2QP3A

Identification and characterization of two amino acids critical for the substrate inhibition of sult2a1
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
284
structure length
267
Chain Sequence
SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNIKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKEYVVDKTQLSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bile salt sulfotransferase
publication title Identification and characterization of two amino acids critical for the substrate inhibition of human dehydroepiandrosterone sulfotransferase (SULT2A1)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 267
sequence length 284
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2007-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qp3A00
5FBLB 1VIAA 4V0ME 1AS0A 2RHDA 1UAAA 5H8WA 2EFDB 4KFSA 1RYHA 1U0JA 2P6NA 3T1QA 1IY1A 4CZ2A 4A82A 3LY5A 3CR7A 4AY2A 4C2TA 4KLZA 4WZBE 3U3RA 4M9QA 4GPTA 4CEHA 4MUAA 2C9OA 3UIEA 1QHXA 1N6KA 4ZCLA 4NONA 2G6BA 3LH5A 4V03A 1RYFA 4ACBA 2J46A 3V4FA 1IN8A 3AV0B 4V0LA 4ON9A 5J4KA 2CCJA 4JLNA 2ODNA 4LI0A 2E87A 2YINC 3IKJA 1ZUIA 4LJAA 5BN4A 4HATA 3DL0A 1SKYB 1T0HB 4B3FX 2QPAA 4OQMA 1WQ1R 2VP4A 2VSFA 2ANCA 5ANRB 4KBGA 4ZI2A 2KJQA 3IILA 3OE7A 4TL6A 3FHTA 4Y0VA 4E22A 4W7SA 4KFUA 5E4FA 4ASUA 4BRUA 1C9KA 2CDNA 1G21E 4F38A 3U3MA 2PMKA 4DDUA 1TUEA 1XD2A 2YYZA 2QMEA 2IEYA 1OPXA 4TSFA 4QGFA 1NIJA 1KKMA 4JYCA 5HKKA 1FOEB 3T5DA 3NHBA 4TTQA 4LOAA 1YR7A 1Y3AA 4C0QC 4JL5A 4PTLA 3SBDA 2N42A 4OK5A 1KSGA 2ZI3A 1VG1A 4NTZA 1MH1A 5JSZA 4GNKA 1OHHA 5D3MB 3WNCA 5EE5B 2B7BA 4L16A 2GVDC 1OIWA 3CZQA 1MKYA 1E2JA 3CWZA 3CRVA 3I92A 4W5JA 2WSSA 4LSGA 1R6BX 4PSAA 1RVDA 1VYTA 3W6PA 2V7QD 4DLTA 2GZDA 3FVQA 4XVQA 1GUAA 2E9SA 4JVLA 3AVYA 5JWRA 1FNNA 2F1IA 2RB4A 3AKCA 2Z5FA 3TLXA 5HCIA 1YKSA 2G83A 1SVSA 3T34A 4UNNA 3EXAA 3R8CA 3U4QB 5IHPA 4B47A 1FUUA 1ZM4A 2JJ2A 3PEUA 3KKPA 4NL4H 1P2SA 1G5TA 2WJGA 3KXLA 1UJ2A 5J47A 1XPRA 1IAQA 3TW8B 5JEEA 1U90A 2A5FA 2QPOA 4C0AC 2F7SA 3FPAA 3TUJC 2GCOB 4HZUA 2UZ3A 1AQUA 4JSYA 1PUJA 2QN6A 1G4UR 2G88A 1I4LD 4A0HA 2P3SA 1H65A 2ZI6A 2XB4A 2ZRLA 1GRRA 1G3QA 4HLQB 4B44A 1Z0DA 3PEVA 1Z6YA 1VCMA 3EZ6A 4MA4A 3GLGA 1KTVA 4TLEA 3MJRA 2MMGA 3C14C 4RSGA 2H5EA 2VHUA 4B33A 4Q01A 2JIZD 1KNXA 1SXJA 4XSGA 1GL9B 1Q3TA 1W7AA 2QP9X 2CLDX 4LV6A 2GF0A 3NDPA 1OH8A 1FX0B 1P9NA 3KUDA 4LHVA 1H8HA 5L3SA 1BH2A 5FUXA 4C2UA 3OEHD 5DN6D 4D0NA 4AG6A 3FMPB 1E69A 4QBFA 2ZSDA 1Q12A 1DVRA 2OBLA 4L5BA 1GDDA 2A5YB 1IXSB 4B74A 5CK4A 3GFOA 3TSWA 3EIHA 4QC2A 2DR3A 4YONB 5HTKA 3X1YA 4UXHA 3SEAA 4JVMA 4PC1A 3A4LA 4RKFA 1S1CA 3BB1A 1J8YF 1S9DA 4PX9A 1ZM7A 5LDDC 2WSMA 1XCGB 1R0ZA 3VX3A 3V9PA 3WY9A 2CLSA 4TLCA 4PHGA 4AYTA 2VLIA 4M9XA 3A1VA 2I1QA 4JLPA 3CF0A 