2QP3A

Identification and characterization of two amino acids critical for the substrate inhibition of sult2a1
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
284
structure length
267
Chain Sequence
SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNIKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKEYVVDKTQLSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Bile salt sulfotransferase
publication title Identification and characterization of two amino acids critical for the substrate inhibition of human dehydroepiandrosterone sulfotransferase (SULT2A1)
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 267
sequence length 284
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2007-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qp3A00
3THWB 2ONJA 1GNPA 1Z47A 2ZEJA 3IBGA 5FPYA 4LUCA 1CBUA 1P4SA 4XJXA 5FPHA 1G8YA 3EZFA 2OBMA 1H65A 3DZDA 3IUYA 1MO6A 3UATA 4OHWA 5KHOC 3NBFA 5JWHA 3B9PA 4IDPA 4D6PA 2ZRPA 1IN7A 1U9IC 4OHZA 3AVYA 1G291 4TMZA 4ZIRA 4X8HA 3ADDA 2QL6A 2OAQ1 3LFUA 1E0KA 5BYJA 1HEIA 2V6JA 2X2FA 1GRRA 1GG2A 2IL1A 4C30A 2FFQA 1XJCA 4Z8XA 1UKVY 1SXJA 5HE9A 5TY0A 3U2QA 4B6FA 1SXJE 1VDZA 2WWFA 3DZ8A 4MGZR 4ZPXA 2B6HA 4IW3B 2OFXA 1ZC3A 3DKVA 3ND9A 1U0JA 1UJ2A 2NO9A 1DAEA 4JLJA 2P6RA 3E1SA 3NVAA 1NP6A 2BBSA 1S9HA 2OBLA 1W48A 1ZD9A 2OM2A 2IBMA 3THYA 1XMVA 2H7VA 1TPZA 4I99A 5EXSA 1LF0A 1PZNA 1X1RA 4N3NA 3GLGB 2F1IA 4JLPA 2XTMA 4FD2A 5L3SA 1A7JA 1XU4A 2ZR7A 1KMHB 1B23P 3FKSA 2REXB 1T3SA 2BMDA 1N5JA 4IJMA 1WDTA 5E7MA 4RZ3A 2FGJA 4Q1CA 1EGAA 4AURA 3C5CA 2EFCB 2MMCA 3CNNA 1AKYA 2KJQA 1W44A 2I4IA 1VKJA 2NZJA 2A5GA 3HP1A 4I1SA 3QVUA 3I92A 1OXVA 4WXRA 4QGGA 1OF1A 4HB3A 1RJ9B 3H4MA 3UKDA 2D4HA 3KUCA 4XTRA 2DWOA 2KE5A 3AVQA 2XXAB 3ZQ6A 3ASYA 3U3OA 2ZRLA 1G8HA 4IOMA 1CU1A 1YJ5A 3K0AA 3PEVA 2QTHA 3ICQB 1XP8A 4JKIA 1KK3A 3A8TA 2GJ8A 4KBFA 2JLWA 1Q1EA 4PZYA 4DLXA 4GL2A 5FTNA 5J40A 1IXSB 2CHVA 4XWAA 5EXXA 2WKQA 4A15A 4QHSA 2WVJA 4H1UA 3AVUA 1FMLA 3TW4A 2GTPA 4H9GA 1TNDA 4CRWB 1KI4A 5CYOA 5G40A 5JWRA 2ANCA 1Q20A 3SI7A 4PAMA 4CEIB 1G8GA 1XWIA 2J0QA 4NL4H 3CKLA 3TR5A 3B1YA 3I4LA 2OHFA 1OKKA 2CNWD 2ZI6A 3O8RA 1P2VA 5GVRA 3UMFA 4A92A 3GMTA 4HATA 4IFBA 2IYSA 1M2OB 4A0GA 1KTVA 1P9RA 1R0ZA 2BOVA 2OAP1 2VP4A 4OI0A 1AK2A 1GZSA 3NH6A 2Q3HA 2MSCB 1Q44A 2IS6A 4O0MA 1D2MA 1HQCA 5FBRB 3TAUA 4NYIQ 4XWKA 3GLFB 2P3SA 3CX8A 3B2EA 4PXAA 1P2UA 4BRWA 5FBWB 4ZI3A 3SBEA 1N5KA 1ANKA 1AKEA 3UMRA 1KDOA 4V0OA 4EDHA 3QKSB 1ZNZA 2ONKA 2YHSA 4DRZA 4DT1B 1VHLA 5JI3E 2XZOA 4TYQA 2KI5A 2QQ0A 1Z2AA 1G41A 5KOYA 3OFNA 1ELOA 2PBRA 3OZXA 3FDIA 2Q3FA 3RS7A 2GXAA 3O8DA 3U3KA 2QP9X 5TVKA 1KMQA 2X77A 5JS7A 3LVRE 1KO7A 3W34A 5A0FA 2XAUA 3CR8A 4G01B 1FNNA 4FMCB 621PA 1AS0A 3SJBA 3A4LA 5CLLA 2J3EA 1Q57A 4FMCF 4RD3A 4EJSC 1G6OA 3DM5A 1SVKA 1YVDA 4JLBA 3W8NA 1DAMA 2CHGA 4BFYA 4DXAA 3I32A 4RFVA 2J7PA 4BFXA 2G0NA 1F6BA 4QNRA 3EIEA 1F48A 3LNCA 5IRCD 4TL7A 5GJCA 1WCV1 5LPNA 1EFCA 3IILA 4JYCA 2J59A 4RKFA 5JJLA 3UXMA 5JBQA 3CRW1 2QEQA 1H8EA 2G6BA 4LYJA 5FBQB 1VCIA 2FPKA 4HAWA 3T1OA 3ETLA 3HJNA 2F1HA 5SZIA 4WW0A 3T1TA 1JQLB 3WBKA 1EG7A 4NYJQ 4QG7A 4DEXA 4YMTA 2CVFA 4LRWA 4Q02A 2W6IA 2GEDA 2VSOA 5CM9C 5EZ5A 1GRNA 1YZLA 3GJ3A 1Q3HA 4KCGA 4PPQA 3T1QA 1P62B 2V54A 3IO5A 1N6PA 5HKKA 3GLGE 5E3HA 1RRCA 1E2KA 2P6UA 5AUPB 3ZS9A 1I4LD 4QNMA 2VP5A 3PXGA 1AGRA 4KXFB 1WMSA 3EZ6A 1T6NA 1G9XA 4MDFA 2Q3MA 2G83A 5A5GA 1G3RA 5GVSA 4GT1A 1UEIA 4D0LB 4JKYA 3WYFA 3ZQJA 2H8KA 1JPNA 2ZRFA 4FXPA 3ZVNA 4G3XA 3LX5A 2DFKB 1OYYA 1P9NA 1T0HB 3JZMA 4TQ9A 1SQ5A 3K8YA 4HB4A 3A6PC 4CW7A 4Z1MA 2DWQA 2EFDB 3BFVA 4X8LA 1U0HC 1OIVA 4EQ6B 3CONA 1XMJA 1M7BA 1PVOA 1L4YA 2IYRA 3P4YA 3FMOB 2P65A 4XD7D 5FR1A 1M6NA 3AVVA 1OLOA 2GZHA 2GWHA 4DKXA 5JFGA 1VIAA 3PIRA 3U7GA 1P9WA 4LOAA 1NVVQ 3ZJYA 1MOZA 2R6GA 4BECA 1RYHA 4R71A 1G8PA 2OXCA 3X1WA 4BFUA 1P2TA 2X19A 5E7IA 4BFTA 3L82B 1KSGA 4CEIA 4GMDA 2QMHA 4RD2A 3LVQE 3VR6A 1VCNA 4IOLA 3W3ZB 5F3WB 4LWZA 4FI3C 1Y63A 2W6JD 3RS3A 1JR6A 1NIPA 1GVNB 4HDOB 1QHHB 2DBYA 1MABB 4OHYA 2IS4A 3FFAA 1J8MF 1W36C 4KYUA 3CH5A 4U00A 1CR4A 3AUXA 1KI7A 2VRWA 5EP2A 3SN6A 3AUYA 1II0A 2ZUBA 3PEWA 3BK7A 1Q22A 3GLFE 2W58A 1E2NA 4EJSB 3TSOA 1E9FA 3K70C 3KFXA 2RCNA 1E2LA 1E9CA 4TLEA 3GFPA 3R9XA 1FP7A 3TUJC 4QJ4A 2ODBA 3VR5A 2HLDA 3AB3A 4DT1A 4CEJA 5IF9A 1S96A 2RMKA 1DTSA 1FFHA 2NGRA 3C8UA 4N1AA 3CH4B 2OESA 2XNDD 1YZUA 3B1XA 1BMFD 1KKLA 3QVVA 4PHHA 1HT1E 4KVAA 4DSNA 2ZRBA 3P4XA 1WF3A 1IJFA 1DBSA 2CL6X 4HYYA 4RVCA 1GILA 4HAYA 1TQ2A 2H17A 3LDAA 2D7DA 2ZPTX 2BCGY 5JJIA 3K0FA 1FX0B 4G5QA 3SYLA 1W49A 3ONWA 3UPUA 1M74A 1IY1A 4X8MA 3RRZA 1JALA 4LBWA 2I1VB 4IOKA 4EKDA 1Z0KA 4FMBB 721PA 4HUTA 1XD8A 1YZTA 4D0GA 2JLUA 4Z54A 4NKRA 2ZVQX 3ASZA 3K70D 4IEIA 2DFNA 2P5TB 4GFDA 2WJJA 4JLKA 4KFUA 4OBEA 5E7JA 2ATXA 4Q7KA 3I5YA 4RCZA 1IN5A 2ZR9A 4JVMA 1G16A 1DG3A 2HDNB 1E98A 3NH9A 1XDBA 1GTVA 2HXSA 4CF7A 1Z28A 4DUGA 1G18A 3OHMA 1OFIA 3SJZA 1GUAA 4B73A 2C04A 2ZJ2A 3G0HA 2QENA 2FFHA 2HCBA 4LJ5A 5AJWA 3PENA 4MYCA 2IYTA 4KLZA 1YU9A 4DDVA 2V4ZA 1KSFX 1G3QA 2G3YA 4C0LA 1VMAA 3DPUA 3F3YA 3LO5A 4LJYA 1T3LA 2PL3A 4YDHB 1E1QD 2WSSD 1EK0A 4RY2A 5F2EA 4GPTA 2ZYUX 