYND 4IXTA 1VKNA 4OKNA 5ER9A 4BMSA 1ENYA 4CMHA 4BO9A 3PLRA 4K6CA 1VJ1A 4AJLA 4DTIA 3GZNA 3GMSA 1XYGA 2IZ1A 1Q7CA 3C24A 4HY3A 2NTVA 3VVCA 4CM1A 1ZMOA 1EVZA 5ENVA 1TB4A 4OKIA 5A9SB 2EG9A 3DAFA 3R3SA 2EGGA 4Z0TA 4PLCA 2ZTVA 3FCOA 3E18A 4MVJA 4B4UA 4CLEA 4R3WA 3BMQB 1R0SA 3OJLA 3FNGA 2VHWA 3CZRA 1DOHA 1PJCA 3QWHA 4YWJA 1KVUA 4D43A 3F4LA 4B79A 4XYMA 1HDZA 3O8QA 5JAIA 2PK3A 2NNLD 4IJUA 3WMWA 4NJMB 1KVTA 2O50A 4XZ3A 5G0SA 4M89A 3ZU2A 1E3EA 2C7GA 1EBFA 1ZEJA 4IY1A 1N2SA 1NPTO 4EBFA 5L4LA 3GGGA 3OQ1A 2BFMA 3OEWA 5CPFA 2GD1O 3HDYA 4TVOA 4AJKA 2QQ5A 2RAFA 4HXYA 3KV3O 3JQAA 4OIMA 1U5AA 4TKLA 3PI7A 5L53A 1PZHA 1GADO 3QIVA 5F21A 3WNVA 4L76A 1PTJA 5A5FA 4DPLA 2GN4A 1VE9A 1U2GA 3LU1A 4PG8A 4M86A 3F4BA 5JYEA 1UXGA 4CL8A 2NSDA 3NKLA 5TX7A 3ONEA 4Q3NA 5B1YA 1UZLA 4DLLA 3CMMA 2VT2A 3ZH2A 4OSPA 4WLUA 3M2TA 3DONA 1MP0A 3RKUA 3TZKA 1CQIA 1VJTA 3ADOA 2CY0A 2OP0A 4CUZA 3LT0A 3MOGA 4GVXA 3I4FA 5G2OA 3FRJA 2G1UA 1R37A 2FSSA 3OECA 3M1LA 4ZU3A 1YJ8A 4IM7A 5F1KA 4LCEA 3KBOA 4N5NA 1U3TA 1UAYA 2IXBA 5KTKA 1C0KA 1PQPA 1NWHA 4H15A 1JKIA 2QX7A 4A73A 3QWAA 4AJOA 1E6WA 2QW8A 1KVRA 1IUKA 2RH8A 5AXBA 1GQYA 3KSUA 4GMGA 1BRMA 4OGWA 3FNHA 4FCCA 1VI2A 1VL8A 1PL7A 3BTUA 4RLHA 1IL0A 2P91A 3PHJA 1DC4A 2YW9A 3GUYA 1HYGA 4WCFA 3GGOA 3VH3A 5FI3A 3D4NA 1Y81A 3V1YA 4UEKA 2GSDA 3ZN2A 3JYOA 1DSSG 2QZZA 3FPLA 4TRJA 3H3FA 2D3TA 3NGXA 4ID9A 5DNAA 2BKAA 2Q3EA 3QVWA 4Q3AA 1HDOA 4ZRMA 4CUJA 1P3DA 4LVCA 5KVVA 2X58A 3NDIA 1E3IA 1PEDA 2AA3A 4ZHSA 4JBIA 5A04A 4PLVA 5AVOA 5ADHA 4OXYA 1Z7EA 1SAYA 3TRIA 4M49A 4TRNA 3UKOA 4CM3A 3AW9A 4IGEA 3HFGA 2FPIA 6ADHA 4MIOA 5COAA 3PQDA 4Z3DA 2EGHA 3RAJA 3GLQA 1DPGA 1LDNA 1ZK0A 4BKUA 2PGLA 3INRA 1K6XA 3SLGA 4BO6A 4E3ZA 2FPGA 3U5TA 2XPCA 2ZTLA 1LSUA 3DOJA 1QXSA 3HQ4O 3D3WA 1BXKA 1EBUA 2LDXA 3NT5A 3OIGA 4NU5A 4F46A 3SEFA 5F5NA 3I6QA 4JN6B 2NVWA 3DBRA 3EHEA 1DFIA 5DP1A 2F1KA 2IDZA 3DTYA 4L0QA 5TC4A 3K8ZA 3X2FA 3F46A 4N54A 2HRZA 3RU9A 4F45A 1JQBA 4DMMA 1E7SA 4LVUA 1WAMA 5H82A 2DBVO 4XD2A 3M1AA 3TZ6A 1BXZA 1U5CA 2NTNA 1Z6ZA 2DM6A 2EW2A 3DBRB 1F06A 2V65A 2ZB7A 3PFWO 1GCOA 2NUAA 1GUYA 2H6EA 4B7UA 3HADA 5U1PA 2GN6A 1W8DA 3ETDA 2TMGA 4UUPA 3ASVA 3JD2A 4LMRA 4KUEA 4PLPA 3W4IA 4CM8A 1WDLA 2EEZA 2H63A 3TOZA 2BLLA 3WBFA 5L7YA 1ONNA 5L4SA 2H5LA 2O4CA 4LSWA 4E2YA 4ZICA 2V7PA 4BKRA 3DWFA 4CM5A 4O1MA 4ALJA 1WPQA 4EUHA 1M75A 1E3SA 4JCOA 1MG0A 4A03A 3G0OA 1DC5A 1JTVA 1FDVA 3GG2A 3UN1A 1PQWA 2HMTA 5IDQA 1YL7A 3ZWCA 1B14A 4UVHA 3WGTA 1K6JA 2JCXA 1XELA 4D3DA 1XQ6A 2YV1A 2Q49A 1LSOA 2X23A 3AFMA 1Z73A 3CTMA 1N92A 3HWRA 3GDGA 7ADHA 3H5NA 4J90A 4ND5A 3Q9NA 3KETA 1LC3A 3K30A 3GNSA 4GVLA 1M2WA 3HE3A 2X5JO 2Z5LA 1WZEA 1YQGA 1J49A 1GZ4A 1K6IA 4CR8A 5DP2A 4AJEA 5GZ3A 1IY8A 3ZV4A 1GYQA 1M67A 2WSBA 3INGA 4HP8A 4A27A 1EUCA 1J6UA 1UP6A 2GPTA 5CEJA 1U8XX 2Z1MA 3PYXA 2WJPA 1P1IA 1H6BA 4AJPA 1OAAA 3HUDA 1ML3A 3JQGA 5KKAA 1D8AA 2VRCA 4KQWA 5TS3A 5FEUA 1VSUA 3KEOA 4A26A 4GLLA 2OMEA 1PZGA 3DMTA 4TRMA 1N5DA 1N7GA 2Q2VA 2JJYA 2V6MA 4LISA 3SC6A 3ZWAA 5JMWA 3PDJA 4BNIA 3AOGA 3PGXA 3A06A 4CQMA 2XF8A 2UUOA 3JD3A 1VSVA 4JBHA 2C54A 2R6JA 3CEAA 2JFHA 3C85A 3KEQA 1BVRA 3DOCA 4RVSA 4IDFA 4XQ9A 3LF1A 3U49A 2QYTA 2O7SA 1M6HA 1DRUA 2D0IA 1XGKA 5LDGA 5GMOA 3DZBA 3JQCA 2WWRA 5C7IO 1HRDA 1G0OA 1EK5A 2ZKLA 1IPFA 1C0LA 2YV3A 4PG6A 1J0XO 2DAPA 5JDIC 2OP1A 4YRBA 2C20A 5IZCC 3ANLA 3RC9A 4DREA 3LT4A 4INAA 4N18A 1P74A 4ZA2A 1NVMB 3EZYA 4RORA 4J1TA 1BSVA 2ZTMA 3HDQA 1ZXLA 1Y8QA 3RD5A 2I76A 3JQ7B 4R69A 1ZSNA 2VTEA 1Q0QA 1SB9A 2P5UA 3EW7A 3WGQA 4XYLA 2DBQA 4UVEA 2NU7A 2PD4A 1UZMA 1OOEA 2OUIA 3RJ5A 3ZWPA 2WEKA 4O5OA 3I9LA 2WMDA 3VPXA 5K6AC 3PZRA 3GMDA 4XIJA 3OM9A 1X1TA 1YO6A 2VUSA 4XYEA 1WNTA 1ZK2A 1KETA 4XGKA 3MJ4A 1HE2A 2XXJA 1NP3A 2Q4BA 4IIVA 3RC2A 3DFZA 5IF3A 4RGBA 2HRBA 1YBAA 3OF2A 1HDXA 1LTHR 2HJSA 3FBGA 4O0LA 4BNZA 3GY0A 1HSZA 2GERA 1I2ZA 4CMEC 1EZ4A 2GN8A 3MWDB 4EJMA 4KWIA 5KVQA 1LU9A 1KEPA 2ZCUA 4BNHA 5L4NA 3TSCA 2PA3A 4BMNA 4TQGA 2ZYDA 5U4QA 4YQYA 4BL5A 3G1TA 5JCJD 3AI1A 4NBRA 3S2EA 1UDCA 3TL3A 4D42A 4BO1A 1HYEA 3G49A 1MXHA 1A4UA 2HU2A 1MC4A 3ENNA 1OFGA 1W73A 2FHSA 4JP2A 2HMUA 3FR8A 4RV9A 2CFCA 1M66A 3WWZA 4A2CA 3LLVA 2BFAA 3L4BA 3P7MA 1AE1A 4DYDA 3IAHA 4J7UA 3BAZA 4CMBA 5I7SA 3KLMX 3QVSA 3JQFC 5EIOA 3BHJA 1R15A 3VHRA 4JJFA 5TIIA 5AQ1A 1SCUA 2Z1NA 3QSGA 3TL2A 4BGEA 4BQPA 3BMOA 3ZW8A 1I3KA 1GCUA 2PZJA 1ULUA 2ZCVA 4QT0A 2FR1A 1HL3A 2G17A 3AOEC 4D0SA 1F12A 4RF2A 3ZWYA 1ZKMA 4U7WA 2OGUA 2BGLA 2AEJA 3F6YA 4HX5A 4OAQA 4CR7A 2YQ4A 5CG1A 3GVHA 5G0VA 2WDZA 2JD0A 1B16A 5BNTA 4J7CA 3CUKA 2BI7A 3DZHA 2C7VA 1ISMA 4LN1A 3W8FA 1E5LA 3GGPA 3RUCA 3OETA 3I9MA 5G0WA 4NR0A 4E4YA 4QFCA 1XG5A 3E48A 4MVJF 4DPMA 2IODA 1SOWA 3N7UA 3EGOA 4WOKA 2I66A 5JY1A 3UICA 4PLZA 1P1HA 1DFGA 1O9BA 2W4QA 4NIMA 3W1VA 1O89A 