2QP3A

Identification and characterization of two amino acids critical for the substrate inhibition of sult2a1
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
284
structure length
267
Chain Sequence
b'SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNIKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKEYVVDKTQLSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bile salt sulfotransferase
publication title Identification and characterization of two amino acids critical for the substrate inhibition of human dehydroepiandrosterone sulfotransferase (SULT2A1)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 267
sequence length 284
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2007-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qp3A00
4BLSA 4OHXA 3KQUA 3L82B 1OFHA 1WF3A 2P6NA 3RC3A 2E9SA 4D26A 4RY2A 4XOIA 1CR1A 3RS5A 5SZKB 3X1YA 3AQ4A 4M1TA 4D4JA 3K09C 4P3YA 1KI1A 4GPTA 1Q12A 2ZI7A 4I1SA 2CXXA 4TYWA 4JLKA 2ATVA 5FI1B 4BLQA 2VSXA 5AUNB 1E9FA 2DWQA 4C0HA 4M1MA 3THXB 1KTVA 4Q4HA 2NPIA 2XOKA 1C9KA 2J7PD 3PQCA 2ZJBA 1OLOA 5FPYA 1KI4A 4LWZA 4MKFA 2BMDA 2ZI9A 4U7DA 1SXJB 2J87A 4MRSA 4GP7A 3BOSA 2YNMA 3BH7A 4RVCA 2F43A 3Q85A 4LJ6A 4MGKR 3T1VA 3U5ZB 1FMLA 4DB4A 2N1BA 1Z0DA 2WMNB 1G5TA 4IRUB 2CHGA 3ZQJA 1T6NA 2DR3A 2JLRA 3KJHA 4YMVA 3T1TA 1E2EA 2RH5A 1D9XA 4JIMA 1UF9A 1XRJA 5DH9A 1N6HA 3VAAA 2XOKD 2ORVA 1CJVC 3DVLA 4OK5A 3V4FA 2JLQA 4DRZA 3U44B 1SXJE 2YKGA 2VP9A 1TAGA 2IS4A 4NCHA 5H1YA 5M04A 3W9YA 4MKHA 3QIAA 2F6RA 4ILEA 3AUYA 1VKJA 3FHOA 2C9OA 1M6NA 1OYYA 3EW9A 3BFXA 2WICA 1R2QA 1XTSA 4LJYA 2HF9A 2HXSA 3CNLA 5EE0A 4B2PA 4CEJB 2RGXA 4B44A 1YJ5A 3MCAA 1KGDA 4JVNA 4F4IA 4D0GA 5FPTA 4Q9HA 1RKBA 3U3MA 2GEDA 4GNKA 1UEIA 2BV3A 3RHFA 3PUYA 2ZRFA 5HE8A 3EZ7A 3VKHA 1XJQA 2BBTA 4E5UA 1UJ2A 3GJ0A 1ZU4A 4JS0A 4D4MA 1NSTA 3QXXA 5DE3A 2H57A 4RD3A 4HZUB 1VG8A 1U8ZA 4C0KA 2BM1A 3EIHA 2I3BA 2ZS9A 2JASA 4IXNA 2QSZA 1TPZA 1LB1B 2BMFA 3MRSA 4GOKA 1AJEA 1JJ7A 4KSBA 1XBTA 3OEEA 4C7OA 3BXZA 3QKRB 3VHXA 4G01B 2QA5A 1HA3A 4DKXA 2OO7A 5E7JA 4NYJR 1OIWA 3LX5A 1VG0B 1L2TA 2OM2A 4N0DA 4CEHB 4ZIRA 4LJ4A 1H8HA 3IILA 4PR0A 3AB3A 4BWYA 1G19A 3TW8B 1NVWQ 4FCVA 3FKSD 3DZ8A 3I8XA 3B85A 4LSGA 3TSWA 1J90A 1MABA 3GFPA 4NONA 2D3WA 2ODWA 1VG1A 1D8TA 2ZRKA 1KMHA 3BFVA 4GOXA 4NDZA 1KO4A 1P62B 1AKEA 2IS6A 3OEED 4DCSA 1IN7A 4TL8A 4A6PA 1I4DD 3B13B 2ZROA 3RLFA 1UADA 3UPUA 4GT1A 4NPHA 5FR2A 4L5BA 1JPNA 1Z07A 3KJIA 1W49A 2FSFA 1SGWA 3RYTC 1VYVA 3UMRA 2RGNC 2VHCA 4EAQA 4XWKA 5GVSA 5F3WB 3ONWA 4OJKA 1KJWA 2WBLC 3TVDA 2FPLA 2Q21A 2QBYA 3CRMA 3SYLA 3A4LA 1P72A 3TSZA 4AI6A 4IDNA 2AFHE 5JRJA 2ERXA 4TTQA 1YRBA 4UNSA 5FOWA 1RJ9B 5CDFA 1YZLA 5BXQC 5E7IA 1N5LA 3QXJA 2CCGA 1XFAA 2WVJA 1S8FA 4PQFA 4EPRA 2GAOA 3W90A 3B60A 4YDSA 3B1ZA 4KFUA 1E2LA 3GLHA 2V1UA 2IYTA 4BLOA 4BASA 1YR8A 4M1YA 3W5JA 4URUR 2QI9C 2VRWA 4Q1FA 4V03A 1KAOA 1ZM2A 2FN4A 4LPSA 5JS7A 3U3JA 2VO1A 3KQNA 2WKRA 2O8FB 1XEXA 3K9HA 1MH1A 4RD6A 4QBIA 5JBQA 2C5LA 1CS4C 4RD2A 1QHSA 1L8QA 2PEZA 1FP6A 4QNMA 4HAWA 4FCWA 3WY9A 4G5QA 2NIPA 5AJWA 1ZCBA 2VTKA 3IIMA 2ZSAA 1Q1BA 4EFNA 2XSZA 4AKIA 2IC5A 1N6NA 1CEEA 2BM0A 2Z4SA 4OHVA 4LV5B 1US8B 2P2LA 3EX7C 1AN0A 2G83A 4V0ME 4EQ6A 3PENA 1DADA 2J3EA 4ZKEA 4B48A 1ZYUA 2J46A 1IQPA 3SE0A 1P5ZB 4Z54A 1FTNA 4M2LA 2OLJA 2ZRAA 3S1AA 5L3QB 2Q0HA 1U0LA 2HT6A 3KX2A 1LS1A 4PO1A 4HYYA 4MH0R 3KB1A 3TMKA 4D2IA 4W5HA 1G5RA 1CJTC 2KSQA 2ZR9A 1D6JA 4B3BA 4OJQA 2ZRHA 2PMKA 1G16A 3ZYCA 1R0WA 1H8EA 4A0FA 6Q21A 3SJCA 5BN4A 5HKKA 2XXAA 1VDZA 4KVGA 4ESVA 4QJ5A 2A5YB 3EA5A 4HAVA 2XSZD 5EZ5A 3K9GA 5EQTA 2ONKA 3I72A 1AZSC 4UNPA 4MRNA 2VP6A 3K0AA 4JL5A 1D2EA 2BKEA 3THOA 4B43A 2HLDD 4ASUA 4QGHA 2ZI3A 2GA8A 4B2IA 2QUZA 3OIWA 4HEJA 4AD8A 3UK6A 3K70B 2QGNA 4DCVA 2H8KA 2O5VA 2R62A 1X8JA 3IGFA 3I62A 1J99A 2CNWD 1TMKA 1Z6TA 1P75A 2FFQA 3B2EA 1ZM3A 1XPOA 2IHBA 5HKKD 2QMOA 1AKYA 4MYHA 3JZMA 3PV0A 4EPTA 3PCRB 3WRYC 2Q3FA 1PV4A 1OXSC 5FFMA 1HH4A 1HT2E 2PZGA 2H17A 2VHJA 4HDCA 3I1FA 4ASUD 3VX4A 3CF6R 4Q4AA 1R0XA 3FMPB 3A6PC 4KU4A 5TMPA 1RRCA 4TYQA 2OCBA 5HTKA 2QSYA 3ZDQA 1G7CA 3OESA 4JLOA 3CH4B 3K0FB 2QNRA 5FTLA 1JECA 1A82A 5BN5A 5J47A 3MWLA 2W83A 3FFAA 4OYHA 4IXMA 3SJAA 4FD2A 4X8MA 3R9XA 2AK2A 4Q9IA 3SZRA 5JCZA 2BBSA 2F1RA 4BZPA 4V0KA 1JB1A 3SBDA 1UM8A 2GETA 1NMXA 1E2KA 2GBLC 1J7KA 1EFHA 4QKQA 1HE1C 1I2MA 4DHEA 4C0BA 2CHQA 4M1KA 3VR5A 1EFUA 5L3SB 3QNUA 2VBCA 3OHMA 4O0MA 1PLLA 1XXHA 4Q66C 5E7MA 5KDOA 4D82A 1D9ZA 2I1VB 3CWZA 1QDEA 3THXA 4RFSB 5KSPA 4CGZA 4EFMA 1SQ5A 1XPRA 1LS6A 2OCPA 5CJ2A 4PSKA 3AM1A 1JAHA 2J1LA 421PA 4FMDB 4B3CA 4NYMQ 2C96A 1ZNWA 1Q21A 3BH0A 2C04A 3PUVA 4KBGA 3B9PA 4CDGA 2GVZC 4QXAA 1SHZA 3C8UA 2A5GA 4A2PA 5E3HA 121PA 4Q1EA 5B58C 3R8CA 5AJVB 1KI8A 2IYXA 2G3YA 5C18A 4C0JA 4QM6A 1T9HA 4YMSA 2J45A 4QBFA 4BGDA 1T8UA 4IDQA 5EP3A 1D2NA 3VFDA 1KO5A 4NMMA 4CYMA 2IUSA 1P3JA 3U2QA 2QN6A 3TUIC 2CLSA 4I4LA 1SVLA 1W1WA 2QMHA 2IWHA 4PX9A 1LY1A 1YZKA 4TLCA 3EZ6A 3GJ7A 1UBEA 3VNUA 3U44A 3TGPA 3LDAA 3WYFA 1SZPA 1SXJD 4F7WA 3IUYA 1PVOA 2IL1A 2OG2A 2I1QA 1GSIA 1YRAA 2DFLA 2ZXUA 2WIAA 3WNDA 3OIYA 4YC7A 2ZRIA 4HSEA 3IO3A 4D81A 4HAYA 3T35A 2XNDA 