4IXNA 2BC9A 3WXMA 1U94A 5FR2A 4R2HA 5TDHA 1IN6A 3VTKA 3NKVA 2XITA 1AJEA 2AL7A 2JLXA 3FMPB 3REGA 1TEVA 2E1RA 2J5XA 2G77B 3V4RA 1AA9A 3T06B 3RHFA 2J0UB 5FTMA 2HT1A 3LBNA 4YMUA 2Z6VA 4EQ6A 5EE1A 3AGPA 2OE2A 3LBIA 4PPNA 4G1UC 4TMVA 3IEUA 4HUQB 4LC1A 4M2LA 2G0TA 3WMEA 2GJSA 1G20E 3MGCA 1AM4D 3RWMB 2NZ8A 2VP0A 3RYTC 2VP6A 2G9NA 2KSQA 4FCVA 5AJYA 1JEDA 3KJEA 5KDLA 4A4DA 3A1SA 1F2TA 4KVGA 1SGWA 2PLRA 1Q1QA 5SZKB 4LHYA 4DZZA 1XTSA 2GCOB 1TADA 4W7SA 3UK6A 4ERNA 4ZDIA 4C0KA 1W36B 1DO2A 2ZE7A 3P27A 3GEHA 1XTIA 2CBZA 3PEUA 2GCPA 3A4NA 3GJ8A 5BYKA 1Z6TA 3BH7A 2VHTA 1EFRA 3OF5A 2GJAA 1BOFA 2O0JA 3CF6R 4OQXA 1GRQA 3Q5DA 2C8VA 2HXYA 4MA4A 4TYWA 3DMNA 2QTFA 3K09A 4V02A 3QF4B 1XPUA 1Z0AA 2QE7D 1MT0A 4FWTA 1RRFA 2CJWB 1ZRHA 4NE2A 3FGNA 1P3JA 3AF3A 3P1JA 3OAAA 1UDWA 1MABA 2PX0A 1R2QA 4A0HA 2QMEA 3PUYA 3WMFA 4DSUA 1ESMA 4WZAE 4ZCIA 1TL7C 4Q19A 5FTKA 3IPXA 5LD2C 2ZI9A 1Z8FA 2WJYA 3KJHA 4I4LA 2GRJA 2ZI7A 2CLCX 1NVUQ 3ADKA 2QRZA 3NBYC 4G5SA 3TQFA 3OIYA 2IYZA 2C9OA 2Z5FA 3IDQA 3NDPA 1NSFA 1R10A 2FZLA 3LW8A 4B3FX 1GKIA 2JASA 1HYQA 3W90A 2UKDA 2VHQA 3HR8A 3S1AB 1AZTA 2AHOA 1IY2A 4B3DA 2WWWA 1QG2A 4DSTA 1RE0A 3ICEA 3B7GA 4D81A 5FPSA 5HTKA 3VR3A 1CKEA 1W7AA 4MUBA 1JJVA 2VO1A 3KXLA 4JZKA 3FKSD 3QI2A 5EP3A 2ZITA 5K8IA 1E2PA 1G7RA 2ATVA 2ZS9A 1G3UA 1TF5A 3BBPA 1G5RA 3L8ZA 3LWNA 2VIIA 3W8RA 1JR3D 1ZU5A 3BRWD 3LAWA 1KI8A 1XCPA 2OG2A 4QBHA 4BPBA 2QY9A 4TQAA 3TGPA 1FX0A 4V0LA 3W6OA 2GF9A 4NMMA 3ZZ0A 4LDJA 1GNRA 3I72A 4QOSA 4F4JA 4GDFA 1IAQA 1YZKA 2ZRJA 4ABYA 1S3SA 3U7EB 3TSWA 3DO6A 1T8UA 1CP2A 4F92B 4DDTA 4TT3A 1TF7A 1XXHA 1OHHA 3GLIA 3A36A 4C0AC 1KI1A 1XXHE 4HDCA 1OSNA 3GLIE 1WBBA 5IHPA 2IT1A 2P0EA 4K81B 2JIZA 1S0UA 2VQSA 5A4JA 4HEJA 4C0JA 1AQUA 1Z6GA 2CCJA 2ZYTX 4RZXA 3CM0A 4TL9A 5DSZA 3DEFA 5JRJA 3GFTA 3T5GA 4C2UA 3QOFA 4PQFA 1KZGB 4UNNA 3KQUA 3KB1A 3RWOA 4D26A 1RW4A 4QGAA 3L0OA 1G3MA 1MO3A 2QQEA 4QHTA 3NWJA 4TTPA 2WWGA 1OKKD 1CULC 3TAHA 4PO9A 4F91B 5F9FA 2ZJAA 2OBNA 3TE6A 3RS0A 2K5UA 4IHQA 4LJ4A 4MDEA 3HU1A 3Q7QA 3GLHA 1JECA 1QRAA 1N5IA 3WRXC 2J0UA 4XIGS 4Q1DA 1T5IA 3B85A 3SC3A 4V03A 3GJ0A 1KK1A 5KPJA 2JLQA 4C4PA 4D4JA 4ARZB 5F9HA 4WXPA 4E07A 4URXR 2AKYA 4EIWA 3REFA 3HDTA 2ZJBA 1COWA 1ZIOA 1DVRA 3WYGA 1CR1A 2VHCA 1NBMD 1ZJ6A 2GCOA 3QEOA 4LZZA 4LBZA 4JIMA 5D3QA 5JSZB 3BC1A 2QM8A 4Q9KA 1JXOA 2HV8A 2QP4A 2N42A 3TW8B 5LD2B 2BJWA 2VTKA 1EXMA 2GDJA 2ZI5A 5KNDA 5BXQC 5AK0A 3VR1A 3V00A 2XZLA 3AVWA 1Z63A 4AK9A 4IVPA 1IHUA 1UM8A 1GFIA 2QA5A 3LLUA 4Q1FA 2Z43A 4DHEA 2B7BA 2KBEA 4OHVA 3QF4A 5LB2A 4OQLA 1J99A 3IHWA 3EWSA 4Y0VA 3CWQA 5B58C 1Z5ZA 1LTQA 4DBLC 4AYTA 1CJUC 1QHGA 1SKYB 2OT3B 2Q9AA 1N0UA 1W46A 2GZAA 4B74A 3GD7A 2C9CA 2FZ4A 1Q1BA 1P2SA 3EPLA 2JATA 2YOFA 4P4UA 2VBCA 3CNOA 2DFLA 5EE5B 1H8ED 3PITA 2ZI3A 3Q5EA 4DIEA 4MGYR 4BASA 1TTTA 4WAUA 3RRMA 1XD2B 4LJ6A 1W4BA 3RSOA 3U7FB 4MUAA 4OHXA 4B44A 3IGFA 1XMIA 1UBCA 4MRPA 1NVXQ 2W6ID 2FX3A 2IXEA 4F7WA 1B0UA 2JDID 1M8PA 4US1R 3K9LA 3SOPA 1RZ3A 4BEBA 4QJ5A 5CK5A 2GA8A 5FPKA 5HKKD 1FQKA 3CRRA 1TAGA 2G1JA 4LV5B 5HZHA 1D9XA 1E9BA 2H57A 3BH6A 2RGDA 1OE0A 2ODEA 1Q1ZA 4Q1AA 3ZVRA 2OCPA 3R9IA 2ZRIA 3C15C 3IQWA 1W5TA 1RPZA 1M34E 4BE7B 1VG0B 1JAIA 2CK3A 3KZ1E 4DSOA 2J9RA 3ND8A 3H2YA 3CF0A 2RGGA 4Q4HB 2VP2A 4WVFA 1J90A 2QRNA 3CRVA 521PA 4Q4AB 3WNBA 1KKMA 5B64A 3TMKA 4B3XA 4Z1MD 1C4OA 4A2WA 4KITB 3K0SA 1X1SA 1SVIA 2GETA 1IONA 5DN6A 4I81A 2IWRA 4AYWA 1N3BA 3SE0A 2MSEB 3UWKA 2CMKA 2PJRA 4KFSA 2DFTA 4TLAA 1U81A 1NSTA 2B21A 3B60A 5KSYA 4JYBA 2ZJOA 3BFXA 2ZRMA 3BXZA 4IKEA 2ZYWX 2IUUA 5K8LA 5L3VA 4JVLA 1CRQA 1AS3A 1BKDR 2H92A 2VSFA 3HR7A 5AJXA 3IKJA 4NYMQ 4MKIA 2HUPA 1KAGA 1QVRA 5IK2A 3TSZA 4N0EA 3VX3A 3QKRA 3NXSA 4DCTA 4MRVA 2RGAA 4QGHA 3OESA 1KI6B 1E79D 3CZQA 4O25A 2V1UA 2NO7A 3KJGA 2OV2A 4LJAA 2DY1A 3TKLA 2V55B 1Z0FA 3ZIAA 3O8BA 4M22A 2ZAOA 4JVSB 5DYGA 2CVHA 5CYPA 2KBFA 3ZVLA 4ACAA 3NIBA 1OH5A 1SVLA 1TUIA 4GI7A 4YMWA 4KLNA 1VCMA 1VYUA 2IF2A 5EXTA 1ZVQA 4AKGA 1QHSA 1KSJA 2BMEA 2IHBA 3CF2A 5FPTA 2VEDA 3B5JA 2F3TA 2WZQA 1GKUB 3X2SA 1X3SA 2AX4A 1HY3A 1DG1G 1ZM4A 2XOKA 3R7WB 4EUNA 3MSXA 1M1YE 1NF3A 3RLFA 1I2DA 5JRZA 3FE2A 2BM1A 2V9PA 2OCYC 3N2IA 2JLRA 4Q9HA 4PR0A 1U98A 3K9NA 1YQTA 4HAVA 4HB2A 3AKCA 5TV2A 2XJ4A 2IYUA 2O8DA 2QPAA 4IXMA 5DIFA 4HLQB 3E5HA 5CK4A 3FOZA 2BMFA 3KQHA 3U44A 3WNDA 3ADBA 2IS1A 1X86B 3KL4A 4PC1A 4D80A 1P5ZB 4NCJA 3X1YA 4F93B 3LD9A 2V3CC 3LXXA 4Q66C 4B3CA 5KSPA 1R7RA 2ZJ5A 4YC7A 4HSEA 1ZD1A 4KFTA 4Q7LA 4QGFA 2QAGA 5KSZA 3DM9B 2Q9BA 1NMZA 3AVPA 4BUJA 3NHBA 1SKYE 1A2KC 1VCOA 2A3RA 3LBHA 4JL5A 2F43A 3QUSA 5J4VA 3U61B 3K53A 2RGNA 1DADA 1ZAKA 4Q21A 4GOKA 4JJKA 2ZR0A 3LX8A 1P7CA 1ZCAA 2REOA 1PLKA 4LHVA 4TLDA 1U8AA 4EAQA 3SNHA 2BV3A 2R8RA 1Q21A 3SFVA 3MMPA 5CIQA 2EFHB 3B8HA 1Z06A 3PV0A 1OW3B 1JEEA 2XEXA 5GJVC 3B78A 2ZJYA 2JJ2A 4ZV4A 4FW9A 4IRUB 4DUGD 2VHUA 4PTLA 3PUWA 1YR6A 2E9SA 4FIDA 1C1YA 3WP1B 2IXGA 3THWA 1W4RA 4LPSA 2WICA 5E4FA 4HLUA 1DAGA 2AK3A 3FMFA 3RS2A 3U5ZB 2CE2X 4MYTA 1CR0A 2HYDA 3QPWA 3I8SA 3PR1A 2WWHA 4EPRA 4M9QA 5CB6A 1K5GA 3DMDA 3EASA 2D3WA 1N6HA 2XZPA 5DGXA 1D9ZA 2C5LA 3EIQA 2YOGA 4TTRA 3K09C 2AKAB 2QBYB 3CRMA 2BEKA 1IM2A 1KI3A 3FVQA 4XH9B 4Q4HA 