4EMBA

Crystal structure of a phosphoglycerate mutase gpma from borrelia burgdorferi b31
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
245
structure length
245
Chain Sequence
FMYKLVLVRHGESEWNKENLFTGWTDVKLSDKGIDEAVEAGLLLKQEGYSFDIAFSSLLSRANDTLNIILRELGQSYISVKKTWRLNERHYGALQGLNKSETAAKYGEDKVLIWRRSYDVPPMSLDESDDRHPIKDPRYKHIPKRELPSTECLKDTVARVIPYWTDEIAKEVLEGKKVIVAAHGNSLRALVKYFDNLSEEDVLKLNIPTGIPLVYELDKDLNPIKHYYLGDESKIKKAMESVASQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
publication title Crystal structure of a phosphoglycerate mutase gpmA from Borrelia burgdorferi B31
rcsb
source organism Borrelia burgdorferi
total genus 83
structure length 245
sequence length 245
chains with identical sequence B, C, D
ec nomenclature ec 5.4.2.11: Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent).
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 4embA00
3C7TA 2OWDA 3LG2A 1UJCA 2H0QA 1BQ3A 4PZ9A 5AJYA 4FDUA 3GW8A 3NFYA 3D8HA 4HBZA 4JOBA 1DKPA 1QFXA 2DWOA 2YN2A 1DKQA 5PGMA 3PGMA 2EKBA 1C81A 2PA0A 4PGMA 2HHJA 1E58A 1NT4A 2EKZA 3E9DA 3IT0A 2OWEA 3IT1A 3DB1A 1SKAA 2P9FA 2HIAA 2P77A 3FJYA 1ND6A 4D4LA 4EMBA 2EOAA 1BQ4A 1SK8A 4GPIB 4D4MA 2IKQA 3EOZA 2GFIA 4ARVA 1DKMA 2ENUA 2DWPA 3OI7A 4EO9A 2WU0A 1XQ9A 3D6AA 2P9YA 3EZNA 3MBKA 5AJWA 4E3WA 1C80A 3QPWA 3DCYA 3K4QA 2WNHA 1BIFA 3K4PA 2P2ZA 3IT3A 3ZHCA 3KKKA 3LNTA 3IT2A 3F3KA 2P79A 5AK0A 2H52A 5CX4A 1T8PA 2WNIA 4JOCA 4ARUA 3GP5A 3R7AA 1UJBA 1SKBA 1RPTA 2YN0A 2P30A 1QHFA 3D4IA 5AJVB 1DKNA 2P78A 5AJXA 2RFLA 2ENWA 3QPVA 4GPZA 4TSRA 2F90A 4D4KA 2AXNA 5HR5A 1RIIA 2P6OA 1E59A 3HJGA 4AROA 2I1VB 1H2FA 1FZTA 1YJXA 4ODIA 2P2YA 2P75A 4ARSA 2H4ZA 5HTKA 3FDZA 1SK9A 4QIHA 2H4XA 1V7QA 2QNIA 4FDTA 2A6PA 1CVIA 1QWOA 1V37A 3MXOA 1C7ZA 3F2IA 4PZAA 2BIFA 1ND5A 4IJ5A 4JODA 5CDHA 3E9EA 1FBTA 2P9ZA 3QPUA 2A9JA 3O0TA 4MA4A 1EBBA 1YFKA 1TIPA 4D4JA 2P6MA 1RPAA 3FDZB 3E9CA 1DKLA 4IJ6A 5AJZA 5CU7A 1IHPA 3LL4A 3NTLA 1K6MA 1DKOA 3GP3A 1H2EA 2HPAA 3BIFA
chains in the Genus database with same CATH superfamily
5LYJA 4AJPA 2YV1A 3KCNA 1I0IA 3F96A 2LUOA 4FFBA 5C8YB 1MOPA 3MWJA 5D5PA 3U4MA 3LCMA 1KKLA 3QNMA 1XBTA 3ROGA 4WXMA 5EXEA 1GJRA 4IMRA 1TVMA 4MGKR 1Y81A 2EKBA 4QSMA 2AOTB 5U4XA 1A8IA 3QSYA 1QF9A 4L2IB 4YXWD 3AILA 2PZMA 5CW1A 3B2QA 2A1TR 3FRIA 1XJWA 1Y1PA 2HF8A 1GAQA 2QL7A 2PV7A 4HQ0A 1Z8HA 1EEHA 1R6XA 1V2HE 4L85A 4DN6A 4J8PA 4GL2A 2EJTA 1Q0QA 2J5RA 1EVJA 1M6YA 2ZT7A 5K8CA 3OZTA 8LDHA 3QUQA 3LRTA 3L05A 1SC3A 5KWVA 3IP7A 3E7PA 4JGIA 1AQIA 3ENQA 5LZ2A 4MS3A 3ZE7A 2Q0QA 2H1LA 4FYKA 4LXQA 4G26A 4HNRA 1D2CA 3IUYA 3D7NA 2XYQA 3G0GA 4IEEA 1YDMA 3JYHA 1KMHB 2NU7B 4W1PA 4YMSA 4IRUB 4AMUA 1AZWA 1I7PA 1T91A 3H5IA 2HBZA 5HJ5A 3GLVA 4UNSA 4AM8A 2M98A 3HA3A 4AUEA 1WUIS 3JTMA 2X22A 1DBSA 4WJZA 1GA4A 4U7TB 2IU0A 1M34E 3VSDA 3VJMA 2PVSA 4M0PA 4FEAA 1CUBA 3K0BA 4CLOA 5FNVF 3JX9A 2VHJA 4DLSA 3U6BA 2JGLA 2RK3A 1E2JA 5JS7A 1J9EA 1PZMA 4BO1A 5TMEA 3FUXA 1GN9A 5KYNA 4UDYX 4O33A 3D7RA 3PNKA 4ZU1X 4DXAA 2LCIA 2XCRB 4AJ2A 4Z8YA 4F7WA 4CL0A 5B4VA 5GJVC 4BGUA 2OCBA 2UZIR 5EJIA 1P60A 1CUSA 2FXVA 1QG6A 4Y2HA 5AXDA 2XUGA 3U44B 2OHGA 3RS4A 3LO5A 1OYYA 2ZCUA 4ZAGA 1P3JA 3ZE0B 2J3LA 4MUBA 4EG3A 2HDWA 3MVEA 1J0EA 4KVFA 4HX2A 2ZUVA 4CEIA 2C97A 3R5FA 1TTPB 2I3ZA 1TAHA 1RTKA 4NI5A 1XQ6A 2XQKA 2ZJOA 5BVGA 4N6GA 2ZJ5A 4FXOA 1QZZA 3P5SA 1KXJA 4ZTUB 2YW2A 2WWTA 2A30A 3U9LA 2R1TB 3A26A 4YCAA 3EIOA 1IXRC 4UCQA 1MX9A 2Q4EA 4LYHA 4H7EA 2OUIA 1UEIA 4DJDC 1NHGA 2H7XA 1SVNA 3DO8A 4ZYZA 4YH1A 1LJLA 3WG9A 3PFKA 1LV7A 3P19A 2IBTA 4WBXC 2CVOA 1W4ZA 5EQJB 3VAZA 2GXUA 4WOBA 2X42A 8OHMA 3CMMA 4L6IA 1DX4A 1ZX1A 3VHXA 7MHTA 3FZGA 4DDHA 1E64A 3N2KB 1DAGA 4F6RA 1ZRMA 1UPTA 2VPWA 1UP7A 1AUOA 3HEBA 4QPPA 4RHYA 1Q11A 2ACEA 2HWKA 2PM8A 2RGEA 4HI0E 5CW2A 4RPJA 3VZCA 1BE8A 1Y4DE 1KMNA 2OGWA 2X13A 5EG5A 4IZIA 4UBKA 3OZRA 1DOZA 1ZOOA 3PDCA 3PNQA 4RA6B 3RWBA 5AH0A 4HQNA 4NMXB 4Z1OA 5DNCA 2FN4A 5LL6P 4RF5A 5DRTA 5SY6A 4HBZA 3L8MA 4KQWA 1YQQA 1ZN7A 4ABTA 3COYA 1EESA 4HAYA 2WV7A 5BQOA 1GTMA 3B60A 3D7KA 3OPQA 1GGJA 4Z0TA 4AUKA 5K20A 1ORHA 3KAQA 3QP9A 4XM2A 1WPRA 2YOGA 2FX5A 5BRJA 2JCGA 3LQYA 2SCUA 4MEJA 5JS2A 5K05A 3AR9A 2B8TA 5EUMA 1NJFA 3CPSA 5DHUA 2RGWA 5F77A 4BX2A 4C7OB 2V0CA 4DTCA 1I3CA 2IKQA 1H0KA 1LLCA 4H3SA 1RW4A 1RJGA 4KI7A 2PHZA 1NBWB 3UNXA 4CM1A 1E4OA 1LQTA 2HBQA 4O4JF 1MVNA 4KVGA 4HFRA 4X7RA 1SXPA 4Y1RB 2B78A 1SVOA 1U7PA 2BKVA 2WWHA 4NPCA 2GCOB 3A6DA 1VI5A 3T38A 3NC4A 4AN0A 1NONA 4H4CA 4QDUA 2O4CA 5TLSA 2PKWA 4MKHA 4TMXA 1Z88A 2VDPB 3ZHCA 1J4AA 4B0PA 4GC9A 2H31A 5AHXA 3I8OA 4EQ6A 4F5YA 4NCBA 4J1SA 1A5ZA 1P5FA 1ZJJA 3CX7A 3NDJA 5EXXA 3SZOA 1Y3HA 1KMQA 2Y93A 9ABPA 5JDIC 3ME5A 2XXJA 3GOHA 3QE3A 4BDTA 1VMIA 1RQGA 4YC7A 3U3RA 3MUNA 3A1UA 1L7RA 1YBHA 2DETA 4LF4B 2VR1A 3A3PA 4O2RA 4FZVA 4F3KA 2F90A 3T4PA 2XUAA 3KETA 1ZIDA 3F6CA 1SEPA 4KQ2A 2GEJA 5IYZF 1U9YA 4UOQA 1QU3A 3E48A 2XZLA 3IRUA 2BYTA 2FUKA 4AZWA 1DRWA 3IXQA 4GYYA 3WWZA 3OZAA 5K0FA 1FJXA 2AE1A 3A1EA 4URXR 4LE2A 4BRUA 4O8CA 3REGA 4U7FA 1X19A 1I51A 3ZCPA 5BN5B 3GPLA 4CIVA 2XMCA 1AMUA 4I6JA 2XMZA 2A6PA 2L17A 1CVIA 1Q7RA 2WIAA 1UPCA 4LYJA 2LNDA 5EIOA 5EOVA 1QS0A 5B1IA 1QORA 