3VC7A

Crystal structure of a putative oxidoreductase from sinorhizobium meliloti 1021
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
249
structure length
237
Chain Sequence
NYQGKKAIVIGGTHGMGLATVRRLVEGGAEVLLTGRNESNIARIREEFGPRVHALRSDIADLNEIAVLGAAAGQTLGAIDLLHINAGVSELEPFDQVSEASYDRQFAVNTKGAFFTVQRLTPLIREGGSIVFTSSVADEGGHPGMSVYSASKAALVSFASVLAAELLPRGIRVNSVSPGFIDTRAEFKTLGDNITPMKRNGTADEVARAVLFLAFEATFTTGAKLAVDGGLGQKLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative oxidoreductase
publication title Crystal Structure of a putative oxidoreductase protein from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti
total genus 82
structure length 237
sequence length 249
chains with identical sequence B
ec nomenclature ec 1.-.-.-:
pdb deposition date 2012-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3vc7A00
2P4HX 4GWGA 1RM4A 3HZZA 1YL5A 3EHEA 1P0CA 2CZCA 2EP7A 3SC4A 4RF4A 3GPIA 3WMXA 3ZHBA 5G0UA 1QXSA 4GI2A 3IUSA 1AUPA 3NTRA 2VUUA 5L4LA 2Q2WA 1I24A 3DZJA 5A03A 3NYWA 4KMSA 4PFJA 2PKQO 4JJIA 2DVMA 4M86A 4OKIA 4CL3A 1EFLA 1HETA 2HRBA 2VYNA 3TZKA 3O03A 2RH4A 1OOEA 3FI9A 2Q4BA 2I65A 5ER9A 4FFRA 2J5RA 1ZH8A 3N58A 4GMGA 1O5IA 1GL3A 4GMFA 4ZICA 2G82A 4PIVA 2E6UX 1CETA 4KTTE 3EY4A 3MJ4A 4WGGA 1YH3A 1PGQA 3GDOA 3JYNA 1GCOA 4ITUA 5T64A 3RROA 2IZ1A 5THQA 4PLFA 4R5MA 4A7PA 4RZHA 2JHGA 1PZGA 3F4BA 3RQSA 4BB6A 3TN7A 3VDQA 1B14A 1H5QA 1HYEA 4CPDA 1YBAA 4BKQA 1DIAA 3E9QA 1UXKA 3GF4A 1PX0A 5KVSA 3WGIA 4GKVA 1W4ZA 4YA6A 3HN7A 3DZFA 2W90A 4ZA2A 1ZZEA 1W0CA 1MG5A 4R16A 4PG5A 1WMAA 2Y1GA 3U5TA 3DAGA 3MJCA 1E92A 3KXDA 1LRJA 4FFOA 4L74A 3VPHA 3H6KA 2AE2A 4ZQFA 2VT3A 1DLIA 1ZIDA 4BB5A 3V2UA 4QXMA 4LK3A 5TS3A 3U3XA 4YAKA 4AG3A 3UFXA 3HJAA 1J5PA 2PV7A 4R1UA 4Y9DA 4A2CA 3Q6IA 4AJPA 1C0LA 1U5CA 4JX8A 3L6OO 4XZ3A 4ZGWA 1BVUA 4ZQHA 2V6MA 1ZFNA 3OMLA 1DJNA 1U8XX 3EW7A 4M55A 4HY3A 4CLOB 1E3IA 2YFHA 3RI3A 4TQGA 4DXHA 9LDBA 1Z75A 3AUSA 3WGGA 3VAZA 3WDSA 5EINA 1WPQA 3WYEA 1KEVA 4UVGA 4C7KA 5IXYA 4F6CA 5TSDA 2PR2A 3HDJA 1OAAA 1ZK2A 4GVXA 4GH5A 4JCOA 3OIDA 4ND2A 2DTXA 1GADO 1EQ2A 2BGLA 1B0AA 3RUHA 4BKOA 2JHFA 1LI4A 3BIOA 2I9PA 4RPLA 4R9SA 1ZBQA 4GLLA 1U3WA 3NGLA 3D3WB 3INRA 3QWAA 3ITKA 3S2GA 5G4KB 1P1FA 3I4FA 1HE2A 1UAYA 1B8VA 1UXIA 3IL2A 2ZTLA 4OAQA 2NU9A 4ZQGA 3AI2A 2QYTA 5THKA 2IRWA 3HWRA 2D1YA 3WQSB 1QP8A 2JCVA 5JW6A 1I10A 2QRKA 1TLTA 4BKPA 5FYDA 3IP3A 2O2YA 2PH3A 1HE4A 2VHWA 2C2YA 4J6FA 3PYXA 3OIGA 2ZK7A 1DBVO 3RVDA 3NTOA 4RVSA 2R00A 3LU1A 1H6BA 5JY1A 4I9HA 1MB4A 1ISMA 3CIFA 1B3RA 3WLFA 4J90A 5FI3A 1E7YA 3SBOA 3WR5A 5CDGA 4CQMA 5U1PA 1Y6JA 3H9GA 4MDHA 3WQQA 1ISFA 1XG5A 2WYVA 2GYYA 1U8FO 3KO8A 4FBGA 4PLZA 4B4WA 2VWGA 3D0OA 4UVHA 2WD7B 1YQXA 3AM3A 1XSEA 3I9KA 5I9LA 4BGIA 1T2CA 2BH9A 1U5AA 2FY8A 2Y66A 1Q2XA 4WLFA 4R4JA 3WYBA 5A9RA 1NR7A 3ASUA 4BO7A 4TRJA 1GTMA 4EITA 3JQCA 4R5HA 3GVPA 4NBVA 1LQUA 3WTCA 1Y81A 3GAFA 1N5DA 1B2LA 2W98A 5COAA 1CQIA 2D5CA 3ANLA 2B35A 5L9AA 3BMQA 1AN9A 4FR5A 4JK3A 4BMNA 2FOIA 1N1GA 3VZPA 4C4OA 1J49A 4PCVA 1YBVA 3F1KA 5CEEA 1NQ5A 1U2DA 1I2CA 1FXSA 4AJNA 2BFOA 2AEFA 3GDGA 3K96A 3K9QO 2Q45A 4K9DA 3G0OA 3MJEA 3GVHA 3OQBA 4QQRA 5EESA 2EKLA 5HWSA 3PFWO 1P0FA 3ZWPA 5I7SA 3V8BA 3JD0A 1PQUA 4QECA 4M49A 4XDZA 3ADOA 2Q3EA 3DZKA 5DBFA 1PR9A 4XRRA 2VTDA 3UOGA 1MXHA 1B16A 2C0CA 3L6EA 1LLUA 4JQCA 3DBHB 3U4DA 5JMWA 3GEMA 1R4MB 2HLPA 3JQBC 2GUGA 3FN4A 5A5EA 3JQFA 3DBLB 4IMPA 1GEGA 3U09A 1NVTA 4PLTA 1VC2A 1UDCA 1VKOA 2Y67A 3V1TC 5CP8A 1RYEA 1E1LA 4ND1A 2HKIA 1HDCA 4F6LA 1HTBA 4CLRA 4MVJA 1JW9B 3WYCA 2JFHA 1VL8A 2AQIA 4OXNA 3CPSA 2G0TA 3NDIA 4Z0TA 1E7QA 1QLJA 4XQCA 1KBZA 4W6ZA 3L4BA 3AY6A 2YHUA 1SOWA 1W8DA 2V65A 2NU7A 1ZSYA 2CDCA 4EUEA 3E6AA 4ALLA 2C7VA 4OKNA 4WCFB 2O4CA 3B1JA 5U9CA 2GASA 3LC7O 4ZD6A 1C1XB 5CEJA 4F45A 2I6TA 2VWPA 1NYTA 2GN4A 3L4SO 4F3YA 3ASVA 3FSRA 1OBFO 4I9NA 3C7AA 1KY5A 2YUTA 2A9FA 4D0RA 4DWVA 1D4FA 4BHTA 1T4DA 3OSUA 2QZZA 4ND3A 2ILTA 5BNFA 2PZJA 1Q1NA 3FPCA 3H8VA 4YJHB 5G0SA 5CHEA 1H6CA 4YRAA 2Y1CA 4P8RA 2ZTUA 1V35A 1MFPA 3ENKA 2FSSA 5TJ9A 1M76A 1LSUA 2YV2A 3MEQA 3LYLA 1DHTA 1GU7A 1R4NB 4R1NA 5ES3A 3GPDG 4O63O 1AXEA 1K3TA 1D3AA 2VNSA 1RPNA 5A05A 4FJ0A 4OSOA 1YONA 3DEYX 3VPGA 2G5CA 4GGOA 4FC6A 2VYND 3DBRB 3K2BA 1IE3A 3ROQA 4U5QA 1ZKMA 2VZ8A 1U7HA 2Q99A 1T2EA 5IDQA 1P9LA 4CM4B 2Y68A 1DAPA 3OM9A 2EGHA 1DC6A 1ENYA 3OJEA 3IIEA 4Z0HO 2CVQA 3NDJA 3ZW8A 2WMDA 2UV8A 4M54A 5ER6A 5KJ6A 4YT5A 3WGOA 5IDYA 4NZ9A 3RFXA 4NNJA 2ZTMA 1WWKA 4IJKA 1N92A 5T8KC 2Y0EA 5DZSA 1SOVA 2GZ3A 3DMTC 3PHHA 4DL9A 2I66A 1P1JA 1ENPA 1P74A 2PLAA 2OBNA 2I99A 2E37A 1P1KA 4PLCA 3T7EA 1BXKA 1HDYA 2ZTVA 2Q2QA 3VPFA 1UP6A 2NVUA 3B20A 3LT1A 4XGIA 3I3OA 3R0IA 4BNLA 3H2SA 4J16A 1UXGA 2GPTA 4H3VA 4IZIA 3QP9A 2QQ5A 2ZYDA 2IDZA 2O7SA 1K6IA 3Q0EA 5G0TA 1WZEA 1VLLA 3TFOA 4E2YA 4IBOA 1HZZA 4D7AA 5C7LO 2EKPA 4J3FA 1BW9B 2J8ZA 1OFGA 2GD1O 3CXRA 5C3MA 2OOSA 5EJ2A 1TT7A 4HBGA 3AWDA 3D5TA 5IFLA 1LLDA 2QG4A 3FCOA 3FHLA 4MIEA 3HADA 2D2IA 2C59A 1LTHR 3GFGA 1E6UA 4PG4A 5LDGA 2CF5A 4QTZA 3DHYA 1P1HA 5I8WA 2XAAA 3JD1A 1XU7A 1ZXBA 1BXGB 3RUAA 4DBZA 5COBA 3JQ8B 1ONNA 2R6JA 4O0LA 2FHSA 4P4LA 3PGXA 1UH5A 4RVHA 1VSVA 3DOJA 2ZJ1A 