5FOUA 1R8QA 4BGDA 2AXNA 2VP9A 2VF8A 3A1UA 4DLTA 1DELA 5LBIA 4EFLA 3KFVA 1U2RA 2OFWA 1Z6XA 4P4TA 1A82A 2EWWA 3A1WA 3FPAA 1KO5A 4XSGA 1V5WA 4LV8B 3QSYA 1UFQA 4P31A 4KYIB 3FMIA 1G1MA 4D0NA 3B1WA 3QXJA 2WPDA 1LS6A 4M1MA 1Z22A 2X8AA 4S2EA 3GLGA 2IYXA 1KMHA 5BN4A 2CE7A 2P6NA 2CDNA 5EUQB 1E2HA 1M7GA 2C98A 2XTNA 3JVUA 3NTUA 4HI0E 1AN0A 3X1DA 2A5YB 2GBLA 3OIWA 1G21E 2L0XA 2MMGA 4Q4LA 1NN3A 4V0MA 4ZKDA 3NBZC 2IA5A 4V0ME 4BQSA 3FHOA 1C9KA 4P32A 1T5LA 3CO5A 3LY5A 1NNEA 2UZ3A 3AVXA 1HE1C 1P73A 1Z6AA 3OAAD 3QPUA 4A8JC 4F38A 3FFBA 2ZSDA 2RGBA 1N6KA 3EPJA 2QM7A 2RH5A 4M1YA 1KDPA 4NCKA 2QGNA 2EW1A 2XNSA 1RJ9A 1VYVA 3RDPA 1YKSA 4QXAA 4E22A 1GNQA 4BFSA 5J4KA 3PVSA 3QQ5A 4LY6A 2X2EA 2XXAA 1OXXK 3KQKA 1SVSA 2F6RA 4AKHA 5FTJA 4EPTA 4PSKA 4C9BA 3WMGA 2H5EA 1P75A 1KY2A 2FGKA 4FN5A 4PHTA 3MJRA 3ZZUA 3BB3A 3EWAA 5FUWA 4ZDWA 3FYHA 1Q12A 1LY1A 1D6JA 2FG5A 2BBWA 1U0LA 5JJKA 2IYLD 4JT2A 5AUQA 5HPYB 3THXB 2QG6A 1T0JB 2H18A 4A9AA 3TBKA 4EPVA 1I4DD 3VNVA 1GP2A 1WBDA 2CLSA 1KO4A 2OEPA 1F2UB 3NC1C 3DOFA 3Q72A 1CLUA 2FV8A 4B71A 1ETUA 5G41A 4LBVA 4QL3A 5EE3A 2R6AA 4US2R 2O8CB 2WKPA 4NCIA 2UVQA 4ACBA 4KODA 4PHFA 2HJVA 4P33A 2BKUA 2IUTA 1XTRA 2ZU6A 5DHFA 3VU9B 3WHKA 3Q8XB 4JS0A 3AVTA 4TT3D 3T12A 1OHHD 4IDQA 1XPRA 3SU8A 4NYMR 3GLFA 3HPQA 2BIFA 4A2PA 4LJ8A 1KY3A 1N6LA 2LWIA 1Z83A 1LNZA 2QGZA 2WMNB 3G82C 2JIZD 5C4MA 1EWRA 4CEHB 2C2HA 1J7KA 2D2FA 3ZLJA 2Q21A 1U9IA 3QKSA 2W0MA 3A4MA 2CL7X 1E9SA 4X8OA 3EA0A 4Q7MB 1DS6A 1FZQA 3MG9A 1RC8A 1IBRA 1GKYA 1KSHA 2HJGA 3CPEA 3EXAA 3EC2A 5KNCA 4GSYA 5LDDC 2B8WA 2OLJA 3AGQA 1NG9A 1XD9A 4M9XA 1OJLA 1XTKA 2FSGA 4LYAA 4POAA 4MYUA 4PC6A 3VR4A 3FHCB 2GJ9A 4UNQA 1Q0UA 4LHWA 4DEYA 1ONBA 2A2ZA 4BLSA 2O8EB 5J47A 3W9YA 1KDTA 3NEYA 1GAJA 4JJZA 4D2IA 3FWYA 121PA 2JJ8A 2IEZA 3MAAC 4EFNA 2WJHA 4BRUA 5DNYB 2OILA 4BFZA 4BLPA 1W47A 2FNAA 4KO8A 1E69A 4DLRA 3OEEA 3PUVA 3SS8A 2O8FB 4GOJA 3CIOA 4HLDA 3L0PA 1EFHA 2FWRA 3FKQA 2O0KA 2JJ1A 1US8B 1H8HA 4B3GA 3U3RA 1S9DA 4A0RA 5UKDA 3WBJA 4KFRA 2QP3A 4JLMA 1DAKA 4EPYA 4DLYA 2NPFA 5AJVB 3R9WA 1Z2CA 4PQYA 1G5TA 4B76A 5HZKA 4ILEA 1XEXB 4A1FA 3A1VA 4ZDJA 1D2NA 4YLGA 3BOSA 4HZUB 1SVMA 5JI2E 1R0YA 1XRJA 2BWJA 4PO1A 2IXFA 4MGKR 2B7CA 3DDCA 2ORIA 1KJWA 3FTQA 3RANA 1NN1A 1SVWA 2Z4RA 2V8OA 1W2HA 4NYIR 1OH8A 1EESA 1LW7A 2A9KA 4Q1EA 4KJZA 4IOJA 4JMPA 2ZE6A 4C0HA 5IT5A 2D7CA 2ODNA 5CM8B 1WE2A 3ZDQA 1NRJB 2JLVA 4MKFA 2Z4SA 3KKQA 3T15A 4NP6A 4L4UA 4URVR 1QBKC 1UKYA 1X8KA 4L8GA 4OI4A 3CUEF 2J41A 4M1KA 5DO9A 1PUJA 3EAQA 4PAOA 1DPFA 3OE7A 2IW3A 3OEHD 1XNJA 3TUIC 2GXUA 1SXJC 3K0CA 5H8WA 3PJRA 3RS5A 4JSYA 4UNRA 4E5UA 1S1CA 1PLJA 1CRPA 1NLFA 1FTNA 1Z0JA 4QRHA 3AP3A 4QKQA 2YVUA 4KI0A 3THXA 3AVOA 3VHXA 2J1LA 4AKEA 4AKIA 1JPJA 3K1JA 1UAAA 1CF4A 2A78A 4B35A 4LJ7A 4A6XA 1F2UA 4N0DA 3MWJA 5HCIA 3K70B 2ZRDA 1E2FA 2H16A 1NI3A 4MRNA 4NU0A 2YWGA 4O2RA 3ZD6A 1L7VC 1OXUA 1UDXA 1YZQA 3LV8A 1EX7A 4GBMA 4NH0A 4TMKA 3WHLA 3GPLA 4HB0A 4LYFA 3BFKA 2ERYA 1TQ4A 3L8YA 1KNQA 3H0KA 1NN0A 3U4QB 1QHHA 4YXWA 2R62A 3ZYCA 4MKHA 3DHWC 4PQRA 4UXHA 4Q7JB 1F60A 2KB0A 1NJFA 2PEYA 5GJWC 3VU9A 1FL9A 3MRSA 4NYJR 5ANRB 4EPWA 5CDFA 3ZH9B 3UWOA 5CDFE 3VKHA 1AQYA 4PZLA 2AD5A 3NG1A 1ZD8A 2JLZA 4EJSA 4CEHA 2F7SA 4HAXA 2NPIA 1S3GA 1SXJD 2YZ2A 3LQQA 3N5CA 4HZIA 1FTSA 2FSIA 2O52A 3SDZA 3W6NA 1UADA 2XX3A 4TYNA 2FF7A 3RSLA 5SZJA 1J70A 2FPMA 2NG1A 5JECA 4AI6A 4DDWA 2JLSA 5KTYA 4NHOA 2J45A 4Q4JB 3EW9A 1QHIA 1IXRC 4NTZA 1VPLA 4JLDA 5IK2D 2IUSA 2D74A 3N70A 3T35A 4TLBA 1Z08A 4DCUA 1T4GA 4MRSA 4G5OA 3SYKA 2FJUA 2NMVA 1BIFA 4XD7A 1CTQA 3ZIAD 5AR1A 2UZIR 2HT6A 4BFWA 3MD0A 4YDSA 5KPDA 3CPJB 2HEIA 4B43A 1BS1A 4OQFA 3KKOA 4LYHA 1U8YA 5JLJA 3E2IA 3AEZA 4BEJA 5JZVA 2PMKA 3CX7A 5HE8A 1QF9A 4ASUA 1XEWY 1NVVR 3QY0A 3MJHA 4OJKA 2DCUA 4KU4A 4Q00A 4A6PA 1WB9A 2YV5A 1X8JA 2DPXA 2QROA 4E09A 2FMXA 2XOKD 3MWKA 1G4AE 5J4HA 4D82A 1GSIA 5AWFC 4TZ0A 2TMKA 1TUEA 2ZE8A 3Q85A 3QXSA 2R6DA 3I5XA 1ZM3A 2PCJA 4RCYA 5DLQC 2AFIE 1BYIA 4DLUA 4AG6A 1NJGA 2AXPA 5EZ6B 4ZDKA 2ZUDA 1R5OA 3VFDA 4PPFA 3A1TA 3F0TA 5TXGA 3T5DA 5C4GB 3NEJA 4URYR 1XZQA 2PCLA 2ZANA 4AWXA 4CYMA 4DDUA 4ZIRB 3AKDA 4Y0AA 5FUVA 3EZ7A 4HZUA 3T1VA 1E2QA 1HURA 1G5PA 1SHZA 3IEVA 4UQOA 1XZPA 3W5IA 1KIMA 2ZYVX 1DARA 2WOJA 1Z6YA 2A5DA 4OI2A 2V6IA 5BN3A 5J5CA 1NY6A 2E87A 1HT2E 1NMYA 4Q1BA 4PC7A 5FH9A 1ZYUA 1M7HA 3GEEA 1AS2A 3BGWA 2ZIAA 1BMFA 2Z0MA 4ZI2A 3IQXA 4IDOA 4RD0A 4BZXA 3THYB 2CEAA 4TSFA 2O0HA 3RC3A 2F9MA 2WV9A 2WTUA 5C2JB 1ODFA 4HUQA 3IIJA 1Z0DA 3FHTA 4CIDA 2ANBA 1P60A 4U7DA 2WWYA 3KXKA 1EFTA 3VQTA 1RRGA 3AKYA 2VH5R 2HYIC 3IIMA 3AQ4A 1U8ZA 2IYYA 4ZCMA 2JJ2D 2W2TA 3M4YA 1JNYA 1Z0IA 3OFND 1E0AA 4PZZA 3EPKA 1QG4A 2RAPA 3IO3A 4IVRA 4PX9A 5L3QB 2NQ2C 1ZU4A 1TU3A 1N6IA 1DE0A 1L4UA 4M8NE 3PUZA 4D25A 1XBTA 2GZDA 2WKRA 3UANA 1FQJA 5EP1A 2XJ9A 1KHTA 4M1WA 2DWPA 1BYUA 1AZSC 3U4QA 2CJWA 2FH5B 1CIPA 1TEXA 3EIHA 4PFSA 5BN5A 2OCAA 2W00A 1W0KA 3U3JA 3TQCA 2FA9A 2LCFA 4LCBA 2Q9CA 2VHJA 1X8LA 2WWIA 3B9QA 1D5CA 2J7PD 2CXXA 2YWEA 4TMXA 1W2GA 1W0JA 1QHXA 3JZAA 5FUXA 4BLOA 4PPGA 4CT5A 5J4YA 1R4AA 4I1UA 2IYQA 4TLCA 2EFEB 4C2TA 5FTLA 4I1OA 4GMXA 4DCVA 3SFZA 4LV6A 3QKTA 3UIEA 2Q6TA 1E9AA 5FUYA 4JLAA 