2G0AA 1FYFA 4Q21A 2BW0A 2NZYA 3E5HA 4PAMA 3BAZA 3VPHA 4FOSA 1HOXA 3RIXA 1YBFA 3KT0A 1ZD4A 2XTZA 3IMEA 3G17A 1PBNA 4JEUA 1K9VF 4GRDA 2O2CA 3S27A 4B8YA 5JCJD 1KEKA 2W9XA 1I1QB 3A9SA 4M0CA 3EXG2 1J2TA 4V0NA 2C29D 2TMYA 2Q1XA 3RAJA 3ZD9A 4RXTA 5EESA 2BMFA 2OO5C 4DYDA 3F6YA 1AKRA 1VMKA 4KDFA 5REQA 3LKZA 3ER8A 2L82A 1TE2A 2JD0A 2P8JA 3QKUA 1KQPA 3RU2A 1N33B 1ARZA 4IUCS 3T5BA 3CE9A 4LV8B 1AB6A 1JG7A 2QX8A 3T3MB 4EELA 3T3HA 4OHXA 4JI0B 3EVTA 4BFTA 4B47A 4KI0A 1K8XB 3TXAA 2OE2A 1ELOA 2XTJA 4FOOA 4G0MA 2X8JA 2ZBFA 3VAAA 4DADA 1HR0B 1S1MA 3CGWA 2QJRA 3ETGA 4EAQA 3KZMA 3JZDA 3AKCA 1E3MA 3RABA 2C4TA 4X1KA 2BM1A 4V1CI 3AEKA 1H3NA 1GVNB 4FCCA 4DZZA 5CEFA 4QUAA 1JDBB 2F2TA 2XNCA 3F46A 3GJZA 1LTKA 5C80A 4MULA 2CLHB 1P9RA 3OP1A 4MGHA 2AFHE 5I9IA 1QIMA 1HE1C 1UPBA 2DBYA 3A32A 2FSIA 2QQGA 2VUUA 3ETHA 3VR0A 5JOQA 1P0QA 3HGMA 5K0SA 4RSGA 2J5XA 4JUAA 3FLMA 4U0JA 1HH4A 3V4LA 5JZ9A 2ZB8A 1ZIOA 2XHEA 2UVDA 3WGNA 4UBJA 5B6JA 5FAKA 1USWA 4MIOA 2NX2A 2J1LA 1J5PA 2ABWA 1PWZA 1XHFA 3OX1A 4ND2A 5J59A 4EO9A 3EBLA 5JQWA 1SCUB 3CM0A 1ZVJA 2ZI7A 1FYVA 1EE1A 1QHHB 2FXIA 2XHZA 3OT5A 4FCWA 4ZU6X 5CBPB 3BAFA 3GT0A 5JCOA 4TXNA 3EZ7A 4BZXA 3G2NA 5A5VA 3S1SA 1PSWA 5FFMA 3DAHA 3VKGA 4COKA 3T7EA 3KPYA 4XDZA 3UMBA 1CJSA 3GCDA 3T9FA 2WJGA 3OG9A 2BVNA 4HDSB 5DTJA 5HEKA 3LFHA 4E3ZA 2XGMA 4AO7A 3O4HA 4EA9A 1R8XA 2BP7A 1LD3A 1OFUX 3D6JA 3DFZA 5FPKA 2ZJ7A 2W6QA 3LWDA 1GCAA 2C4UA 2OORC 2GHQA 4QHYA 3IHKA 5DHAA 3A9CA 4Q02A 1MJHA 5CFOA 1WUYA 2NO4A 3WBKA 3K9NA 3TIXB 1GPBA 1X1TA 2HMWA 5FBLB 2BGLA 2QENA 5FXMA 4PPYA 3PHGA 5TDHA 4F4FA 5IKEA 1AG9A 4MQUA 1TUGA 6CHYA 5JYEA 1WW8A 3KYJB 2ZSUA 3AUSA 4RCZA 5L7TA 5DM2A 5JYCA 2PL9A 1JV2B 5T67A 5JALA 1UZUA 3ES9A 3T7DA 2Q7DA 1WHTB 4XPZA 3IEVA 2X8LA 1OLXB 2E4WA 2RKBA 2OHFA 4QKQA 1BRTA 4OVKA 5CD1A 2BGIA 4IJMA 4MQ4A 4YONB 1Z83A 4QDOA 3OQIB 1F06A 1Q1AA 3AU9A 4FLEA 4N5DA 4PZAA 4RPIA 1TW2A 5DTRA 2PZBA 5TNXA 3PNYA 3TZBA 3VVMA 3W6ZA 4F71A 4ZVTA 4JJEA 2CXRA 4C5CA 4ETNA 5CDSA 2XZOA 1T5SA 1FFHA 3EISA 3BA1A 2BUCA 4NH0A 1D2RA 1B0UA 2ETXA 1C8LA 2Y0CA 4X5OA 4N0EA 3V42A 3O8CA 5G0TA 4ZVRA 2CLSA 2BFFA 3BF8A 3JZFA 4Q9IA 1MQ9A 1V1MB 1Z33A 5F2NA 5JC8A 1R9GA 3FWZA 3I9V1 3R6TA 1L5LA 1NX6A 1E9VA 1NKTA 3BWCA 3DFUA 5JDCC 3T9AA 4AJJA 4MHTA 1LI4A 4PG5A 5C5CA 4K28A 4W5TA 2BI7A 2GWHA 3IBSA 1RAIA 3PJGA 5FL7D 3WXMA 4NJOA 4B71A 2HW8A 4YO8A 5I7UA 1Z5ZA 1M83A 3LLCA 4ZMRA 4HL6A 1UC5B 2XVYA 1ZRHA 4OREX 4GQIA 4HWSA 4ZXFA 3BIFA 4B6OA 1S1CA 3GCXA 3NJ8A 1SRRA 3D3WB 4JYMA 8GPBA 4FMDB 3GEGA 10MHA 5DW0A 1R4NA 1VHJA 4J0GA 2H16A 4IQFA 1QRUA 1SKYE 1E9FA 1UDAA 2JIQA 4ALLA 1YL7A 2QW0X 4Q6WA 1IUNA 4JJ8A 4MLCA 4B3XA 3ETDA 1E6UA 1CETA 4PWYA 2VRBA 3L7LA 1YC5A 1TB4A 2PMBA 1FMLA 2GPBA 1Y3IA 2IEGA 3DUWA 3UK7A 3CVWA 3ZD6A 1EX7A 2O19A 3W7BA 2CBXA 2QYOA 2NU9B 3H9CA 5DM4A 1C9MA 1EK5A 1BDBA 2PT7A 2DLNA 3PJEA 4PW0A 4LHYA 4WERA 3C3CA 5ERYA 1G9TA 4LY3A 1UOEA 5CJJA 3V4RA 2QQ0A 4D4MA 5I7RA 3IAFA 2ZCVA 3RSFA 2F7SA 4B83A 4OB7A 4F6CA 4F4HA 2CVFA 2FDRA 3P26A 4TTAA 5FPQA 5AVXA 2G1KA 4R1SA 4KGXA 1XZIA 1VQ1A 2GN9A 1E5QA 3PYLA 4BVHA 2KMLA 1XDGA 1MOZA 2GBPA 3TTSA 5FUMA 1WL8A 4MS4A 2OCXA 4M89A 3TNFA 3U7JA 4B46A 4RTSA 4YJ3B 3IDQA 2P7IA 1PT8A 3DMYA 1M76A 5ILQA 1XYYA 4JIGA 1SIBE 2R00A 5AICA 1RWBA 2BJHA 4WAUA 1J99A 5DX1A 5FFFA 1G7TA 3CT4A 3NBZC 1QO0D 3CX8A 1ZOIA 4XFKA 5EXSA 1TQ6A 3PTAA 1YUMA 4A36A 3CGGA 1OYVA 1K63A 3BRWD 5FHQA 4PC3A 5AQ1A 4CETA 3DTVA 4X95A 5G3YA 2ZB2A 4V0ME 4JLOA 4Q4AB 4RADA 3F6EX 3NWEA 4G8BA 3FB4A 3P9CA 4S1TA 1KQGA 4JI4B 4V0KA 1IBLB 4G8CA 4N3AA 1XAGA 1U0OC 3LSTA 1K92A 1C4OA 1U1IA 3LW7A 1TM1E 1UBRS 3CS3A 3I1JA 1SPBS 5DLDA 3SXJA 4AWAA 5KTMA 2R1UA 4ITVA 5C8YA 1E59A 2E85A 2PKXA 4ZOEA 4JLNA 3DAYA 3V34A 1FS6A 2J6BA 5A71A 1ESMA 1OVGA 4CUZA 1IHYA 9MHTA 1OBOA 2AOTA 2HC9A 5E9WA 3B6IA 3PB3A 3IR5A 4BP9A 3I5MA 5CRIA 2VNHA 3C8DA 2XMPA 4MROA 2H4FA 3GT7A 2OPBA 3A27A 3DDNA 3BXPA 3CF6R 5DWQA 2LP4Y 2NXJA 1RPJA 2TMGA 4FBLA 1QXSA 3COZA 4OLAA 4EVIA 1Z4KA 3ACDA 1N2OA 2AXPA 3C41J 4D8WA 1OIWA 5JFGA 4LNHA 4AJKA 1LK7A 1M6HA 1O5TA 4ZD6A 3C7DB 3WOHA 4J1QA 1EWKA 1QF6A 1O6BA 4LIPD 4OOEA 4B2LA 2OD9A 3P0FA 5DM60 2H3HA 4J76A 7AT1A 1DAEA 5JYBA 3AUXA 1TX4B 2FOLA 4IGEA 1XL1A 3HBLA 3SJCA 1ULSA 2VJYA 4GPEA 5TV2A 1OBFO 2D1TA 1JHQA 2NV6A 4Y7DA 1CY7A 1EVYA 1KMHA 1L4EA 2B94A 2BMEA 1XN1A 2NU7A 3BVPA 3EVCA 3LPLA 2XCIA 2IVZA 3IPXA 2IS1A 3BXEA 4MLZA 4OFXA 4G9BA 3OP4A 5CU7A 1FRQA 1CRQA 3FWYA 3A4TA 3MG9A 1Y5RA 2D5IA 2ID8A 4YNBA 1J42A 3U80A 4G5OA 2LW7A 4D9IA 4UQLA 2YHIB 3NALA 1CUAA 3D0QA 2DQ4A 3C97A 4PLHA 5FOSA 2C2WA 3N2IA 2FSUA 3HA5A 3C7TA 4LBVA 2GN0A 1QG0A 1CK4A 4ALNA 4AKSA 3KHKA 4RQBA 2I6TA 4BNDB 3FUTA 1KY2A 3V7UA 1H8EA 1VLVA 4NE2A 4BQRA 4YRGA 2Y67A 3X1ZA 3PVZA 2ZQYA 5CLHA 2JJ1A 3IPYA 3OTQA 3RS9A 4C6RA 4KAXA 5LP6B 1XMQB 1WB5A 3EY4A 5B4TA 4D92A 1B74A 1FBNA 4CQMB 1TZMA 2G83A 2I6GA 3U44A 1XK6A 2Y4OA 1YZLA 3VR5D 3GRKA 1BGXT 3INNA 3HV0A 4G0PA 5FDFA 1ZP6A 2FUG6 1PVDA 4A23A 1EXWA 1GUFA 1E2HA 1AZTA 1Q12A 2Y1EA 2JAQA 3EVNA 4IMJB 4PINA 3ZE8A 1EWRA 3ZGVA 3TLGB 3ZX4A 4CIDA 1QTNA 1S3FA 4HB4A 4M9RA 2XKKA 3QVLA 2BEJA 3TJZA 4E1AA 2PZKA 4ZYYA 2IHJA 4D9CA 3IGFA 5ADWA 3CYFA 1KHTA 2K7FA 2R1TA 1FMTA 3RRBA 3GFSA 