3IO5A 4LYJA 5P21A 2ZJ2A 4CT5A 3VX4A 3KJGA 2IUSA 2WMNB 4LPKA 1G20E 2F55A 3MWJA 5LBIA 4RZ2A 1E2KA 2CK3D 3KXKA 1JJVA 1YR9A 4OBEA 5HE9A 2OAP1 3QG5A 4A92A 1KMHB 5FI1B 4YMVA 3ZVNA 3TIFA 1Y63A 3W5IA 2YOGA 5KTYA 3L0IB 3DMDA 2J5XA 1E0SA 2B7CA 3B1VA 4WXPA 5H68A 4Z54A 4JLBA 2BBTA 1U0LA 5TY0A 1OYYA 2IF2A 2X8AA 2HF9A 1CRQA 5FOWA 4UJ5A 2PCJA 4PAMA 3WMEA 3FB4A 4P33A 1KI7A 2JJ8A 3FKSA 2FZLA 3FOZA 2OM2A 2P67A 1HURA 3E5HA 1DBSA 1F2TA 1GL7A 2WBLC 3QI2A 4DIDA 5FPSA 4NH0A 4QJ3A 2ZRAA 5JBQA 2AK3A 3KFVA 3FMFA 3DDCA 2ZIAA 5GJBA 2GXQA 4A8JB 5G3YA 2QAJA 1KSFX 2W58A 4R98A 3ZZ0A 3N2EA 1E32A 4YXWD 1R4AA 4K46A 1OYWA 4FWIB 4IW3B 3NWJA 6Q21A 1JEEA 1NLYA 2ZR7A 1AGRA 3REFA 1AKEA 1G8PA 5EZ5A 1X1RA 3IQXA 2A3RA 1TEVA 4CYMA 1XPOA 5BN5A 3DOFA 1SXJE 3A1WA 1VCNA 1ZC3A 5EQTA 3QKRB 4M0LA 1ESNA 2AX4A 4IVPA 2AR7A 1DAKA 4IVRA 4C0SA 4D80A 5DGXA 2DCUA 4KVAA 4RZXA 3NDBB 3QOFA 1KDPA 3KQHA 2XSZA 4I4LA 3I1FA 1AZTA 1Z2CA 2ZRKA 4URUR 1CP2A 4KITB 5J4LA 1BS1A 3RRZA 1XMIA 1RE0A 3C15C 1KAGA 1ZNWA 1SHKA 3W3ZB 4L9WA 2V55B 1XFAA 5KPDA 1HQCA 4OHYA 1E98A 2WPDD 3CWQA 4AKEA 2W2XA 4GMDA 1XB2A 2EVWX 3A8TA 2C04A 4FIDA 3BXZA 1JR3D 4Q4LA 3OFNA 1K5DA 2HCJB 4B3BA 4KYUA 1CR1A 1E99A 3UANA 1NMYA 5DNYB 4G5RA 2CJWA 4PHFA 4JKYA 4EKDA 4C7OB 4TZ0A 1W4CA 4Q9JA 3U7GA 3BB4A 4CGZA 3KTAA 1NVWQ 1X8JA 4CEIA 4LHYA 3T1VA 2WWIA 3WP1B 2JLUA 1BYIA 1W4AA 1G8GA 2FX3A 2REOA 4O2LA 3CX7A 4R2HA 1CR4A 1QG2A 1ZD1A 3P4XA 5KO2A 4DDTA 3PIRA 2V1XA 4ABYA 1EXMA 1U94A 2ZJAA 3CF6R 2VTKA 4LJ6A 2ORWA 4RD4A 3UATA 3VR3A 1U98A 5FBQB 3DPUA 2W6JA 1DPFA 4G5SA 3ZS8A 1AN0A 4ZI3A 1OXSC 1VYVA 4A2QA 4ZIRA 5CM9C 3NC1C 3NBYC 1KK1A 1E2EA 4M1KA 1DADA 3H0KA 1TF7A 1Z3IX 3M6AA 2PH1A 3WYFA 3K9HA 2IYUA 1Z5ZA 4Q4HA 2NPFA 3C5HA 4ITRC 1CULC 2RGAA 4RD1A 1HE8B 1US8A 3AF4A 1XEXA 3Q9LA 1F5NA 4TMTA 3CRRA 3LVRE 1N25A 4RD3A 5GVSA 3M0EA 2OAQ1 1SVWA 2ZJZA 3OZXA 4LJ5A 2HJVA 4B76A 4HB0A 4BLTA 1KO1A 1P73A 1DOAA 3NIBA 5JZVA 1XX6A 3PR1A 5EE3A 1HA3A 2CE7A 1NBMD 1GTVA 1KJYA 2QU8A 4JJKA 1AA9A 3N5CA 3LV8A 4IDPA 1F3OA 5E7IA 5CITA 1NY5A 1R8SA 4QXAA 3SHWA 2A5DA 4BLPA 1XJQA 1XTQA 2BC9A 2WICA 3FDIA 4M53A 1K8RA 4I1VA 1OV4A 2AKYA 3JVVA 4OK6A 2YKGA 3EW9A 4QKQA 2VHCA 2ZROA 3ONWA 4V0KA 4YDHB 5BW8A 4ZPXA 1EGAA 4M1YA 1GRNA 3BH6A 4GDFA 2R65A 3EAQA 4DZZA 4DWJA 2QM7A 5EZ6B 1JAHA 4I81A 5FTJA 2QA5A 4LBZA 1UF9A 4N1AA 3NBZC 1E9BA 1M1YE 3AVXA 1NNEA 3BS4A 3VQTA 1JJ7A 3OAAA 5BQ5A 1YVDA 1GITA 2XJ4A 3QKSA 3N2IA 4TMVA 2OHFA 4ARZB 4FMBB 3KB1A 2FPMA 3V00A 4GT1A 1PUIA 5FR1A 4TTRA 5KSOA 2NG1A 4UNPA 3DEFA 3EC2A 4K81B 4CIDA 2DWOA 4IDHA 2QL6A 2BCJQ 4FCVA 3WNDA 4NPHA 2R2AA 4AK9A 1JR3E 1OB2A 4ZO4A 1FMLA 2NO0A 1GM5A 1BO6A 4M8NE 4DSTA 1NY6A 1MO4A 1HH4A 5FPKA 2B8TA 3PUYA 2J7PD 3U44A 3T61A 1OFTA 3FWYA 1IJFA 3LO5A 4G0NA 2JLXA 2ZUBA 3SNHA 