4EITA 1ZZEA 1T1SA 5CPBA 5AXCA 3X2EA 5JSFA 4CLRB 3GR6A 1PQUA 1NHWA 2Y1DA 3DO5A 3TZHA 3OIFA 3W6ZA 3ZU3A 1MV8A 2B0JA 1PGNA 1NHGA 2EIHA 3QW2A 4MVJG 4IDGA 4H7PA 3V2GA 1EDZA 3W4JA 2BMAA 2FZEA 2W2LA 1E7YA 3PJDA 2GF2A 1NVTA 3GA0A 3E8XA 3H9UA 4I5DA 4W99A 1YDWA 4RPJA 4F6LA 4WLNA 4CLXA 1TEHA 5DBGA 3PQEA 1U9JA 4I9HA 4D41A 5B4VA 3MOIA 4XA8A 5CFZA 5J23A 3WX0A 2YDYA 4B4VA 3KYBA 3OA0A 4I9UA 2X9NA 4J1QA 8ADHA 2WM3A 3ORFA 4QFDA 4KWHA 1DLJA 6LDHA 4E0BA 1JA9A 4KTVE 4QECA 2PNFA 3ULKA 2WD7A 3PHHA 4IZIA 4TMFA 3OA2A 3U0BA 5IDXA 2NM0A 4DLBA 1CWUA 1EUZA 3TNLA 3I23A 2CNBA 1LLQA 4YA6A 2NACA 4HV4A 4DIBA 4J6FA 5THKA 4ZJUA 2X1HA 3GHYA 1EVIA 2FWMX 1WMAA 4PVCA 4FC6A 4QTZA 4R41A 5CDYA 2VNSA 3RFXA 1QRRA 1A71A 1AHHA 4PLWA 1XU9A 4DIFA 3G3EA 3OSUA 4NNJA 1GV0A 4JJIA 4BGVA 3C7AA 4MVJP 1L1FA 1UP7A 4WEQA 1PJSA 2E6UX 4L8VA 2QG4A 3Q3CA 1UZNA 3JQBC 5DT9A 4BKOA 4ZN6A 3LDHA 3ZGYA 3U09A 4CQLA 3Q1LA 3GFBA 3DOOA 1PS9A 1YL6A 3RFTA 5JC8A 2HK9A 3ST7A 2O3UA 3QRWA 1ZSYA 4CMCA 4K6FA 4DUPA 3AU8A 1GDHA 3H5RA 3K5PA 4ND3A 1HWYA 1Y5RA 2GN9A 4II2A 4BKQA 1PJLA 4QX6A 5ILGA 2PLAA 3WBBA 3ROPA 2E4AA 1LQTA 1YOVA 2UVDA 2XAAA 1NQAO 3EVNA 3Q9UA 4BKPA 5KCZA 5KOIA 4E5YA 4B3HA 1RKXA 1H5QA 5L51A 1B8PA 4FGWA 1T1RA 4P4LA 3FF4A 4W6ZA 5A06A 1I24A 4PLYA 1HDGO 3W6UA 3MEQA 4AJ2A 4UULA 3JQ8A 4MKZA 2J5RA 2YJZA 1YOVB 3UHAA 3DDNA 5FWNA 1U4OA 3KSZO 3QJ5A 1FJHA 2Y1CA 3BYZA 3WGYA 3VC7A 5TF4A 1B8UA 3UUWA 4PRLA 3PFFA 1ADGA 3D0OA 3JQ8B 2VWHA 3TN7A 3VOSA 3LT2A 2Q46A 3CPSA 1Y9EA 3PPIA 2JKVA 2Q1TA 3PVZA 1OMOA 3BTSA 3GEGA 3O26A 3S2FA 3UW3A 5CP8A 3VZRA 3ITDA 3WLFA 4R1SA 2H9IA 4BUCA 5JBIA 3E82A 3VH2A 4RVUA 1Q0HA 5HS6A 4CR6A 4KUGA 5I8WA 4CLOA 1XEAA 2D59A 1OC4A 3D7LA 3HJAA 2OO5A 4PVDA 3SX2A 2JAPA 3PZBA 3JQFA 4GSKA 2GRAA 2HO5A 3WGZA 3BMNB 1C1DA 2C5AA 3M6IA 5T5QA 1GYRA 1PGPA 2I65A 3ZW9A 1I8TA 3IDSA 3MTGA 4GWKA 1T4BA 4G5HA 5L40A 3RUAA 2RHCA 3GOHA 4J9UE 3F5SA 4FC7A 4ND4A 4URFA 4A7PA 3WMXA 1NAIA 1NYTA 1CETA 3ZU5A 1DFHA 4B7XA 4XGIA 3DFUA 2JHGA 2WD8A 4IGFA 4GBJA 4Y6RA 3ZV6A 1V3UA 4IDEA 3UOGA 3TZCA 3FBTA 4E6PA 1O0SA 3HFSA 5JMPA 1ONOA 3RI3A 1EQUA 1GUFA 3RUDA 1ENOA 2G82A 5DBFA 3FTPA 3JQEA 3ROQA 1HXHA 5A9SA 2AW5A 5FYDA 2RCYA 2Q2WA 2B83A 2A94A 5H83A 1YONA 1FK8A 2R2GA 2LDBA 3JCZA 4D3SA 5I7VA 3BMQA 3DZIA 2JFGA 2PKQO 2JCYA 4YJGB 2EP7A 2YQ5A 2YY7A 3QA9A 4MVJH 1MC5A 3DAPA 2EXXA 3WS7A 1NQTA 4NJMA 5CDTA 5IN4A 1X14A 1L7EA 5EERA 1FF9A 4DQVA 1K3TA 4FN4A 3UCEA 3MJCA 3C7CB 3E1KA 3QE3A 5JAMA 3ETEA 3I9KA 1Y1PA 3T4XA 4B4OA 3ZV3A 1MGOA 1SBYA 4C4OA 2QRLA 3MJSA 3D5QA 2PY6A 3D1LA 1CDOA 4O6VA 3I9NA 5EINA 1V8BA 3H4VA 1U3VA 3V1TC 1V3VA 4NK4A 4AJNA 2P4HX 4WLOA 4BNWA 2Q4EA 3DMTC 3QHAA 2DPHA 2VHVA 1UAGA 9LDBA 3NRCA 4Q39A 4PCVA 2WTBA 3JYPA 1I3NA 1WDMA 1H6DA 1D1TA 3IUPA 5TT0A 1H9AA 4ND1A 4QSMA 2F00A 3S8MA 1P1JA 1D4FA 4HADA 3RWBA 1QKIA 3E03A 3NX4A 1UXJA 1JVSA 1BTOA 5EJ2A 3RVDA 4J2HA 5A3JA 3DHYA 1Q1NA 3SBOA 3C8MA 4LSMA 1R4NA 2GO1A 3ANNA 1BWSA 1JWBB 3GVIA 4RF3A 5HRUA 2AG8A 4OQYA 1SZJG 3EYWA 4YAEA 3DBVO 4BNFA 2B5WA 3I52A 4KZPA 4IS3A 3QP9A 3VDRA 2Z95A 4MVJE 4D7AA 5JS6A 1R4NB 2Y67A 4RL6A 3GPDG 3GNTA 4E12A 3LK7A 4XQEA 3KM0A 2DLDA 3DBLB 4D3FA 2GLXA 2AQHA 3WFIA 1TLTA 2A92A 2CDBA 3PTZA 2NU8A 5A1TA 2BFOA 1JU9A 3H2SA 2ZB8A 3VTZA 1BXGA 2VUTA 3JQBA 4GLOA 4LK3A 4YT8A 5I7FA 3FPCA 3A4VA 1FDSA 3I5MA 4AJ1A 2B35A 1P33A 2DFVA 1LDGA 5ENDA 4W4TA 5AYVA 4LW8A 1GZ6A 1VL0A 1EUDA 5THQA 3TZQA 3EK2A 3JQAD 1BXGB 1H93A 4EGFA 3ETGA 3WGIA 1EFKA 4AJIA 1R4MB 3GEDA 1ZIDA 2ZJ0A 3QWIA 3DC2A 5HS4A 3QLJA 4MVJI 4KQXA 2PZKA 2GNAA 3GQVA 4GX5A 1ISGA 3I6IA 5CDSA 3IUSA 1MA0A 2DTDA 3VKUA 4OM8A 1QYDA 1UXIA 4Z0HO 4KDFA 3SXPA 3ZHXA 4E31A 3AUTA 3IS3A 1SMKA 4FBGA 3ONFA 3ANMA 4YT5A 1MFZA 1E7WA 3SLKA 5HM8A 5L45A 4E2ZA 4GX2A 3ROMA 1TVEA 2Y05A 3DHNA 4YJFB 5GZ6A 4RZIA 1GEEA 2E49A 1SEPA 4NMHA 1NQ5A 3DBHA 1F0YA 1KIFA 2R00A 4W9NA 4X54A 3V2UA 1I36A 4QEDA 1ADCA 4RJTA 1P77A 3L4BC 1P1RA 3OBBA 1KC3A 1KVSA 4ZQHA 5EL0A 1YQDA 3WOHA 3SJ7A 2HJRA 3D64A 4BGUA 1NR1A 2VZ8A 3PHLA 5JAQA 1HYHA 2C59A 2PZMA 3DBHB 5IJZA 4ITUA 4IDCA 5ITWA 2VTDA 3VPHA 3NTQA 1SC6A 5T57A 3ZWXA 1NPDA 1XLTA 1N1EA 1YBMA 2VWQA 3FI9A 3I9JA 4IQ8A 4Y98A 1LNQA 1DIRA 1BG6A 2JD1A 3JV7A 3TFOA 1ZJYA 4IDBA 3FD8A 1S7CA 4RVGA 3DZGA 4I5FA 3PGJA 1LRJA 2J3HA 1KYQA 4MIEA 5EPOA 1HDRA 3NEPX 2J3IA 3TQHA 5LC1A 4EUEA 1F8FA 1Y5MA 3U4HA 4NH4A 1LLDA 2CDCA 3FWZA 2Y0DA 3L0DA 1ZMTA 1NFQA 1E1KA 3C7DB 3UF0A 4Z9XA 4YBZA 3WIDA 3GZ4A 5DBIA 4OH1A 1ISIA 5DCYA 4BNMA 4CMJA 4O59O 3RFVA 1GZ3A 2X22A 5JNLA 2FN7A 2B4TO 4NBWA 3F1KA 5EN4A 1E7QA 3JQ9A 1GTMA 2HQ1A 2AMFA 2YZ7A 1A7KA 4MKXA 5JYDA 1TT5B 5B4TA 4RQTA 1ZBQA 2P2SA 1CERA 4NG5A 4Y6SA 5HWSA 2G5CA 1MFPA 4KOAA 4F3YA 5JCXA 4U6SA 5IFLA 5A05A 4GQAA 4MIYA 4J4TA 2EJVA 4XWYA 2AQ8A 2DFDA 1CIVA 2UUPA 4WNCA 4UVDA 1GD1O 3KTDA 2VCYA 5IZ4A 