4TL8A 3S1AA 3CWZA 4LX0A 3AF1A 4PHGA 2A5JA 1YRBA 4U02A 3B13B 4F4CA 1E3MA 2EWVA 4CT4B 2IC5A 2WPDD 3QBVA 2QMUA 1A1VA 3M6AA 1K5DA 2P5SA 2ODWA 2QPTA 5EUMA 1S8FA 3P32A 4M0LA 4A2QA 1R0XA 2BM0A 2G1KA 3BB1A 2V1XA 3P26A 3E70C 2PX3A 4M4SA 1XJQA 2FE4A 5FL7A 1N5LA 2OLKA 3KB2A 2IF0A 4GOXA 2NO6A 1ZM2A 1UPTA 3CX6A 2NTYC 4FCTA 4TMTA 1XMSA 2JCSA 4TZ6A 2A30A 2VYFA 4M1TA 4WZBE 1XX6A 4RD1A 1FNMA 3BE4A 1G17A 3C14C 2OO7A 4ESVA 1YR8A 2C99A 2X1VA 1HUQA 2BHRA 3HU2A 4JT4A 2F1RA 4TQUS 1CJVC 2D62A 1NG1A 5G3ZA 4EFMA 3RVBA 2HCJB 3SHFA 1F3OA 1UBEA 1OH7A 1MKYA 3BAFA 4M1OA 5EQTA 1LVGA 5JS8A 1MRSA 2GF0A 4L5BA 5CLQA 2XSZA 1HA3A 2QE7A 3EZ9A 3GQBA 4AD8A 3I61A 2FOLA 2QU8A 3AV0B 1NLYA 4UJ3A 5FFMA 5EE0A 4URZR 4L15A 4UXJA 1FUUA 4TTQA 2WJIA 1VG8A 5L3RA 5TARA 1W4CA 2YINC 3KKNA 2DR3A 2OSBA 3QKUA 4A82A 5AUNB 3NBXX 3IIKA 4TYPA 4HLCA 1NVWQ 4PO8A 5H68A 4MH0R 4B75A 1G7SA 1OYWA 1IY0A 1YHNA 2PZFA 5M04A 4M1SA 3GCGA 4QJ3A 3TLXA 2RGCA 1E2GA 4RSGA 2A5FA 3KDSE 1MV5A 4MGIR 3LW7A 3AKEA 3QBTA 2NOAA 3THOA 5JWOA 2EYUA 2GILA 1WP9A 4Q48A 1VG9B 2ZXUA 3KQNA 3LLMA 4D4MA 2IEYA 1MRNA 1CJTC 3VMFA 3SYNA 2ZREA 5B30A 1XTQA 4ARZA 2R6CA 4LC0A 4FMDB 5FOVA 3X1ZA 2V7QA 4FWIB 1DAIA 3BD9A 1N6NA 2ZRNA 4FMDF 3V4FA 1V43A 1GOTA 2FSFA 3AF4A 4QFMA 1JR3A 1SHKA 1JR3E 1KJYA 3TUZC 4DB2A 1YR7A 1FPMA 2AD1A 2HLDD 5JSZA 5ELXA 3AH8A 4DCNA 2GNOA 4HAZA 2FDCA 2ECKA 1G8FA 4XTCS 3JVVA 4BZQA 5L3QA 1J8YF 1MH1A 2GESA 5TMPA 2WJVA 5HCNA 4B2LA 1CXZA 4PC3A 5DI3B 1RRPA 1NKSA 2QT1A 2GK6A 4IEEA 1CR2A 3AF2A 3Q9LA 4NPHA 4M9SA 1TU4A 3SEAA 1E9DA 2D06A 4P3YA 3UG7A 3J81k 4LGMA 4CVNA 5GADl 3K9GA 3RABA 2O8BB 1KDRA 1ZIPA 2R9VA 4AYXA 2QPOA 4XVRA 5DYIA 1E2EA 2Z83A 5KSOA 2ZAMA 3I1FA 4RJLA 4OK5A 1ZUIA 3WNCA 3OEED 1VIYA 2MSDB 4W9MC 1ZBDA 2ASEA 4E03A 2WAYA 4RZ2A 2FSHA 4Z51A 1XD2A 3RC8A 2JJ1D 1GITA 1H8HD 3MWYW 3SQWA 4BFVA 4GZMA 5D3MB 3K0CC 3WY9A 3H86A 1MR3F 1OB5A 3L2OB 1GWNA 3H84A 3QXXA 1D8TA 4DWJA 3EARA 4MYHA 1VHTA 4WIAA 5CB8A 3TR0A 1E2MA 4GNKA 4QC2A 1ZW6A 3BJIC 3QXCA 3L43A 3VAAA 1DOAA 1IN8A 5F98A 2FFAA 2RHMA 1U90A 5B57C 5H1YA 1E99A 2WJGA 1NBMA 4S35A 3BS4A 1NBME 2AWNA 3LQRA 4BLTA 4W5HA 4CEJB 1NY5A 4V0KA 2H1LA 4FCWA 4EPXA 1Y3AA 1N2CE 5G3YA 4CGZA 1GL7A 2YYZA 2OUKA 2ZUCA 4Q4AA 2AK2A 1P61B 1KZ7B 1ZP6A 2ZQ5A 4B32A 5KU1A 4Q9LA 5SZHB 3UMSA 1E9EA 1QHNA 2PT5A 2G88A 5JCPA 1IQPA 3V9PA 2FN4A 2AN9A 1P72A 1W1WA 3BERA 3OE7D 2IK8A 2IHYA 3WRYC 2ZSAA 3U6KA 3QENA 4P4SB 4A0FA 3UG6A 1T91A 2GEUA 3K0FB 4PC2A 1DAHA 2CHQA 4NDZA 5JMTA 3AP1A 1OV4A 3RNLA 1N6OA 4WOPA 1EFRD 1E4YA 5EJEA 2ORVA 1E1RA 1S2MA 2YC4C 3KTAB 4QBFA 1KI6A 4JL8A 2QSYA 4Q03A 4UNSA 5FOWA 4C3ZA 3QG5A 1D2EA 3MCAA 5DISB 1TF2A 1VECA 2ZJ8A 3U60B 2JEOA 2XB4A 4BZPA 4TYYA 2JA1A 1E9RA 2GAAA 3A58B 4Q9JA 4NCNA 1G6HA 1A5TA 1R5NA 3GJ4A 2BCJQ 2YJTD 4YXWD 2DB3A 1KJZA 2GEVA 4OI1A 3TVDA 3D7MA 1N0VC 2JDIA 4DIDA 2Q0HA 1OB2A 1RYFA 5DN6D 3PUXA 1HQYE 5BWMA 3C7KA 4L9SA 3BH0A 4Q01A 2XGJA 5H70A 1S1MA 4V0NA 2R6FA 4G5GA 4YMSA 4W5WA 3P20A 5C46F 2GAOA 3R7WA 4B33A 1EFUA 3AM1A 1ZM7A 4NBSA 1XPOA 2DHRA 1OFUX 2FPLA 4YQFA 4NZYA 2C78A 2QUZA 2GVDC 1ZINA 4AC9A 4TWZA 5E95A 1GDDA 3VNUA 3QIAA 3ADCA 3K9HA 4C7OB 4OQMA 3HWSA 1CJMA 2NIPA 2KWIA 221PA 1JBKA 1YE8A 1UEJA 4I1VA 4YMVA 5DI3A 4O3MA 3ECCA 1UBFA 2BVNA 1DAFA 1G64A 1UKZA 1VTKA 2ZTSA 4HDQB 1GM5A 3IBYA 3PQCA 4ITRC 2ZU0C 5GJBA 5DI9A 3IPYA 3VKGA 3OIVA 3LRPA 1CEEA 3G5UA 5LB4A 4J0QA 5KDOA 2QTVB 3R8FA 4TN1A 1W4AA 4NCHA 1F2TB 2EFGA 2PZGA 2RGXA 2RKOA 2YC2C 1LB1B 4IDNA 1XB2A 4LSGA 4QBGB 2O8BA 3W5JA 4R7ZA 3SHWA 1EWQA 1HE8B 2OFOA 4ZKEA 4JL6A 3X1XA 2R2AA 1BH2A 3ZZTA 4RZUA 4URWR 5DHAA 4ASUD 2ZM5A 3W3AA 3PFIA 4WBSA 4C0SA 1E79A 3ZS8A 2BDTA 2W0SA 3TNFA 2CCGA 5CIWA 1WQ1R 1WA5A 1KO1A 2HF8A 3SQXA 1UF9A 5D3MA 2YNMA 5FOTA 2I3BA 2J0VA 2ZRHA 4MKGA 4PAQA 2CLDX 3I73A 4CDGA 3CRQA 2IYWA 3L0SA 2GKSA 2ZSEA 1N25A 3CLVA 3F8TA 4XSHA 1HTWA 3B1ZA 1MO4A 1KAOA 1UKEA 3RS4A 3LA6A 2ZRGA 5KO2A 2VF7A 1ZM9A 2QMOA 1WXQA 3HU3A 2AFHE 2P67A 5K8TA 1BO6A 5FBLB 2FU5C 1PLLA 2ZE5A 1Q3TA 1A4RA 3MUFA 3M1IA 3D6TB 1I4TD 1XCGB 1G4UR 3R20A 2QN6A 5JEDA 3QPVA 4OL0A 1E0JA 2QBYA 4C0QC 3QG1A 3CW2A 3C41J 3EC1A 1JQJC 2C03A 2QI9C 4TSFD 1O87A 2SHKA 3QF7A 5DH9A 2BJVA 4KAXA 4JBWA 4II7A 1G7TA 1E2IA 2CNWA 4Q47A 3DKPA 4L16A 1TMKA 2J7KA 3N2EA 4CZ2A 2P2LA 1COWD 1FMJA 3WP0A 4B6EA 1E4VA 2OXRA 1PUIA 4P4SA 4Q18A 2GCNA 2YOHA 4A8JB 1W36D 5KYKA 4R2IA 1G19A 4PANA 2ZRKA 4M9ZA 2A7QA 2PT7A 2BEJA 2VSXA 5CITA 2J0SA 1Z29A 2C95A 2ZRAA 1NMXA 2PLFA 2GK7A 1FUKA 1E96A 1LFDB 1XXHB 3KTAA 2B8TA 3GLIB 1K8RA 5DE3A 3I8XA 1FP6A 5TB5A 1OIWA 3FB4A 4R9UC 821PA 4QHYA 4L9WA 2C77A 1ZUNB 1OPXA 2LKDA 2W2XA 1W0KD 1L8QA 1DO0A 2QAJA 1G7CA 1UBGA 2GXQA 4DB4A 3PG5A 2F1JA 2OCBA 3HYRA 5CJ2A 1XJ0A 3EZ2A 5FOSA 1W0JD 2ZS7A 3O8CA 1E0SA 2PMDA 2WIBA 3W6PA 2JLYA 2W83A 5C1BA 1PJRA 1R8SA 1IJEA 1II8B 3NHAA 3GFOA 3AP2A 5G53C 1HV8A 4LJ9A 1A2BA 4KBGA 3SBDA 4AIIA 1FW6A 1NKTA 2BBTA 1L2TA 3I62A 3OIUA 4MRRA 3A37A 3VHLB 1GL6A 4RFSB 2WAXA 3NDBB 3O47A 1XTJA 3NC0C 4D4KA 3GLHB 4C7OA 2QZ4A 1KI9A 3GP8A 3VKWA 2ZRCA 4US0R 1VYTA 4ESHA 1OIXA 4G0NA 4HAUA 3BORA 2ORWA 4MITA 2XB2A 3GJ6A 4URUR 1TX4B 3QNUA 5FL7D 1E32A 4W5JA 4JLOA 4XVUA 4M21A 4PSAA 3HPRA 2BMJA 4QM6A 2O8CA 