3VC7A

Crystal structure of a putative oxidoreductase from sinorhizobium meliloti 1021
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
249
structure length
237
Chain Sequence
NYQGKKAIVIGGTHGMGLATVRRLVEGGAEVLLTGRNESNIARIREEFGPRVHALRSDIADLNEIAVLGAAAGQTLGAIDLLHINAGVSELEPFDQVSEASYDRQFAVNTKGAFFTVQRLTPLIREGGSIVFTSSVADEGGHPGMSVYSASKAALVSFASVLAAELLPRGIRVNSVSPGFIDTRAEFKTLGDNITPMKRNGTADEVARAVLFLAFEATFTTGAKLAVDGGLGQKLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative oxidoreductase
publication title Crystal Structure of a putative oxidoreductase protein from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
total genus 82
structure length 237
sequence length 249
chains with identical sequence B
ec nomenclature ec 1.-.-.-:
pdb deposition date 2012-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3vc7A00
3H9GA 3UICA 1WMBA 4YJFA 3GNQA 1A5ZA 1E5QA 4IIVA 3RFVA 1MLDA 1UZNA 4PZCA 1I0ZA 4JJGA 5EL0A 2PKQO 3KEOA 5AOVA 1QYWA 4BKRA 3MJ4A 3RIHA 1OBFO 2O23A 4GX5A 1UXGA 4MP3A 1HDZA 1CEQA 3OHSX 4LVCA 2R6JA 2VOJA 4DIFA 3IUPA 1ZMOA 1BVRA 4RORA 1XQ6A 3F5QA 1G1AA 3R3JA 1ONPA 2BRUA 4IDAA 1T4BA 1HSOA 1U7TA 3QSGA 1MC4A 4YVFA 3GR6A 3V2HA 3EAGA 4PG4A 3KRTA 4ND5A 4R3NA 3I83A 3JQ8A 1E77A 1ENPA 3KO8A 1E1MA 1BWSA 3RC7A 2JHGA 2OP0A 3KYDA 4BO5A 4DREA 3VZQA 2PD4A 4B3JA 3E1KA 3DMYA 4R01A 3WGIA 3G49A 3DTYA 3LYLA 3IP1A 2EGHA 4AJPA 1E6WA 2W2KA 3WQSB 1BXZA 1HZZA 1K2WA 2EIHA 3DAPA 4M86A 1NQ5A 1K3TA 3UOGA 2P9EA 3I9NA 4Z0HO 4BO9A 5THKA 2HRZA 5A04A 1LRLA 1IE3A 2QQ5A 1A27A 3F4LA 5COQA 5BNFA 4BO6A 2B4TO 1UP6A 4YTEA 1UDCA 1GEGA 3OQBA 4GX1A 1YB4A 2YZ7A 1FDWA 3GG2A 1LDMA 3WXBA 3L07A 5T5QA 1GEEA 5B4UA 4CJXA 3HZZA 1O9BA 3ONFA 1DBVO 3HHPA 1R66A 3NTRA 3COSA 4BVAA 3WGZA 1HETA 3GNTA 4E5KA 1PGNA 2H63A 2GRAA 5JC8A 3EY4A 1DJQA 2O3SA 4J2OA 3ORFA 3QIVA 1C0KA 3DBRB 4AG3A 1R15A 1TT5B 4MVJI 4ZQHA 1A4IA 4Z6KA 2GNAA 4IXTA 1PJQA 3RCBA 1YRLA 1ZSNA 2Y1FA 3DL2A 3H5RA 2JAPA 3Q1LA 2GN4A 3QVSA 4BMNA 3PJDA 1LX6A 4DC0A 4QFDA 2EP7A 3ZNOA 3FR8A 5C7LO 1QORA 2EJVA 4TKLA 1E1NA 4ZHSA 2WM3A 4Z3DA 1FDTA 3AM4A 1FF9A 2PGJA 1A7KA 2F00A 2AEMA 3IOYA 1E7YA 3QP9A 4XYEA 3F6YA 3ROPA 3V8BA 3ZGYA 2OOSA 4DUPA 4TMFA 3C3XA 2Q2WA 1UP4A 4WE3A 2IRWA 3GG9A 5CEEA 5TLSA 2WJPA 1T4DA 1DJNA 2C29D 5KNLA 4L74A 3UCXA 3AM3A 1GL3A 3C24A 1C3VA 5A1TA 3GEDA 4IS3A 5ES3A 2I65A 4LW8A 4JQCA 3SJ7A 1M66A 5G4LA 4RVFA 4JJIA 2UUOA 4PLYA 1JKFA 4NBTA 2CVQA 1YDEA 3CZMA 1A4UA 3H5AA 4Y6SA 2NQ8A 3L9XA 5ITVA 3NDIA 2HO5A 2VHZA 1FDVA 1YQXA 1T2AA 1K6XA 1U4OA 4OMUA 2VRCD 3H4VA 3QW2A 4BMVA 4M49A 2ET6A 2NTVA 2JHFA 1R16A 2LDBA 2NU6A 3MJSA 3PQEA 2P68A 1IOLA 3I9MA 1C0IA 1PJTA 4I5GA 3V1TC 1U3UA 3ZWAA 2QIOA 3JQFC 3OFSA 3DBRA 1PR3A 1ENOA 1TT5A 3KYCB 5JO9A 3L9WA 2CSUA 1E3WB 1P1KA 4MVJG 1YS4A 4G81A 2OXIA 4NU5A 5JAMA 4PRKA 1T2EA 3AUTA 3K2BA 4J90A 3DMTA 3W8FA 4BIIA 3IP3A 4YRAA 3ZNQA 4N5LA 3F1KA 2G17A 4NJOA 4PG7A 3S2GA 3V1UA 4J9VA 2XPCA 1AUPA 1YH3A 3AOEC 1BXGB 3NUGA 4CMHA 1IHYA 1U2DA 1ZK0A 2GCGA 1Q0HA 3VH3A 3KV3O 1GUYA 2ZCVA 2Q99A 3AWDA 4BNMA 4CM9D 1YB1A 2O3UA 5H83A 1BRMA 1J5PA 3CXRA 3ZW9A 4NU6A 4FFLA 2I5PO 4O1MA 2ZQZA 5JXWA 1LQUA 4FBGA 1JWBB 2HRBA 3RC9A 3IAHA 3Q2KA 2JKVA 1HDYA 3OECA 3KOUA 1DC4A 2FY8A 1NVMB 2POQX 4QFCA 1EDOA 1QLJA 4OIMA 1H9AA 3OSUA 4BNVA 1I3KA 4MP6A 5DCUA 2GLXA 2UDPA 4JXKA 4CPDA 1HF3A 3G0OA 3AW9A 5TSDA 3HADA 4J2HA 4E2ZA 1NQTA 1E7RA 2WTBA 5KIAA 4RPJA 3RI3A 1P0FA 2GR9A 2EP5A 5TGDA 4CR7A 3BAZA 3PTZA 2DAPA 4UEKA 3LU1A 1J0XO 4HUJA 1U3VA 3JD0A 1QV7A 2O3RA 2YDYA 2WD7B 2NTNA 1N7GA 2CY0A 1YOVB 4XB1A 2IYPA 3DHEA 4R54A 2X7HA 4MIEA 2X6TA 3I6IA 4HADA 5EIOA 3UXYA 4L76A 1M67A 2RIRA 2X58A 3EDMA 4RL6A 1HDRA 3RFTA 3ZWNA 1T2CA 3PIIA 4PG5A 5JO0A 3KYCA 2BF7A 5L7WA 1E3WA 1NPDA 3JQ9A 3DFZA 3INRA 1NWHA 5DOZA 1H6BA 2J5QA 4NFYA 3NRCA 2P9CA 3VTFA 1P0CA 1Z6ZA 4I1IA 2A35A 4IS2A 2OMEA 4UUMA 5C3MA 1KVRA 2FOIA 3GH3A 1ZH8A 2X86A 3I3OA 3PJGA 4FOSA 5COBA 4O5OA 4XIJA 2DBRA 5L9AA 2DLDA 2HMUA 5G4KB 1LNQA 2HMWA 1BXGA 3WBFA 4WLUA 1YKFA 1DHRA 2R2GA 3RVDA 4E3ZA 1XQ1A 1ADCA 2A92A 2PH5A 3MZ0A 4ND2A 3VZPA 1JW9B 3F47A 1ARZA 4KWHA 1PJLA 4GVXA 1C14A 4WOKA 3M1LA 3W4KA 2C5EA 4DIOA 2W8ZA 3PGJA 4XRRA 4M87A 3ANLA 4FR5A 4MVJM 1NHGA 4WLFA 3WS7A 3K5PA 4RZIA 5L95A 1FDUA 3C7DB 3RUIA 4HFRA 3O4RA 1XU9A 1R0SA 1XKQA 2C82A 2ZJ1A 3FCOA 4JBIA 1ZUD1 2BLLA 3H9EO 2ZK7A 4PG6A 1ZVMA 4RVDA 2EG9A 1H94A 1PX0A 3QWAA 5I7VA 4AJOA 4PG8A 2FP4A 4DXHA 2Q2VA 3QHAA 2D1YA 4I5FA 1LLDA 4CM9A 5B37A 1E3LA 4JJFA 4KZPA 4BNWA 4F3YA 1TXGA 3VH1A 3DZIA 3AFMA 1R6DA 4E13A 5L4NA 4ZQGA 4OQZA 3JD1A 3JD3A 1QR6A 1IULA 2WD7A 3AK4A 3GF4A 4U0JA 4KDFA 1YOVA 5F1KA 2FSSA 2OFPA 1EBFA 1WDKA 3E18A 4Q3EA 4Y8VA 5JBIA 1IPFA 1A71A 4A2CA 1B14A 5F5NA 4U8GA 4L9RA 1QRRA 3ZU4A 3LC1O 3WNVA 5AXBA 1KVTA 1KY5A 3LF1A 4AICA 2I66A 4HNHA 1U8FO 1JLLA 1Q0QA 4PLHA 2XAAA 2YDXA 1ENZA 1N7HA 3GVIA 5COAA 2O7QA 3Q3CA 4DVJA 4O63O 4JLWA 4GMGA 5G4KA 5KTKA 2X5KO 1JA9A 1TA4A 4HFJA 3QE3A 4L4XA 1B2LA 1HXHA 1TEHA 5IG2A 3PK0A 4J49A 1B7GO 4QQRA 1F8GA 4Y6RA 2BFPA 2PKRA 1TVEA 3JYPA 1DIHA 1WAMA 1HE5A 4PN3A 4RVHA 1ZEJA 4IDCA 3IL2A 1SBYA 3B20A 2DTEA 4Y9DA 2DBVO 4D0SA 2IZ1A 4PIVA 3HWRA 1D3AA 1AXGA 2UYYA 2VHVA 1IB6A 3VPFA 3KXDA 