4LJ8A 2CCKA 2ZVQX 2X77A 4EFLA 1XPUA 1GILA 1XTRA 4P31A 5IK2D 3FOZA 2VA8A 4Q7KA 1R8SA 1GRRA 1UEJA 2EFCB 2DB3A 1C1YA 3NVAA 5C4MA 2WWXA 5KNBA 4MRRA 1K5DA 1R0YA 2EFEB 3ZVLA 1GVNB 1QRAA 1S1MA 3QY0A 4JLBA 3NH9A 4M1WA 1X6VA 2DY1A 1NLFA 1JR3E 1ESNA 5KPJA 3UWKA 3FYHA 5JHHB 2OBMA 1Z63A 2UZ3A 1G291 2IF0A 4Q9JA 5AUOB 2AWOA 3KTAB 1YKSA 2XNDD 4JL8A 2CVHA 4GZMA 3IPYA 5A5GA 1TQ2A 1CTQA 3RRNA 2GZHA 2PZFA 2NO1A 1U8AA 4HLDA 1OXUA 3AF4A 1OXXK 3C41J 3QKRA 5FBVB 1R5BA 1KO7A 1FOEB 4X8LA 3SEAA 4C0QC 3P4YA 2W2XA 3GJ8A 4D0LB 3ZD7A 1AS2A 4HDQB 1Z6AA 3PJRA 4XD7A 2VF7A 4CEHA 1DEKA 3U6KA 2R6DA 3UWOA 2NZ8A 1SVKA 3V00A 4YQFA 2WJIA 1GUAA 3BE4A 4BFTA 1EESA 4JLNA 2ZR0A 4TZ0A 4FMBB 1ZD8A 5EP2A 4F93B 1T3SA 2FZLA 2QQ0A 3T34A 1G8FA 3CX7A 4XWOA 2RHMA 2WJGA 4UXHA 3C16C 5DN6A 4HB4A 3Q7PA 4RZ2A 5EUMA 3QXHA 1UKVY 3EWAA 4Q48A 3SYNA 4P4SB 3ND9A 4XWAA 4DC9A 4EPWA 4B6FA 3O8RA 1E0AA 2ZAMA 2WWGA 1Z6GA 5HZKA 1XZQA 1XTJA 2HDNB 2WOOA 5KU1A 4QBHA 4LBWA 1A2BA 3Q5DA 2GCOA 1UBCA 1SKQA 5IHPA 5KHOC 1ZU5A 1GNQA 4I81A 3ADCA 1YZNA 1NP6A 4BUJA 3GLGB 3EARA 2FOLA 4LZZA 2ASEA 1RJ9A 3ZJYA 3OEHA 5AJYA 3QJYA 1XTKA 1Z08A 2RGCA 1RE0A 1TU3A 1VPLA 1G5PA 2C77A 4L9WA 5DN6D 2WOJA 4BFXA 5KO2A 3N2EA 4M21A 2GCPA 4TMTA 4TMWA 3THYB 1OH5A 3IKJA 4G5SA 1UDXA 5JSZA 3EZ2A 3LLUA 4EJSA 2CVFA 1T3HA 2QY9A 1V43A 3Q9LA 1UFQA 4AK9A 2IYWA 5BYKA 2FH5B 1KNQA 4Z8XA 2NG1A 3GLGE 2GZDA 1E79D 2PX0A 3E70C 4PZYA 3HU2A 1W2GA 3A1VA 5J4YA 3OEHD 2W0SA 3RRYA 1AS0A 3A4MA 1GKUB 5FR1A 2F3TA 1E2IA 2Z5FA 4CEIA 2J0QA 2SHKA 4KVAA 5EJEA 2GJSA 1SHKA 2ANBA 3A58B 3CX6A 4Q4LA 4DSNA 3DM5A 4OHZA 5KSZA 4JBXA 3GPLA 5DIFA 3KXIA 2QMEA 1E2DA 1YZQA 1G3IA 1W4BA 2YV5A 4B34A 2ZYTX 3CW2A 1N6PA 2OAP1 3NHAA 1QHIA 4LUCA 2IWRA 1N0UA 2CLCX 3SR0A 1KDRA 2AXPA 2QE7A 1W36C 2OFOA 4HUQB 1XCMA 1HTWA 1E2QA 2H16A 2OBLA 1Q20A 1ZNZA 3K53A 3UANA 1ZCAA 1KSFX 2KB0A 1Q0UA 1FFHA 1XNJA 2QAGB 2QTVB 3B1YA 1G7SA 5CYPA 4OI2A 3TK1A 3UIEA 1FNNA 1E0KA 3P32A 1OFTA 4PFSA 1Q57A 3OFND 2XNSA 1KK2A 2E1RA 1CP2A 3LXRA 4LHWA 3SQXA 2O8BB 2XZOA 1R8QA 2OUKA 4M53A 1P2TA 2HEIA 4C0LA 4A8JB 3GMTA 5A4JA 2W0MA 4II7A 1TUEA 1XMIA 4OQNA 4A0GA 2XJ4A 2BEJA 2JIZA 5EXXA 2QE7D 3LO5A 2IYZA 4D4KA 1DAIA 3BGWA 1KI2A 1G20E 4QFMA 1NVVQ 2Z4RA 4QG7A 3AGQA 1NSFA 3QEJA 1M7BA 3PIRA 5DI3B 4BFSA 3V9PA 4TMXA 4AYXA 3M4YA 2WSMA 4OBEA 3VR6A 1SVOA 1OKKD 3CONA 4XVUA 3UMSA 1NY5A 3VKWA 3RSLA 3LQQA 2RMKA 4W5JA 621PA 1RPZA 4GRAA 1LF5A 1RYFA 1DG1G 2D2EA 4M1SA 3TLXA 2X19A 2FG5A 3VU9A 2OCAA 4BEBA 5B57C 2FGJA 4X8OA 3SYKA 4IVQA 1QVAA 2Q3MA 2JIZD 3FTQA 4JLMA 4US2R 4LCBA 3K70D 5DISB 2RB4A 1RW4A 2VL7A 1ZNYA 3AF1A 3HU1A 3K0CA 4IEEA 5E4FA 1E1RD 1ZRHA 2HJGA 3TR5A 3PXGA 1M1YE 3UG6A 2F9LA 4C4PA 3QPVA 4EDHA 3NHBA 2ZRCA 1RRFA 3VR4A 1X86B 3I92A 2GZAA 4AURA 2QGZA 1E9RA 4DCTA 1E0JA 3FHCB 3GLFB 1Z0JA 4AKEA 2B8TA 3JZAA 1ETUA 4JT2A 4BLRA 1HEIA 3SDZA 2NMVA 4AKGA 1AQUA 4NH0A 3R7WB 2ZRJA 1VTKA 2F1JA 4JLVA 4LHVA 5JEEA 3ETLA 2MMGA 3LBNA 2BEKA 2QMUA 2ZITA 3AEZA 3NXSA 1WDTA 1WP9A 2ECKA 2PMDA 3AKCA 3L8YA 1GRQA 5D3MA 1VCIA 4F91B 3CF0A 5FOUA 5C1BA 5EXPA 2ZJZA 4DLXA 3T5DA 1GFIA 1C4OA 1MO5A 2F1IA 5IT5A 2HXYA 3P1JA 2K5UA 3GLFE 4NTZA 3C15C 1VG9B 3NH6A 2A30A 4IDOA 1JI0A 1L4YA 2OAQ1 2ZQ5A 4UJ5A 1Z0AA 1SVIA 1XTQA 4Z1MD 2ZU6A 3KL4A 2F9MA 4LHZA 3GLIB 4GP6A 4JSYA 2OCYC 3DOFA 4HZIA 3TH5A 1FPMA 2VQSA 3W6OA 5CB6A 1AZTA 1PLJA 4NYIQ 4FMCF 4DSTA 5AUPB 1OSNA 4BFVA 5ELXA 3RS2A 1HT1E 4R2IA 1JPJA 2ZREA 3DM9B 3ICQB 3QKSB 1TF5A 2RGAA 2FJUA 3WNCA 1N6LA 5L3RA 4E07A 3ZZUA 4YXWD 1W4CA 5EZ6B 2V3CC 3L0IB 4Q02A 1EWQA 4OKSA 4NZYA 4QJ4A 4WW0A 3TKLA 3MWJA 2REBA 2XTZA 5FPKA 5HZHA 3GLIE 1I4TD 3KXKA 2C95A 4RFVA 1LVGA 2BWJA 3FE2A 3B1VA 3PR1A 5IF9A 3VX3A 1T8TA 5EE3A 1Z6YA 3TJZA 1NMZA 4Q1AA 4EJSC 2HCBA 2ZYVX 3LW8A 1E2MA 2AD1A 1G3RA 3QXSA 1ZVQA 1RYHA 2UKDA 2FA9A 3QVUA 1QHHA 2NPFA 3SFVA 1E2PA 3WMGA 4B35A 5B64A 2YHSA 3PEYA 1PLKA 4R98A 1P4SA 5JMTA 2NZJA 3PEVA 4FXPA 4MGIR 3ASYA 2GEVA 1XJCA 5HCNA 3FKSA 1N6OA 2AKYA 4IFEA 3DMDA 1ZUNB 2OHFA 4FMCB 1MO3A 4B3GA 1YQTA 4TL6A 3O47A 5HPYB 2J9RA 1KSJA 1S1CA 1ZAKA 1FL9A 2FFAA 2QENA 4MA4A 3O8BA 3GJ4A 1OW3B 2DFNA 1U81A 2C9CA 4H1VA 1EFTA 1G6HA 4ZDKA 1DELA 3FKQA 2BMJA 1KO1A 2C78A 3FMIA 1VHTA 1HQYE 1NY6A 3WYAA 3EASA 3QF4A 2AX4A 3GQBA 5KOYA 3QPWA 2B21A 1OV4A 4IJMA 1IXZA 2WKQA 5F98A 1JEDA 2KBFA 5LD2C 4DCNA 1FX0A 1VCOA 2FEOA 1A4RA 5KDLA 3D8BA 3UG7A 1KDTA 1DAFA 2EFDB 1OFIA 1DBSA 2WZQA 3C14C 1G4UR 1JXMA 4P32A 5EP4A 4RJLA 3EPKA 1JJVA 2RKOA 2ZIAA 5D3QA 1AGRA 2DHRA 2BBOA 5SZJA 3R9WA 4S2EA 3GJ3A 3TQFA 3W6NA 2V4ZA 3EZFA 2FZ4A 3ZZTA 1DVRA 1E2HA 2XB2A 2GILA 1OHHD 4WOPA 4B32A 2AR7A 2IS1A 1XX6A 4BRUA 2JLVA 4JBYA 1OT3A 2WSSD 2NOAA 1NJGA 1YR7A 1ZNXA 3HR7A 4CVNA 1XTIA 3L0OA 5FOTA 2XTNA 3W3AA 3T06B 3AVXA 2DWOA 3IHWA 1TADA 4JBWA 3ZS9A 3RAPR 1MT0A 4LJ7A 4A9AA 2GJAA 3AP2A 1EG7A 1W0KA 1ZUIA 2KE5A 4HAUA 2XZPA 4NU0A 3NKVA 1NJFA 4KHZA 2H1LA 5CK4A 4QRHA 1XP8A 1TU4A 2CHVA 3RS3A 4Z51A 1Q22A 3SJBA 4DLWA 1K8RA 2V6JA 3DMNA 1Z0KA 4DLRA 4XTRA 3THYA 3M0EA 1U8YA 4HAXA 4W9MC 2Q6TA 1G41A 1TTTA 1ZJ6A 3QPUA 2OBNA 2D7DA 4M4SA 5CJPA 1YR9A 2AL7A 3K0CC 1N6IA 4EIWA 3SQWA 2P6RA 2ZE7A 4IVPA 1E6CA 1NVVR 1XDBA 2R6CA 4N3NA 4Q1CA 2FNAA 3DL0A 5DYIA 3U6BA 