4EMBA

Crystal structure of a phosphoglycerate mutase gpma from borrelia burgdorferi b31
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
245
structure length
245
Chain Sequence
FMYKLVLVRHGESEWNKENLFTGWTDVKLSDKGIDEAVEAGLLLKQEGYSFDIAFSSLLSRANDTLNIILRELGQSYISVKKTWRLNERHYGALQGLNKSETAAKYGEDKVLIWRRSYDVPPMSLDESDDRHPIKDPRYKHIPKRELPSTECLKDTVARVIPYWTDEIAKEVLEGKKVIVAAHGNSLRALVKYFDNLSEEDVLKLNIPTGIPLVYELDKDLNPIKHYYLGDESKIKKAMESVASQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a phosphoglycerate mutase gpmA from Borrelia burgdorferi B31
rcsb
source organism Borrelia burgdorferi
molecule tags Isomerase
molecule keywords 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
total genus 83
structure length 245
sequence length 245
chains with identical sequence B, C, D
ec nomenclature ec 5.4.2.11: Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent).
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 4embA00
5PGMA 1H2EA 2YN2A 1UJCA 2I1VB 4D4MA 3LNTA 1SK9A 5CDHA 1E59A 3K4PA 1BQ3A 4IJ6A 3D4IA 2H52A 2YN0A 4D4LA 4PGMA 3O0TA 1RPAA 3PGMA 1H2FA 2HHJA 4ARUA 2EKBA 4MA4A 3F3KA 1FZTA 1EBBA 1C80A 1DKOA 4EMBA 4ARSA 2F90A 3GP3A 4QIHA 4JOBA 3IT2A 2QNIA 1SK8A 4FDUA 1TIPA 2PA0A 2BIFA 4IJ5A 4JOCA 5AJZA 4GPZA 4HBZA 3QPUA 2OWDA 1T8PA 2DWOA 2H4ZA 3DCYA 2ENWA 1SKAA 3IT1A 1E58A 3MBKA 2A6PA 4AROA 2P9FA 2WNHA 3NTLA 1DKMA 2GFIA 2WNIA 3BIFA 2OWEA 3D8HA 3EZNA 5CU7A 4ODIA 5HTKA 3ZHCA 2P78A 1YFKA 3EOZA 3KKKA 2P6OA 4ARVA 4PZ9A 3DB1A 2P30A 2P75A 4E3WA 3C7TA 3MXOA 2H4XA 1ND5A 1SKBA 3FJYA 1DKQA 2DWPA 5HR5A 2P2ZA 2P77A 1C7ZA 3K4QA 1QWOA 1XQ9A 5AJXA 3E9CA 1QFXA 2EOAA 3NFYA 3QPVA 4JODA 4PZAA 4D4KA 2IKQA 5AJYA 2EKZA 1K6MA 5AJVB 2P9YA 1BIFA 3QPWA 3IT3A 3GW8A 1QHFA 3E9EA 4GPIB 1DKNA 3E9DA 5AK0A 2P9ZA 1NT4A 1CVIA 2P6MA 2ENUA 3F2IA 1V37A 1IHPA 1RPTA 2P2YA 2WU0A 5AJWA 1FBTA 3FDZB 3OI7A 1DKLA 2A9JA 2P79A 3GP5A 4TSRA 2HIAA 3LL4A 1ND6A 1RIIA 2RFLA 1BQ4A 4D4JA 1V7QA 2AXNA 3FDZA 3D6AA 3R7AA 1YJXA 5CX4A 1C81A 2HPAA 3LG2A 2H0QA 1DKPA 4EO9A 1UJBA 4FDTA 3IT0A 3HJGA
chains in the Genus database with same CATH superfamily
4R40A 3PDHA 4NZZA 3CWQA 4TTTS 1LLCA 3WLQA 4E6EA 2CLSA 4MWBA 5CBPA 1HM5A 2JAQA 5IJ0B 4MNTA 3SNHA 1V43A 4LJ6A 4O0MA 4ZI7B 1MVLA 3L7JA 1T3HA 4C0BA 2B4QA 3FPSA 1MC8A 1CUHA 2GZSA 2QMOA 2CVFA 3A26A 2PFGA 3D5TA 4YK7A 5TY0A 1SCNE 2HSGA 1EVIA 4MKRA 4H59A 1I6KA 1N2EA 3RC8A 2ATCA 4O25A 4H7JA 1EMDA 4OB8A 4WOPA 1A27A 3IBTA 4ARZB 2AH5A 2NP6A 5LLSA 2WV9A 3JQ8A 4GRIA 1V8OA 4TMXA 3K20A 1K7SN 3B8EA 3SM9A 1CC1S 3IMFA 4H1WA 1YRBA 3FHJA 4N0EA 2XMSA 1B8OA 1QDEA 3F97A 3P2MA 4JB3A 3RYFB 1AM4D 1XZNA 2I5PO 5LP6A 2UYGA 2A5GA 3HXTA 4LXXA 4NS1A 4BQNA 5FB3A 4Q4JB 4RIHA 1PQWA 4X90A 4ZHQA 2JRLA 3V80A 3TSAA 1NQAO 3LO5A 3HJBA 3IE2A 2O0HA 3PYXA 1JWAB 3ZYCA 1XZKA 1OXUA 4FMBB 4A5OA 4CQJA 3T3OA 1Y4ZA 3H1AA 2J30A 3WRXA 2PE5A 5JZVA 4WK2B 3ZHTA 1NMEA 1X1RA 2FA9A 5CT6A 4AKHA 3DZBA 3REFA 1H4TA 2OB1A 4P86A 2YQ4A 4XYLA 2FN7A 2B99A 2AJBA 3H5AA 4MR9B 4CG2A 1O0SA 5JRJA 1NBOA 4JAVC 5A0VA 2YVUA 3ER9A 4URFA 4GZMA 2ZTUA 4ZMRA 1SBNE 1VDMA 2WWHA 1W35A 1SCAA 2AG8A 2C5GA 4XJXA 5DHRA 2OMKA 3JYNA 3E3NA 4LVCA 3A9SA 2R1TB 4TM7A 2GCNA 4W9NC 2VP3A 2DE0X 4DJDC 2QPTA 2EFDB 2Y9MB 2R3SA 5TC4A 3DE6X 3R3JA 3UMVA 4EELA 4JBYA 3THYA 2P0EA 2P75A 2FE4A 3O90A 3FGZA 3PXXA 3RLIA 5AVJA 3RVKA 5IC5A 1IRXA 3B1KA 3QPBA 4FINA 4EKEA 3KYDA 1L1EA 4MLZA 3STUA 4G89A 2YWHA 1XFDA 2BTOA 1FB5A 3D6VA 3ILYA 3LC7O 4QX6A 2B6NA 2YMMA 1N6RA 1SUWA 4HFMA 4JS0A 3U7IA 5B55A 2OCDA 2UZ4A 4OFWA 3SZGA 1HQKA 5EMJA 3BJZA 2HUPA 2XX3A 4ZI7F 3K9NA 4KWEA 3IHWA 1LBQA 1FS4A 4MMYB 3MTEA 5HBGA 3OZDA 3PIRA 16PKA 1Z34A 4MO9A 3EZ7A 2WHYA 4II2A 4UNNA 1N3YA 2VPQA 1ZC3A 2DQKA 2NADA 3ZLUA 3N0TA 4JOQA 4PX2A 2GN4A 4DJ5X 1ZJJA 3EASA 1ZU5A 2V54A 3CF4G 4JJAA 4KFUA 3U13A 5CFNA 1ZEJA 2C7GA 4EI7A 4URXR 2PRKA 1P2UA 2FEPA 3C3KA 3HXOA 4J3NA 1CEYA 2Q7XA 2UVPB 4GYKA 3AG5A 5IUKC 1LBTA 5IKMA 1MB0A 2Y0EA 1MF7A 2X0FA 4EBBA 4UBLA 4D3DA 1EE1A 1EVYA 3ED5A 4ZO7A 4B7ZA 2GLUA 3WGLA 3MQFA 3ZWVA 3ND8A 3PLAE 3K9QO 6REQB 1PTJA 3BVPA 3FPCA 1WLYA 4NS4A 1T3ZA 4AN0A 3JQAB 4HN9A 3ZLVA 4B31A 4OMUA 4JJZA 1UXKA 2FPXA 1N9GA 1SKUA 4LX8A 2RG1A 3OC0A 3IHLA 4JKYA 4OX9Y 2RG7A 2YUIA 3ESBA 5J2UA 1XAJA 4W5JA 1XLTC 2XOKD 4LHXA 3SFTA 5JWRA 4WNYA 1GAQA 1GLGA 3AUFA 3GDFA 2W2LD 2YZ2A 4JLNA 1U0HC 1YZNA 2WG1A 3EWNA 5J2TF 4NOJA 2Q3CA 2IYRA 3ZWKA 4BFYA 4EJ2A 4WXHA 4Z51A 1TKRA 4KBYA 1Z4LA 2A3RA 3O1JC 3ZDEA 3VC2A 4OM8A 3TGLA 4X8LA 4ZCTA 2WJZB 1V71A 1IJBA 3C5CA 5G2OA 2GEKA 1A5ZA 1YE5A 1OB2A 3VSBA 3DMDA 3MGBA 1QP0A 2HK9A 2Q5IA 3LDUA 2KX7A 4FCCA 1GCUA 1Q50A 4Q3NA 3VAAA 1EUZA 2OBYA 1XJCA 3AJ9A 3G89A 3I52A 5DGDA 4YMVA 2R96A 2QRVA 3L7OA 3ZKWA 4M0LA 1BS9A 2HNKA 1NNUA 1TTPB 3FFTA 4R2IA 4YAWA 2CSXA 3VNUA 3ZCTA 1RLIA 2JKVA 4TLLB 3Q0IA 3NOOA 3TQIA 4D3FA 1I36A 1YJCA 3PHJA 4XAQA 3JYHA 1FLDA 5C1OA 3C3BA 3OJXA 1S2DA 2QRMA 3TLMA 1NOIA 4O2BA 1E4EA 2IV2X 5GONA 3VC1A 2Y99A 4WCFC 5C8DA 3E3AA 4M1EA 1ADJA 2VJBA 4I2VA 3L0YA 3E2IA 2RB5A 2TMKA 3UBMA 5BOSB 1UOEA 4K1LA 1YK1A 1GTG1 4QRHA 1NMSA 3EUAA 2CUNA 3L0PA 1XF1A 3NJ8A 3ZV5A 3AUXA 2VF2A 4CKWA 2D4HA 2R0QC 2YN4A 4YO8A 1YFKA 2XE8A 2IZ1A 2GK7A 2C7VA 5IEJA 4C4XA 