2J5KA 3NDJA 1XQ1A 3WLEA 4NDNE 2ZYAA 4WKGA 4YAJA 4EDFA 1T25A 1E5QA 1IHYA 2I67A 2AE2A 2I99A 4Z9FA 1C1XB 1Z7BA 3DXFA 4RF4A 1GYPA 2NADA 4XDZA 2GZ2A 1EEHA 1PJBA 2HMSA 1JWAB 1DJNA 3WYCA 1UR5A 1DC6A 2Q1UA 1T24A 3IIEA 4HWKA 1DO8A 1R16A 5EQDA 2HCTA 3MJTA 2BGKA 1Y9AA 2XXBA 4BOYA 1DIAA 3NTRA 3NYWA 3KXDA 4R51A 1I3MA 3EDMA 2NVBA 3EAGA 3M2PA 1YGYA 2Q45A 4BQRA 1FMCA 1XDWA 1E6EA 4WLFA 5F1PA 3WYBA 5G4KB 3WTBA 4S1VA 1MLDA 3H2ZA 4OMUA 4IDDA 3ICPA 3CINA 3PWKA 4PLTA 5DOVA 5TSDA 3CH6A 3IQDB 1IYZA 4FDAA 5KJFA 4WUVA 3IOYA 4L73A 2C07A 4DQUA 5IDYA 1ULSA 3UCXA 3VZSA 4C7JA 1V9LA 1UUFA 3TDKA 3JQ7A 5ITVA 1G6KA 1OZAA 3FTNA 1YDEA 2BELA 5EQFA 5ES3A 1NVGA 2VWPA 4PN3A 2Y0CA 1IZ9A 2BRUA 3TWOA 1L7DA 2YHIB 1DHRA 3S2GA 2CVQA 2D1YA 1SB8A 3KVOA 4YAIA 4PIVA 1KEWA 2JHFA 2YFQA 3GNQA 3H9EO 2GCGA 4K28A 4L4XA 1O8CA 4DBZA 2VRCD 3U4IA 4U8GA 2H1SA 1ZNQO 3GRPA 3P2OA 4K1LA 1RJWA 3R0IA 4TZTA 4KTTE 3RUHA 3GAFA 3IP3A 1C0PA 4J9VA 5JCJA 1CF2O 3FN4A 2EKPA 5AOVA 2P5YA 3ICCA 2O23A 4CQMD 3RUEA 4DRYA 2C2XA 2HMWA 4NBTA 2HUNA 3H65A 3LC7O 1D3AA 3DZFA 4RPGA 4CV2A 4J4BA 1QG6A 3PHIA 1F17A 2ZQZA 3DQPA 4CLHA 1LUAA 3GDOA 3A9WA 3K2BA 4JROA 4GGOA 4EI2A 3IJRA 2DQ4A 2P68A 5IXSA 4YPOA 1NX6A 1BDBA 1ADBA 2DU8A 4JK3A 3KSDO 2AG5A 4L74A 2VNAA 3FNFA 4E2XA 2O3SA 3HN2A 3TPCA 3DHEA 2AXQA 3WTCA 4CPDA 2YFHA 4ALKA 2QYSA 3AY6A 2X0NA 4OSOA 4II3A 4OO3A 4TVBA 1WDKA 4ZVVA 5L7WA 5TT1A 3I1JA 4QXMA 1OC2A 4FFMA 1U7HA 4FFPA 1YE3A 3ZNQA 2IEBA 3N58A 4PLHA 4CODB 3INTA 4RVDA 1RYEA 1C0IA 4CUKA 4FOOA 2D2IA 1LRKA 4DWVA 4BS9A 3U4CA 1V6AA 3UXYA 3BHIA 2UDPA 3R3JA 3Q2IA 5F1OA 1X0VA 2FOIA 4RDIA 4XKJA 2X9VA 2P9EA 1SEVA 4BNYA 5ICSA 5JPIA 1TI7A 1PJTA 2X0IA 3QVTA 2CF6A 3K31A 4HFRA 4XYBA 2ZIZA 2W8ZA 1I2CA 4JJGA 5LCXA 2C82A 2PWZA 1A7AA 2EW8A 2VOJA 4QUKA 2IRWA 2X0RA 4CJXA 3OIDA 5BNIA 3KYCB 3LZ6A 5F3RA 4LGVA 4J0FA 4A0SA 3R1IA 5CEEA 3DL2A 1R6DA 3LSYA 4RPKA 3ZZNA 3B1KA 1PX0A 1WZIA 2D4AA 2ZB3A 2OL4A 4BO2A 2GZ1A 4P4NA 1TA4A 1UH5A 4FJ2A 2ILTA 1K0UA 2CDAA 1EE9A 5GZ1A 4RPLA 3GT0A 1UDAA 4DXHA 4PZDA 1Q0LA 3W8DA 1ZUD1 3HNPA 3LC2O 3Q6IA 4IMRA 3VZPA 2UYYA 5KJCA 5FFFA 1Z45A 2VQ3A 1QV7A 4UEOA 4GL4A 3RROA 2PKQP 4TKMA 1NPYA 4FFRA 3HG7A 4EUFA 3B70A 2B4QA 4J7XA 5BT9A 4CLRA 3FNEA 1NAHA 3NT4A 4UVIA 5T67A 3T7EA 1XKQA 5C7OO 3I4CA 1PJ3A 3IKVA 1P44A 1DAOA 2QHXA 3P2YA 1I33A 5H81A 2DUWA 4DBVO 2A4KA 1HZZA 4FOSA 4O63O 3BA1A 3AY7A 4NFYA 1E1MA 2FY8A 1JW9B 1PL8A 4XRGA 3PXXA 4IZHA 1EE2A 3MTJA 1T26A 1D7OA 2VN8A 1PR9A 3S2IA 2D5AA 3B1FA 3ZDFA 4FFOA 4P22A 3HSKA 2A35A 1Q2XA 5JDCA 1LX6A 4FJ1A 4R1UA 1KEVA 4XB1A 2X4GA 4R1TA 4YAGA 5K0ZA 1A9YA 4OOFA 1VRWA 1RYDA 1P45A 4MP8A 1O94A 3ZNOA 4NK5A 1PZFA 1N7HA 4F6CA 5KWEA 5TNXA 2QRJA 4Q3BA 2NLOA 3ONDA 4Y67A 4WK6A 3UVEA 2B69A 4U0KA 4YT4A 3ASUA 4KDEA 3L6DA 1SO8A 3AUUA 4WLEA 1GL3A 4YEDA 4LRTB 4Q9NA 2QRKA 4XIYA 3U9LA 4E21A 2J8ZA 3VPGA 3CMCO 4S3MA 1LI4A 3S1LA 2W90A 1AN9A 3O38A 1ZK3A 4R3NA 3A1NA 1V35A 3ADPA 1QYWA 1QYCA 1X7HA 4LMPA 4E5MA 1A4IA 3KYDB 3ZNPA 2EP5A 1P0FA 1XWFA 4R5HA 1YB5A 3I83A 4R4JA 1W0CA 2VZ0A 1EK6A 2DT5A 1WMBA 1QLJA 2CD9A 2W2LD 3OJOA 5TLSA 1LQUA 2C5EA 3QVOA 1C14A 3WQSB 5I9NA 2O48X 1GQQA 2B37A 1PSDA 2J6IA 1DXYA 4I1IA 4D46A 4GX1A 4WOJA 1PU2A 4MINA 4DIOA 3VH4A 1VL6A 2AHRA 2X9GA 1LLCA 3DR3A 3I9OA 5I9MA 3WGOA 1R0KA 3WQRA 1WW8A 1F8GA 4I8XA 4R5MA 3VPFA 1P0CA 3VVBA 4B3JA 4ROSA 4JXKA 1P1KA 4ZRNA 3IC5A 5G0UA 2GASA 4I9NA 5FI5A 1JKFA 2VYVA 1O6ZA 1YB4A 4Y9DA 3E5MA 1ISJA 1WP4A 2O2SA 4FGSA 3GVCA 4AFNA 4WLVA 4ZQFA 1LRLA 4IDAA 3FR7A 3F1LA 3RBZA 2Y1GA 4I5EA 1O5IA 4CM9D 3DZKA 3OEYA 4PG5A 4W7HA 5TRTA 1KVQA 3G17A 5EMHA 7MDHA 3ZWNA 1IPEA 2XOXA 3C1AA 3F9IA 1ZXBA 3PJEA 3AFNA 4XQCA 5A02A 4H16A 4N5MA 2R00C 1JVBA 4W9NC 4B4WA 3OJEA 3ZWVA 3BMNA 4CMIA 1H6AA 1Q7GA 4BNGA 3SC4A 4ZQBA 1LDBA 5CHEA 2ZQYA 4XR4A 3EUWA 3GAZA 1DRWA 1Z75A 4MVJM 1B3RA 2HMVA 3E6AA 5JC1A 1DIHA 3KLPX 3PK0A 4CMIB 4JGBA 5ICMA 2VYNA 2EF1A 4CMAA 5I9LA 4YB8A 3OJ0A 3BMCB 3JD4A 4JBGA 2EJWA 4IIUA 1NNUA 4A5OA 3ITKA 1IHXA 1FDUA 1IULA 4M54A 3AK4A 4N5LA 5COBA 4E33A 2GYYA 4U0JA 1KC1A 4AVYA 1E92A 1Y8RB 3WGGA 4HNGA 5IXYA 1PIWA 5G4LA 2JAHA 2UV8A 1UP4A 3TF5A 1ZVMA 1FDWA 1DHTA 1DAPA 3GVPA 1NWCA 1WXDA 3LVFO 2VHZA 1B0AA 2C29D 3GN1A 1X15A 2CUKA 3HB5X 3S55A 4QQRA 2AEFA 3D3EA 4HFMA 1AUPA 3K92A 1JN0A 2IXAA 2PKRA 5GY7A 5CDGA 3RJ9A 2WE8A 2X5OA 4YJGA 1QMGA 3JYQA 3MCVA 4FD3A 1T2FA 5LDHA 1UXHA 3JQ9C 3JD1A 3OQBA 5IAAA 3KRTA 1GPJA 2Y1EA 3EY4A 1UJMA 1G1AA 1TT7A 3T7CA 1Q7BA 4AJ4A 4NFHA 4TWRA 1WVGA 1E0DA 3DB2A 3GG9A 4MP3A 2WE7A 3WJ7A 4YRDA 5C37A 5TQVA 4WGGA 1XCBA 3ZCXA 2NQTA 2GUGA 2ZATA 1HE5A 2ZK7A 3N74A 1EDOA 4AICA 4J1SA 3HHPA 2E48A 3T4EA 1DJQA 1J5PA 3ZWOA 3BTVA 4YT2A 3OH8A 4XYGA 1B7GO 2I5PO 4FS3A 4MDHA 1WWKA 1MB4A 3PRJA 4CM4B 3HB4X 4WCDA 4CM6A 3LLSA 3KOUA 3P19A 3RC1A 2V6FA 4BO0A 4CL3A 3JYLA 5DCUA 