1U99A 4YMWA 5FOXA 3ZVLA 4D0GA 3RS4A 4DC9A 4DHEA 2CHQA 1CTQA 2WAXA 3THWB 1ONBA 2IYRA 2BJVA 4D4LA 4JZKA 1XEWY 5AUNB 1G8HA 1HUQA 1UEJA 2OFWA 3W9YA 3I4LA 1AZSC 1AS2A 1E94E 1NVXQ 2G0TA 4P0TA 4RKEA 1OXXK 2QPTA 2RGBA 1W0JD 2PZFA 3CONA 4Q7KA 5TV2A 2Y8EA 3G0HA 4LYFA 3GCGA 5DHAA 1BOFA 2DWPA 2HLDD 3CX6A 2G0NA 2FOLA 2ZS8A 2J0UB 1RRPA 4XSHA 2CHGA 2GA8A 3K0CA 3QVUA 1DG3A 2WHXA 3KZ1E 3IHWA 4DSUA 3L0OA 3QSYA 1LY1A 3EA0A 3IGFA 2ZYTX 4PHHA 4CRWB 1KK0A 5LD2C 3NG1A 4US2R 1N5JA 2KSQA 5JWOA 3TVTA 4ZCIA 5HE8A 3AM1A 2HT1A 4CDGA 5FFMA 1BYUA 3WHKA 4XH9B 3Q5DA 1JBKA 2LKDA 1TEXA 1KI9A 2Q0HA 1NBME 4QL3A 3EPKA 4DRZA 1HV8A 3IIJA 4MH0R 3EPHA 2J87A 1CJKC 2R6DA 2IS4A 1DS6A 4FI3C 3L2OB 2AD1A 4LK2A 2ZRHA 1OIXA 2GESA 1ZP6A 2JLZA 2C2HA 2P5SA 4DJTA 1JAIA 3GMTA 4NP6A 2QQ0A 4OHVA 4XD7D 1RKBA 1CJTC 4E03A 3CNLA 1XTJA 4H9GA 4JT2A 2XXAB 2IW3A 1DO0A 2E1RA 4LWZA 4EPRA 2C95A 1XTIA 4GBMA 5AK0A 2W0SA 3U6KA 2BMFA 3CH5A 1YQTA 2J41A 2IS1A 2NO7A 2XZLA 3X1XA 2R8RA 1N6LA 2I4IA 1JNYA 2CLCX 4C30A 1X8LA 4QBGB 3RSOA 2XZPA 1E2MA 2VP9A 3QXXA 1JPJA 3O8BA 3AP2A 3EARA 3EWSA 3K09A 1YZLA 4KHZA 5BN3A 2O8DA 4XWAA 3B9QA 2BWJA 3IBGA 3G5UA 1IN4A 4PR0A 3QVVA 1AJEA 4UNQA 3K0SA 5CDFE 3AVTA 2QMOA 1OH7A 1YR8A 2B6HA 3SQWA 4XVUA 4QJ5A 1HT1E 4Q9HA 1XXHA 3EZ2A 4Q03A 3W5JA 4R2IA 4D2IA 3VFDA 4B48A 3LBHA 4PHTA 1W0KA 3LRPA 2WWWA 4GFDA 2OE2A 2JDIA 4NCIA 4GI7A 3T35A 1ZNYA 2EWVA 2GTPA 1A2KC 1Q1ZA 1XCMA 3UG6A 4Q4JA 2O0JA 4EJSA 1P2TA 4LBWA 4WVFA 1EFRA 2IYYA 3SFVA 4B2PA 4X8MA 2WJYA 5B57C 1KI6B 4FMCF 3KQLA 2CL6X 1NN1A 4Z1MA 1WP9A 3BRWD 4QHTA 3QXCA 3VNUA 1F60A 1UM8A 1ZCAA 5AR1A 2O8FA 3PJRA 2GBLA 2Q3HA 2ZRIA 3ZIAA 2W83A 1GIAA 3VR5A 4R71A 5EP1A 2PBRA 4X8OA 5C46F 1AK2A 4LY6A 1N0VC 3UG7A 4IOMA 1E3MA 3EZ9A 2VBCA 3AVOA 5KPJA 3GLIE 5L3QB 3VR2A 1NJFA 1G17A 3P4YA 4DIEA 4JSTA 1G4AE 1LS1A 2H92A 2FZ4A 3RDPA 3MGCA 821PA 1CS4C 1LV7A 2AFIE 3HJNA 3BE4A 3QQ5A 4DCUA 4LJ8A 1F2UB 3K0EA 5JECA 5HZHA 1Z63A 3RRYA 2QAGA 4TT3A 4E07A 2ANBA 2WWFA 1HEIA 1P9RA 2MSCB 2FFQA 4QHSA 5D3MA 4URXR 2JASA 4QHYA 5FL7D 2QY9A 2FN4A 4HB4A 1LNZA 2JAQA 1E1QA 1N2CE 1CXZA 1NN3A 3KFXA 1N5IA 3BBPA 3PXGA 2BEJA 4MUBA 4Q47A 2CE2X 2CEAA 3FHOA 2P6RA 3HR7A 1N0WA 1TF2A 2ZUCA 4YMTA 4NYIR 2BMJA 3GLIB 1IQPA 3Q7PA 4FMDB 3HPRA 3GLFA 3AGPA 1QHYA 2PZEA 4U02A 1QVRA 1GKUB 2FG5A 5LD2B 3NBFA 1XXHE 1ZIPA 1YRBA 1K6MA 4A6XA 2QEQA 5FOTA 1G18A 4HUQA 3TQCA 3Q72A 4PPGA 2OFXA 4II7A 4Z8YA 3SHFA 3AGQA 3THXB 4XOIA 4WW0A 3LBNA 4LHXA 1OFHA 1E4YA 4HLUA 3FGNA 3LXXA 2ZSEA 4DLYA 4NMMA 4B35A 4BASA 4MRVA 3I3SR 1Z6XA 4JMPA 3K0FB 4EFLA 3AVWA 3IIMA 3U61B 4BLOA 3RHFA 3DMNA 2ECKA 2AK2A 1NLFA 5K8IA 1Q57A 2OBNA 1AGPA 1RC8A 3K9NA 2H17A 2ZS7A 1ZW6A 1RFLA 5JJLA 1CJMA 4PPQA 1P61B 2YHSA 2UKDA 2ZRDA 1E9AA 1KI3A 2A7QA 2UVQA 2GJ9A 3ND8A 4ESVA 