2G1UA 1P1JA 3IJRA 4WK6A 1KOLA 4ZN6A 1X7HA 1YJ8A 4LRTB 5I7FA 1I10A 3AI1A 2TMGA 3TOZA 4Q3DA 4G5HA 1EQUA 2E49A 3M2TA 3MWEB 3ONDA 4W82A 1GR0A 3EW7A 2CFCA 1N1EA 1ID1A 2ZYDA 3WGQA 5IDWA 2Y0CA 1DIRA 3WOHA 2JD1A 1PJ3A 2O3QA 4FGSA 4EI2A 5DP1A 2FSVA 1WZEA 2HAEA 3HDQA 2GO1A 1PEDA 3GPIA 1E3IA 4GQAA 4NFSA 3U4IA 4Q9NA 2B35A 3M6IA 2VQ3A 3L6DA 3OETA 5HRUA 4PLPA 3B70A 3AU9A 1D1TA 5JYEA 3P5SA 3F5SA 3L6OO 2QRLA 1Z74A 2X23A 3K73O 3GRKA 4UVDA 3OJEA 1M75A 3D5TA 2TMDA 2FRDA 3KSDO 3KTDA 2HMVA 4EYEA 1M6HA 2PA3A 3EK2A 3RJ9A 3RSHA 4YRDA 1XR3A 3QA9A 1P1FA 1QYXA 1GZ4A 4J1TA 2J6IA 4FJ1A 2GZ2A 3BXXA 3GGPA 4ZRNA 5BNTA 3NGLA 3O38A 3WGGA 1HL3A 4G65A 4LSWA 5JAZA 4CUJA 3DHYA 3BTUA 1TB4A 1X0VA 3GZ4A 2I3AA 3S2FA 3FRJA 4AJIA 5HS6A 3AUSA 3WFIA 1PJ2A 2JCYA 3MTGA 4AJ2A 1L1FA 1P1IA 1LSSA 2RAFA 4OJNA 1E3SA 3LDHA 2JJYA 4M55A 4MKXA 1BXKA 4XGIA 5GY7A 1XELA 3VKUA 1C1XB 1T1RA 2DUWA 3QVTA 4CV1A 2O50A 4E2YA 3BZUA 4JROA 4OYRA 4S3MA 5EQFA 5G0UA 4EDFA 1B0AA 2EGGA 1QXSA 1ZFNA 2O2YA 4EZBA 4LVUA 3DONA 4C7JA 3HSKA 1IZ9A 1F8FA 1U9JA 4D79A 5BR7A 3OJ0A 1PU2A 1DOHA 1PSDA 1X0XA 3CZRA 4XEHA 4J7XA 2VWGA 3WWYA 3F3SA 3JQBA 1GTMA 3O03A 3D3EA 1EBUA 3RD5A 1BW9B 5K9ZA 3V2GA 3RJ5A 2AXQA 3RC2A 3C7CB 3IKVA 1EE9A 2GSDA 1I3NA 3NT5A 1V0JA 4OKNA 1X14A 4M89A 5FI3A 3ABIA 3SLKA 2SCUA 3UFXA 2X0NA 4BNFA 4D46A 3W8DA 4CMIB 4WLEA 4BQPA 4NJMB 4J4TA 1YWGO 5EERA 2AEFA 2VZ9A 5C37A 2ZTLA 3DZJA 4R9RA 2X9GA 4KTTE 3WSWA 3DMTC 2Y66A 2YFQA 3E9MA 1AXEA 4NNJA 3F4BA 1HLDA 2EERA 1VJ0A 3U09A 4HNGA 1I33A 1YL5A 1NR7A 2IDZA 5DCYA 5HS4A 2DTDA 3LK7A 4WNCA 1BHSA 4ND4A 4U6QA 5GZ6A 3ZCXA 4A7PA 2CVOA 4IDDA 4YQYA 3BMCB 3ZU2A 3HFSA 4LCEA 2C59A 1WXDA 2A4KA 4CR6A 1GYQA 4BGEA 1E7QA 1VRWA 3G3EA 5ICMA 1CJCA 2Y93A 1LDGA 2BELA 4HP8A 3PQFA 1C1XA 1V3UA 2CDAA 2ZB7A 4B3HA 3WX0A 1ZIDA 1XCBA 2Z1NA 1DO8A 3QLJA 2YHUA 4IDEA 4D43A 1JN0A 2YHIB 3MJCA 4ZQBA 3K8ZA 4XR4A 4BO3A 3H2SA 1UP7A 3KSUA 1NP3A 2DFVA 2XXBA 1PS9A 2Y67A 4F45A 3E9QA 2AW5A 3S2EA 1BW9A 4YAEA 4BOYA 5C7IO 4JBHA 1QP8A 1VC2A 3KVOA 4D45A 1XYGA 2DPGA 4U6SA 4LCJA 2PLAA 1KC1A 4R1UA 4CMIA 1K5HA 3I52A 3JQ9C 3TJRA 4NJMA 2Q2QA 3RUEA 2B5WA 4FSHA 3SJUA 3MJVA 2LDXA 5EQDA 1J4AA 1U5CA 4U0KA 1E7SA 2I3GA 1I01A 5T8KC 4WCFB 3QVXA 2P2SA 4XB2A 3I4CA 1RYDA 2JFFA 3EUWA 3PJFA 1VL6A 4W9NA 4WKGA 5DBGA 1A9ZA 3ZNNA 1VJTA 1DB3A 1PQWA 4FD3A 4PVCA 4YWJA 1H2BA 4J7UA 5G0SA 3H2ZA 2QW8A 4PZDA 2GZ3A 4KWIA 2Y99A 2ZYGA 4NHEA 3BMCA 1ISIA 1LRKA 4GSKA 1HLPA 3ZV3A 1E92A 1ZNQO 4GLLA 1Q1NA 2Z5LA 4KUGA 3EVTA 3GHYA 3SX2A 4YT4A 1HYHA 3KUXA 3GN2A 4ZVVA 1R4NB 2X0IA 3GN1A 4RF2A 4XD2A 5CP8A 4CMJA 1PS8A 3CKYA 5LC1A 4DBZA 5FI5A 2FR1A 4BL5A 3CIFA 4FOOA 2BMAA 3BYZA 1NHWA 3ICCA 1SB8A 1JAXA 3MCVA 4CLRB 3K96A 1VL8A 2Y05A 5CFZA 2HSDA 4U5QA 3JYLA 4CQMD 2X4GA 4Q3CA 4RPLA 4I9NA 4F46A 2YHIA 4GX2A 1DLJA 5GZ3A 2QZZA 3D1LA 3X2FA 4DPMA 3I6QA 3RWBA 4QEDA 2PNFA 3Q9NA 1DHTA 1H6DA 1HTBA 4E2XA 2VCYA 4EGFA 3Q2IA 2Q1UA 2G5CA 3WJAA 1U5AA 3GK3A 4HFNA 4HFMA 1DIGA 2GD1O 2WYUA 3A1NA 1EEHA 4B7CA 1SZJG 4IBOA 4WUVA 4RLSA 2OBNA 4ZRMA 3DZFA 2NU9A 3WTCA 4FB5A 2F1KA 2JAHA 4ALKA 4CQMB 4YT8A 1P45A 3DDNA 4TRMA 1DAPA 4MVJF 2HU2A 3PEFA 4NK5A 3FI9A 5DZSA 4CUZA 4HKTA 1YONA 3FR7A 4J91A 1YXMA 3ZV6A 3L77A 4XGKA 2NADA 1Z7BA 2BFAA 3OF2A 4WCFA 1HE2A 3PYXA 5F1OA 3ASUA 4NQZA 1AHHA 2WDZA 2GN8A 4MDHA 1V6AA 1AGNA 4ZQEA 1CQIA 4E0BA 2VYVD 3IQDB 1SAYA 4RDHA 4ID9A 4IXWA 3ICPA 4KP7A 3K92A 1LLUA 3HN2A 1D7OA 3ETEA 3K30A 4YXFA 3DBHB 3H5NA 4FCCA 3FD8A 1NXQA 4WJZA 4J0EA 1HDOA 1OC2A 2P9GA 2EHDA 3AM5A 3ANMA 4LSMA 4DPLA 5TJ9A 3ZWYA 1NAHA 4OAQA 4IJUA 3ZHXA 2O3JA 1R4NA 2PD6A 2Q4BA 4XQEA 2BFOA 4R9SA 5JAQA 4RQUA 2XOXA 2C2YA 4MVJD 4OM8A 2QYTA 4CLRA 1UXKA 4URFA 4A10A 2J3IA 5G0WA 4YAGA 3KBOA 3S55A 3EVNA 3NDRA 1DEHA 8ADHA 1DFIA 2Y1CA 5JAIA 3IIEA 1LC0A 1DRVA 3K9QO 3FF4A 4Q39A 4ESOA 4YJGB 5DCWA 1HE4A 1GDHA 1S6YA 3G1UA 1E1KA 3UCFA 3H9QA 4TSKA 1BSVA 3F1LA 2FZEA 1JVSA 2Z95A 4YAJA 4YR9A 4DLBA 4BKOA 4J4HA 4B3IA 3JQCA 1DIAA 1PJBA 4MPDA 3R3SA 2YJZA 3TWOA 4FIZA 9LDBA 4RQTA 3NJ4A 2XF8A 4MP8A 5B4VA 4ALJA 1O8CA 4XQCA 4CQMA 2FPIA 3G79A 5DOVA 1WLYA 1P3DA 2CNBA 1I36A 2ZTVA 1DPGA 3IMFA 1YGYA 3ZU5A 3I9OA 3V2UA 4FW8A 1FK8A 4LMRA 4GMFA 4LRSB 4ALIA 1ISMA 3OIDA 4J7CA 1B3RA 1LUAA 4MINA 2AQIA 2ZTMA 4ND1A 4AJ4A 3VVBA 4UUPA 5JE8A 3BTVA 3GUCA 3GOHA 4NBUA 1WNTA 1SB9A 1MXHA 3SBOA 2NVUB 2GF2A 4O6VA 3FWZA 3CINA 4ZGWA 3C85A 4W99A 4GVLA 2V6GA 3DBHA 4YT5A 3WQRA 2E6UX 4L75A 4WNIA 5K6AA 1ZEMA 4BMSA 4XA8A 2E37A 1UXIA 5FWNA 1R0KA 3MJTA 5DBFA 3M2PA 1RPNA 3STHA 1O5IA 1RM0A 5JDIA 1B15A 3U4DA 4AJHA 3N74A 4IQ0A 3NT4A 1VKNA 3HDJA 2YW9A 1EVJA 4K6FA 2NV6A 5ADHA 4PLFA 1QMGA 3TZ6A 4BO2A 5IDXA 1XWFA 1SOWA 1UZLA 2Q3EA 1LQTA 2VRBA 4P4NA 4DC1A 1QYVA 5TIIA 3ASVA 1KVUA 4P4GA 1NTOA 4YJGA 4GLOA 4H7PA 1PL7A 4B8ZA 1U8XX 3AI3A 3AU8A 5JCXA 3HE3A 3JQBC 5MGBA 1EZ4A 3TOXA 4S1VA 1K89A 3IKTA 3NT2A 1I2BA 3GVPA 2OORA 3DZKA 2CDCA 2Y1EA 3NAQA 4XYBA 3VZRA 1B26A 5JNLA 4ROSA 4MVJA 5CG2A 1PZHA 2EEZA 4PLZA 4R1TA 1Y9AA 2G82A 3ZHBA 4EEXA 4HWKA 1O95A 3TZKA 3E48A 4J9UE 5T6BA 3B1FA 3ZV4A 4CM6A 4J0FA 5L51A 1Z82A 1E0DA 1SCUA 4M8SA 4E30A 3FBGA 2Y1GA 3FTNA 4R3WA 2D5AA 3H3FA 4QSMA 5U9CA 1R0LA 2HK8A 3PRJA 4AJLA 3QV1A 4OSOA 4W7IA 