4GX0A 4RDIA 2RBEA 3KV3O 3P7MA 2O3UA 3OICA 3I9NA 1MUUA 2GNAA 4ALMA 4TVBA 4E2ZA 3KVOA 3PQDA 2IZ0A 1NX6A 2FPIA 4R3WA 5F5LA 5F3RA 3PJEA 1ZNQO 5L3ZA 2VUTA 3VPSA 1LDMA 2A94A 4KDEA 3KOUA 3H65A 2GF2A 2QHXA 4J9UE 4B3IA 2PZMA 1G6KA 1ZCJA 1R15A 4M1QA 4GSKA 1H2BA 5BSEA 2HMUA 2Y0CA 1U3TA 3WGTA 4YJGA 1V6AA 3VKUA 1HKUA 4UULA 4DIOA 1ZEJA 1DFGA 3JD2A 2ZYAA 4EYEA 3E48A 1NHGA 3KM0A 3ZWWA 4YXFA 2FZWA 2IEDA 5FFFA 1GAEO 4B79A 4K1LA 4RF5A 4CM5A 2C82A 1PGOA 3RJ5A 4YACA 3AOEC 3JQGB 1P1RA 1I3MA 4BO1A 4NI5A 4RVGA 3FR8A 1CERA 3I6IA 4FS3A 1SAYA 3QVXA 5L7TA 4GGPA 3JD3A 4CMEC 3ZWAA 3KSDO 1BXZA 4ILKA 5JS6A 3RU7A 4HX5A 3D4PA 3PDJA 4WEQA 1FDSA 2DT5A 4LRTB 4TWRA 2QYSA 2ZCVA 4FJ1A 2UYYA 3GY0A 3E5MA 4BQRA 3K73O 3H5RA 3A1NA 3ZNQA 4EJMA 1W73A 1HLDA 1GYPA 1F8GA 1KOLA 5LDHA 4JBGA 3HFGA 3PHLA 1IB6A 2Y0DA 3AUUA 4NBRA 4K6CA 1TT5B 3BZUA 4U6SA 2AQHA 2X9NA 1SO8A 4N18A 4E3ZA 1WW8A 4DMLA 2HCTA 2Z1NA 3DHNA 4K6FA 4XR9A 4CMKA 1LRLA 5KJ1A 4BUCA 3BTSA 1T25A 2DKNA 3H2ZA 3O26A 4TRNA 2VOEA 3C24A 3SLGA 5DN9A 1H6DA 3DTTA 2CVZA 1PJ4A 4HXYA 1EE2A 3L6DA 4BV9A 1C1DA 3PYMA 4IDAA 4E30A 5B4VA 1JKIA 4NJOA 1J6UA 2Y93A 1E3EA 1M66A 1LU9A 1NXQA 4DGSA 3HHPA 2X7HA 4E12A 2EHDA 3K2EA 1I3LA 1LLCA 3WXBA 3QWBA 3GA0A 4NHEA 3ZH2A 3RJ9A 5DULA 4LN1A 2B83A 5JDCA 1Z82A 4CUJA 4I5GA 5CDSA 1YOVA 3AY3A 1N1EA 4WCDA 1T2DA 4BOYA 1E1MA 2BFMA 4AJ1A 1H9AA 1SMKA 2RHCA 2DU8A 3VPXA 4JP3A 2JCXA 2WDZA 1JAYA 2PGLA 2AG5A 5JXWA 1XIVA 3PVZA 5MGBA 1UDBA 4ZJUA 5IAAA 1JQBA 3LDHA 1TI7A 1IPEA 5JPIA 3WSVA 4PLVA 1KVTA 5HTOA 3GHHA 3CUKA 3GGOA 1ISJA 2WM3A 1PJBA 1I36A 2WYUA 2YV3A 1EZ4A 1FDWA 5KJFA 1EVZA 4MP6A 1ZMOA 2HK7A 5G2OA 1SEVA 2CSUA 1IY8A 1EEHA 1GFSA 1GQYA 1ZK4A 3TQHA 3EUWA 2AQ8A 4UUPA 5KKAA 1HDZA 1Z7EA 4R01A 4INAA 1I33A 3ZNNA 1CJCA 1MG0A 4RLSA 4RJTA 1GV0A 3HSKA 4W82A 4EW6A 1DC4A 1LQTA 4TKLA 4DQXA 2B37A 5F21A 4OM8A 3IMFA 2NSDA 4CV2A 3JYLA 4Y6PA 4PVCA 4YJDA 5FEUA 3IP1A 4EJ0A 1L7EA 1MP0A 4M8SA 3Q2KA 3GZNB 3ZV6A 5I7VA 3D7LA 3SEFA 3BTUA 4KTVE 5HA5A 3UCFA 4RL6A 3F9IA 1EBFA 3H9EO 3ON5A 5JO0A 2XXBA 1DB3A 4PG8A 2NV6A 1JVBA 3PYLA 4OOFA 2H63A 3VZSA 1VPDA 3T4XA 4MKZA 1Z7BA 3ZV3A 4A73A 1ZJYA 3VTZA 3DAPA 4G81A 4TVOA 1EVIA 3PWSA 3QY9A 4UVEA 5MDHA 2I76A 1LJ8A 4RZIA 2JD0A 2PK3A 4JBHA 3C1TA 1V3TA 1KEPA 5T8KA 5BR7A 2Y1EA 1YQDA 2LDXA 4OO3A 2H6EA 2NNLD 2XF8A 5IJZA 2FR8A 4WPGA 4MVJE 1R16A 5C7OO 4QO7A 3GVCA 1QMGA 3OJLA 1YBMA 2YV1A 2Q1SA 1A4UA 1HE3A 3FPLA 2JD1A 3O8QB 4CM6A 2VZ9A 4Z9FA 2J5KA 2JFFA 2ZQZA 2GDZA 2OP0A 5I9NA 4AJOA 1CYDA 3ITDA 4RDHA 3F4LA 1XDWA 3I6QA 5CPFA 5C7IO 3ZWXA 1ZO8A 4ZHSA 4BO4A 1ZW1A 3BMNB 1DEHA 1DSSG 2P5YA 3P19A 4HP8A 4IIVA 1VL0A 1BDMA 3AU9A 3C1AA 1HSZA 4ONEA 4BNTA 3LT2A 3K31A 1SBYA 2J6IA 1JWBB 4WCFC 3SJ7A 4A26A 3MCVA 5A9SB 3EZYA 1EK5A 1JKFA 3PZBA 4P38A 3S2EA 1P1IA 1HYGA 4MPDA 3GLQA 3KSUA 4FFNA 4U8GA 3KLPX 1KERA 5FWNA 1GZ4A 1JWAB 1N9GA 1U2GA 1JAXA 3IDSA 3KTDA 3PWZA 5JO9A 5TJHA 2CVOA 2QRLA 3E5RA 3PHJA 3Q11A 4EUFA 3GVXA 3ZGYA 4Q3BA 5GZ1A 1IZ9A 4GBJA 3AUTA 3JQAD 4YEDA 1IL0A 3ZWCA 2B69A 3W8DA 3UCEA 5TIIA 5L4NA 1P44A 2Q50A 4YR9A 1TVEA 2P4QA 3GRPA 3INGA 3OECA 1Z74A 2ET6A 2JD2A 3ROKA 4WLNA 3UKOA 2P68A 2PZKA 3LF1A 3PFFA 2CMDA 3G49A 2Q4EA 2OGUA 4FSHA 1ENOA 1LC3A 5TX7A 3OP4A 3VZRA 4ALIA 1U4SA 3GC6A 4BO5A 4PRKA 4BNVA 4GX2A 4XQGA 5FI5A 3DWFA 4DQUA 3NDRA 2EJVA 2DFDA 4CMIA 3N74A 3DL2A 1XQ1A 3PIDA 3BAZA 2PNFA 3GQVA 1HSOA 4XEHA 4H15A 3ONDA 3ZW9A 4LCEA 4XIJA 1C0IA 2C54A 2QZ9A 3RC1A 4BNJA 2VZ0A 2OL4A 3ETGA 1A4IA 2EW2A 2GZ1A 1NNUA 4W4TA 2GZ2A 1HRDA 4FOSA 1HDOA 2NQTA 3AOEA 3GG9A 4KQXA 2D5AA 3EYWA 2HMSA 4JNKA 3ONFA 5H82A 4W7IA 1NP3A 4CMEA 1PWZA 2Q49A 1KETA 5EPOA 3MTGA 5TQVA 5I8ZA 2NADA 4NU5A 1E7WA 1NQTA 4LVUA 4N5NA 3WLEA 2WE8A 1EMDA 1RWBA 1X1TA 3OA0A 4OHUA 4DPKA 4W99A 1V3UA 2DPHA 1P33A 3QVWA 3R3SA 4II2A 3GK3A 2UUOA 4YAIA 1JDJA 3LC1O 4BNYA 2FR1A 1KVQA 4PZCA 1D7OA 5G0VA 1WVGA 5A06A 4R41A 1BTOA 3W6ZA 5EMHA 3B1FA 1DRWA 3D1LA 3RBVA 1PGJA 2ZCUA 1HL3A 2TMGA 1AE1A 1YWGO 4Y98A 3PQFA 4BGVA 1F06A 1TEHA 2E49A 3DMYA 2HK9A 3UW3A 3WIDA 4R69A 2X6TA 3SXPA 4XJSA 5JAZA 3GRKA 3FRJA 1ZVMA 2EEZA 1BRMA 1MGOA 3GZ4A 5DP2A 2ZQYA 2W2LD 3FTNA 4RLHA 1YB1A 2FZEA 3ZWBA 3HB4X 4Q39A 2CDBA 1KY4A 1S6YA 4FCCA 4Y6SA 3MOIA 4FFPA 2VTEA 4YT8A 4BNUA 3LK7A 3MWEB 1HF3A 2IXAA 4LMPA 3V5NA 3OEWA 4RF2A 4NJMA 2X5KO 2ZIZA 3BMOA 4EJ6A 4ALKA 4LSWA 1NBOA 1DPGA 3RFVA 1S7CA 1E7RA 4YBZA 2EF1A 4CQMB 5DT9A 3PI7A 2Y1OA 2HMWA 4L4SA 4U0KA 3E8XA 4BO8A 4D44A 2BLLA 3IJPA 1PTJA 1A72A 4NMHA 4Q3EA 3ZV5A 4OJNA 1MC4A 1B7GO 5EL0A 2DQ4A 4YAJA 5J23A 4KUGA 3WS7A 3MWDB 1XU9A 1NPTO 3NTQA 4XWYA 2EERA 1XWFA 2NVWA 2RAFA 2FMUA 2PD3A 5ICSA 4KWIA 1PR3A 3QWHA 1E3WB 4HNHA 1QYCA 1EBUA 1MC5A 2B36A 1W6UA 2HMVA 3GG2A 3QE3A 3FD8A 3I4CA 4FN4A 5A9TA 9LDTA 4PZEA 4OYRA 1UZLA 2UDPA 5DDIP 4R9RA 2ZJ0A 3AUAA 1WDKA 4XRGA 1YE3A 4RORA 4EBFA 4LGVA 3OQ6A 1Q0LA 4IM7A 3ENNA 1QR6A 2EJWA 3I9JA 4JBIA 2HJRA 1O94A 3GFBA 4YQYA 4CODB 3E03A 1VJTA 1O89A 2CY0A 4GPD1 2D0IA 4N5MA 3SJUA 1B8UA 1UXHA 3QRWA 1PJLA 3L9XA 4C7JA 1XYGA 3FBGA 1F0YA 2RIRA 3DAFA 4ALJA 3ZNPA 5A4DA 5DBGA 1SCUA 3EMKA 2OBYA 4XR4A 2B4TO 1GZ6A 3W4JA 1PEDA 3BTVA 2CNBA 4DC1A 2Q1TA 3Q3CA 4RPJA 3IQDB 4GWKA 4WLEA 3C3XA 4HADA 2X4GA 1GCUA 1TB4A 