1CR2A 4RCZA 3FKQA 3K1JA 1HYQA 1KZGB 2R44A 4IVQA 4ZDWA 1KAOA 3AH8A 1E2IA 3LBIA 3IIKA 4DDVA 3LLMA 3ZVRA 2OXRA 2RGNA 2IYVA 3Q5EA 2CNWD 2VL7A 1JEDA 3W6NA 3E70C 5AJZA 2RGXA 4ASUD 4JLKA 4A15A 4S2EA 5EUMA 1CIPA 2VHQA 2ZSFA 4CW7A 5FTMA 3CF2A 4G5GA 4TSFD 2MSEB 3KL4A 4MYTA 2REBA 4TMKA 4B3DA 4BEBA 5AUOB 5HKKD 5SZKB 1UKZA 1QHHB 4Q1FA 3P1JA 2GK7A 5EUQB 2ZQ5A 2IL1A 2QG6A 4HDCA 3T5GA 2ZJ8A 1AIPA 2JLQA 5B30A 2CBZA 4FWTA 1U81A 3THYA 4URZR 3QENA 5EXPA 2XEXA 3SS8A 2QBYB 4HAYA 4X8LA 3B5JA 4KCGA 3W34A 5F98A 1NG1A 3CO5A 1VG8A 4OHWA 2X2FA 1QZXA 4NBSA 4BRWA 1MRNA 2YV5A 1P6XA 2O8CA 1WBDA 1ODFA 2LCFA 3PUVA 3LNCA 1TX4B 1X6VA 1LF0A 2WTUA 4RD0A 1S2MA 1D8TA 1J7KA 2FPKA 1QRAA 1W44A 2GHIA 1XJ0A 1ZMXA 2FFAA 4FN5A 5FBRB 5FUVA 4M4SA 1IOZA 3AF3A 4IHQA 1XMVA 1WF3A 2HT6A 1KGDA 4NCJA 3VR1A 4TYQA 2FFHA 4GOXA 4NYIQ 1EFHA 2ZU0C 1U2RA 3EA5A 2JJ2D 4B3GA 2X1VA 4NKRA 4F4JA 4GP7A 1YJ5A 4QJ4A 2WWGA 3QPVA 4URWR 1XPUA 2IYQA 3BWDD 1KSHA 2ZRGA 2V4ZA 4UNRA 4YC7A 3TNFA 4A8JA 3V4RA 3W8NA 3WYAA 4RFSB 4O3MA 2GCPA 3R9IA 1BIFA 2C5LA 4JBWA 1SXJC 4L4UA 4AD8A 3FFBA 1P7CA 1HY3A 2ZRFA 3TKLA 1Z6TA 4PO1A 5J5CA 1SXJD 4UKDA 4KSBA 2NTYC 4IJMA 2ZEJA 1FTNA 2KWIA 3TUZC 1R2QA 1P3JA 1EESA 5G53C 5JRZA 3NH6A 4PQFA 3ZYCA 1MABA 1H8HD 4N3NA 3X1DA 1UBGA 1KI2A 4PPNA 2O0KA 2WWXA 2WIAA 5GADl 3A36A 4DKXA 3TVDA 5IT5A 3U7FB 1ZUNB 2KE5A 3B13B 4GMXA 3U3KA 1ZNZA 4PQYA 3PUXA 1IY2A 1M8PA 5D3QA 1G5PA 3GJ8A 3MCAA 4NZYA 2WJIA 3L82B 1E0AA 4IDOA 3S1AA 4Z51A 2HXSA 2QSYA 4P4TA 1JI0A 2BEKA 1CR0A 4U7DA 2PLRA 1OXVA 3MWKA 1FZQA 2YNMA 4D4JA 2WWYA 2WV9A 3B1XA 1W1WA 4KYIB 4X8HA 2X77A 3HYRA 3RS5A 4PANA 2IUUA 4CEHB 1KIMA 3L8YA 1Z83A 4MQBA 1WDTA 5KUTA 4QBIA 1G7RA 2FFBA 1EFUA 2IYXA 2G9NA 4W5WA 5KNCA 4Q9KA 2PCLA 3MFYA 2FDCA 5C2JB 1FFHA 3OIYA 1J8MF 3H1TA 4DCNA 5JI3E 3W6OA 4HI0E 3RWOA 3CRMA 1W47A 4OQFA 2C77A 1GILA 3VU9A 2P0EA 1XZPA 1OFIA 2JIZA 4PAOA 1UKEA 4MKFA 5BXQC 1MOZA 5DI3A 1XTKA 4UNSA 5TARA 4ZV4A 1JPNA 5F9HA 3A6PC 3C4JA 2WKRA 3JVUA 2ZU6A 3FKSD 2O0HA 4OK3A 2BBWA 1R7RA 3QXHA 5E7JA 4BZXA 4DCVA 3AVVA 4TZ6A 1VMAA 4P4SA 1UDXA 1Z2AA 3GLHA 4O25A 3B6EA 1P2VA 1XD2B 2NQ2C 1VG0B 3X1WA 5FBVB 3OIVA 4I99A 4NYMR 2ERYA 5AUQA 2YZ2A 3QY0A 3LQRA 4AI6A 1OLOA 4YQFA 1ZBDA 2BKEA 2VSOA 4V0OA 1UFQA 4I1OA 4Q7JB 4LV5B 3QXJA 4A2PA 4EQ6A 5J4YA 4PZLA 3WXMA 1ZM9A 2GVZC 2QUZA 5JSZB 1IN5A 4DB4A 5JLJA 2J9RA 2BIFA 1D6JA 4TLBA 1G64A 4TMWA 4WIAA 4QOSA 2F43A 3SBEA 2XSZD 3GLGE 2H8KA 3HDTA 2CK3A 1E9SA 1KI1A 3BJIC 2CXXA 3KJEA 1SZPA 4B43A 3L0SA 3CR8A 4DT1A 2A9KA 3TAHA 3AUXA 3WMFA 1RRCA 2JATA 1VHLA 4KLNA 4TL7A 2ATXA 3NBXX 4BEJA 3R20A 3K9LA 4A4DA 2O8BA 1K5GA 1TTTA 1ZINA 1ZRHA 3QEOA 3M1IA 3VAAA 4ESHA 4XWOA 1PVOA 4M1WA 1TAGA 2NO6A 3ZS9A 1XMSA 2H57A 3DM5A 4HUTA 3CRW1 1WXQA 3NC0C 3OFND 2W00A 4IOLA 2R6GA 2VP0A 