4B4UA 4L73A 3JV7A 1UAYA 2J3HA 3LZ6A 1RJWA 2ZKLA 4WGGA 1LU9A 2HUNA 2AE1A 3CE6A 3NDJA 1RKXA 3CUKA 1NFRA 3JD4A 5ILGA 3WLFA 2NVUA 3LSYA 4BUCA 4MKRA 4YCAA 4FFPA 1ZK3A 4YEDA 3QWIA 5EMHA 1DAOA 4RGBA 3PVZA 3UGKA 1YQGA 1JU9A 3UH1A 1XLTA 1ISFA 3PZRA 4CQLB 3V5NA 3D0OA 4L8VA 4AL4A 1ZCJA 3EGOA 2YV1A 5A05A 3PHLA 1LLQA 3GDFA 1LBEA 4CL8A 4RPKA 2RH4A 1AN9A 5A5EA 2ZATA 1DC3A 2RHRA 1T25A 4FJ2A 4CM8B 2GASA 4INAA 4DLLA 2QZ9A 5I9MA 3TRIA 1ULSA 1GCOA 5KVCA 1VLLA 4GI2A 2H5LA 1D1SA 3PDJA 4TQGA 1MA0A 5F1PA 3WICA 1K0UA 1WMAA 3QWFA 2X9VA 5A9SB 2J3JA 2C2XA 3RU7A 4PFJA 4JGBA 5JLAA 5JCJD 1XU7A 4W4TA 3WIEA 3QJ5A 3D3WB 1F06A 2VRCA 2B5VA 2WSBA 4E4YA 3Q9UA 5KVSA 3GZNB 4TZKA 4I9UA 5KKAA 1I32A 3ANNA 3R0IA 3K31A 5JFOA 4TVOA 4OQYA 1NWCA 5IF3A 4UVEA 1H93A 4BGVA 4P38A 1W4ZA 4E5MA 1IHXA 1P1HA 3QRWA 3OEWA 4W9NC 1UR5A 2I6TA 3VHRA 1ZSYA 3WSVA 2C54A 3UUWA 2VTDA 2GN9A 3QVOA 3CSDA 4Z0TA 4D0RA 3VC7A 4F6CA 1PGOA 1Z7EA 1H6CA 2Y1OA 4IMRA 5FEUA 3P2YA 5KJ1A 5EESA 1NVTA 4N7RA 4ZQFA 3GT0A 1PR9A 4CQLA 3PDUA 5JDCC 1UZMA 3HB4X 1GQYA 4BKPA 2WYVA 5TJHA 4PVDA 1NR1A 3FSRA 5AXDA 3ZZNA 5U4QA 2X5JO 1EE2A 1HDXA 1M2WA 2NVBA 2Q1TA 1EK6A 4Q3AA 4JIGA 1UDBA 3F9IA 2D3TA 2UV8A 4PLWA 5TF4A 2D4AA 4KUHA 2V6MA 4BKUA 1B8VA 4CM8A 3U0BA 1Y6JA 5ITWA 1KYQA 4PCVA 1LSUA 1YB5A 3DFUA 4CMAA 4R16A 4B4OA 4D44A 2OHXA 4II3A 2FN7A 4CM4B 5JYDA 4OXYA 3A14A 4KQXA 2YV3A 4LGVA 2YQ5A 4YRBA 1JAYA 3TZHA 4XR9A 5A9SA 4FC7A 1I24A 4O0LA 1YE3A 3WBBA 5DULA 2DBZA 2B4RO 1ORRA 1ZKMA 1JWAB 1BG6A 3D3WA 5L4LA 1CERA 4WASA 3DZHA 3GHHA 4DTIA 2OP1A 3CMMA 3GZNA 2ZCUA 1GZ6A 3PYLA 3T7EA 5L3ZA 1GU7A 1HYGA 2B36A 2JFHA 2RH8A 2J5KA 2WE7A 3DOJA 4B4VA 1UXJA 4B79A 4DWVA 3GVCA 3AJRA 1T1SA 3WGHA 5IN4A 2XXJA 2EKPA 1GYPA 2O4CA 2B69A 4CV0A 3C7AA 3OIFA 4WCFC 3UF0A 4YT2A 2OBYA 2CMDA 2V6BA 1HEUA 4XYGA 1XSEA 3U4HA 5JMWA 2IEBA 1ADBA 1ZJYA 5JCJA 2GN6A 2I67A 3RBZA 1LDEA 4YACA 4FN4A 4CM3A 4CR8A 1Q7CA 4LISA 3ZWOA 3KEQA 4B7XA 3U9LA 1GCUA 3GGOA 3E9NA 2O4UX 3RUFA 1D8AA 3I9LA 3DAFA 4WEOA 2PY6A 1WW8A 2BHLA 1I8TA 4FFMA 1EFKA 5F21A 1YJQA 3ENKA 1H5QA 3DQPA 1OAAA 2AE2A 4YJDA 1GYRA 4XQ9A 5T64A 1ZBQA 1Q2XA 4YQZA 4EJ6A 4EUFA 1GUZA 4UEOA 1ULUA 3E5MA 2EJWA 4MIYA 3A9WA 3SXPA 4RF3A 3PHIA 1KEWA 2IXAA 4BV8A 4C4OA 5B4TA 4AVYA 1HDGO 3LT1A 3IJPA 2IODA 4BS9A 3C1TA 1Q7GA 4D42A 4RJTA 4CLOB 4JP2A 5I8WA 2NU8A 4IY1A 4UVIA 3JQGB 1B3BA 5IXYA 2WYWA 3HN7A 3UAGA 1GV1A 4UULA 4M54A 4CMEA 4DBVO 1UH5A 4R4JA 3D4PA 4CM4A 2PK3A 2D2IA 1GPDG 2GZ1A 1B16A 4BNZA 4ALLA 4NR0A 1WP4A 3VPSA 2VWQA 1NBOA 2GYYA 3IC5A 9LDTA 4A5OA 4L0QA 3WTBA 4CMKA 2WMDA 5A3VA 4BNKA 3F46A 3TFOA 5L53A 1PL6A 1MB4A 3GEMA 4G2NA 3H9UA 3FNGA 1LSJA 4Z9FA 5A02A 3INTA 4N54A 1U3TA 3NEPX 3PQDA 4UVHA 3BA1A 4BO4A 4CMCA 5T57A 1LTHR 5CDYA 3VPGA 1Y8RB 5EPOA 2VHWA 5AXAA 3AI2A 4GKBA 1ZXLA 3GVHA 4Z3KA 2Y0EA 4E21A 4A03A 5G0TA 2BI7A 5KJFA 2BGMA 3PGXA 4D3SA 1CIVA 4IM7A 1LDYA 1EUZA 5DBIA 5H82A 3E5RA 1PL8A 3L6EA 3P7MA 3ADOA 3ZH2A 3KYBA 3U49A 2VHYA 3QVWA 5K6AC 5CEJA 1SOVA 3WB9A 4CMGA 4CUKA 4E6PA 4CM1A 4YAKA 4NMHA 2VUTA 5A03A 1Q0LA 1YBAA 3OM9A 1HRDA 3GA0A 4NK4A 4OO3A 5GMOA 4K26A 2W2LD 4EUHA 3UW3A 2DQ4A 1T2DA 5JDIC 1EQ2A 4QX6A 4CV3A 1EVYA 1VM6A 7MDHA 1E7MA 4BQRA 1WPQA 2OZPA 3GEGA 2QX7A 3FHLA 4CLHA 4CLOA 4I5EA 3PYMA 4RCVA 1R4MB 3RC1A 3JQGA 1QLHA 3GDOA 1EK5A 2B83A 1XDWA 2ZB8A 4GH5A 5TRTA 5HWSA 1U2GA 2AG5A 4UUNA 3JQ7B 4CM7A 5LCXA 3ZNPA 5ENDA 4RF4A 5TNXA 2ZTUA 2Q49A 3VPHA 3RUHA 1GQ2A 1KEUA 1E6UA 2X0JA 4GPD1 3D4OA 3QWBA 2I99A 4WLOA 3VH2A 1N2SA 1T26A 4E31A 1MXFA 3OQ1A 4R41A 3KM0A 1LC3A 1CF2O 1T24A 5JMPA 3RBVA 5BQFA 5A4DA 3H8VA 3JTMA 1KIFA 4K9DA 3MEQA 5DNAA 3RASA 3RROA 4BNJA 1PWXA 3LT2A 2H9IA 3M1AA 4QO8A 3GLQA 5LDGA 4A73A 1PGPA 4GWGA 3DXFA 1Y8RA 3DR3A 2O7SA 5CDGA 4R68A 1HWYA 3A4VA 2W4QA 3GFGA 2VYND 4XRGA 3E82A 1HT0A 1IL0A 3FNHA 3A06A 1DLIA 2PZMA 4IDGA 3WLEA 3I23A 1EVZA 3C1AA 4TRRA 3ZW8A 3DHNA 3HB5X 1QG6A 3S1LA 2CUKA 4E5YA 1GPJA 3FBTA 1C1DB 1SC6A 2BD0A 1VKOA 4ITUA 4BGIA 5C5IA 2VTEA 3ZWMA 3OJOA 5IDQA 1MFPA 2JD2A 3WIDA 4YB8A 2QYSA 1JKJA 4YPOA 4OXNA 1W73A 3DAGA 3TL2A 4OGWA 4IZIA 3D4NA 1XA0A 3I9JA 4YBZA 3RUDA 4RPGA 3MTJA 1HDCA 4GBJA 1R4MA 2P4QA 1VE9A 5TT0A 3PJEA 1R37A 4OL9A 4ZICA 3UHAA 1CQJA 3JQ7A 3G17A 3BTSA 4J16A 2YFHA 2EV9A 1GY8A 2X0RA 2AMFA 1L7EA 3HFGA 5TS3A 3W6ZA 2DM6A 3OA2A 4XYMA 1X15A 2OO5A 3IUSA 1A9YA 1CDOA 2W2LA 3RFXA 4D7AA 3Q11A 2CVZA 1RYEA 1ZJZA 1DSSG 2C7VA 1P74A 4FC6A 1BGVA 4DGSA 1H2HA 3R1IA 1OC4A 4O59O 3NX4A 2Y1DA 4K1LA 5G0VA 5BSEA 4XKJA 2QG4A 4HBGA 4RVSA 1NX6A 2I9PA 2NLOA 2NVWA 3VH4A 1PTJA 5THQA 3FN4A 4J1SA 3K6JA 4A26A 1YDWA 4DQUA 3PZBA 1P1RA 3UN1A 4YAIA 4DRYA 4HV4A 1ZSVA 1H0KA 1ONNA 1YBMA 3HDYA 3UCEA 4E2WA 2Z1MA 5KJ6A 2E82A 4NFHA 3WNQA 5AXCA 5FF9A 3GNSA 1DRUA 4ZJUA 3AY3A 3BHJA 1C1DA 3RUAA 1O94A 3GRPA 3HG7A 5ENVA 1VI2A 5BT9A 1B8PA 3O9ZA 2C20A 1MG0A 1SEVA 1NFFA 4IMPA 2W90A 4L4SA 2VYNA 3O8QB 2NACA 4WCDA 3JSAA 2ZB3A 3PFFA 4W7HA 1Y81A 2DVMA 3BHMA 2DPHA 4BNGA 3JQEA 5L45A 2BFMA 3NYWA 1A7AA 2FR0A 4PLTA 1ISHA 1X1EA 4OH1A 5BNIA 2OL4A 1G0NA 4IJWA 4RV9A 4C7KA 1E1LA 1U1IA 3DBLB 1DC5A 3ULKA 4TROA 2VWHA 1CWUA 3EZLA 5CEFA 4ZA2A 4JN6B 4ILKA 1ADFA 2PV7A 2YV2A 2DFDA 1P33A 2DC1A 4GKVA 3TNLA 3WWZA 2IZZA 2PTGA 5HBRA 