3HRKA 4PNHA 2RBKA 5AIBA 4K9RA 3WMFA 3RHZA 3E8XA 4LY6A 4QGAA 3W5BA 4MKGA 5BT8A 3BE6A 3OJFA 1DT3A 1SUBA 4HH3C 4P4GA 4BWVA 1G4HA 1GPH1 4XWOA 1IBMB 1TIKA 3MWLA 1ZSVA 1VPWA 3NASA 1WOYA 2KJQA 4G1EB 3ROTA 4YP0A 1FL9A 3BGVA 4LS3A 1MFPA 4WZAB 4U7HA 5HUHA 2IY8A 1SC1A 3BSYA 2RDMA 3BWDD 3R7AA 4ZOLB 3VVLA 3WMGA 5JSQA 3T5GA 4DV3B 3RSQA 3U4CA 1YS9A 3LX5A 1ENYA 3K72B 3PUIA 4WY8A 4BB5A 1DU4A 3RVKA 2WUWE 2BZGA 2G0NA 5IABA 1T2UA 4ZZ1A 2H1HA 4Q4DA 4QRIA 4DJAA 2J6CA 1N3LA 1W5TA 1NP6A 4XX0B 3M5CA 5A4JA 4Z2AA 1NYLA 1OFUA 3PC8A 1F2UA 2P6RA 1M3SA 3HJGA 1UJMA 2GDZA 2IX3A 3OOHA 3GRUA 1KF0A 3ONFA 3SI7A 2WFZA 3LC2O 5C8VA 4MQEA 2OENG 1DCKA 1SZPA 3KLOA 4G8JA 1GNSA 1JSLA 4I1PA 1CS0A 4C7OA 2HQBA 5EJAA 3QOYA 5IXSA 5ESDA 3U3XA 2GVZC 3DMPA 3F4KA 3QKTA 2YWHA 1XJ5A 1LRLA 2N1MA 2O8BA 1TC1A 1HSZA 1P0FA 3GJ4A 1DEHA 4H59A 3NVAA 3AVPA 4N76A 4Q01A 1ECGA 3CNOA 5KVVA 4N48A 1MPTA 2B0CA 2GA8A 1N2ZA 3ENWA 4IWNA 4QYSA 4LY0A 1YBMA 3Q7IA 2QVYX 5DKFA 3VTAA 4LK3A 5GADl 3IE2A 2GCOA 4HUTA 2P6MA 2JEOA 1Q0LA 3PEWA 5IANA 2GFQA 5JZSA 1L7DA 2IYLD 4W9NC 2VEOA 4JLVA 2W43A 4YREA 4PQFA 4URFA 1DEKA 1GP2A 3UGJA 4DM4A 1RBMA 4FX2A 2I3DA 4P38A 4EMTA 2IGTA 2B92A 2F9FA 1Y1TA 2NYAA 1FDOA 2D1YA 3F7NA 3U4GA 3LU1A 1PE0A 4CPDA 1JAXA 4BNFA 1QBGA 3A2LA 4MTLA 4NDAA 3HB9A 5LQJA 2W58A 2LDBA 2CXOA 2GAAA 2Q5QA 1JNXX 2V5UA 3PQ8A 4FLMA 5AW4A 4DBVO 5KJ6A 1JTEA 1L5QA 4C4AA 1UAYA 1XZKA 4S1VA 5D1NA 2CVZA 2WFAA 1E8NA 3AGPA 3LF2A 1FNSA 1S8OA 2VN8A 2ZRPA 1I3LA 3JCZA 5FBWB 3SQXA 3LMKA 2ACWA 4MQ6A 1ZNWA 4WNIA 3HL0A 2G71A 4D0NA 2Z9CA 3JALB 4EKDA 3HJHA 3T7JA 1IZ9A 2O05A 3PCRB 3VOAA 4RPKA 3ZHUA 4ID3A 5C18A 3ETCA 1U1EA 3GAAA 5DN6A 4AP5A 5BN5A 3HJNA 5KREA 5BN4B 3HI4A 3LXMA 4M1WA 3L46A 1XEXB 3QWIA 1JLHA 3AVUA 2IPXA 5CJPA 4AKHA 3GLSA 3WGOA 4BCBA 4L5BA 2ZRHA 1LWOA 1CJTC 3WLAA 1PAUA 3BEOA 1IXYA 4KQMA 5ITVA 3GCGA 2WU0A 3RRXA 4QYWA 5JNRA 1DV2A 4U7JA 4QUBA 1NLZA 4Z0NA 5ES3A 3LPAA 2QPTA 3IDAA 4KE7A 3WLKX 5FL3A 4YFVA 3OT4A 1VTKA 1M6EX 4WFKA 4QEDA 3DLBA 1NLUA 1POWA 3FCAA 1IK4A 3JD4A 3AB7A 2PBLA 3M82A 2WPNA 3AR8A 1HEYA 3NHUA 3PIDA 3NCTA 4G0OA 4JDUA 3EXHB 5A04A 2VQ6A 3ASVA 1ZDMA 3S68A 5H59A 4PR0A 1YSCA 3KAPA 1PP4A 1Y7HA 3GPDG 1WTAA 4M9CA 3KTDA 4MRRA 5EJ2A 3D59A 1L4NA 4FQ8A 1K4YA 4L4RA 4YAOA 5A7GA 3SIPA 3I6ZA 2YY7A 5K3SA 1LLDA 4LA4A 3C43A 2V9CA 5SICE 1UMKA 5BSWA 5T6MA 3GJ3A 3KFVA 5ALRA 3UK6A 2WMDA 3C8MA 4M99A 5A4DA 4HXEB 4LI3X 4LXTA 5E1MA 4ZVOA 4GM4A 4KN8A 1WEHA 4FHGA 2OC9A 3OWOA 5JZBA 3A37A 3R77A 4PZCA 4RLHA 3V1LA 3WDLA 2EC5A 3ST7A 4QPJC 4UXIA 2H4ZA 4A2CA 2EG5A 1CJVC 1UDCA 1RLMA 3GYGA 2I7VA 4I8DA 3EXAA 2ZREA 4K1XA 3ZWCA 4N65A 4R7ZA 1T1GA 1FF9A 1RLJA 1Y0BA 2VZEA 4L4ZA 2PX2A 2FMTA 3FI9A 5M3BA 3O3OB 1XHLA 2O9JA 3ECSA 4N6OA 4DWVA 1VJRA 4COOA 3QE4A 2O5VA 4X94A 2XCUA 1EX1A 4IG4A 1VIMA 4C0BA 2MR6A 4MA4A 1WXWA 4WDQA 1QFJA 4QICA 3JARB 4HX5A 2DKOA 2WQ6A 2OCAA 1YTLA 1RLIA 4G65A 4FE3A 3U0VA 1Z4OA 3TQSA 4BFCA 1I10A 4U2BA 4HT3B 5CBPA 1NUPA 1EQ2A 3P2IA 1SIUA 2C31A 5DGHA 3HJCA 2BZ0A 1N5IA 5CM9C 3FGZA 5DO9A 5LQDA 3T6KA 2NGRA 1GGNA 4MWSA 4G97A 5HYVA 3QEBZ 1NNEA 4YDRA 5CYOA 2WBLC 2ZSAA 4WOJA 1B6TA 3THYB 2UU9B 2F1KA 1RP1A 2QRVA 2W2KB 4V1CB 4C2AA 4K9SA 4JC5A 1MX3A 1RKUA 2WD8A 5J47A 1LBQA 3TD2A 4Y0NA 4BEVA 3O1JC 5BQFA 1U2ZA 4LDPA 4D6YA 2XBMA 1OXBB 4YMTA 2F3SA 2CD7A 3U3JA 2Q4BA 1ZGAA 4ZQIA 3A14A 2COUA 4YRFA 3N05A 5GPBA 4X65B 1U8FO 4RPLA 2GUWA 2QUIA 4KJZA 1V5WA 4FT4A 3ICCA 4C0JA 2D54A 4OSEA 1XTKA 4OHFA 4M37A 3TTVA 1DHTA 1Z16A 4P7KA 5IC4A 1JR4A 3G9UA 2PJDA 2RB5A 2P3SA 4Q12A 1CJCA 4OBWA 2BHLA 1FJGB 1WHTA 3DDZX 3NZEA 1OLXA 4JUFA 3CVXA 3CCCA 4OP3A 4CF3A 2X8BA 2JJ2D 5I9BA 2O4UX 3A3NA 4II7A 1ZA1A 3KQLA 2I9KA 2DPLA 2JD1A 3OQIA 2R1VB 1SUDA 3E23A 3SZMA 3IOYA 3I45A 3MWDA 3EGXB 4L4SA 4TMFA 1LJUA 2IV2X 4I6GA 2M1ZA 4BO6A 1CZOA 4EHNA 4TV9F 5LDGA 5CPFA 5CAEB 2HMAA 3WXBA 4E5PA 3MK31 4J29A 1MQSA 2WJHA 4HDNB 4RGYA 3FCOA 2Z8ZA 4WEQA 4UBNA 1G7CA 4RIEA 1EI9A 1F4VA 4RTNA 4ZRDA 1TM3E 3GIWA 3BZBA 1V1MA 5JCPA 3O82A 4FR5A 3MMNA 4MV7A 3NP9A 4DYVA 4YAUA 1X3SA 3B36A 3GUCA 2VA9A 1U04A 1ZXBA 2ZBQA 5HIIA 1EM8B 1SCKA 4EHDA 1AHPA 2LKDA 4MP8A 1GQSA 4QNMA 2Y0EA 5IJZA 1TEZA 1XPUA 2UYQA 2GXSA 2V55B 3EW7A 1C0PA 3K96A 4PHGA 5LZ8A 1ZH2A 3SEAA 4P3YA 1KI1A 3TG8A 2WP8J 2YJNA 4LE0A 3EEOA 3Q8LA 1RWMA 1FS4A 3VO8A 1NV9A 4FHEA 3RARA 3ND9A 2HLDA 1TCUA 3AOEC 1PIWA 3K9LA 2O0KA 3PFWO 1T4CB 4I5EA 3QVVA 1UPAA 4RAQA 4EABA 4MRPA 4ISCA 3KXPA 2NU9A 1QK3A 2J32A 5JAZA 2A5DA 3NIDB 1VSBA 4KIGA 1VCOA 3K16A 4R1NA 5M2QA 2CV2A 2WM9B 3ZV5A 2Z09A 6PFKA 2GN2A 3TDKA 1QTQA 4DQ0A 4FJ0A 2GH1A 5CIWA 2DFLA 3BH7A 4AG3A 4JODA 5CDHA 5BRNA 4NMHA 1DRUA 1P80A 4W82A 1GPUA 3BK2A 1E4VA 2PSFA 1XFAA 3I2FA 4YJ3A 3NIFB 1SRQA 3TBKA 1XRNA 3V4FA 3W78A 1WV0A 1NPYA 1Q1QA 1VYHA 2F3RA 1YB2A 2GM3A 2MSWA 3AKEA 1L5WA 4PNPA 4L1KA 5HFAA 4C0HA 2H51A 1H4VB 4G89A 3VR4A 2P2CA 4KL8S 1YDHA 2DTDA 3KSUA 1OXTA 2XUFA 4JBWA 1E2QA 4R3UC 4WIAA 5FD8A 1Z18A 5HRAA 3GEMA 3I9OA 1VL5A 2ZZKA 1PR9A 1UZMA 4JC8A 1NFFA 4Q4AA 1XTRA 2R9VA 3WICA 5IRCD 3I64A 5JAOA 4WOPA 2PLRA 1Q0HA 2K2WA 3A8TA 3LT0A 1JKXA 2O2XA 4EUNA 2G1AA 3GRRA 1T26A 2QRKA 2YWRA 3BMCB 1E77A 4IXTA 2NZ8A 2BUBA 3O4IA 5EAIA 2EDAA 1V1RB 2W11A 5HZMA 3HM9A 2R8PA 2XW6A 