1EH5A 3C1TA 3ZGZA 3D1LA 1BU5A 3DHYA 1W19A 3G23A 1C1DA 1V8ZA 4S1TA 4BKRA 1XUOA 4H7IA 3KX2A 1V3TA 4LJYA 4N3BA 4NULA 3KFVA 1AF7A 1O95C 1P1IA 1SOVA 1ZRMA 2AN3A 2NU7B 4PZLA 5EJ2A 5KYVA 5TJHA 1JLLB 2EX1A 4S35A 3S8YA 1LQTA 1VHJA 3FUWA 5BSWA 1W1IA 1YC2A 1H5QA 1WUKS 1SXJB 3D0RA 3QBTA 3QX8A 5FH9A 1FP4B 4LFCB 2EW8A 1W5BA 3EODA 4WESA 4YUAA 2XW6A 3UJ8A 5DHTA 1Y1KE 4LV6A 3KPWA 2GAAA 3AEKB 2CFSA 4M53A 4RH3A 5EP1A 3TRIA 2GMWA 2VYCA 4C03A 1TD9A 2NT3A 2ZI7A 4LOKA 3IDOA 4A1OA 5E2IA 4DWVA 4HT3B 2OZPA 4LC9A 4Q34A 4AECA 5LDHA 1FLAA 4U7WA 3G85A 1A69A 3H9UA 1I1OA 3AF2A 2DJ5A 3BWBA 3IMKA 1EPUA 2WWRA 1JIIA 4ZKDA 4AS1A 5DISB 5SY9A 3GCDA 1OTYA 2WSSD 3JQ9A 4UHFA 4YMHA 2GTHA 3Q9UA 2G63A 3ROQA 2GN9A 3FZEA 4WVLA 1YR9A 3AGPA 2IV7A 2CXNA 1OX6A 2MSCB 3Q6MA 5DTEA 2B7CA 2OBLA 3WRYA 1U7HA 3LLVA 4F8YA 3OPYB 1HPLA 4Y6LA 4O2BB 3SIPA 4NATA 1KC1A 3K0FB 5C31A 3EPPA 3OLZA 4KQKA 1GSHA 4I66A 3ADOA 4HXFB 3CX3A 3IL2A 2FW9A 2AXNA 2H51A 2BI4A 2I6XA 4MINA 4OG2A 4YMWA 3GUYA 4M99A 1P75A 2J0VA 1YDFA 3GFOA 2HHAA 2XODA 2VHQA 2Z4TA 4NCJA 2P0YA 3LGAA 4PZZA 3WB9A 4C0XA 4WRRA 1Z73A 2K87A 1H1LA 1CUSA 1WCXA 3OJFA 1NMYA 2ERYA 5B6PA 3IYLW 1ECJA 1FUIA 3TDKA 1D6MA 5DYWA 4KLCA 4XB2A 4PWZA 4D0GA 3NALA 2RGRA 2IZZA 2VTBB 3BDAA 4QBTA 4XGKA 2I3BA 3WX0A 4DR4B 2V6FA 1HA3A 5TR9A 3RHTA 3RUFA 1IWOA 1HQYE 1ULUA 1F12A 2I2CA 2WSYB 2Z1NA 4MQLA 3T7DA 1CW2B 1JPUA 2VDUE 4IUYA 4NMXB 4BUZA 1Q83A 3ILXA 3O8OB 4IVQA 4HNVA 5K0CA 4R4JA 2H63A 3LUPA 3IKLA 1GG2A 1OR8A 5J4KA 1ZYUA 5G4KB 4NF2A 1CUDA 1JW9B 2WTNA 1PN3A 3DOIA 1TAHA 1DEAA 1PEYA 3PJDA 3N8DA 5JCOC 3AU9A 3MBOA 3JQ8B 4B3FX 3RTCA 4N1AA 2E82A 3JD1A 1ODKA 7ABPA 2QVBA 1Q0TA 2BEWB 1Q20A 5K3FA 1DG1G 1NSFA 4HAXA 2BGLA 4YWJA 4RTMA 3DMGA 4WUVA 4Q4HB 2JAPA 3IB3A 1L5NA 2IK8A 5A5DA 5AW3A 4ZOAA 1DBQA 1EWKA 1ZJ4A 2YJ3A 2E87A 4M1MA 3AONB 3WMXA 3HU3A 3WGTA 4ZU6X 2BHRA 2SHKA 1BW9B 4MVJM 4QAQA 1A9YA 2BW0A 5DIZA 2HEGA 2HQOA 2Q1SA 3DAOA 4WECA 2VPIA 2NUPA 4WCFA 4ZGGA 2GVZC 1PK8A 4X20B 1GQ2A 2NSDA 1K4MA 1BMFD 1ZM9A 2X7JA 3BIFA 1XXHA 3GCXA 3FWYA 4W1SA 4OA8A 4CJXA 3GJ6A 3SPXA 1EUCB 1JSRA 3JZIA 1NN5A 2Y3IA 4ONEA 5BWCA 3G1TA 4JQZA 3WNCA 5C1DA 3GEIA 3PNKA 4GO1A 2FSFA 3HUDA 3M1IA 3AYXB 3LUJA 2IUYA 2H4XA 2IYWA 2R1TA 4MVJD 1XHEA 3QHAA 4D92A 3NWEA 3RUDA 2NU9A 1V5GA 3A6HA 4R71A 4M7OA 1ID8A 3H11A 5AKEA 5C8YB 1UMDB 4AY6A 3DD5A 3ZHSA 4NX2A 2BC9A 2C4MA 2E7ZA 3QLTA 3AY0A 5IG2A 1N1DA 2KM1A 1WXFA 3OX4A 4DW8A 4DEVA 2Z43A 3W8NA 2FXVA 3RHFA 4HPXB 4D9JA 4WIAA 1I3MA 1NVWQ 4BRZA 1XHLA 2G0AA 1ZJ6A 1TKAA 1ZISA 1DP4A 4KYVA 2ZRHA 2V0GA 1F0PA 1C7QA 1JLRA 1L4NA 2FWRA 2VSFA 3BSFA 4FZRA 3JATA 4TRJA 3UCXA 4C3OB 3A1UA 4OFZA 4FCVA 4EW6A 3GEHA 4JMLA 1CJMA 1Z74A 2O0KA 2ENUA 3GBSA 1YQWA 3HI4A 3HPQA 1CHDA 3KNZA 3A27A 3I2YX 3PC6A 4KAJA 4MV3A 3H84A 4AWBA 2QY9A 2OKCA 3OZBA 4FLFA 4MV0A 4A8JA 3K96A 1SAYA 2H8KA 5HXAA 2JIQA 4TSFA 5JXJA 1VPVA 3IBCA 1V8BA 2P4SA 1XRPA 2R7NA 2WM3A 3LBIA 1GFZA 4FMDF 1HORA 1CUIA 2GEVA 3S2UA 5I48A 2R68A 3MC1A 5LM3A 2WLSA 1NTOA 3W2IA 4DIUA 1UMBB 5H83A 3FSJX 5BR7A 1E3TA 3RB8A 2HR1A 3O2JA 4YT4A 5A06A 1OIWA 4IG9A 2R6HA 4PPQA 5FR2A 3GLGE 3T7KA 2F3QA 1YDGA 1NLZA 3HDJA 5F9HA 2OSBA 1HV8A 1I3LA 1ZL2A 2HD4A 4O4LB 4M1KA 2GR9A 2L0XA 5DULA 1QRAA 2G72A 2FR8A 5AKZA 1NIPA 3LTNC 1H66A 1WXQA 1L5LA 4CGZA 4XVQA 2DEUA 1JTFA 3NBYC 2HMUA 2RARA 2BJHA 3SZUA 4A82A 4BJ3A 3T54A 4CEHA 1L7BA 3WWOA 2JLZA 4W8GA 4LRXA 4G85A 2BGMA 5HM6A 4NBKA 4LZAA 4PYKA 1G19A 4II7A 2R8EA 4E5YA 1THMA 1H8ED 2B5OA 4K26A 4BGUA 1JJIA 2FMXA 2RAPA 4P9NA 4RSMA 3KUUA 4YBZA 5EC8A 3UC9A 4QULA 2E85A 2QE7A 1Y0BA 4AO6A 3F9IA 5E3IA 1S02A 2N0SA 1NC1A 3OQMA 2QLBA 2Z3WA 2EDCA 3I1IA 4B4UA 2V74B 2Z5VA 2DGDA 2B25A 2GO7A 3I28A 4JT2A 5EAIA 4QIHA 5I4BA 2I6GA 2WZQA 2P5YA 3B2NA 5EZYF 4NRDA 2G28A 1AGYA 3N2KB 4BN4A 2RGAA 2Z58A 5F23A 2YW2A 1YU6A 5DBOA 3NYWA 2O8EB 3FYUC 1JIVA 2YV4A 1TO2E 2XD4A 3Q8XB 3H7AA 5KX5F 3CLHA 2HU8A 1E3QA 1IAVA 1JWLA 1CY0A 1Z2AA 2HN9A 1P60A 4ETWA 4CR7A 3K1JA 1T1RA 4I1VA 3V48A 4DR7B 3NTLA 4K87A 4TYNA 1CNEA 1WRBA 4DUGD 1H2WA 2RHLA 4ZC8A 1R74A 1DXHA 3PFCA 3R3WA 1Z4JA 3R3VA 3RQIA 4X3OA 3U17A 4Z9AA 3G49A 2XWQA 5BMOA 1ND5A 2ZANA 3O7MA 4ZDJA 5CFOA 4O29A 3O9VA 1SXPA 4FMPA 5FQNA 1ZW1A 1VE1A 3I83A 3EZ9A 1Z4NA 2Z6VA 5EE1A 1LNSA 2EGHA 4DL9A 1MTZA 2HRBA 5MN5A 4P7FA 3ZE9A 1W25A 4J0EA 1QIIA 2DYKA 2R5FA 4TWIA 2DY0A 3GLKA 3LOPA 3TEMA 3UOAB 5AQ1A 4B5KA 1X0VA 2JH8A 1RBZA 1L7DA 3QG5A 4PFSA 5F5NA 1EDBA 1QK5A 3T95A 5KC9A 3VJRA 3EZYA 3QA3E 4YA6A 5DTMA 1VI2A 3ZGXA 1SXJE 4PE5B 3ZY5A 5BURA 2BCEA 4RE5A 1JQBA 4ZYUA 3NTQA 3OHMA 2GA9A 3V4VB 3PPVA 3ZS9A 5ALNA 1CU1A 3VR5H 5FI0B 3EXEB 2CXRA 3QNWA 5D3ZA 1XLUA 5BQPA 3WR5A 2FWPA 1OT5A 1P8AA 3V97A 3ILVA 1H6BA 2ZRGA 3FNQA 4PQEA 4RY0A 4JI1B 3RG8A 1U4NA 2XNKA 4C4OA 2C99A 1RXUA 3HCPA 5DBEX 3C5WP 1RRVA 4CMCA 2LBPA 4MEBA 5FA8A 1QCCA 2H29A 3P2JA 1GSAA 1CQXA 4UPEA 1C1HA 1JG1A 2ZRDA 4JC4A 1M7BA 2DBRA 1SURA 3O4IA 4DSNA 5DIFA 1D7OA 5KIAA 2OC4A 1SBCA 2PFSA 4LTMA 4PG7A 1F6WA 2X4GA 4E5UA 1OF1A 1JEQA 2FWIA 1GKLA 3CEJA 2DB3A 1UFOA 3INRA 1TW2A 2IP1A 5JAMA 1W49A 2OD2A 3QG1A 4FCWA 2IQ5A 4CQNA 2QRQA 4KO3S 4YCDA 4HH0A 1EDDA 5TNXA 1O96A 1VHWA 3GZ4A 1EIZA 4FI3C 5DNVA 1VTKA 5G0UA 4B45A 5F1YA 2VTBA 5DGTA 1RPAA 