3N7UA 1NASA 1DC6A 3D5QA 3I9KA 3RUCA 4WOJA 4XGNA 1C0PA 5CAEA 4WPGA 3KZVA 1VSUA 4BB6A 4JBGA 4GAEA 1G0OA 5L7TA 5I8ZA 5AQ1A 3L4BA 2HQ1A 5A06A 4XDZA 2AEJA 1ISJA 1XEAA 3PPIA 1E6EA 3S2IA 2VN8A 5GZ1A 3SC4A 3JQ6A 1Y1PA 3NKLA 2DU8A 1DDOA 3GAFA 4PRLA 3EMKA 1P31A 2EWMA 2PH3A 2X22A 3GY0A 3FPCA 4IIUA 4BB5A 2E48A 4HY3A 4LMPA 3PLRA 1ZXBA 3BMNB 1PGJA 1O6ZA 1NM5A 1Z75A 2Q50A 2FR8A 3LC7O 4ONEA 2VHXA 4BNTA 3O8QA 5JS6A 2FWMX 1HYEA 2YY7A 5CPBA 2CF6A 3T4EA 5I7EA 3ITKA 2PGDA 4FQ8A 4J43A 1BMDA 1Y7TA 3LF2A 4CMEC 2EW8A 2BGLA 5CDTA 5DF1A 4OSPA 3DWFA 3TSCA 5A5FA 2FPGA 2VOEA 4A27A 1YQDA 3DBLA 3VKVA 4KOAA 1QSGA 4L4RA 3CMCO 1C0LA 2OUIA 4N18A 4BV9A 3ROKA 5L7YA 4GWKA 2BGKA 4WECA 3QWHA 2B4QA 4JCOA 6LDHA 1EUCA 2BH9A 1E3JA 3QY9A 1I30A 1KC3A 4GL4A 3D64A 4DL9A 4UAGA 2HK9A 1NPYA 3PI7A 2X5OA 4YA6A 3NTQA 4XCVA 6ADHA 3LC2O 1BDBA 4MIOA 4FGWA 4CV2A 5KJEA 4IDBA 1JVBA 4E5PA 4NDNE 2CZCA 4GX0A 4CMBA 1KBZA 2HMSA 1IPEA 4J1QA 2PR2A 4MOWA 4QECA 3WG9A 3GFBA 3QQPA 4BNXA 1QYDA 4Z9YA 2VZ0A 3GPDG 5EN4A 5IZCA 3LT0A 3MWDB 1U3WA 1GV0A 3BMNA 2VYVA 1CYDA 1KS9A 1MGOA 4QXMA 3JYNA 1Z45A 2WD8A 1ZK1A 2DUUA 4BNIA 4BNUA 5BSGA 4J3FA 5AYVA 3WGOA 3I5MA 4IQ8A 4NZ9A 4Y98A 2HLPA 3Q6IA 5JPIA 4CL3A 1W0CA 3JD2A 1VL0A 4P4LA 4DPKA 5ER6A 4FDAA 1Y5RA 3GQVA 2Q1WA 4RO0A 5B1YA 5MDHA 4AJKA 3L0DA 3ZWCA 2X8LA 4QTZA 2AA3A 2JCXA 3ENNA 2HJSA 3ZWBA 5J23A 3RU9A 4QT0A 3LLSA 1NVGA 4YJHB 5L4SA 2FMUA 2C7GA 1Z73A 3OP4A 5I9NA 4WLVA 2VNAA 3JCZA 2FPPA 4OXKA 1Q7BA 4U7WA 1F12A 1PJCA 2ZJ0A 5A9TA 4GGPA 1XHLA 2YQ4A 1X13A 4B7UA 3CTMA 3GUYA 3PXXA 1W6UA 2PFGA 3H9JA 3W8EA 3VZSA 3PHJA 3TL3A 4DMMA 1YBVA 2NM0A 3OJLA 5ICSA 1BDMA 3WYCA 3DC2A 1P44A 2J8ZA 1SO8A 2NU7A 4I5DA 3ONEA 3D7LA 3A28A 2HCTA 3SEFA 5JY6A 1SNYA 3I1JA 5CHEA 5ILOA 2CF5A 2B0JA 5JY1A 1N92A 2HMTA 3SLGA 4HX5A 3PHHA 4PLVA 5IFLA 2RCYA 3PWKA 2G76A 4NH4A 1TLTA 1PJSA 2QRJA 2UUPA 3ON5A 4TRJA 1P77A 5CPFA 1OMOA 3WMXA 4EEZA 2HJRA 5TT1A 2VUSA 3GMDA 3U62A 1R12A 5CDUA 3B1KA 3FNEA 1NQAO 3E6AA 3LLVA 4GGOA 1ZW1A 2WE8A 2Y0DA 4K6CA 5H81A 4Y67A 4EBFA 2GUGA 3WR5A 2J3KA 1B8UA 2AQHA 3WYBA 3ZI0A 1K6JA 2O2SA 3PWSA 3W4IA 2RHCA 3ZU3A 1SEPA 1PS0A 4CM5A 1I3LA 1QV6A 4X54A 4EJ0A 4JP3A 4TZTA 5BSHA 2ZYAA 3KB6A 3IS3A 4YJHA 2QHXA 3OQ6A 4J4BA 2H6EA 4MO2A 4NBVA 2AQKA 5TX7A 2YUTA 2P5YA 2C5AA 3WYEA 1KERA 1I2CA 1ISGA 3VDQA 1H9BA 4BO0A 3WDSA 1OZAA 1YL6A 3DOCA 4ALNA 4BO7A 4AJNA 2R00A 5DDIP 3UKOA 1IUKA 4RLHA 3JQAD 2W98A 1AHIA 3MOIA 3SC6A 2EKLA 2JFGA 3VPXA 4DYDA 4CLEA 5T8KA 1EFLA 1RM5A 3C8MA 2ZB4A 3GDGA 3TZCA 1MFZA 1U28A 3ZN2A 2UAGA 1ZK2A 1E3EA 1ENYA 1BVUA 1N1GA 2D0IA 2NNLD 3BMOB 1YL7A 1OFGA 2C0CA 4IINA 3ST7A 2IE0A 4BKQA 5DT9A 4DMLA 3DOOA 3JYQA 2GGSA 4Z0PA 1X1TA 1GAEO 2PKQP 1ZZEA 4FPXA 1GZ3A 2Y68A 5C7OO 4BNLA 1NAIA 3JQAB 3LQFA 4IPTA 4Q3BA 1PZEA 3H65A 2JD0A 1RWBA 3W4JA 4QUKA 4BHTA 2Q1SA 5A9RA 4TWRA 3RQSA 5KWEA 1NQOA 3K2EA 4UVGA 2P4HX 4IDFA 2E4AA 5IN5A 3HUDA 3I4FA 5HM8A 4XZ3A 1KY4A 2A9FA 3DEYX 4AJ1A 4MKZA 3AUUA 4IQGA 1IY8A 2V6FA 3SVTA 1UDAA 1J49A 3H6KA 2JL1A 4R5HA 3ADPA 3AFNA 8LDHA 1FJHA 3HNPA 3TQHA 2YYYA 3ZWWA 3HJAA 4WLNA 1D4FA 4XWYA 1E7WA 1P9LA 2NSDA 5U1PA 1F14A 4II2A 3RKUA 3KHUA 3TPCA 4XYLA 1I5RA 2EXXA 3FWNA 3ETGA 5KVVA 1DFHA 1ZK4A 1PQUA 3TN7A 5KVQA 5AVOA 5IAAA 5I7SA 5JSFA 1CETA 3DO5A 2VNSA 4N5MA 4XIYA 3VDRA 3WQQA 4FS3A 1E5LA 1K6IA 2FZWA 3JQDA 4UEJA 3LT4A 4OOEA 1LA2A 3FPLA 4IZHA 4Y6PA 3L4BC 4N5NA 5B12A 4R1NA 1ONOA 4DLAA 2DT5A 1CRWG 2IZ0A 5TC4A 3E03A 1FXSA 1O0SA 1N9GB 1PZFA 1LJ8A 3BTOA 4PZEA 4ZU3A 4I08A 5K0ZA 3BMOA 4KUEA 3ETDA 3CH6A 2PZKA 3L4SO 4JNKA 1VSVA 4BNYA 4EW6A 4IGEA 2DKNA 1LDBA 1TI7A 2IEDA 4RVGA 3ZWPA 2RBEA 3TDKA 3JQAA 1IZ0A 1OOEA 2NUAA 4I8XA 1GUFA 1I2ZA 2CDBA 2D5CA 4RDIA 3GVXA 5T67A 3DZBA 1JTVA 4BNNA 3UVEA 4CLDA 1WZIA 4EUEA 1XGKA 1LRJA 3NGXA 3X2EA 4W6ZA 4J1NA 4PGFA 3ZHYA 4A0SA 1MP0A 1T2FA 4IJVA 1ML3A 4M1QA 5FFFA 3G1TA 3U4CA 5IJZA 4B4WA 2NWQA 2Q46A 3KLPX 5DP2A 5KKCA 3PIDA 4LK3A 3EYWA 3TF5A 1SMKA 5BSFA 2BKAA 3CEAA 3VVCA 3ZHZA 1X7DA 4ZD6A 5LDHA 3P19A 3VTZA 2G0TA 1EUDA 4P22A 2HDHA 3GGGA 3WFJA 4RZHA 2IYOA 5IZ4A 4TVBA 2C07A 3ZWVA 4FFRA 3BMQB 3OJFA 3T4XA 5HA5A 4RVUA 1MUUA 3RKRA 1F0YA 1WWKA 3DBVO 4AJEA 1RM3A 3KETA 1MG5A 2P91A 1N5DA 1RM4A 2ZQYA 4KDEA 3O26A 1HE3A 1FDSA 2DBQA 1KVSA 1DRWA 5F3RA 2VT3A 4R69A 1LDNA 1PQPA 3BHIA 2DTXA 5IXSA 4H15A 2JCVA 4BGUA 2HK7A 2NQTA 3S8MA 4BO8A 4DQXA 1GQQA 4AFNA 3WMWA 1DXYA 3MJEA 1N9GA 4K28A 4B8WA 3C1OA 3WGYA 1GFSA 5IZCC 2V65A 3B6ZA 1UJMA 1V9LA 3W1VA 5I9LA 4BO1A 4E32A 4OKIA 1O89A 1BTOA 1EVIA 5ER9A 1UXHA 3H7AA 3LVFO 5KOIA 4H16A 1DFGA 1JQBA 4PLGA 3NV9A 3OICA 1Y8QB 5F5LA 1ZO8A 5CDSA 4R1SA 5A3JA 1QKIA 1IYZA 1Y9EA 1XIVA 1HSZA 3AY7A 1HKUA 5EJ2A 2VT2A 4JX8A 1PJ4A 3GAZA 2D8AA 1X7GA 2V7PA 1MC5A 2CD9A 3FTPA 1UUFA 4RF5A 1JKIA 1V8BA 1FMCA 2UVDA 4NBWA 2Q45A 3N58A 5DN9A 3DZGA 1GADO 1M76A 1H6AA 3PP8A 2PWZA 4NI5A 1EMDA 3NJ8A 1I3MA 1PIWA 3OBBA 4J6FA 4ND3A 5KCZA 3EC7A 3ROMA 1JDJA 3JQFA 4KMSA 1LSOA 4EJMA 1YVEI 2OGUA 3RAJA 2ILTA 4DIBA 1U4SA 3Q0EA 2BI8A 2O3TA 4NIMA 5G2OA 1AE1A 3ZWXA 2O48X 4XX0A 3OEYA 1WVGA 2EKQA 1V35A 1DIBA 2EW2A 2D59A 3BMQA 4XQGA 2WEKA 2J5RA 3KSZO 2NTJA 3DB2A 4H3VA 3PHGA 2PGLA 4GSLA 2IXBA 4PLCA 2I76A 1LLCA 1MV8A 2QRKA 1NYTA 5EINA 