2OLKA 4YGYA 3IHLA 3TD9A 2YJ3A 4BS9A 1RKVA 3N2EA 3UMJA 2P4UA 2WILA 3OCUA 1WR8A 5BMVF 4HVTA 4IIGA 4P4TA 4CFZA 2ODQA 2G1PA 4Q5IA 1OA1A 3IEPA 1HEUA 2W6JD 4TM7A 4EHLA 3TTWA 3HCOA 4I50B 4HSEA 3T12A 3ZWDA 3NOOA 1BS1A 1RJ9B 3O31A 3UG7A 4PN7A 1A7UA 4Q4JB 2P9HA 3BXGA 3ITKA 2JI6A 3OE1A 3P27A 2GRUA 2P11A 3BMOA 3G85A 1M0SA 5DPMA 3RU7A 4OYLA 1GZ4A 3ZYCA 2VQDA 4CDNA 4QNNA 2CJPA 3KE8A 1R0RE 2XEXA 1GTJ1 3B6ZA 4UNNA 1RYFA 3AO0B 4NJEB 2Q2WA 4C3UA 3ZWYA 4NFSA 3NJ4A 1P2DA 2I99A 2GX6A 4E3WA 4C0SA 2W42A 3H16A 4ND6A 3J7TA 5A7HA 3S0JA 4V02A 2FJUA 4QWMA 1SEVA 2HJRA 2HU5A 4LWOA 2CF6A 2PWPA 4ON9A 3JD0A 1XCMA 1V1JA 2P9TA 1XYVA 4Y2UA 4NK4A 1BD4A 4BE9A 4IDAA 4N3NA 1CUXA 3G9QA 4D57A 1RQ7A 4QUKA 4DIUA 3U7GA 5LQMA 4Q9DA 1IJFA 4EY5A 4OA5A 2VWQA 5H1YA 2IOYA 3UY4A 1PJ2A 2RGDA 1ZCFA 4R1QA 2YHIA 3A3KA 4KE9A 4D81A 5CFRA 1HLPA 3L0BA 4MUKA 4JEHA 2A58A 2ILTA 2AJBA 5IDXA 4TMZA 4CIBA 5KNCD 3E0QA 3OESA 2YFHA 4LV6A 1SN7A 3C6BA 2IODA 3K92A 3RYTC 4EEXA 4BNDA 1C5KA 2GN1A 2NSJA 2QJOA 2YHUA 3JYQA 1OBHA 1VSQA 4EHHA 3MGGA 2X77A 3DTNA 3QJYA 2NTEA 1JAYA 3ZV3A 1SBTA 4M0LA 1IY0A 1V3TA 3AUTA 4O4HF 4BEBA 5LP6A 8ABPA 1QNLA 1RFLA 3CEMA 3DEFA 1BFUA 2FA9A 3ZK9A 4CIAA 2WF8A 5I5GA 4CQMA 5KTRA 5K5EA 4X54A 3C7KA 1GTZA 2PH7A 2Q4RA 4E4RA 5L3RA 2I65A 4MYDA 3KJEA 4RH0A 1KU6A 4IQ4A 1XTIA 3FOFC 2DBQA 4Q7EA 4UUPA 1DUVG 4E5VA 3MAGA 3OEEA 4RIHA 5JWOA 5I8WA 1TVCA 2XNHA 3G8YA 2O8DB 3FMOB 3TIGA 3IP9A 3R7FA 1ISIA 1IDN1 3EMDA 3A4YA 1FNBA 1E6EA 5CCDA 3AFGA 1HMYA 1W8IA 5DXAA 1J2YA 1LI7A 1VPTA 3EXG1 5SZJA 1E7RA 3ADPA 4UU1A 4E30A 3E8MA 1GY8A 1M7BA 1WULS 2QR5A 5KQLA 3G59A 1N5MA 4HHEA 1XTVA 1ORTA 2F48A 4W5WA 4D45A 1HG0A 1QVRA 5JRZA 3RS3A 2UZ4A 3LY7A 4PYRA 5A3QA 3K2EA 2CSUA 2GM5A 1IN1A 1HE2A 4R68A 2H57A 3VDNB 1U7WA 2EZ4A 2OAP1 2R87A 5CCEA 5DVZA 3NG1A 1EP1B 1WMBA 3N7AA 4MI1A 4CDRA 3PGJA 4BO5A 1TQ8A 4ERNA 5E9QA 3A25A 3BGSA 3OWHA 2G80A 4MJ7A 3UMYA 2PMDA 5IULC 1E0JA 1U9CA 3OE7A 3I39X 1WDKA 2QN7A 1PS0A 4OGFA 1FMJA 1K5DA 3LFTA 3AFNA 3LDUA 2O8FB 4XX0A 4NCKA 3D8HA 1T10A 3M5PA 5CNJA 1ODKA 4EPTA 4UZEA 3SHWA 3FTCA 1BW9B 3NAMA 1ZAYA 4KQFA 4Q7LA 4R3WA 1AQJA 4BVLA 1ORVA 1Z6TA 1NMXA 2GYUA 2JZOA 2K4MA 1IHOA 2Q3FA 4KXWA 1NTRA 4RKQA 3U40A 3FJYA 1MT0A 2ZW9A 1R0ZA 2CHEA 2ZSKA 3DE0X 3DLTA 3GJ0A 2VDQB 3OIFA 1DMRA 1BXRB 3NONA 5GONF 5JSHA 2WD7A 1LK0A 4JMLA 1KBOA 1FP2A 4FFOA 3I6YA 3M7IA 3AEYA 3R3SA 4MUXA 2VSXA 2XVXA 3E3LA 2KB0A 2VP0A 4RBNA 1WW2A 5ED0A 1WF3A 4F45A 1WUHS 1OX6A 3G8BA 4PYIA 1NLYA 2CHGA 1FMCA 1DBVO 1MFZA 4MUHA 4ZFNA 1KO1A 1ML3A 1OGYA 3BH6A 2R8YA 3D6AA 2Y76A 4UAGA 1YFJA 2FU5C 3GV0A 1R88A 3PIIA 1WCWA 1VOTA 2PK3A 1HTBA 3MYRA 2BGMA 4RHEA 1HT1E 3MTDA 3EDCA 3GMTA 3IAUA 3KZVA 3HY4A 4MVJF 4RV4A 1EWQA 3Q7SA 1C8KA 3RVLA 4LDAA 1UKZA 3K7EA 1ENPA 3HB1A 4IRXA 5AK0A 2EFCB 1QRSA 2Y1OA 1HYQA 2XMDA 3LVQE 4GWKA 2YQ4A 4HATA 4RDCA 4BB0A 3AR2A 1J5XA 4ZAFA 4XFDA 4PCUA 1QVVA 3GP5A 5B3JC 5K09A 2QF7A 5AJVB 1A7JA 4BP8A 3RJ5A 5H83A 1N2CE 2E9SA 1LW7A 3IQFA 2RAFA 3KHTA 1ZQ9A 2C8VA 4R98A 4U6QA 3KCQA 1PR3A 2P7HA 4O4IF 4HEA1 4KBYA 3P9YA 3I04M 1QE0A 4YJKA 3K70B 3JAWB 1C30B 2V96A 4JOQA 4MRMB 1X1SA 1QAOA 2L2QA 1VL0A 3BICA 3M2TA 3OLZA 4X00A 1ECPA 4FMCF 1U9IC 2DKFA 5FEMA 1KIFA 5DBFA 3JALA 4XB2A 5KYWB 2X4IA 4B6QA 1HTTA 1AOXA 1IUOA 5D5QA 2CLFB 2NTVA 4KG7A 3RF6A 3MLBA 2EJBA 2H4XA 1MG0A 2VNKA 3F8WA 1QLWA 3W90A 3EH2A 2VRCA 2ZI4A 4OQQA 3CZPA 1GPWB 4PZDA 4RORA 5HG0A 1AMOA 1XEXA 1LSJA 3V32A 3DHYA 1Q1ZA 3MTBA 4YBZA 4ACAA 4AUMA 1JU3A 4HQ6A 3RR2A 3CN7A 2O2ZA 5LDHA 1X0VA 3WYCA 2O7VA 3N07A 4IJQA 3UXEA 1KRWA 2QE6A 1MF7A 2ZS8A 3F3MA 3BBPA 5AVKA 1Z08A 4JD5A 1U7TA 2DULA 1P6QA 1YZTA 2QLTA 1ZD2P 3AJDA 4K6OA 1H05A 2YJ5A 3T9DA 4D0RA 2BKXA 2PMKA 4NYIR 2AGVA 2DC1A 3OIGA 2QTNA 3P9RA 1LB1B 5KKAA 1MIOA 1R9JA 3MCUA 2C5EA 2PLAA 1BRMA 1Z25A 3B1VA 3DPUA 3EXHA 4H7DA 1IG3A 2CE2X 4LCBA 1PBTA 4UU7A 2ZJYA 2Y1KA 2B4KA 2IY9A 1CQWA 1ZH6A 2AX4A 3QXJA 3RT1A 2VDJA 4ZQCB 1FMFA 4IHJB 1RQ2A 5T5QA 5B64A 4E7PA 2IH2A 5FEUA 3LTNC 3N8DA 2G08A 1O94A 2R6ZA 3RVSA 4DL9A 2JGDA 3BGOS 3ZQ4A 1SUIA 2W90A 1PV2A 2NAPA 1NG1A 1I2DA 5FADA 3TQHA 3N3BC 4E22A 3SQWA 1N4DA 2FP4B 2FWBA 1SQSA 3IV6A 2W48A 3DVLA 2PL3A 1XMPA 1X87A 1R0XA 1RWQA 3D3KA 1OHHD 3ZI7A 1D6JA 3EJWA 2GAIA 3L93A 3EA5A 1I9CA 2VK2A 3QM1A 4HGPA 3WLJA 3PDHA 2VP9A 4XCXA 3WK4A 3HC7A 4J43A 2WLSA 4KMSA 2DUUA 1UEJA 3ESBA 4L8WB 1A9PA 2ZUBA 1Z0IA 5L51A 5AXCA 1E1YA 5K6AC 1C29B 4WLUA 5EHNA 5PNTA 1CUHA 1E4YA 2VSNA 3PF9A 4R8KA 2TS1A 2HH9A 3WLRA 3NNNA 3P94A 4Y1FA 1C0KA 1E1DA 3DCYA 3MHPA 2FQQA 4JHXA 3JARA 1BO6A 1CZRA 2ZJ8A 3TOVA 2QSJA 3BRQA 3PV0A 5CDUA 5KBYA 1W34A 2CFOA 2O5CA 4YMIA 4L76A 4N5HX 4WADA 3E84A 4E5UA 1G3RA 1YS1X 3VR6D 5KOJA 3O4GA 2RBEA 4OQEA 2H85A 3ED1A 3A9TA 1MRNA 2J59A 3E9YA 4U6NA 3MS4A 4UVHA 1NN1A 4BRSA 4MV1A 1IC6A 5BV1A 2CMKA 4HWPA 1DBWA 3THYA 1RXEA 3DC7A 4X3OA 3EGOA 4LF8B 2W2KA 2HA2A 3EDOA 3GLRA 3X43A 4IDBA 1THGA 2N9UA 1XPRA 5IAJA 2AXNA 2B4AA 1G291 3O84A 4JLMA 5FF9A 4TT3A 5KVQA 1WE2A 5IVDA 1IJBA 2J4DA 1JDTA 4CWAA 4DJFC 4I55B 1ZL0A 2QMQA 2P9JA 4OKNA 4DCNA 4OHYA 2QRNA 2BV3A 1UMBB 1KA9H 1V7PC 3VSAA 4QGGA 1YAHA 2QUHA 3GK3A 4I5GA 3ZJ4A 2RGNC 2C8JA 4RMJA 4RK6A 1QX3A 2H1CA 2RIPA 4AF6A 2XCSB 4IXDA 3KEFA 4FCTA 5FPHA 