1VPDA 4J49A 4ONEA 2BGMA 3NUGA 3JQDA 4G65A 4YTEA 1ONPA 3Q0EA 2B5VA 3GZNB 2W98A 3O9ZA 4RPHA 1GU7A 1I32A 3C1TA 1FDTA 1ZCJA 4ALMA 3VKVA 2WYVA 5JE8A 4CMKA 1YXMA 3BTOA 1LJ8A 4D45A 2C2YA 2ZYGA 4IINA 1ENZA 1X1EA 3WWYA 2GR9A 4RLSA 5DZSA 4Z6KA 3QWFA 4D44A 2OORA 1CQJA 1MG5A 3NTOA 4JQCA 1X7GA 3WNQA 3OQ6A 4ALLA 3VTFA 1X13A 1XR3A 3RBVA 4FR5A 3DBLA 2HK7A 3O8QB 2DKNA 4E2WA 2ZTUA 5AXAA 2VT3A 2NTJA 1AGNA 1VC2A 2Q2QA 1U4SA 1T2DA 3L6EA 1G0NA 3GRKA 4MVJD 4NPCA 4QO7A 1E6UA 3QWBA 4UREA 5A9RA 3GEMA 1E1LA 1U3WA 2Q1WA 3F5QA 1PGQA 3JQAB 4KUHA 4RQUA 4TROA 1I0ZA 2G0TA 1GQ2A 1KBZA 4CMGA 1ZO8A 5KKCA 1I3LA 3E9MA 3JSAA 3JYNA 2I9PA 2J3JA 3GK3A 3WXBA 1R4MA 4YR9A 3C1OA 1N1GA 2GGSA 3HDHA 3NJ4A 2PGJA 2RBEA 4N7RA 1BHSA 5HA5A 3MWEB 4L4SA 1R12A 1K2WA 3EZLA 2OHXA 3MJVA 5DULA 4CM7A 5B12A 3GPIA 4M8SA 3V5NA 1H2BA 3ABIA 1DIGA 1YKFA 5KJ6A 5JW6A 1BW9A 4WJZA 5CG2A 1XIVA 2Y66A 4XCVA 4YACA 3KO8A 1V3TA 4E32A 4RDHA 1B8VA 2JD2A 3LT1A 2BF7A 2IZZA 1LDYA 1GUZA 2PH3A 1NBOA 3G1UA 3SJUA 2PTGA 5L3ZA 3EVTA 3BIOA 4UVGA 9LDTA 4YJFA 1BW9B 3K2EA 3WICA 3WYEA 3K96A 3L4SO 1E3JA 5DN9A 1UXKA 2I3AA 4UUOA 1NFFA 2NV6A 3WGHA 1B15A 4R68A 2PZLA 4RVHA 5KVCA 4PGFA 3ZWWA 4JP3A 3STHA 2Q99A 4J2OA 1P31A 2DTXA 1VKOA 4IQGA 4WCFB 3VAZA 4DA9A 3OP4A 1EFLA 1TXGA 3UCFA 3OHSX 1YQXA 1XSEA 1VJ0A 3PIDA 4GSLA 4ZD6A 1ISFA 5MGBA 3BXXA 1W6UA 3WDSA 2C0CA 4HFJA 4XDYA 2X86A 3H9QA 2FZWA 4PZEA 4UUNA 4BNXA 2J3KA 3AM4A 1XU7A 4YYZA 5KJ1A 1HTBA 3U4DA 2BHLA 4WECA 3MZ0A 4E13A 4FSHA 3AU9A 2EKLA 5JFOA 2X0JA 1HSOA 1R0LA 3PHGA 2Y1OA 3FWNA 4PG4A 4UEJA 4W82A 4IXWA 1SNYA 3JD0A 4R9RA 4BO4A 1KEUA 4GMFA 1ZH8A 4UAGA 4BVAA 3QQPA 1EMDA 2YHUA 3LF2A 4LCJA 3K9QO 4JIGA 1M76A 2NWQA 2WYUA 4BO8A 4MJLA 4G81A 3G79A 1GPDG 3L77A 1EVJA 4LRSB 4EW6A 2YUTA 1TT5A 3D3WB 4XQGA 4BIIA 3LQFA 4DL9A 4E5KA 1GAEO 3HN7A 4P8RA 1OBFO 3WSWA 4ZQEA 4FB5A 5JLAA 4Y8VA 1HDYA 1KY4A 3C3XA 3V2HA 3ON5A 1LLUA 1J4AA 4DMLA 4Q3EA 3DTTA 1PJ4A 4MKRA 3IJPA 2BI8A 2P9GA 1LA2A 3H5AA 4R54A 4QO8A 2O3RA 4CLDA 1QORA 1H9BA 1ORRA 2IEDA 1HKUA 1NTOA 1LDMA 2P9CA 5C3MA 1SPXA 4MOWA 5MDHA 1C1XA 1QP8A 2NQ8A 1B2LA 4TRRA 4DLAA 4PLGA 4GGPA 1GR0A 4CM8B 1LDEA 3D5TA 3MJEA 2FSVA 1ISHA 2VZ9A 3B20A 4U5QA 1NFRA 4NFSA 1S6YA 3GDFA 5JDCC 2AQIA 3JTMA 4JX8A 2Y68A 3L9XA 1HEUA 1Y6JA 4HFNA 1T2AA 2OOSA 5COQA 4OJNA 4OYRA 3A28A 2OBNA 5U9CA 2BFPA 3KB6A 5A4DA 3QV1A 5TJHA 4BNLA 4PFJA 4DVJA 2DBRA 5TJ9A 4AJJA 2HSDA 4GH5A 3WQQA 1VM6A 2CSUA 3H6KA 4U6QA 5G4KA 4DC1A 3IL2A 4B8WA 4FFLA 1A72A 1BVUA 4IPTA 1AXEA 5EESA 3V8BA 4NJOA 4ND2A 4OHUA 4L75A 3TFQA 2Y99A 1PGOA 4Z0PA 1YJQA 3UH1A 1RPNA 4Z3KA 3UFXA 2JCVA 1DB3A 5T8KC 1RM0A 5DCWA 1P1FA 1E3WA 3PLNA 5I7EA 2HLPA 4EEXA 5KIAA 3B6ZA 2PD6A 4CV3A 4CV1A 4FFNA 3CXRA 3AJRA 4P38A 1PWXA 1NXQA 4W7IA 2YHIA 3PEFA 2PGDA 2J5QA 3JQGB 1V0JA 2VRBA 1XA0A 5BSEA 3PIIA 1E1NA 1HE3A 1E3WB 3PJFA 4B7CA 3AM3A 1RM4A 3DEYX 1I2BA 1ZJZA 3GH3A 3PJGA 4J91A 4CQMB 3K73O 3PYLA 2O3JA 2E37A 2OBYA 1X7DA 4EJ6A 2RIRA 2PD3A 4MP6A 5HTOA 2EKQA 2VOEA 3CSDA 1W4ZA 2POQX 1SOVA 3RSHA 1YWGO 4YVFA 5L95A 1U7TA 1DLIA 1CYDA 4BO3A 3CE6A 4MPDA 3QVXA 1NR7A 5BSHA 4P4GA 1YVEI 3AI2A 3ZHYA 4GPD1 4G2NA 3H9JA 3ZV5A 1ZSVA 2CMDA 1LSSA 3IMFA 4Q3DA 1A5ZA 3AUSA 4YQZA 2FRDA 3BHMA 4J43A 5DOZA 1EVYA 5JY6A 2EERA 1IOLA 4EJ0A 1NM5A 1KERA 1PL6A 3RASA 1QYXA 2O4UX 1H2HA 4XJSA 1DRVA 1HE4A 3A14A 3EMKA 1N8KA 4IMPA 2PR2A 4BNKA 3IKTA 3RBXA 1E77A 1Y8QB 3H3JA 3O03A 3COSA 4IQ0A 3ZHZA 3GHHA 3RUFA 1N9GA 4NHEA 4J0EA 1C3VA 1WLYA 2Y0EA 2PH5A 2X5KO 2UAGA 4HUJA 4K9DA 3VPSA 2FPPA 3AI3A 3ENKA 4FIZA 1R66A 1K5HA 4E5NA 1E7RA 4MO2A 4FW8A 4JLWA 5KVSA 2X8LA 4R1NA 1N9GB 3KHUA 3BZUA 4RO0A 3F47A 4D79A 4KP7A 4RCVA 1BDMA 3GVXA 1LBEA 1RWBA 4HNHA 4IUYA 3KYCA 1GFSA 4XR9A 1T2CA 3HZZA 5A9TA 3CIFA 1H6CA 3AUAA 4Q3CA 4BGIA 1YBVA 4BO5A 5HBRA 4EEZA 5I8ZA 1U28A 4ALIA 1ZW1A 5BQFA 2X7HA 2ZB4A 4FPXA 5FF9A 2CF5A 3RU7A 1JKJA 3AWDA 4OOEA 5JO0A 5K9ZA 1ZK1A 2HKIA 1KS9A 3PQFA 5F5LA 1AXGA 3O4RA 1LSJA 5IDWA 5A3VA 3GUCA 5L9AA 1PGJA 2O3QA 1U1IA 3NDRA 3OFSA 5CEFA 3WG9A 2NU9A 4Z9YA 4IS2A 1IE3A 1PZEA 2AEMA 1DDOA 4R01A 5BSFA 1IZ0A 2EV9A 4AJHA 2IZ0A 2I6TA 1I01A 3H9GA 1Z82A 1O95A 4GI2A 4RVFA 1D1SA 5B4UA 1PS0A 2CVZA 1BGVA 3VDQA 1HETA 3Q2KA 5AXDA 5L7TA 4BNNA 4XRRA 4WEOA 1I5RA 1LEHA 4DPKA 1AHIA 2Y93A 3WFJA 2V6BA 1DC3A 4TSKA 1P9LA 3BMOB 5G0TA 4AL4A 5CAEA 1PJQA 1Z74A 3NAQA 4CV0A 1HT0A 2O2YA 1PJ2A 3L9WA 4B3IA 4GWGA 4A10A 2VWGA 4RF5A 3RQSA 4WNIA 4ZGWA 1ZK4A
chains in the Genus database with same CATH superfamily