4CODB 3JYOA 3AOEA 1EDZA 3WJ7A 4D3FA 3OA0A 3T7CA 2EF1A 3PWZA 4Q3NA 1N8KA 4E12A 5JC1A 2PZJA 3TZQA 3KLMX 3DTTA 1ZMTA 1U7HA 4FJ0A 3WGTA 2P5UA 3U3XA 2GDZA 5L40A 3E8XA 2AQ8A 4OOFA 4XDYA 5TQVA 2PD3A 3W6UA 1HZJA 3HQ4O 4YDRA 1OI7A 1WDMA 4NG5A 1F17A 4HXYA 3VAZA 1NFQA 5KJCA 1Y5MA 1YO6A 4XJTA 4F6LA 3OIGA 1PZGA 4I9HA 1Y8QA 4D3DA 1SPXA 2Q4EA 1KEVA 2AHRA 3OMLA 3PFWO 3GMSA 1MX3A 2GPTA 2ZIZA 2AG8A 2X1HA 4FFOA 4MJLA 4OHUA 4R51A 4R5MA 1S7CA 4ALMA 1UAGA 4UUOA 3U5TA 4BNHA 1VJ1A 4YJFB 1V3VA 1M6WA 2PZLA 1KEPA 3BIOA 4FFNA 4E33A 5JW6A 2B37A 3GC6A 3VOSA 4EITA 2H1SA 4UREA 3ZDFA 1PWZA 3AUAA 2VZ8A 3ITDA 4DA9A 5HTOA 1QYCA 1KETA 4DYVA 1W8DA 2FHSA 3AY6A 4TKMA 3INGA 7ADHA 4Z9XA 4CLXA 5CG1A 3IDSA 4E5NA 1J6UA 1NNUA 1A72A 1V3TA 4DQVA 2R00C 3ROQA 2X9NA 3JQ8B 3PLNA 4LN1A 3OH8A 4MVJH 3ZV5A 4MVJP 4WEQA 3KYDB 3NTOA 2HKIA 1GD1O 4JK3A 3FNFA 1LEHA 1LXCA 1VPDA 5FYDA 1ADGA 3EHEA 2W2KB 1G6KA 4YYZA 4NBRA 4NPCA 3MOGA 4XJSA 4TRNA 3B1JA 1XG5A 5IDYA 1WDLA 1L7DA 4IUYA 2VWPA 3H3JA 1NPTO 3HDHA 4KQWA 4MVJE 3RBXA 4IJKA 2A94A 2VUUA 3TFQA 3CPSA 1KVQA 4D41A 5JDCA 3EZYA 4KTVE 4AJJA 3P2OA 3V1YA 4QO7A 3R6DA 1PGQA 4IGFA 3AOGA 4P8RA 1LI4A 1TT7A 2WWRA 4RPHA 2GERA
chains in the Genus database with same CATH superfamily
3RVBA 3L6BA 3WHLA 2ZG6A 1A5ZA 1E5QA 4F4FA 1EI9A 4IIVA 3F6SA 2FW9A 4K81B 1FDIA 1I0ZA 2P3QA 2PKQO 3CUUA 4Q1CA 2C4UA 3AF1A 3GDWA 3B1XA 4GD3Q 1LQ2A 2UZ3A 1UQTA 2EVWX 2ZBPA 5AOVA 3RH0A 5E2AA 2QF7A 4ER7A 3PI6A 4GX5A 4MP3A 3W6OA 1BEEA 2KB0A 3C98A 3BCUA 3EJWA 4GR9A 2IIBA 2IUSA 3GFSA 4FZJA 4GKAA 4KACA 4LVCA 3WB1A 1OA0A 4JT2A 4LXXA 4MGEA 3KXPA 4DSOA 4RULA 1WHTB 2ZZKA 1TZJA 3DDHA 2QX8A 3QFTA 1CF4A 1FS4A 1XQ6A 1G1AA 2X4DA 3C5CA 4EVSA 2ORIA 4NS4A 3O21A 4FE3A 3M0EA 4KHZA 4QSHA 3RG2A 1VXOA 3TAHA 2BEKA 4YVFA 1JHRA 2XLCA 3EAGA 3R5KA 4OHCA 3E23A 3PTAA 3NBZC 4NCXA 4DAEA 1KWKA 3QFSA 3HB0A 1FUUA 3JQ8A 4TN1A 1XCLA 3DD5A 4KO4S 2PSDA 1LFAA 3EEFA 4BO5A 1NDQA 4DREA 4DZTA 3DE3X 3MD0A 3SYLA 3WWCA 1DWUA 4KI7A 1EYZA 3EGCA 1JQDA 4R01A 4YP5A 3G49A 4IXNA 2Q4DA 1GITA 4P6VF 1C9DB 1Z38A 2OHHA 3L7YA 4FMBB 4OQPA 4GI5A 5EYPB 1E6WA 4BQQA 4EHFA 3OOYA 1KZGB 1MO6A 3AFHA 3NBQA 3I8OA 1UWKA 2C7PA 3JARA 3W34A 2WWYA 1E1RD 1KJ9A 3E3AA 5FWDA 3IERA 1G60A 4GPBA 3I9NA 5DXFA 2WWIA 4HLDA 3KHTA 7REQB 4TTIA 1FNMA 3K0CC 4NBKA 3TO5A 1XRJA 2XSZD 4IIXA 4M9SA 4QVIA 5C46F 2BZSA 2OFXA 2E85A 2BOVA 2RB5A 4BO6A 5COQA 5BNFA 3LUAA 2R85A 1D2HA 1QUFA 3V1NA 4YTEA 3M34A 4R7ZA 1UDCA 3KT0A 2D74A 1VDZA 3OQBA 4LOAA 4RJ2A 3WXBA 2DJIA 3WMEA 4EELA 4MAFA 1Z4MA 4QUDA 3GUZA 1XF1A 3CX3A 5LLTA 1K75A 3HZZA 3QKRA 4YDSA 4QOGA 3HHPA 1O95D 4LIPD 4G1BA 1IM2A 4KQ2A 3NTRA 2J67A 4E5KA 2J0QA 2DOKA 1PGNA 2WFAA 2FK7A 1T0JB 2WKPA 4HDSB 3L7OA 4ZT3A 1KI9A 2ZRMA 2AIRA 3BOSA 3EY4A 4KIWA 5CLJA 2X2FA 4WVFA 3ORFA 4KR2A 1FLAA 5HMMA 4DDHA 1C0KA 4RA6A 1R8JA 2WHXA 3CWZA 3NTUA 1R15A 4YN3A 3L3BA 1ONSA 2QSUA 3IAUA 3PA6A 3I2HA 3ME5A 1BE8A 3EXG2 4MVJI 2ST1A 3BHNA 1L4NA 2IOFA 3Q2OA 2UZIR 1PJQA 2P6OA 1L5SA 5EMLA 5CT5A 1ZSNA 4QKQA 3I01M 1LF0A 3K32A 3DL2A 5F3WB 4KLZA 1ODTC 2JAPA 3ZVLA 5MF6A 1BKYA 3Q1LA 1N2CB 4WNAA 1NV9A 4N82A 5FTNA 1DQSA 1K2VN 2ZW9A 3O8OA 4MS4B 2C77A 4QFDA 3GLHA 4OQLA 5EJFA 2VPIA 2ZIGA 5DJ5A 1WMSA 5HKOA 1NQWA 4MB6A 3SHQA 3LUBA 2PGJA 1K8RA 3AG6A 1T10A 1NZFA 4GKKB 5BT8A 4PQYA 3P94A 2W6ZA 1XEXB 4QVKA 2UZ0A 4GYJA 4TMFA 4AB1A 4I4TB 1NQXA 4PWZA 3KQWA 1CIPA 3EZ2A 4H3HB 2CMFA 5TLSA 5HDBB 4G0OA 3OLQA 2C29D 5KNLA 1ZOOA 1USKA 1R0WA 3TTXA 3AM3A 1DWPA 1FRQA 3C24A 3ECSA 1Q7EA 1G9TA 2UZAA 3GEDA 4MWDA 3E5NA 3B9RA 2I65A 1NE7A 5BMVA 3C14C 2Q1YA 4LW8A 4UMDA 5DBEX 4C7OB 1M66A 4RVFA 4ZJPA 1M1NA 5C4GB 3ZWKA 4LJKA 3ZE0B 1RKVA 3N6RA 4JDUA 5KYXB 3FUCA 3NHRA 4W5RA 1J0EA 1TUBA 4P0PB 1KMCA 1GPYA 1L4GA 2JFXA 1FDVA 4YUYA 2VRCD 3DKIA 5U4XA 2CLFB 4M49A 2AV6A 5REQB 7AT1A 1XROA 3I8XA 3ZH9B 4BFZA 3D2AA 3B5EA 4JKOA 4L5CA 5ABPA 3PQEA 4QOEA 1AV6A 1WJGA 1IOLA 1H69A 4I5GA 3VU9B 1VFNA 1LPMA 4MV7A 3OFSA 3DBRA 3FWHA 5AVJA 1PE0A 1XTKA 3U61B 3LDAA 3KD2A 4IIFA 1TT5A 4FUQA 5HF6A 2BTQB 1KFKB 1D2CA 1E3WB 3NYQA 2BGWA 5JAUA 5K3FB 1JWLA 1E2KA 2P1ZA 2XDWA 1VSTA 1EM6A 1QAOA 1P62B 3FHCB 3G5TA 4FGUA 3AF6A 4BWGA 3KUCA 3MGBA 1T2EA 1RP1A 5FPKA 4J90A 4JNCA 2G6TA 1DAIA 2CD7A 1Q15A 1F9AA 1X94A 3ZNQA 3B5IA 2ETXA 3F1KA 2LUOA 2ZWPA 5BNWA 4PG7A 3T8YA 3S2GA 2KLHA 3V1UA 1V4NA 2WT8A 2XPCA 4IFEA 4EHJA 5CA1A 4DA6A 4YCMA 2ZROA 3FMVA 1M0EA 5EAIA 3IPRA 2YW2A 4PY2A 3HVHA 3VH3A 5A4IS 4XVCA 2ZCVA 2J4FA 1FFBA 4B0PA 1NT4A 1RTTA 5H83A 2CVPA 2XZDA 1X86B 3PNBA 4O29A 1OXTA 1I5OA 3E4CA 2I5PO 2VDWA 3RC9A 3IAHA 3NIFB 4U7PB 2JZOA 3Q2KA 2JKVA 4Z0NA 1T4CA 1UMCB 3OECA 5HIJA 2XWJI 4CIWA 1Z5UA 4HWTA 2E18A 1P4SA 3EIFA 3P4XA 5LIRA 1A4RA 3W3AD 2WFZA 1YE8A 4MI3A 2QPLA 4BNVA 4TZ0A 1B6SA 5KYTA 1B74A 1WVMA 3ABSB 4JXKA 3CRMA 1E8MA 2HJVA 4PC2A 3IAAA 2F1JA 1T8PA 5TSDA 3DTVB 4L2IB 4BJHB 3CZAA 1SHLA 3RIMA 2EZUA 2IS4A 1CVLA 1E7RA 4JLAA 5H70A 2F3QA 2P6NA 4P58A 1GRQA 2MU1A 3RI3A 5TGDA 4TM8A 3C6ZA 3BAZA 1WCYA 2E4XA 4DLSA 4YMVA 2AFHB 3IVGA 4UEKA 1TQ2A 3WNDA 5J1SB 1G6Q1 2REQB 4JVSB 4RMNA 3DDZX 1C3EA 1W0JA 1QVAA 2HOQA 1U8TA 1L5YA 5IP5A 3ZYZA 4WIAA 5FBHA 2H29A 4H7KA 5ALYA 2ZBQA 2YWXA 5HJ2A 3DHEA 4OB7A 3HJHA 4R54A 2D8MA 4CN9A 