3E1KA 4NH4A 3NT4A 3WMWA 3HG7A 3JD4A 2VRBA 3F1LA 4AJLA 3RUIA 2X86A 3B1KA 3JYQA 1Y8QA 3EC7A 4XJTA 3R3JA 5EQFA 4CLRB 3U62A 4IDEA 4B4OA 5L7YA 1C0PA 5GZ6A 3DHEA 4ND5A 5CDTA 4L8VA 2YFQA 1WMBA 5JAIA 4JXKA 4Q3CA 2BD0A 1K2WA 5G0WA 3L0DA 1FDUA 3ULKA 1NHWA 1ZK3A 2O3QA 4Q3AA 3RC7A 5CDUA 4L9RA 5KJCA 2E82A 4D46A 4BNWA 5BSHA 4BNKA 4Z6KA 5DP1A 4W9NC 1RM0A 3GUYA 3H4VA 4JROA 4WKGA 4D3FA 3VDRA 5ILGA 4AJJA 1JN0A 4B8WA 5C37A 2GN6A 2BKAA 4WOKA 5JY6A 2O3SA 3CH6A 4MVJM 5DCWA 3A06A 4E21A 1JLLA 1X1EA 3KEOA 1GPJA 5CEFA 4AVYA 2HO5A 3JQ9C 1CDOA 1PJQA 1M6HA 4YJHA 1A71A 2OUIA 3VZQA 3HDHA 3S55A 3CTMA 3AM4A 3KYDB 1Q0HA 2IYPA 2OORA 3U4CA 1NM5A 4D43A 1A7AA 2WJPA 3PP8A 2JFGA 2JL1A 3PRJA 4UUMA 5JCJA 3W4KA 5AXCA 4FPXA 2BF7A 3DOCA 3MJTA 1FDVA 4JP2A 4WOJA 3ICPA 3VKVA 4A03A 1B15A 3T4EA 1BVRA 4Q3DA 1K6JA 3VH3A 2X0RA 4RGBA 1T24A 3P2YA 4PG6A 4FFMA 4PLPA 3DBRA 1WNTA 2P9GA 3BYZA 3GNTA 4BQPA 4H16A 3QWFA 3RD5A 4KWHA 3JYOA 1VSUA 2DC1A 4XYMA 5KIAA 3CEAA 3FWNA 4DUPA 4UVIA 3KRTA 4WJZA 4DA9A 2B4RO 4ALNA 5TGDA 2BFPA 5JNLA 3FNFA 5AYVA 2RH8A 3ABIA 4UAGA 2X58A 4GX5A 1NVGA 1UUFA 3F6YA 4B7UA 3KYBA 4F46A 4Y8VA 3OBBA 4CMBA 4TZKA 2VN8A 1BMDA 1HZJA 3BMCA 1FK8A 2X1HA 3CKYA 3DONA 3QHAA 5U4QA 4HNGA 4UUNA 5KKCA 1O8CA 2ZATA 3TDKA 4CL8A 5KOIA 3G1UA 4B3JA 2NVUB 1PQPA 4CV0A 3R1IA 3WBBA 3GGGA 2PD6A 3AOGA 4NFSA 2DTDA 2O50A 3B70A 3UCXA 1GDHA 1YL7A 3LC2O 4J0EA 4ZRMA 3WWZA 3JQEA 4I5DA 3RWBA 5KVQA 3MTJA 1Y8RB 1DRVA 1V3VA 4CR8A 3L77A 1Q7BA 3H9QA 4YB8A 4RVUA 3WJAA 1BW9A 1UZNA 4J7CA 2A35A 1IPFA 2GRAA 3BHMA 3ANMA 3BXXA 3JQAA 3M1LA 1Q0QA 2A4KA 3LSYA 1VJ1A 2O3RA 3AI1A 3AW9A 3FWZA 1K6XA 1H6AA 1O6ZA 1L1FA 4CMCA 4J2HA 4M87A 4A0SA 4XIYA 1RYDA 4JN6B 4O59O 1AGNA 2QW8A 3GR6A 3KYCA 3UVEA 3HUDA 4I9UA 3CMMA 3TPCA 3VHRA 3CMCO 4XA8A 2H1SA 3KBOA 4EEZA 2YW9A 5TC4A 4ZVVA 1Z45A 5DCUA 3ICCA 1HDXA 4DC0A 5KJEA 2Y99A 2WD8A 2QX7A 5DOZA 1G0NA 4CLHA 5IZCC 5BNTA 2WSBA 1YO6A 2DBVO 1DHRA 2PWZA 4J7UA 1IUKA 2CF6A 4CM1A 1ADGA 2V6BA 1M67A 4CM8A 5L40A 2R2GA 3VTFA 3IOYA 4OH1A 3F46A 4MO2A 1ZMTA 1WDLA 2O4UX 1KC3A 2GLXA 4LRSB 4DLAA 3ZHYA 2W2KA 3IKVA 3PZRA 3V1YA 3ZNOA 2PFGA 3IAHA 4WE3A 1I2ZA 1XCBA 1NQAO 4QFCA 1UJMA 4XQ9A 4NQZA 4GLOA 2NWQA 1T1SA 4NPCA 2EWMA 4ZRNA 1PZFA 2CFCA 2E4AA 4IJVA 3RUEA 2NU8A 1CWUA 3IJRA 1EDZA 4MVJG 4YJGB 3F47A 4YVFA 4IY1A 4HKTA 2VNAA 2BHLA 4QSMA 4XYGA 5JC8A 3DZBA 1YGYA 4WLVA 3OEYA 5CFZA 3RFTA 4AJ4A 2EKQA 3H9UA 3WGHA 4FDAA 1H0KA 4BGEA 4DREA 1C14A 1WLYA 1LDEA 3HDQA 1E7SA 4IMRA 3GGPA 3DBVO 3S8MA 3DFUA 3G3EA 4KQWA 4TRRA 3L9WA 3WQRA 3ZI0A 2J3HA 5L53A 1LC0A 3BA1A 3EAGA 2HQ1A 1U1IA 4IXWA 4WK6A 2EG9A 4EZBA 4G65A 3C7DB 5G4LA 4YT4A 4B7XA 4WLUA 4YJFB 3DTYA 3H3FA 2GN8A 3H5NA 1NFQA 2WE7A 2PA3A 1J0XO 1ZSNA 2GR9A 1U3VA 1Y9AA 1GEEA 2AEJA 3FNGA 1U7TA 8LDHA 4FGSA 2H5LA 1NFRA 3PXXA 4UREA 2VOJA 2GSDA 2WWRA 4XGKA 2W2LA 1QYVA 1LNQA 3JQBA 1ZSVA 4RPHA 4BO3A 1DC5A 3NT5A 4J2OA 4YTEA 3WG9A 3G79A 3VVBA 8ADHA 1PS8A 1DIBA 4QT0A 1YDEA 4BO9A 3LQFA 3X2EA 3F5SA 3SC6A 3O38A 1Q7GA 4U7WA 4D41A 1F17A 3OFSA 4NFYA 1C1DB 3GH3A 1JVSA 4BNHA 2CDAA 5F1OA 2G76A 5DOVA 5GMOA 5ICMA 5L7WA 3ZDFA 5JBIA 4RVDA 2DFVA 4CM7A 1E0DA 2BI7A 1PSDA 1D8AA 1OZAA 1MA0A 3ZV4A 4AJIA 4YAEA 3UF0A 3GMDA 4LVCA 4FC7A 3LF2A 4RPGA 4E5YA 2JKVA 4QX6A 2YYYA 2NTJA 2D4AA 2HDHA 4WECA 3TOXA 1QYWA 2EXXA 5A02A 2X23A 1QV7A 2CUKA 4N7RA 2R00C 1XEAA 2NM0A 3A28A 4W9NA 3JQ7B 1O0SA 2ZB7A 1KC1A 2VWQA 3U9LA 4K28A 3V2HA 1EVJA 1V9LA 3WFIA 2RCYA 3AI3A 4Q3NA 4R68A 4GAEA 4D42A 3CINA 3COSA 3ETEA 5LC1A 3JQ9A 2YHIA 1HXHA 1F8FA 1ONOA 2FN7A 3AU8A 3WBFA 1D1TA 5K6AC 3I83A 5IZ4A 4YCAA 4CQLA 3WFJA 5TNXA 2EGGA 3O4RA 4D3DA 1K0UA 4BKRA 5FF9A 3TOZA 4BNIA 4NDNE 3JYPA 4GQAA 2P5UA 1YJQA 3AJRA 1A9YA 2EV9A 2X5OA 3M1AA 1ADFA 4NR0A 4WUVA 1VM6A 4TSKA 1IOLA 2YQ4A 5JDIC 4O5OA 3QSGA 3ZU5A 3GDFA 1KVUA 4AJHA 2PD4A 2E48A 4JJFA 5JCJD 3NJ8A 3ZWNA 4R1TA 1SZJG 2HU2A 4IJUA 3KB6A 1E1KA 2PZLA 5JAQA 1NR1A 1YJ8A 2BGKA 3RBXA 1CIVA 2XPCA 3Q9NA 4Z3DA 2B5WA 4BS9A 4B3HA 3AK4A 3DMTA 1NAIA 3GHYA 4XGNA 1Y5RA 2UAGA 2VHVA 5T57A 2IEBA 4NK5A 1O9BA 2HJSA 3W4IA 4A5OA 4Z9YA 1UXJA 1FF9A 3ORFA 4HV4A 2BMAA 5DBIA 1U9JA 1VKNA 4FFLA 5H83A 1UAGA 1N7GA 3QWIA 1ISIA 1R37A 4MKXA 3ZN2A 2X0IA 3OQ1A 5JFOA 4WASA 2VHYA 3DOOA 1ML3A 1LDNA 1SB9A 4IQGA 2AQKA 1YXMA 2C07A 1YB5A 2B0JA 1A27A 4OGWA 3C1OA 3KETA 1R6DA 3O8QA 1UR5A 1K89A 1WDMA 4ZQBA 1IHYA 3UHAA 3QQPA 1B26A 3OA2A 4IDBA 2TMDA 4J0FA 4B8ZA 2IODA 3BMNA 3L4BC 4EGFA 3FR7A 3WGZA 4J1NA 3LT0A 4A10A 1U4OA 1V8BA 3LLVA 5JYDA 3PJFA 4AJ2A 4E32A 1NPDA 3W8FA 1RJWA 1BGVA 4EUHA 5A9SA 2NACA 4DLBA 3RKRA 1FDTA 1ZJZA 2GN9A 4M89A 2DUUA 3D4OA 1PS0A 1SNYA 4JGBA 3VVCA 1GD1O 5HRUA 3OETA 3ROPA 1N9GB 4UUOA 1GUYA 1IULA 5KCZA 4O1MA 1PIWA 3OH8A 4E0BA 4QO8A 5ITVA 2POQX 1LSSA 5AQ1A 3FTPA 5CG1A 5IZCA 2FRDA 3NX4A 4L4XA 4CUKA 3I9OA 5JLAA 5GZ3A 3E9NA 2C29D 4CM9A 2X5JO 5L45A 1BG6A 2X9VA 1NTOA 1WXDA 3MOGA 2C20A 2RHRA 4J91A 4MVJP 2QRJA 4WEOA 5BNIA 3PQEA 4UEKA 5TT1A 4IDFA 1XELA 1A9ZA 4MVJH 2VYVA 5CPBA 1MX3A 3QVOA 4DPMA 1BSVA 1GY8A 4CMIB 2DUWA 4OMUA 4YRBA 1F14A 4BMVA 4LMRA 4Z3KA 1EDOA 4MP8A 4NG5A 4B4VA 1I01A 3TL2A 1X13A 1DDOA 4DTIA 3DB2A 3ZWVA 1H93A 4K26A 2AW5A 3QV1A 3WJ7A 2YJZA 3RUCA 4BNGA 1EVYA 4ID9A 5IDWA 