2EYQA 1RIFA 5CJPA 2CK3D 4JLNA 4GZLA 2B92A 2W2VA 1NN5A 1NLZA 4B2IA 2JGNA 3VR2A 2EQBA 1II9A 2IWHA 1E2JA 1K6MA 1SZPA 4AY2A 3B82A 4RKEA 4B48A 3R8CA 1MO5A 3KX2A 2XSZD 2AWOA 3QXHA 1DEKA 4XOIA 1YRAA 5BW8A 3MFYA 1F5NA 2WOOA 1X6VA 1RFLA 2ZS8A 5FOXA 4C0BA 2QSZA 1OXTA 4OQNA 4P0TA 2NO0A 2BBOA 4DLWA 2I1QA 5KDDA 4M53A 4UNPA 3EG5A 4H1VA 2C9YA 3H1TA 1AIPA 3BIFA 3KXIA 4IDHA 4RD4A 3SJCA 2GVZC 4XWOA 4DC9A 3RAPR 2DYKA 2GJKA 2Y8EA 3LXRA 2AR7A 1LF5A 1VG1A 2GXSA 2C96A 1U99A 3QJYA 3CBQA 4TL6A 4K46A 5AJZA 2VL7A 1OFHA 1S4QA 4O2LA 6Q21A 4AG5A 1FOEB 2RB4A 2LKCA 3U7HB 3L0IB 2O8EA 2PH1A 3ZGXA 1EX6A 4DLVA 2QAGC 2YWHA 4OK3A 1AGPA 3KKPA 4OYHA 2NO1A 1JAHA 4BLRA 3U6BA 4DLZA 1KNXA 4JLVA 4K8OA 1Z3IX 4LBYA 4YONB 3EX7C 3ZVMA 1LS1A 2ZSBA 2O8FA 3GJXC 2RGNC 1QDEA 3CZPA 3CR7A 5FI0B 1JI0A 1NIJA 2VA8A 2V7QD 1W5SA 3KUDA 3B1VA 1US8A 2WMOB 1RKBA 1SKQA 2J87A 1TQ6A 2ZVPX 4A8JA 2FEOA 1SVOA 4QBIA 2W6JA 3TRFA 5JCZA 4JVNA 1T8TA 2WSMA 4JSTA 4KSBA 4IVQA 1SULA 3MLEA 3SR0A 4OJQA 3TJZA 2PEZA 1ZNYA 3CNLA 1OXSC 1XEXA 2HF9A 1GL9B 1I2MA 1LV7A 5B2ZA 1YZNA 4DVGA 5K8UA 2GHIA 4R98A 3C16C 1XEFA 1T9HA 4DCSA 2REBA 4LPKA 2CCKA 3EA5A 2J46A 1E2DA 1SXJB 4HLUC 4XVQA 3DVLA 3QE0A 4JBYA 2OZEA 1HH4A 1KYIA 4B47A 1QZXA 2QNRA 3T61A 4B34A 4D4LA 1E94E 1T3HA 4PSVA 2WHXA 5KUTA 4TMWA 4B2PA 4GP7A 1N6RA 3T34A 1P6XA 2ERXA 2XNDA 5P21A 1XF9A 2QT0A 2QORA 4DLSA 1KOFA 3KQLA 1OT3A 1II8A 3QKRB 2BKEA 3C5HA 3I3SR 3AF0A 4WA7A 3U3MA 1R5BA 5L3SB 1CJKC 1O3YA 4MQBA 1YZGA 2N1BA 4WZ6A 1E6CA 3EPHA 2EU8A 5EXPA 3D8BA 1YR9A 4RD6A 8OHMA 4Q9IA 4KSCA 4ZCLA 2IX3A 4BLQA 2ZROA 4RFSA 2VLIA 3GJ7A 2ZI4A 3GJ5A 1JB1A 3GLHE 4UXIA 5HR5A 3Q7PA 3PCRB 3TIFA 4KV9A 1IN4A 3CPHA 5FI1B 1IOZA 2EVWX 3MWLA 1CS4C 3SJAA 2FFBA 2IS2A 1J2JA 1KK0A 4LHXA 1ZCBA 1IXZA 2WIAA 3KJIA 1WRBA 2F9LA 3BWDD 3K0AB 5L8VA 4F4IA 4BWYA 3DL0A 3GEIA 4GP6A 4UJ5A 4B3BA 2GBLC 1ZNWA 3K0EA 3D31A 3D3QA 5JHGB 1JJ7A 2F3RA 3HYTA 1R0WA 4ZO4A 1TQDA 2F55A 2N46A 5AUOB 4KHZA 5C18A 1XFAA 3LH5A 3TVTA 1Z07A 2O8DB 2FEMA 1GIAA 1RVDA 2ZETA 2CL0X 2IYVA 5FL3A 3RRNA 3U44B 1KI2A 4LHZA 421PA 3ZD7A 1ESNA 1ZUHA 3CB4A 3QEJA 5IDVA 4FINA 5FBVB 3RRYA 3SZRA 1E1QA 4G5RA 1N0WA 2R65A 2WSSA 3F5FA 2PJZA 4JBXA 1ZC4A 2RHDA 3DOEA 4IFEA 2QAGB 1JXMA 3IHLA 4Q4JA 2JAQA 3BB4A 4QM7A 2ZJZA 1KO8A 2ZSFA 4LI0A 2YKGA 2R44A 4U5XA 1KK2A 1ZMXA 2F43B 1KGDA 1OFTA 1QVAA 2VPPA 3PEYA 5EP4A 4Z8YA 1E1RD 4OKSA 5J4LA 2D2EA 5KNBA 4UKDA 5EE9A 3B6EA 3TK1A 4NONA 3M0EA 1QHYA 3VX4A 3OEHA 4LK2A 2WWXA 4DJTA 1NL3A 1G3IA 3KKMA 2RGEA 5JHHB 4Q5IA 1XCMA 1R6BX 2YWFA 2O5VA 1XEWX 1ZNXA 3TH5A 3WYAA 4A36A 1OH6A 2WM9B 2WBLC 2XTZA 2PZEA 4GRAA 4OK6A 5JEEA 3Q3JB 3C4JA 1PV4A 4ON9A 5BQ5A
chains in the Genus database with same CATH superfamily
3THWB 4PM4A 1GNPA 3IBGA 1REQA 3IEXA 1JTEA 1MZVA 3N0XA 3OE5A 4LUCA 4UEOA 5FPYA 1WZNA 3HA5A 3PE6A 1P4JA 1QR6A 5JAMA 4KWIA 1TW3A 2QUHA 3NCHA 1G8YA 5IUJC 1JZQA 1V16B 2GN4A 2Y4OA 3VR6H 3FTEA 1GPLA 2VKTA 1MO6A 5KHOC 2O4UX 3W7BA 2P9HA 1QV6A 2OAEA 4JKOA 4GX0A 3KWMA 4K87A 1JEOA 1IN7A 2I55A 3IURA 2F8TA 2D5AA 2J9XB 3DXXA 3AVYA 1GPBA 1A77A 1YBMA 1YCGA 1ZKMA 1YMUA 1JIQA 3EMDA 1JP7A 4UUQA 2MDTA 1LVUA 4HWRA 4O4JB 1JV2B 1M8FA 1PVVA 3KEOA 3DG9A 3IJ5A 1XA0A 3OIGA 4HNSA 2D1FA 1SELA 3KZXA 3JVIA 4YMHA 1M8GA 2HXGA 3U2QA 4DWOA 3B6IA 4F3KA 3AR6A 4EB0A 3OQOA 3ENNA 1QGDA 1FJ2A 2FK7A 1SQSA 3FCCA 1G59A 1WUHS 5FWYA 4UD2A 3B52X 1QS0B 2HWKA 2CLLB 1DAEA 1P0QA 1GXSB 1NP6A 1XTUA 1KEEB 3DL2A 4GUAA 4H3HB 1FFYA 3A7DA 4FYWA 1GCGA 2IHKA 3OQ1A 2IBMA 3U31A 1AF7A 2HM7A 5HF6A 3EUFA 1TPZA 3BGOS 1Z5UA 1LF0A 3IBCA 5TGZA 3U4CA 2F1IA 1U2EA 1XU4A 3ZH2A 3BJZA 1R4NA 5C81A 4X3PA 4KEAA 2A1IA 2BMDA 3GLKA 4YHHB 5ECGC 4FEEA 4X1KB 2RH4A 4EHKA 5D5HA 5LC1A 3PRYA 5ERYA 1OZFA 2FGJA 5EHGA 3C5CA 4CMEC 1HFKA 1NT4A 1RHQA 3CNNA 2PR2A 4MR9B 1EVLA 3MHPA 1WKCA 1W44A 1OLXB 4UBNA 1Z74A 2NZJA 4O2BA 4I1SA 1DBIA 3GXBA 1H6DA 3I92A 1OXVA 2VG8A 3FWHA 1BNCA 4I8IA 1Q19A 4GYYA 3U0VA 2B4KA 4UHKA 3GF4A 1LC3A 1RJ9B 2HNBA 2CNOA 4G0YA 1Z13A 4RGVA 4BNGA 6YASA 3OZ7A 3JWIA 5DNCA 2COKA 3FLEA 2BZSA 1W34A 3A6JA 1CNMA 1NMQA 2FHPA 3QV1A 4MVCA 4QEDA 4QQKA 4RS4A 2ZRLA 3EY9A 4KWCA 2CF6A 3RRJA 4D3SA 4JEIA 3U62A 1T1IA 4ARUA 3RUIA 4OMUA 3VC3A 2JLWA 4DLXA 1DRJA 2E4WA 2B3TA 2ID9A 2P3QA 3FPLA 5J40A 1IXSB 1J00A 2WUVA 1NU8A 4H6WA 1PJAA 1YB4A 3GDGA 4XDGA 3LYHA 2QG4A 2WVJA 3C6XA 4IIVA 5IDYA 5IS2A 4H9GA 1CUSA 3ECSA 1TNDA 3AJAA 4F6CA 4X66B 1KI4A 1D0VA 5G40A 2Y0EA 3TBHA 4NS1A 3SI7A 2VRNA 3TFQA 5AKIA 5K4AA 2J0QA 3P8ZA 2O2ZA 5A3VA 1KXZA 3I4LA 3UAVA 1OKKA 1XFDA 2CNWD 5LU9A 2GPYA 5GVRA 1L4NA 3PC8C 4RJIA 1V7CA 3ETGA 1Z17A 3VVMA 1LPPA 2I99A 1A98A 2Q9UA 1M2OB 1XTVA 1KTVA 1P9RA 2E3JA 2OAP1 3JWPA 4ZVSA 1GZ3A 3TB4A 3BMOB 3RBVA 5IDQA 3TL6A 4BZZA 1I4WA 4X7PA 1GZSA 3R5JA 2WWVD 1ECJA 3H7AA 1DRWA 4ZAWA 1Q44A 3K0HA 2IS6A 2AXEA 5FBRB 1HQCA 2EX1A 3N74A 1LBSA 4I2VA 3H42B 2DRIA 5JZOA 4BXOB 4G0VA 3RKRA 1DLJA 1DWQA 2P3SA 2Q2VA 2XBMA 5I4BA 1WPGA 1A69A 3CX8A 3B2EA 3HVKA 1P2UA 2WU0A 3ND7A 4JSRA 1JA9A 2BSAA 3R3ZA 3GP5A 3B3JA 4KQXA 1YRYE 1M2HA 4MVXA 1AKEA 5AW9A 1L8LA 4UU8A 3AI1A 1K08A 3TRDA 2DLDA 7MHTA 1N2SA 5IC5A 4EDHA 3QKSB 1ZNZA 3SC6A 3OOSA 2XT6A 2EXXA 2R1VB 4G1VA 3VNQA 1VHLA 4RF2A 4DRZA 2XZOA 