5JFGA 1E2NA 1W0KD 3AKDA 4OQMA 2J0UA 1T5IA 4HI0E 4DXAA 4AG6A 2R6FA 4Q1DA 4GBMA 1EXMA 3GJXC 2IYVA 4DT1B 3BERA 1TNDA 5DLQC 1KHTA 2WWYA 4MDEA 5GJCA 1ZUHA 2AK3A 2GJ8A 4HLUA 2QRNA 5EXTA 1J70A 2IXEA 5JWHA 2ZU0C 4TLEA 5TV2A 3TSOA 4DEYA 5JEDA 3THWA 1ZM7A 5FTMA 2XB4A 5SZIA 2KI5A 2HLDA 2QP3A 1NBME 3E2IA 2IYUA 4RSGA 3FHTA 5DNYB 4C2UA 2O8CB 2WWHA 4IOMA 2OXRA 2EVWX 2ZRBA 3AUXA 4HUQA 3M1IA 4DDVA 1KJZA 4TMKA 1UDWA 2DPXA 5LBIA 5KSOA 5FTJA 2CNWA 3OZXA 1YU9A 3KKQA 1I2DA 1ZW6A 2QAGA 1JNYA 2AXNA 3AVPA 3L2OB 2NO7A 4AKHA 5DO9A 2OT3B 4LRWA 1Y3AA 3AF0A 3W6PA 2ZSDA 4BECA 3CNNA 3CX8A 1OFUX 4Q01A 2DYKA 3MWKA 3M6AA 1UKZA 2PH1A 3B8HA 1DARA 2ZI6A 1KIMA 2QPOA 4YMTA 4XJXA 2CJWB 1EFCA 1L7VC 3I4LA 4K81B 2JATA 3TNFA 3X1XA 2NGRA 4KXFB 4PSVA 1FTSA 2R2AA 3RS7A 2ZRLA 1OH7A 2BJVA 2D74A 2G0TA 2IS2A 4HB0A 2GXAA 1J8MF 1NN0A 3OE7A 3FFBA 1W5TA 1Q3TA 4LBYA 3IO5A 1WQ1R 2FPMA 1JBKA 1U9IA 4NCKA 3IDQA 1WB9A 4Q4JB 1GM5A 3FGNA 4KBFA 3GP8A 1BH2A 3TUZC 3EC2A 1M34E 1KKMA 4PHGA 1ZP6A 3FPAA 4JKIA 1Q1QA 4KLZA 2EYQA 1DAGA 1Z5ZA 4AY2A 1DG3A 3TE6A 4TZ6A 2PEYA 1OXVA 2BCJQ 3OF5A 3PUZA 2X2EA 2O8DA 2FF7A 4XVRA 5CIWA 3EZ9A 3GEIA 1RFLA 4MRVA 1V5WA 1E9EA 4C0SA 1S0UA 1WA5A 1R7RA 3AF3A 3U3OA 1SVSA 1U94A 4NYIR 2PT7A 2ONJA 1O3YA 4UJ3A 1Z8FA 2JLSA 1U98A 4PZZA 3OE7D 3IPXA 4EKDA 3A37A 4JKYA 4C0AC 3GFOA 4XSGA 3T1OA 4B47A 1T0HB 2GK7A 5JI2E 1E99A 2RCNA 4LBZA 4PAQA 1NF3A 4I1VA 4A1FA 1NIPA 4YDHB 3HYRA 4UNRA 1VCNA 2J5XA 4GFDA 4A36A 4PQRA 2QU8A 4L9SA 4W5WA 3TUJC 1TQDA 1QHXA 1BS1A 2CEAA 2A9KA 5G3YA 2OEPA 5AR1A 2H7VA 2BKUA 4GSYA 3W8NA 5FUVA 4XVQA 3R7WA 2EU8A 5E95A 4PC1A 3QENA 4G5OA 4UNQA 2VSFA 4Q00A 3NG1A 4BQSA 5JHGB 2JDIA 4OHWA 1MRNA 4CT4B 5KSYA 4IKEA 1HURA 1EFRA 4JYCA 2W6JA 2BBWA 4QJ3A 2RAPA 1N0VC 4ZCMA 3A1WA 4P4TA 2ZTSA 2FSHA 3P27A 2EQBA 2OESA 3L43A 4W7SA 4RD4A 1NIJA 2LCFA 3LVQE 2FDCA 3JVUA 1DOAA 1SXJA 2IK8A 2IYYA 3CH5A 3G5UA 4KLNA 5FOSA 3U61B 1W48A 2O52A 2YWFA 1ANKA 4DWJA 1PZNA 2OLKA 3B7GA 4WZAE 1T0JB 4Q47A 3WMEA 3LNCA 2VF8A 1II0A 2GHIA 4ZCLA 3SFZA 2WJHA 4K8OA 5FOVA 3ADBA 3QUSA 2WJYA 3PUWA 2JDID 5JECA 1F6BA 5JJLA 1N6RA 2JJ2D 5IK2A 4DB2A 1EFRD 2W6JD 4JJKA 4HB2A 2FFHA 2ZE8A 2J59A 3CB4A 2DFKB 3R20A 3AVTA 4PQYA 4JSTA 2P67A 4V0LA 4YLGA 4DJTA 1E2JA 4B3XA 4BEJA 4DDUA 2F43B 4IFBA 2X1VA 1SULA 1M74A 3NBYC 1LTQA 4D80A 3FMFA 3TVTA 3X1ZA 1Z6XA 4QOSA 1XMVA 4WZ6A 3BB4A 1E3MA 1E98A 2IA5A 4A0RA 1MRSA 5CM9C 3RS0A 4R2HA 3SHFA 1GKIA 2F7SA 1MO4A 5DHAA 4LHXA 1AS3A 4PHHA 3KZ1E 4JVLA 4CEJA 4Y0VA 2J41A 2FMXA 1XEWY 4WA7A 2PZEA 1WXQA 3VR3A 1COWD 2MSDB 3CRVA 4LYAA 3CKLA 4LV6A 5KDDA 3U3KA 2PJZA 3QKTA 1XB2A 3LQRA 4OL0A 1N6KA 5BQ5A 3I8SA 2CE2X 4AG5A 5B2ZA 1II8B 4IW3B 2HJVA 4A92A 3FDIA 4IEIA 4HZUA 4UQOA 3I73A 1MO6A 4U02A 3K8YA 1QHNA 1E32A 1FQJA 3QQ5A 4BRWA 5FBRB 1TUIA 4DUGD 4JLAA 3ZVNA 1YZTA 1IAQA 1Z83A 3F8TA 3NBXX 4LK2A 1P6XA 4Q7MB 2FEMA 4B73A 3LFUA 4HLUC 1CU1A 3BIFA 521PA 4B3FX 1OF1A 3I32A 2NTYC 1CJKC 1NI3A 2R44A 3B1WA 4Q7LA 4ZDIA 4FI3C 5CM8B 5KUTA 2PBRA 3LAWA 2B7BA 4TL9A 3RANA 4CZ2A 2IF2A 1CBUA 3BFKA 3N5CA 4PZLA 1GP2A 2LKCA 2ZANA 3IEUA 2NO6A 1UPTA 2KWIA 4JJZA 4CW7A 4C9BA 5JZVA 3U4QB 3VR2A 4BFYA 5KNCA 4LBVA 1XZPA 1JXOA 3LA6A 2VH5R 2IEZA 2I4IA 3NDBB 4TTPA 1RIFA 2MSEB 2E87A 5FUYA 4KAXA 1KAGA 3TAUA 2FX3A 3AKYA 3L8ZA 4CT5A 3IQXA 2IEYA 5J4KA 3DZDA 3QBTA 1MOZA 3G0HA 1TX4B 2DCUA 5BN3A 3B82A 4FWTA 4F4JA 3PFIA 3PUXA 5ANRB 4Z8YA 1OH6A 4PHFA 2YC2C 5LB4A 3AP1A 4PSAA 2DBYA 2QEQA 2VSOA 2ZE5A 4RD1A 1MABB 1CF4A 2XAUA 2O8EB 3KQHA 3GJ5A 3W8RA 1B23P 2FSGA 4E09A 3SNHA 2ZVPX 4KFTA 1KSGA 1KMHB 1DAEA 2VP4A 4GI7A 1E79A 3CUEF 3CPHA 2FPKA 2YOFA 1MKYA 2IYSA 2VHQA 3P20A 4ESHA 4F38A 2QPTA 3EPHA 2NO9A 3ADKA 1P2UA 3E5HA 3NC0C 4PO9A 4G5RA 2YJTD 3LBHA 1CLUA 4V0MA 4C3ZA 3HPRA 1DO0A 4IVRA 1E9DA 1IHUA 1Z28A 4RKEA 1E2FA 1GAJA 1E69A 2AHOA 1FUKA 1DAHA 4D6PA 5FUXA 3AVWA 1VIYA 4ON9A 1KMQA 4M1OA 4DDWA 2O8FA 4N1AA 2V7QA 4PPGA 3LY5A 2PX3A 4JL6A 3U3RA 4ZDJA 4LC0A 2P6UA 4L15A 1NMYA 1W0JD 1CJMA 4GMDA 2AN9A 1ZM4A 3FVQA 1GL9B 1F2UB 1NRJB 1VIAA 2CL6X 2ZYUX 4LJ9A 4QC2A 3WHLA 4ACAA 1TF7A 2C99A 4B33A 3RC8A 2EWWA 3CR7A 4NYJQ 3OFNA 2BVNA 2P5SA 2F1HA 3AP3A 4XIGS 5J4HA 2JA1A 4IOLA 1US8A 1ZBDA 4FIDA 3WBJA 3AGPA 2J0VA 4GOJA 2WPDA 3BS4A 5FL3A 2Z83A 1OH8A 4LJ5A 2D7CA 1XEXB 4JYBA 4OK3A 2Z6VA 3W5IA 1A1VA 1LNZA 5L3QA 3AVQA 3DDCA 1E9AA 3FMOB 4B71A 3K1JA 4O25A 4L4UA 5EP1A 4G1UC 3K9LA 3WRXC 2FWRA 3RWOA 2V7QD 3LLMA 3WP0A 3BJIC 2QAJA 1IN4A 5J5CA 3ZZ0A 1CRPA 5G3ZA 5IDVA 2LWIA 5CDFE 2DFTA 3U7GA 3LRPA 1SXJC 1ZINA 2RHDA 1E2GA 4U00A 5K8TA 1M2OB 5CYOA 1KK3A 5AWFC 3ASZA 4URYR 4TQ9A 5FBLB 4EQ6B 1W4AA 1OKKA 4HLQB 4MKGA 1W44A 4A2WA 4M9XA 4MYUA 4MUBA 3S1AB 3C4JA 3QI2A 3P4XA 3ZS8A 1VYTA 2WPDD 2WKPA 1F48A 4QGGA 2V6IA 2QP9X 3MJRA 5B30A 1YVDA 2UZIR 3CBQA 3KKOA 2IW3A 2QT0A 5K8IA 1U99A 2GJ9A 3RVBA 4MDFA 3ND8A 4PC7A 1E1RA 2XXAB 2YWHA 1TQ4A 2WWFA 4KYIB 4LPKA 4B74A 3CPJB 4TWZA 1S9HA 2MMCA 4DLZA 4TMVA 4NYMR 4TQUS 4OI4A 1G7TA 2Z0MA 1XD2B 4URXR 2CMKA 1Z0IA 5AJZA 4TSFD 4NL4H 3AVYA 3C7KA 1DPFA 2ZS8A 3CM0A 4QGFA 4HAZA 4N0EA 3IIKA 3KKNA 3F3YA 4TMZA 2A5FA 1RRPA 2GXQA 2V1XA 2VPPA 4BE7B 5J4VA 2ERYA 4Q7JB 4B75A 1O87A 2FGKA 1NKTA 3DPUA 4X8HA 3CIOA 4DDTA 1Q44A 