4BEWA 4DR2B 2X5XA 3OIUA 5IBCA 3UJNA 2G72A 3HG7A 2E21A 2AN4A 1JKMA 4O4LF 4YAFA 3VDMA 4AECA 5JJCA 4KO4S 3TRIA 2PH3A 3L4BC 4M49A 3PQ2A 5B3KA 1GAEO 2C3MA 2HZ7A 3N2NA 1KEUA 1PR2A 2B1GA 4Q3LA 4WASA 3DDUA 3DV0B 3HP4A 3OO0A 2FG6C 2P5YA 2PQ6A 3EG5A 4N47A 3ZIAA 1QKJA 1BE6A 3CW9A 3K0AA 2EF1A 2ZM6B 1NXTA 4MB2A 4HDNA 1XRLA 1AO3A 3C3MA 1A2OA 3H6GA 3KFXA 2VXOA 2QAIA 2VG8A 3KTAB 1LX7A 3KRTA 3DH0A 3RNOA 2YN4A 3TCNA 3BKWA 4C7VA 3AM1A 3F5QA 7YASA 4TMWA 4DR3B 2VZ8A 3LUBA 3R0JA 3GT4A 5FA8A 1NOKA 4HC4A 3BT7A 1NE2A 1P7WA 3RSSA 3ZW8A 3IL2A 1VG9B 3DXZA 4ZCTA 1CUFA 1UBEA 2H8KA 2RHDA 3M3HA 3ND8A 3PIRA 4QTZA 5E7IA 4ZCLA 5TQ0B 4JYCA 2REBA 5CD9A 1BFDA 4FT2A 4I1UA 3F4LA 3CZMA 4HY3A 4MUGA 4RJKA 1L1FA 3SKYA 5FWYB 4ZGGA 2RHLA 2AC2A 2ZKLA 2X9QA 4OLJA 1XTBA 1N6PA 1WXXA 3KALA 1W4CA 4FONA 5LBIA 2OV8A 4BKMA 4BCCA 4EGFA 1WKCA 5KNCH 3K2QA 1I6LA 4Y6LA 3WV4A 3AF2A 4BXOB 1XL0A 2VHTA 1O03A 1CBUA 4MI6A 5AKIA 4B3DA 1WW3A 3ROPA 5EZYF 1T4CA 2CCJA 1I4DD 2JGEA 4K2HA 1EKXA 4NOJA 2ADFA 4KMMA 1AZSC 1NVXQ 2O20A 4IXNA 1C1XB 5ALJA 4BB6A 3PS9A 1JT9A 2QM7A 1RHRA 2ATIA 2O23A 3Q10A 4OHVA 1YXMA 5LOVB 5K3FA 3WMEA 5KCZA 2QWXA 3HXQA 3OOYA 2Y0DA 5HM6A 2V7TA 3VHQA 2GEUA 3IP8A 1DLJA 3WGUA 1EWVA 2FW7A 1EQUA 2H18A 2B2NA 3OVMA 4PHTA 1H3EA 1AUXA 4C0AC 2Q46A 3F97A 2ORED 4KR0A 3AIKA 2DF8A 2YKGA 1UAAA 2ZR9A 5HUJA 4YB8A 2C5SA 3CR7A 2ZBRA 4KEAA 5FTKA 2GASA 1K27A 4Q7QA 1TQDA 1W1WA 1NY6A 3U56A 1MIHA 4HAXA 2AOXA 4U0KA 3PNBA 1X39A 1JHDA 1YE3A 2EFJA 4NHOA 4BMVA 2E4VA 2ZYRA 3JPWA 2XGOA 3MN1A 4KIUA 4LXUA 3X1KA 4AURA 4CIXA 1X74A 3IFSA 4YJ2B 2G9UA 3X2EA 4HS4A 3MJSA 5AKXA 1AGNA 2I1WA 2RFLA 5JAHA 1RWKA 4MUMA 4JWKA 2PKQO 4C6HA 4MO9A 1F4LA 4JL5A 4CMBA 5LIPA 3EIQA 2JJQA 3FFTA 4TQ9A 4LG1A 1OH8A 2Z5FA 3ZLBA 2JGIA 2IF0A 1SHUX 2OCLA 2EGHA 3C3YA 4MITA 4X44A 1DNPA 5EEGA 5EL0A 4M0MA 5HKLA 3AVXA 1ZWKA 4NMWA 2GLXA 4TX1A 4WZBB 5IBPA 1GGHA 2BM0A 4M76B 4BNZA 3TGPA 2BMJA 1RP7A 3E0XA 1F0KA 1L5VA 3R0VA 4A73A 4XIGS 1WXIA 2HDNB 1RJ9A 3G3EA 1LBSA 1I4TD 1JW9B 4Q4JA 4W6ZA 5HPYB 5ITZB 2QSYA 2WVGA 1KK2A 2AN1A 1CS4C 2YX1A 3OUTA 4LDRA 5F23A 5G0VA 1N5OX 2PXXA 3QV1A 4FLFA 4MCHA 3ORSA 4KRYA 1IY1A 1TO6A 2FHPA 1ECJA 2HJGA 3GJRA 3IUBA 3O0TA 3OMXA 4BZPA 5KNBA 3MJ4A 4TMVA 2GAFA 5EE5B 2Z1MA 1P9LA 3EZYA 3KJGA 4M1QA 1KS9A 5AXBA 3CSUA 5JAMA 3WK5A 4PO9A 1MLDA 1NP7A 2JFWA 1EBFA 2GTHA 2PGDA 3KEOA 1B1AA 2BUAA 4XWAA 3O7WA 1P18A 3DKVA 4KSCA 3GLUA 2ZRDA 1I6WA 1YHZA 4XJTA 2FPGB 1M2OB 1G1MA 4NZ9A 5EQFA 1RRGA 3E2MA 3GP3A 4TL7A 4TXMA 3PVCA 4R5MA 2QZJA 5BW5A 1H2EA 3DFMA 1ZL2A 4DKXA 1N2XA 1R3DA 1NM5C 1KAGA 1S96A 1T6ZA 2J09A 3IALA 1X1EA 5CH3A 1FFAA 4KREA 2QGZA 4ZV9A 4F97A 3W8RA 1VLLA 1IEQA 2IUSA 2VH5R 4QPDA 4JDPA 1GNLA 3HCBA 4YAEA 2FGJA 3JR3A 2HK8A 4K81B 1JEOA 4TN5A 3WK6A 3CVVA 3UC9A 4CGZA 3CLHA 1NBMA 4D9MA 3OE4A 4DV6B 4F5DA 1UM9B 4IDNA 5CDTA 1GGVA 1JZQA 4X84A 3CVYA 3DPSA 2XYGA 6GPBA 5AP9A 4M83A 1A1VA 2JAWA 1XVAA 4L16A 1PEDA 2PT5A 3BCHA 4NXNB 1QQBA 2O3TA 4IPTA 4ZJPA 1L5HA 2WM3A 2G1UA 1E5DA 2JIDA 4EYOA 4BMXA 1VC2A 5KYKA 1Z6AA 4RA9B 5JVDA 2PA3A 3R3ZA 2O8DA 5KX5F 2ZSJA 2DBRA 3KQQA 1Z5NA 2Z4SA 1DQYA 1C3XA 4KWHA 4P08A 3DDOA 4CM5A 2IYXA 4KUEA 1U6KA 1FNMA 3AEQB 2A33A 4EG7A 5A9SB 1IY8A 2P2ZA 4C3ZA 2E82A 2E7ZA 3GFPA 3GFFA 2HUNA 5IYZB 2G09A 3PE3A 1E9SA 4NS1A 4B75A 4C29A 4UCWA 1N5KA 1P61B 2DCMA 4EG8A 3UPUA 1Z74A 1EP9A 3A1NA 4Y1EA 4URUR 3WRXA 3ZV6A 4DG5A 4MYRA 5DT9A 4DBLC 5KKCA 1M2VA 3HJRA 1KOGA 2QA5A 3L49A 1GYQA 4ME6A 4JQZA 2EP7A 3T1YB 2WZQA 2CUZA 1JMYA 3UUGA 4Z5XA 2EEZA 5AW1A 1Z17A 1ICIA 1MRZA 2QMZA 3GD7A 3U7IA 3PKJA 3SWWA 1L6IA 1Y4AE 4ND5A 2O7NA 1OFTA 1P1BA 3BREA 4Q39A 4C0KA 2VDLB 1BW9A 4GEKA 1VGVA 5EIWA 2RSLA 2PZGA 3QVOA 3C5HA 2FLVA 2XRMA 1Z3CA 2P1DA 3SS8A 2YJZA 3WE7A 2H4JA 3SYRA 1N1MA 1BXRA 3MXOA 1Z82A 4OJKA 4DWOA 3WIVA 3OAAD 2ZPTX 3UBMA 4H3KB 4TLAA 3WP0A 4AS3A 5E7JA 3C5EA 5DB4A 5EN4A 3L92A 4QG3A 4ED9A 4WLNA 1LBHA 2FNAA 1FBTA 1NHWA 2WJAA 4LRTB 3AOGA 1FE8A 3M5DA 1I3KA 1VBKA 1LJ8A 2B1JA 2IUTA 2X5OA 3CX6A 1UL1X 3LSYA 3O7MA 4YN3A 4D42A 1O0CA 2KBFA 3R3JA 4V0QA 1KE1A 4KDCA 4KXUA 1KS2A 3VKVA 4MV0A 4UKDA 5I4BA 1NXQA 3H2GA 1K6XA 4Z3KA 2G6BA 2O1EA 4JJKA 4TRJA 4K6HA 1Y3DE 5IKOA 5BWBA 1SVIA 4BO2A 2AG8A 2CD9A 2PBZA 4QUDA 3HJUA 5E38A 4C30A 3ZDFA 1ZCJA 4ZO9A 1DAIA 2REXB 4BC1A 2Z8YA 4PPFA 1W88B 5DHFA 3R76A 1E9DA 2VSFA 3N2ZB 4PRYA 4Q1AA 2DFPA 3VR6H 3KKMA 2YWGA 3MSCA 3LUJA 4JVSB 1N7JA 2QLMA 4D44A 2FEXA 4FMBB 1QDEA 1WVMA 3PA6A 5TEWA 3LM8A 4O29A 5FBRB 1P1RA 4J16C 4PSKA 5EJEA 4MZDA 3UXMA 3B3AA 3OEWA 3EPLA 4KSBA 3JAWA 4I3HA 4EPRA 1C30A 5BWOA 4ZO8A 3E1KA 4JVNA 5KQPA 4QLBA 5JNWA 1FQOA 2Y3IA 2YWXA 1GXSA 3IT1A 4GSLA 2AF4C 4RXUA 4F93B 5KYWA 2VK8A 2NT4A 3UENA 4D82A 2Q28A 4KQCA 1DJOA 1KY5A 3MWKA 3WDSA 4DSAA 4D99A 1V3VA 3MILA 4RFLA 1D7AA 5B1DA 3ZZ0A 5LUAA 4LF7B 3WNDA 2ESRA 3T41A 1ZUD1 1T8YA 1H5QA 4IOLA 1YB6A 3VVCA 1D0VA 1RM5A 3RK0A 4EEKA 4HH1A 1PU2A 3UHPA 1XPOA 1R4AA 1H2XA 2ZBDA 1C3EA 1T2DA 1ETHA 1DSSG 1M75A 4BFYA 2BBTA 3HYRA 5A3VA 4RK0A 4EW6A 2P9GA 1ZNXA 3AUKA 3EN0A 3SG0A 3H0CA 3C0KA 1G0NA 3OJOA 4HF7A 1YRLA 4GLLA 4GPBA 3RUAA 2Y27A 4QJ5A 4CMIB 3Q2KA 4D7AA 2HYIC 3AUUA 1P8JA 3SXPA 3LUKA 1HL3A 1NMYA 2BM8A 1TF2A 1W4RA 4EGSA 1OXKB 1X14A 2YZMA 1BE1A 