4QPDA 4EVRA 4A6DA 3GLIE 1V6SA 4FGLA 3EJWA 4LS3A 4DLSA 2FN8A 3N7TA 4PC1A 2P5TB 1RNLA 4JB8A 5LXTF 1PYGA 2UXDB 3COPA 1J7KA 1F8FA 2P68A 2OLJA 2PSEA 1TF5A 3FCUB 2FR1A 3A6ZA 1E66A 1G5HA 3NT2A 3C3EA 5I7AA 1QBKC 3V1TC 1FZTA 1JYFA 2HX1A 2AI2A 4GKVA 3ZD7A 1VL2A 3BFJA 3RNLA 1QO0D 3E3MA 3FCXA 1S7CA 3L8ZA 1EWRA 2DFLA 5SZIA 1C0EA 2X0EA 3N2IA 2A1UA 5JS1A 4MRPA 2HJWA 2BRUC 4D0NA 2TRSB 1VJDA 1EVEA 2FSUA 4DLBA 4HMQA 3BPSA 3UJ9A 1TQ6A 2F7SA 2Q28A 3CMMA 4E12A 1MAAA 2Q3MA 3CXUA 3GVHA 4G3XA 5JBIA 1NRIA 4JL6A 1N0HA 4AP6A 2JLVA 1LBSA 5TQ2B 2JI4A 4F3NA 3WGUA 4S05A 3FYSA 4GNRA 1QNFA 3DAYA 3C5VA 3SBDA 3TSOA 5JAPA 1ZOSA 1YRQA 1VCOA 1T9AA 3T12A 4BNKA 2Y4NA 4CM5A 1DRWA 3JYLA 1LVHA 4DHWA 4CHGA 3WICA 4JBGA 4LBYA 3VH1A 3ECAA 4NBUA 3WIOA 3R5TA 2DM6A 4X20A 1YIAA 5DLDA 2W83A 1ZKMA 3HBFA 4W5QA 2QJRA 1N9KA 2P35A 3D7LA 3UPTA 2XCLA 2P65A 1QOZA 3KFLA 5DM0A 1NYLA 5AD1A 5ADWA 2AYYA 4TYYA 3DMRA 4JP5A 4MYRA 1Z4PX 4PR3A 3SAJA 3AVWA 3IP9A 2F3SA 1JYSA 2CWDA 4GI7A 5IBQA 3HO1A 3P2YA 4MUGA 3T52A 4GM4A 4OHOA 2QYOA 3B5IA 4JLDA 3MS7A 4B3SB 1XU9A 2J33A 1OX4B 4QEZA 1LXCA 2R4UA 1QP7A 2OBMA 5C4GB 1Z13A 4BFCA 4DPLA 1QHIA 3OCCA 3CV3A 1Y5LA 2JI6A 4G5RA 5C8XA 1CUCA 1PW7A 2PDAA 2ZSAA 4A16A 2OP1A 1K5DA 3LCJA 1XK7A 2GYWA 2ZBVA 4OOEA 3RCBA 4Z7NB 5D6OA 3PNSA 1ZH4A 2D8MA 2EHDA 2N3ZA 3CONA 4BZPA 3QE3A 2ACVA 1NFQA 1VL8A 1QDUA 1RVDA 4LC1A 4BNGA 4DNXA 2P6MA 2G9RA 4J4TA 2PT6A 5T57A 2P67A 2PEZA 4EEKA 1FQJA 3EA5A 1H1LB 3SEQA 4TTRA 4B6FA 4FSXA 7REQB 1W75A 3OQIB 4QBHA 3W34A 1U2GA 5EXSA 4ANFA 4CV1A 2LR0A 4JUCA 1SBQA 4V0OA 4LNUA 4OSOA 1ELOA 2I55A 1FEZA 3EK2A 2GARA 4GZLA 4QGAA 1KYZA 4W1QA 3WZMA 4EUHA 2V8OA 2GK3A 3DE5X 4YLYA 4R8MA 2FP4B 3ETDA 1TTTA 4NARA 3EGEA 4YNBA 5AXBA 4IIYA 3DSRA 2RH8A 1W36B 1VCHA 5B7NA 1P0QA 3L5OA 1X42A 1U99A 4DIKA 2KYRA 2H1SA 1UBLS 5IEBA 1CF9A 4ZCSA 4XWOA 4D57A 3RYIA 4OXNA 1U7XA 3CVJA 3WHIA 3OSUA 1MV8A 2CUTA 3IRUA 1K7EB 2G9VA 4DNQA 2Q4TA 3WQQA 1U2GC 5DEIA 1JX6A 4LRWA 1G20B 3RTEA 1F7UA 4ACBA 5JD4A 3BCRA 4E6PA 2PR2A 3E0QA 1ZJ5A 1ARZA 1WU8A 1M3SA 2QUJA 2UZAA 1S6YA 1OWLA 3MT7A 1TYDE 3P9XA 1DEHA 1KQOA 4AUMA 4K88A 5LU9A 3OIUA 1YS6A 3CZ9A 4UPDA 1S3IA 1KFKB 1N2XA 2Q3BA 4L95C 4UCXA 3WK9A 1RI5A 5K6AA 3ZE1B 4E5VA 1SXHA 2D4AA 3PQ8A 4QQNA 4NH0A 2UVPA 5BW4A 3MUFA 4D81A 4MRSA 1R8JA 1STOA 1T9CA 3RADC 2I0FA 5C35A 3EZFA 4QGFA 4LAFA 2AN4A 3TTSA 3IX7A 3R0IA 2H7YA 3KB6A 4BFTA 2H9AA 1JIQA 2QRLA 1YZHA 3FDXA 1U8ZA 4I9HA 1ONBA 1SUFA 1UH5A 2APJA 1E92A 3PR3A 4II3A 5P21A 3JQAA 4JIGA 1BXGA 1U9ZA 3N2NA 2PLWA 2QD3A 1OH5A 2GBGA 5HW0A 1ZPDA 4I5FA 5K8UA 2IIPA 2IXTA 1Y7LA 1IDN1 5G41A 1Z07A 5FPTA 1HURA 1QHEA 1YS4A 2ZUFA 4XW2A 2VT3A 3M6XA 2PSHA 2RGNA 3VPHA 4F38A 3FB1A 2OC9A 2H07A 4ARVA 4H1VA 1T6XA 2OILA 1FNDA 2EWVA 3H2IA 1SCUA 4YJHA 1F38A 4RZXA 4KPEC 4G0XA 2IYQA 4GQBA 2YNMD 2AZMA 2NZ2A 3JCZA 3FZNA 1PNVA 1GILA 3D3QA 5EJMA 3WNQA 4F4HA 2FX5A 5HS4A 4A2WA 3B5JA 3HGQA 4IYJA 3R8CA 1XMJA 2RKWA 2QRVB 4FEYA 3LZ6A 4PYOA 1KIFA 3HJCA 4XE5A 5BMVF 2REQA 3ZGNA 1OU0A 1EZ1A 4NMLA 3C5EA 2MSDB 1Z0JA 3BGIA 2C4WA 4WBSA 4KP7A 4F3YA 1HTBA 1YUBA 2QYHA 5EHZA 3THYB 1D1SA 3ENZA 3JQEA 4EJMA 5JADA 1OC4A 1XVLA 3ONDA 2V5UA 5H7XA 1TE2A 2ZBUA 4PYLA 1IZ0A 1NF8A 3FYUB 3I4FA 4NCKA 4PLVA 1HQCA 4P4SA 4KYUA 1W96A 4BUCA 1W46A 1NDQA 3BWDD 3GGOA 1EUQA 1D4OA 2D54A 4R6WA 1K88A 2XQKA 3RBVA 1PIWA 2H1CA 4FYYA 1NW4A 3D81A 5GM1A 2EZ8A 1IJFA 1AIPA 1W8DA 3RGGA 4WTOA 4HV4A 1DINA 1SHKA 2DWQA 4TN1A 5B4VA 2LKDA 1J2JA 4C4YA 3RVMA 4HRXA 3P97A 2V9ZA 1AN9A 4XWTA 5KYTA 3IDFA 3L4KA 3VR1A 3P96A 2ID8A 4IX1A 2KHZA 3VUFA 1EK6A 1GPNA 3IO5A 2JLBA 4LGVA 1D2CA 4WNAA 3CTPA 1BSVA 4MKXA 1A4IA 1Y4SA 3PHIA 4LCEA 4PM4A 4DCUA 2UYOA 1G8PA 1K6XA 4NZOA 3MT9A 4Q9HA 3ZEAA 2CL0X 1RMYA 3KAJA 5DP2A 2B0JA 2WT4A 3WYCA 5L7WA 1FJXA 4G5YA 1TM4E 3A4LA 4IVPA 3OFVA 3R9WA 1X1CA 1QIDA 1TQDA 2XUZA 4PYMA 4MV5A 5H16A 2XLCA 5JMWA 1VSUA 2Z2JA 4YP1A 4Y2XA 2QTMA 4JR2A 3QKSA 3DEHA 5DGHA 3B6ZA 3AEKA 1EQUA 1N5KA 5FPYA 3ST7A 2OCXA 1U5CA 1MDFA 4XGQA 4GZ5A 4M55A 3VSDA 3O8BA 4Q1VA 4IO1A 2X2PA 5AICA 2QG4A 2JFNA 3GZJA 4MQEB 2RK3A 3MYYA 1TQ8A 2XECA 4GS5A 4BLQA 1VBFA 3FZYA 2ASEA 4D0RA 4TT3A 1G9XA 1PKEA 1U7UA 1ZI8A 5EPEA 4O1HA 3K15A 3SQDA 621PA 2AE2A 1WG8A 1OZHA 1UUFA 1B0PA 2IHVA 3O1HB 3W6ZA 5B3JC 4ARIA 1Z45A 1Z5UA 4BE7B 3DT9A 5HKOA 2NXNA 2GXAA 3IVGA 2J9YB 2C3PA 4QHSA 5TDHA 1I5RA 5CURA 3N9IA 3Q8LA 1IY8A 2UZ0A 4BZZA 4DA8A 4ZGBA 4X65B 1LNQA 4P3YA 5LQUA 4QJ5A 1A9RA 3KDSE 4UHKA 4KN9S 1WXEA 1Z62A 2AGVA 3BZWA 4XM0A 1E7RA 4KR0A 1F14A 3MFYA 5KI6A 4K6FA 5EP3A 1N2BA 4FBLA 4E07A 1FNNA 7MHTA 1JHQA 2JBWA 2PXCA 3ND5A 2IH4A 1U7OA 3U39A 3H9GA 5C1BA 4Z9XA 4BMOB 1VGQA 1YWGO 2C3YA 5FOUA 1FTQA 1WCIB 1YAJA 6GPBA 1Q22A 5D86A 1U9IC 3FFAA 4DCOA 5LOVB 1YACA 2NQ8A 3MRXA 1G6Q1 4P54A 3PDJA 4X1IA 1XTPA 4KDCA 4TL7A 1JLKA 3M9LA 2G40A 5K45A 2X2FA 1QK4A 4OFBA 1GCIA 4EG4A 3AUJB 3BFVA 5EIFA 3H9QA 3OURA 1NVTA 1VYTA 3VR4H 3I1JA 3PJRA 1T2EA 1P72A 2Q4RA 2GX6A 1ML4A 2PBFA 3HZHA 1CYEA 1B16A 4BNLA 4LF6B 2CDCA 1RDFA 5DI3B 2DX7A 3GT4A 2TS1A 2YFHA 2O8BB 3EDQA 3EQ2A 1DBSA 3KHKA 3COSA 5IDWA 2W2QA 3MD9A 2FN9A 2I4OA 1WPXA 4E03A 2E9SA 1JXMA 4PFJA 2IEZA 4ND2A 1VIDA 1W93A 5A4JA 3L7LA 3SX2A 1A82A 3DTVD 3F8SA 1DFHA 3G0BA 1MC5A 2OCGA 