3FZEA 4GBED 2VJBA 2B8NA 3OFNA 3JQ8B 1ELOA 3OZXA 4ZQIA 3OA2A 4Q9NA 3R41A 5TVKA 3NIGB 2P8SA 4GAEA 5JS7A 3NGXA 1KO7A 4U3JB 3VVLA 3R6TA 3CR8A 3T9FA 1LUAA 2F48A 3L0CA 2DUNA 3MTDA 2WB2A 4DCMA 3U26A 3BL5A 4EYOA 5IVDA 3PXBA 1Q57A 1USVA 3DVRX 4UMEA 1UMKA 4D9KA 1YVDA 1D1TA 1KP2A 1DAMA 2CHGA 4DXAA 5TIIA 1EHIA 4Z53A 3UXEA 1Z15A 2X6TA 4CHTA 1DT5A 2FAXA 3H8JA 4IO0A 4C0WA 3C8ZA 1F6BA 1XRSB 2IVFA 4IIBA 1XZEA 3WLMA 1F48A 1TT5A 1SIOA 1SH7A 1U8XX 3O8QA 3WDMA 5AW2A 1F2DA 4IP0A 2V45A 3U4DA 3IILA 2J59A 1IHXA 5E4TA 5TPWA 2JVKA 4RKFA 3AWDA 1RLUA 3K4PA 3H05A 3PBKA 4LYJA 2G6BA 4DILA 3GT4A 2PDAA 3VUFA 5DZSA 1NXPA 3DZKA 4MCAA 1E7SA 4WW0A 2OZKA 2EJTA 3AM4A 3T1TA 1FP4A 3WBKA 4GOOD 4NYJQ 4QJBA 2YASA 1X80A 2ZVJA 4YMTA 4XB6B 2CVFA 3CU5A 1XPJA 1PNRA 4M3NA 4YAEA 5K1ZA 2DMRA 3L04A 5LN1A 5F12A 2ZUUA 1JG2A 4MJXA 5KYUA 1A1SA 1RWQA 1Q3HA 2GNAA 2BGRA 2HTEA 2J5QA 3GJ3A 4MYDA 4RADA 4KE6A 5M3BA 4CCWA 3PWSA 1P62B 3IO5A 1Q17A 3GLGE 5K45A 4GD3Q 1YR2A 5AUPB 3ZS9A 5JY6A 4N48A 8MHTA 2VP5A 2R6HA 1AGRA 1YR3A 3HB5X 1JB9A 3TTXA 4MDFA 3PHCA 1R8JA 3BEOA 2MSNA 5FCDA 3OJCA 4MJ3A 4ZCSA 4HXGA 1P0IA 3X0DA 4JJ4A 5EOVA 1DDIA 4JKYA 4QTZA 1DJLA 1TA4A 1OCEA 2E4ZA 3EQ6A 4M7RA 4XYBA 4ETNA 1EDDA 1JPNA 1S3IA 2Q5OA 2ZRFA 3ZVNA 3L1UA 5CLGA 4ZMBA 3HVJA 3EXHA 1YQ9A 2I66A 1IUOA 1IUKA 2X23A 4YRNA 3I2KA 3Q2KA 4IV0A 5DCWA 2XA9A 1KYYA 2EFDB 3I76A 4ZMRA 2JA2A 1U0HC 1OIVA 2HF7A 4NDAA 3UAOA 4Z9YA 2HQRA 3QNWA 1EG2A 2ZJ0A 1PNTA 1QR2A 4C4SA 4Z9XA 1AKNA 2ZAGA 2O19A 3P4YA 2QX7A 5F3DA 3AVVA 2GWHA 4M9CA 4OAQA 4KREA 4ZV7A 4DKXA 3ZU3A 3PIRA 3H1EA 2XXBA 3P2MA 3OCWA 1WIWA 2IEDA 5I4KA 1BDMA 1PFWA 1G8PA 3OE4A 2OXCA 3U40A 3V7YA 3VPCA 4WTOA 4L2IB 3L82B 4BE4A 1MXFA 5CCDA 4CQNA 2XD4A 2JIQA 3CLRC 3WG9A 3TSAA 3HXTA 2RHLA 1JHQA 2I8AA 2WYIA 3EZNA 1U8FO 3LVQE 4KWTA 4YMGA 1TAQA 4U2DA 1RPNA 3ABIA 4M99A 2H7XA 5DTQA 2E82A 2ZBQA 1OBVA 4ATNA 2CZGA 1YAHA 4Z1OA 5F3WB 3RVMA 3K3PA 3WGZA 4RMHA 4EHIA 1T26A 3S8YA 4EITA 4ZK6A 2JGEA 4Q82A 2H8GA 1B0AA 4TRJA 4OHYA 4Y6SA 4BZWA 2BONA 2XE6A 2AMJA 2OHXA 4KYUA 2PUAA 4ETIA 3CH5A 1DJPA 4M89A 3AUXA 1KI7A 1XA3A 1S8OA 2PWAA 2GBPA 2VRWA 4NC9A 4NOMA 4YAWA 5H81A 1ZL0A 1ZMBA 3AUYA 4IV5A 3UWMA 3I37X 1EQ2A 3GVXA 1IRXA 1L4BA 2F4NA 2W58A 2TMGA 1E9FA 1D2CA 1P0MA 3JWJA 4TLEA 1E2LA 3WKAA 4OH1A 3GFPA 4DV4B 3R9XA 2YJNA 1LK0A 1N3IA 3OJOA 3SC4A 4MV9A 2X0DA 3IJRA 5LYYA 3SSMA 3ST7A 2HLDA 3GRRA 4GBJA 1UJ4A 2IYEA 3VAZA 2CLEB 1S96A 2BPOA 2DETA 1DTSA 5LQUA 2O2XA 3DC7A 1LDGA 1H23A 3DDSA 4K6OA 1YZUA 4YQYA 3QVVA 4L5YA 3AW9A 1ZVJA 1HT1E 4GMHA 1TAUA 1SUBA 2B2XA 4M0MA 4DSNA 5EKSA 2W8BA 3P4XA 4M1EA 1WF3A 2CL6X 4RAQA 1B16A 2IFTA 1CEYA 3PJFA 5HF9A 4BX2A 2H17A 2FWAA 3EW7A 2DQYA 1FDOA 3DBHB 1RYYA 5EMJA 4B5LA 2PUWA 2CJYA 1FP1D 3K0FA 1FX0B 1H3FA 2EKQA 4OP1A 2OHHA 5LR6A 1M74A 3NEAA 5GGXA 3KR0A 4LBWA 4CQMA 2XE4A 5CDTA 4EKDA 2G8LA 5CMLA 1B7GO 1YRHA 3UW1A 1Q91A 4H4EA 2JJQA 5DKFA 4D9HA 4CV2A 2PD6A 4RANA 1JUDA 2VTDA 2VYCA 1VPWA 3F6RA 5E7JA 4TUYA 2WJJA 2RHBA 4KFUA 1BHJA 4DM4A 1D1QA 1K68A 2ATXA 3I9FA 3Q2OA 5AESA 4RCZA 1NSYA 1SXQA 4FBMA 1WEKA 4YRIA 5DTMA 3TN7A 3NH9A 4INJA 1Z28A 2C0QA 2WLTA 2OV6A 2RJ3A 5CH8A 1G18A 1YUMA 3NETA 3LHIA 2ZIUB 4MQEA 1W76A 4DG5A 1OFIA 5E2AA 3S3TA 4MQUA 2WHQA 3G0HA 2FFHA 2HCBA 1Q7EA 5F4ZA 2Z5LA 4CCSA 4K6CA 5J58A 5KIAA 5I9MA 4DLAA 4XUEA 5JNUA 1YQDA 2V4ZA 1ATIA 3U5TA 2ROQA 2X2PA 4INPA 4H7IA 1X7ZA 3KOUA 3VPGA 1LBHA 3HMQA 1NP3A 1RU3A 2NXCA 2XIJA 4RY2A 5LOVA 2ZYUX 2VCYA 3RPEA 4D92A 4QDXA 5AXAA 4ZJZA 5IPFA 3HEBA 4BJ5A 4F9EA 3U80A 1QPBA 1IN6A 2ZYAA 3S0JA 4FLFA 3TNJA 4EO4A 5BWBA 4PGAA 2Z5VA 4GM0A 4ANFA 4TVSA 4AF7A 1SZCA 3WWOA 1WWKA 4DMLA 4P4LA 4LNAA 5JAZA 3D3WB 4IIUA 1AA9A 4GPEA 1MQ8B 1TO2E 2Z6VA 4DTIA 5A6VA 4Z7JA 2YXEA 3FSRA 5KINB 3VBCA 4TM8A 3H4VA 4G1UC 5CH5A 2WSYB 3WK7A 4TMVA 4B6SA 3ZY5A 5KYXB 1ZR4A 1U4SA 3PC6A 3RYTC 3GGSA 1GUFA 2KSQA 4GE0A 1HEYA 1CRLA 5KDLA 3CNHA 1V39A 1F2TA 1BA2A 2ZR8A 1SGWA 3O2NA 1M2VA 1Q1QA 1ZD3A 1MJGM 2GCOB 2HMVA 1TADA 2VUIB 4M9UA 4OMDA 4W7SA 3UICA 2PK3A 3RIEA 3CT4A 3GUYA 2ZE7A 4JK3A 4YCAA 3WGJA 4ZO6A 5KVVA 1XTIA 3A4NA 5ALPA 1EFRA 3F47A 1LLDA 1N0IA 1EQAA 4G5HA 4P81A 4KR9A 4RDXA 1U4OA 1CY1A 3GRPA 1FFXB 2OGWA 2VDKB 3DLPX 3Q5DA 4JC5A 4OQXA 4UBLA 3RIGA 3UJ9A 4MA4A 4UTRA 5KTTA 3ILHA 1VJRA 3R5FA 4EUSA 3I4FA 3K09A 4RH3A 4V02A 1I9CA 5BOSA 1Z0AA 5FNZA 1MT0A 3PF9A 3ZNPA 3M83A 1RRFA 2CJWB 2QLLA 4I4NA 4NE2A 3FGNA 3AF3A 1N2OA 2POCA 4Q3OA 5BN5B 4B7UA 1UDWA 1CK4A 5IYZF 2QTCA 2P2SA 3OUZA 3PUYA 4DSUA 1WQ3A 1IZYA 1ESMA 3MLAA 4RVGA 5HMLA 5LQKA 4Q19A 2QI9F 3IPXA 5DXAA 3GDFA 4BEWA 4DV3B 5LD2C 4WOCA 2HV9A 3HKDB 3KJHA 5G1NA 3P2YA 4I4LA 2YHIB 2ZI7A 1I0LA 4N82A 1NVUQ 4XD7A 3SXPA 5ENDA 2LE0A 3WVNA 2QRZA 3WMWA 1U65A 2V6FA 3WK6A 1RI5A 1JZTA 1KOLA 1GV0A 3QP9A 1Y7PA 1YAJA 5B3JA 2C9OA 2EEPA 3BZUA 3RJZA 5AHWA 3FZGA 4OXYA 3U7QB 2FZLA 2O2HA 4FB4A 1CNFA 4FGKA 3DONA 2NU6A 2QUBA 3B12A 2RGYA 4Z0TA 3W90A 4EW2A 2VHQA 1NUHA 1OZ0A 1AZTA 2AHOA 1IY2A 1JWBB 3IBFA 3A9CA 1DC8A 3L1IA 3HYLA 3VO2A 1QG2A 3P9NA 5HZGA 1RQGA 4ZT7A 1QKKA 5EQJB 5JZ9A 3UENA 2QVGA 1ENYA 1NVGA 2UV8A 3IIEA 3O75A 3P9IA 4XCQA 5A4AA 1U9YA 4J9UE 4M98A 2UXBB 2QIPA 2ZITA 3ON5A 2CFRA 1Y8AA 2YDYA 2I6SA 3SK0A 3AFMA 