3U60B 5FBQB 1NN5A 2A78A 1XJ0A 2CDNA 3SBEA 3WHKA 1NKSA 2JLWA 1AA9A 4NE2A 3WYGA 1TF2A 3K0FA 3Q7QA 4LGMA 8OHMA 1MR3F 1ZD9A 3WXMA 5FH9A 2ZI5A 3BRWD 1F2TB 3KJGA 2Q9BA 3X1WA 2VHUA 4QBGB 1G8PA 3ZVRA 2WWIA 5TY0A 3KJEA 4RZ3A 1GWNA 3RDPA 1XF9A 1HQCA 3PITA 3ICEA 4Q4AB 1QVRA 2Q9AA 2C8VA 4LY6A 4PO8A 5C4GB 3EPJA 2ODEA 1IY0A 2A3RA 2CLDX 4Z1MA 5L3SA 2XEXA 3SJZA 5EE9A 4WXPA 2G1KA 1Q3HA 1M7HA 2YWGA 4G3XA 4FN5A 5TXGA 3EIQA 1OB5A 1GIAA 1G6OA 4RFSA 1E0SA 4KV9A 3MD0A 5DHFA 2A2ZA 3TQCA 1VHLA 2YOGA 2G9NA 1ELOA 1HY3A 1S9DA 1KK1A 2H92A 1P9WA 3B1XA 4KJZA 1GRNA 4QHYA 2IXGA 4YXWA 4EPXA 5G40A 4OI0A 2ZSBA 2X2FA 1Z29A 3RNLA 2O0JA 4KFRA 5LDDC 2ZUDA 3T5GA 4DLUA 4BFWA 1XCGB 2EFGA 1WBBA 2ZRNA 1XEFA 1XXHB 3AF2A 3H86A 1N25A 3K0EA 1OE0A 4U5XA 1A7JA 3MJHA 4EPYA 3HP1A 5EXSA 4IDHA 1W36B 2EYUA 4POAA 4RZXA 1RRGA 2GKSA 1ZC4A 3BBPA 4UNNA 1S4QA 2PL3A 3MWYW 3BB3A 1PUJA 3Q72A 2PCJA 3ECCA 1P61B 3A1UA 3GD7A 4JT4A 3B5JA 2ORWA 3F0TA 4K46A 4DLTA 2W00A 4A15A 2R8RA 2KBEA 1M7GA 2IYRA 4URZR 3KB2A 2REOA 1JR3A 1KI6B 1I4LD 2OE2A 2IXFA 2EWVA 2QP4A 2ZEJA 1IN8A 2ZS7A 2ZETA 4Q03A 1CR2A 4US1R 4M22A 1UBGA 4DBLC 4MKIA 1Y63A 3NBZC 4DIEA 1XXHE 3BB1A 4M0LA 3HDTA 4GDFA 1DO2A 2ZRDA 4IOKA 2JJ1A 3CR8A 2G1JA 3I3SR 1GG2A 2BHRA 5TARA 2L0XA 1WE2A 3DOEA 1JALA 1WMSA 3OIUA 1TEVA 5F2EA 2ZUBA 4OQLA 3IEVA 2WTUA 4BPBA 3CPEA 1UKYA 5F9FA 2QORA 1HE8B 3X2SA 2WV9A 2X8AA 4ZDWA 1VMAA 4D0NA 4TQAA 1LF0A 3UATA 2G6BA 3AVVA 2HT1A 4Q9LA 1JR3D 5CLQA 1II8A 1T5LA 4RKFA 2UVQA 2WMOB 4LI0A 3A36A 1CRQA 4OQXA 4PPQA 3KTAA 2ZYWX 5F9HA 5JWRA 2JJ1D 4Q18A 1U2RA 4HATA 4O3MA 5J40A 3D6TB 4I99A 1J2JA 3ZIAA 1KKLA 2CL0X 4KFSA 2AWNA 2QTFA 3BK7A 2HV8A 1G8HA 3ZLJA 4P0TA 4LV8B 2WWWA 1OHHA 1YZGA 1UBFA 2PCLA 1E4YA 1QG2A 3HPQA 4M9QA 2JLZA 3AKEA 1W5SA 2RGDA 4PTLA 2WSSA 3GCGA 3TRFA 2LKDA 2QTHA 3TW4A 2B8WA 2QL6A 3EG5A 1X8LA 3U4QA 5G41A 1IJEA 3LVRE 3HU3A 1DE0A 2GBLA 2GF9A 1Z47A 4E03A 2WAXA 2HUPA 1WCV1 2VEDA 4PAOA 2ZI4A 1FQKA 4PAMA 4A2QA 3MUFA 4RD0A 4BZQA 4IOJA 4DZZA 1G21E 2W2VA 1IXSB 4O2RA 2ZPTX 5AJXA 3ZIAD 4PPFA 3QSYA 3U7EB 5AUQA 4XTCS 2BMEA 1G18A 5JWOA 4P4SA 1U0JA 1UKEA 3GJ6A 3X1DA 4US0R 3N2IA 4DLYA 2JLYA 1KYIA 4YMWA 1R4AA 2QT1A 3K70C 4C2TA 3LV8A 1KZGB 3NTUA 2ZJ8A 4Q19A 3SI7A 2QPAA 2ANCA 1S3GA 2VLIA 5CIQA 2O8EA 1S96A 3EA0A 1NG1A 5C46F 2GNOA 3GLGA 1SVMA 1BOFA 3VQTA 2DWPA 3MAAC 4YONB 5SZHB 4AWXA 1XU4A 3WNBA 3KQLA 1TQ6A 5LPNA 3QG1A 1IBRA 1CIPA 3QXCA 1GTVA 2FFBA 4TN1A 4RZUA 1ZD1A 1Z22A 5CK5A 2H5EA 4NCJA 4LYFA 1H8HD 2IBMA 4B6EA 2PJRA 1E9BA 3KKPA 2GCOB 3CLVA 2ZJ5A 1VCMA 3MSXA 2KJQA 2Z43A 3KXLA 1N2CE 4MITA 2QZ4A 3W34A 2A5DA 3BC1A 1AGPA 3K0SA 1OJLA 3AH8A 1DAMA 1KY3A 3EC1A 2B92A 3FWYA 4LC1A 3GEHA 5EE1A 1F2UA 3BD9A 1OIVA 1TL7C 1QG4A 1XEWX 2ZRPA 1FW6A 2PLRA 4BLPA 1SVWA 4BFZA 1Z06A 1KNXA 2AFIE 1EK0A 3BAFA 4HLCA 5JSZB 3IIJA 2XTMA 4QHSA 1G8YA 2JLXA 3CRRA 4EJSB 5L8VA 1E96A 4Q1BA 1T4GA 1E4VA 3VTKA 1N5JA 3LWNA 2RGGA 4L8GA 4AYTA 3RRMA 2ZAOA 3CRW1 4ZCIA 2BJWA 1WBDA 1P73A 3K9NA 3QG5A 4LX0A 4AYWA 2C03A 4FWIB 3CO5A 1FP7A 1XCPA 1OB2A 4H1UA 2HYDA 4ARZB 5DYGA 4UXJA 1E9SA 1N3BA 4ZI2A 3WP1B 3TAHA 4CEIB 1W7AA 4TT3A 2ZJOA 2W58A 5FTNA 1GNPA 3CZPA 4ABYA 4I1UA 3W3ZB 3CRQA 1KI7A 1KY2A 4JVMA 3AVOA 2O8BA 3OIVA 1FUUA 1ZM9A 4TLDA 3H4MA 3MGCA 4A8JA 5C2JB 5CB8A 2V54A 2WHXA 1IM2A 1PUIA 2A5JA 1EX7A 1D5CA 4JVSB 2JLUA 221PA 4ZV4A 2GWHA 1JAIA 1NL3A 1QHGA 2YOHA 4NHOA 3UMFA 5K8UA 2D4HA 4OI1A 2IYQA 1M8PA 1Q1EA 5LD2B 2XITA 2CL7X 2VP0A 1DS6A 2VP2A 5DI3A 3NEJA 4V0NA 1XD2A 4TT3D 4FINA 2GXUA 4FCTA 1Q1ZA 4GMXA 3I61A 2PLFA 3DKPA 4KITB 2QM8A 1AK2A 1R5OA 2GVDC 4M8NE 3NBFA 2ZJAA 1ZC3A 2ZJYA 4J0QA 4L16A 4AC9A 1F60A 1S2MA 1N5KA 3H2YA 4RCZA 2GTPA 3PEWA 3ZD6A 4Y0AA 1JQLB 2V55B 2WIBA 2ORIA 2Q3HA 4TTRA 1H8ED 1NVXQ 3O8DA 5P21A 3VNVA 4LYHA 3T1QA 2HF8A 1U90A 4MYTA 1G3UA 4Q5IA 3C5HA 3QBVA 3DKVA 5JCPA 1F2TA 1F3OA 3NIBA 1NN1A 4A0HA 5A0FA 4FMDF 5FTKA 1JEEA 3GLFA 1RZ3A 3VU9B 1NVUQ 2XX3A 4IHQA 4XH9B 2OZEA 3BORA 3DHWC 2ZR7A 4KO8A 1K5GA 4G0NA 1SKYB 4B2LA 1AQYA 1KI3A 1YE8A 1G64A 4RCYA 2AD5A 2JJ2A 1HUQA 4FW9A 4URVR 3QOFA 4PC6A 1Z2CA 3IBYA 1IXRC 5CLLA 5CITA 4QHTA 1T3LA 2OFXA 1XMJA 2P65A 1G4AE 1GKYA 2FE4A 5TB5A 3EIEA 3BWDD 3RSOA 2ZJ2A 1NN3A 4TLBA 3L0SA 3QE0A 1H65A 3JVVA 2OV2A 1G7RA 3H0KA 3H84A 1QZXA 4JLJA 1QF9A 3MFYA 3SU8A 1D2MA 1R0ZA 2IYLD 2P3SA 3SHWA 3MLEA 4BLTA 3H1TA 4B3DA 1SKYE 3VHLB 1KI9A 5D3MB 5BYJA 1G17A 3ZGXA 3GLIA 2C9YA 4Q4HB 2OSBA 2OILA 1X1SA 4V0OA 5IRCD 2C2HA 5L3VA 4LOAA 4H9GA 4NCNA 3QVVA 721PA 1COWA 2JJ8A 3QKSA 3IQWA 5HR5A 1KO8A 4JZKA 3P26A 4P33A 4WVFA 3IBGA 1KI6A 2PT5A 1ODFA 1R6BX 3KFXA 1N5IA 4PC2A 4G5GA 2GRJA 3NDPA 4I1OA 1E9CA 2V9PA 4WZBE 4TYYA 5KYKA 2VYFA 3VKGA 1ZIOA 1W2HA 2ODBA 4DUGA 3ADDA 1EGAA 4ERNA 1G9XA 1G3MA 3QF7A 1P9RA 3HR8A 4M9SA 2XGJA 1FZQA 2B6HA 1LFDB 2YINC 4HUTA 1W36D 3LH5A 3DEFA 3TBKA 4WXRA 1WRBA 4QGAA 3OAAA 2ZSEA 2ZUCA 4JMPA 2IUUA 4GZLA 4F92B 2GESA 3PEUA 2IX3A 1P2VA 1JR6A 2O0KA 2AKAB 1B0UA 3WMFA 1LW7A 4A6XA 4CRWB 2A7QA 3A1TA 4CF7A 4TYNA 1JQJC 2ODNA 3ZH9B 3CF2A 2RGBA 2VHTA 2GAAA 2ZM5A 2MSCB 3D31A 2JGNA 1IN6A 2FV8A 5AK0A 3HJNA 5EE5B 5FI0B 1A2KC 1XMSA 2BIFA 2J7KA 4PANA 4YMUA 4URWR 4ZKDA 4NKRA 4R9UC 1Z3IX 2WJJA 3Q5EA 3WBKA 4JLDA 3KQKA 