1XMIA 4C04A 1CS4C 4S0ZA 1E3JA 1UOQA 1S4QA 3ETGA 2ZUUA 1BG6A 1BFDA 1ZD1A 4C7BA 4NDNE 4RZQA 1QU2A 4UMDA 5I9LA 1ZUNA 1VBNA 3OT5A 2JA1A 2JLWA 1NI3A 4E2ZA 3AXTA 1W30A 4Z1MA 2WF5A 3FA2A 3RJ9A 2XUQA 4DF3A 4PV7A 1AKUA 1R3UA 1FXUA 4RENA 2NZXA 5CVTA 5AW1A 3OIGA 3PU6A 1S3GA 1LB1B 4BRWA 5ITVA 1I6LA 2BM8A 4FCTA 4V24A 5JUWA 5CT9A 4C76A 1P44A 3QV2A 3WRVA 3R4CA 2C77A 2I3DA 3OKCA 3CR8A 3INGA 4C88A 2W2KB 3TX6A 3N3BC 4ZVPA 1AHPA 5C8YA 4XXHA 2XKBA 4FC7A 4X85A 3TB6A 4QVIA 4EG7A 4TLBA 4Y98A 4EDHA 3ZDCA 1MU0A 3PQFA 3TD9A 5HCUA 5I9IA 2O3RA 4OHRA 1CDZA 1VA4A 5B58C 1CZLA 3JQGB 4QO8A 2D62A 2IBSA 3ZPXA 4CMEC 3TG2A 4ECAA 1KVUA 3FCEA 3GA0A 1WTCA 1KI6A 2W70A 2GZAA 1E79A 1I4TD 3F3MA 4K9OA 4TXJA 4EBFA 3HS3A 1EINA 3L9XA 1K7FB 3AKDA 3GROA 1YBMA 1J8VA 3AKCA 4H1HA 3X0DA 4J0JA 4EMSA 2HWWA 2QX9A 1PG0A 1S89A 1XL0A 4I5GA 4M1OA 4CV3A 4DT1A 4OHWA 2SNIE 1FFHA 1MCZA 1OW3B 1PQYA 2G4CA 2QTGA 3DOOA 3UWDA 4I4LA 1FPQA 3C6XA 2OXEA 4TLEA 4DWJA 1P7VA 2Z4RA 1S7GA 3WMRA 1YI8A 1QGUA 2MCFA 4MHTA 4K2HA 5H02A 3G9QA 1JHVA 3ZWQA 3Q9SA 1QP4A 1ZJYA 2A1TR 1SO8A 3PRYA 2BMAA 4JBLA 5DTRA 5A4KA 5BSHA 1YA6A 2NZJA 1U3VA 1Z08A 2YY5A 4Z9BA 4LHSA 1E9RA 2PQ6A 3NVDA 3GY0A 1SQ6A 5T4FA 5DHPA 4CM6A 1JE1A 1Y42X 1ZAYA 2ZUDA 5IF9A 3CPEA 4ZO8A 1RWXA 5IH3A 4DIOA 2QVYX 4K9NA 4L7VA 1TKBA 5HOQA 3D1JA 3ZCPA 2GOYA 2ZETA 4KQFA 3A06A 3U62A 1ONOA 5HZKA 3A9CA 1OBOA 3D6MA 4I50A 4MITA 3M6FA 4PRYA 3W8EA 2GBCA 4Q3DA 2O1SA 2B37A 1RHUA 3BHNA 2FHPA 2KLBA 2D7DA 1D1TA 2B78A 4KIGA 4YJ3F 2BGUA 4MUFA 3MRVA 3DJYA 1ZGJA 3JQFA 5IT0A 3JWJA 3AW9A 1BX0A 4F6CA 3HY3A 2OKGA 1EGAA 4MR7B 3SOZA 2QX7A 3C8DA 3CB2A 3IC5A 1N4AA 4RZHA 4DB4A 4WZZA 3AUKA 4GF5A 1Y3AA 3RK0A 5J47A 2QGZA 3ZR4B 1SIOA 2X19A 4EG6A 1CVRA 5DI9A 1FSGA 5FI3A 3QYAA 4N0DA 1W0JA 3K1YA 3QPWA 3LS2A 2Z98A 4XLTA 1N6KA 5FJIA 3N2KA 3EIWA 1B0UA 1NULA 1GPLA 1R15A 1PL8A 1RTKA 2AJDA 2DUMA 4FDLA 5HSGA 1GDTA 1NT4A 1DBPA 1QTNA 2E4WA 4RSGA 5CHYA 4CFSA 2AZXA 3WGYA 1CZNA 1KMCA 1NBEA 3GNSA 5H1YA 1OCEA 1GQSA 4RGVA 4B83A 1Y82A 3T3IA 4P5PA 4CRWB 2VH1A 2ZROA 4ZT4A 5K5EA 2ZYDA 3I62A 1DG9A 3PHBE 3UT5B 1VPLA 2R85A 3KWJA 4PNPA 2C42A 1NJ8A 3R5KA 5DGCA 4GBED 1E32A 1G20A 4NU6A 4PLPA 5EWJB 1E2FA 3HRKA 5KQSA 2BF4A 3V4PB 4EYGA 4WE3A 3D0QA 4QZVA 1BDMA 3R0QA 1C41A 3TW8A 5CT8A 4JDPA 1H5UA 3T7SA 4ALNA 2A14A 1XQVA 1ENZA 3DBRA 3GELA 4I08A 3DZ8A 2W90A 5IULC 4GX1A 4FFLA 5AI9A 4DLVA 2HJGA 5FEMA 4KREA 4UMVA 2GD0A 1XEXB 2GD6A 4BLWA 2EFEB 3VGJA 2PL5A 2ZE5A 5BNIA 3EIFA 4YPVA 2XAUA 1IZYA 1ESNA 1IWBB 2PUVA 5EQJB 1ZITA 1FVFA 2AVNA 2TMYA 1ETUA 1L4EA 4TWJA 4PLCA 1RIFA 4GYJA 5B2ZA 2JJMA 4ERXA 1CZKA 5LBUA 4R3NA 3QMMA 1M2FA 4ZOQI 1GZVA 3EXEA 3BDIA 1E7MA 4YR9A 1EBBA 2PO7A 3UVEA 2AFRA 1YE8A 2G9UA 3DEFA 4IILA 4MXDA 3ZWCA 1CR6A 4ZFNA 1Q57A 4ZOLB 3R0VA 3H6HA 1J1IA 4L50A 4Q02A 4DDMA 1E1YA 3DKPA 3CPHA 1EVQA 1QUEA 4CN9A 1XE3A 3G6WA 4QPJC 4BVBA 3HN6A 1J07A 3LDGA 4D0LB 3PFBA 5B1IA 1JIKA 1PFUA 5CMLA 1K2VN 2SCUA 2VPWA 1IYZA 3KR2A 3NYIA 5FEUA 1NLUA 3U44A 2GO1A 3GHHA 2QD1A 3D6HA 3HRHA 3BE8A 2B8TA 4LWQA 1PZGA 3P5BA 5H0IA 1YL5A 3TBFA 3TF5A 4C22A 2YQ5A 5K01A 1KYVA 1MW9X 4LYEA 5REQA 1OY1A 2AK3A 3WDKA 4CU2A 5E9AA 4HDMB 5BVGB 1DPGA 4OIMA 1T8UA 3LK6A 3W5CA 1G6HA 2JIMA 1ODTC 4EHLA 2C31A 5I47A 3PHCA 1LWOA 4JR0A 2UU9B 1X1TA 4AKGA 4UAVA 4XYEA 2D1QA 2FPPB 2WZDA 2Q8NA 3WWCA 5JZSA 3E9MA 4PG6A 1ID1A 3ODGA 4BYGA 4MI6A 3PC2A 4Z8YA 2ON6A 4TVSA 2XGSA 4C1BA 4OGLA 4DCGA 5AI5A 2VXCA 2E5WA 3H9CA 4IHJF 4EZBA 3E03A 1VG1A 3IKVA 4UDYX 2R6ZA 1RWKA 1I2BA 3JQCA 1SG6A 3O1IC 4PHHA 4Y7DA 5KOIA 1E2NA 2QE6A 3PA8A 4GPIB 4WXPA 1UFKA 2CEKA 1VYUA 3ABIA 4RIIA 4GYWA 2VDQB 4R81A 1ILWA 1DIAA 1H6CA 2CLEB 3KQWA 3M9WA 5IVKA 1IG3A 4KMSA 4JVNA 4DLYA 1Z3IX 2Q3LA 3DF9A 1AUPA 4A0GA 1FDTA 2AMVA 5FUMA 5AW9A 1ICIA 5DM60 3SFZA 3RS7A 1CNMA 5E95A 3WL5A 2ARKA 2XV1A 3OIWA 3T06B 4PNEA 2J3IA 4HN2A 2CKDA 3SWWA 3WE7A 1K89A 1EFDN 1JJ7A 2L2QA 2P0AA 4BNWA 5AIBA 2A30A 3EVNA 3JAKB 5JI2E 4MVWA 3VNSA 1OXKB 5E38A 1MVOA 3AL3A 3PL1A 4GKJB 1V9SA 2BKVA 2MR6A 3ODPA 2IU6A 1M0TA 4MP3A 4XB6B 2Q27A 2H7CA 2G8NA 3LG2A 2JA2A 3OPQA 2GQ0A 1NP7A 3HY6A 3P0EA 4BNIA 5I7WA 4W63A 2I1VB 2W0SA 1KVQA 5LR6A 4WEQA 2C9OA 2Y71A 4MUHA 4UD2A 3U4QB 2VSYA 3P4UA 4GVXA 4NU0A 2RHCA 3W3AH 4E08A 1YCDA 4I4TA 1QRDA 3D0KA 4E5DA 1JZSA 2VXOA 4YT2A 3CVXA 3CS3A 3W05A 2ODTX 5FBRB 4CW7A 1TK2A 4IOKA 3GGCA 5JS2A 5F7OA 1P0CA 2NG1A 1XZMA 5IDXA 4Q3BA 4FFMA 1HR0B 5JZBA 2QM7A 4M0KA 3ROGA 3S2SA 5CT5A 4E32A 4XRGA 3ANLA 3Q5EA 1O6FA 1UBNA 1B93A 3AKZA 4NXNB 3PVCA 1CB0A 4TS9A 3MWDA 4BE4A 5KWEA 4DV4B 4XA8A 1EGVB 1W5AA 1XCGB 3F1KA 2V9PA 3GAMA 4X6YA 4DCMA 2WM9B 1OBVA 1P91A 3HCOA 3RIEA 4EWLA 2BOVA 1MJGM 1X8KA 3B3GA 4UBOA 3RSCA 3I2GA 3GLIA 2GN6A 3F90A 4X64B 5MDHA 2R5NA 1SD5A 2OHFA 3I39X 1Y8QA 2Q4BA 1NUHA 3B89A 3C3JA 4IJMA 1EM6A 2WZCA 1SZCA 4H3KB 4IY1A 3E7FA 3BSSA 2FV8A 1Y6ZA 4IUDS 4YFYA 1TZBA 3AHEA 5KNCA 4GMFA 1ZK4A 3GH3A 4IGEA 3UB4A 3PRKE 2HRQA 3RT1A 3WL7A 4UXHA 4RKFA 3D43A 1GFWA 1GL6A 2C61A 4JP2A 5AK3A 1DV1A 4MLDA 2GPNA 2MHCA 2WM8A 3BH6A 4OXIA 5DNDA 2Q1XA 3U4HA 2ORIA 3DTVB 5HZMA 2ZVPX 1ADCA 3ZHUA 6NULA 1P45A 2W93A 1IZ8A 1M2OA 2Z8XA 3CUEF 2R00C 1E5LA 1ZSYA 2IFTA 2ZCUA 3BD7A 4AJJA 2FPLA 1A8PA 2P2ZA 3R5FA 5BN4B 4JB2A 1NXXA 