3SYLA 4E5UA 2WKPA 2F9LA 3AUYA 5FPTA 3SJBA 1M2OB 1EFCA 3NTUA 1GOTA 1KI4A 4DLXA 4MGZR 2JJ1A 4EDHA 3ICQB 2Q9CA 4JIMA 1R8QA 3KUCA 2X2EA 1XMJA 1G1MA 5DSZA 5HPYB 1MRSA 1V5WA 1Z29A 2FU5C 4UQOA 3GLGB 1PZNA 4XTCS 4NE2A 4LHZA 1Q44A 1SXJB 3AKYA 1KJZA 5DE3A 3B1YA 1TF5A 3CB4A 1E2PA 3KKQA 4A1FA 5A4JA 2P65A 3C8UA 3MWYW 5EE1A 4MITA 2W6JD 3K9GA 5L3SB 3SE0A 3G82C 4QGGA 3PUWA 5JFGA 4P32A 1CU1A 3IDQA 3TW4A 521PA 1GNQA 3THWA 2BMDA 4HYYA 1T91A 3BC1A 3LXRA 1XTRA 1Q22A 1G7CA 1W2GA 3EIQA 1YZQA 5AJYA 1WB9A 2O8EA 4QM6A 2JCSA 1KY2A 4KJZA 3KQNA 1R10A 2BDTA 4WXRA 3K0AA 2WPDA 1S3SA 4Q19A 3ECCA 1ZYUA 1SQ5A 3DZDA 3I61A 2LWIA 1LB1B 5IRCD 4NYMQ 1OSNA 2J0UA 1OH6A 2QT1A 1E0KA 3TRFA 5G3ZA 4OJKA 2D62A 3RS3A 4JYBA 5JS8A 4PSVA 1XCPA 1DARA 5CB8A 1DAMA 4Q21A 5LB2A 2AHOA 1G19A 4LC0A 4M1OA 2ZSBA 4S35A 1II9A 1N5LA 2F9MA 3NHAA 1E2NA 4IXMA 5EP2A 4D81A 4Q1CA 2DWQA 1P4SA 2OUKA 1KDOA 2GJSA 1NJGA 2VP2A 3SYKA 4G5QA 3TJZA 1FL9A 2D7DA 1OW3B 2F3TA 1ZVQA 2RKOA 4KV9A 5E3HA 2NZ8A 3R7WB 3RABA 3WRYC 1Z0KA 2XZOA 2ZR9A 1NIPA 1E9DA 1NKTA 2VRWA 1LTQA 3E2IA 1TQ6A 4IEEA 1ETUA 1WRBA 2VEDA 5JCZA 4Q00A 1N6PA 1VYUA 1F2TB 2D3WA 1XWIA 2GNOA 3KJIA 2FNAA 2XGJA 1QVAA 5IK2A 2EFHB 4B34A 3OAAD 2R9VA 2N46A 5EP3A 3AKEA 3MUFA 2R6AA 1OXTA 2OO7A 3LDAA 5LB4A 1XJCA 1E79A 4OKSA 2FJUA 5JHHB 2Z6VA 2DFLA 2F6RA 2JEOA 3QPWA 3OHMA 1E9EA 2IK8A 2ONJA 1GKIA 4Q4AA 3WHLA 2PX0A 1GL6A 2WVJA 4DDWA 4A9AA 2A30A 3CNNA 4G5OA 1EG7A 2C78A 2PX3A 1WMSA 4HAZA 4EPWA 3OF5A 4H1UA 5ELXA 3PVSA 1W2HA 1KMQA 5FUWA 3AF1A 4LZZA 5FTKA 5KU1A 3GEHA 1E9RA 2VH5R 4AYXA 4QGAA 2ZI9A 2HDNB 3Q8XB 3SJZA 5J4VA 2Z4RA 4NDZA 4JLJA 1UDWA 5FOSA 3CPEA 5JCPA 1FMJA 4MRRA 4Z8XA 4D26A 3BORA 4KVGA 4MGIR 4QGHA 2KB0A 4HAXA 1X1SA 2RAPA 4C0HA 2J7KA 1N5KA 1G7SA 2SHKA 3O8DA 3C41J 3B82A 3FYHA 2HUPA 3K0CC 4QRHA 4UXJA 1QBKC 2AXNA 4W5HA 1G3IA 4RVCA 4BE7B 3RAPR 2AFHE 1SVLA 4LUCA 3VTKA 2ZRMA 5CB6A 1GWNA 1II8A 4JLAA 4EIWA 3RRNA 4TLAA 2JLWA 2G3YA 1KI6A 121PA 1RRFA 1GAJA 1AKYA 2CJWB 4I1UA 5FUYA 3W90A 2FGKA 1G6OA 1L8QA 5JI2E 3T12A 1T3HA 2YVUA 3KTAB 4IOKA 1KHTA 3AP1A 2GJKA 2CMKA 1S3GA 3TK1A 1UPTA 1E2LA 4QBHA 1YZGA 2W6IA 3LX8A 2Q21A 4TYNA 2A5JA 1KNQA 5EP4A 4HB2A 2QE7A 1EX6A 4KFRA 2FEMA 3PEWA 4Q7LA 4JVNA 1PLKA 1A82A 4MYCA 3ZZUA 5FOVA 3QE0A 2ZVQX 1YZUA 2HYDA 2Z83A 1Z07A 3ZH9B 4ZIRB 4BGDA 2OCYC 3CH4B 2XOKA 1O87A 4BFZA 2WM9B 3MWLA 1OB5A 3C5CA 3C16C 1NSTA 3HWSA 4Q4HB 3PENA 1XD8A 3CIOA 1US8B 2GEUA 3KB2A 4DLWA 2VF8A 3LD9A 2ZJYA 3QXSA 3KKMA 5EXSA 2QTFA 3BK7A 1JALA 2ODEA 1N6OA 3SZRA 3K09C 4DLUA 2ZM5A 1W0JA 1W49A 2Z0MA 3HYTA 5F9FA 1OKKA 2IXFA 2FSGA 5TMPA 1W5TA 3QF4A 3MRSA 1IJEA 3EASA 4JT4A 1XP8A 2ATVA 2VP5A 1EK0A 1ESMA 1IBRA 1ZAKA 2IYWA 2ZE6A 2C96A 4RCYA 4IXNA 4GP6A 1G16A 4PSKA 2EYUA 1IONA 1PJRA 4DUGA 2AL7A 5CJ2A 2IEZA 