2ZVDA 3Q6IA 4B3SB 2ZUEA 2FEMA 3EDMA 3HKEB 3HZZA 4G5HA 1QFZA 2OK8A 5CR9A 1ODSA 2WZDA 4RHTA 4ALKA 1QTIA 3BGWA 2ORVA 4NPHA 4XUDA 4OHZA 3L9XA 1YR3A 2FG5A 4GZMA 4M36A 2AEFA 1Z47A 1DQNA 2OM2A 4U7GA 3GVHA 3H7IA 4CJXA 4CLRA 3ZGXA 3CW2A 3HUDA 2V8OA 3GBPA 1B8PA 3B8HA 1IQRA 2BGUA 1JUDA 2F1RA 4CQJA 5IJ9A 1YQEA 2C3UA 2DFVA 4KQ1A 1AHIA 3G8DA 3WVNA 1XA0A 4MHOA 2Q4TA 3H6HA 4HDQB 1D9ZA 2PRIA 4Q1VA 2R8EA 1E7WA 2Q0HA 1L4HA 3EWSA 3GLIA 1G64A 4R8VA 2FP4A 4W5HA 1W25A 2E2WA 3A10A 1Q92A 3KJQA 4OV6B 5DZSA 1P5ZB 1OX4B 4YA6A 3K5WA 4UNRA 5AVQA 2ZXUA 1PJ4A 4JZKA 4LRUA 3DF7A 2EIHA 1JE0A 3QF7A 5TX7A 1RMQA 3GEIA 4XW2A 4YPFA 3GJQA 5KU1A 2I4MA 2BGGA 4EKNB 4XIIA 2C3OA 2H1WA 3M4YA 4MYCA 4W7SA 5JHHB 1KIMA 2J7PA 4WKOA 2OYRA 2ZSDA 2I22A 1CZHA 3E9EA 5SV2A 2G4LA 4LYAA 1KDOA 5J2TA 1II8B 2P35A 3IPAA 3LXUX 2ZR8A 4MWTA 1L1RA 2FGKA 1KQNA 5EJGA 2PKYX 3N1UA 1ZK3A 3WLOA 2FKNA 2QTRA 4IIJB 1BEEA 5CXSA 1ZYUA 4RPHA 4EVQA 2YIMA 1DO2A 2AEMA 5EC8A 4E32A 3PPXA 2WA2A 1M6NA 4JBHA 1ILEA 3EEFA 2Y1FA 3AHGA 5JWRA 5KIAA 4UUMA 1KZHA 2I0FA 4GPAA 4HRYA 2ZRBA 2ZXEA 3IT3A 3NYWA 5CNKA 1CY0A 4BC0A 2WFLB 1UJCA 2DCUA 1GTRA 5F3RA 1QV9A 4OXXA 5C2JB 3PC4A 4ZEVA 3BN3A 4XXHA 4UTRA 2FWRA 2JFHA 4Z4HA 7GPBA 2ZR7A 2BFNA 1R0YA 1J0BA 2W71A 2VHVA 3L3BA 1YDGA 4HRVA 4M1EA 5D7NA 2LCFA 1FW8A 2OKGA 4C7BA 1A9QA 1E32A 2E5WA 4MRSA 4PFSA 4Q18A 4CKCB 5H4GA 1PTJC 4MIKA 3SKXA 1WDTA 1MTOA 4GKAA 3UHJA 4E5KA 5C5EA 1OKKA 1JMVA 1JEAA 4PS0A 4NAUA 3OFJA 3S55A 4UZFA 2HQRA 5TS2A 3AG5A 5B1HA 4JEMA 4DRXB 1NLMA 1SOMA 3HO8A 2E49A 3NRBA 4HGRA 4WCVA 3AT1A 4QATA 3WQBA 2J3EA 1FP7A 1F48A 2NIPA 3CXUA 5FB3A 2QX9A 4J0HA 2IYPA 4UPEA 4JKOA 1K6IA 1IVYA 1ESEA 1CR0A 1M2FA 2FG7C 4FXPA 4UTOA 3EZNA 4YI3A 4AJEA 1MEEA 3VBEA 4AT1A 3F5FA 3QIVA 2HBYA 1UKAA 2A7XA 1K0UA 3VYSB 3FOEC 3N0TA 4H31A 1FEZA 3DF9A 2HIGA 1DX9A 4IIYA 4EIWA 1GA1A 5LYJF 5KYTA 4UAVA 2BFPA 1GKKA 2B4TO 2WJZB 3LBHA 4Y2XA 5THXA 4J4BA 4FOTA 2QORA 3B78A 1N34B 3U2QA 3OZBA 4ZAWA 2P2NA 4YDHB 3MRXA 4JOCA 5C7OO 2AQ8A 4MJLA 4TQAA 5JW6A 2GKSA 3PC6A 4WWHA 1I5RA 2J3QA 1TKBA 4BZWA 5AJXA 1Q7CA 2IX9A 4EFMA 3ZDXB 5TQ0A 2YWFA 3FSEA 3R40A 4K0KB 4G3XA 1PLKA 2YYYA 4E2WA 4HYEA 3IO3A 2XAAA 1KJIA 3FETA 3TF5A 2JKVA 4UFOA 1E3WB 1OT3A 1UBOS 3QYJA 1J09A 4GIBA 4KAJA 3NKFA 4BBAA 1RM3A 2EHDA 1QHXA 1G8GA 1NFQA 4DWJA 3DTVD 3Q0TA 2IS4A 3N2LA 3FMIA 1L8AA 1W52X 3IVXA 2FCRA 3CPHA 3OZSA 4PQYA 4S3MA 1B4DA 1PNRA 2FVXA 4U3JB 1R5NA 3QEMA 1C1XA 1BZYA 1WXHA 4EW1A 3EYWA 2JFYA 2C2MA 1L7BA 3T7CA 1EFPB 3W2HA 4EHFA 3OQNA 2XCOA 2VJCA 2CDNA 4US0R 1E2BA 2I4OA 3U9SA 1MX1A 1WUTA 2JAHA 5CURA 2DWUA 3HJFA 1P1FA 2QMOA 1KZ6A 4HNGA 2XZTA 4MW1A 3QF4B 1Y1RA 4P32A 3UB4A 2E5LB 2AKEA 1XT6A 1JDNA 4WXHA 3C8ZA 4MLPA 1M74A 2QU7A 3SC6A 4DM7A 4YASA 1Z0JA 2GBLA 2GK7A 1R8YA 4ZDIA 4DR1B 1E2LA 2IYNA 1CLUA 1VBNA 3DMTA 3PRKE 3BCSA 4LYDA 4XUCA 3RFVA 4MCJA 2EJWA 2FQYA 1LPNA 2O6HA 2AR0A 2ZANA 4IIBA 3BJZA 2H54A 2XE6A 1XWWA 2ZYVX 4G9EA 4IGFA 1GO2A 1D5CA 2QT9A 1DOHA 3PD7A 1I2AA 1XZQA 3BWMA 2HU2A 1ZWLA 4QULA 1Y1SA 1NJSA 3B53X 3VGJA 1TCAA 4YJ2A 5CCXA 3IVRA 1JFSA 4HAUA 2PZAA 2P90A 3R9KA 1FS5A 4DDUA 4H18A 4MVJE 1IIRA 4IV0A 3KT3A 3E6AA 1AQYA 3IP6A 2H5IA 5EIEA 1JALA 3D9QX 5EWMB 1WD7A 3WYDA 3ZU3A 5LR6A 2V7XA 1I4OA 5I3CA 3WL5A 3GWZA 1GL9B 3G1UA 5CGZA 5H4HA 1WS6A 2VO1A 4RSRA 4YP1A 1UBMS 3M4JA 1FFDA 3OUZA 4WZBA 3QEAZ 2Q62A 1NPTO 1THMA 3GA7A 3H8JA 1Z6XA 3LO8A 4FFPA 2WU1A 4BV9A 3S5UA 1R6VA 2NYRA 2XOEA 2WHEA 2D2FA 5DE3A 1MQ8B 1NJGA 1P0IA 1NULA 1PR4A 1RWXA 1ZMOA 4HRAA 3Q0EA 5AW2A 5LKAA 4EG4A 5ITZA 4DLLA 3PNLA 4UARA 1OOEA 3FXAA 4KQIA 4PQEA 3DFIA 5CLQA 4M87A 3A3YA 3P7MA 1R00A 1JHUA 2JJ1D 3EARA 4IEFB 1YA4A 1HKUA 3RSLA 2IPNA 4XVCA 1IWOA 4W9MC 4Z4EA 3QVGB 1ZXLA 4AW9A 3AR6A 3CRVA 3UJ3X 2C57A 3VZPA 4YUXA 2B9VA 1GQFA 2PXHA 5A0FA 2F3TA 3ECAA 3LKVA 4CMKA 4DS3A 3VU9B 1OA0A 1E2FA 5H81A 3AR5A 1A2QA 5AI8A 1YRYE 3S8YA 3AF4A 5F76A 3QW4B 5I4IA 4AQYB 2PJZA 3EZ9A 3JQ8A 1M2OA 4XYEA 1JDZA 4H1WA 3TEJA 5IAKA 3I5YA 4DNOA 3THXA 4R01A 2UUPA 4DARA 3FF4A 1FFEA 3FRHA 4NZZA 4UVGA 1LVUA 3CSSA 4MDYA 1CQJA 3O3NB 4JI1B 1GOTA 1ZKMA 2BLNA 1F14A 3A05A 3IILA 5JCZA 2QTLA 2NZVG 1DT5A 1ZG3A 5K3BA 4IS2A 2FW1A 2FK7A 3SOZA 4DCJA 1DE0A 2CJWA 3B48A 1YE8A 2ZI9A 1HORA 2Q9AA 4GLOA 3S2FA 1NQXA 1NC1A 3AL3A 3O2NA 4TWIA 3B5IA 4X1YB 3QRWA 4X91A 2Q3CA 3TUZC 3RFUA 4MDFA 3AJAA 3BDVA 4TM8A 5ER9A 3WB9A 1UXIA 2Q3LA 3DEKA 1RYBA 4KGVA 2JLVA 1QWSA 2OXFA 2VSOA 1LS6A 3RADC 1VLQA 4EZIA 2HRCA 3EPJA 1O77A 4DLYA 3H1PA 1O4VA 1N5LA 3BL8A 5K03A 4LFCB 4WFQA 2VXYA 4BUJA 1XMIA 1RAAA 2BFBB 2I76A 2COKA 2X3FA 2R8OA 4WNYA 3ELUA 4R16A 3AEQA 3W9SA 5KOHB 1DC5A 5A9SA 4MQFA 5JSFA 4JYPA 4YI5A 3P20A 3V33A 4UEWA 3LHKA 3PSHA 1G8FA 1HT2E 4WY5A 5DNDA 1I3OA 4F3CA 2Q1SA 2RJNA 2JDIA 1UMDB 3MD9A 1VYTA 4GOJA 2ZATA 5FOXA 4A6EA 4GWGA 5JG7A 2C9DA 5CT8A 3D8TA 5M04A 1MABA 3GFBA 2NPFA 2H29A 3UJ9A 3OPMA 3GZ4A 4RKWA 2JHPA 4TYMA 4E5DA 1XLTA 3VGPA 4AZ0B 3H8WA 1PGNA 3OPXA 3PFHA 4IHQA 3BQNB 4DW8A 2XR1A 3KQNA 1MAAA 1PHPA 4DLUA 4NWIA 3DFKA 3PHIA 3TQFA 3TQOA 4LVUA 4V0RA 2VJDA 4M22A 4KR3A 4CZ2A 5BXYA 4LGYA 2WT9A 4UMFA 5C51B 1M34B 2EGGA 3Q4GA 2YNMA 1Z5OA 2IOQA 4B5KA 1DB3A 5EYPA 3I28A 3R7WB 3RPEA 1MB2A 3EGDB 1ZJWA 1I1OA 3UWPA 4NYMR 