5MHTA 2X6RA 1EYZA 3KZVA 1NN0A 5A0FA 1XMOB 3VYSB 1DEAA 1B26A 1R8XA 3EDRA 3NKVA 4U2CA 4GUAA 5F12A 5FWAA 5KAMA 1T4DA 5IARA 2XD9A 1SQFA 3B8HA 3H7AA 4G8DA 2Q1SA 2CDNA 2NO5A 3H5OA 4BEBA 3A37A 5TPZA 4XEHA 1JAYA 1T9GS 1T6YA 3C5VA 3TW4A 1Q15A 5IJ9B 2O9JA 4CU2A 3PG5A 2PT6A 4H1WA 4EZEA 2HK8A 2MSKA 4QYTA 1E7MA 3K8QA 2BSXA 3X1DA 4FWTA 3CGWA 4Y6PA 3KU4A 2BFDB 3NC1C 4XDGA 4F3NA 5TB5A 3STUA 1J9EA 4RJLA 3U62A 2QD1A 1T3LA 3BXGA 2XCIA 3LPCA 4V3CA 3LYHA 4UUQA 4RD4A 3H2GA 3STVA 3WP1B 4ALNA 3JASB 3LRTA 3KXIA 3DMDA 1NW4A 1IK4A 1R0WA 2XUOA 2ZVQX 4XGNA 4HJRA 5FYQA 3RKRA 2VQEB 4L9RA 2RCNA 3UMRA 2RARA 4J4HA 1KY5A 3TI7A 3UO8B 4ANFA 4LC0A 4CYMA 1K97A 3GLFA 5IKOA 5EIBC 3VYVA 3UV6A 3CVWA 1FIUA 3MRVA 1I7QB 1NZDA 3H1TA 2TECE 3D1VA 1XXHA 2ICAA 4URZR 4XSGA 1PG2A 4OXXA 3ZU4A 1Y4ZA 4NU6A 1K7YA 1K92A 4BP9A 5ADWA 3L46A 1IBRA 4ERNA 4YMTA 1BQ4A 3HJUA 2JJ2D 4HLNA 4DRXA 1QTRA 2WYWA 3T06B 3TQTA 5U4XA 1OA0A 4Y18A 3TW6A 3J7TA 4RJ2A 4AX4A 1U2DA 2QTWB 4E5SA 2A5JA 4RM2A 3QX8A 2QYHA 2V7EA 3AKZA 4AF6A 3I6BA 5DGHA 2V6JA 3QY9A 5BUZA 5ALIA 1JECA 5LSAA 1U2EA 4P84A 3KE8A 1ADFA 1QH9A 1U2GC 4XARA 2JFFA 1TZKA 3TQFA 1XALA 2AMJA 4WQMA 2W7TA 2E4ZA 2IOFK 2RG1A 2ZXUA 1EKXA 2RC6A 1XHLA 2WWFA 3V4ZA 2ENWA 3EZ6A 1TVKA 1OBOA 2C4TA 4F11A 4C6TA 4TKUB 1M2NA 1V6CA 1WEKA 1E20A 1RM5A 1THTA 5THXA 2UZ4A 1L3BA 3I3OA 1NXSA 3G5UA 2QKYA 3LAWA 3B1VA 3FE2A 3HCFA 3VH1A 2GXSA 2WIFA 3BRWA 4FT2A 4JAVC 1N3BA 3HDJA 4WSOA 4AZSA 4MLZA 5J2TA 5IG2A 2O2ZA 4M9UA 2AR9A 4ITVA 2RJ3A 3P9NA 1JIUA 4PPNA 3PWSA 5B37A 3SVTA 5E0KB 4B8ZA 4EBBA 1MIOB 4I50A 2WWHA 4JSYA 4Q9JA 2ZUCA 1EQ2A 2V7GA 3FHLA 1PJRA 1DEHA 3ZWMA 3G0GA 4UOQA 4GKBA 2JI9A 3TJRA 1V1MA 2WT4A 3ZHBA 1Y1TA 4E7OA 3IV7A 5K0SA 2H1FA 4FNGA 3PPWA 4K26A 4F8YA 5BV2P 4JGIA 3R9XB 4BDSA 4X8OA 3THOA 1AGRA 1Z2OX 3A6EA 4DDWA 4XWWA 2IHYA 1IB6A 4XJTA 1EXWA 1HLPA 2FQQA 2PZEA 1C3OB 5LWQA 1KWGA 4RSGA 5JXWA 3PHBE 5MN5A 3QVMA 1IC6A 3NBKA 5HX7A 3QELA 2D13A 3UB3A 2FR8A 1BA3A 2DBZA 4G84A 2WAMA 4IFTA 4WKNA 2EWMA 5EIHA 3WGKA 3SR3A 1TW2A 3I6YA 4HPXB 4UBMA 1OYYA 2DPGA 3QXCA 3TKLA 4BQSA 4CMEA 1I30A 2D8AA 1VIDA 1IVYA 3B3AA 3EBOA 3BB3A 4LDZA 4PLFA 3SP1A 4CF7A 5KOHA 2B4YA 1KOGA 3WIEA 5DLQC 4QTUB 4RZHA 3PNSA 2GJKA 3NGLA 3U3ZA 3FNIA 2QF7A 1IBSA 2IYQA 3A6FA 2R8EA 1FXSA 3QVGA 2IPMA 3SF8B 3S3TA 4AG3A 4NP6A 1JLLA 2R9VA 1HLDA 2BCJQ 2QUHA 2TMDA 1DJPA 2FMUA 4JQSA 4XB2A 1KYTA 3LV8A 4L28A 1GN9A 4S1PA 4Y2GA 5CW2A 1IXRC 1Y8RA 4PICA 5ALDA 2IKSA 4DCMA 1FS5A 3F8TA 4E1AA 1KI6A 1UCFA 3VU9B 2I1QA 2C78A 1H2FA 2B4RO 4DR3B 4TLAA 1WCIA 3VZQA 2DF8A 1HFKA 4BO7A 5I5EA 3WAGA 2VYVD 2BGRA 3GF4A 3IVGA 3LFUA 6CHYA 4AWBA 2NVUB 2OZPA 4HVTA 4YV7A 1QIMA 4GT1A 2BR4A 3AGQA 1ZGBA 1ZN9A 2C9OA 3OPMA 3CB4A 5EE5B 1N0HA 4UU8A 3NT2A 2D62A 4HDRA 5BXQC 2WPDD 1HRKA 2VS1A 2Q0SA 3L07A 3PDCA 3R23A 2FWJA 3RJTA 4B83A 4MVCA 2WJJA 4LJ9A 1DIBA 1KK0A 3HV0A 4OGKA 4EGJA 5F78A 1T8UA 4B7AA 4HNQA 3ZY5A 4ZEVA 1EA5A 1TZMA 2HTEA 2V9PA 1G21E 3IP1A 4DJDC 3FGPA 1WHTB 2P79A 4TLDA 3MINB 2DKFA 4FZRA 1S3GA 2CJXA 3JWPA 4OL9A 1TK2A 5AVZA 1VG0B 3AERB 2ZRMA 4OATA 4DC0A 3D4OA 3KIPA 3V00A 1AURA 1VDZA 3ZI0A 3RF7A 3GH1A 5AW9A 4ENVA 4RELA 1ZEMA 5FL3A 3S29A 3GB9A 5CA1F 2B8TA 1I4LD 3L7NA 3MTBA 3UK0A 1C2YA 4J1NA 1HZJA 3DW1X 2PMWB 4BWYA 1D09A 2PFSA 1UEJA 5SYNA 1O87A 1GOTA 2VPIA 3M6LA 5E6UA 2B7CA 1GAJA 1GV1A 1KFJB 1BMDA 5FR1A 1DAMA 3VOAA 1P17A 2BD0A 4C78A 2W6JD 2ADFA 4YJHB 2EFEB 5IEJA 1J0CA 1JB9A 2NZ2A 1PUXA 2IE0A 2ZI6A 3B2QA 1UKAA 3H97A 3ZVLA 1GAXA 4IXTA 3S5UA 4NMWA 1VKNA 2RK4A 2QVYX 2VNJA 3RVPA 4H7IA 5I7OA 1QWOA 3G59A 3VVCA 2C5BA 4RA9B 4CM1A 2F1OA 3BD6A 4IWXA 2Q6LA 2FNAA 2JAWA 3L0BA 4LHVA 4UFOA 4OKIA 3SAJA 3DAFA 1JHVA 5A9SB 3MTEA 3HJHA 1CLUA 1SIUA 2CLOB 2WNIA 2ZTVA 2IHTA 1VSBA 4PLCA 1BEEA 4B4UA 4JEIA 3HJGA 4UPVA 4GMDA 1QP0A 2A3RA 2QDKA 2IXFA 2VHWA 1C7EA 4B79A 4BRSA 9MHTA 1QRAA 4KPUA 4WK0B 1LBHA 1HDZA 5IKMA 2NT4A 4MX8A 3FPHA 4IJUA 1W34A 3WMWA 1KVTA 2QD4A 3ZU2A 3P2MA 2WMNB 3VUFA 4DNFA 1DQNA 4KXMA 1EBFA 4PSAA 2AZ4A 3ZD8A 1EDBA 1O9HA 2GEJA 3QA3E 3GUVA 4TWAA 2GVZC 3MD0A 2PPVA 2XBLA 3R0XA 5H80A 4Q82A 1YA6A 1IDOA 3OEWA 2P3LA 2DRIA 3R0ZA 4BX8A 1HLFA 5AUPB 5A62A 2Y9MB 3KV3O 4LRUA 4W5JA 1U5AA 2KW5A 4FHCA 1Y4UA 4OUDB 4QSHA 2C3UA 2XRMA 2ZWVA 3AHJA 3EASA 3QIVA 2A84A 1P4RA 1OLUA 1VE9A 1YVUA 2QP4A 2JLVA 3LU1A 1TQ2A 4ESEA 4CL8A 4D8YA 3NKLA 5J2UA 3SJZA 2QZSA 2WUWE 4IH9A 2ZYRA 4KXNA 3SR4A 1FTQA 4C5CA 3ZUGA 4CVNA 4DLLA 2PUHA 2VT2A 2FG5A 2PUFA 1GDDA 2XOEA 4PBSA 5AKKA 3PV0A 4WXYB 2FZ5A 2C5LA 3UJNA 4B5LA 2CY0A 3EZFA 4TV8F 4AWAA 3GJSA 5K8IA 1KAGA 4RK0A 4ABYA 4AP9A 4F4CA 3I4FA 3OE4A 1YE5A 4YJ3B 3PGA1 1V11A 4Z99A 4AF8A 4GWLA 5ELXA 1U2QA 1OB2A 4ZU3A 3C6YA 3C5EA 4MV8A 1RPAA 1YJ8A 3ZGNA 4LCEA 3CX8A 1IWBB 1S9HA 3STWA 1Z35A 4K3VA 3SYRA 2QX7A 2ZITA 4EFMA 1S2IA 3QWAA 4L3VA 2VJMA 4Z1MA 4RMJA 3DP9A 3GPLA 4HAIA 5E95A 3M5PA 5IW8A 4C4XA 4UTRA 2ATIA 4UU0A 4LRXA 4BBAA 3IAM6 1OGJA 4O2BF 1BNCA 2IS6A 2GBGA 3B6IA 1IVSA 1CT9A 4F91B 4FQ5A 1JSLA 4JSTA 1G16A 2E0IA 1ZU5A 4C7VA 2PRIA 1NGSA 5BVHB 2IV3A 5AVYA 5KTSA 2W6OA 2YW9A 1Y34E 3GUYA 2AG6A 3VH3A 2I87A 1J1IA 3C3EA 1YZLA 1HNZB 1CEEA 5GJBA 