4ZDIA 2G1KA 1Q3HA 1T5IA 4KFTA 5EE0A 1COWA 4DB2A 1IN6A 4D4MA 1N3BA 1CJVC 1BMFA 2F1RA 2ZVPX 3KQKA 2Q6TA 1Z47A 3A4NA 3LWNA 5GVRA 5FOUA 2QMHA 1KO8A 4CEJB 1Z06A 4EJSC 1QHGA 4DEYA 1D9XA 4TTPA 2BOVA 3DO6A 4OQNA 1S9HA 4WZ6A 4XJXA 3O47A 1EFRD 2QM8A 3T06B 3ZJYA 3TGPA 1II0A 1O3YA 4PC6A 2ZRCA 3B78A 3I62A 3QBVA 1NMZA 3QKSB 2GBLC 3B85A 5KNDA 4Z1MD 3ADCA 2IWHA 1HE1C 3AVPA 3NVAA 4TN1A 2CL7X 1NKSA 2P6UA 2WKQA 5KYKA 3L0PA 4G1UC 5GJWC 2ZXUA 1IHUA 3ZIAD 3KX2A 1H8ED 3OEEA 1JQLB 4U5XA 4RZ3A 5DLQC 3ADDA 4QNMA 4BFYA 4URYR 1G291 2FMXA 2GKSA 2Q9AA 2BHRA 4Q02A 4ZKEA 4IOJA 3AVUA 1T8TA 1LW7A 3ETLA 1DTSA 4Q1BA 4DBLC 2QORA 4ILEA 3P20A 4B71A 5M04A 1T8UA 2DPXA 3ZDQA 1F48A 4V02A 3U44B 4C0BA 2OZEA 3X2SA 1NSFA 4M2LA 2CL0X 2ZJ5A 1OE0A 4F91B 3SR0A 2QAGC 4MRPA 1QHHA 1FUKA 1P2UA 1XD9A 4LCBA 4MGKR 4PZZA 1VDZA 3FFAA 4JLOA 3TBKA 3J81k 2GK6A 2VHTA 4C4PA 4B75A 3W3AA 1N6IA 1W46A 1D5CA 1P9WA 3M4YA 3VKHA 2NO1A 1RRGA 3MSXA 4F92B 1KO5A 3IQWA 2ZSAA 1YE8A 2N1BA 4B32A 5KDOA 2ZTSA 4LJ4A 5FR2A 1OH5A 3OIWA 2XNDA 5KSYA 3GPLA 3NEYA 2DFTA 4RZUA 1ZU4A 1G9XA 1M7HA 2C8VA 1OXUA 3P26A 3RC3A 2QGNA 5E95A 1RJ9B 2ONKA 2OLJA 1XNJA 1SVKA 5A5GA 1E2QA 2GILA 3AF2A 2ZUDA 1D9ZA 2C9CA 621PA 5JJKA 2XB2A 4GL2A 3LVQE 2PJRA 1TQ4A 2EFGA 3ZQ6A 3ZD6A 2D2FA 5UKDA 2OV2A 5H70A 4MYHA 4JJZA 2GJAA 4US1R 3RYTC 3THOA 4KBFA 4BLRA 4HLUC 2GAAA 2KBEA 3ADBA 1W48A 3BB3A 4Q48A 2BBOA 4TMZA 1DAIA 3U7EB 1N0UA 2UZIR 3QNUA 2W0MA 3GJ6A 2D4HA 3IPXA 1E1RA 1ZM2A 3GEEA 4O2RA 4GRAA 2IS6A 3GJ3A 1U9IA 3BH7A 1ZIOA 2J0SA 1YHNA 3U4QA 2I1VB 4BPBA 4D4KA 2VO1A 3LFUA 1MV5A 1TMKA 1MO5A 1E2GA 4V0NA 4BFXA 4DCTA 4DSNA 1OFUX 2JA1A 3PQCA 1G8YA 3I72A 2VQSA 3FMIA 1UADA 2Q9BA 5BWMA 1YZKA 4BFVA 4WZAE 2DB3A 2GCOA 1J2JA 1L4UA 2RGNC 1P62B 5FL7A 3UXMA 2GXSA 1MR3F 4AIIA 2A78A 2DFKB 2RGEA 2BMEA 3CPHA 3FE2A 5LPNA 2KI5A 2QTVB 2DFNA 3U5ZB 4KO8A 2GZHA 3VKWA 1V43A 3FMOB 3KXIA 2IYSA 4FW9A 1WA5A 4JLMA 4A0FA 1UKVY 3AEZA 5KDLA 1XTSA 3QPUA 5AJWA 3N70A 1FX0A 1XXHB 1HT2E 2OG2A 3BAFA 5AUPB 1FP7A 3TR0A 3BFKA 3K53A 2QROA 3OE7D 3PUZA 3QKTA 4HEJA 4M9SA 2GEDA 3TR5A 3RSLA 1FQJA 1VPLA 2IF0A 2DYKA 2ZJOA 3B7GA 3E1SA 1TUIA 4US0R 5JMTA 4JL6A 1SVIA 4CF7A 3SFZA 3LA6A 3ASYA 1W4BA 1MO6A 1EFTA 4POAA 5AWFC 1U8YA 3F8TA 5C4GB 1FP6A 3CLVA 3OESA 2RGGA 3JZAA 3F0TA 1B23P 2REXB 3VHXA 4DLRA 2P2LA 4KXFB 3GEIA 4Q4JB 1A2BA 2OCBA 4EJSB 1D2NA 1R0WA 4P31A 2JLYA 2IT1A 1VG9B 4PC7A 5FL3A 3EG5A 2GF9A 4PXAA 1G41A 4EPTA 5L3RA 1QHSA 1X3SA 3RS7A 1N6NA 1OHHD 2LKCA 1F6BA 5JS7A 1NG9A 5JWHA 3IEUA 2VPPA 4PAQA 4BFWA 1QHNA 2O8FB 4CT4B 2TMKA 3NXSA 2WSSD 4AWXA 2GXAA 1LVGA 2WOJA 1A1VA 2HCBA 4KSCA 2D06A 3KKNA 1KMHA 3R9XA 1SKQA 1DAFA 1G8FA 2C03A 2KBFA 4GOKA 2QQEA 2IHBA 2WAYA 1Z08A 4A8JC 5C1BA 2CNWA 4FMDF 3GLFE 2D2EA 3PFIA 1I2DA 1JXMA 2PMDA 3ZZTA 