2GERA 4DMMA 4ROSA 1DJQA 1XGKA 4GKBA 3QIVA 1M6WA 5I7FA 1E5LA 1R0LA 1X0XA 2X0NA 3TRIA 3AFNA 1RKXA 3KEQA 1C0KA 1RM3A 3NUGA 4XYLA 3V2GA 3MZ0A 1GQ2A 2VUSA 3M6IA 2A92A 2F00A 1ARZA 1P77A 2B5VA 4N5LA 4CLOA 4LW8A 1N8KA 5L95A 1LBEA 4YT2A 3RSHA 3WOHA 1XQ6A 4OXKA 4IS2A 1MV8A 1QSGA 2V6GA 2VT2A 4L73A 4W7HA 3H9JA 3VH2A 1ISHA 2FWMX 4OQYA 5ILOA 4P22A 2ZB8A 1IYZA 5JSFA 2V6FA 2V7PA 1E77A 3GOHA 2HMTA 5A3JA 3MJSA 1JU9A 3PJGA 4J9VA 4YPOA 4IJWA 1QKIA 5CAEA 1H94A 1HE5A 1PJCA 2JCYA 3B6ZA 3D3WA 3BHJA 3DFZA 4B4UA 4GVLA 4S1VA 5G4KA 4PLGA 1T4BA 2DAPA 4IDDA 4AFNA 4LISA 1Q7CA 4L4RA 3AFMA 3EK2A 3GEDA 3IS3A 3TL3A 3ZWMA 4BNFA 1GYRA 4E6PA 2BI8A 4RF3A 4II3A 3V1UA 2BRUA 5KNLA 3C85A 1GUFA 2LDBA 5TT0A 4YYZA 2IXBA 3WTBA 3AM5A 2G1UA 3G1TA 4E2XA 3NAQA 2PGDA 5AXDA 3GUCA 3S1LA 4N54A 5KVVA 2I3GA 1A5ZA 5BSGA 3KLMX 4PVDA 3H7AA 3D5QA 3VOSA 2YQ5A 2P9EA 4G2NA 1J4AA 1DAOA 3F5QA 2D8AA 3NV9A 4OL9A 1C3VA 2AHRA 1M75A 1M2WA 4DQVA 5AXBA 4CMJA 3ADPA 5IDXA 4ZQEA 1A7KA 2NLOA 2I5PO 4CMAA 4NJMB 1E6EA 2X0JA 3BMOB 1Y7TA 1Z73A 2WYWA 3BTOA 3QA9A 1I32A 2OHXA 3HN2A 3KHUA 5HS4A 2WD7A 1QYDA 4A27A 4MP3A 2AMFA 4XX0A 3I9MA 1PU2A 2YY7A 3PIIA 1GYQA 4NBTA 3DZHA 1D1SA 3C7CB 4FJ2A 4KOAA 1DFHA 4G5HA 1YQGA 2YDYA 3HB5X 5K6AA 3OJFA 1V0JA 3K92A 4YQZA 1E3WA 5AXAA 3KZVA 1LRKA 3OIFA 3D3EA 1LDGA 3E82A 1KVRA 4KZPA 5F1PA 1T2AA 2P2SA 2HAEA 2OMEA 5JMPA 4RCVA 1ONPA 3ZU4A 3ZCXA 4QEDA 2C7GA 3BMQB 2Y1FA 3JV7A 5COQA 4PN3A 1PL7A 5ENDA 5JDIA 1T1RA 3PPIA 3GMSA 4OQZA 3S2FA 1DXYA 2D59A 3A4VA 5HBRA 3TWOA 4DIBA 1ZK1A 1YL6A 4R54A 4MIYA 4RQTA 5JYEA 3TZHA 3UH1A 4OIMA 3PWKA 1PWXA 2IE0A 1NASA 2DBRA 3ZWYA 1GZ3A 4IGFA 1XA0A 3GNSA 2OXIA 1X14A 1PL8A 3R6DA 3DBHA 2P9CA 4YDRA 1R4MA 2HK8A 1Y5MA 2DPGA 3MJVA 1ULSA 4NBWA 4PLWA 4YWJA 1GPDG 5AOVA 2FR0A 3DBLA 5JE8A 1CRWG 4HFRA 1IZ0A 4CLXA 3QJ5A 5ITWA 1NAHA 2BGMA 3LZ6A 3STHA 3Q9UA 4I8XA 5B4UA 4XDYA 1VL6A 4J7XA 3HDYA 3K6JA 4HFJA 2BFAA 1LX6A 1AHHA 1YKFA 1OC2A 4E5PA 1EUZA 3OF2A 5IN4A 3EDMA 3E18A 3PLNA 4AJEA 2FPPA 4IPTA 1DRUA 4E2WA 2PKQP 1Y8QB 3LVFO 1ZEMA 4TMFA 1IHXA 2NTNA 5F1KA 4BNNA 2Y05A 1G1AA 2OO5A 5B4TA 1YB4A 4D0SA 3PDUA 4LCJA 5JDCC 5F5NA 4WCFA 3RASA 3TNLA 5A3VA 4BL5A 1C1XA 3I23A 3RUFA 4D3SA 4EDFA 1DLJA 1VRWA 5EERA 1QV6A 3UUWA 4XD2A 5JC1A 1I2BA 3H5AA 4MJLA 4NBUA 3PEFA 4BV8A 1T26A 1P31A 4KP7A 2VHXA 3DDNA 1R12A 3CSDA 1QG6A 4MKRA 3TSCA 5BSFA 1G0OA 5HS6A 2JAHA 1PJ3A 1UZMA 3FBTA 3FF4A 3O9ZA 2O7QA 5JAMA 5I9MA 1HEUA 1DIHA 2OFPA 3Q2IA 3W1VA 1I8TA 4IXTA 1R4NA 1EE9A 4XB1A 4R1SA 1ZUD1 3M2PA 1LSOA 3KYDA 1GR0A 3KUXA 2HSDA 3WX0A 1H9BA 3ZU2A 1VE9A 1H2HA 1NVMB 5A5FA 4URFA 4E13A 1OMOA 1R0SA 4GL4A 2I3AA 2D3TA 1I5RA 1LDBA 4CM4A 2VHZA 5BQFA 4E4YA 3HE3A 3S2IA 4XB2A 3UXYA 1PJ2A 4P4NA 3GEGA 4FIZA 4XYEA 1XR3A 3PJDA 1PJTA 2O23A 3ZZNA 3TZQA 2SCUA 3P2OA 4CM9D 2C2XA 4Y6RA 2PKRA 4BO6A 3WGYA 1KYQA 2X9GA 2VRCA 4L76A 4BO0A 3ZHXA 4RV9A 4TKMA 5EN4A 1NQOA 3TZ6A 4J1QA 5A1TA 5CDYA 1B3BA 2VYVD 4I1IA 5DCYA 1KVSA 4CV1A 2ZB3A 1GQQA 2XXJA 3NGXA 5GY7A 4OSPA 3NT2A 6LDHA 1MFZA 4BGUA 4I08A 5EQDA 2ZKLA 3RIHA 1HYHA 2AG8A 4CLEA 3PHGA 3F3SA 1PS9A 4UVDA 4BIIA 3BMCB 1HDGO 2PY6A 1PZEA 2IYOA 2NQ8A 1I3KA 1BWSA 2NTVA 4IQ8A 1DOHA 3ZHZA 3OJOA 4PZDA 1P3DA 1O95A 3ST7A 1GV1A 1N2SA 2G17A 2PH5A 4J4BA 1FMCA 3RC2A 2IZZA 1NFFA 1N7HA 5T5QA 1OC4A 2VQ3A 2X8LA 3CE6A 5L4SA 3UAGA 3WIEA 4AICA 1Y8RA 1DFIA 3NJ4A 4NIMA 4R51A 5JCXA 4CM3A 1Z6ZA 4DYVA 2ZB4A 3JCZA 4J4TA 4ZU3A 1P45A 1DO8A 2VCYA 4HWKA 3JQAB 1ZXLA 1X0VA 3DO5A 6ADHA 3RAJA 1LLQA 5IN5A 5BT9A 1YDWA 2J3IA 1PGPA 2YDXA 1KS9A 1BXGA 1DC3A 1UP4A 1Y1PA 1WP4A 3KYCB 3QVTA 3U4HA 2NVBA 3JQ8A 4MOWA 5EIOA 4HFMA 3WWYA 3ETDA 4S3MA 2Q46A 1GUZA 5K9ZA 4RO0A 4WNCA 2EW8A 3P5SA 2VWHA 4H7PA 1L7DA 1I3NA 4DPLA 1ADCA 1QLHA 3K30A 5HM8A 1E5QA 2Q1UA 1PGNA 4KUHA 4MVJI 4E5KA 3SLKA 3I52A 3RBZA 1LA2A 1Y9EA 1EFKA 3EZLA 4IIUA 3LLSA 1MXFA 3TZCA 4EI2A 1E1NA 2DLDA 4XCVA 4L0QA 2FPGA 4CM8B 4IDCA 3L07A 5DNAA 1NPYA 1EUDA 3DQPA 1UP7A 3EVTA 3RKUA 3GAZA 4CLDA 4CV3A 4IINA 3C8MA 2NU6A 3I9LA 4WLOA 3DZIA 4BMSA 4J4HA 1EQUA 4AL4A 5CG2A 5KWEA 1ENZA 3PTZA 1T2FA 3D64A 1WAMA 2DM6A 2W2KB 4ZN6A 1JKJA 3IC5A 1ISGA 3DXFA 3FNEA 4MIOA 1CF2O 4RPKA 2O3JA 4PG7A 3ROMA 1R66A 2FP4A 4TROA 4ESOA 4B7CA 7ADHA 1VI2A 3VH1A 3I5MA 1WZIA 4XKJA 2Q1WA 3X2FA 3RU9A 4FOOA 4Y67A 1LDYA 3JQGA 5IXSA 4J49A 1VJ0A 5ENVA 1ID1A 4CQMD 4DLLA 1EUCA 4EEXA 5KVCA 5C5IA 3TF5A 2HRZA 5K0ZA 2O48X 1PQWA 4Q9NA 4CR7A 1JA9A 1MLDA 5B12A 4FW8A 4ND4A 1E3SA 2PTGA 4Z0PA 1SPXA 4YRDA 3AY7A 4IZHA 4I5FA 1AHIA 3WNVA 1KEWA 4YJFA 2Z5LA 3U0BA 1QRRA 3CZRA 1CEQA 1LXCA 4U0JA 3UN1A 2HUNA 2Z95A 1LUAA 3GN1A 2CD9A 1X7DA 1AXGA 1ORRA 3SVTA 3UGKA 2DBZA 1I30A 4U6QA 2NUAA 4FD3A 4YAGA 4GSLA 1TT5A 2YZ7A 2BELA 3EGOA 3T7CA 1NWHA 5LCXA 4MINA 1DIGA 1SB8A 3SX2A 3LT4A 1CQJA 4JIGA 3GT0A 3I1JA 1LEHA 3DC2A 3JQDA 4UEOA 3WSWA 4CR6A 4J1TA 3NKLA 1BDBA 3Q1LA 5KTKA 4CJXA 4IDGA 4L75A 4LSMA 4E5NA 3U4IA 1F12A 1PZHA 3IUPA 3OHSX 4BNXA 2AA3A 2J3KA 1SEPA 1B8PA 3A14A 3HNPA 2Q2VA 4BKUA 3EVNA 3NRCA 2UUPA 3RCBA 4PGFA 4FGWA 3WNQA 2W8ZA 2I67A 3DZGA 2JAPA 3QW2A 5TLSA 2JJYA 4UEJA 5TRTA 1XHLA 3N7UA 4X54A 4R3NA 4I5EA 3BHIA 3W8EA 1HLPA 1U3UA 1X7HA 1YOVB 3OJ0A 1R0KA 4E33A 1XKQA 3PK0A 3HFSA 3VH4A 1HWYA 4DRYA 3PHIA 