3L0IB 5SY9A 2ACVA 2WYOA 3SG0A 4L76A 1GO2A 5CVTA 2ZVPX 1P2BA 5HBGA 3L0OA 4OFXA 1T2CA 4KXXA 4PG5A 1B6TA 1RWNA 4HI0E 4AY4A 3U4QA 2AOTB 1G18A 1OH5A 3EAQA 1ABFA 3BGVA 1LWNA 4WKOA 1PUJA 5DOZA 2J5QA 3DWGA 2P9CA 2VPTA 2ZBFA 3JZMA 1M33A 5KQPA 1Z6ZA 3HR8A 3O2JA 4X20A 1FSPA 2OMEA 2ZSHA 2G36A 4XUGB 4QFBA 4UUMA 5IEBA 1HURA 3G2QA 2FOIA 1Z08A 5C3MA 1WDWB 2YNMA 3RYHA 2JK1A 2X86A 4WGFA 4X3CA 3R3WA 3GFQA 4HYEA 2DBRA 5L9AA 1U8EA 2DLDA 3TX2A 1G2OA 2BSQA 3HK2A 2OR3A 5YASA 4Y2PA 1SXPA 1XQ1A 1S4QA 1EJBA 1LFDB 5IVDA 1O7JA 1ARZA 4X60A 2PSHA 1XDBA 2ZUCA 4PX3A 3S0JA 4AMGA 6GPBA 1IBKB 3DL0A 1TU0A 2IFTA 3LL4A 4M87A 4RZIA 4WJLA 2XUQA 3RIEA 5KZMB 4IEIA 4AO7A 3BC1A 2ZUSA 4HFRA 1QH0A 3FTDA 3KOXA 5J4YA 1R0SA 4LGYA 3FCOA 3FFXA 3GCXA 5ALLA 5FYQA 4PG6A 4F93B 1NVVR 2FU5C 2JGRA 4XLZA 2GRUA 4RVDA 4ZAGA 2EG9A 1H94A 1PX0A 2AHOA 2H17A 3QWAA 3VSEA 4AJOA 2X3YA 2Q2VA 4NS1A 1BD3A 2BM0A 3Q41A 1W88B 3T15A 4CM9A 2IOQA 4M98A 2GBLA 1KEZA 3A3OA 2J31A 1FFHA 1Z6QA 4X1IA 3VYRB 3WLPA 3LXRA 4AMZA 5BSVA 4MTLA 1UBKS 1R6DA 3AFMA 3ZJUA 3KXLA 4O4JF 1LVUA 2RGAA 4OQZA 2MTBA 2VJQA 2IIVA 4DGQA 2Q6LA 3GBPA 1WUKS 5FQOA 5C8YA 4ZJYA 1YOVA 2DY1A 4UQLA 3E18A 4EFMA 1WDKA 1T1IA 2PZGA 3DUFB 3HY6A 5EVJA 5H8WA 1SXJE 4BVKA 2H4ZA 2Z5FA 3EXG1 1UF9A 3UM9A 4H6PA 3R20A 1SCIA 3ZI7A 1ICIA 4R6XA 3WK9A 1RBMA 3UXHA 3LV8A 4ZHQB 1JPVA 2LW7A 1ZUNB 3EW9A 3DXXA 2W6CX 2IP1A 4WW0A 5LJLA 4MR9B 1PK7A 3W7AA 1FJXA 2B2CA 3SHWA 1KY5A 3LF1A 1E32A 3D6VA 3HXKA 3I42A 1JEDA 1Q0UA 4HNHA 4PLHA 1JEJA 2ODEA 5T4HA 2D2EA 5BXYA 1WE2A 2YDXA 4HO1X 4NCIA 4MQBA 5COAA 3RODA 1OROA 2O7QA 4DVJA 4EAQA 1PLLA 5HM6A 3NH6A 4JLWA 3OJXA 4GMGA 3FF1A 1KPHA 5CW1A 4EKEA 2X5KO 1IM5A 1GL7A 1FVXA 4IJ5A 2XTZA 4JLPA 2MHCA 1T9AA 2X8AA 5DRYA 3WLIA 2YWGA 3KEFA 2PT5A 3WNCA 1DIHA 3PXDA 1E4EB 2RGXA 2EZTA 4RVHA 4MKHA 4TV9A 5IJXA 4J0IA 1Y5IA 2IZ1A 2X4IA 4PIVA 4P84A 3ROZA 1D3AA 3FKQA 2C9CA 5AUOB 2VHVA 4WKCA 2WT9A 4R2KA 1U7XA 3SF8B 2P3LA 2G1UA 3E53A 3IJRA 5KMGA 4LRTB 2FLVA 5I7FA 5BURA 1I10A 5ARBA 4D25A 2C78A 1M10A 1HR0B 4OP2A 5AHXA 1RXIA 3N2GA 4N6OA 2BCJQ 3TOZA 2IDJA 2D1RA 2E49A 1CRQA 1HTTA 2O59A 1WBBA 3MWEB 3HJNA 4XSHA 2NXNA 4JQSA 4N40A 2GF0A 3WGQA 5FLEX 1TGVA 4MCJA 3UUEA 4EI2A 2JD1A 1PJ3A 2FOXA 5DTEA 3RVKA 5DP1A 2FSVA 2VXOA 1KI6B 3AJDA 4I36A 1NBIA 3NBAA 5FJJA 4DLUA 4LDZA 1EJ6A 3K20A 5KYVA 4NFSA 3WLHA 4A5SA 3UKDA 1SK8A 3EHDA 4Q9NA 3G2OA 1TF7A 2HIMA 1QH1A 3ZHVA 2O7RA 4Y30A 4KLRA 2YMPA 4PX2A 1IMJA 3QU2A 1II8A 3OETA 4D4IA 1W0KD 2ONJA 1IBSA 3B70A 1WZNA 3VR6D 4B47A 4ENQA 5J4LA 4Z2AA 3L6OO 3CX8A 2QRLA 2ODWA 1HFEL 5IKPA 3H6HA 4UVDA 4EY5A 4GGMX 3OZSA 2O2CA 2QKYA 2GJKA 5AKGA 4TLCA 3TLGA 2P0EA 3DM9B 2QPTA 2FRDA 3KSDO 2HMVA 4WADA 4DJDC 4R9UC 5BN5A 1FX0B 2O7NA 4CGZA 1XRMA 1LD3A 3QELA 1P1FA 1G6HA 1XZMA 3NHKA 1DAEA 3FXAA 4DNFA 1XMJA 2J6IA 4OXQA 4UU1A 3TRJA 5BWOA 5BVHB 3GLGA 1VIVA 3GL9A 3IR7A 4F5WA 4F11A 2R6ZA 3L04A 4LSWA 5CIWA 3GB9A 4O2BA 1QFXA 5ITSA 4GZMA 5JS1A 2BDTA 3HH8A 1TB4A 2CNNA 3GZ4A 3S2FA 2J08A 3FRJA 2FA9A 4N0QA 3WLKX 3ZXSA 1RPTA 1DQNA 4F7WA 3PDIB 3ZY6A 2R62A 1JIIA 2BHSA 3DVAB 1L5KA 4G25A 1RJ9B 2HK6A 2Q5FA 4MKFA 4H7DA 4BWVA 1UFOA 2KSQA 4OJNA 2H7XA 1E3SA 4RHXA 3OTWA 4XGIA 3VKUA 1XELA 1JU4A 4A2WA 1C1XB 1T9HA 2OKCA 2DUWA 4MW7A 1ZMBA 3BZUA 1OKKA 2K87A 3P2IA 4OYRA 1G20B 5EQFA 2VJNA 2ESRA 2Z5VA 5G0UA 2IUTA 3U3ZA 5C1IA 4D98A 2JI4A 4A3SA 5IT9A 2EGGA 4JP8A 3STYA 3MUOA 4XSGA 3U3KA 1AGRA 1U5BB 3E22B 4XARA 4UCFA 2LKDA 1LW6E 1LZKA 2GT1A 4KQ9A 5HMLA 4HNUA 3WQHA 3HSKA 3GRAA 1F8FA 4ZALA 5BR7A 3OJ0A 4NEGA 4QDOA 3CZRA 4JBLA 2VWGA 4I55B 4IGIA 2BP7B 2E55A 5J2TF 2R87A 3R7SA 3D3EA 1RYBA 1N8NA 2OXTA 4OBWA 2RJOA 3C3BA 4TKUB 1XNQB 5F9FA 3JPYA 2AXQA 4JI6B 3TEMA 3IKVA 3ZX4A 2F8TA 1OIWA 1QJCA 1ZVJA 2D00A 2GSDA 1V8FA 1BVHA 1GPUA 3QUSA 2PGIA 2R84A 3H16A 4L9SA 2YRWA 3AHCA 4FMDB 1X14A 3JRXA 3S1AA 3ABIA 3N2KA 4OHWA 3UFXA 3VA7A 3UJPA 1JS1X 3W8DA 2H0QA 4DZZA 2O8DB 4BQPA 3TQQA 4J4TA 4OQEA 3K05A 3DZJA 2HXGA 3IHKA 2ZB2A 3ZIAA 4TLMB 2VKQA 3TW8A 4RXTA 2Y66A 3OC6A 1JI0A 1KXZA 5GJVC 5BW4A 5KTTA 3DGFC 1PG5A 1REQA 2KMLA 3GOQA 3VSDA 4AKTA 1XMPA 2N0SA 1NUTA 1XV5A 3L6UA 4IP0A 5KX5F 1RXEA 1SKQA 4OA5A 2FWIA 4LYGA 4FHGA 4C6RA 1RYNA 1YDFA 4LS3A 1NR7A 3CCBA 4Y2VA 3QVGA 4EUNA 3LK7A 2VAWA 1BHSA 4XCXA 4Q6WA 1WZ2A 3LP8A 4ND4A 4O0MA 5GZ6A 2A14A 1T0BA 2CVOA 4IDDA 4Z9AA 4KFRA 4GM0A 4QTXA 4A7PA 1LPBB 3E84A 3FYUC 3MYYA 4NDZA 4LMBA 1Z8DA 1PL0A 5C7YA 3BK1A 2WJWA 3SE0A 5AM2A 5K8TA 3PUWA 4WESA 3ENQA 5ICMA 4B3DA 3ZKWB 4ENPA 2QRPA 1MC1A 4DLXA 4ZI3A 5JJCA 2BELA 2RI0A 1V37A 2W7TA 2EJCA 1GGJA 4L8FA 2CDAA 2XJ4A 1E1CA 4B3HA 3WX0A 1ZH0A 3P1JA 2Z1NA 1DO8A 2WSLA 1F5NA 2VBIA 1XE3A 3RG8A 4DMKA 1X7YB 3QLJA 2YHUA 3MVEA 4TLAA 5KU7A 2YWEA 3MJCA 5ALJA 1XMSA 3AP1A 1XDUA 1Z12A 3NIBA 4F1JA 3U3MA 4Q02A 5BSWA 3UHOA 5CFNA 1P4JA 3HN6A 3L7JA 1MB9A 2ISCA 1FFDA 3H2SA 3BILA 1JQEA 1CFJA 1PBNA 4GE3A 1SM4A 3JATA 2J3EA 3E9QA 3GIDA 1XPOA 4KE6A 1II0A 4YAEA 4QU5A 3GRZA 3QMWA 3DMRA 4JBHA 4D45A 3BE5A 1XYGA 2F9LA 4KRXA 1JH8A 4U6SA 4E1BA 3CE9A 3T4PA 2B98A 4K88A 1CUFA 3M9LA 3JQ9C 1CR2A 2WWGA 4NJMA 3VDMA 4E6EA 4ME6A 5BSTA 3RUEA 1QFYA 1NLZA 3HM9A 3B1WA 4IO1A 3SJUA 3BA6A 4QD3A 2VNJA 3MBKA 1J4AA 4JITA 4DNQA 1Z35A 2G0NA 