5AJHA 5EOVA 4OLBA 4G09A 3EDYA 1XAJA 1DSSG 3JYOA 2QZZA 3G8CA 4FSXA 1SRRA 4CFSA 1QVZA 5IC4A 5LNK1 1EUDB 2XE8A 2BKAA 5DNAA 1MOQA 3QVWA 5FUYA 4LVCA 5FQNA 2X58A 3ID6C 1E3IA 3DUFB 1PEDA 2AA3A 1H05A 3HABA 4H6VA 1NBEA 5DM2A 4BFZA 2PANA 1V47A 4UAVA 1F3OA 4PLVA 1EXNA 4I4CA 1N57A 2YVUA 3LPDA 2ATEA 2IGBA 1SAYA 3AWIA 4H9GA 2O6LA 3RO7A 1JAIA 1VLMA 3OLZA 4F3TA 1AXRA 2BGJA 2FPIA 1WUYA 1MH1A 4WHMA 1D1PA 3PPXA 5DEOA 4QKQA 1ZN2A 4MIOA 5COAA 3V1LA 3E1GA 3PQDA 4FI3F 2O8DA 2EGHA 1KZGB 3RAJA 3ZS8A 2J9YB 1GKYA 3OE7A 1CR4A 2JI4A 1AQLA 3D81A 1U28C 1YB6A 2G77B 2DR0A 3QU4A 4ZVQA 2PGLA 2XB6A 3INRA 4BO6A 2FPGA 2C97A 2C5GA 3QVJA 2F3SA 1LSUA 3LTEA 4BECA 2H92A 3HQ4O 1RQPA 2OCXA 1BXKA 1EBUA 2R6GA 3OIGA 4HVAA 1YASA 4HYYA 1UFOA 3EXIA 2AG1A 3SEFA 4F46A 5F5NA 2Z8ZA 5TPWB 3DNPA 3AF6A 2NVWA 3AHEA 5IASA 5LBIA 3N53A 4C7XA 3RYIB 3K8ZA 2A5LA 3TQOA 3N76A 3PQ8A 4N54A 5F1YA 3THSA 5KU1A 1I5OA 2CXXA 4NULA 5FUWA 3VR0A 4HDQB 4LVUA 1K5PA 4KYTA 3E7WA 5H82A 3SJCA 2O0JA 4AU1A 1MO2A 1TJ4A 2NTNA 3ANXA 5C8VA 1NSFA 1EP3B 1R0BA 2BI4A 2Q1YA 4W5HA 5DGIA 3THYA 1RXVA 4I3FA 4FFVA 3DBRB 3JAWB 3ND6A 4AZVA 2V65A 2ZB7A 3MFYA 3H83A 1YZFA 1GUYA 4MA5A 1XTJA 2JI8A 1SCBA 4IXDA 3HDTA 1W8DA 3ETDA 4TX1A 5A7FA 2RC5A 2J1LA 1C8LA 3MS7A 4NG4A 3TRFA 5FEMA 3IUBA 4CM8A 2NXCA 2HY7A 2QM7A 2RGEA 1V5EA 2BLLA 1ILEA 3PUZA 1FTNA 3E7XA 2VSFA 3URKA 4GD3Q 3RWMB 4E2YA 2PEYA 4ZICA 1VPLA 4GM4A 1CJSA 4BKRA 4CFZA 3NWOA 3D6AA 4KQFA 1Y42X 1XDZA 4ALJA 1FU8A 2F3TA 1M75A 1U1GA 1WSAA 3C7TA 3G82C 1K68A 2PBLA 4JCOA 2FI1A 1J0EA 1DC5A 1FDVA 1SCJA 2LW7A 3HO1A 5HVNA 2AOUA 1B14A 3F74A 2VC2B 2G5TA 5EMKA 1OA1A 3ZJ4A 3ZIAA 2W42A 1P4SA 5FNVB 4FUQA 5KHOC 2J5XA 2O05A 4D3DA 4FVTA 5KYWA 3EIHA 3NETA 4G9GA 2Q49A 2FW1A 4R9NA 3CTMA 5JS1A 2LD4A 1Z73A 3HWRA 3ZGOA 3BRQA 2BFWA 1RS0A 2XMQA 1SVNA 3LO5A 7ADHA 2ZJ6A 4JFRA 5HKKD 4ND5A 4BXOB 2NVOA 5AVJA 3LECA 1J0AA 3K30A 3HYTA 3GNSA 3QEBZ 2J4DA 1CU1A 3OPYI 1MN6A 4KQ6A 2I22A 3ZK7A 5ALUA 1WZEA 3OT4A 1J49A 2ZSFA 3SSAA 4PAGA 3KU1A 3SICE 1JXQA 5GZ3A 1C5KA 3DVAB 1GYQA 1XAIA 1FUKA 4A27A 2GTIA 5KEIA 2GPTA 2IHBA 2X5NA 3EPRA 2JW5A 1L3CA 2E5WA 5FNVA 3HUDA 1ML3A 2EC5A 4ZAXA 1GLVA 1UJCA 3M89A 4JA0A 5TS3A 3ZIUA 4ZMRA 4E15A 1VSUA 3KVRA 4AMZA 1MABB 1FFDA 1E2HA 5ARBA 4D3YA 2XNSA 3UGTA 2GCEA 1W19A 1N5DA 1DXQA 2OV6A 3PD1A 1AQNA 3N0WA 2V6MA 1E94E 4LISA 3SC6A 4WOCA 1N2JA 3PDJA 5DGXA 3A06A 2XF8A 3FHJA 1SQGA 1MGPA 3ZQ4A 1VSVA 3VOBA 2R6JA 4BN0A 1C7JA 1U0NA 2JFHA 3C85A 1EJ2A 3KEQA 5J2TF 2KHZA 3P0IA 2BDEA 3S7TA 5BQ5A 4DM7A 1JXAA 5IANA 1CUIA 3WKEA 1Z8DA 3U49A 3LF1A 2FJPA 2MTBA 4I50F 1A8IA 1HV8A 1XGKA 2D0IA 5I3ZA 2WJ3A 4QICA 4C2UA 3NYIA 3DQQA 4OAOA 5BOVA 5EKSA 2WWRA 4X3OA 3EGWA 4EHBA 5C7IO 1HRDA 4XVCA 1FDRA 1DINA 3TBKA 2ONYA 5D7BA 4BBPA 2AXPA 2ZYHA 2X0KA 4EGQA 1ZLXA 2OP1A 4YRBA 5AVXA 1QRSA 3UMBA 1OX5A 2C20A 2FE1A 2OWEA 4JLUA 1C4OA 3RC9A 3ENZA 2F6RA 4INAA 3K0BA 3OY7A 1JH8A 4N18A 1XD2B 1NL3A 2OCDA 3K72B 4R8LA 1NVMB 3EZYA 1UC8A 4RORA 3LPAA 5AM5A 2I6SA 2H16A 4C04A 2O07A 5DJ5A 4RVNA 1XQXA 4JR2A 1CRQA 4PZLA 4BVFA 1Z38A 3KKKA 1ZSNA 2ZXFA 2XOKA 4HMOA 4DEVA 4G5YA 4LF9B 1Z9BA 1QQAA 1Q0QA 1SB9A 4RVCA 5E1OA 3WGQA 4NCBA 2C2WA 2DBQA 3D3KA 2NU7A 4UVEA 4GE3A 4XWAA 4EJ2A 5B1IA 5FORA 2PD4A 4DMRA 4JI2B 5IBQA 4DSOA 1DQRA 4BB0A 3UAZA 2Z2JA 3I9LA 2DJIA 4RMIA 1RFLA 3IEVA 3VVLA 1EP2B 4XIJA 2R6R1 3OM9A 5ALHA 2HWYA 2FR8C 4K3UA 1BMFD 4D9IA 2Q4BA 1P5HA 2HX1A 1Y80A 4IIVA 1A9PA 4CDRA 2HRBA 1YBAA 1HDXA 1LTHR 1DVRA 1U0JA 3FBGA 2JIPA 3G6WA 4TL6A 4JZKA 4CMEC 4NV3A 2I2FA 4ZEWA 5KYXA 1M2HA 3MWDB 5KVQA 4DTCA 5LMNB 4CEHB 2AS0A 2XITA 4KYUA 3L7DA 5L4NA 1X1AA 1XRPA 2OE2A 4QM7A 3MWGA 1YQWA 1AQJA 4KW7A 4ZOCA 1MDFA 3BAFA 4N1AA 1R9NA 4TQGA 2AMYA 3KAJA 4DUGA 3EDCA 5JSYA 4WNYA 4YQYA 3GV0A 1G9SA 3H3XA 4QU8A 2ZP1A 3S2EA 3Q6NA 4J0DA 4CKEA 4ENQA 5I4IA 1W36B 2OUKA 2XVMA 1QMPA 4PW0A 4L5JA 3DLPX 4PZ9A 3RIGA 2GBLA 1A4UA 3CF6R 4MQFB 3ENNA 1KYYA 1NW3A 3NWBA 3UFBA 5CJPA 3L6BA 4RV9A 1NUSA 1FUUA 3WWZA 3U9SA 1CR0A 2GX6A 2IXTA 3E5NA 5GJCA 3UT6A 1Z36A 2LCFA 3EXHC 2P78A 3A3OA 2CXRA 4OK5A 3WQHA 3IAHA 4RENA 1PG5A 2QTBA 4AZ3B 4MQLA 4CMBA 5EVJA 3QVSA 1RHMA 2CXNA 1LPPA 5EIOA 1PBNA 2RJOA 3HRKA 4M9CA 1AGYA 5ALYA 2RH5A 2FGKA 4DT1A 2YS7A 4EJSA 5KC8A 5TIIA 3QKTA 4V3BA 4MPTA 4P0QB 2AZDA 3BWBA 2AKYA 3GLKA 3FMVA 4HEQA 1NVBA 2HN9A 3Q98A 4MI9A 3KPJA 3SQLA 2PZJA 3GUHA 5CM9C 3WZLA 2FR1A 3ACDA 4MK4A 4Y1GA 1N77A 3QLVC 4D0SA 1F12A 4RF2A 1NW8A 4BFUA 1WU8A 4YR7A 1E2GA 1QGDA 5F3WB 2LXNA 3ZVRA 1G20E 2WJ6A 3KVNA 1HY3A 3GVHA 1XRNA 2WDZA 3W6OA 3MHTA 1B16A 3LS2A 2DECA 2FFAA 4M60A 2JJQA 3Q8WA 4JCCA 5CVEA 3V8MA 2C7VA 1ISMA 4LN1A 3W8FA 2PVPA 4DADA 5AW7A 2Z3ZA 3RS9A 5IJ9A 1E5LA 1XNJA 3FG9A 3I2JA 4BMZA 2PS9A 3L79A 3TO5A 3HDVA 3I9MA 4C0WA 4E4YA 5FOTA 5SZJA 3AVTA 2BFDA 2IYYA 3MGAA 3CWQA 4YIKA 2C5HA 5BPFA 