1CXZA 2R9VA 1BKDR 2F3RA 1IOZA 5TVKA 3B6EA 2NO0A 4ITRC 3SS8A 2ATXA 4HB3A 2GJKA 4R7ZA 1GDDA 1VYUA 3N70A 4PHTA 1J8YF 2RGEA 5FPHA 3OAAD 4Q21A 1QHHB 4TL7A 2CBZA 3TR0A 3A8TA 2QRZA 2G77B 4BFUA 2GF0A 5BWMA 5FPSA 4OK6A 4LJAA 5GVRA 1KDPA 1YZUA 2JAQA 3D3QA 5FUWA 1E94E 2D2FA 3O8CA 1BO6A 4DLSA 4BZXA 4DSOA 4OHYA 2QAGC 1II9A 3REFA 3FB4A 2EFHB 3EAQA 4JLPA 2FU5C 3KFVA 5KPDA 2D62A 2OFWA 4HDOB 4PPNA 4C7OB 3K09A 2GCNA 1KK0A 4NP6A 3QEOA 3NC1C 1OPXA 1MV5A 2WM9B 3U7HB 4A8JC 2XZLA 1IY2A 4ZI3A 3AVUA 1IY1A 3QF4B 4QM7A 4ZIRB 3KUDA 3I5YA 4NBSA 2IHYA 3KKMA 1IJFA 1AIPA 3GFTA 2ZE6A 4E22A 4D25A 4MQBA 1DAKA 1FX0B 1YHNA 3R9IA 5G53C 5DGXA 1W46A 3A1SA 2GDJA 2YC4C 2IUTA 1U9IC 1KJYA 5J4LA 1FNMA 5HCIA 5KNDA 3VR1A 1W0JA 3U7FB 5JS8A 1T91A 2HCJB 5JLJA 3I5XA 1BYIA 3NWJA 3IHLA 1GNRA 3PG5A 4LDJA 3VMFA 4LYJA 1KZ7B 2W2TA 3A4NA 4XD7D 3CZQA 5H70A 5UKDA 3T15A 1KDOA 1P7CA 1BMFA 2YWEA 4PXAA 1GL6A 3B78A 4MGZR 2YZ2A 4TLAA 2QBYB 3Q3JB 3UXMA 2BOVA 1XD9A 1NBMA 3MG9A 1E1QA 5FOXA 4PC3A 5LB2A 4M9ZA 1EX6A 4Q9KA 1OYWA 4A82A 3HWSA 5GJVC 4D4LA 5KTYA 3F5FA 4QNRA 2O0HA 2WAYA 5GADl 4LHYA 3REGA 1DTSA 1S3SA 4S35A 2W6IA 4MGYR 1R10A 3T12A 4DT1A 1P9NA 2NQ2C 3GLHB 4NCIA 3EPLA 2CK3A 2EW1A 4MYCA 4ACBA 2QQEA 5JI3E 4EUNA 5H8WA 3ZVMA 1BYUA 1GZSA 1ONBA 3QKUA 1BMFD 1UAAA 5JJKA 4DIDA 4KSCA 1CR4A 3PVSA 1AM4D 2R6GA 4MUAA 2JEOA 3SC3A 1KSHA 3GEEA 1NBMD 1EWRA 3LD9A 1X3SA 2O8CA 1R5NA 1E1QD 1P2SA 3RRZA 1KOFA 3T61A 2C98A 2XJ9A 1CR0A 5DSZA 1Z0FA 2J0UB 4AIIA 5JJIA 3LW7A 4ARZA 2W6ID 3LXXA 1TEXA 3E1SA 1HV8A 2QROA 5H68A 3GLHE 1G8GA 2ZRMA 4TSFA 3SN6A 2CK3D 1FMJA 3LX8A 3THWB 2V8OA 2QG6A 4DSUA 3ZQ6A 1IN5A 3KUCA 2H18A 1YR6A 2YVUA 2CJWA 3C5CA 3L0PA 2GXSA 1W4RA 1LV7A 1NG9A 4EPVA 1RVDA 4A4DA 2G0NA 3KDSE 3Q8XB 1CULC 1Z2AA 5K8LA 1OXTA 2Y8EA 1NLZA 1F5NA 2BC9A 3J81k 2F55A 4IDPA 2J0SA 1W47A 1CKEA 2WJVA 4KODA 1U0HC 1GOTA 4Q4JA 3RABA 3RWMB 2N42A 3CNOA 4DLVA 1VECA 4GL2A 4CIDA 3K0AB 5DI9A 1K6MA 2Q9CA 4KI0A 4DVGA 1P60A 4KYUA 3DO6A 3SOPA 2CCJA 2BCGY 1X8KA 1CJUC 2VP5A 4UXIA 2ZSFA 3B9QA 3UKDA 1A5TA 2TMKA 4ZO4A 4QL3A 5FL7A 2BDTA 4C30A 3R8FA 3EXAA 5GJWC 2GEUA 1G1MA 2RGNA 2ZRGA 4MRPA 4F4CA 1ZIPA 1X1RA 1GITA 4WIAA 4UKDA 3HYTA 3MMPA 3LBIA 1G3QA 4DEXA 821PA 2HYIC 2GK6A 5HE9A 3NEYA 1IONA 4KCGA 1HYQA 4B76A 5FBWB 3BH6A 2P5TB 2FSIA 2YYZA 5BW8A 4WBSA 1XWIA 4XSHA 2REXB 1NLYA 3RS4A 3V4RA 1NNEA 4DCUA 4P4UA 2O8DB 4O2LA 5GJBA 1ZMXA 4R71A 2D06A 1ESMA 2R65A 3CWQA 4OQFA 1N0WA 2VIIA 4WAUA 1GL7A 1PJRA 1XD8A 1QHYA 3TIFA 3EWSA 1L4UA 2IT1A 2QM7A 2JCSA 3G82C 5EUQB 5FL7D 1RC8A 4ZPXA 5TDHA 4V02A 3AV0B 3D7MA 2N46A 1BIFA 2J7PA 5JRZA 1QBKC 2CE7A 2R6AA 2P0EA 1OIXA 2G88A 4TYPA 2B7CA 2OXCA
chains in the Genus database with same CATH superfamily
4BLSA 4NEHB 5IBCA 5DP2A 3T0GA 4W1QA 3AINA 4HG2A 1ID8A 2GZRA 4EEKA 2NU8A 4FTWA 3R6TA 2Q5OA 2W8BB 3CKMA 4P36A 1R6AA 4FW8A 1TO6A 2OZPA 3T41A 1C3OB 3WL3A 1G59A 3X1YA 2A0YA 3MJ4A 4YRTA 4D4JA 4GR4A 2WY2D 2GYVA 1D2HA 4OGKA 1NQAO 4I1SA 1EGVB 2CXXA 3DBLA 4L1KA 4Q3AA 1ECFA 2HPZA 1N9KA 4G8JA 4WKOA 3SE7A 4DSZA 5AUNB 1UMCA 2E5LB 2AI1A 1XN1A 3MTDA 3THXB 2X58A 1CK4A 1QWSA 2NPIA 2XOKA 4YT5A 4KR7A 2AW3A 1HT0A 2I76A 3PQCA 4G9GA 1TJYA 3AJDA 4CV1A 4O4JB 3EXG1 5F23A 2ZCJA 1YQGA 4LWZA 4MKFA 2BMDA 4PGMA 1RYMA 3RU3A 1W19A 3M9LA 2FP3A 4MLPA 1A95A 1QPBA 1BXGB 2HNKA 1RPJA 2NV6A 2VFAA 2YNMA 3BH7A 3BOSA 1NURA 3L1JA 4RVCA 1OXKB 2UYOA 3T1VA 3P94A 3I2GA 4DB4A 2F59A 2GH1A 1O94D 4KNYA 2C3MA 1KU0A 1OV6A 1ZOSA 4N3AA 1RAHA 1G5TA 4IRUB 2HA5A 2PWPA 4BX9A 1VL0A 3ZQJA 4F8YA 3ZIUA 8GPBA 2FUNB 3Q41A 2FX2A 1GGVA 4P83A 4W1SA 2PTGA 2XQGA 3T1TA 3WBFA 2H0RA 3U56A 2RH5A 1YB2A 3HKBB 1Y1LA 2B9EA 3OCXA 1XRJA 4YRAA 5HP4A 1N6HA 1AUQA 1JGTA 2ORVA 5IULC 2B20A 1PZGA 4JBNA 4OK5A 4R51A 4DCMA 4YRNA 1VSTA 3O7WA 3HB7A 2AG0A 3U44B 2HY7A 3PBKA 5JZSA 4M98A 4AUKA 5E1DA 3AJEA 1X19A 1TAGA 5IC4A 4RPHA 3FMVA 1MO2A 4RSRA 2IS4A 1MX1A 1EDDA 2OHIA 1J33A 3W9YA 5IT9A 4MKHA 4YUVA 4ILEA 3X44A 2HJWA 1VKJA 3AUYA 5LJIA 3EW9A 1M6NA 2OMKA 4YJKA 1MVOA 3TPFA 4YMIA 3X1JA 2EL7A 2IOHA 2DETA 1XTSA 3WRYA 1JYSA 2IZ1A 2HXSA 2XVYA 3A1CA 3CNLA 3KOMA 4WLOA 1OWMA 4AWAA 4B2PA 3ZDCA 5DLPA 1MMFB 4Y2GA 4CEJB 4P54A 2BMAA 4EO7A 4HWGA 3MCAA 3MQ4A 4MGHA 4D0GA 2V6BA 5EVJA 5JYDA 1HE5A 5GOTA 4UBJA 4UU7A 5IXSA 1I5OA 5TPWB 3PUYA 1A97A 1XRRA 1P1KA 2NU7B 4ZARA 1T10A 3RT1A 3IA2A 1QOQB 4DBVO 3OZRA 2VPXA 3EGOA 4I9FA 3PU6A 2CLLB 4GG1A 1UJ2A 3FB1A 2AA3A 1X14A 5KQRA 4D4MA 1WNFA 3PFCA 3KG2A 1IUPA 4KQGA 3TOCA 3GR6A 4MX8A 2WJ6A 4TM8A 1PP4A 2PS0A 2VPIA 3EIHA 3N8DA 1SC4A 4WY8A 4X94A 4JYZA 2QTWB 2BE9A 3M4NA 4EWLA 2JASA 2PMCA 1TPZA 5EFZA 4ZI7A 3P9QA 3QU9A 2BMFA 3WQSB 3VKFA 3JQRA 2HNBA 5CD9A 3BXZA 3VHXA 2R8ZA 4NJEB 3UEOA 4G24A 1HA3A 2LV8A 4J4TA 2OO7A 1IPEA 4N4AA 4UULA 4JI1B 1OIWA 2CXTA 3WHPA 2R68A 1IPHA 4CEHB 1ZY2A 3M6XA 2V65A 2ZVDA 2FZWA 1O95C 1LBTA 1YR2A 2Q4DA 1ZVVA 3IILA 4PR0A 4IQ8A 2SNIE 3AB3A 4QWMA 2C31A 2EJVA 4Y2XA 5H9VA 2R79A 3UAOA 4E21A 3OQIA 3WWOA 4FCVA 1YNSA 3MEQA 3JQDA 3DZ8A 4FUQA 1DOHA 4HY3A 4LSGA 4ZA2A 3PGMA 4UVEA 2C9ZA 1PT9A 1ZITA 2D3WA 5JCOA 2PU7A 2ZYDA 4ZO9A 4GMFA 1E7RA 3D3NA 1OA1A 1D8TA 4Y2QA 4NDZA 3WJ7A 1ZVKA 3JD1A 3KYDA 1P62B 4DCSA 5KI6A 5JD4A 1IN7A 3JQFA 3A4IA 1U80A 