1YFLA 3I1JA 3BBPA 3DV2A 5EJ5A 2VIIA 3I2YX 3W8RA 4HGPA 4WSOA 4J6FA 1TW2A 1ZU5A 3LAWA 3QLJA 1XCPA 4QBHA 1MVLA 3T7IA 3ZYZA 4KAJA 3ZZ0A 3I04A 3WLSA 4BV8A 1WCIB 1YZKA 1KWGA 3A9RA 4HWGA 3F3SA 1P1CA 3A1CA 4R8KA 5TRTA 3CNQS 3VNRA 2GYYA 3HI6A 3OCCA 1W73A 4TT3A 4C04A 5AQ1A 3GLIA 3A36A 3WHPA 4C0AC 3GLIE 1WBBA 1PDWA 2J6HA 2NUPB 5L4LA 1K63A 2HC9A 4K81B 4HNAA 3P0JA 2YDXA 2JIZA 4NBWA 3RROA 2RBKA 3ESCA 1U2QA 4CKWB 4LE0A 4EF4A 5JFTA 4HEJA 4DKJA 2HX1A 5TX7A 2Z6UA 4EBFA 3ILVA 1AQUA 3EJ6A 2X3FA 2ZYTX 1SCIA 5SYNA 4XVHA 3FI9A 5JRJA 1H42A 2HIGA 1MA0A 1QYVA 3BE5A 4XYMA 4C2UA 3PKZA 1UWLA 5I6DA 5TQ2B 5IFLA 3I6BA 4PQFA 1UXJA 4EK9A 3KB1A 3RWOA 1RW4A 5JCXA 4Z4IA 4QO8A 1TK9A 3WK5A 2PANA 2Q0XA 1RPAA 4AY6A 1MO3A 4P7KA 2AOWA 1PFVA 5BP7A 1YZVA 1ZL2A 2ILTA 4KX5A 4QOEA 3SEFA 3QLVC 1OKKD 3MCVA 3TAHA 3ZHRA 1J8DA 4F91B 5F9FA 1C3LA 2LV8A 1E1NA 2ZJAA 1DIRA 1SA0A 3F6PA 4KH1A 1W8IA 3TE6A 1BA3A 1K1EA 1XMQB 1QDLB 1ADJA 3OKPA 1T8RA 2I8CA 2R8EA 3Q7QA 3L7OA 1JECA 1JPUA 2JARA 1N5IA 1SR8A 2EATA 2J0UA 5ARBA 3A28A 1L7QA 2DECA 1OXKB 4NNOA 1DCKA 3GJ0A 4HYQA 2WQZA 1P5JA 5HS4A 2JLQA 1U7DA 1JHDA 1XAIA 4ARZB 1Q0TA 5F9HA 3PPWA 3VSDA 3WJ1A 1Y42X 4URXR 2M6SA 2AKYA 3ES9A 4OGGA 4PCAA 1QWOA 1OFVA 3F7OA 4X6YA 1TD9A 1COWA 2ZJBA 3I83A 1DVRA 1ZAYA 5AVVA 1CR1A 4BQPA 4B3MB 1QGOA 1WXGA 1ZS9A 1BX1A 1GNVA 1IVYA 4H4CA 2WA2A 4E46A 5J43A 1JF8A 3BC1A 2QM8A 4Q9KA 2QP4A 5LD2B 1L1EA 4UMVA 4HNRA 5CEFA 3K31A 2VTKA 4C7KA 4C0XA 2BW0A 2OGTA 2ZDHA 3VR1A 2V4UA 3BFJA 1SBCA 4FHGA 1A5ZA 3H6KA 1MLDA 4RTOA 1Y81A 3NW9A 1TMGE 1P1KA 3D7KA 1GFIA 2C3MA 3WIVA 2B4QA 2Z43A 2FPGB 3WWZA 2B7BA 1MHPA 3JYLA 5LB2A 2OYSA 1JDTA 1J99A 1U0RA 3OZWA 2BELA 3DDUA 3IH5A 4QDOA 5IASA 1X1DA 4WUVA 4CV3A 3CWQA 5GV7A 1YT5A 5EHNA 1NGSA 1WZEA 1QHGA 4K1LA 4NF2A 4JYPA 2OT3B 2Q9AA 4L6IA 1N0UA 4E14A 3C6YA 4P0PB 1W46A 4EX6A 1D2AA 4IDDA 4Y1EA 4NEGA 3DOOA 5F5XA 1TIPA 2Z98A 5T5QA 2FW8A 2XLCA 4BFCA 1BQEA 3EXHC 1B6TA 1PG5A 4C2BA 2BF7A 4H1WA 5JXHA 4OYYA 4H0CA 4HRAA 4OL9A 5I7FA 2VBCA 3KJNA 1VB3A 3CNOA 1XVTA 4OVKA 4DIEA 4ZMSA 3HO6A 4LRSB 4FP9A 1VL5A 2ZQYA 2VDQB 4U63A 3RRMA 4IUBS 4D5GA 1QO0A 3Q6NA 4X97A 1M10A 2VXBA 2HA5A 3K7EA 1SKMA 3PHIA 1LEHA 4B31A 2G1PA 3IGFA 4R1QA 1QRTA 3ZDDA 4ND7A 1EJ6A 1PFGA 2ZUWA 4BNDA 2Z2KA 4HDRA 3T7AA 1ZR2A 1U1IA 4IY1A 3ROXA 3SOPA 3L8EA 3ZY3A 4F12A 2MOKA 4BEBA 5CK5A 1MB2A 1OV6A 3FYUA 3FOWA 3AUSA 5FPKA 2AC2A 4J8PA 1RJWA 2G1JA 1RPJA 5EHIA 4F84A 1DBRA 1WHSB 5EZQA 1I1NA 3J81A 1D9XA 1E9BA 2I2AA 3BH6A 2Z6QA 1BFUA 3DH0A 4L5IA 4N5LA 4S1VA 3MWDA 1RPZA 3IQWA 1W5TA 2GUGA 2PRYA 4LXHA 4EZBA 1P7ZA 3UT5B 1PSDA 3NR2A 2CK3A 3NPMA 4J0EA 4RHYA 4YJGA 4OM7A 2YNMC 3DMTA 2PSSA 4XQCA 2RGGA 4IHJB 5ESXA 2NM0A 2HHAA 1H0SA 3AG6A 3R7DA 3WNBA 2H7YA 3GEBA 5B64A 1HT0A 5CT5A 4A2WA 1X1SA 1UFRA 3G85A 4KITB 1ND5A 4WXEA 1DXHA 1RWNA 3AERB 1FBTA 3GLTA 3UWKA 1EUYA 2CMKA 1T0UA 4IIJF 3AR3A 4TLAA 1JQ3A 1TCBA 2YJGA 4IQGA 2B21A 3B60A 1A9QA 3O4RA 4JEMA 4Q16A 5KSYA 1BVRA 4N18A 4Y0NA 3L9XA 1JWLA 3A4TA 1G2IA 3KYJB 4NSNA 5L3VA 4AQ7A 4JB3A 4PGMA 2QL9A 3AT1A 3LBYA 3QXGA 5T67A 3MQFA 4I8XA 4BX9A 1YQWA 2P62A 3I2FA 2QDXA 4N0EA 3ZQUA 5KNCH 5D3ZA 2ZTUA 1DDOA 3QYFA 3W3AD 1HYGA 4QGHA 5G4KB 2GARA 1DIGA 4O25A 3IUEA 2NO7A 1W6UA 1VSQA 3KJGA 3KCQA 1ADCA 1BCRA 4IMPA 5KKCA 1OVGA 4M22A 2ZAOA 4ZVUA 5DYGA 2KBFA 3NIBA 1LNSA 1SVLA 5FPPA 1AHIA 4YMWA 5A0VA 1VCMA 2V7GA 3WQQA 3R5SA 4GVLA 3O84A 4S24A 1ZVQA 3U4MA 4AKGA 4ZZIA 2C31A 4IJUA 3TIGA 1JIJA 2PS1A 5DBFA 2CHUA 2V4MA 1MFZA 1D07A 2EJWA 5JROA 1DNPA 1GKUB 4D9NA 2E4XA 2OBYA 5CDGA 1GFWA 2JFGA 1DG1G 1JDBC 1EDBA 3CRZA 3L7LA 4IS2A 3GRCA 4XSVA 5IC4A 4EUNA 4CIXA 3MSXA 3RLFA 3WB0A 2V0CA 2R79A 3REQA 3CE9A 3F8SA 5JRZA 1HZZA 4YV1A 3SIWA 9ATCA 2BM1A 2PG3A 4Y1RA 3HBLA 1AOXA 1KC3A 3T3DA 4GWLA 1HG0A 2IIBA 5CG2A 4RA6A 2J85A 2VDWB 2XJ4A 3H6GA 4ZI7B 3IMEA 2DQSA 3FOZA 2ATCA 4ZO9A 2CFTA 2OMEA 3WNDA 4B6RA 3ADBA 4PC1A 1ZJJA 1NW5A 1LI7A 1XZ8A 4XYEA 1SOMA 4JFRA 3KDPA 4RQTA 3SAJA 4COKA 4ZZ0A 2WFLB 1WV0A 3LXXA 4C21A 4M0DA 3HHEA 3W1EA 5KSPA 1ULUA 1HFEL 1SBNE 4PU0A 5BWNA 1J0AA 1ZD1A 4K3UA 2JFVA 2WT4A 3GAAA 3M9LA 3AFOA 4KFTA 4P3KA 5KSZA 4QT4A 4XWTA 4OGWA 4ND3A 1V8DA 1LPOA 3NHBA 2IHUA 2WHYA 3B3FA 1OAKA 4M76B 1BE1A 3LBHA 4G65A 4JL5A 4CQMD 3MC1A 2I34A 2JGMA 1KPIA 4JCOA 3IVXA 4JI0B 2RGNA 1XYGA 4Q21A 1CY6A 5DM70 3BGDA 3V2IA 3L0ZA 3VM6A 1EVYA 1P7CA 5A9TA 3RSCA 5EYPA 2J9ZB 5KX5B 1BMQA 2BV3A 2ZJ3A 4TWIA 2BGNA 3STXA 1CVIA 1HMPA 2EFHB 2A4MA 2HNAA 2LXNA 1UL1X 4REQB 1K6JA 4P3PA 5AM0A 5FO1A 3DCIA 3PXEA 2AOUA 4LX8A 2YV2A 4AM8A 1QOZA 1Q1NA 1QG0A 2BTQA 1Z2EA 4FVTA 1T5OA 1CZNA 2FSVC 3RVQA 1ZI9A 1SU8A 2I4TA 1P19A 1MAVA 2YMPA 2CBGA 5AKKA 2I4RA 4NBTA 3PUWA 3QFRA 4L95C 1L9KA 2F9FA 1YDHA 1Y1KE 3OJLA 5IABA 3WP1B 1GNLA 2IXGA 3I6YA 1MW8X 1YVPA 4LPSA 2I7XA 2FW7A 1RYZA 5E4FA 1GTG1 5JU6A 5HGXA 2CE2X 3S70A 3DMFA 4NEQA 3ASUA 5EZYB 3EUEA 4G0XA 2OGZA 2C4VA 3HNRA 2ST1A 2XZPA 3KBBA 4KFCA 1D9ZA 2C5LA 3JYHA 2G82A 4TTRA 3TLMA 2RONA 3K09C 3E8XA 3UMCA 1HSOA 3HJRA 1ZISA 1I2BA 1Z68A 2FN9A 4JDPA 4TVBA 4W8HA 4XH9B 4BV2A 1X7XA 4MDHA 3PX7A 5LP6B 1R8QA 1KJ8A 5A9SA 4R1OA 1TJ4A 4G2TA 1T8PA 3LSYA 1ISPA 5BSTA 1N8TA 1ULAA 4QDTA 4AN4A 1OA0A 3ZE1B 1BEUB 4F3CA 2YJ4A 1DELA 