2UVDA 1XLTA 3PGJA 3JQ6A 4XYBA 4Z9XA 4QUKA 3M2TA 2B4QA 3D4NA 4J43A 3QLJA 3HQ4O 4XQEA 1QORA 5TF4A 4PRLA 1YVEI 2H9IA 2C5AA 3G17A 1TXGA 1E3LA 2ZYGA 4MVJD 4OOEA 5L51A 1E7MA 3A9WA 3FNHA 4NFHA 3JQ7A 4DIFA 4HFNA 1KIFA 1RM5A 3TFQA 5IF3A 4KDFA 3GVIA 2WEKA 2EP5A 2O3TA 4IQ0A 4BVAA 1HT0A 1ZK0A 3ZWOA 1LSJA 4JLWA 4KUEA 3RUDA 4DVJA 3WICA 5I7EA 2YHIB 5ADHA 4AJKA 3DR3A 4FB5A 1U28A 1UDAA 3H3JA 4CQLB 1X15A 1I0ZA 1ULUA 1HDRA 4IGEA 1YS4A 3GZNA 5B37A 3UICA 5H81A 5T6BA 2GO1A 3ZU3A 3E9MA 1TA4A 1BHSA 3INTA 2OP1A 4P4GA 4RQUA 5IG2A 3K8ZA 2J5QA 1E6WA 2AEMA 3GNQA 5B1YA 4O6VA 3PLRA 3WGQA 3U49A 4RVFA 4IUYA 1EK6A 1PL6A 4TRMA 2AE1A 4E31A 2O2SA 1YRLA 4FQ8A 5AVOA 4BNZA 1QYXA 1NWCA 2GCGA 4IS3A 1OI7A 2GGSA 3K5PA 2F1KA 4E5MA 4TZTA 4CMHA 4QFDA 1PJSA 3JTMA 2X22A 4NK4A 7MDHA 2W4QA 1ADBA 1E3JA 2WTBA 2DTEA 4PLYA 3ONEA 4WNIA 3WB9A 1JTVA 3JQFC 5DF1A 2C5EA 4D79A 5A04A 4BO2A 3QVSA 2J3JA 2Z1MA 4GX1A 2FSVA 5T67A 2VRCD 3NEPX 2Y1DA 4J1SA 1FJHA 3JSAA 1SC6A 3KSZO 4DYDA 3TJRA 3GN2A 2P91A 4DBVO 3IKTA 3ANNA 2EIHA 4CMGA 2AXQA 1KEUA 4HUJA 3W6UA 4BNMA 4CUZA 3CZMA 4PLHA 2DBQA 4MVJF 2XOXA 2OZPA 4JJGA 4OXYA 1DIRA 1X7GA 2PGJA 2QIOA 1K5HA 3RC9A 4NU6A 4D45A 3VC7A
chains in the Genus database with same CATH superfamily
4K40A 1QC5B 1RM4A 5AVZA 1YL5A 4LOJA 5DTRA 3OM1A 4DJFC 5LQCA 1V4VA 1PFUA 1VSTA 1Y4DE 1D8TA 2BFEB 2EP7A 3SC4A 5C8DA 2QBYB 4YALA 3GPIA 1MZPA 3G9QA 1BWQA 4FYPA 1FOEB 4K9SA 2CXOA 4LC0A 1V9SA 5L6MB 4QUDA 4OATA 4BVLA 3WA7A 3A9UA 3E05A 4LI0A 5BSTA 3R7SA 5A03A 2I3BA 3NYWA 4KMSA 5AOCA 2O19A 1Z6YA 5FB3A 1T9GR 3P9YA 3MSCA 3ISVA 1DKMA 3FM9A 4K03A 4M86A 2G6BA 1SZCA 2F8SA 1NC3A 2PS0A 4CI9A 3ZGLA 1MA3A 3V4OA 3W1EA 1E2EA 3AC0A 1TIBA 4MA0A 1K8YB 1IJFA 2I65A 2Q4BA 3EVAA 3K8OE 4NFLA 4EHBA 2R4QA 1OV4A 2LVBA 3MBIA 2DSNA 1O5IA 1GL3A 2HJWA 2GBPA 3BL6A 4OB6A 5A2QA 3DE3X 3GFOA 4Q1EA 2KPOA 4KTTE 3EY4A 1CJVC 3MG9A 3GDOA 3MJ4A 3GFQA 3P2MA 3WMFA 5HIKA 4QXAA 3I5XA 2GJAA 4MGHA 3QENA 3RROA 1F0NA 2E0IA 1PLKA 3QNWA 3M82A 4R5MA 5C2JB 4DANA 1YVRA 1Q6ZA 2PXCA 1OA1A 2WK1A 3F4BA 4IR7A 4RZHA 5BWLA 5EY5B 2C3UA 1QTRA 1T2UA 3RQSA 3DV0A 1N3YA 3VSBA 1H5QA 3QE4A 1YBAA 2X4DA 3BJEA 3FCSB 4TKZA 1OGYA 5LQAA 4LHWA 3OBIA 5KPJA 1VGRA 2JLUA 3MBKA 4KR7A 5LZ2A 4B3SB 4DSOA 2E18A 5JPCA 2X2OA 2BV3A 4V02A 2CWDA 2Z04A 3NH9A 2HSGA 1QVAA 3B5JA 4ZYZA 4ZA2A 5K1ZA 2Q3MA 1JIIA 1MG5A 1RI5A 1SHKA 2JZCA 1BX0A 1RVDA 4O8ZA 2Y1GA 1NT4A 5IAJA 2QX4A 1E2UA 1RVV1 3WMGA 6REQB 3U5TA 3V00A 3KXDA 4FFOA 4L74A 1NXOA 4EECA 3NHWA 3NVKI 2ZVQX 1BNCA 4IDHA 1UJ6A 3RVQA 2V4UA 3KHKA 1ZIDA 2I0FA 4C0XA 4HMPA 2F9LA 4LK3A 3V2UA 3U3XA 2HA5A 1HQYE 2XF2A 3UFXA 3JSXA 3KTAB 5KNDH 1J5PA 2PV7A 3I3SR 3HFRA 1C4KA 3L0BA 3Q6IA 5KYTA 4P4SA 4RZSA 5DX1A 1U5CA 3COVA 3KLNA 4Q4AB 4CNBA 3F96A 5IYZF 2ZJ4A 5FLXA 4LKOA 2QROA 4LE1A 2IXTA 4ZQHA 1MQ8B 2H5JA 4HGYA 1T5BA 4GOND 4E5DA 3OMLA 2JLYA 1DCTA 5AM1A 3PSHA 1P7CA 1HFJA 4Q9HA 3JAMA 3ND5A 2AI2A 3Q3GE 2XZOA 4NOMA 5AJZA 4TQGA 3VDNB 9LDBA 1Z75A 1C3OB 2GEJA 3AUSA 1ULAA 4HX9A 4I6JA 1WPQA 4M36A 4UVGA 4X3PA 5EINA 1OBCA 4GUDA 3TTTA 1JFTA 1NKVA 3NTLA 1XRPA 1G66A 2H2HA 4ARAA 1DP4A 4GH5A 3OIDA 2DE0X 3QLEA 1I2AA 4ND2A 1NRIA 5EXXA 3ZZUA 5IKOA 4AZVA 4MX8A 1OX6A 1EQ2A 2BGLA 1B0AA 4WBNF 5HFAA 1G5TA 3MMXA 3T7AA 7MHTA 4F6RA 4IMJB 2HADA 3CJTA 1JKXA 3D3WB 1KRXA 3LPMA 3X1DA 3LUJA 5DCLA 1U1FA 2OV6A 1NNSA 5TMBA 1W1UA 1ZXXA 5HSGA 1DU4A 1UAYA 3CFYA 4NECA 1B8VA 2AB0A 3KZCA 1XYYA 1N2CB 1ST2A 2NU9A 4QATA 2IW3A 3AI2A 2IY9A 2QYTA 3W79A 2PSJA 2ZCJA 1ATZA 1OX4B 3GLFE 5KO2A 1CIPA 3WQSB 5KHLB 2LKDA 2NYAA 3JRNA 2JCVA 3O8DA 2REBA 1I10A 1WNFA 4IHJA 4LI3X 5JW6A 1J22A 2R6FA 3C8HA 1AS0A 4HQKA 4Z7QB 2C2YA 2RGNA 4J6FA 3UAYA 2IX9A 3GLFA 5J1SB 1D4OA 5I7OA 1BMTA 4AY4A 2R00A 3LU1A 3BQ9A 2W00A 4NOLA 1MB4A 1G3QA 2GPBA 2XI4A 4I19A 3WLFA 3H4MA 2XMBA 2Z5FA 4JL6A 3VR4D 4B84A 2JBHA 4PFSA 3T5PA 2AC7A 2W43A 3A6EA 3UG6A 3W3AH 1Y6JA 2PUTA 3WQQA 1T9BA 4NMMA 5I8PA 1D2NA 4O4HA 2XUHA 4Q1CA 1USKA 4BQQA 1UMDA 4JVLA 2R8ZA 1DL5A 1CQWA 1E2DA 1M2NA 1OFVA 3KO8A 3QG5A 2B2NA 4FBGA 4OHRA 3WGLA 1GQFA 5JRZA 4LGMA 4CF6A 4AZWA 2XUKA 4CF7A 2V03A 2XGGA 3WL8A 2O8DB 4B48A 1U5AA 4LOIA 1ZU4A 3ETJA 3MRTA 1BXRA 1X7YB 2KQUA 5FTMA 5ABPA 1W4CA 1A98A 1NQWA 1KYYA 3F4KA 4PHHA 5A7HA 4F21A 4BO7A 2ST1A 3CLKA 4RDXA 1GTMA 3DZCA 4DIEA 1ZI9A 2W2MA 1C81A 1P4AA 2P30A 3D3JA 1EVQA 3UYLA 3GVPA 4NBVA 1N5JA 1PWYE 3ILHA 3QNMA 4L7VA 3ETHA 3FNQA 5C18A 3GAFA 3ZDRA 3B2EA 4PSKA 4PM4A 1AV6A 3HY6A 4FD2A 4KXVA 4TTAA 3EF0A 3A9CA 3O0TA 5L9AA 3EC2A 1AKYA 4BJ1A 1N1GA 1J9ZA 4HYYA 2JFPA 2ZYUX 4MAAA 1XYVA 1YBVA 4JP5A 2CJWA 1U2DA 3ZJYA 4AJNA 3Q9LA 5CEEA 1EDEA 1A82A 3TBFA 2AEFA 3EEOA 2XB8A 1NBWB 2LV8A 4OX9B 1HFKA 3L0IB 1UZAA 4EQ6A 2CXUA 2EKLA 3PFWO 4K6GA 5I7SA 2V4ZA 4NZOA 5CK4A 1DAMA 2BZ1A 1WXQA 4FQ5A 5EXTA 5F9FA 4MCHA 1V8DA 1WKVA 1HORA 1FTSA 3P32A 1FNSA 4B8YA 2Q3EA 1PR9A 2VTDA 3UUGA 3E0QA 1YD7A 3MCAA 3ADKA 3EGXB 3GEMA 1R4MB 2HLPA 1E2HA 3O4VA 4TSFD 2MYNA 5ELLA 2R11A 1GEGA 4E51A 3CX6A 4UPVA 4ES6A 3KBBA 1C8KA 1DKRA 4FFBA 1Q0ZA 3CO0S 4ND7A 4PLTA 4ADSG 2Y67A 1K9VF 1RYEA 3RS8A 1E1LA 4ND1A 1P2FA 1AQJA 1QO0D 1YZHA 4CLRA 4MVJA 1SU4A 3ZE0B 3THWB 1N2EA 1GDTA 1UBKS 1J7KA 2JFHA 2XNDA 2AQIA 5EKXA 4UJ3A 4ZP1A 