3P1JA 3N7UA 4WOKA 3SZGA 1ZNWA 3LXRA 4PBRA 2H1OA 2I66A 5JY1A 3R77A 3S2YA 1L7BA 1P1HA 4R2KA 3LNCA 2IU0A 3LRXA 1M33A 3NXKA 5HZKA 3KKNA 5AJXA 1F9EA 2VNKA 1DCFA 2XWQA 2ISSD 4K9PA 4AQ7A 3HCDA 5ICFA 2YIVX 2F9MA 5ESDA 4DA6A 2VPTA 5CPBA 2GCOB 2EWVA 5JBQA 1PQUA 1NHWA 2IU4A 2Y1DA 3DO5A 1A2BA 4PGGA 3SIXA 3AP3A 3TZHA 1N34B 2FAXA 3OIFA 1L8LA 4BMXA 1TU0A 3L8HA 3WLNA 2MR5A 4X7RA 1GL7A 1MC1A 1J22A 3HWSA 3IQFA 1N8NA 4I14A 3PXGA 5JD3A 3T3PB 3TECE 4EPWA 1EG7A 2OCYC 3V2GA 1G18A 1YB2A 3GJ5A 2FZEA 2NV0A 3H8SA 1T4CB 3L40A 3JR3A 3TX2A 3PJDA 4YFVA 3ZHRA 2ISCA 2EKZA 4IYJA 4NC9A 2IT1A 5TGTA 3FW1A 3GYBA 4W99A 4RPJA 4F7DA 4WLNA 1TEHA 5DBGA 1J8YF 1NY6A 5J2UF 2AH5A 2WLSA 5FB3A 4B0PA 1WMFA 2DMRA 3IPCA 5ICGA 4D41A 4OHZA 3MOIA 2V7UA 4G5QA 5J23A 3WX0A 2NN3C 2PUJA 3T5BA 5JYCA 1TL7C 3PIRA 3DDCA 2X0FA 2WM3A 1Y82A 3ORFA 3RLFA 1GPAA 3EQ8A 1JA9A 4KTVE 4TKUA 2I7XA 2OPBA 3M49A 3H9CA 3SS9X 1U3CA 2Z56A 4BMDA 4JY7A 4TMFA 3DE2X 2WTNA 3IOEA 1P2VA 4OXRA 5LOVA 4Y0NA 4DMHA 4DLBA 3U6KA 1ZMXA 2X40A 4PGMA 2GS9A 3TNLA 3X1XA 1IZYA 3IVMA 4CV2A 1E2JA 1CY1A 1DX4A 5BMOA 3LUAA 4HZUB 4M6WB 4RHEA 2C95A 5CJ2A 3UXHA 4B6SA 4E4TA 1BQ3A 2Q29A 5BW8A 1MIOA 4J6FA 4DIBA 3PNBA 5ESRA 4L51A 4PVCA 4GKJB 3RFXA 3A3NA 4Z0NA 1A71A 1FRFS 4DIFA 3R7FA 1QFXA 1Z4QA 4MJ7A 4RU1A 2VJLA 1L8AA 2CEKA 3DFMA 4FHEA 4LYEA 4CT5A 5JASA 3L7OA 2FSIA 3LVQE 4IL5A 3DNMA 4EY8A 2A5YB 4WEQA 4D6PA 1GXSB 3MSCA 4DV1B 1KJNA 4PR3A 5HCNA 1T5DX 4L8VA 4KXYA 1KMQA 3OAAD 4ZREA 1P6XA 3Q3CA 5KWJA 1UK9A 1C3OA 1MAHA 1NI3A 2I4IA 3HYRA 3DR5A 3LDHA 4RHXA 1TGYA 5CDFE 3EARA 3GEHA 4RPIA 3SM3A 3WYFA 5B6JA 2J9FB 4FIDA 3DOOA 2W4MA 3GT7A 5ALPA 5JC8A 2HK9A 3ST7A 3IVAA 4DKXA 3N75A 4PBTA 4WNAB 3AKDA 2O3UA 4BFTA 3QRWA 4QDKA 3HY4A 4K9NA 1ZSYA 4DUPA 3PUHA 2H2AA 3OUZA 2NOAA 4Q6WA 3B7GA 2WFAA 1GDHA 3K5PA 1DBIA 4JELA 4JKYA 1MENA 2HXGA 1N0WA 1PAUA 2VJDA 1QPZA 3ND8A 4BKQA 2VQ6A 4XIIA 4QX6A 5F4ZA 4W1QA 1U9CA 6AT1A 1LQTA 5FOSA 2PWYA 3SF8A 4C5BA 5KPDA 3G68A 4E5YA 1RYFA 2G80A 3O3CA 1JMKC 4NWIA 4MUIA 4TMVA 4B3HA 1GGFA 3WLSA 1B8PA 1EDEA 4KWCA 3RUPA 5L3SB 1ZG3A 1DTSA 1NLFA 2WHQA 5A06A 1I24A 1KHTA 2C7BA 3EQ7A 1GPNA 3CVOA 3MEQA 2WJYA 4ZK6A 4UULA 3WKCA 3O82A 4ZGGA 1N32B 3FMOB 1M2VB 1ZGCA 3L06A 3VU9A 1L5YA 2F1IA 2XTNA 3SQDA 4EG3A 3H18A 5TQ0A 4NAHA 3DDNA 3FPGA 4BFSA 1U4OA 3KSZO 2W71A 4K6MA 1M1YE 1U9YA 4JMPA 4RIHA 3WGYA 5IPFA 1TMKA 2Q5OA 3QMVA 1DQZA 1G7SA 1WV1A 1YR6A 4DQLA 1GFZA 4E07A 4Z8YA 4R0MA 1YZUA 2E18A 3D0OA 2VF2A 4ZZ3A 1OXBB 3TN7A 1KJYA 2Q46A 3C3JA 4RMNA 5EFOA 5IAKA 3UWPA 3HUEA 1PYGA 5LZ2A 1M2EA 3TG2A 4MGHA 3CUUA 3E05A 3S1SA 1NDUA 3TXYA 1BC5A 4ZARA 3BH6A 4EYKA 2J9GA 3TNYA 3AM1A 1WHTA 1DO2A 4KUGA 4B47A 4NOMA 2V0NA 1J24A 1ZQ1A 3COYA 1E0JA 3D7LA 3MINA 5EC8A 2OO5A 5ILQA 3AERA 4PAMA 1DQYA 1Y3AA 3JQFA 1TF5A 2HO5A 1TKRA 1Z7WA 3OTWA 4GSKA 2R6ZA 3HNOA 2VTBB 1BHQ1 2C5AA 2QGZA 1KU6A 4EG6A 1VP3A 4NYMR 5E1BA 1U0RA 3GFFA 4QUHA 1Z4PX 3M6FA 1JYEA 1RWXA 1I8TA 1Y1RA 2I65A 4PYKA 5F3DA 4GWKA 4TT3D 4R84A 3CISA 3KAPA 3T41A 1ACMA 3EOBI 4IGKA 3S2UA 4KWEA 1J42A 4FC7A 5I48A 2O57A 1A76A 2Q2OA 1NAIA 3RHZA 3WMXA 4E5UA 4PSKA 5ALLA 1NYTA 1CETA 3ZU5A 4L9SA 5ALQA 1DFHA 4B7XA 2ORYA 4WADA 4MUJA 2PEZA 2WD8A 4IGFA 5LP6B 2PKEA 4QGGA 1P8AA 4XD7A 2J3DA 3TZCA 3CLVA 4TTAA 1OH6A 4NNOA 2COEA 2ORWA 3FBTA 3QHQA 4E6PA 5JSUA 1E1QD 5FBHA 4UNSA 1CY2A 1ONOA 2FW7A 1KR2A 2MYTA 4NABA 1UZUA 5HG0A 4E1VA 1M5RA 1OCEA 4UAUA 3F78A 3WFZA 3EPPA 3P20A 1Z3CA 3GXBA 3JQEA 3WHLA 3L7CA 5A9SA 2PZGA 3EGVA 3LKDA 1SN7A 1YULA 2OCGA 2Q2WA 2RCYA 2A94A 3F6PA 3P4UA 4I2NA 1O97C 2R2GA 3LLUA 2PRZA 3M33A 2Y6UA 4U7DA 2JFGA 4LJAA 4JP5A 3KEMA 5HJ2A 5TR9A 1WUTA 4QGFA 3IHLA 2OB2A 3WB2A 1E5TA 2L69A 3HA5A 2PA0A 1MC5A 1F51E 2QX9A 5CU7A 1YS6A 3AF0A 3OEHD 1E96A 5IVDA 3UWSA 3DCJA 1XVIA 5DHRA 2PMEA 1X14A 1L7EA 2O0LA 2YW2A 3A9UA 5A7GA 2BW0A 4I3HA 2GILA 3JWHA 4WBSA 3P8ZA 4I55B 1GNLA 3RIYA 1JIKA 1UJBA 1OBCA 1NN5A 1WQ1R 3ES9A 3KQTA 3DE3X 3FNQA 1PZNA 1X7ZA 4R1OA 1B6RA 1L5ZA 1NU8A 4RAOA 1MX5A 2WHPB 3P9ZA 1U63A 1S1CA 4C6SA 3D1LA 1CDOA 1QK3A 3IUYA 4FOLA 4O6VA 5EINA 1V8BA 5LLSA 1U3VA 3TDNA 3EYAA 1T0JB 1WQ4A 2IYUA 4OUDA 3I5XA 1AUOA 2WMYA 3SXJA 4WLOA 3U48A 2Q4EA 3K5WA 3QHAA 4M0LA 1KF0A 2DPHA 1R0XA 4ITRC 4NV0A 5CVUA 3HY3A 5CB6A 1AUXA 4PCVA 1HL7A 4YCDA 3WGJA 4J8PA 3TLAA 3AEQB 3HVUA 4LJ4A 3SFZA 4MW9A 3IUPA 4D5GA 1A2OA 2IZ6A 1HG0A 4HNAB 4ND1A 1P5RA 1J1UA 3MGCA 3O2QB 4UU1A 1EIZA 4N3GA 1ZICA 3ZLTA 5IF9A 1JQDA 3MXTA 2VK1A 3EXEA 4FILA 4K9RA 3RWBA 1PNRA 3HXKA 4WZAB 5LQRA 2AUNA 3B1WA 2AIRA 2QWXA 5EJ2A 3TSYA 4FP9A 5ESWA 2XA9A 3GD5A 1KH3A 1ZM4A 3RM3A 1Q1NA 2Q9UA 3C8MA 4HQFA 6REQA 1QWSA 3UYLA 3EAQA 2GO1A 1JWBB 2WP8J 3OU7A 1ZCFA 2GA9A 3S8EA 5HRUA 2Q3BA 1Y1QA 1Q22A 3CPJB 2AG8A 1M7GA 2ZRCA 3RYFB 4YLGA 4TM8A 3I52A 3P9QA 4KE9A 1G8PA 4ECEA 3ESAA 3QP9A 4LXQA 3UJCA 