3CG4A 5DISB 1GL6A 3OPYB 4JS0A 5LMNB 3H5VA 1AM4D 3LKDA 4MPPA 2G4VA 2W2QA 4PC1A 5JSKA 3RGWS 2VAXA 3J81A 1MAVA 2ZJFA 1MPXA 2J45A 4FYYA 4M54A 4PLGA 3WBFA 1JR3A 2Q5IA 4OEHA 4UHBA 4FWIB 5EPUA 3TOSA 1P2BA 2C95A 1NFRA 2P9YA 4LDZA 4LCJA 5ENZA 4LRQA 3MWEB 1E2DA 1NW7A 3CNHA 2OG1A 1KJWA 1M1ZA 3CWQA 4O25A 2VS1A 3TRJA 4I8IA 1VRWA 5YASA 2FW0A 3G88A 3IB3A 5CK5A 1K66A 1SQ0A 3HE3A 4M4SA 5DN6D 4XB6B 2GBFA 3QGMA 3IT2A 3NTQA 4E2FA 5BUSA 1HY3A 1UDWA 2PRKA 1S2LA 2GD6A 3C87A 1JHYA 5K3EA 4IGIA 4O2BF 1UJ5A 3DR3A 3PC3A 2UYCA 1B15A 1SXHA 1CFJA 1W88A 4CFSA 3FBGA 3I83A 2GBCA 1NJ6A 1FYXA 1IEVA 4DCGA 5I9TA 2VLIA 4ITUA 3CA8A 3EA4A 2FW9A 4IWYA 4DV5B 2Y1WA 4N18A 2Z6AA 4BNMA 1PJSA 1Q44A 4AB1A 1HNWB 1DFIA 1V6CA 5C4IA 3AB8A 5AJHA 3CZQA 2P2GA 4F4CA 1KQFA 3RYCB 1SHKA 1PVVA 3W34A 3INTA 3KWFA 2V7GA 3GZNB 2GZ2A 2K5UA 1THZA 3F9CA 2ZP1A 3OLCX 5WRFA 3FWKA 2AA3A 3PXDA 1H1DA 4UTVA 2CEKA 1HYEA 2YXNA 1KYQA 3NYIA 5GMOA 4V0LA 4W5QA 4I5IA 4RVOA 3W4KA 2TYSB 1JDSA 5MGNA 1RXIA 1RZ3A 1O9HA 1G8YA 2XUJA 3EIFA 3LLMA 1I7DA 3AJ8A 3PJFA 1WBBA 5D3ZA 1T29A 2XYVA 3ZI4A 2XUPA 3N58A 3RFCA 4D4GA 1W5BA 3MCVA 4A0QA 3CPEA 4WCFC 4D74A 1KWKA 4JL8A 1W47A 3W6NA 2RG7A 3NWPA 5JAQA 2CFTA 5JS1A 3W2FA 3JQFA 1Y82A 3MJEA 1U7ZA 4UUAA 4ZAVA 3ZE9A 1G4UR 4M1OA 1J9ZA 2DWQA 4KV7A 1YI1A 4P3OA 1TJPB 1DDGA 1U2DA 3N75A 1QONA 3SVTA 4QVIA 2I8LA 2HAEA 3KQTA 3N3AC 2GZRA 3RLFA 3SZUA 4CMIA 1Z07A 1X2EA 2R7KA 4ZMSA 3MELA 2O7QA 2HXYA 4KNWA 3U0BA 1P4RA 4OXRA 1Q22A 2B5WA 4DB4A 3HKEA 1HQYE 1VHQA 4YQEA 3V8MA 3WYEA 3OEHA 1BEZA 2W6MA 3DCNA 4LGCA 4QXOA 2CKMA 3V3TA 4A6XA 5BSEA 5JD4A 1IOVA 1QRRA 4JQOA 4D26A 2FFJA 2F00A 1TFRA 1H2WA 4PFQA 5EIBD 2XTMA 3C3PA 1MKYA 3WHKA 3QPCA 1KI6A 5E6SB 3NTOA 2R8BA 3ZQKA 5HBRA 4PEVA 1K1EA 1K9SA 1OU4A 2ATCA 4D8YA 2R25B 1ZN8A 3ZY5A 5AOVA 5JY6A 4I4LA 4BOYA 1KP2A 2MCFA 3RTAA 3STWA 4HFMA 4JYAB 3W05A 3TTUA 1MA0A 1PT7A 2W0MA 3TLEA 3I12A 1ODTC 3EFOB 4ERXA 1PFVA 3L8ZA 2PQMA 4DLRA 5IUJC 2MTBA 2FVYA 3DL4A 4MAAA 16PKA 3DAPA 3IV9A 1JECA 3O90A 1GPKA 1U7HA 1X9HA 2EIXA 4LJ8A 5HIMA 1QOZA 4I99A 4DLTA 2P5TB 2WUVA 3JRXA 3PHLA 1XNHA 4OQ4A 1TOAA 4F1KA 5LU9A 3W5SA 3DTYA 3SBOA 3I9NA 3LTEA 4WKBA 4KTVE 1QH0A 1V4BA 1F8GA 1GRVA 2A0WA 821PA 2BC9A 2ISCA 1A9SA 3EHEA 3NORA 3BE8A 3KJZA 3GRCA 1NGSA 2JFOA 1II8A 1X77A 1BIFA 1VFPA 1MH1A 4A2WA 5IS2A 3N74A 5K01A 4RVGA 4U2GA 5JH7A 1JDJA 2PD6A 4IIJA 3EW9A 2BGKA 1ZFNA 1NXVA 4M0KA 5TGTA 3RAPR 2OSVA 3A9VA 3KD2A 1GKLA 3LCCA 1Y8QB 5E0KB 1JQ5A 1BWQA 1U1DA 2CLLB 4NZYA 1KPGA 1IBRA 4FYJA 4NMLA 4QNRA 1LI5A 1CF2O 4KLRA 3JV7A 3ZS9A 2IIPA 3B85A 3QLVA 3AFHA 1NUUA 5HMMA 2AXEA 3A2MA 4JL6A 3IIJA 4Y3UA 1EB9A 5ADVA 2QXUA 1GAWA 3ASYA 2WFLA 1E3QA 1R7RA 1VMDA 3AR4A 5FWNA 3V7WA 1H3FA 4QU9A 5KMGA 4D8TA 3V2GA 2E4XA 4H6XA 4IBOA 3VUEA 4QUGA 4XTRA 3JQPA 2XECA 3OHSX 1UMCB 2HJSA 3AVQA 4ND8B 5AKYA 3UJPA 4BVEA 4HDCA 1ABBA 2RGYA 3ZCQA 4M2LA 3OBIA 4GH5A 2WTEA 1IMOA 3H9BA 1X7ZB 1R8JA 4LYGA 4I9NA 5D51S 4RZHA 1W4BA 3H2YA 3VH2A 5BOSA 4TOIA 3GJTA 4XA8A 4DRXA 3YASA 3QJ5A 3E4CA 3C6XA 2XWPA 2YHSA 1NF2A 4D9EA 2OQRA 3K09A 3TL3A 2C2YA 3B1WA 2QTTA 4G0NA 2FKAA 4AJNA 3CXRA 3VYRB 3SICE 3GQVA 2HLDD 2A9JA 1A7AA 1YZKA 1AQ6A 3H18A 1Q0ZA 3P2JA 4RV9A 4PYNA 2VJOA 2AFHB 3VPFA 3WLSA 2XXBA 3K20A 4M7WA 3BC1A 2PFSA 1LNZA 1OLSB 2CBZA 3F3SA 1P7VA 1K3FA 2WIJA 1YUBA 3CLTD 3IAM6 4GYKA 3JYOA 4ZQGA 5C8YF 5IT5A 1IRIA 2BTEA 1GLNA 3SAJA 2ZJ2A 5DEIA 5DDIP 5HRCA 4CV2A 2B4QA 4DJEC 5B3AA 4ZRNA 1XKQA 3ILHA 5BNIA 1CZUA 2J3JA 5HRUA 2KHZA 2PMFA 3UJDA 3DKRA 3R3XA 4PC6A 1K7SN 3TNYA 3K9BA 2UVPB 3B3QA 3D0OA 3JRNA 4M6WA 4AU1A 5CDFA 4MWBA 4ITRC 2ID4A 6ABPA 2B69A 1KOJA 2IITA 1SZDA 1D07A 3GYBA 3W2EA 1DKRA 1QC5B 2RH8A 3AEUB 1ONPA 2AVNA 5ALNA 4EFDA 2FWPA 2J4FA 1DKPA 2GHIA 1WB9A 1E3WA 1GU0A 4MO2A 3VR4D 3PGMA 4UATA 4NYMQ 1PFUA 2BBSA 4FX5A 1UK6A 4M0UA 2OHJA 5DNEA 1JSZA 4G56A 1B16A 1S2DA 1NXSA 1C1DB 5EFOA 3SQNA 4KPUB 4NZNA 4NICA 2CLIB 1KAMA 3FJOA 3ULKA 4AMGA 1CUJA 5LB2A 1K97A 2D2IA 3K8YA 4AWBA 1U3WA 2O3SA 3NU1A 1EHCA 3VSBA 3SDSA 2G76A 4B9AA 3RTEA 1Q3KA 1DCFA 1EFPA 3F9RA 2JGRA 3WRYA 2SNIE 1D03A 2IBMA 4QYIB 3WJ2A 2Z43A 1OFVA 3T1OA 2QUJA 3A4MA 2GPSA 3QF4A 2R6AA 2IPAB 1BCRB 3P9SA 4Z9AA 1UAGA 2O2IA 1NDHA 3DL7A 5E2BA 2O8EA 3K4PA 4QRHA 5BSRA 1K5GA 5DWDA 1MUUA 3TE6A 2JFBA 5A5GA 4O8ZA 2OAGA 4BV2A 1TDJA 5DNUA 4YCSA 2NO6A 3S44A 2QRHA 1YZYA 2AHRA 5EZQA 4DCTA 1Z45A 3BD9A 2MMGA 5FULA 2A1IA 3H5TA 1G2OA 3I42A 1AXRA 2BDEA 4RD4A 3P52A 4UTZA 5KJ1A 3VNUA 3EE6A 1PJZA 1T13A 3FOBA 4GBGA 3OQHA 1HEIA 1V35A 2VH2A 1KARA 2ENWA 4JT8A 1QZ3A 4J6FA 2BFEB 4JSTA 4GPTA 2QROA 1SKUA 2XPCA 3VQTA 1NNLA 1DQRA 2FR0A 2XNKA 2JLAA 4BNGA 1NNSA 5KKNB 5AVTA 2RJ3A 5EKSA 5MF6A 4Q34A 2WINI 3VTZA 2ORIA 3U5ZB 5EWMA 4E0BA 4ZCSA 2PCLA 1R10A 1UC4B 2FSVC 3V4ZA 2P4SA 3OZ7A 3QFHA 4OF4A 1ECFA 1X8KA 2VDMB 2OFWA 1JLRA 1GPNA 2VT2A 1EZZA 3NUQA 3TW4A 1VJGA 1WWKA 4O0LA 2SKDA 4DMLA 5GJWC 3AP3A 2C7VA 4HQLA 1WMAA 3I2HA 2WQZA 1N2BA 1LCIA 2OB2A 2Q9UA 4X93A 2HA3A 2OESA 3MGAA 4H7JA 1GCOA 2YRXA 3F2IA 3FAKA 2RK4A 1NOJA 4RYLA 1SKYB 2PGLA 3VKUA 4EARA 4IAOA 3RYFB 3CTPA 1XC7A 4ACBA 1HC7A 1QIKA 3T54A 3VZQA 5KNDD 4V0SA 4BGDA 4U2DA 1YQXA 3HO6A 4RZIA 4Q03A 4ZVPA 2OZLB 2O52A 1YJ8A 3QVGA 4YFYA 2OV1A 4CQMD 3UMMA 