1XSEA 2EX1A 3WR5A 2Z2JA 4FK8A 4C06A 2H4ZA 5BO5A 2YV2A 4KVFA 3RLFA 3I58A 4QDKA 5BN3B 5FR2A 3PEEA 4FYPA 2I6UA 3K92A 1JPNA 1Z07A 2VT7A 3ANLA 3PGKA 4L5BA 2FSFA 1CY1A 1SGWA 1O6FA 5ICFA 1VYVA 3BSSA 4XWKA 1RVV1 4C89A 5F3WB 4OJKA 3R23A 1F14A 3TVDA 2Q21A 4QT0A 2ORYA 4LTMA 3ZBUA 1TUBB 5EIFA 1R4ZA 3A4LA 1Z5NA 4HX9A 4HEQA 2QJRA 2VVTA 5T4EA 1ZK0A 1I1NA 2BFMA 3OLWA 4XDGA 3QEKA 1U3UA 5LYJA 2EKBA 1LDNA 4OJTA 4UNSA 3TQOA 5A5EA 1RJ9B 2W2KB 4GYJA 4MWTA 2VDLB 2OWEA 3DF7A 4PBRA 2D5LA 2CCGA 2LUOA 3F49S 4UUQA 1S8FA 2R87A 2NSDA 2XQKA 3AIKA 4IV8A 5LL6P 5CEEA 2L19A 2PXXA 3B1ZA 3DLCA 1I94B 2V1UA 3PPWA 2IYTA 5JXGA 1Y5NA 1YR8A 4ITUA 4M1YA 1RXIA 4D9HA 1X7ZB 2NTNA 3I6MA 4NAUA 1KAOA 4KWTA 5K03A 3PXXA 4AM8A 2FN8A 3IPAA 2BRUC 4GPZA 1ZZEA 3NDIA 2FK7A 1J8FA 3D4LA 1V16B 2XQVA 4OO3A 2EKLA 1RI1A 1S02A 1PL6A 3PHBE 4NMLA 4RANA 3BVPA 3W3AD 1WB6A 4GKVA 4WDQA 2C5LA 4D9CA 5ITWA 5KIAA 1EP1B 1L8QA 1QHSA 2JAXA 4Y98A 5ALPA 5AVKA 1PZHA 4YAKA 1OXMA 4LNHA 3FX2A 5AJWA 3G02A 1ODJA 4NOKA 1EBFA 1SNYA 3IIMA 3G9UA 4YROA 2GLTA 1ZR4A 4X54A 2IC5A 3H7IA 3PVCA 1SFRA 5CXXA 3S68A 4D8VA 4OHCA 2X0KA 3ODGA 2M1ZA 3ONDA 1TMYA 4IYJA 5F9MA 1MVNA 1CUBA 1V4VA 3EX7C 4EQ6A 1FJHA 2PXHA 1JR2A 4X41A 3ZEIA 1OUMA 1ZLYA 2G04A 3BMNA 2ZRAA 5L3QB 1SQ6A 1PJTA 1BEZA 4OP1A 1SU4A 4CMIA 2UUOA 3ZZNA 1LS1A 4PO1A 5LNK1 2IVFA 3JQCA 3KB1A 3H5LA 1HYBA 5FFFA 3EN0A 1FFXB 3M5WA 4WNIA 1QB8A 4BNDA 4CLRB 3QPDA 6CHYA 4UEJA 5E4TA 1T4CB 1G16A 2PMKA 2WR8A 4HDMB 1R0WA 4A0FA 4MVJE 4AN0A 4ZGGA 3SJCA 3TRIA 5JW6A 5H5JA 2P35A 2C61A 4TV8A 4DSAA 4ESVA 2CMFA 7REQB 1NTRA 2GT1A 4IFTA 2XSZD 4Y30A 3K9GA 5EQTA 3DV2A 2H1RA 2I2WA 1KQ3A 1EK5A 1VBMA 4NIMA 2BR3A 3EXHB 3NNDA 2HA7A 3EXIA 3FF4A 4UNPA 3ON5A 2VP6A 2FR0A 1D2EA 2F48A 3OC0A 2X4LA 3ZE7A 4OL9A 5B1DA 3LCJA 1BFDA 3N87A 4MINA 4B43A 1HOXA 1WUKS 2VYQA 4HNRA 4ASUA 5IXYA 2XBLA 4JJ7A 1E59A 3QHPA 3G0IA 4B2IA 3QUAA 2QUZA 3WKAA 3C1AA 1JHUA 5ICEA 2V7XA 2PGXA 3CN7A 1Y8QA 2R62A 3MK31 3X2FA 2A88A 1QTNA 2PBZA 3IGFA 1J1UA 5A7GA 2DE0X 2VPTA 3LLVA 3B2EA 2FFQA 4ZQFA 2A59A 1BGXT 4CLDA 4YUAA 1DRKA 4I8XA 1W5BA 5KQLA 2WWRA 4KBYA 1NYQA 5LIPA 4AZWA 4RKWA 1AKYA 2HOQA 4P7FA 4DN6A 3LQ4A 5CCDA 4P98A 3W1WA 4AT1A 4EPTA 2ROQA 2W2OA 1AQNA 2BFCA 4F86A 2Q5IA 5TQJA 1UWKA 1Z6PA 4HDSA 1HH4A 3TDNA 3RIMA 2H17A 2IDKA 1SBTA 2HU2A 5C8YA 1OVMA 1AO0A 4X00A 5G0UA 3DYVA 5TE9A 3VX4A 5IKOA 5ALYA 1Q3KA 5CLGA 4LF5B 1TQ8A 1VDMA 4KU4A 4MEBA 2PSJA 1JJIA 1AE1A 2M9MA 4R0NA 1R50A 2GZSA 4RCVA 1RKXA 2VDJA 3B70A 1KWGA 1G7CA 3JY6A 3OESA 3QKIA 2Y1FA 2EXXA 4REMA 1K7YA 7YASA 2QNRA 1P91A 1QKJA 1Z7EA 3ZE8A 3KSZO 1JECA 2RHHA 1A5AB 2AEFA 1QPZA 1YD7A 1ZBQA 1DX6A 2D4AA 1RS0A 4UU8A 1BH6A 1GYRA 1IWPB 1BC5A 1G5QA 1WUJS 2AK2A 2B7LA 3AFHA 4F5DA 5JCZA 1PZEA 2F1RA 4FP9A 4V0KA 1GO2A 5BV1A 3SBDA 3WNVA 3FYDA 4GECA 1TM5E 2PZJA 4IUYA 1UM8A 1WXFA 2GETA 1E2KA 2GBLC 5CURA 3E0QA 3KV3O 5B3AA 4DHEA 2X13A 3FGPA 4M1KA 2ZTVA 3BTSA 5D3KA 1W1IA 3D02A 3P71T 4YJDA 2NXWA 3HYNA 4OU4A 4O0MA 2VDPB 1XXHA 5E7MA 2HQRA 5KDOA 4Y2TA 5CFOA 1PSDA 3U48A 3ZD9A 2VF5X 4HEA1 3S7TA 2KLBA 5CTAA 4FYIA 4P2GA 1TYBE 3M6FA 4YP6A 1ZHHA 1Y6FA 4URFA 1WQ4A 2BR5A 2IEBA 4B3CA 4FZJA 4MS3B 5IZCA 1DJQA 1LLDA 1RAAA 1TKAA 2VEOA 3IVAA 6ADHA 5KWSA 3H5NA 3BH0A 1TJ4A 2C04A 3G7UA 4FYVA 3RVSA 2CJPA 3IUEA 4CDGA 1VM6A 4IDCA 3C8UA 3PQ7A 3CF4G 4MWSA 121PA 4BTLA 4CFZA 2LDXA 1H0SA 4HS9A 3CUSA 4TWAA 5D85A 3R8CA 5AJVB 3DOHA 4UTRA 1KI8A 1U4SA 1PGQA 1XZ8A 2NXEA 2Q7OE 2G3YA 5CAEA 4KN8A 4C0JA 4LF8B 2NTEA 3NIWA 3PIDA 5EQFA 1T9HA 2I33A 4RORA 3GFVA 4EZIA 2O59A 1N1EA 4IDQA 2WJ3A 2PD4A 4GI1A 1KO5A 3L0ZA 1ZIYA 3VTZA 1P3JA 3GLUA 1I1QB 5EPUA 4YV7A 1MB4A 2OY0A 3HNRA 4I4LA 1SVLA 2QMHA 1NVMB 4HTAA 4X84A 4TLCA 3EZ6A 5BSGA 3VNUA 3HFSA 2BPOA 1YDMA 1A2OA 3KQVA 2IL1A 2OPBA 4HGRA 1GSIA 1YRAA 4X7RA 3GV0A 2YHUA 3CLSC 4CTMA 2X14A 3IKLA 3OIYA 3RIYA 3T7JA 2DH5A 4D81A 2IX9A 4HAYA 4WK6A 3NZEA 2VH2A 1FRZA 2UZAA 2CCKA 3ZBQA 4DYHA 4YMLA 1SWWA 2RG1A 4ZVKA 1SXGA 3DTYA 2ID8A 1FTQA 4IJKA 4NI5A 1XQ1A 5FEUA 3W5DA 3CVXA 1XALA 1EA7A 2W93A 3LUBA 4TX1A 4ZT5A 4R4JA 1K5DA 2Z5GA 3ZKWB 4PNHA 5JNRA 3ZCSA 2VJLA 3ADBA 1VPEA 1O8CA 2COKA 5KQGA 5BXYA 3OOEA 3FNQA 1QRAA 1S1MA 4EG3A 1Y4SA 1EXDA 3NH9A 1WETA 2FDXA 2ZJ0A 2DY1A 2J5RA 1NLFA 4UHBA 4WERA 3RJTA 3ETJA 3TF5A 1RWBA 3UWKA 3FYHA 3LT5A 3U13A 2YMQA 3VTFA 2G8NA 4G56A 1NI4A 2OBMA 4CCYB 5IJ0A 1G291 4O33A 2B4RO 2A1IA 2G70A 2DOKA 2YS7A 1XMOB 2YUTA 1UQUA 3G0OA 4Q9JA 2OAEA 1NW9B 2XNDD 4BX0A 3NTLA 5I01A 2CVHA 1L7XA 1V8BA 4GZMA 4L6AA 4NATA 5BN1A 3U9LA 5DULA 2GZHA 3ZN2A 3B3GA 2I7TA 3AF4A 3F6YA 3H6HA 5E2AA 1R5BA 3FVWA 2RHOA 1DZ3A 1CP3A 1WDLA 1XLUA 2J9XB 2PFKA 2VAPA 4FX2A 1WHTB 4X8LA 5KNBD 3P4YA 2W2XA 3GJ8A 1ABFA 4D0LB 1AS2A 4DMHA 3B20A 3VR3D 3WKBA 5B1IA 3TCKA 1DEKA 4LHEA 3U6KA 5FFNA 2NZ8A 2B2NA 1JEYB 3BE4A 1WCIA 3FLMA 4XLTA 3VOBA 4X6UA 4MIOA 2ZR0A 1QH9A 3UMBA 3VUFA 5EP2A 3GGGA 4FILA 1TLLA 1RQ7A 2RBKA 3CNHA 3RO7A 1G8FA 1SQ0A 1YQEA 3DQPA 1SHTX 3STUA 3ZZMA 4F60A 2QTTA 4QXMA 1UXIA 2QDXA 3BXOA 2RHMA 5JFTA 2WJGA 5AJUA 5F2NA 3OO0A 2A3NA 1AA6A 2Q4TA 4BYGA 4L5YA 3QXHA 4N8EA 1FBTA 1B4DA 1NJSA 3SYNA 4Q3LA 3ND9A 4EPWA 4TLLB 3C5VA 4XUEA 3W2HA 5HDQA 1IHXA 1UL1X 2H2FA 2WWGA 5HZKA 1EWTA 