3R3XA 4FVTA 1E7SA 2DUMA 1FSFA 2P27A 2QVXX 4I4LA 1GKYA 3B1YA 3AHEA 4HDNB 4ZVRA 3AR3A 3TH5A 3T12A 1F0PA 4AY3A 1JEYB 2P2SA 2QTGA 4OATA 3P2JA 4TZ6A 2B30A 2XIJA 3IE1A 1DC7A 1VG1A 1U28C 2JFFA 4K05A 3PJFA 1VL6A 5DLDA 4WKGA 3RS0A 2IJGX 2YQZA 3ZNNA 2KQUA 1OXSC 4AD8A 2EAUA 2QGNA 2IF2A 5G0SA 3H2ZA 2QW8A 4PANA 5LZ2A 4DF3A 4NV0A 4GSKA 1BHO1 2L18A 1U0FA 3TK1A 4C0AC 2YY5A 5I9IA 3P0RA 2YRXA 1OXBB 1VIDA 3SX2A 4IKEA 4ZJZA 1HYHA 3V00A 2REBA 5EXPA 1R4NB 2X0IA 4RFLA 4BTEA 1M5RA 1RKBA 4WUTA 5FI5A 3U44B 2WUWE 3DEZA 4BVHA 4FOOA 1ZY2A 3BYZA 4RSMA 3ICCA 2VG8A 1SB8A 4RETA 1RQPA 4E3WA 1MOSA 3MCVA 3NZEA 1WQ4A 2Y05A 3L01A 4B35A 2XVMA 4H59A 3L8MA 3PEVA 1IQUA 3Q3JB 4YREA 3T3EA 1N78A 4WBSA 4U5QA 2FG7C 2I6FA 5CCEA 2CN1A 4Q3CA 4I9NA 4B46A 2PSJA 4RKFA 4KR0A 1FFAA 5GZ3A 4FYKA 4M2LA 3GRCA 3D1LA 1K8YB 1ZN9A 3D6TB 4IX9A 3RWBA 3Q9NA 4HB3A 5ADUS 4RKWA 3DFKA 1S01A 2JI9A 1HTBA 4KPGA 3EPHA 1VJCA 3IOBA 4G5FA 1C4WA 1M0WA 3MHPA 4HFMA 4HFNA 4EF4A 1DIGA 5KUTA 1A04A 1PK8A 1EEHA 1F6BA 2ZT5A 1NMQA 1NTRA 4IBOA 4WUVA 3ETHA 1G21E 1GGKA 1VYUA 4HN2A 3MF4A 4FB5A 2NU9A 3R4VA 2WZQA 2ZIEA 4MGHA 3T1VA 3WTCA 4EG0A 1VE3A 1MAVA 4DA4A 4H0FA 1K5GA 1Z9BA 1DAPA 2EZ4A 3QPWA 4N4AA 3TCXB 2Y8EA 3UEOA 1WMDA 2G04A 2MDTA 3FI9A 4NK5A 2ZAYA 3KJHA 3P97A 4KNVA 4OK3A 4QUBA 3S44A 5HCIA 5DGIA 5E38A 1YXMA 3H0KA 4U63A 3LFTA 2GI4A 2NADA 4MIKA 4WACA 2V55B 4XGKA 2QRHA 3MGKA 4MUNA 2PS3A 3O8DA 2GSWA 3WZLA 1UIRA 1OGJA 1SZCA 3OF2A 1EVKA 3I76A 1HE2A 3KHSA 1BROA 3C5VA 3K9GA 4NQZA 4Q4JB 1JT9A 1AHHA 2L2QA 2PYDA 2WDZA 3PQ3A 1V6AA 1AGNA 1G8HA 4XUDA 4G0NA 1ACJA 1CVRA 1KL7A 2VYVD 3KE9A 2G70A 4ID9A 5FLKA 4PICA 4Z4HA 2EX4A 2OZLA 4LYAA 4E70A 1D7OA 2WAYA 3H0EA 1JPNA 2BONA 2FE4A 3SQWA 4M1WA 4GC9A 1HDOA 4AZ0B 3KOOA 4BLRA 2VNKA 1PHPA 5B1SA 5F73A 5TJ9A 1P5JA 4KSYA 4AMYA 3SVZA 5FRDA 2C4VA 2A9PA 3UXMA 4M88A 2DR3A 2WHPB 3OOHA 1FFXA 1U3FA 3IO5A 2D0PB 3FMPB 1OQAA 4ODIA 4IGKA 2XOXA 1RRVA 3GLIA 2W8BB 1UXKA 4PONA 4Q1DA 4PQGA 4A10A 2J3IA 5G0WA 4KXWA 3NU1A 2CT8A 4YAGA 4MARA 3S55A 5P8WA 3STVA 1DCMA 1DEHA 3HU5A 3NDRA 4IHJB 1IPHA 4LTMA 4QJ4A 4ZT6A 1HDEA 1Y7HA 1WF6A 4QYSA 1P8AA 3AONB 2ZUBA 4ZWNA 3DKKA 1DRVA 4Q39A 3FF4A 3MRTA 1BQEA 4GXNA 5ECYA 1KS2A 1HE4A 3NVMB 3F8SA 1U0LA 3KJFA 5CLLA 5DCWA 2OCIA 3FDZA 4MI6A 4PPFA 3D4BA 4RY8A 3CY6A 5H7XA 4JI2B 5J58A 1IJFA 3H2GA 3HDGA 1KI1A 3IX7A 1JVSA 2Z95A 3HVKA 4X24A 3BJZA 4YAJA 5AJVB 4BKOA 4DT1B 3SSAA 4B80A 1T43A 3WP0A 3ILHA 3JQCA 4B3IA 4RTJA 1JXQA 2HO4A 2PXAA 3NJ4A 4MP8A 1PFUA 5GP1A 4G5QA 4ALJA 5AW5A 4CQMA 2ID4A 4Z9BA 1MA3A 3DVSX 5HDQA 3OKFA 4XD7A 4YRPA 1W46A 2GTIA 3QTLA 3TLMA 3IT3A 1O5OA 4UPEA 4QPDA 4CF4A 4HT3B 3JALB 3IEPA 3WKEA 4MICA 4IQFA 3ZU5A 4LF7B 1E2GA 4IQ4A 1MW9X 3S8YA 3BH0A 4FW8A 3U2QA 1FK8A 2YC4C 1LUAA 2AQIA 1Y3IA 3ND9A 4U2EA 3VVBA 1VHLA 1M9NA 4KYVA 2PUHA 5EIAA 5JE8A 1XC7A 4J1TC 4PIMA 2XA9A 1DCFA 3GUCA 2AXNA 3H5IA 1TDJA 3IRVA 1MXHA 2D4HA 2FEKA 4I0WB 2MWMA 5CT9A 2FNAA 3FWZA 2JJ8A 3HEBA 4XM1A 4G3XA 4PYMA 3AB3A 1ZCBA 4HLCA 3ICVA 3VJLA 3AVXA 2C00A 2WB2A 1ZKDA 5BWMA 4L75A 3CNBA 3HCCA 1L7MA 4ZOBA 3ZKAA 1ZEMA 2C98A 1VLQA 3MG9A 1V43A 2IUFA 1LBQA 4ZIRB 1HM5A 2HL6A 3K4HA 3RSQA 1D0SA 1GA6A 3MJTA 2JLZA 2CVFA 3H5OA 3Q6MA 5IYZA 4GRAA 3GLFA 3VRHA 1LK7A 2FDCA 5T4EA 5ALZA 1Z2EA 5CVVA 5JDIA 3QIAA 5JJLA 3HKEA 1XEWY 2BFEA 3BORA 3K0FB 4IQ0A 4JL5A 1N3IA 1VKNA 3HDJA 4K6FA 5ADHA 2NV6A 1CUEA 4N3NA 1QMGA 3T3NA 4U7TB 1L5GB 1N2GA 4B6RA 4B3SB 2IGBA 3P8ZA 4P4NA 4P7BA 2WJGA 4DC1A 4CIAA 5AM5A 1P8JA 1Z13A 4NEHB 5KCMA 3M4YA 4PPYA 1E2MA 4HMOA 4FUTA 4QXOA 4YJGA 2HDOA 3AI3A 3L8DA 4B8ZA 1DGQA 1G3IA 2CL7X 2G83A 3JQBC 4RHFA 5MGBA 2I33A 2VSXA 5DNWA 3IKTA 4M7WA 1I2BA 3DZKA 2N75A 2CDCA 2Y1EA 4QBIA 4XYBA 3RNOA 1B26A 3U3RA 4YDQA 1W36D 1AUQA 1CS0B 1DKUA 1ZM3A 2EEZA 2P0AA 5HKBA 4YRQA 2YS6A 4QHSA 4DRZA 1FOEB 4HWKA 2CSXA 2ONYA 2IYRA 1NG1A 2A0YA 2WJZB 5T6BA 3QEBZ 4EQZA 3V6MA 1S9HA 3IAXA 2IP2A 3P9KA 2W2TA 1E0DA 3NGMA 2XKJE 3JWGA 3FTNA 4F3RA 1GNVA 2D5AA 2WT4A 1PFKA 3NIGB 3WWPA 1AGXA 3IIIA 2Y6UA 5EHGA 2HK8A 1KH1A 2BZGA 1QO0D 1ZD1A 2R6R1 2WTAA 3DEFA 3KTOA 3AUFA 5EGSA 3QFHA 5DW0A 4B4UA 1D09A 3F5FA 1CG6A 1EDDA 1EFVA 4QDZA 2QE6A 3JV7A 3C8ZA 4XSVA 1VJDA 3UJCA 4HAZA 2J3HA 5EP3A 1RJWA 5LB2A 2DCMA 2W70A 3S2ZA 4ZEVA 1N2OA 4R1MA 4YP7A 2QE7A 4WXPA 3CRRA 3CE6A 4FYPA 5ILGA 1RKXA 3CUKA 4YGYA 4W5JA 2J0VA 3WLFA 4PZLA 3MERA 5FWXB 2NVUA 1JA1A 1PLJA 3I3SR 3EARA 3LSYA 2YC2C 4BUCA 4YCAA 2ZULA 2WUVA 5BRNA 4DUYB 2P3SA 5JJKA 3HKDA 4RGBA 3UGKA 1CNFA 2HQRA 4QULA 3FTQA 4FFDA 3UT6A 1SCAA 3ZCQA 1QH9A 5FPQA 1U2QA 2PGOA 5DK4A 2G1AA 1QK4A 621PA 1QHNA 4ETIA 1VL2A 3HB7A 5FLYA 1XK7A 5HNKA 3HP1A 4ACBA 1MPTA 2O20A 3PHLA 2B8EA 3VAAA 3TQRA 4YAWA 2F8LA 3NASA 3P26A 2OV1A 3OOJA 3PQ7A 5FWYB 4CL8A 1L1QA 2QX9A 4EMTA 3P0HA 5IJ9A 1ZD2P 2HIGA 3S6JA 2R8BA 1L4FA 2GASA 5DYWA 2VF4X 1Z8HA 1U1CA 4O4HA 5BQ5A 1DTWA 2WOOA 3KKPA 1W7AA 1EVLA 5K3CA 1USVA 1VLLA 3QX8A 4GMDA 2H5LA 3H5TA 1V96A 3OVMA 1P6XA 1SCBA 1MA0A 1R88A 3PDJA 3S70A 1Z5OA 4RA9B 3EWSA 3PGVA 3QE0A 3QWFA 5A9SB 4G8JA 2QTZA 1QU3A 2C2XA 5I9TA 1BCSB 4PFJA 3FKJA 4KRGA 5DYNA 1GZ7A 2PGAA 3FUUA 1GR1A 4Q00A 1IK6A 3ESDA 5IUKC 2QD3A 4YJ2F 3WIEA 3QJ5A 3A25A 4IG4A 3EA5A 1ZCZA 3TL6A 4WH0A 3N39C 