1E79D 1HT1E 5JZMA 3A1UA 1H66A 5IJ9B 2A84A 2WT8A 1KBZA 4G0UA 2CNLA 2RB5A 4XWWA 3C6XA 2ZM6B 1TFRA 4IGKA 1ZCAA 2CDCA 1XJCA 4EUEA 2F8TA 1P3JA 5JYBA 4XLLA 2CJPA 4P0QB 2BTQB 5JVDF 3SAJA 4RMGA 4UTRA 2IYRA 4WCFB 2GASA 3O8OA 2ZT7A 1G8HA 4ZEXA 2I6TA 3BBLA 2VSOA 5EJIA 1UM9A 1SXQA 2F1JA 5IEJA 4QXOA 1RBMA 1AGYA 3C3DA 2I3ZA 3L4SO 2P7IA 3C7AA 3K1ZA 4G36A 2DYKA 1JHMA 1JLLB 1N25A 1Z39A 2YUTA 1F0PA 3EA5A 3PE6A 1D4FA 4FHFA 2PWBA 3RYIB 3OSUA 4BIMA 5IU6A 4AXBA 4MUBA 3STXA 3OX4A 4D8TA 3UV7A 4EFNA 1Q1NA 3FPCA 1HDEA 3H8VA 5KSPA 3OPNA 4DRXA 2GM4A 5EIXA 4PX3A 1KQOA 5FOUA 3O82A 4YRAA 4P8RA 4TZ6A 4C4SA 3ENKA 2FSSA 2DY1A 1R4NB 3QE2A 4R1NA 3VO1A 5TPWB 3BXHA 4H17A 2H1FA 3K70D 1MT3A 2P2GA 5KSZA 4V0NA 2ZE6A 3EXAA 4L6CA 3FAZA 1AXEA 4Q4DA 5LWQA 3KZNA 1B0UA 1RC1A 3DEYX 3N0RA 1GTRA 2BGRA 3RAPR 1M1UA 4B9EA 4B09A 3RVOA 1UK7A 1WMDA 1XBTA 2VYND 4FC6A 4FFDA 5KAMA 1PUXA 3K2BA 3LIIA 1P2DA 3ROQA 3Q1KA 5K3DA 4U5QA 4EF5A 4IJ5A 1BD3A 3WDKA 3SI7A 2Q99A 5JSUA 1UT8A 5GGYA 2UXCB 3GFRA 4OXRA 4OMCA 1SCIA 3GP3A 1YR1A 3A27A 2Y68A 3G0CA 4POOA 4GLJA 2J48A 2OCGA 2WJ6A 3M9LA 4ZI7B 1UPAA 3AR3A 3HO8A 3IIEA 2JJ2D 3ZC3A 3C3CA 1P7PA 1B73A 3IAXA 3AY0A 2C5LA 1G1MA 1T0PA 4J0HA 3PI6A 2A0UA 2XLCA 4Y2QA 4LY3A 1W25A 2FW1A 2IJGX 4B3TB 2CD7A 3HVRA 3OUZA 4U3JA 1GGKA 3FDIA 4RZUA 2SNIE 1CEXA 3DQQA 1MQSA 3GGSA 3I64A 1U1DA 3IPXA 3NBYC 3GGJA 4LSZA 1Z17A 4Y1FA 4AO6A 1GL9B 1DRJA 4LXIA 4R2WA 4BX3A 1R5NA 3PT5A 3QMWA 3SHWA 2HHHB 1UMCB 1X8JA 2BAGA 2I99A 1P1KA 2Z2KA 4C0SA 3QEBZ 3CIOA 3ZIAA 2ZTVA 3D8BA 2Q2QA 2XRFA 3LT1A 4BNLA 4G97A 1QIJA 2B1QA 3H2SA 1GPBA 2BFWA 3ND7A 5TEWA 2VRWA 4IZIA 4D02A 2B78A 3R7BA 3OLYA 1P73A 2DPYA 2QQ5A 2ZYDA 3NG1A 2O7SA 3UMRA 5G0TA 1WZEA 3STVA 1J90A 3H2HA 1BYIA 4EW2A 1QG4A 4ZU6X 1HZZA 1RQ2A 3AZQA 4C07A 1BFUA 5C7LO 1O8BA 1APBA 1BW9B 5CYFA 1BEEA 4CQJA 2Q1YA 1FLVA 1FSPA 2ZOSA 2P6RA 3EOZA 4DWWA 1E2MA 1Q83A 2WVJA 2HV9A 4KYUA 1M1XB 4LYJA 1E0SA 3RBAA 2J9YB 4KYIB 3WDLA 5HCNA 3T4PA 1T3ZA 2I6UA 3IUEA 1U0GA 3D5TA 4IUBS 4HNSA 1CUAA 1ZITA 1T5DX 2QLMA 3RTBA 4J8PA 3SHQA 4LGYA 3ZU6A 1R88A 4QBHA 1CDEA 3VNBA 1DAFA 3ORRA 3IEVA 1QGUA 4HTFA 4PG4A 3ANXA 3V1MA 2CF5A 4WXPA 2AFHA 3P9KA 4TWIA 5AT1A 2FUCA 2XAAA 5BW8A 1E8DA 1U2GC 5EJFA 1ZXBA 5BNWA 3OJCA 1UFVA 2DFLA 5DLDA 5DHRA 1NF8A 5D7NA 4QPJC 1K88A 5CURA 4O0LA 3TGPA 2C4UA 4JUBA 1L4UA 2R1TA 3GMIA 3ZI4A 1NMSA 2OAGA 2FJ0A 1GPH1 1VSVA 4RDIA 2ZJ1A 1S4QA 3WO0A 1L1RA 2C2WA 4PY2A 3P7MA 4WIAA 3EGVA 2O3UA 4XW2A 5KYYA 1N33B 3VKGA 2GNAA 4ALMA 3MFYA 4UQPA 1AMNA 4TVBA 4D57A 4JITA 3KQKA 3CLVA 4RA9B 2IZ0A 4BUZA 3IAEA 4H6PA 5F5LA 2A1UB 5F3RA 2GYUA 1ICIA 2BVNA 1MQAA 1CK4A 1KYWA 3TOSA 5LOVB 4Q4JA 5EWMA 3BL8A 3VPSA 2IHTA 4KDEA 1XCMA 2VQ6A 2BMWA 2JAQA 2QHXA 1Z2DA 3HBLA 3FCEA 1HRKA 3T1VA 1E8MA 2IYEA 3OQVA 1H2BA 2O6HA 4ZIRB 5GV7A 4C3OB 3UJDA 3E2IA 4YJGA 3HKCA 3DP7A 4IOKA 4V1CA 2BKLA 1NXTA 1JKJB 2PFSA 2W8BB 2FSGA 4EYEA 3G59A 4LHSA 4M0LA 2F4VB 1ULBA 4PAOA 2ZRBA 1NHGA 3ASZA 4X1KA 2FZWA 4LEIA 3UOWA 4NHOA 1E2FA 1Y3IA 4RHCA 5ICCA 2IEDA 3DMNA 5FFFA 4NEGA 3B1XA 4CWAA 4K1LA 1D4ZA 2Y3IA 3AOEC 3BVPA 3FI0A 3JQGB 1E0AA 5C46F 1QOZA 4XUEA 5GJBA 4EHFA 4RVGA 1CERA 3I6IA 3L0CA 2B4YA 1SAYA 3QVXA 4AY5A 4GGPA 2Q3FA 4A2PA 1RCUA 3P9ZA 1EK0A 4H08A 4PC7A 4ZV9A 2IC5A 1IWBB 3ZWAA 1RJ9A 1PYOA 1P2BA 4LBYA 3G5TA 5G3ZA 4HX5A 3D4PA 4OI2A 1ZZGA 2DT5A 1I4WA 3IIJA 4TWRA 4YV2A 4BV2A 2IPLA 4Y0AA 3UBMA 4Q01A 1XJ5A 3K73O 3H5RA 1JQLB 2ZIXB 4LK2A 3TR5A 3X1ZA 1W73A 1HLDA 2ZUWA 2VRNA 3E9YA 4URWR 1I5OA 1ECCA 2H1WA 1I4DD 2D00A 3DLPX 4FOTA 4WA8A 1OYVA 1PWEA 1RWXA 2N75A 2ARKA 4G84A 1SZDA 2NUTB 2W0SA 1A9RA 2BIFA 4OXIA 4CGZA 1TUGA 3KOWA 2KX7A 4D3FA 2X9NA 1SO8A 1J39A 3BWEA 4KFRA 4RZXA 1X38A 2HCTA 3U3KA 3DHNA 1CQJB 3FDZA 3UAOA 4MKGA 2OMKA 3A3YA 5CT4A 4HLUA 2WYIA 3SLGA 1YKGA 1G55A 4FHEA 1PRYA 3AJ8A 4QGBA 1PJ4A 4IIYA 1RXYA 4YNBA 5AJVB 4N47A 4DB4A 5C31A 3TVTA 4P31A 4BV9A 4EJ2A 1FTWA 1VIVA 2DWOA 3AGPA 3PYMA 5GONA 1VLMA 1KSFX 2GEKA 4PQGA 3RS7A 5ADWA 1FTNA 4LNAA 1I7NA 4HMQA 1M1ZA 1I3LA 1E62A 3GA0A 3WRWA 4NHEA 3OZXA 3OU2A 3G9ZA 5TE9A 5DULA 3RT7A 2CV1A 5EPUA 5HFJA 4UTPA 5JDCA 2WWGA 4DN6A 3WKCA 2HA0A 5KDDA 1SXPA 1YOVA 2F59A 3AY3A 5TQ2A 3Q0IA 1T5HX 2Z6UA 2OHHA 3FPKA 5A2GA 1JEJA 3C8DA 3RVSA 2YMQA 3BILA 2BFMA 2Z2YA 4IMIB 4ZCLA 3ZOKA 4C5AA 4JP3A 4G9GA 3N2GB 1T6BY 3NI2A 4FGZA 2P6PA 3COJA 2RK6A 3K0KA 1S2OA 1D0IA 3TG8A 3LHSA 3BCHA 2BL4A 3ET5A 2HFJA 1G5PA 1IPEA 1JS1X 5JPIA 3WSVA 2XBMA 2ECQA 3BDIA 2VAMA 3GHHA 3IELA 2XCIA 3GGOA 4J7AA 5KDLA 3ZQKA 4F2GA 3FMGA 4RZ2A 5EJ7A 2YV3A 3H5TA 1POWA 1TVKA 3GRZA 2ZUDA 1WQ4A 1C8LA 1PLLA 1RLOA 4PN3A 3B36A 4DA6A 1UFQA 2OCIA 2VPPA 1GFSA 4RYDA 4Y2JA 5JZBA 3K6RA 1K7XB 1LK5A 1GPKA 1ZK4A 3EUWA 4QDJA 1D5CA 3R6LA 1Z7EA 1CY8A 1I33A 2ZPUA 1IXKA 3E7FA 2QRQA 3LUKA 1ACJA 3ZNNA 5JI2E 5HCUA 3HKBA 4N0EA 4KN5A 4RLSA 4IAOA 3V8PA 1UC9A 1UJ2A 3ZLUA 3TKYA 4ZDIA 3HSKA 4W82A 4EW6A 1DC4A 1LQTA 1RYMA 3K0CA 4ZVUA 5F21A 2NSDA 5E6RA 3WY9A 4Y6PA 3NBXX 4C76A 1Q95A 2WUGA 4YJDA 3EDYA 2ZUUA 1K5GA 4RK5A 5FEUA 2ZLBA 4AO8A 4C0AC 2B8NA 2QMOA 1P4HA 2AK2A 4M8SA 1BCRA 2HRDA 3Q2KA 4Q9IA 2DWQA 3GX1A 3TNYA 4DEXA 1FMFA 2AWOA 3VU8A 5AHRA 5FA8A 2I4RA 3GCZA 1VYTA 5HTKA 2A3NA 3H9EO 3IOMA 4RFSA 1YS2X 1XT6A 