1V95A 2WOOA 4WK4B 3RB8A 3A2NA 4LBWA 1AUXA 4U8GA 4LVCA 3Q5DA 1SU6A 1X1TA 4GMGA 5BNFA 4DGSA 5IEJA 2GCOA 5DHQA 3NM5A 2NWQA 1D3AA 4P7JA 1GNQA 3MWFA 2XB6A 4I81A 5K1ZA 3TLAA 3QVWA 4AJOA 3MS2A 1VJTA 1N2SA 3EARA 1EINA 2FOLA 4LSWA 1VHQA 1K27A 4LZZA 2ASEA 3ZLUA 1YB6A 2IYFA 3C6YA 3NANA 3U1TA 1Z08A 3ZCVA 4L9WA 4YLEA 4DM4A 3S2IA 4BFXA 1N2IA 2AUNA 3A70A 4Y2RA 1MBZA 2OHXA 1H9BA 4M7OA 5HHTA 1I5EA 1UMBB 4TMWA 2AI2A 3JATA 3NPMA 3THYB 5TQVA 3IALA 3NR2A 3OT5A 4UUNA 4JI0B 1UBKS 1QO7A 5JSZA 1TOAA 4R54A 1TCAA 3LT4A 2CLIB 4AW9A 1I7SB 1DB3A 1IATA 1RM5A 1XF1A 1T3HA 1U7HA 5CFPA 4ZOAA 3QXGA 2QY9A 3RF6A 2LIVA 1V43A 3O8QB 2M32A 1HEYA 4YJ2F 3IRVA 3AR8A 1SXIA 1MQAA 1T1EA 4RH1A 1ZRSA 2GO1A 2NVBA 2NG1A 2DLCX 1MT3A 1E79D 2PX0A 2Y0PA 3D7SA 3E70C 1GT91 2OUIA 4MS1B 1AQIA 2CVOA 4OMUA 4DIMA 3IDSA 2J07A 1U2DA 3OEHD 3RRYA 3ZWNA 1GKUB 1NJ1A 4TKMA 4IO1A 1E2IA 2BI8A 2Z5FA 5EJIA 5HQTA 2J0QA 5I3ZA 3CHYA 2TS1A 3T38A 5DM2A 3WLRA 4DSNA 3CX6A 4MQFA 2QL5A 4OUDB 1QIIA 4Q4CA 4WKBA 4IWXA 2P9CA 1E2DA 1G3IA 5EPOA 1QTRA 4B34A 3CW2A 2OAP1 2IWRA 5COQA 4LUCA 2W2LA 3RFXA 3SR0A 1IVYA 1DC8A 4Z9FA 2AXPA 2GASA 3Q0IA 1AC5A 3WWDA 4TWBA 3VC3A 4HUQB 3RKUA 4OLJA 1B8OA 1XCMA 1HDIA 2H16A 1RCTE 5JAOA 4P0QB 4K6HA 3EODA 1FFHA 1MB3A 1U1EA 2CLKB 3NP7A 3A27A 2QAGB 4FQ8A 4IHJA 1QQTA 4JKOA 5CYPA 1W88A 1PU2A 4KQHA 2C2WA 3ZHUA 1DBIA 1FNNA 3UIEA 3P32A 3HR4A 5BVHB 2QN1A 1ZKMA 3I2JA 6REQB 2F8MA 1FW8A 1KK2A 2XNSA 2QX6A 4LHWA 2WIJA 4ND4A 4CQJA 5KOIA 2XZOA 2VJPA 1R8QA 4M53A 4XLLA 3HCWA 4C0LA 3WL6A 1PWZA 2Q6IA 1K7XB 1V9LA 3JD0A 1XZHA 3GMTA 3K05A 4X71A 3Q0TA 5FBHA 4YJ2B 1RPAA 1TUEA 3J7AC 3DW3X 4OQNA 4N40A 1G55A 3QVJA 4JVOA 1PTKA 1XAIA 1GQ2A 4U7TB 3W5BA 3DZFA 4MICA 1HDOA 3WDSA 1KI2A 3I04A 3FBWA 1PWEA 1G20E 1RI2A 1NVVQ 2AOUA 2AUTA 3NJ4A 4QG7A 4DPMA 7GPBA 3QEJA 4X1OA 4C01A 3PIRA 1FXUA 5DI3B 4BFSA 5K3AA 1ZGAA 5LP6A 1IEWA 3G8CA 5FXMA 3VR6A 4OBEA 3CLTD 4IJ5A 2VQFB 1CEQA 1EFDN 1EZ1A 1NNSA 2V7VA 4NFHA 4YBZA 1NVBA 1NY5A 3D6UA 2XUQA 5DRYA 2NVUB 5AVJA 4RV9A 1HFEL 2PGNA 1RPZA 1RC0A 4UEQA 2G36A 1LF5A 3T0IA 4G9BA 1MCZA 3TLXA 3VU9A 4BMPB 4BVJA 5HM8A 4DNQA 5D87A 2HQ1A 3H13A 4J6FA 5EL0A 5A1JA 2FGJA 5DDIP 4LVOA 3L7DA 3F4KA 2GA9A 2XNJA 4UVHA 1QAQA 2BLNA 2Q3MA 4JLMA 5G1NA 3AX6A 5HFAA 3RYIA 3AB7A 4KDCA 5DISB 3OQMA 5HJ5A 1XFDA 3HU1A 3KT0A 2HJGA 4LX8A 4FDTA 1M1YE 1F2VA 3W5SA 3USCS 3IAUA 4M83A 4C4PA 3KEGA 4GX2A 1L4EA 3QPVA 4BLVA 5COAA 1DT5A 4EDHA 1DAPA 3FZQA 1SPBS 4Y3UA 3UHFA 1AB5A 3EVBA 3M70A 5IKXA 3I4CA 3D2BA 3O8OB 1B26A 4GDMA 3V1MA 1Z0JA 2E2WA 5H02A 4AJJA 1P4HA 1I01A 3PKJA 1T6XA 4BLRA 1GRVA 1HEIA 1O94A 1SH7A 2RE8A 3K30A 4K28A 4HNVA 2WF7A 2F1JA 4LHVA 4F85A 2G06A 2ZIZA 3ETLA 1F5SA 3U4MA 3FNHA 5DVZA 3C6ZA 1CUSA 4L4XA 3X3HA 1BE8A 1D03A 1WP9A 2PMDA 1CZRA 1QYVA 1PGNA 5D3MA 4YIKA 2COEA 5C52B 1VCIA 5HS4A 2JBAB 1JQBA 1MTOA 2XCQA 4DLXA 1EJBA 5AW1A 3T5DA 4F1JA 5IJAA 3HDQA 2AJ8A 3NAZA 2HSWA 3GAMA 4D0RA 4C21A 3GLFE 3KT8A 2IXTA 5IH3A 5KJEA 3WGIA 3SPXA 3C5EA 4KGDA 4UJ5A 3AFGA 4U39A 5A2GA 4RIHA 2YQ5A 2Q2QA 3AY3A 4JXJA 4RS3A 4JODA 2PX4A 5REQB 5JQWA 4UCXA 1R3UA 1T2AA 2ZU6A 1YNOA 2KMLA 2D2IA 5CB6A 3TH5A 1JG6A 3IOBA 2ZTLA 2CLFB 4C7JA 5JMWA 4BDTA 1TAHA 1FDVA 2P7HA 3S0JA 4DSTA 5ELXA 4BFVA 3TIIA 3ET5A 1XIVA 3HZRA 4R2IA 4PN3A 2WU3A 3RF7A 5I48A 3ICQB 3S44A 4EM6A 1TF5A 3V8QA 3AIIA 3EIXA 4GL4A 4F4FA 4DR6B 1A8QA 3A6HA 4E07A 1VKRA 3GMDA 4WWHA 5GZ1A 1XMPA 2V3CC 2WTNA 5CXQA 4R2XA 4UUPA 4X0EA 5FWXB 1G63A 2N75A 3R7BA 5CPBA 4JEHA 1FFEA 3H83A 4WW0A 3H9BA 3KYIB 4KXWA 1TZCA 3H5OA 1CE8A 5KZMB 1NC3A 1O6GA 4R01A 3GLIE 2GBIA 3JTMA 3JQ9C 5EJ7A 4FZVA 4YQZA 1DRWA 3VR4H 1AMNA 3M5DA 1ZJ5A 3AL2A 3GVXA 3GVIA 2C7GA 3PD0A 2WM2A 5EE3A 2QW0X 3UV3A 4QRDA 1OX6A 1Z6YA 3ZR4B 5CHYA 5DTMA 2ZYVX 1G6Q1 1M2VB 1XNGA 1Q6YA 3MWEA 3NWPA 5E9JA 4DQKA 2UKDA 3WMGA 2FA9A 1IJKA 1QHHA 5K0FA 3SFVA 2JC3A 3RCBA 4XPZA 2JFVA 2Q5CA 4TKUB 1GV1A 4L08A 4IO0A 4FXPA 2O2DA 3ASYA 2QRKA 2XVMA 3FPEA 3LCUA 4P7GA 1U2EA 4RK7A 3VPXA 4AULA 1E60A 4F2GA 4K3VA 4IFEA 1OI2A 1KJQA 2NYRA 3SQMA 1O9BA 4L0DA 1HPLA 1YQTA 4G5FA 1ZH8A 4NULA 1C14A 1M0TA 2HMYB 3O47A 5HPYB 1KSJA 3GFGA 1ZAKA 4V3BA 1V25A 1FL9A 4H35A 4KXLA 1J2EA 3O8BA 1M75A 3DGEC 3B2NA 2H52A 4QSMA 5CT9A 3UT6A 1U81A 2XUFA 4IH1A 1JA0A 3BE5A 1TK9A 2P3OA 5BPFA 2XRMA 4ZDKA 1DELA 3FMIA 1KO1A 3HJBA 3DTVB 4AVYA 3H9CA 1H6AA 1VHTA 1HQYE 3A0UA 5DZSA 3GQBA 2DB3A 5HBGA 4JJEA 1TTHA 1I6WA 3LVBA 4PLFA 5A5FA 1QU3A 3QPWA 2FW1A 4IJMA 2C5EA 1M6VB 4RLHA 4FZ3A 4DR1B 5DIZA 3BRCA 1IDN1 1FX0A 1A4RA 3NNSA 3SSNA 3UICA 3W7VA 1TU0A 2P40A 3CLTC 3GGSA 4K8RB 1HNWB 3TRDA 3HADA 2NUTA 2EFDB 2Y1CA 3E9CA 3FCSB 1I51A 1AO3A 2IPMA 2X23A 3IERA 4RJLA 2NT3A 2ZIAA 4QGBA 5D3QA 4ZV7A 4N5DA 5EWJB 5SZJA 1NXXA 4S2EA 16PKA 3T3NA 3OY7A 5FPPA 1PTJC 4A23A 2BGMA 2P2NA 3WKCA 2CT8A 2YYSA 2A7XA 4RTKA 4E5DA 3O93A 1E2HA 1PW5A 4UASA 4WOPA 1OC2A 1X8XA 2AZTA 1QFJA 2ZIGA 2J6CA 3C4QA 3OJCA 4QQ8A 1URPA 5GZ6A 4KAFA 3WZ2A 2JLVA 1U5BA 3SQOA 4HH3C 4UZEA 4F3RA 2NOAA 4QUAA 2GPSA 3D5TA 4CVNA 3ZWPA 3L0OA 3Q40A 3VDMA 1L4GA 3ROPA 4MR7A 3W3AA 3L4BC 5AVXA 1NUQA 2PO5A 3ER6A 1TADA 3QW2A 4YCLA 5E9WA 2ZJ7A 1BW9B 1MT0A 1GQQA 1RQLA 1C5KA 2AJLI 4A9AA 4A1OA 2KE5A 3GPDG 4MPPA 4WL0A 4EKGA 3NIFB 