3LHSA 4JJIA 2R6GA 4KPYA 3K1AA 5H3CA 2P1RA 1MG5A 2P3LA 2FUG1 3PGA1 5L95A 1ISFA 3E1GA 2BZ1A 3JS5A 4G1MB 3VU9A 4BVGA 2V7QA 1NW6A 2XCTB 3RFTA 4IMPA 3G7SA 5JAIA 4OUDA 4BQIA 1K6MA 3EB9A 5D7BA 2CYCA 2YDYA 1QQ5A 1WP4A 5K8TA 2R48A 1EUQA 2PSHA 1UUFA 2CGEA 1JEJA 5TT1A 2H1SA 1IVNA 5EUQB 2HO5A 3C16C 4XD7D 3ZLUA 1Q0UA 2W6ZA 4GWLA 1T2VA 3QU4A 4B5LA 3RUPA 4CI0B 1C2YA 4HZGA 3P45A 3TTTA 4GVPA 4YUZA 3D02A 3AEZA 2X4GA 5BUZA 1XNRB 2V7VA 4B43A 4CL2A 3A6ZA 3LWNA 5F9MA 3O8DA 1F5NA 4B3TB 3IOEA 2CFRA 1N0UA 3WGQA 3W3ZB 3EHDA 3ESRA 2G36A 5LWHA 1N2SA 3FOCA 2Q5EA 2I8CA 3USES 3GMDA 5L8VA 1CQIB 1N7HA 2BFCB 2HMUA 4NG5A 4X1YA 1JZSA 4YMWA 5A05A 1VZ3A 3OE7D 1AA6A 2IF2A 2ZIFA 2EW8A 4V2IA 1L7XA 2CB9A 3L1JA 3UGTA 4YV0A 4N54A 2CYAA 3CU5A 4MJXA 1DAOA 2H11A 2H2IA 2Q2NA 2PS0A 4U39A 5LUBA 2MSEB 4JYBA 1LF0A 1HK7A 1LPPA 2B99A 4HTFB 4P0TA 3I4FA 2QD1A 4YCLA 3L4KA 4WLEA 3SC2B 3TNLA 4N3BA 4BFVA 4CTOA 1JI3A 4FNOA 1I24A 5JCJA 2V7UA 2BFBA 4RETA 4MMZB 3RC3A 4F2HA 4B3BA 1QZUA 2WZBA 3BFKA 3E05A 1YU9A 3ZI0A 5KOHA 2YVAA 3T7SA 4CM9A 5EIXA 1RI3A 1JHXA 3EVAA 4QODA 4IDHA 3L1IA 3NB0A 1YMVA 4GX0A 5B7NA 3N70A 2AR9A 2WDZA 3M6AA 4OOFA 1UBUS 1ZRSA 4FYIA 1HE5A 3QNUA 3PZRA 1T8RA 2VPIA 4H77A 3D6MA 1JXMA 2CXNA 3T9BA 5BR4A 4U7WA 2WE7A 4GAEA 5F3DA 2R7AA 3KC2A 1T9GS 4ZRMA 3WP1B 4AZ0A 4RVDA 5LLDA 4PC7A 4MYSA 2H5EA 3HRHA 1U0LA 2KW5A 3L6OO 3K94A 2WU4A 1M1UA 4RX1A 5EZ6B 3U39A 1K2WA 5JIBA 1K8YB 3BQ9A 3SIRA 1U2GA 1M34A 1P73A 2NQTA 3I37X 4KYVA 4UBOA 4WACA 3WNVA 1GR0A 1UP4A 2D3WA 3LLSA 4IUDS 1BMQA 1BGWA 1F17A 1U3GA 3R7WA 1Y3BE 3EGDA 3NHZA 4V3BA 4ZT2A 5JZOA 4KQ6A 1YACA 3AJEA 2MT9A 1YQWA 3OPYA 3OTHA 2CV0A 4BMOB 2ZRFA 3AM3A 3T61A 3X1DA 3F74A 4LWQA 4DIDA 2DQYA 1CW2B 3HXPA 1UKVY 4QG7A 2JIBA 2EERA 2HSZA 1DEAA 4UC0A 4F12A 5DMXA 2A5YB 4OCZA 1M2KA 4NBUA 5CA0B 3U4QA 3MWEA 5EI5A 2ID7A 5ALPA 1JFTA 1R15A 3R0IA 2OV4A 4LZAA 5HE9A 5TEVA 4DFDA 4RC9A 5DK4A 3NHMA 4MK4A 3K73O 3UO8B 1MJGA 4OQFA 2VRCD 2WHRA 3MT7A 4HJRA 1O6CA 2VAVA 3FDJA 4LY9A 2IQIA 3H1FA 3FSRA 2LCQA 3VYVA 2HWWA 2NXWA 1RC0A 5AHRA 1J90A 3WTCA 2RHTA 1CR1A 4UNQA 2MR5A 2VAPA 4ZVUA 3OJEA 2HI0A 3WKDA 3HR8A 4OM8A 2TRSB 3LYLA 1E1KA 3HVHA 3TXYA 1EDZA 3AHEA 3BJIC 3V8BA 4FGJA 5JARA 3UCXA 1RCFA 2IT1A 4OBXA 1WBDA 4FKZA 2VP6A 1U4OA 2C5HA 5NLLA 1REQB 2X7HA 4KW7A 2P67A 3U31A 2J9RA 1JQAA 2NTJA 5B1YA 3RYCA 1A7KA 2W2LA 1USUA 4Q7JB 3GZNA 3GGJA 1UK7A 3GD5A 4I1YA 1QYVA 3IJRA 3IYLW 2Q29A 2E37A 2QRGA 3DLPX 2R00C 1I7NA 2HLPA 1Y48E 2WMNB 3GF4A 2QQ5A 4PPGA 1MO2A 1O94D 1XQ1A 1XTSA 1PFYA 2Z95A 3DZDA 1FXWF 3ML1A 2WTMA 5KSOA 1YL6A 1ZN2A 1V5EA 3COWA 1ZVMA 3L1KA 4N9WA 4K2AA 1KSHA 3SZRA 3PDUA 3MW8A 4UCXA 2VBIA 1SU7A 3FNEA 1O5OA 2AG1A 4FD3A 4R84A 5E6RB 2VKTA 5IUKC 1AGYA 1ODLA 1XZBA 1ZIPA 3O21A 4FR0A 4KUHA 3WGVA 3PZBA 4WI1A 1T3ZA 2BD0A 3QUBA 5DM1A 1QOQB 2RC6A 2O07A 1G5QA 1OY1A 1GPAA 2O7RA 5EWLB 3SC4A 3KR0A 4TZKA 4ENWA 4RO0A 3T5TA 3AGQA 1A8QA 1AE1A 1NU6A 1OUMA 2B9EA 2ZSIA 5E8RA 5LJIA 4I19A 1W49A 3ILSA 3I52A 2DAPA 1HE3A 1IE3A 3E70C 1OFHA 2FEOA 4NIMA 3RK4A 3LI2A 3DOUA 4EUFA 3T1HB 3ERCA 1WQ1R 2ODEA 4J0KA 5CG2A 4MUNA 1FJ2A 1U7XA 4RJIA 2PVPA 2WVJA 4WL0A 5CNIA 1Q74A 4II3A 2GNAA 1XWIA 5E6SA 1MO4A 1IM5A 2OBMA 4UASA 5FTMA 1O97C 4F0JA 1Q0SA 2JVIA 4UDXX 1F3LA 2X1VA 3JATB 3TUJC 5TB5A 1ZR2A 5EJ7A 4MVWA 1M5UA 3D8RA 3CR3C 3JWJA 3M3DA 5I8PA 1EH5A 1O58A 1YE5A 4TVKA 3KJIA 3VR4H 3OCVA 3SY8A 5IJ0B 3EFOA 2W8BA 3IX7A 3UB3A 3UV6A 2DT5A 3HXLA 4CMAA 1KJYA 3KWJA 4I3FA 4P53A 2IOHA 4ZYUA 1T5HX 5TQVA 4TT3D 2OOSA 1PUIA 2P3OA 4KFSA 1IZ7A 1EG2A 2AK2A 2P6PA 3Q40A 4XYMA 3WB0A 4BNIA 3R23A 5EHXA 4QDTA 4DQVA 2I6XA 4JIMA 4G86A 2XIJA 1YR8A 1SCQA 1YFKA 3GJ8A 5LIRA 1O0SA 1Y3FE 3C14C 4ESOA 4HVLA 1VSUA 2AOUB 3ZBQA 5JY1A 1WTCA 3V1MA 2J0UB 4C6SA 5A9TA 3BGIA 2E1RA 5E4YA 5JRDS 2P2LA 1XX6A 3B3FA 3WQHA 3LYHA 1V9CA 4QSHA 4FMDF 5ETJA 4PLTA 1I7LA 5AM2A 3VFDA 5CDGA 3H0KA 1QDLB 3DLCA 3IOCA 3T7KA 1I33A 5LJLA 2DJIA 2M9MA 4DQUA 1Y8QA 4A6PA 4FP9A 1FY2A 3JW8A 5KTTA 1KNXA 2BHTA 2G67A 2ZE8A 2XXAA 1MA3A 1TKAA 2CW5A 1OWPA 3V8PA 5B7QA 2C7BA 3PYXA 3RRMA 4E7OA 2KI5A 3RBXA 5CT5A 2C8LA 4ARBA 2MSNA 5BYKA 3DE4X 1DMSA 3N2GA 4EUEA 3U3MA 3ZXIA 5LFAA 1Q0TA 1MENA 1O7JA 4JASB 4ND8A 4OHPA 1UMCA 3P0JA 3RRNA 3TZLA 4B09A 2VYNA 4D02A 2OXCA 2VUSA 4YWJA 5AKJA 4YJ3F 5E4TA 1LNQA 1X7ZA 4RVCA 2QM8A 3JSAA 2ZIVB 2QE7A 3EQ7A 1EDDA 1LQ2A 2P62A 3O4VA 3NBYC 5DTEA 2X58A 1OZ0A 1G4AE 2PY6A 2Y1XA 3E5NA 3FCXA 3WLNA 1HTWA 2VUIB 3UH1A 4ZCMA 1NRXA 4G5SA 1U0TA 3E5MA 2JARA 4DM3A 1DAFA 3EPKA 3QA3E 1V8FA 2A86A 2SICE 1ID1A 5JJ5A 1NKVA 2HSDA 3AUYA 4JNKA 4J0JA 3HKCB 2GPJA 1VL8A 2AFHA 3DJFA 4HJXA 4RY2A 3HR7A 3K71B 5KYUB 1JBQA 3SXUB 1FIUA 3RS2A 1OLSA 5FI0B 1M5TA 5HCUA 3D64A 2IUUA 4MW2A 5HKBA 1RADA 2IZOA 4R83A 3MGBA 3ZXUB 5BV8A 5A3RA 3I5XA 2HGZA 2DSNA 4ZZIA 4UU0A 2JL1A 4MW4A 1QAMA 1O9BA 2I4IA 2WJ6A 1ECLA 2Y2UA 3MYYA 1SO8A 5D3MA 3C8UA 5E7QA 5G4KA 1XMSA 3CZCA 1HETA 4AO6A 2PRSA 3AUAA 3PSAA 4H16A 3THWB 4KACA 2UVPA 1J8YF 4EYKA 1RDFA 4AXBA 3CW8X 1R27A 1XVTA 2J0EA 2ODWA 1U0NA 2PE5A 3ETNA 1QC5A 1WHSB 3AEUA 3UA4A 3CX4A 1BVYF 2P9CA 1PNTA 1L9XA 3MM4A 4RACA 2ASVA 1WCIA 4NVRA 2O5EA 1WXDA 3FYUC 1YVRA 4F38A 3P0RA 4MW0A 4Y2TA 3M0EA 1JMKC 2FN8A 3HDVA 1OXMA 1GM5A 4ASUA