3OE1A 1TVKB 2PWAA 4EUEA 1SQ5A 1EAYA 2PUJA 2W6CX 5EMKA 4MV1A 2HSDA 4MW6A 1FX0B 3SQMA 1XAIA 1M1NA 4LKRA 4YP7A 1GARA 3UMMA 4BNFA 1JDNA 3ZIUA 3ZW7A 1BYIA 2VT7A 3TTVA 2F1RA 1R8XA 3ESRA 5F7XA 1IVYA 3EYAA 5F4BA 2WSBA 2AG1A 2E37A 5HE9A 1X7YB 4U7DA 2N1BA 2FUG1 1Q2UA 2DPHA 3L6DA 5G40A 4GC9A 4RY9A 2FGKA 2GK6A 3HU1A 2E4UA 4RD6A 2BFBA 1A5AB 1H22A 5CRIA 1R7RA 2P2YA 2AWNA 4DREA 2CE7A 2NM0A 4LPSA 3SSAA 1KK1A 2VBGA 3WIEA 2G1KA 2P79A 2PT5A 3G9ZA 1KKLA 3GDWA 3U7FB 4AO8A 1MN6A 3HM2A 3N0WA 3P0HA 3RS3A 4C7OA 2A9FA 4PAWA 2H3HA 3TR5A 2O20A 1TD1A 3A1WA 4J94A 4NG4A 4NCNA 1IB6A 2GUWA 3GYBA 3W9BA 3ZCUA 4B3HA 2WFLA 4WOCA 5HOEA 2UAGA 3PLNA 4C4ZA 1U6IA 1V5WA 4QUBA 3J81A 4L4RA 4TQUS 5T41A 3IEIA 3DH0A 4LJRA 1ODFA 3O26A 1PFWA 3L8HA 4DUZB 3L02A 1D2GA 5K0NA 1H2RS 3DOJA 2I03A 2XVAA 3F6SA 2DBZA 1ZZGA 2EV9A 4BO6A 4KGZA 4WBNA 5DBFA 2YH2A 1YASA 2QSYA 3FAZA 3INYA 4PR0A 2ZUTA 3WJ2A 4A6XA 3SQLA 4F4JA 5K6RA 4FBGA 3RFVA 3FHOA 1Q1EA 3C70A 3Q7EA 1M1YB 2ONJA 4CQLB 1XYGA 4JJ6A 5DCYA 4QGGA 3H1EA 4QXAA 4ENVA 6YASA 1BQEA 1A1SA 1QGUB 1IN8A 1AVTA 3CVVA 3AR3A 4EI9A 4YCAA 3LXUX 5CLGA 1ZEMA 3G2IA 3ELBA 3JQAD 3A58B 2QPLA 4P4SB 3T9FA 1NR5A 5CT4A 1NQUA 5DP1A 2CWWA 1KRHA 4C29A 1YJAA 1AQYA 2WJWA 3OUUA 3SEZA 3I0ZA 5ALJA 5LXTA 1XPJA 2G25A 2X76A 3H2KA 3OQPA 3O74A 3GYGA 4X71A 1XTVA 2D1YA 3G82C 3H8WA 3KALA 4X24A 3ZD6A 3BGOS 1HL3A 2VJNA 3WNZA 4XLLA 5ETJA 1DAGA 2V6IA 4AVYA 2GASA 1QO7A 2B98A 2JGJA 1C8KA 5KOJA 3OZSA 1W1UA 3C3DA 3V2IA 2REBA 2FPSA 2F2TA 4BL5A 4ER5A 1RAIA 1FP1D 8GPBA 5H68A 5GM2A 5D3MA 1SPXA 1UZMA 1TFRA 1W85B 5H4GA 3SHOA 4JVMA 4AZSA 3M6VA 4NMMA 3Q8WA 1MO6A 4Q01A 1N2JA 1EXDA 1T2NA 1YQXA 4WASA 2WNIA 3MGKA 3G0HA 4IEFB 4RVFA 3X1ZA 1IEQA 2JGFA 3K6JA 1X77A 3JWEA 3ZHCA 4N65A 1GVNB 2VUIB 3CC8A 3DKRA 2P4EA 1X70A 3L1IA 4KDFA 4PLFA 3TSYA 2WT9A 3QKSB 1XALA 1FP2A 1Z39A 3EA0A 1TQ2A 3QX3A 2O8DA 4IH1A 1N3LA 1ORDA 1R5OA 1RWOA 2AOUB 3TQHA 4EABA 2LIVA 4NCBA 2PRJA 3AJRA 4BNJA 2ZULA 3LRTA 4BX3A 4C6TB 3HLKA 4FHGA 5FYQA 3CKKA 1XLTA 4H31A 1ZMBA 3I1FA 3L41A 4HRAA 4MKZA 2BEKA 2WM2A 3ZQJA 4EY7A 2PBZA 3VSAA 2ZQZA 1QMGA 3KZNA 5A9TA 1RAGA 3C8HA 4YDQA 3ZY4A 3GJSA 2INGX 3I5XA 1WNFA 2CE2X 2NMVA 3D0OA 4OMDA 1Q95A 3RUCA 4JLJA 3TNJA 3VH2A 2XBMA 4TYPA 4GE0A 1R0BA 5TT1A 3ORHA 5F2NA 2J45A 1XMPA 3X1JA 3DPIA 3LOUA 4UCFA 1EFRD 4AZ3A 4DA4A 1QZTA 2IEAA 1JT9A 3OOYA 1JG3A 1V26A 1YIDA 3WLNA 3W4JA 1FDWA 4J9VA 4XKJA 2XITA 4UFNA 2QP3A 4LECA 3DXYA 4N7BA 5EL0A 3RSQA 3TW8B 5JMOA 2D0OB 5TS3A 3R8XA 3ICOA 5F73A 2PMEA 4MGYR 4XQGA 3NAQA 3OTOB 1S8NA 1DKLA 3JV7A 1IM8A 1DJOA 1M5UA 3OCZA 1NVVR 2Q45A 4L07A 1QQTA 1Z0FA 2AFIA 2FQWA 2NVBA 3AY6A 4YFVA 1E2UA 1GZSA 4NAHA 4R1TA 5DN9A 4JVOA 1F6BA 4JXKA 5AK4A 1NJSA 1YDEA 2HPHA 4BZXA 5DBIA 5H3HA 2ZBFA 3HR7A 4OHUA 4MOWA 4I4NA 5G1PA 3HWX1 3UMCA 4PW0A 4E33A 3BAFA 4WI1A 1E6LA 1XEFA 1E2LA 3BXGA 4TPKA 4DIFA 2P5SA 4EW3A 2NXJA 3FVWA 3QI2A 3HDGA 1RLOA 4BJHB 3KB2A 1QF6A 2BSQA 4BNDA 1NVDA 1P31A 3QU2A 2H1OA 3L0ZA 1TJYA 5GPBA 5ALSA 3OKPA 4IMJB 4B0OA 3GEEA 5TARA 3UKJA 3O8QB 3THRA 5IC4A 1H2FA 5HDBB 1SU4A 4AQ7A 1H3FA 1RJFA 1Z2PX 2ZUVA 1AXRA 4I1IA 4JYPA 4TZTA 5JECA 1FSZA 3QFCA 5IK2A 3LTEA 1USIA 2CLIB 2I6FA 3LA8A 1QIKA 1T0BA 3F7TA 4A8HA 4P34A 5BUQA 4JWKA 4UCQA 4OEHA 3WLPA 3RO7A 4DG8A 4BX9A 4QDKA 5L45A 2AJTA 3VOTA 1GGNA 2BGRA 1H8HD 3M5CA 4G5HA 1PZFA 3SEFA 4JC5A 4C4TA 1AZSC 4L5BA 1WUIS 2IELA 1SWWA 2GYUA 2PD6A 2QGNA 4PLTA 5GGYA 2FMHA 1N57A 3JASB 5BVGA 4TZ6A 4MKHA 4RHCA 4FGJA 4M1SA 2Z5LA 2X42A 3T5AA 3UG6A 3VR3D 2YWGA 2BFPA 1L3CA 4LXUA 4FHZA 1E2MA 2GPJA 4ENUA 2FPPA 5C34B 4LRSB 3H83A 2PKQP 2VA9A 3CBGA 3MUEA 3AIIA 1F9AA 4MUMA 3RD5A 4U6SA 2QWXA 5K3SA 3O8OA 4R8SA 3AFMA 3ZXSA 2OGZA 4AF8A 2Y9PB 3HSYA 3QLUA 4G26A 1NYTA 4XQ9A 4BWFB 3CW2A 1J2EA 1OFUX 2HK6A 3U60B 2PZEA 1G64A 2VNKA 3EIUA 4PFQA 5JCPA 1IWPB 5LA6A 1GAJA 3KV3O 2NX2A 4TROA 3DLHA 5DM1A 3KQKA 4NICA 2HQSA 3JVVA 1QVVA 1WPRA 3ZCQA 3VA7A 5AH0A 1V2HE 1RKBA 2ZSEA 2CXXA 2QOEA 3HEBA 3E35A 2ZYRA 5AXDA 2I4RA 4PYNA 4FFSA 4LF7B 4F4CA 2I91A 3OHPA 2Y1FA 1GPAA 1RQXA 3RU7A 5K9ZA 4PXAA 4ZAVA 4YMSA 3U7JA 3OA0A 1NVBA 1NL3A 3IQIX 3BN3A 2RJOA 4EF6A 3EVZA 5CGQB 5DGIA 5LBTA 4EFLA 1FP4A 3JAKA 5AK0A 4CMKA 1R0ZA 4KR9A 3GN2A 3BORA 1YI0A 4QBKA 2WQ7A 1E2KA 1U5BB 2W6NA 4FS3A 4QQ8A 5E0OA 5F2EA 4HOYA 2DR0A 3IUNA 3NG1A 1E18A 3ABQB 1GFIA 3PYLA 4CVNA 1KZYC 3A8TA 5AFSA 2ZYVX 3TXYA 2YRFA 1M9NA 1Z25A 4JBWA 4ENPA 1ZI6A 3H5IA 2CF5A 3NPAA 4EJFA 3FLMA 2VF7A 1C9JA 1MRZA 1VRCA 3CRNA 2RGUA 3SHQA 3G2NA 1KOLA 1UKVY 3ROEA 1UBEA 1Q7EA 3GNLA 1YFLA 3COWA 1LS1A 2PS0A 3D7MA 4QYTA 1PZEA 4W5WA 1AE1A 1YFJA 3T7JA 1X13A 3L46A 1TEXA 3KTAA 5LQAA 1G5TA 2GM9A 4QNMA 1A2QA 3HBLA 1IC6A 4P93A 5HPYB 3NOXA 5HIMA 2WFLB 4R83A 5PGMA 1TU3A 3QBJA 4M9QA 4PO9A 1QHHB 2ZIXB 4TV9A 4B4OA 1EI9A 5EJ4A 3FWKA 5ALYA 2FOIA 3HCEA 2IH5A 1HE4A 3V1UA 3SYMA 3RFTA 4ZV4A 4DM4A 4S12A 4Y0AA 4IJKA 1OWPA 1PS9A 1P17A 2CHVA 2IEYA 3VQTA 3QJ5A 1X6VA 2FKNA 3HL4A 4B87A 4Y2YA 1NLMA 2JAOA 2JFWA 4O4JF 3UJHA 2F00A 2YMPA 3IP6A 4AW9A 1KYWA 4ZJZA 4Y6PA 2QW0X 4EKGA 1CS0B 1I32A 1RAFA 3BOSA 3SVTA 2AEFA 3ZV4A 2W2OA 1QGED 1HFEL 3MTBA 2GTPA 3EXHB 2ZATA 2VEOA 4C7VA 2VAXA 4PHTA 3SU8A 1OWNA 1UJ5A 2VKTA 3O4JA 3VVBA 4F60A 2IS4A 1TYAE 3BQMB 1TVEA 