4M9RA 3D3NA 5DYGA 4Z4EA 1K97A 2JAWA 4B32A 2MYTA 3O3OB 4RV5A 3JARA 1OTXA 1H2WA 4JJAA 2W2PA 2VVTA 4MKZA 1DEKA 1JDBB 2GEUA 4PTLA 3TLMA 3W8RA 4BLWA 1ZJYA 1HFEL 4G81A 3ROEA 4DR5B 1ULTA 2BBSA 2H4YA 1EVIA 4UVEA 3QY9A 1LJ8A 3T3EA 1M6EX 2PK3A 2V5AA 4F2WA 3C1TA 3DKIA 4TS4A 1NXPA 2WIBA 1V3TA 1ZNYA 4I99A 5DHUA 4MR8B 5T8KA 1V2GA 5BR7A 4HRXA 1YQDA 1R0CA 4OO3A 2PEYA 1YRAA 3A25A 2VUHB 2A5FA 2NNLD 2YHAA 3QYFA 4X63A 5FA6A 3UB4A 1UFOA 1JXQA 1J0CA 2YOHA 2IS2A 1R16A 2OV1A 4X7MA 1DUSA 2B4KA 4LDPA 1ZIYA 3VNRA 5C7OO 4QO7A 3S68A 3LL7A 3G7NA 4JLBA 4MPPA 3TW8B 1IHUA 2QRZA 5FH9A 5I9IA 4BXOA 2VNJA 3ZHUA 2VDJA 1XVVA 1YBMA 2VNIA 1A4UA 4WHMA 4C0QC 2XA2A 2VF5X 3ZXUB 3QPCA 4C6RA 3HV0A 2JFFA 2XGMA 1TCCA 2AZMA 3IP7A 4Y2YA 3IVXA 4AJOA 4BPBA 4I3FA 3F4LA 1XDWA 4EA7A 1P2VA 1UM8A 1ZO8A 2F48A 3ZWXA 4CI0B 1GRRA 2P5YA 3P19A 4F5YA 3IKJA 3SPXA 1H3NA 2I2FA 4RMNA 1BDMA 4M22A 3AU9A 3C1AA 1HSZA 1L3IA 2XZTA 5JNTA 2P2LA 4IV8A 3AXSA 3CLSC 4M6WA 1CKEA 4NOKA 4P3YA 4TXNA 5ALQA 3DLTA 1L5KA 3QXHA 3U4QA 5TQJA 1G6HA 4W5HA 1DKOA 3VPBA 2A5DA 3UK2A 4MA5A 1QC5A 3Q6MA 4G8JA 5DXFA 2P35A 1RTTA 3CUTA 1QKKA 5A9SB 1BMFD 2FUG1 1OX5A 2QN7A 4S24A 3TIFA 2G9QA 5CT6A 4AO7A 5A0FA 4MGYR 2ZJ6A 4P86A 5EEHA 3ZHQA 4KRGA 1P1IA 1C7FA 1CB0A 3E84A 4NU0A 4DLTA 1KGSA 1ZVQA 4UQLA 2ZJ3A 3KSUA 4W1PA 2HPHA 1GZ4A 3QFSA 3AFGA 3KTDA 5FBHA 5BYBA 2V98A 5TJHA 2NTEA 2FK8A 1Q0UA 1NYQA 4JI7B 3PHJA 2B8JA 3FOCA 3ZGYA 2Z08A 2WU1A 1IZ9A 3CBQA 4WBXC 1QVZA 2OORC 3VI4B 5JWRA 3RO7A 3BDAA 5L4NA 3EXIA 4B3GA 2P4QA 5GINE 4EY5A 4C7OB 4AURA 1H8HD 1VG8A 3UKOA 1K8ZB 3FB4A 1ORHA 1N6PA 2PZKA 1VZ2A 3LF1A 3MQ2A 2QSUA 1R6UA 3G49A 3HJTA 2Q4EA 3J80A 1ENOA 1XAIA 4RTQA 3VJRA 1V5GA 1OLXA 2W6OA 3VZRA 2HIHA 3B48A 4ALIA 3GC6A 1SR8A 3C3KA 4ZT5A 4BQFA 4JLSA 1U8YA 2IYWA 3E3AA 3UGJA 2QXTA 3EAFA 2B9VA 3DL2A 1OJLA 1GL6A 4TPKA 2ZJ8A 4K9NA 3P9IA 4W5QA 4KGZA 2VQFB 2Q0XA 2YWDA 3OIWA 2WSIA 2QAIA 3MGGA 3QKSB 4L8FA 1NA5A 1XMJA 3CJQA 4MRSA 3M5PA 5H7XA 5A6VA 1ADYA 3H5LA 2I71A 1SC4A 4BNJA 5EJ8A 3EWSA 4F4DA 1XZQA 2VZ0A 4F04A 4B4DA 3E7DA 2DHCA 4QU5A 1BA3A 2GBCA 4RE5A 1XTVA 2GZ2A 3DB1A 1MTOA 1Y33E 2ZI3A 1U3DA 2GVNA 5B3AA 2DCUA 1YHNA 1T29A 5IBRA 4CL0A 4EAQA 3EDCA 2HMSA 3TIIA 1IM8A 1FQOA 4IX1A 2FZ4A 1F48A 1EVKA 3KTAA 2OV2A 3NFRA 4G0YA 4CMEA 2Q49A 4PRZA 3B85A 2AKYA 5F3WB 1WVMA 2OKCA 2Q21A 3JYHA 2GESA 3L49A 4AN4A 5I8ZA 2NADA 1OZGA 2M1ZA 2JFUA 4LJYA 4LVUA 2VHTA 2JAOA 3DDZX 3GFTA 3OCVA 4RNCA 3N86A 2NXCA 2WE8A 3GLHB 3T1NA 3OA0A 4HTAA 4W99A 1ZD4A 5E38A 4G37A 4Q4LA 4QFBA 1JQ3A 1E5DA 1OLOA 3R3SA 1GZ7A 1KDZA 3ZYZA 1T8TA 1J23A 1C3OA 1WE2A 4DJEC 5CD1A 4H3SA 2WTAA 2FR1A 4LPSA 1KVQA 4PZCA 1X8LA 4WD3A 2FGKA 3I73A 3Q7SA 3O75A 1EWQA 4R41A 4RC9A 1BTOA 2PKWA 5EMHA 1OWOA 1DRWA 1T4MA 4B75A 3BHNA 3O94A 4KLNA 3E7PA 3ANSA 3Q8MA 3D9QX 4AULA 2ZCUA 2ECOA 3HHEA 1W49A 1AE1A 3CVOA 4Q9AA 5L6LB 5CIYA 3RADC 4GKAA 2WJIA 4QUIA 4IGIA 1F06A 2P4EA 3P9PA 2E49A 4W5JA 5HGJA 2ZWVA 3VMFA 1P9RA 2PCLA 1PWHA 1YQ9A 5EZ6B 4B74A 1WXIA 2V55B 1YQTA 1F60A 3HCCA 2QVXX 4XJSA 3VR0A 1FPQA 1BRMA 3HCNA 3KJHA 2I8CA 5DP2A 5BVGA 2BZ0A 3AVXA 4B5KA 2VDQB 4RJJA 4O3FA 3K4QA 4RLHA 1YB1A 4UOZA 1QB7A 3HB4X 2X0DA 2HDNB 2CDBA 4KDCA 1T3TA 4BFLA 3PTAA 1SQ6A 2ZS8A 1RYHA 1JDTA 3L05A 5LOVF 4L6AA 3LK7A 4V0MA 2VA8A 1N4AA 3VNUA 3BWDD 5ES4B 1FTGA 2V1XA 4NJMA 2VYFA 3OCYA 2VP6A 3IVCA 2G9RA 1AXRA 1NBOA 1OAOC 1E7RA 1JXOA 4CQMB 2R4UA 3RUPA 5JYCA 2WSYB 2HMWA 4L4SA 4U0KA 4UBKA 4BO8A 3R09A 2MWMA 4IIEA 1PTJA 1ES9A 5LD2C 3W5UA 4NMHA 4WKNA 3C43A 4CF3A 1Q0SA 4EG7A 3WGJA 1SU8A 3Q98A 1MJGA 3AHHA 3LBNA 3LJKA 4PBRA 5J23A 2I55A 1HQKA 3MWDB 3DL7A 3CEMA 4AZ3A 1G8JA 2HL6A 3JQQA 2NVWA 2IU0A 3RHTA 3VC3A 4HDNA 3QFCA 4YMLA 5ICSA 3RYHA 2QD4A 3IO5A 3ZE7A 4HDMB 1VLJA 1EEXB 5AVUA 1L5YA 1Q2UA 2XNSA 1E3WB 5CVTA 1X7YA 4OLFA 1MC5A 1YIDA 2WINI 4FYXA 4IP0A 2B36A 2HMVA 3IT3A 4L22A 4HB0A 4DA4A 2CVHA 2N1MA 4UBMA 1K7SN 2ZRAA 4TS9A 1HDIA 2QRNA 3L7JA 3D8HA 4PZEA 4EFKA 4EUNA 4OYRA 3S2YA 1UBLS 3O31A 3IAFA 4R9RA 3WJ2A 4EPRA 1YZTA 1NOKA 1V16A 2PRKA 1W9MA 2VAXA 4I4TA 4K86A 4OHMA 4XRGA 3PQ2A 4PYIA 5JALA 4F71A 1MRNA 2Q4RA 1Q0LA 3N6RA 1GFIA 2EJWA 4FSXA 1O77A 5AI5A 1BU8A 1Q22A 1CQIB 2XGSA 1O3YA 4X9XA 3RYTC 2DHEA 1P0PA 3WI7A 3K2QA 4DR1B 4YLEA 2VJMA 3E03A 5GQSA 1VJTA 4JYZA 3O74A 3LRXA 4D8XA 3FNIA 4GRDA 1FVOA 4K0KB 2CY0A 2JGLA 4KHPB 3BRQA 3SJUA 2HLDA 4JLUA 1IJBA 1CE8B 1JYSA 4JQOA 4LJ5A 1I7SB 4P53A 4MW6A 3U16A 2UVPA 2BYTA 3LDGA 3TCNA 3ZNPA 1LFAA 1SCQA 4XB6B 3WRVA 2UYGA 3NHJA 1SCUA 5DBGA 3P5BA 1Z08A 3JZDA 3LLMA 4UE6A 5IM4A 3TGLA 4LF5B 2JDIA 2GZSA 3T99A 2WC1A 3QUTA 1KEKA 1PEDA 1NV8A 5EUMA 4YREA 4DC1A 1ZIPA 1NLMA 1J5EB 3GRUA 4HEJA 3BQMB 1V7QA 2UUCB 3O4JA 3AVQA 3P20A 2ZR7A 3IQDB 4KQ9A 2DH6A 4WLEA 4YO7A 3SNHA 4YRCA 2X4GA 4H7HA 1KQFA 4CXMA 2XRZA 2NYUA 3N07A 2Q4TA 3G9TA 4U7DA 2QRVA 5C0OE 4GOJA 1F9AA 2X1VA 2VRBA 1RHKA 4JASB 2IF0A 3RVBA 3B1KA 3JYQA 2J41A 3EC7A 4TXJA 3REOA 1N3BA 4FLEA 1KKLA 4IDEA 2HH9A 1IN5A 3ZY4A 1R0BA 1UBFA 3DHEA 3PGMA 4IRUB 4L8VA 2CFOA 2PSFA 3B2QA 5GZ6A 4A0FA 4ZK6A 2WIJA 4ZYTA 2BD0A 4QNMA 5IJ9A 3AP1A 2Y77A 3CNNA 3U4GA 1CUUA 4UE2A 1QVVA 1R6BX 4MWBA 1NHWA 1ZK3A 2O3QA 4DCVA 2IHZA 3DA8A 3C39A 3RC7A 1RLMA 4GNRA 4L9RA 5KJCA 2XKBA 2E82A 