4IICA 1Z2DA 4D9IA 3U7IA 1YH3A 2OGUA 3R76A 3LCMA 3KFVA 2CXRA 3KT0A 4ZQHA 2WYVA 1Z6XA 2X0JA 4P4TA 1SAYA 1SC1A 2WUEA 3A1WA 3W8DA 1G63A 2J5BA 2Z1MA 3DKIA 4XSGA 3D6JA 4RSRA 2H65A 4K2HA 3SLGA 3AB7A 1RTKA 3OLCX 1PQYA 4KYIB 2ZBFA 1Q7GA 4YYEA 1VKOA 5CPFA 2VJCA 1CNEA 3QXJA 3UV6A 3N8DA 2FWPA 3HEAA 2GN9A 4FDMA 3I09A 1KBZA 1Z22A 4OHRA 4M1MA 4XYGA 3VH2A 4KQ6A 3AWIA 1JZSA 2F3SA 1JDBB 3BSFA 2OCDA 1NBWB 2BEWA 5BN4A 1Y8CA 2GCGA 1TEZA 2J32A 2L69A 2HBRA 3S2FA 1T9GS 1E6MA 1E9VA 2XTNA 4Y6LA 5AVJA 2AB0A 1G21A 3T7EA 4BNUA 1K97A 4BKUA 4CCYB 1G21E 2MMGA 2ZBDA 4V0MA 4BNTA 3BMQA 5L6MB 1HDYA 1WUYA 4V0ME 1C9KA 4N0PA 1PZEA 4YP0A 4DE5A 3CO5A 1NNEA 2UZ3A 4KAFA 1KHHA 2IY9A 1Z6AA 2D7JA 2FRVA 3LUCA 3QPUA 5E1OA 4NU8X 1N6KA 4KOAA 2P9TA 2RH5A 2PZAA 5COBA 1KDPA 1GG9A 2P9ZA 2XNSA 4JXKA 1H6BA 3FNEA 3I6QA 1GNQA 4QXAA 2H0RA 4AJ2A 4BFSA 3B48A 2E89A 1GUZA 3PGKA 3PVSA 4GZ3A 4BMVA 4CBVA 2X2EA 2QZJA 5CA0B 2XXAA 2QJFA 4H27A 1C29B 2Y0CA 3G0CA 3LLVA 3O4FA 3OG9A 1DEOA 2EX0A 4WKCA 5AVQA 1WY5A 3N2NA 4PSKA 4BCDA 1IPHA 3WMGA 3FDFA 2JVIA 3VSCA 5I51A 1KOGA 2FGKA 3SZMA 2BFBA 4BTEA 2NUAA 4LECA 2LPMA 3RVOA 3BB3A 4N01A 3EWAA 1BWSA 2N0SA 1B15A 1XROA 2EBWA 4CXMA 1CZUA 1QC5A 4J2HA 1LY1A 4EB6B 1D6JA 2FG5A 1UWVA 1NOJA 5EIXA 3AHIA 5JRDS 2XCSB 2JGDA 2RDMA 4JT2A 5HPYB 3THXB 2QG6A 2H18A 3TLAA 3TBKA 3NYQA 4B6PA 3RFFA 2OEPA 3EQ9A 4FS3A 4UFPA 4PAWA 5CW1A 1QHFA 3L06A 1ZI6A 2VAPA 2JVJA 5F78A 4Q3LA 5LDGA 4W63A 4R1TA 1XRLA 2BI4A 3GYGA 1FDIA 1VCHA 4B9AA 5E1DA 4CTMA 4B71A 4W1QA 4BO4A 4CI0B 1XQ9A 1AXRA 3ETCA 4IMJB 5EE3A 2ZWPA 3OOHA 2ADFA 4V1CB 1SB8A 4HRXA 1GQYA 5KQPA 2DLCX 2UVQA 5AVSA 5IXJA 4KODA 4PHFA 2JHFA 2HJVA 1V1RB 3NHWA 3PKIA 5DHFA 3WHKA 3ZE8A 4JS0A 4WLFA 3TAXA 4TT3D 3HCRA 5E4YA 1C3XA 3SZLA 3ZY2A 4NYMR 3FUXA 4X6UA 3GLFA 4NIMA 2WF7A 3GN2A 1SG6A 4ARSA 4FBGA 1HDCA 2JLAA 4M9RA 3U17A 3ICWA 1JW9B 3KNZA 2FOXA 2JIZD 1EWRA 1N92A 3TYXA 1L5RA 4BLVA 3T1HB 4BY9E 1K7CA 4X1IB 1BD4A 4R1MA 1U9IA 3O3MB 5FBZA 5JISA 1XDDA 1H2RS 3EA0A 1M8JA 2X8JB 4RIEA 2AT1A 3BTSA 3ULKA 1XCOA 3MG9A 3OCZA 4BNYA 3G2NA 2IEBA 1A2QA 3L41A 4OAOA 3JASB 1Y6RA 4KR3A 3L79A 1GKYA 1R12A 2CYCA 2HJGA 5EG5A 5TJHA 4Q3NA 5LDDC 1NG9A 1L4GA 3EHEA 1XD9A 2VHEA 9MHTA 4UVHA 1PK9A 3CVVA 2GEBA 3X1MA 1YRLA 1HG1A 2GPSA 1X39A 4UBIA 1PK8A 1XTKA 3G2OA 4G0QA 2FSGA 1P1RA 2YRWA 3JD4A 4LYAA 4POAA 3S8MA 3ABRB 1XNRB 2C4TA 1EJ2A 2OL4A 5KWIA 5J23A 3FHCB 1ZUWA 1IZ0A 4UMDA 1W4ZA 4Z7QB 1NZFA 4KRGA 2A2ZA 4BLSA 4YLYA 5MDHA 5ECDA 4EGAA 1L4FA 5BSKA 3NEYA 3JQPA 2GM4A 1IMOA 1XF1A 1NZDA 1V0JA 3D8UA 3HZZA 4U2GA 2BZGA 4D2IA 7REQA 2G76A 4YP7A 4BFZA 3QRWA 1W47A 2FNAA 4FFRA 5AKLA 3I1IA 1ZGBA 2R48A 3F97A 3JSAA 3SHOA 4DLRA 3OQBA 1IL0A 1OZGA 4GOJA 5F7ZA 4PFJA 5HJ2A 1M0EA 4IJWA 2B2CA 4BX8A 1EFHA 3TOZA 1EX9A 3GGPA 5CFOA 3FKQA 5A3RA 4KIJA 2E2WA 4UAVA 1RI3A 3SVTA 1US8B 4LYGA 1H8HA 2QSJA 4EYQA 1YOBA 3OLXA 3DQQA 4IG4A 4MK4A 4EELA 3DNMA 5K8CA 4EPYA 7GPBA 4EVIA 4XFDA 3VYSB 2PBLA 3KOOA 5AJVB 2AR9A 3PGLA 3Q7IA 1XZLA 4PQYA 2CXPA 3ACBA 4R1NA 3OJWA 1ID8A 1NXXA 4WPGA 1DWOA 1PT8A 3GO4A 1NQXA 4L4SA 1XTZA 2FP3A 3HRIA 1R0YA 1XRJA 1X1EA 4PO1A 3TPCA 1B8UA 4D99A 3WNZA 2H7CA 2ERCA 2AZ4A 4N6GA 3Q4GA 4F9FA 3FTQA 3H2ZA 3UMGA 2PPVA 1MXHA 1EFKA 3EULA 1AQJA 5LUBA 1UXKA 1LW7A 3KOXA 4RQAA 3P9CA 3GA7A 4INOA 4KJZA 4RQBA 2FXVA 1G9SA 4JMPA 4C88A 4I1YA 4KPUA 1CEQA 3NASA 1W96A 1TM4E 1I36A 3LUDA 5CM8B 1WE2A 2ZFUA 1VMEA 3T15A 3ZTTA 2BM8A 1TVMA 1U0FA 5FB3A 1QBKC 1UKYA 2HIAA 1X8KA 4L78A 1YDGA 4OI4A 5IJ0A 4RDCA 2WKSA 5LVAA 1G6KA 3VDQA 4HJXA 1ZY2A 1M1UA 3HCEA 4GKKB 1JEQA 3OE7A 3OEHD 5E6SB 2HMSA 3TUIC 2O2CA 1DMRA 3K0CA 4X1YA 1EK6A 2Q5LA 3QEAZ 1Y1TA 5AXDA 3ZJ5A 4E5UA 4YUYA 3NB0A 2B1QA 2SCUA 3OPYB 4WBNA 4P3OA 4J6EA 4U2EA 3AUJB 3BQ9A 2V97A 4BBJA 1PFYA 1ORDA 3AP3A 4QKQA 4OLBA 1AO0A 3EPPA 5A7HA 3HVIA 2J1LA 1MIOA 4RPIA 1BDBA 2JGLA 2A78A 4S3MA 3QK7A 4R9SA 4A6XA 4G36A 3ZUPA 4B35A 3VRHA 2D00A 2NO5A 5GONB 3WLRA 1YJBA 1P4AA 1HQDA 3DR3A 8ATCA 3PNQA 4M46A 2ZRDA 5KHAA 3K70B 2Z2ZA 3AW8A 1ODSA 2YWGA 3N8NA 2WD9A 1OXUA 4HY3A 4KQJA 4NH0A 4GBMA 1RQ2A 1VB5A 1PJCA 4G97A 4LYFA 4DB2A 2NX2A 2XCLA 2NYAA 2PYDA 4XGKA 4EJ2A 1KNQA 2ACWA 1JWAB 2A3NA 3PDUA 2VQ6A 1L5HB 5MN6A 1DZ3A 1U7OA 4AXBA 5CW2A 5ICEA 1C8LA 2CD7A 3MJDA 2Z2XA 3FJYA 5LJIA 4MKHA 1QX3A 2JCGA 3DHWC 4NAHA 2VWPA 4UXHA 3VC7A 4M87A 3WADA 4DLNA 5I8WA 1SRRA 1UP6A 3COPA 3E8MA 1D09A 1FL9A 2D0PB 3MRSA 4NYJR 2WFZA 4QU8A 5ANRB 3DBRB 3RW9A 2GLXA 3ZH9B 4EY5A 1Q6ZA 3HB7A 1KORA 4PZLA 4HQ6A 1VE5A 4TLMB 1ODJA 2AD5A 3KB6A 4CEHA 3OQPA 2F7SA 4HAXA 5CLJA 1VDMA 2VK8A 1POXA 4DGSA 2V6MA 2XX3A 3DBLA 4OB8A 1JIIA 3S29A 3TLYA 1CE8B 5SICE 2JAOA 5SZJA 2CSUA 5JEDA 5JECA 4XJVA 4AI6A 4MLCA 3KYDA 2I80A 4PNPA 3A31A 5D3KA 4MW5A 4MEBA 4FQ5A 1JMVA 2HHLA 3D59A 3OPYI 1QP7A 1OTXA 4II2A 4JOCA 4NOLA 1QHIA 4LRYA 3TECE 1XVUA 3S1SA 5F2KA 4IIDA 5DCUA 1Z62A 1VPLA 1XN1A 1QE3A 3UV7A 1I3OA 3U09A 3ESRA 4NEHB 3ANYB 3LG2A 3V80A 4BU0A 3D7LA 2XRYA 3N70A 2VHWA 1J22A 3T35A 4TLBA 3UPTA 5A4FS 1KU6A 2WV7A 3CINA 1GR1A 4R68A 2FJUA 2NMVA 3Q9UA 4FJ0A 1FNCA 4RU1A 4X85A 4C4AA 3KUKA 3R7FA 3UUFA 4CN8A 1QFMA 3UMBA 2WNHA 4H3VA 4BFWA 5KCZA 4YDSA 10MHA 3CPJB 3HTXA 4QZVA 1AGNA 3RYIB 1NFRA 1KQ3A 3KT3A 4BDSA