3I58A 1X74A 1CQJB 2J67A 2XYPA 4MVJE 4ENWA 5GIOE 1RI3A 3C43A 1NMQA 3LDGA 3QUAA 3LK7A 2YOGA 3HJNA 3KKZA 3L1IA 5CVCA 3RIXA 4HNUA 3FSJX 3HEMA 1OH5A 3HR7A 3A6KA 3PNYA 2BONA 3WFIA 4D3FA 4Q21A 4MMZB 5BVHA 3PTZA 4DGQA 4QUBA 1FLAA 3L6UA 2VLBA 3H2SA 1CY8A 3VTZA 1GA6A 4PWZA 4KQKA 3RSFA 1E9FA 3JQBA 5FUVA 4BP1A 4GLOA 3CRMA 4ZU1X 3H0EA 1KHHA 4LK3A 4YT8A 4OP2A 1A8PA 1P9OA 4LF7B 4ZVTA 3MJRA 1M0SA 2I4MA 3N2IA 2BHSA 4UAJA 4QXOA 4AJ1A 1QFSA 1P33A 2B35A 2HQOA 1GRNA 3NEAA 5AYVA 2V3CC 3W5VA 4DB4A 1GZ6A 2GWHA 5KYUB 1EUDA 3PCRB 3BERA 2P2NA 2J0SA 3J80A 4CU5A 3DUFA 1GTL1 2JVJA 3N8KA 4EY4A 4JASB 2HD4A 1IRIA 4V1CI 4AJIA 1R4MB 5JAUA 4WIAA 3QQ5A 2PSHA 2HU7A 3DC2A 3QWIA 5DMXA 3U3MA 4KQXA 4LSGA 3HXTA 1MQ8B 5CX1B 5FIUA 3GQVA 3I6IA 2DTDA 3IULA 4XTCS 1PR4A 1QHHA 2P6RA 1T36B 2ZR9A 4H59A 4KDFA 4YLYA 4HO1X 1DL5A 5EPOA 4E31A 1XMSA 1TO2E 4HDMB 4FBGA 3ANMA 3F6SA 3HA2A 1Z47A 3C8DA 3SC3A 1B8NA 3MM4A 4ER7A 1KQNA 2YVQA 4REQB 4C7BA 5DLPA 5HM8A 4U7PB 1QG4A 1F1BA 4LSZA 3BSFA 4DNOA 4GX2A 1CS0B 3R5SA 1Y5IA 2RIPA 2Y05A 2PJDA 4FX5A 1O4WA 2OGWA 4RZIA 3USES 4ETWA 5FA5A 2Y0PA 1SKYE 5TPWA 4KO4S 4C14A 3OVMA 4Q1AA 1LS1A 3Q10A 3KQHA 1Z6PA 3G0BA 1F0YA 2R00A 4HWPA 1FUIA 4WXPA 4COKA 2QRMA 2ATXA 3CEJA 3ESRA 4RJTA 1P77A 3U4QB 4P0PB 3DDUA 1NW9B 4KQJA 3DHWC 3ZS9A 5AR1A 1KVSA 5EL0A 5LVAA 4R6XA 1AZTA 2C98A 1JQLB 4Q9IA 3E22B 3JAWA 2RE8A 1DG9A 2YJGA 3PHLA 1YTLA 3P9RA 4DJEC 2NTYC 2QZJA 5CNIA 2ODBA 3LPNA 2J3EA 4ITUA 5ALEA 4EJSC 2VTDA 4GZLA 1I7DA 4Z53A 1H66A 2MYNA 1TZJA 4PX3A 3SF0A 3LG2A 4C1NA 3NTQA 1QIEA 3ZWXA 5JHGB 3VR2D 2JLXA 3WJ1A 4BLPA 3CT6A 1DKNA 2I03A 3I9JA 2FWIA 1CRZA 3NAGA 4MQ6A 2QMEA 2HCJB 4Z7OB 1YUBA 3VHQA 1OE0A 4AN4A 1ZJYA 1LK5A 1AGXA 1UBSB 4LF8B 3QLTA 1V8ZA 1S7CA 1JDZA 4RVGA 4PNZA 4YK7A 1F4VA 1YJXA 4M4SA 1A3CA 2FUKA 3PGJA 3JX9A 2ZS9A 3R5TA 5B2EA 2BM8A 3TQHA 3B60A 2P62A 1F8FA 4JVLA 2B3TA 3U4HA 4ADSG 2Y8EA 1HOTA 1LLDA 1UOPA 2Y0DA 3L0DA 4JJEA 4UMDA 1SZPA 4LOAA 3B13B 4D9FA 1E0KA 1JFTA 1Z62A 4B9AA 2CFOA 3CLUD 8GPBA 3GZ4A 1ZM9A 1SIWA 1U94A 4X20B 4Q24A 4O59O 4D4LA 3OKCA 1I7NA 5JNLA 4HGPA 1WCV1 2FN7A 4BXOA 3GLGB 4JT4A 3KOYA 1B1CA 2FQXA 1A82A 1FC0A 3LX4A 2HQ1A 2YZ7A 2ZWAA 5FTWA 2OXRA 2XZPA 1IZZA 4MKXA 1GTG1 3E7PA 4GPAA 4P6VF 3WIBA 4EHAA 2R68A 4MTCA 4EKNB 5B4TA 4HZIA 3A1DA 1FVHA 1QG2A 2GWRA 3MWYW 2P2SA 4Q4CA 1OFUX 3DVAA 4B33A 1LLFA 3P26A 3R4CA 2IY8A 3IMGA 4KE7A 5DISB 4U6SA 3KKEA 1RCFA 1JSCA 4XWYA 3HCOA 3JZAA 4H1TA 2Q62A 2EFDB 3T3HA 2RD2A 4EKEA 1XDGA 3A0UA 3OX1A 1P2BA 4LDRA 4NDAA 5GQSA 3ZDRA 5IMSA 2BV3A 2C4MA 3BFPA 1GD1O 1KMIY 2CXTA 3BDIA 2CJFA 1F8XA 2I55A 2ANBA 4PC3A 5BNZA 3TR5A 2DCUA 3UA4A 3C74A 1MABA 3NDJA 5FV4A 2DYKA 1IEQA 2I34A 3P9SA 4NDNE 1WXIA 3FUXA 4GP9A 4WKGA 4YAJA 5AO9A 1T25A 4O4JB 4DLXA 4EDFA 2I67A 2AE2A 3GGDA 3GRVA 2HWXA 1N2XA 2IXDA 2NADA 4XDZA 1Z0DA 1O94C 4XIFA 3WZMA 5LOVF 3KFLA 1PJBA 3CU5A 2HMSA 3CX7A 1VGVA 1ZH2A 4UU7A 1DC6A 2QG9A 1X2BA 1OU0A 2R65A 1V6SA 5EQDA 2HCTA 3OPVA 3I5AA 3V3KA 4X64B 1ZOOA 3AZQA 4MQ5A 5IT9A 2GCPA 3NYWA 1N0VC 1BWQA 3QUSA 2JBHA 3KXDA 3R6WA 4UM5A 5EKUA 3L1UA 3V9AA 4YRIA 4UTXA 4PZUA 3DP7A 4DIEA 3PFBA 3EDMA 4JI1B 4BY9E 3K9WA 1J8MF 2Q45A 2C4NA 2P77A 2QJTA 1P3Y1 3GRAA 1XDWA 2OBMA 4IUBS 4C4ZA 1M1NA 3RS0A 3HXQA 2QX8A 3DMHA 1R8SA 4YMUA 3ZBPA 1BWRA 5DHQA 1TJ3A 2WYOA 1MLDA 4WCVA 3KT0A 4QHYA 4OMUA 4D74A 2WA2A 4D8TA 4EFLA 4IDDA 4B85A 3GEIA 9ATCA 2RHHA 3K8YA 2CWWA 2JGKA 3PWKA 4WZBE 5C18A 4U2GA 3KHSA 1XD2A 3T15A 2J08A 1EWYA 2I33A 1IYZA 3IQDB 3NHPA 3WL4A 4E70A 3E7FA 3CIOA 5LYYA 2C07A 1T1EA 1KEZA 3PTLA 1V95A 1TQ6A 1ULSA 5IDYA 3VZSA 4ND6A 1UUFA 1XL0A 1JDBC 3OOJA 2M2IA 3HXOA 1OZAA 3FTNA 4V2IA 5DV9A 4IKEA 5ES3A 1NVGA 1XD9A 4M1TA 5D8DA 1YA4A 2GRUA 1FRZA 4RKEA 1IZ9A 4RCYA 3U4MA 4ZT2A 4MR7B 1L7DA 5IAOA 5JNVA 4W5TA 2YHIB 4P3NA 1K75A 2QMUA 1SB8A 3THWB 2QTGA 1KEWA 1DG1G 1RXSA 2JHFA 1J1ZA 2EBUA 3GNQA 4N8EA 1BS1A 1O8CA 1QIKA 4K1XA 5IVIA 1KZYC 2DHRA 4FGUA 2VRCD 3U4IA 1R0ZA 2JF0A 2MR6A 5P21A 4CKCA 2Y1LA 4K1LA 3R0IA 3TD6A 3CURA 2HSWA 4J3NA 1AF4A 3WLJA 2WJVA 2IUFA 3GEBA 3ECCA 2F8MA 4ZV9A 1Q83A 3IXLA 3MWDA 3ICCA 4MW1A 3TX6A 2H51A 4RK5A 3ZBUA 4DRYA 2W83A 4LJ7A 5JS2A 2AVDA 4ZYXA 1N2HA 1D3AA 2AK3A 1CQXA 3CLTD 2CCJA 3VI4B 3REFA 3D3NA 1IEXA 4HDCA 1OILA 4JEMA 3GDOA 3NPAA 3SQOA 4C6RA 2ZRKA 2PN1A 3LNTA 3VGJA 2X77A 4EI2A 4E6EA 1E2LA 2J07A 2O54A 2P68A 5KNDH 4DV0B 1JSXA 2CDRA 2WA1A 2D7CA 3PEEA 4K46A 1E66A 4WH0A 5D1NA 4YPOA 2IOHA 3OQMA 3B5IA 5KNDA 3E9YA 2D2VA 3KSDO 3O21A 4MQFA 1XRLA 4UTNA 1UZAA 2AXQA 4OGFA 1E6LA 3WTCA 2P4UA 4CPDA 1UJ5A 1BO6A 2YHAA 5M3BA 3AV0B 2EGUA 3AY6A 1Z5PA 2X0NA 5A6SB 3TIVA 1DUVG 2AJLI 2JGIA 3EIQA 4M7RA 4FXPA 2P1DA 5I3CA 3I1JA 4QXMA 4AZ3A 1KRWA 3A32A 4FFPA 3Q7SA 2P2DA 1A7UA 1UBJS 2IEBA 3VSCA 3U26A 4MYRA 2Q5EA 4B9EA 3TTWA 4RVDA 3TBHA 1C0IA 3OF3A 4US0R 4P81A <