1EE9A 3BYZA 3ZHBA 1GGMA 3B85A 1W8IA 4Y2UA 4EDFA 3A1CA 3JD0A 4XIJA 1OA1A 2Q1UA 5CG1A 2QLMA 2XGOA 2Y77A 3LUDA 4J1SA 4ZVUA 4I3FA 4UM9D 3UHJA 4M37A 1ISFA 3C8UA 3K0EA 4H4DA 4NP6A 3JYQA 5G4LA 1GZDA 4WBXC 1NI4B 3CSUA 4F9TA 3LBAA 4ZVVA 1XCBA 5A5VA 5IXJA 3MTAA 4H18A 5FFMA 3IKTA 2EQ5A 4Q66C 1YB6A 4UOEA 5BO5A 3GGPA 1JH9A 4LVOA 1OI7A 4JP1A 2DQSA 3FMPB 1TYCA 1A9PA 3IVXA 3GMTA 5DV9A 2OUKA 2FSHA 1UL1X 4I1UA 2VTVA 3U49A 3GWGA 5IDQA 4ES6A 5H8WA 2FCAA 5CPFA 5GIPE 2GXUA 2C88A 3FW1A 4FOTA 3QU4A 3W0LB 4RFSA 3AF5A 3QX7A 1RRGA 2QL6A 3D5EA 4GX2A 3W78A 3WYEA 4DFDA 4F2GA 5K0LA 1RXWA 1M7GA 1G5QA 1ZIDA 1FFXB 3MMPA 2AFHA 5CDTA 5KYKA 1NJ6A 1Z75A 2CXHA 4DIEA 2O8NA 2FI1A 2OVBA 4N8DA 2WSIA 4DJTA 2GDJA 2XMBA 1ZG3A 2IIVA 2C03A 1F2TB 3F4KA 3L8GA 4PZYA 1KE1A 5AQEA 4DYVA 4QL3A 1DEXA 1N3IA 3KWMA 4UCWA 5CB4F 5AHKA 2O2HA 3UBTA 4NOMA 2V7WA 2MYTA 1B8NA 3NETA 1R8YA 2A7XA 1J00A 3THXA 4Q3CA 1XR3A 1WBDA 1YULA 1UAGA 2J0SA 2GPYA 5IM4F 3HACA 3OKFA 3OQ1A 5JSHA 4Z3KA 2PXHA 1DQNA 3W90A 1RWPA 3ISTA 3WOHA 1FCJA 1PGPA 1U8FO 3JR7A 3JATB 1EP1B 2ZJ6A 3AVXA 3TCXB 5H9WA 4N5DA 1QYXA 1HDIA 1PHPA 1VKZA 2DUWA 3ANMA 1JDBB 2ZBDA 2Q5OA 3RH0A 5REQB 4DPKA 4E1VA 4C78A 2M1XA 2GJ4A 5BT9A 2Q1TA 2K2WA 5JNUA 2H3EA 3UXMA 3K09A 1D4AA 2BI8A 1QE3A 3NHKA 2IYAA 3U61B 5C53B 1C9MA 1D6JA 1YHNA 1PCXA 5BOVA 2Z8YA 3RVRA 1QYCA 5FADA 2QJTA 4IXMA 1NW5A 2C3MA 3IAAA 9ATCA 3AM5A 5FF9A 5B58T 1KE2A 4JASB 4G63A 4FX2A 2GF0A 2EFHB 1DFGA 2OHIA 1KU6A 2W6MA 2A1TS 4MB0A 3VPDA 2K6GA 3M8KA 4ND3A 5LQRA 3FOZA 2CBZA 4D3SA 4DMFA 2EP7A 3LSYA 4LCBA 1K8QA 1AMUA 1OGIA 4JYCA 3CINA 4LJ4A 4BQRA 4YRZA 3ANXA 1WUTA 1I6WA 4UBIA 4WFKA 3MRTA 1BKYA 3HVUA 5HIIA 2JH9A 5DLYA 5KQRA 1E3SA 1JKJA 1V3VA 4ZXFA 5JZ9A 1F4LA 1WCYA 2WKPA 1TQ4A 4EB3A 4G4SP 2OLEA 3KJXA 4Q39A 2FG7C 2J3DA 1CLEA 1E2PA 2RGDA 2VHWA 2A8YA 2XQIA 4YCJA 4CE6A 2FN3A 3K0CA 1M6VA 2X5OA 2PYZA 4TRMA 1PQ4A 3B7PA 1TJ4A 1ZNXA 2RKBA 4KN6A 4CF6A 5D5HA 1SXJD 2GZHA 1ICEA 1P5HA 1GZ6A 1SVUA 2QTVA 4G0PA 4DTIA 2NTNA 2AYXA 3L7MA 1Z0ZA 1G2IA 3FUVA 3L06A 4OXRA 4FZJA 2BGJA 3WGGA 1X3LA 5IANA 3QPUA 3IA2A 2EGUA 3P9RA 4FHDA 2R8PA 4PCAA 1OFUA 1VYVA 1HBJA 5C4MA 3A3NA 3DCYA 5LN1A 1ABBA 4HQ6A 1N9GB 2MSLA 4L08A 3R3HA 1L4GA 3CE6A 3MBKA 2FUCA 4YJGB 1G55A 2M6RA 5AM5A 3C8MA 2LTAA 3AI1A 3OVMA 5AKKA 2R9VA 1WCWA 3GHYA 2XCRB 1AH2A 3EXFA 2X4IA 1ZXBA 1P2FA 2CMHA 1TUBB 1DKRA 1SJ9A 5IAEA 1WJGA 4UAJA 2P78A 2ZG6A 4K28A 2R60A 1KAMA 2QUHA 2JL1A 3O94A 4ND4A 4PZ9A 4XFJA 1FXWF 4I4TB 2G6TA 3BIWA 2AD5A 3T5GA 2ZLBA 2OZKA 3AEQB 3K9GA 5AI0A 4I5IA 4Q16A 1EQ2A 1N2SA 3MCUA 4BVEA 4A4DA 3EVFA 4AZ3B 4P38A 4D8TA 2JI7A 2H1IA 1LSSA 3PSAA 1DGQA 1TT5B 3TQQA 1HTWA 3INTA 2DU8A 2X2OA 4V0MA 3I2IA 4WZBB 3FCOA 2CLHB 4IOLA 2PEYA 5DDIP 2HGZA 2JFUA 4H35A 4L5JA 2JJ8A 2OD7A 3PGXA 2ATIA 2DLCX 2DSTA 3PQEA 4KVAA 1KYXA 4QDZA 2HPVA 4P0PB 3UV7A 2NV0A 3HYTA 3LZDA 1ODIA 4B2PA 1GCOA 2IYTA 3QU9A 4FT2A 3E05A 2BKUA 3K05A 3TZLA 4L85A 2AQIA 1FVXA 2O7QA 4W1PA 4E13A 4M9RA 4NFLA 3ICQB 1VJ1A 2XE6A 3MJFA 1QH1A 5CNKA 4HRYA 3RANA 1DO8A 2II6A 4Q93A 1X87A 2HJRA 2JFBA 3E22B 3JQ7B 3OZAA 4QGBA 1PFVA 1YA4A 3JZAA 2I6TA 3OOHA 3SQWA 3OQNA 3ILHA 1MAUA 2WTAA 2XWJI 3KVVA 4Z2YA 1I01A 1Q1NA 4I0WB 4M0MA 4D97A 3HDHA 5AUPB 1X94A 4CKWB 1NY6A 4TKLA 1IY0A 2QORA 3QF4B 1Z6ZA 4B75A 5I3ZA 1ZP6A 3GZNB 4ZTBA 3ZVNA 3DTVA 2HV9A 1L7RA 3HCRA 1GUYA 5A3VA 4LIPD 1FYXA 4JZKA 2H54A 4K0RA 2AZTA 2EJTA 4FP9A 1U94A 1P3JA 2ECQA 3LMKA 2RHOA 3M2PA 4RMIA 2ZREA 4HG2A 3NS7A 1Q21A 3HKEA 3IVMA 4YRTA 3V4RA 1REQA 3I09A 2X9QA 3EF3A 2OPHA 1HT0A 3UMRA 4N8SA 5A4MS 5E7JA 1D9XA 1WKCA 3CA8A 4BVKA 1C3VA 4G9BA 4D43A 1SVWA 2GERA 5C3MA 1XU4A 4HXEB 1KYTA 1YB5A 1Z38A 4DARA 3UHAA 1JEQB 3V3KA 3SJAA 4IFIA 2RSLA 3VRHA 4YQYA 1YCFA 1ZGCA 2X8JA 3K30A 4ZYVA 1O2DA 1WDKA 3WMGA 2QVGA 3FYTA 1JFFA 3C6MA 5IAAA 3HKBA 2PSDA 4W7IA 3PVSA 4UVIA 2BEUA 3ESCA 3LLCA 4UTOA 2ZYGA 1XQWA 3DBOB 2ADFA 4RH0A 1HDRA 1PEKE 5NULA 1J9ZA 5FLEX 3T7IA 2Y1GA 3ISJA 4IIVA 5H4HA 1OHHD 4XSHA 4JYBA 4B76A 4QOIA 4D3XA 5KNCH 4LYYA 4FSHA 2GPBA 1RFLA 3TGWA 2JPDA 2RIRA 1O9HA 2AD1A 4CIYA 3H3JA 3LPNA 5JXIA 1UMCA 3KQUA 3I6BA 1EK0A 3N28A 1SOAA 3GJ5A 4ZK2A 4YP5A 2VTDA 2WMNB 3HB1A 4DBVO 4PF1A 5DHSA 5JZOA 3HWSA 2C98A 2FX3A 2GWHA 2IGBA 2ZXFA 3E81A 3NBQA 4BUJA 4YT8A 2V8BA 4B6EA 2DOKA 2OWEA 1VGVA 4B2IA 2Q8QA 2QPAA 3DJFA 2VDLB 1ZCFA 2IPNA 1YQ9A 1HFKA 3N59A 4NJEA 4ZO4A 1M1YA 4CQLA 4RK1A 4OYYA 2NYUA 1YB4A 2N47A 1FLVA 4CTMA 5KJFA 1GAXA 4IMPA 3GPCA 4GQAA 1F6DA 2R62A 1NF2A 2C92A 3ACDA 3Q15C 4WLEA 3EZLA 1AT1A 4RM2A 3SD7A 3UHOA 2EJUA 4KHPB 1YR7A 2YHSA 3VYRB 1OE0A 3KR1A 4BNZA 3CWZA 4C7XA 2F3UA 2IKQA 1CRWG 2OFXA 3C98A 5JLJA 2R8BA 4TTJA 1BXRA 1ZVQA 4HFRA 5KHAA 2PX2A 3A10A 1JV2B 2EHJA 1FRVA 1OBCA 1XO1A 1JSCA 3B6IA 4V2IA 3OY7A 4CPDA 1UZAA 2AHRA 1J0EA 3QKIA 1YHZA 4ITVA 5T5QA 5B7GA 5FOXA 2QQGA 1E8MA 2XWBF 3R74A 2DT5A 1OX4A 2BE7A 1AXGA 2GHQA 4DIBA 4F5YA 2ZJ2A 3SHVA 3WYDA 1Y3FE 4IRMA 1R4MB 1PYOA 4FWTA 4ZEXA 4BX8A 3ANTA 4O4LF 1G20E 3IBFA 3KTAB 3LVQE 1XA0A 3OZGA 5D3MB 3LCRA 1LDNA 1M8PA 2W2MA 2VOJA 2AK2A 4HYEA 1UWKA 3CW8X 4HLCA 4URYR 3FR8A 3IKMB 3MWJA 1Y9ZA 4NL4H 4U2GA 2JC3A 5JAQA 5ICEA 5F98A 5FULA 1NHGA 1NF9A 2X8LA 4YDSA 2H0AA 2H2HA 1G59A 3I64A 3MK31 4YJ2A 3T1HB 1IUOA 