2AKAB 2D7CA 2V9PA 3RS2A 3CM0A 2HV8A 4PQRA 4WAUA 3KQUA 1KDRA 2OEPA 2AXPA 3Q3JB 1G3MA 2WMOB 3NKVA 2QAGB 4GOJA 1VECA 1X8KA 1QG4A 4LC1A 2ODBA 2IWRA 2NO9A 3FTQA 1YU9A 1GNPA 1E9FA 4OI1A 4R7ZA 2GAOA 4LYHA 3UMFA 5FPHA 1QDEA 1JB1A 1Q0UA 1GSIA 3F3YA 4LBVA 4F7WA 2PJZA 2QTHA 3ZVMA 4C0KA 1FNMA 2F1HA 4MGYR 2J45A 5A0FA 5JJIA 1XRJA 1ZM3A 2FV8A 4JS0A 5B58C 2OLKA 1G7TA 3RLFA 4A2WA 3GLFB 4ZCMA 2RHMA 3QKRA 2ZJBA 2AN9A 1GZSA 4XIGS 5SZIA 1B0UA 1NVVR 2XJ9A 3IUYA 3RVBA 2V7QA 4HUQB 8OHMA 1GRQA 3VR4A 3QUSA 1T9HA 4OI2A 4BECA 1GNRA 5IF9A 1U8AA 1ZD9A 4LHWA 1VTKA 3BGWA 2XTNA 1DELA 2GXUA 4URVR 5J4HA 2GETA 2FEOA 2NIPA 3U60B 2ORVA 1E2FA 1CBUA 1KK2A 1P5ZB 3FHCB 1P75A 2PT7A 1AQYA 3IO3A 2YC2C 1E4VA 4LV8B 4Q9LA 3Q85A 4F4IA 3NEJA 2CCKA 2V6JA 4U00A 1NVUQ 2PEYA 1ZJ6A 2WWHA 4RJLA 2XX3A 2ZI7A 1Q1QA 2ZRJA 3SN6A 3TAUA 1W36C 4Q18A 4WA7A 4B3CA 2EWWA 3QBTA 3MMPA 2F1JA 4RY2A 1U0HC 4C7OA 4MKHA 3TMKA 1ELOA 1W36D 3H4MA 4BFSA 3R9WA 4IFEA 2ZRBA 5JEDA 4BZPA 1Z22A 2FE4A 2WJVA 2CHVA 1IM2A 3B60A 5DHFA 1N6HA 1XBTA 3LAWA 5FPYA 1E2HA 4ZKDA 3AB3A 2QSZA 4IFBA 3CBQA 1TL7C 1I4TD 3LW7A 4TL9A 5SZHB 5KOYA 3C7KA 2EFEB 3RC8A 2B8WA 5EJEA 3I8SA 4IEIA 3GD7A 2D74A 3D31A 2EQBA 1Z0AA 1S8FA 3OEHA 5DN6A 3TSOA 4ACAA 3K70C 5JRJA 5AJVB 3THYB 4M1TA 2B92A 4AC9A 3K70D 3K8YA 2XNSA 3GFTA 4ZDKA 3GJ0A 5SZJA 3CW2A 2CVHA 4N0EA 2NZJA 1CEEA 4KU4A 2A5GA 4NHOA 1R0XA 2FSHA 1Z6AA 2OFOA 3GP8A 2BVNA 4JLDA 3WRXC 3ZLJA 4WOPA 5CJPA 4Q5IA 1LS6A 3IPYA 2BM1A 4OI0A 4AKHA 4D25A 2O8CB 3A1UA 1Z0FA 3BOSA 2OSBA 3GJXC 3Q7QA 5IDVA 4HLCA 1DO2A 1NMXA 2GEVA 1Q20A 4XWKA 3HU1A 2V1UA 2G1JA 2ZYWX 1KDTA 1FTSA 3H2YA 4GZMA 1XEFA 5F3WB 4TQUS 1MT0A 2G77B 3HR8A 3R7WA 4FXPA 2V54A 4IRUB 4LPSA 5AJXA 1M74A 3RWMB 2FH5B 3QKUA 1Q1BA 2EU8A 4NYJR 3CNOA 2Q3MA 4UXIA 1R0YA 3BIFA 3GJ4A 421PA 1NVVQ 1XDBA 2IS2A 4B6EA 4PO8A 3BFXA 2JJ1D 2XTZA 4OYHA 2AWOA 2EFCB 2IHYA 1SVMA 2MMCA 4UJ3A 4Q9IA 1N6RA 3T1OA 1HTWA 4LJ9A 1FQKA 2WIBA 3CUEF 1DAGA 3HU2A 3DOEA 2YWEA 1Q21A 4L15A 3MLEA 4DLZA 3OIUA 3L8ZA 3SQXA 4HZUB 4NU0A 3VNVA 3GFPA 4LBYA 1TU4A 4ARZA 2IYZA 4YXWA 2ZETA 2V8OA 3ND9A 4TMXA 1MABB 2XTMA 1G3UA 1D2MA 2Q3FA 3W8RA 1FPMA 4B6FA 1PV4A 4TYPA 1GG2A 4KI0A 5CIWA 4JVSB 4C3ZA 3IHLA 4DLSA 2RCNA 2Z43A 3JZMA 2GDJA 1ZD8A 4HDOB 2IYTA 2B21A 4HLDA 3MAAC 4BLSA 2ZAOA 1I2MA 2XAUA 2ZS9A 3S1AB 4I1SA 4LJ7A 5DYGA 1QHIA 4JLVA 5K8LA 3H86A 4FCTA 2GZAA 4NCHA 4QG7A 2WZQA 1KK3A 1KKLA 3F5FA 4PFSA 1G5RA 3KDSE 2Z4SA 1CRPA 1XEWX 2FSIA 1A7JA 4J0QA 3GLHE 1R5NA 2BCGY 2QENA 2PT5A 2O5VA 1RW4A 4BFUA 2CVFA 1L2TA 2C99A 1Q1EA 1YRAA 3I8XA 4HAVA 4PO9A 5KSPA 3U2QA 3I5XA 1KSJA 4IDNA 4TYYA 4G3XA 2BM0A 2O52A 4HDQB 2H7VA 1JR3A 2QP4A 3EWAA 3VU9B 4P4UA 2WJJA 5TXGA 3BH0A 1VCOA 3CX8A 3TE6A 1KO4A 5DI3B 3WBKA 1GVNB 1E6CA 1Z0JA 3A37A 4M1MA 4TYWA 2OBMA 1W36B 