2YIJA 3EC1A 1QWSA 3OD1A 1GRQA 1M2JA 1IVYA 1E2GA 2BTQA 2R8OA 4L8YA 4MH0R 5D3MA 4Z6KA 5DP1A 5J43A 2HX1A 3GUYA 2I6XA 3K0FA 4JROA 4Q34A 3RSCA 4L50A 4TXHA 5ILGA 3SDZA 3SJZA 4RD6A 5EOVA 3HPRA 4Y1GA 1JN0A 4AJJA 2ACEA 2GPWA 1KFBB 3WYNA 4WOKA 1KE1A 2I4MA 2O3SA 5H5JA 2FPLA 5AVSA 4EL5A 1J1UA 2CHGA 3A06A 3OWXA 1NBEA 1T9ZA 2OGZA 1JLLA 5B57C 4U2CA 4Q0MA 3JWPA 2A57A 2QP9X 4HZGA 3RYIA 3NYQA 4CTOA 4OK6A 4AVYA 1J8VA 2CLIB 1CDOA 2D1FA 3LKZA 4Z1MA 1M6HA 2XZLA 1QBKC 1QZTA 1F1BA 2ZB2A 5C8XA 4N8DA 2E3JA 2GM9A 4LJAA 1Q0HA 3OEEA 2IYPA 3WGUA 4FE7A 4Z7NB 3OOJA 2FG5A 3K4HA 4XI9A 4D43A 4LZOA 4MV6A 1A7AA 3PP8A 1VZ3A 2VDRB 1PD1A 5TPWA 1DRKA 2CLSA 2IXEA 5AXCA 3W4KA 2E6KA 2QU7A 3TINA 1TFUA 3TDMA 2QM0A 3RRMA 3VKVA 1B15A 3T4EA 1ACLA 1BVRA 3EXHC 3QJYA 1T9CA 5IKXA 2FX5A 2ZJZA 4RGBA 2E85A 3T41A 1W581 2GB4A 4PG6A 5C80A 2BPOA 4OK5A 4PLPA 3FYDA 2I33A 2ZYHA 2C5GA 3AJ9A 2P9GA 2O7RA 3TTWA 3VR5A 3BYZA 4W5WA 4BQPA 4V0LA 4H16A 4PS0A 5ALOA 1KRWA 1E1QD 2H31A 1X8KA 4KWHA 1Z07A 3O1LA 4OD0A 4RKWA 1QNLA 2FSUA 4XCQA 3V7YA 1J2YA 3CKMA 2PWAA 5KIAA 4PFKA 4UVIA 3KRTA 3ENWA 1ATIA 1ZBDA 3U7HB 3LD9A 2BFPA 2AR9A 2E4XA 3HABA 3VZDA 2ODEA 2ZUBA 1NYRA 5AYVA 2NSYA 2AKAB 1DIOB 2X58A 4GX5A 2Z6VA 5T4FA 1NVGA 3UJHA 4DCNA 4UTVA 3KYBA 1XCOA 4F46A 5LUAA 3AVOA 3MUOA 4JFAA 3FA2A 2VA9A 2HEIA 3SX0A 4LF4B 3ZKWB 1YZKA 4RD0A 1K7YA 5EWLB 3NXKA 3S4YA 3HY4A 1WMFA 5U4QA 1UC4B 1KU6A 3QHAA 1EVEA 5FQNA 3W2GA 4Q47A 1P75A 1ZJJA 1C9YA 2QVCA 5GPBA 1GVNB 1HE8B 2R3SA 4UAUA 2NVUB 3USES 3HNOA 3R1IA 4NE2A 2B6HA 3WBBA 3MS2A 1RXCA 1J0AA 2PD6A 3SQDA 2PGNA 2YWJA 1PHRA 1U0NA 5J2TF 3R7NA 4B3XA 1EP2B 1PZNA 5K7SA 4I9FA 2WICA 5EGSA 3RWBA 2Z2JA 3ZYCA 4XJXA 4CR8A 3C8UA 1NBIA 3H9QA 2NXJA 2WU4A 1BW9A 2GZAA 2XAUA 2ZAYA 1QP0A 3UMYA 2GRAA 1BHJA 1T0HB 4TMVA 4F1WA 1VJ1A 2O3RA 3FWZA 1TVCA 3N8NA 1TM3E 4LNHA 4AMUA 1PLJA 2FJUA 5E9AA 4YCNA 1O6ZA 2JIBA 2BCEA 2OAQ1 1XDBA 3OPQA 4M0MA 5H59A 1QFYA 3MB8A 1RYDA 2JK1A 4O59O 5A5GA 1NRXA 1AGNA 4P5DA 2Z43A 3GR6A 1LPBB 4I9UA 3TPCA 4Y6GB 4DR3B 2I2BA 5ISMA 4XA8A 3HJGA 2RBGA 1U6KA 3ZTWA 1R0WA 3QPAA 4ZVVA 4R0VA 4R8SA 4MQUA 3V9PA 4BNDA 1ZD2P 3ICCA 4K9QA 4UTOA 4C6TB 4H0CA 2Y27A 4D99A 3IQHX 1A5AB 3RF7A 5E9WA 2FRDC 2XNHA 2BSQA 3JATA 5H9VA 2VJNA 1L4LA 5CA0B 3HYLA 5DB4A 2R6R1 1ADGA 3KKQA 4M9XA 2V6BA 2B8TA 1T3SA 2P79A 4TKVB 1FRVA 1K5DA 4QUHA 3QUBA 2FPGB 3LK6A 2F3TA 1WBDA 3ZGVA 3F46A 4MCAA 1RZRD 2HREA 4RA9A 1I4LD 4KV7A 2R66A 4MO2A 3GYGA 3SX4A 4DLXA 3JRWA 3L7LA 4QHSA 1KC3A 2GLXA 4ZAXA 4DLAA 3ZHYA 3FWKA 4U2DA 2IYLD 1SHTX 3PZRA 3RRFA 2PFGA 4GOLD 3HJRA 1R00A 2IEAA 2H7CA 4MLPA 1NQAO 5E4TA 3MAAC 4D9FA 2DJIA 3FWPA 2EWMA 2CFCA 3TKAA 2FP4B 1NF3A 2HA2A 1CWUA 2PX3A 2G08A 2QTMA 4MVJG 2DFTA 3IBSA 3FPBA 1W85B 2ZU6A 3OZDA 3QEOA 2DKOA 4XYGA 3ROZA 3PDIB 1DUIA 1U9ZA 3DF7A 1JFFB 2FN3A 1RCTE 4PYMA 4RD3A 1QHXA 1YCDA 2R8YA 4GE3A 4NE9A 4GBED 3W6NA 5EMNA 4G1VA 4Q4CA 2EKQA 4LV6A 2WQ6A 4BGEA 2BEUA 2JKZA 5DE3A 3W9SA 3LZDA 1WLYA 3HDQA 2ZWAA 1QWOA 1E7SA 3B3QA 3V2IA 5GJWC 4GZ5A 3ZI0A 5BWOA 1SXGA 1K7CA 2J3HA 3BA1A 3DCNA 1MJ5A 1DO2A 4MR9B 2IITA 4YRGA 2FQXA 3U7QA 2EU8A 3DTYA 4QJBA 3H3FA 4RA6B 2GN8A 1YR9A 3U7EB 3GA7A 4W5OA 3SQMA 4JR2A 1GEEA 5HVNA 2BKUA 4ZKDA 3FNGA 5BNZA 2PQ6A 3EZ6A 4FGSA 2EQ5A 1E5TA 2H5LA 4DKJA 4F4FA 4UREA 1GGVA 3TTXA 2WWRA 1INLA 4MCIA 4O1HA 2I1QA 4XGKA 3X1WA 1LNQA 3VGPA 4E46A 1NXVA 2JFZA 3CF0A 2OB1A 2AOTA 2DSTA 8ADHA 1O94D 1PS8A 1DIBA 2RI1A 3IRVA 4M60A 5BXYA 5KNBD 2FN4A 3NBZC 5GOZA 5DX0A 3X2EA 3N2YA 2G06A 1SKYB 3DTVA 4NMWA 5T7BA 4DDUA 1EFPA 1R5OA 3SC6A 3ZHSA 2PO7A 2X40A 3EMVA 4AX8A 5CBKA 4D41A 4P0TA 1IY0A 4I50B 2IE8A 2CEKA 2HSWA 3BRWA 1Y63A 1YI0A 4MCJA 4B35A 3FMOB 3I72A 3LPNA 1TVMA 1C1DB 1JVSA 4Y18A 2PA0A 2JLQA 3SZUA 2WDPA 2OCAA 2WMOB 4RGVA 3ZGZA 2IYQA 2C4VA 3A2MA 4GR9A 1SOMA 3MK31 5MN6A 1UJ4A 1VMAA 5E3HA 3ZV4A 3HJFA 4AJIA 1M3SA 3ILSA 3SS9X 3PUWA 1TJPB 4LVCA 2ONJA 3WK4A 3TXYA 4IJMA 3QBTA 4RPGA 4E5YA 4QX6A 3DEJA 5FUXA 1Z37A 4QGSA 2WNSA 4CL2A 4GC5A 1TJ3A 1SRRA 4LIPD 1EGHA 3N2GA 2C8JA 1I6LA 2CUKA 2X23A 3DTNA 3S8EA 2NM0A 3DEFA 3BBPA 2IT1A 3LLCA 4EAAA 3AL3A 4W9NA 2QLBA 1O0SA 3DCIA 1XALA 1GSOA 2CKDA 1QYRA 2WPDA 3A6JA 2P62A 4O29A 1QOPB 3C5HA 4PR3A 4FWIB 4QHYA 1F5SA 3L6CA 4AUKA 1IEVA 3LCVB 4GU5A 4Q02A 1AU9A 1EVJA 1OYYA 1E2JA 2C4HA 2RCYA 4Q1DA 5K03A 4BLRA 4UDYX 3SQNA 3CRMA 3KLOA 1IRIA 3H0EA 3OWOA 5JXJA 3PL1A 1N9ZA 4GEGA 2V0NA 2OXCA 4CCYB 5ICGA 4DDTA 2QTAA 3JQ9A 4JXJA 4MJ7A 3S8YA 2HA4A 5HKBA 3W5BA 1F8FA 3NVAA 4M53A 5K6AC 2HD4A 1W5EA 2VLIA 3S5JA 4JJ7A 2CZQA 2EL9A 3ZWQA 3M6FA 1Z5NA 3SM9A 4D0LB 3IUQA 5F2OA 3TOZA 1D6NA 3PR2B 1WD7A 4NDNE 2X15A 4NBLA 2PO5A 3EWAA 3AJRA 3M1AA 1W6RA 1XMIA 4IWXA 1L5HA 3AZPA 1ADFA 3D6JA 3RFFA 4OHXA 3MT7A 3QVGB 1JIVA 4FWBA 3WWOA 2A2ZA 4C0JA 3QKRA 2YQ4A 3VKHA 1R8QA 2P3SA 4LECA 3I5AA 4UBNA 2QK4A 2FWJA 1U1GA 3INNA 2I8LA 5LYYA 4AJHA 3HKDB 4S0XA 4OJYA 4O4JA 4A8PA 1M6NA 5JSHA 4IJUA 3KB6A 4HNVA 3P71T 1E1KA 1FL9A 1P5JA 3QXSA 1WW3A 4C7KA 2YQZA 3GJZA 3WLKX 3N1UA 4PYNA 2BGKA 1YJ8A 3WMEA 2O6LA 5BQ3A 1OPXA 5BV2P 1C1YA 4RETA 3BXFA 1ZVVA 3PC4A 3AK4A 4IZOA 1NAIA 2F3UA 4L51A 4YRZA 2J0QA 4TS1A 4ND6A 5BOSA 3KFXA 4PPFA 3NHSA 5T57A 1O9BA 3BFKA 3JALA 3VR2D 4C4RA 2HJSA 4GQBA 1FS5A