2QAGA 4KW7A 2OCKA 4EHBA 1M8KA 3QG5A 4TZKA 1I32A 4EY6A 3R0IA 1CC1S 1XXHE 2N47A 2PUEA 2GCOB 1IEWA 3FLBA 3IDQA 2C4TA 3VV2A 3VPCA 4QJIA 1ZIYA 5JRZA 3IQIX 1IRIA 3QJGA 3NBUA 4P38A 1RLUA 3TNYA 5FPPA 4E5MA 1KH3A 1XJWA 2PMBA 2A5FA 1DZ3A 4K9RA 2DP4E 3DMFA 4LRXA 2R47A 3P27A 4KE8A 2PKCA 5K8UA 2YS7A 2I62A 1KDOA 2OGZA 1W44A 5D01A 3U6BA 5FNVF 1UKBA 5CA0B 3WKBA 3UUWA 2CXXA 1EA5A 4JFAA 1MIOB 3QVOA 3TSAA 4Q4CA 2Q7OE 3RIYA 2HBQA 4D0RA 2WJ4A 4CTMA 4F6CA 1BDJA 2W71A 2F1HA 1N1MA 1PGOA 5FEUA 2CJWB 3EFOB 3KU4A 4YV1A 5KJ1A 4C1BA 1QNFA 1KBQA 3CZPA 1TCCA 5DIFA 5EESA 5H16A 1FNDA 5TDHA 1ADJA 1PR9A 4BX3A 5FUMA 4CQLA 2CNKA 4GLJA 3LGAA 1US8B 1UZMA 5JDCC 1DTSA 5CCDA 3ZDXB 2VYCA 3LHKA 2NUBA 4AP6A 1YRHA 4PVDA 1NR1A 1V95A 3L1HA 5AXDA 3G68A 3KSBC 3ZZNA 5U4QA 3UBMA 1QC5A 1BX1A 3OWOA 4JSRA 2FZKA 4HLUC 4J0KA 1UK7A 2NVBA 2PMDA 1ZN8A 1EK6A 1Q1QA 4J0JA 2IEGA 3ONVA 3ZLVA 1VI6A 4KZKA 4BKUA 2V6MA 3F78A 4FONA 3EOAI 4LC9A 2XUZA 1UM9A 2H57A 4NC9A 3QOYA 4PCVA 3FWPA 3M83A 5JANA 1C4XA 3VYVA 4B4OA 4TVKA 3UUGA 4LNUA 4U7GA 1BKSB 3M6UA 1ZWKA 1C7FA 4JEHA 1RWQA 3A1SA 3SFVA 4DNXA 1W47A 1U2ZA 1M3SA 2QMQA 1QR2A 6REQB 5HRCA 3GP5A 4KQXA 5JNRA 2ZRJA 2WM8A 3IAFA 2NPFA 2VBGA 3HA2A 4YRBA 3C41J 2BM8A 5ADVA 1ZVVA 1H23A 4O0LA 1L7PA 1YE3A 1OI3A 5DULA 3WBBA 1NW7A 5EHNA 1D2GA 1QH8B 4BXOA 1BG6A 1RJGA 3Q12A 2FLKA 4O5AA 1KJZA 3DZHA 4EPVA 4DCJA 1OIVA 2QR5A 1G7TA 3KWLA 3T7EA 1GZ6A 1WIWA 5JSZA 1FL9A 3ESYA 4B4VA 3QVKA 4I3GA 2WE7A 2E21A 1TMGE 1K3UB 3GW8A 2KBEA 3B1ZA 3E7DA 2XDAA 3GVCA 4L5IA 3WGHA 5KTYA 4IRXA 1EK1A 4CV0A 3VHQA 4IYJA 4WCFC 4M0EA 2V6BA 4MRMA 3U4HA 2IEBA 1ADBA 4YRLA 4DDUA 2GN6A 4NP6A 4BJ6A 4YONB 4FN4A 1MC8A 4P08A 4KIUA 4CR8A 4LISA 3ZWOA 1G19A 2MR6A 1GCUA 1HZZC 2ZGVA 2VJDA 3W5CA 4BB9A 1EIZA 1D8AA 3QM1A 5LZ7A 2J6CA 5I47A 1SRQA 4Q12A 3URKA 3DAFA 1RQGA 2PY6A 3QKUA 1I8TA 3H6GA 4FFMA 3G82C 5F21A 3ENKA 4KN5A 3KALA 1OAAA 4YJDA 5D3MA 2P62A 3AX6A 3OO1A 3L7DA 2C99A 4XQ9A 5T64A 1EB9A 4YQZA 3SEZA 1K5DA 2XNDA 1Z5PA 4A8JB 3AINA 2MIIA 2IVFA 4MLPA 4DM7A 1Z0IA 4RF3A 2I7DA 1Y80A 4KFSA 4C4OA 5B4TA 4DABA 2CDRA 3EG5A 5TVKA 2ZRGA 1Q3KA 3EMBA 1I6WA 2IODA 4GFDA 4O1HA 1VPEA 1DCTA 4O4IB 5LFAA 3N8GA 4CLOB 1IONA 1AHPA 3CH5A 3L4KA 2XHEA 3MLEA 4EYQA 2Z30A 3OZGA 1BWQA 1JH9A 2YRFA 1D5WA 1M34A 3O8NA 3TRDA 4OLJA 4CMEA 1WY5A 2Z3ZA 2ZIWB 1UH5A 1XNHA 4ARIA 5BPHA 1TE2A 2PRSA 4R4JA 1R64A 4JP5A 2I29A 3KNZA 1DELA 2HJGA 3GUVA 3CVWA 2D2IA 1G2IA 5KYNA 2VPZA 4X41A 3JSXA 1D2AA 2NO6A 5EJAA 1SA0A 3LO5A 5CX1B 2F55A 1EGMB 1EU1A 3L05A 3VPSA 1NY5A 4HQLA 4EKGA 1E2LA 1NBOA 5C5CA 4BP1A 4US0R 1KPIA 5AR1A 2HN9A 4WBNF 4NXNB 4MQ5A 1SK9A 1Z36A 2GJSA 3ZVRA 3WTBA 1BNCA 2MYUA 1I0IA 3CO5A 3LDFA 5F7OA 4BNKA 3K6SA 3F46A 2AXPA 1Q7TA 1SUFA 2BGNA 2HCFA 2W6ID 4JLKA 1X70A 3VM6A 5KNBD 2R2AA 1Q1AA 3KE8A 3BFVA 4G5YA 3VDRA 4ITVA 5CBPA 3A6EA 1LSJA 5A02A 5FULA 3INTA 1YACA 3PQDA 4MTCA 3BA1A 2VF8A 3TB4A 3I0MA 2XJ9A 2YZGA 1M2EA 2WQ7A 1H1LB 3RABA 1WG8A 1MZPA 3NXSA 5EPOA 3PG5A 3I1FA 3U16A 4OL0A 2EG5A 5AXAA 2CLDX 2CLLB 4GKBA 1ZXLA 4R3UC 4RK7A 2WA1A 2HX1A 2Y0EA 4Z3KA 4ZI2A 5IDQA 3E81A 3TGLA 4IVNA 3C3DA 4D92A 3SE7A 1S8AA 3R3UA 3H1AA 4QYWA 5DBIA 5H82A 3E5RA 1QHHA 3D6MA 3ADOA 4OJMX 3ZH2A 3H2YA 1RS0A 3FBWA 1EHYA 4C0JA 5F9HA 2O19A 5K6AC 4EG1A 1SOVA 2RC5A 4CMGA 3IBYA 2X14A 3D6AA 2QYOA 4E6PA 4NMHA 4ZK2A 4MR7A 1V5EA 2OCLA 3GEPA 4RFSA 3VVMA 5AM0A 4OO3A 2E4VA 1X2BA 2R68A 3HY3A 4RX1A 1KFCB 4WFQA 3VAYA 1Y4DE 2DQ4A 2I8LA 3TQCA 4QRIA 1EVYA 1VM6A 5BUZA 4CVNA 3V7WA 1GNPA 2UUCB 1DEOA 1JMKC 1WPQA 4XPIB 2OZPA 2PRYA 1NDUA 3PJRA 1OWOA 2JJ1D 2QLBA 3FHLA 4ZMSA 1X3SA 4I5EA 4RCVA 5MHTA 3LFHA 1E2DA 1FRVA 2A5GA 2C04A 1A97A 2MR5A 1QLHA 1EK5A 1CUCA 2O6LA 4ZC8A 2AG5A 1KOJA 3PPVA 1IH8A 5TARA 4G5RA 2AH5A 3PX3A 3RSZA 4D02A 1GRRA 5LCXA 3C3WA 2ZJ6A 3O84A 2J87A 3EWNA 5ENDA 2H4FA 4FWIB 5E7QA 3SIRA 2Q49A 2VBCA 4XOIA 4Q4AB 3RUHA 3RR2A 1WMFA 3T5CA 3WGLA 1E6UA 1H4VB 1N2IA 2QNBA 4WLOA 3AZOA 5AJYA 3L5OA 1Z4QA 3OQ1A 4FMPA 1TYBE 3DOEA 1XYYA 1S7GA 4PCAA 3KM0A 2JBWA 2FKAA 3PQ4A 3DCNA 4Q6BA 1RAFA 1SQ0A 2IZ6A 4MW9A 3VU0A 2O2HA 1U6KA 3L7AA 1S3IA 3HDVA 3RROA 1OAOC 4ID3A 4CQNA 2V7UA 1S2NA 4EGAA 1J9GA 3MMPA 3PCXA 1EXWA 2HWXA 3P0EA 4RY0A 2H9IA 1O1YA 3RYCA 2JIOA 1GQSA 1RBZA 4QO8A 5LDGA 1UBSB 3GDHA 4GWGA 1YA4A 2YJ3A 4A73A 5HIAA 3ZJTA 1KOFA 1GA1A 1S5PA 4OM7A 2WSIA 3B82A 1M7GA 4R68A 2ZEJA 3CM0A 3A4VA 4MPTA 4D8WA 2EHJA 4ETNA 1P19A 2WV7A 4H18A 3THOA 3U56A 1HT0A 1RLIA 1OFVA 4JUDX 1EVZA 2ZPUA 1XFAA 3ZW8A 3URMA 1FYXA 2MSCB 4KDRA 3N7TA 3DHNA 3RE1A 5JAOA 1QG6A 2CL6X 3S1LA 2CUKA 5FEMA 1VYTA 3DZCA 2V4ZA 2H5IA 1BHJA 3FBTA 1NQVA 3CLUD 1LS1A 3FHJA 5TPZD 5DNYB 1SC6A 2I2AA 2X7JA 3WSTA 3AL2A 1X8LA 2BD0A 1PR6A 2I91A 1G66A 1PI3A 1SD2A 4ITUA 3ZU6A 4BGIA 1KY3A 1WF3A 2VTEA 3ZWMA 5J4VA 2XB9A 1C3OA 2JD2A 2B92A 3HJCA 1UZAA 2QYSA 3QKIA 1V1MA 1JKJA 4FKZA 4Q01A 4ZU6X 4ZDIA 4GP9A 4OGWA 4Z53A 3WISA 2PH7A 4LDRA 1XA0A 4LHSA 4DMFA 2JIQA 5FL7D 4DANA 2HQOA 2AOUA 4YBZA 3OPNA 4RPGA 5A0VA 4U7JA 4JJZA 4V0SA 3D0QA 2FG5A 1R4MA 2HSWA 3MJHA 2FB9A 1R37A 3HR4A 4LXTA 4MCAA 1S1MA 3FKSD 5DIZA 4JV5B 1TAQA 3JQ7A 3BTSA 2IIPA 2EV9A 1GY8A 4LWZA 5AVXA 1L7EA 5D7BA 3X3HA 2DFPA 3OA2A 2OHIA 3MCAA 1K66A 2RG7A 1NN3A 2OHFA 1J42A 4Z