4Y2PA 2H1LA 2ZSJA 3PDJA 2VAXA 1XP8A 3V2UA 3GJTA 1N8KA 3BN3A 1OFVA 5BV7A 3QVGA 5AOCA 2WNIA 3BXFA 3Q6MA 2E4WA 2QD2A 1P7VA 4MUGA 2V6JA 2AOVA 3DMNA 4XEUA 1Z0KA 4DLRA 5C3MA 2EQ5A 1U8YA 3GP3A 5DM1A 3UGKA 1TTTA 4L5IA 3U0VA 3EZXA 5ERXA 4M4SA 4BUZA 1N2EA 1NF2A 3EQ2A 4JBIA 4MUKA 5K0BA 2AL7A 3GOHA 4RTRA 1N6IA 2DTXA 2G25A 2F9FA 4RADA 1P1BA 4ZT3A 2ZE7A 1O6CA 4IBOA 4WXYB 3T99A 2CUZA 2I1WA 3L7IA 1ODIA 1XZLA 4Q1CA 5KTSA 2XQJA 1FY2A 2YW2A 4X7MA 5TGTA 1W0KD 3IVGA 3WO0A 5GM1A 1WQ3A 1E7QA 1T5IA 2GBPA 3D5QA 1JN0A 2CFIA 2PV7A 3BL8A 3ELUA 4AG6A 4EP1A 4GBMA 3M1YA 4M7WA 4CCWA 4DT1B 1TNDA 1XKTA 4GC9A 3T5AA 2FUG6 2JGIA 4MDEA 2AK3A 2NQTA 3V9AA 2GAIA 3K16A 2QRNA 5EXTA 1J70A 4FDAA 2IXEA 2M98A 2ZATA 4N8DA 4O2AA 3V1TC 5JEDA 3P5BA 2XB4A 5L7YA 3TFQA 5SZIA 1LK5A 2P9JA 1FVFA 3FCOA 4CNQA 4RSGA 1OLUA 2G08A 3OPNA 1OOEA 4C2UA 3B7WA 4IOMA 3ADOA 4ZU1X 2KYRA 5HCUA 3SEZA 4F06A 2WHEA 3BD6A 5LQDA 1H2ZA 3BQMB 3MW8A 5H0IA 1KTIA 4DDVA 1KJZA 2QN7A 3KKZA 5FBKA 2WILA 5IBRA 2XE8A 4XX1A 4EY5A 4Q3CA 5CEJA 1IMOA 1XE3A 3LM8A 2PWYA 3R09A 1I2DA 3WNQA 1QIDA 2AEMA 2JHFA 1Q0PA 4L02A 5CPFA 4NAVA 2DULA 4YAEA 5DO9A 4BQIA 5IVIA 4KE6A 3AF0A 5DT2A 3CS3A 5A4FS 3W6PA 3CNNA 3CX8A 3U0BA 1G5IA 1OFUX 4KPUB 2CNLA 3TGLA 1PNRA 2BH2A 2C07A 4EVSA 2BUCA 3B8HA 4FYHA 3VC1A 4PLWA 2PT6A 2QD1A 2QPOA 3BMOB 3ELDA 2Q28A 1EFCA 1L7VC 5KJFA 3D59A 3OD5A 1GSAA 4EL5A 2QYTA 3RI3A 1SHUX 4PYOA 3AHHA 5CNJA 5HMMA 3EQ7A 1Y7TA 3GD5A 3KJNA 5JDCC 1YIAA 3B9BA 1DWQA 1E4EB 2R2AA 2BFBA 3WWEA 1RYEA 3EIWA 3CV3A 4AJ4A 3OP4A 3PCXA 3LBAA 1PJ2A 4BX3A 1OH7A 2G0TA 4M9RA 3OHPA 3RYFB 4AJKA 1J8MF 3KDPA 4TXJA 2VZ0A 1W5TA 2BF7A 2V8BA 5ESXA 4LBYA 3OZUA 1HFJA 1EYZA 4IXWA 4O8CA 3O9VA 5KYVA 3ZOKA 1GM5A 1WB9A 1KZHA 1L3BA 3ZLTA 3V1YA 3JARB 4L07A 4M8IA 1BH2A 3LWDA 5GQSA 3DEYX 2CZCA 1HLFA 1WZCA 3F6RA 3EDMA 1ZP6A 5TIIA 1Q1QA 1N5RA 4W63A 1DAGA 1QGAA 2I6GA 4AS2A 5ISMA 1JLLB 4CF3A 3ZW9A 2O8DA 4G0PA 5L7WA 2FF7A 3C8HA 3K5PA 2P78A 4WACA 4W4TA 3S2SA 4C0SA 1S0UA 4FE7A 3AF3A 1SVSA 1U94A 1L4MA 1A4UA 3LX4A 2WLTA 5DGTA 3SKXA 2VDNB 3AEUB 4J03A 4LF6B 4PZZA 3DF9A 3A37A 4C0AC 1F9AA 1LUAA 3IQEA 1T1RA 2YDYA 3ORSA 4XSGA 5A3VA 4ZOLA 4D56A 1DQPA 4RQUA 4DV3B 2RCNA 1NF3A 2Q2OA 5IABA 1JWAB 2Y0BA 2ZFUA 4Q3BA 2ZSIA 2JD1A 3UJPA 3LRTA 3W8NA 3OKPA 2W8BA 5NLLA 1UKBA 5AKHA 1YT5A 2EU8A 3OZVA 3R5JA 2QW1A 4RAOA 1WXHA 1YAJA 1C3OA 4IKPA 1V41E 3QENA 5AOBA 3LI2A 4UNQA 2VSFA 4OMFG 4UUMA 1V1MA 4DWOA 3UT5A 4OHWA 1TT5B 1MRNA 1EG2A 5KSYA 1HURA 2J5BA 4YCJA 3BGIA 5K3FB 2IPOA 2CZQA 5EMJA 3I3OA 4P4TA 1KOLA 2ECFA 2LTAA 1DC7A 2JFUA 2WWTA 3P27A 1ZGCA 1RTKA 2Y0CA 4FFOA 1M10A 4O4JA 3LVQE 5EHZA 1H4SA 4I2NA 2W2MA 4UMEA 3T5TA 4KN6A 3CH5A 3NC4A 1KBZA 3L1UA 3GHHA 1B0AA 1UINA 1MD9A 1FMFA 3H97A 1BXGA 1BSVA 2YWFA 2GTIA 2I29A 5HM6A 2PKRA 4B2YA 3CZRA 4JI8B 3LNCA 5JCOC 1DCTA 2TRSB 1A27A 1ZA2A 2IOYA 4M1QA 2I7XA 4X61A 4ZCLA 2ECOA 3UK2A 4B7UA 4BKOA 3QUSA 1AUOA 4HNSA 4F04A 1VGVA 3JX9A 4OQYA 3WV4A 2XE7A 3JQFC 3I37X 2QRGA 3LBYA 3NIGB 2VPWA 3LY9A 4LRXA 2WQZA 4XRRA 4DW8A 1Y7IA 2PKQP 1EFRD 5F76A 1DHRA 3W5UA 4NXMB 2YMPA 1UBLS 2AJBA 3H8WA 4JJKA 5P8WA 3HKBA 4K0KB 2ZE8A 1HK7A 2OCKA 5GAJA 4M6WA 3OTIA 1A7KA 1LX6A 1EQAA 4JSTA 3OZDA 3ISVA 1W4ZA 1A8PA 2AVNA 3GDGA 4QUDA 4V0LA 3M6WA 2PYDA 3VPHA 4ZCPA 2F43B 2XQFA 1SULA 3WK5A 4N49A 2P9HA 4RHXA 3W6UA 2IHNA 3T7CA 1AXRA 1NVEA 1ULSA 3B5IA 3IUPA 4H7JA 3DL4A 4QOSA 1XMVA 3M6VA 3K4QA 3BB4A 1V48A 2AYYA 4LGVA 3ZHOA 1U63A 3FTFA 4TRNA 3WV5A 4INJA 3ZWWA 2BW0A 1ECJA 3OT4A 2QRMA 3MUNA 3PE6A 1SC1A 2O3JA 4R2HA 4W1RA 1U6KA 5CM9C 2F7SA 2I78A 2CMHA 3L46A 5JPDA 4LHXA 2A14A 5F64A 1MTZA 2YHBA 2CSXA 2XKAA 4CEJA 1IOWA 2PBLA 1JQ3A 4Y18A 5B1EA 2XUGA 4JUFA 3CN9A 4D5GA 1I7NA 4L8WB 3UBTA 4ZU6X 5G1PA 3D0KA 5CBKA 2VATA 4MKXA 4WINA 1RHKA 1WXQA 3VR3A 3FWZA 2NU7A 3CKLA 4LV6A 4FGLA 4ZVUA 2R7LA 5KDDA 2PG3A 2YTZA 3DHYA 4KPYA 2H63A 3BJMA 3KR0A 3LQRA 4KK3A 3G6KA 1PIWA 3I8SA 1BWQA 3O4FA 4MV1A 3VR5H 4AG5A 2WYIA 4Y2HA 2HJVA 2I2DA 4IEIA 5TQ2B 5I9IA 1XL1A 3K8YA 3RUPA 5I9TA 2PBFA 2GZ3A 1TUIA 3MRVA 1YZTA 3DMTA 2D1FA 3NBXX 4LK2A 4EJFA 5BR4A 1P6XA 2EKZA 3LWBA 4H60A 5FV4A 2AX3A 2FEMA 3TX2A 3ZCXA 2VK4A 1CU1A 3L0DA 2QTGA 3BIFA 4LA4A 4YH1A 4F3NA 3ZBPA 4B3FX 3O74A 1OF1A 2WIKA 3FUUA 4NJEA 1EVLA 5I7HA 1CJKC 4ZDIA 2J9GA 2R44A 2AQHA 3GVPA 5D5HA 1X87A 2PL5A 1KEZA 3MAGA 4Q9DA 2B7BA 4TL9A 3RANA 1RM3A 3MCVA 1A76A 3G2QA 5FA5A 2X41A 3UM9A 1WF6A 1N36B 2LKCA 5L4LA 1UPTA 4ZOCA 3DWEX 5G1OA 2Y6VA 4HQFA 1VCHA 5JZVA 3HDHA 1ICEA 2BD0A 2QOEA 3AK4A 3A28A 4RGBA 1U7PA 1GZ5A 2YRWA 4BFYA 1FYEA 2EW2A 2EKDA 3IIEA 3JQAB 4IHKA 2IEZA 2IPAB 4MZXA 3L05A 1J2RA 1EWVA 5JY1A 2E87A 1BE6A 1V39A 1M72A 3MTIA 3TAUA 5JBNA 2JAOA 4RELA 3AKYA 1DWPA 1MGPA 2WHQA 2AYXA 4BVHA 5J5VA 3QBTA 2BY4A 3ZV5A 1GUFA 1KAMA 1PEAA 1J20A 3G0HA 4WOBA 3G23A 3OWXA 2OZVA 3B82A 3DTVD 5BN3A 5A2QA 4FWTA 4F4JA 3ZWMA 3IE2A 3IP9A 1IVNA 2JVJA 4FKMA 4ER6A 5LB4A 3UFBA 1RAEA 2P6OA 2QEQA 1MDFA 3NHYA 4JITA 5I45A 1X1AA 3FDXA 4RD1A 1KQNA 2FW7A 2VDKB 3G13A 1KEVA 2XAUA 4PGGA 3ZHQA 4Z7QB 1IUNA 3W8RA 1VP9A 3AHFA 3SNHA 1ZZGA 2I5PO 1WS6A 4MQ4A 2G5PA 3RK4A 3ZY2A 1DAEA 4GI7A 1E79A 3CUEF 3L18A 3PNPA 1DKLA 4LOIA 2YIVX 5JAQA 4EABA 4XYEA 3KZNA 1B8VA 2IYSA 3NTOA