4JQOA 1KZHA 2WAXA 5SZHB 1O94A 3RK1A 3TK1A 4LNUB 1ISPA 1HMYA 1OVGA 1WMSA 2VZ8A 4MYUA 1BJKA 2DH5A 2X86A 1Z7EA 1NM5A 4IDQA 3F78A 1XTKA 1G41A 2X0JA 2QRGA 3CZCA 1MX1A 4AURA 3A36A 3G68A 2NO6A 2OAEA 3KQYA 4LDQA 4XEUA 3U9LA 3K0BA 1IJEA 3LNTA 3WK7A 3VYWA 3ENVA 2NO1A 1T0IA 3K4PA 3CLVA 4MVXA 1GNQA 2UUOA 3N6RA 4F3CA 5GZ6A 4PANA 2FG5A 3HJTA 3EZXA 5SYMA 3ZG6A 1RMTA 1SZPA 3M81A 3A6KA 5FIUA 1FX1A 1R9GA 2HA3A 4X3PA 5BT8A 2LW7A 5I3CA 1M2EA 3HA5A 5KOHB 5ALXA 5JW6A 3ESAA 4ZQHA 1YZ3A 5CFRA 3RYCA 4CV0A 1H2ZA 1EEHA 1SKMA 2VZLA 5T3YA 2M6KA 2PZKA 1T43A 3GMDA 3BERA 1YR3A 5D1HA 3WJAA 1CUJA 3GX1A 1GGHA 1GNRA 4PZPA 1CQJB 4UQPA 2QBYA 2FPMA 4CGYA 3UMYA 1II8B 3HNPA 3ZJYA 2DECA 1SK8A 5EKSA 1RBYA 4HB2A 1HK7A 5F3WB 3KJNA 5EUMA 4TLDA 4IHJB 5FT9A 2ZSDA 3HYSA 2JLRA 3ZIDA 5EP2A 3PICA 4ABYA 4O2LA 4HFJA 4BQIA 4EAQA 1M2JA 1NUTA 4GM1A 4KAXA 1CP2A 1T9HA 3CG0A 2Z2XA 4FYWA 3R44A 3PYMA 3X3HA 3ON5A 1ZO8A 2C59A 1XJQA 3PL5A 5IFKA 1DC7A 4Y2QA 4OJQA 3PFWO 4L4UA 4WZAB 2VATA 1P7PA 2AFHB 1BXGB 1J9EA 3QE2A 3UA4A 5ILOA 1ULBA 3DO6A 5T7BA 2JASA 1GG8A 1E1KA 1S8AA 4IQ4A 3WI7A 3CRQA 4J75A 4XCXA 1ESDA 2PMFA 2QN6A 4KNWA 2FF7A 1DU4A 1V5IA 2GK4A 4ZO6A 3WQHA 2FZGA 4Y2GA 5EN4A 2ZYIA 3EVGA 2I4IA 2XHZA 1Z2DA 2PUFA 3PUXA 4Z7JA 1RP1A 1ACMA 2H17A 3DM5A 4O8ZA 3OECA 3HNOA 2ZPTX 5FPKA 2JZNA 1JMKC 2RGCA 4Q21A 3I05A 5L3SB 4HBGA 4YMLA 1IXYA 2Y2UA 4OK3A 2J9GA 5KCZA 1F2DA 1LBIA 3W8DA 1BKDR 4H77A 5FA5A 1DAOA 4XI9A 4B8ZA 1U0OC 3LLMA 3PUJA 2JATA 2REQB 1PDVA 2DPGA 4NU8X 3ZZNA 2VZEA 4ZJPA 4X1YA 1Y6QA 3OU2A 3H19A 5TPWA 2QTCA 3PLRA 5CK4A 3GAAA 3WMWA 3N1UA 4ZZ1A 1ZRNA 1RLMA 2VHTA 3M7IA 2LUOA 1GL9B 2VQSA 2ZWIA 2O3TA 2IXEA 3BMCB 3IAS6 4INPA 2GGSA 3MYRA 4J0IA 3WQSB 5JC1A 2V7PA 3ISVA 2PR7A 3PA6A 5A1TA 3UK6A 2AJLI 4H1UA 3S81A 5GGXA 4U7HA 1UK8A 1WDTA 2A0WA 4U3JB 3PNMA 5C0OE 3DGFC 5FUQA 1DRKA 2QM3A 2W71A 3OZVA 3D6FA 2P69A 1FYEA 4GR9A 4DQUA 4BY9E 4PBSA 4EPVA 3MMZA 4N7MA 2JGLA 1G4AE 3U16A 1K0UA 3N70A 5ALTA 3PUHA 4JGBA 4QLOA 4XUEA 3QXSA 1I51A 2FYTA 3BC1A 1D6SA 3NU1A 2RAFA 3O8LA 4EHIA 1SXIA 3S44A 1Q0SA 1HQDA 1O94D 3D02A 1GGVA 3EIQA 2MINB 1NJGA 4K6GA 3KC2A 1JDBC 3PDIA 4ZPJA 1C3JA 3TFQA 4Q19A 1J5XA 2WA1A 5DH9A 2NO5A 5HRUA 3RVJA 2A78A 2PNFA 4URWR 4KPGA 2H52A 4CM9D 4WCVA 3R3ZA 1DIHA 1JILA 1WUHS 2FVXA 3B1FA 2I6UA 2BI7A 5FV7A 3WWDA 5CUQA 1KDPA 2QAGB 4RTOA 1UAYA 3KD3A 1FFWA 3OCXA 4G65A 4CV2A 4Z7QB 5K2OA 2QKYA 2ZJOA 3V33A 4BECA 1BDHA 4EY8A 5K0GA 1N3BA 4LMAA 1OAOC 1UOOA 4MUJA 2WWTA 3QELA 4MGIR 1KFBB 2XB2A 1UEJA 3E7DA 3K0CC 5ES4B 1V7PC 1HDOA 2G76A 4V39A 2GKOA 4EW2A 4M60A 4B48A 3O9ZA 4L15A 2YJ5A 3I32A 4H9GA 1VDZA 2Q5FA 1Z88A 4V2UA 1CEQA 4BNDB 1LLQA 4CHTA 1O7JA 2QTBA 1TZKA 5B1SA 2IHTA 4EOGA 4Q3EA 8ADHA 3Q7RA 4W1RA 1T5DX 4G37A 1P5FA 1LI7A 1ZN8A 1PQUA 4XM1A 3RC2A 1FU4A 1JBKA 1NVFA 3CTMA 1Z35A 4QDTA 5THXA 3EXAA 3A1NA 4I14A 2VS1A 4MV9A 4OHZA 2BSAA 4PSAA 4JXZA 2Z09A 5K8CA 4DR6B 1VKNA 3V7YA 2D8AA 5EVCA 5B57C 3PEYA 4OXKA 4OQDA 4RLHA 2V3VA 1GGJA 3D4LA 2X8AA 4JI5B 2ORED 4RTNA 4F4FA 1LTHR 2PZ8A 3D8BA 2YV5A 1QYIA 3I04M 5IYZF 2P9BA 1CZOA 1BC5A 4V3BA 3IAXA 1I94B 3CUVA 3KXKA 1NAIA 2KSQA 4YIHA 3UN1A 3D9QX 1E3WA 2H85A 5C46F 3OBBA 4OB6A 4BN0A 5DFAA 1B42A 4BPRA 4DG9A 5ELLA 4M21A 4HDRB 1U1FA 3HXPA 1A9QA 3NP9A 3QPVA 1G63A 1OAKA 2QZSA 3JWHA 5CDFA 4K03A 4GUAA 5IS2A 2F8TA 3KLBA 3AR4A 3PWZA 2JLQA 4JQYA 2HMYB 1R6VA 5AW2A 1JAYA 2Y27A 4KXUA 5A04A 3T1NA 5BNFA 3HVKA 1V3UA 3HYLA 5GMOA 2WYVA 2Y05A 5KYWB 3OE5A 1USKA 4AFNA 5IUNC 3HADA 3T7CA 1E2DA 4KAFA 2I7XA 2J87A 4N7RA 2XYQA 2IUUA 2W6JA 5DT9A 4PO8A 2HZ7A 1L1RA 4IW3B 1Q0QA 4Q3OA 4XFKA 5JMTA 1O3YA 4QFMA 1EDZA 1L3BA 2YIDA 2Z8ZA 3DDOA 3E6AA 1BGWA 2QMQA 4EB8A 1IFXA 2PL1A 1DBVO 2XY4A 3PNVA 3JQ6A 4YAEA 3PHGA 3KEQA 3AX6A 2CNWA 1DQPA 1I2DA 1ND6A 1J70A 1T5TA 3H65A 3NHZA 3QVJA 4I6JA 4LYHA 4BFVA 1I7SB 1OFVA 1APBA 2HW8A 1IHOA 4YC7A 2X5NA 4C1NA 4TLMB 1DVRA 2GVNA 1IQUA 2M98A 3LA6A 4G8CA 1XTSA 3KSDO 3UK7A 1LJUA 1IPHA 3H4MA 5CA0F 4YHBA 1T6BY 1AMOA 3ZY2A 2EW1A 1K7CA 3RRJA 5JYDA 5C8YF 3WV4A 4XGIA 5KX5A 3Q6IA 4HQOA 4P6VF 4PYRA 5BWOA 2AX3A 2QYTA 3KJGA 4HDOB 4CLOA 1Y1SA 4BTLA 3U6KA 2XPCA 1WSAA 4G6ZA 4OBEA 4ASUD 2PHZA 4EB6B 1X7HA 4J1NA 4MTLA 1H94A 1CY7A 4I46A 4Q3LA 1T0HB 4M6WA 4B8WA 1F20A 2BJWA 2C2ZA 2D5LA 1K0FA 4FFBB 3RBZA 3TWOA 2W8ZA 4P82A 3NNNA 5EZSA 2WUGA 1P7CA 1PFQA 1YSCA 2LE0A 5KQMA 2FPKA 1IN1A 3MM4A 5C1IA 4FFRA 2NU8B 2Z9BA 3TINA 1QG2A 4TV9B 2HNBA 2I62A 1VHDA 3T3HA 3VPFA 4Y6SA 3UPUA 1CE8B 4HF7A 3UAVA 5JQGA 1M2NA 4EGJA 2O2SA 1PL0A 3OF2A 2D00A 2WWGA 5DTIA 4BFZA 1ESZA 3DBHB 2WYUA 3RYTC 1ZIOA 3V8RA 3VKUA 3CR7A 4PN3A 1WZIA 5TQVA 4J3FA 4X6UA 2JCYA 5EE3A 4QVGA 2UV8A 1EA5A 5FWXB 2WTUA 2CJYA 4MVYA 3VX3A 5TIIA 5M34A 3TQCA 1I9GA 4JLWA 2XXJA 1D8TA 2WFMA 2YIVX 2NT4A 2J8ZA 1ORRA 2VWGA 2XZTA 3HUEA 3QUSA 2HXYA 3NBFA 1G3MA 4IV0A 5CBPB 1D0SA 2PWBA 2XMRA 4ZI7A 1IZ9A 2A4KA 2C4KA 1HEIA 3U3ZA 2Y1EA 3DTNA 1BCRB 2BKLA 1EFPA 4U9UA 1G98A 5EIOA 4AG6A 5I4CA 3Q8KA 4C2BA 4EJSC 1QRTA 3V2HA 4EKDA 3ANSA 1U2TA 3LF2A 2X9GA 3HDQA 1GUFA 3AESA 1Y7HA 1X1BA 3WZLA 3QEBZ 2GN1A 4OJYA 3NOQA 4BQPA 1UFVA 3CO0S 3EOZA 5BYJA 2B34A 3I5YA 4IUBS 1F8XA 1TECE 3K2EA 3PX2A 1LLFA 4PXYA 3GJZA 4YCNA 2IBMA 5ALGA 3QMPA 1EX7A 3E5HA 3T5CA 4NHOA 4BIMA 1NOJA 1DHRA 1K97A 1L4HA 2FPGB 3ADPA 4OYRA 4B6OA 5BV0A 2V4MA 2BEJA 5LZ9A 3ZJ5A 4Y8VA 3TIGA 4PRKA 2BGNA 4HDAA 4P3PA 3RFCA 1MG0A 1MOPA 3FTQA 1RHMA 1CEXA 4YAOA 1GADO 1SBIA 1RYEA 2AR7A 3NTRA 4LJKA 2JLAA 1A9TA 1DFIA 4L5IA 4UD6A 5ANRB 1P9LA 2Q6IA 2PVPA 3KTOA 2GCGA 1KJWA 1THZA 3I37X 3LCCA 3BGDA 2JGEA 4G86A 4R68A 4AY5A 2JARA 4LMRA 3I0NA 4CMBA 1R12A 2EFYA 3E5NA 1WHSA 3F7MA 3IQFA 2ADMA 3PB3A 4I7EA 3U31A 2CCJA 3TM4A 1XFAA 5JH7B 4DV7B 3M6AA 3ADDA 2V6BA 4MQ4A 2COUA 2TSYB 2EEPA 3EDCA 3QVSA 4JX8A 4MYSA 4X1YB 3SC2B 1VKHA 2W11A 2ORYA 4N01A 4DOMA 4F9EA 1YZYA 3ROZA 5GY7A 1CERA 3LX6A 1T2FA 3O38A 4Q7QA 5C51B 3TOVA 2D2VA 3SE7A 4NV0A 1GPWB 5BR1A 4PG5A 1EZZA 2ZVJA 5IDYA 2XGJA 1XRSB 4M7RA 2YQZA 4U3JA 1ZUWA 3R7WB 1QCDA 1E61A 2PLRA 3JY6A 4NESA 4ZAYA 5DCWA 3DFZA 3GA7A 1LU9A 1NYQA 5LLTA 3NH6A 1PNTA 2P27A 3HJGA 4OQPA 2OV6A 3L77A 1WBBA 3VXKA 1JJVA 4YJKA 4U0KA 2X40A 3LW8A 5EWLB 2C4UA 3N39C 4FLMA 4HJRA 4L78A 4AU1A 5IU6A 3FLAA 1JDSA 3NHYA 4B6GA 1UAAA 3OEED 5AVKA 2ZJYA 1L1QA 4TGLA 4BKOA 1UEXC 4JUAA 4DAEA 5B3AA 3I9NA 1S1CA 3RRNA 4BFXA 1UDCA 1T0JB 2AQ8A 3K8ZA 3VPCA 3FWZA 5HF5A 3W3ZB 1RLTA 4KW7A 5FNVA 1COWD 3NDRA 4K9RA 5KB3A 1NJ1A 2HSZA 4HZUA 3C39A 4G5QA 1T2VA 1CUAA 1K5HA 1M6YA 3BSWA 3WB0A 1W5EA 1EWQA 3F6PA 5G0SA 3BFPA 5AESA 1FYDA 1X14A 3AVQA 2NPOA 4N48A 3GJRA 5H81A 3SYRA 3L8EA 5CCBA 1NBMD 3FX2A 1AY0A 3L7DA 3HQ4O 1IM5A 4ZVKA 1GA6A 2CBGA 2JVKA 4ZOLA 1YS1X 5AHXA 1SHUX 5DYTA 5LZ4A 2N1MA 3Q40A 2PV7A 3A9RA 1UBJS 3KXDA 3AW8A 2V55B 1FTYA 4XSVA 1DUVG 3D6NB 5FRDA 2O2JA 2GH1A 3F98A 4PZ0A 3ZWWA 1XKLA 1YVEI 2ZE8A 1S4MA 1HF3A 3MF4A 4Y9UA 5J5VA 3ZQ4A 1HKUA 4PZDA 1Z6QA 3DE3X 5J4HA 3WLSA 3D6UA 3K9CA 4EW1A 3OZTA 1KPIA 3Q7IA 4J0HA 1PDOA 4K46A 4LSZA 4N49A 4RHXA 1KS2A 3HDTA 1AO0A 5EHXA 4YRGA 1NNLA 2ZRLA 4XB1A 2EKQA 5HKKD 5KO2A 5EEHA 1Z16A 3L8MA 3L05A 2J9FB 2H2IA 4JB0A 1FUUA 2JD0A 1Q0PA 2VP5A 4GP9A 1H9BA 5D3KA 1CD5A 1JFFB 4N8EA 1AQNA 2JIDA 1JQAA 1KU0A 3BGSA 3CZ5A 4FGZA 2BEUB 1SVKA 5DWDA 2BTQA 4A03A 1EFUA 4D4KA 5CDSA 2Z57A 3PQ2A 3VNBA 1A2KC 1YU9A 4GZ3A 5AXAA 3RC9A 2QDKA 1KKUA 2H4FA 1FW6A 2IYFA 3QEOA 3AF3A 3EGOA 1GGKA 1JHOA 2O3UA 3FVVA 3M9XA 4KHZA 4QATA 4HY3A 1NY5A 4D8XA 3GG2A 5COBA 3WJ1A 4YMGA 1HSZA 1BRTA 3E9DA 3V7FA 3ETJA 3F6YA 4BVGA 1DIOB 1LH0A 1MJHA 1RMQA 1P4GA 1U11A 2HA7A 2NO4A 2X58A 4KH1A 4UPVA 4KR2A 1ULSA 1UPUA 2Z3ZA 4YRLA 2CNWD 2OE2A 4AKSA 4QOJA 4IF4A 5CEFA 2QD5A 3HVHA 2R47A 4R1LA 4RVDA 1NBMA 3V9AA 1SQSA 4ZT5A 2XZLA 4KSYA 4KV7A 4XCQA 4G36A 3WMFA 2FUNB 3WXBA 4AXBA 3QMVA 2BDEA 4CDGA 3SIRA 4KO4S 2QK4A 2LGJA 4HSGA 4M46A 1EFRA 5HK8A 1E7YA 2PRZA 1BQ4A 3SXUB 4H4EA 5FPSA 1WMFA 2YXBA 3H5LA 4H0NA 3VMFA 1SXJA 4IO0A 3L1KA 2B5VA 3WISA 3H17A 5CLJA 5FOTA 1H69A 3R3XA 1N5OX 2ZTLA 1XDUA 1RM3A 4B73A 5ALUA 1S5PA 3QVGA 4E4YA 1GRCA 4A73A 3AB7A 1DAKA 3B70A 3KVNA 4GEGA 3D6TB 3FTEA 1U2PA 3ZTWA 5TQ2A 4C4RA 5T4EA 1N7IA 4HL6A 4UREA 4ZYWA 5IYZB 1RC0A 2P9EA 2V1UA 3CRW1 4I50F 4YYEA 1AKTA 4ZCPA 421PA 3FROA 1PK7A 1H8HA 2CXTA 8ATCA 3U9TA 5CJ2A 3RIGA 1AV6A 5AJUA 4YBRA 4AJ2A 1U5AA 3LQYA 4C6RA 2ISQA 3WP0A 4IINA 1UADA 3T61A 3P1JA 3WLOA 3VYUB 2ACKA 3I3SR 1A71A 3EISA 1GDDA 2VWQA 1C14A 3NM4A 4PSCA 4TMFA 3DOHA 3ZGOA 1VFPA 1E1CA 3ZXIA 2J4DA 3FMOB 4Y0NA 3UM9A 4BX2A 3DMNA 2L82A 1KJNA 1T34A 4IMIB 1EHYA 3KEMA 4UEWA 5D7BA 4CLXA 3V2GA 1C5KA 5FWDA 1L5OA 3CBQA 4NI5A 1Y4UA 5TGDA 3VH3A 3WSTA 5JVDF 2HXGA 3HSKA 1KBQA 4DV1B 2N42A 1Z8HA 1TM2A 2X41A 4YJDA 1G21E 1E9CA 2NIPA 3HN2A 2OB2A 4G41A 1ZA2A 3RUPA 2WHEA 3O3CA 1Z9BA 5BSVA 3A9VA 2IPLA 3C1AA 4ZMSA 1O94C 2JKZA 4IQ0A 2XA9A 4KNYA 4OI2A 5JD6A 3DWIA 1TNDA 2VQ6A 2C9MA 1U80A 3HNRA 5BP7A 2XZPA 4KIFA 4P4NA 3R9XB 2P9JA 5LWHA 1TMYA 1RZRA 4CIAA 2F1JA 4S04A 3UW3A 3LX8A 1KEEA 5BRJA 1AS2A 5LKRA 5G3YA 1A4XA 2O3SA 4Z3OA 2F59A 1U28A 2H92A 2ZQYA 1TJ5A 2VYFA 5COQA 3RKUA 3TX2A 2QR5A 3IUMA 3ND6A 2A5DA 4FMCB 5CTJA 5DX8A 4G24A 1R88A 1UKZA 2XYHA 4OY3A 4E31A 1ZIYA 3L8CA 1IONA 2NZUG 1Y1LA 4JJEA 4PBTA 1IHUA 3M6MD 4ZYXA 4DA7A 3EMVA 1G42A 1E3DA 1SBTA 3UWSA 2IHYA 3BL5A 4LJAA 4DR2B 1VP9A 5FHRA 3QEAZ 1BW9A 1HT2E 1VIMA 2FLVA 3GRAA 5KJCA 3QVLA 2CY0A 4WCFB 5DBHX 3CO5A 1J49A 4GSLA 3ZDYB 4B6QA 1DXYA 4DA0A 4XVHA 4ZVOA 1QFMA 2QN2A 1FFBA 3IEXA 4RIGA 4O3MA 2BP7B 3MUNA 3O92A 5EIBC 3VR4D 4MYDA 3PQCA 1P1FA 2B82A 1T2DA 2AS0A 3OI7A 1DBIA 2MWMA 4AY2A 1RWBA 1OZ0A 3NBUA 1QWSA 2EJCA 4EG8A 2W2VA 3R6LA 1YJBA 1MIOB 2X6QA 3THOA 3ZJUA 5CYFA 3HDVA 7AT1A 1KWKA 2Q2QA 3KZVA 2JCBA 3UUFA 4GHWA 5FTMA 1II0A 3FI0A 1H65A 4MUEA 3B1ZA 4D4HA 2JVIA 4RV5A 4X54A 4HDKA 1T5SA 1WPGA 5CJJA 4HC4A 3WLRA 4JI7B 3Q3EA 1KDYA 3VNVA 2AI1A 1Z0AA 5ICGA 2HCBA 4CCYB 1O4WA 4B6JA 4BO9A 3R7WA 4D4MA 3HG7A 4KLAA 4B2LA 1SXJC 1J42A 2NU6A 3OZFA 5KU7A 1V9CA 4ZDIA 3S27A 2HHCA 1J22A 5TMPA 5AVYA 1WA5A 2GA8A 4MP6A 2I76A 4N12A 4ZQBA 4CL0A 2GFHA 1SA0A 4YRBA 3GD7A 2OCKA 2YV3A 4EY3A 2ZITA 2QX8A 3G2PA 1AGNA 3TJZA 1K75A 2VKQA 1O08A 4R9RA 3U6BA 5IVHA 2UUAB 2PGAA 2X77A 1XYVA 5TLSA 1RXEA 3QTLA 4CQMD 4ZVMA 4D9BA 4FU0A 3H4IA 3NYQA 1XXHE 4UTPA 2OCBA 2GM3A 4LQ4A 1SXGA 1GEGA 3L1JA 3QUTA 4WJZA 5D6NA 3KQLA 4HUQA 1GZ3A 3WBKA 3UT5A 1U0BB 3IT2A 4S1OA 2G77B 2VG8A 2R6R1 2R7KA 4UJ5A 2QZPA 3E7WA 4Z0HO 2FJUA 4F12A 4H7KA 2WF6A 4YXWD 2E1RA 1DV2A 1PJ8A