3WMGA 4HAUA 2OCPA 3MG9A 3SJAA 3AP3A 2JLSA 1GP2A 3R8FA 3EIEA 4YMUA 5L3VA 3TQFA 1JQJC 4DVGA 1NI3A 5CLQA 2K5UA 4P4SB 5IK2D 4TQAA 4M1SA 3GLHB 1ZCBA 2ZI5A 4QM7A 3B8HA 3WNBA 2RMKA 3O8RA 1E79D 3EZFA 4NYJQ 1KO7A 1VHTA 4ERNA 2V6IA 4JKIA 2QRNA 1SULA 5EXTA 4QFMA 4HB3A 4JL8A 1R5OA 2IXGA 5F2EA 2FGJA 4A0RA 2QGZA 2ZE5A 4EQ6B 1XZQA 4MDFA 3CKLA 1DG1G 2XXAA 3SDZA 1YR6A 2R6FA 4D82A 1IXRC 1JXOA 3K70B 2IXEA 3CPJB 1X86B 3D6TB 1IY0A 3QF7A 1E2DA 2FSFA 5GJCA 3KKOA 4TQ9A 4HSEA 3PITA 2F43B 3AVQA 3H84A 4Q1AA 5C18A 1NN5A 2RGCA 4N0DA 2C9YA 2GJ8A 2HEIA 3RNLA 1U8ZA 1J99A 3ADKA 1S96A 3IBYA 5DIFA 4DT1B 4C0LA 2ZYVX 1NBMA 3CRQA 3SYNA 4K8OA 4LX0A 3EPLA 1CF4A 5DI9A 5HCNA 2YWFA 2PL3A 4AKGA 5C4MA 1SHZA 2O8BB 3HU3A 1OJLA 2FWRA 2V3CC 1KOFA 4CEJA 3LLUA 1C1YA 2ZI4A 1RZ3A 3AF0A 5CYPA 5CLLA 5TB5A 2VHJA 2RGDA 1KJWA 3SOPA 1MO3A 5FTLA 3EZ7A 2NPIA 2VF7A 5TVKA 4GZLA 4AYWA 2J1LA 2BJWA 3KJHA 4EAQA 4TL8A 4OHXA 2JLRA 4M9ZA 1T3LA 3DKPA 2J3EA 1CKEA 4YDSA 2JLVA 4D0LB 1EX7A 1I4DD 2W6ID 3P27A 5DISB 1ZUHA 3LQQA 4R9UC 3TH5A 5K8UA 3EPJA 2QE7D 1S0UA 3GJ5A 1ZU5A 4MRSA 1NLZA 4D6PA 2ZITA 4GSYA 4HAWA 1NP6A 3LW8A 1PLJA 4W9MC 3I5YA 4BWYA 3RRMA 3WP0A 2HJGA 2NOAA 2ZE7A 4MRNA 4CEIB 2ZR0A 3SI7A 4FINA 1UBEA 1C4OA 1UBFA 2FPLA 4F93B 4Q66C 4WBSA 2QP3A 5G40A 5CDFA 1M7BA 4YLGA 1UEIA 2ODWA 5GJVC 2XOKD 2H18A 3ASZA 1AS3A 4C0JA 4EFMA 1TQ2A 2F3RA 2I3BA 3RANA 4DCSA 1T6NA 2JGNA 2MSDB 1OT3A 4MDEA 2YWGA 3A1TA 2QZ4A 4IKEA 5DH9A 4OHZA 4IDQA 1PLLA 1T3SA 2O8EB 1E9CA 4LGMA 2J7PA 4LJYA 5L3QA 3ZD7A 1Z0IA 4B2LA 5J40A 1TADA 3P32A 1QF9A 3K0AB 4L9SA 4OJQA 5EXXA 1L7VC 3RS0A 2EYQA 1OKKD 5JHGB 1IXZA 2R62A 4KAXA 3PG5A 4DLVA 3BFVA 1F2UA 4FCWA 1RJ9A 4FMCB 4RD2A 1XEXB 2QNRA 3NH9A 2DHRA 2QT0A 2ASEA 5B2ZA 4AKIA 2ZREA 3VMFA 3VKGA 2OXCA 2C98A 1S1MA 2DBYA 3HPQA 4L8GA 4O0MA 5FI0B 4XVRA 1ZC4A 4DUGD 2AWNA 2HLDA 2H1LA 4MKIA 4NCNA 5KDDA 3DKVA 3DVLA 4F4CA 3U3OA 4DXAA 1COWD 2IUTA 3UK6A 4BUJA 2BV3A 3I32A 5CK5A 1BMFD 4Y0AA 5CYOA 4XTRA 3TUIC 5FH9A 3GLIA 1KYIA 3UPUA 1E96A 2PEZA 4PC2A 5E7MA 221PA 2J0VA 3MJHA 4KODA 4QNRA 5BYJA 4TLDA 4EFNA 4FD2A 1G3RA 4C9BA 1Z28A 5HR5A 1RPZA 1W0KD 4MKGA 3SJCA 4H1VA 4B3XA 2BBSA 1GFIA 2WOOA 1NRJB 3AQ4A 3CZPA 721PA 3UKDA 1P60A 3U7HB 2JDID 1XF9A 1M7GA 1D2EA 3THXA 2GRJA 3SC3A 2QMUA 2PLFA 1J90A 1WBBA 1DAHA 2FA9A 2OT3B 4Q4AB 3OEED 3K0FA 4P3YA 4B2IA 4XD7A 1YZTA 2YWHA 3AKDA 4OI4A 3DM9B 2PZGA 5B64A 2BKUA 3PCRB 2NGRA 4G01B 4B73A 3QJYA 3ZGXA 2A2ZA 4OQXA 2VSXA 2ZRPA 2OCAA 2QI9C 3B9PA 3D3QA 2L0XA 1BKDR 3U3JA 4EPVA 3SU8A 3LX5A 2ORIA 4DSOA 4A36A 1UKYA 1EWQA 2ZRNA 4RD6A 3UMSA 1DE0A 4OQLA 1G6HA 1RIFA 2HF8A 1W5SA 3X1ZA 3EX7C 1JR6A 1E0JA 1TPZA 4PC3A 5DYIA 1SGWA 3A1SA 4LDJA 2ZAMA 1AM4D 4Q1EA 1LF5A 1SVOA 2XITA 1T4GA 3GJ7A 4LYAA 5HZKA 3DZ8A 5H1YA 2YOFA 1M34E 2XNDD 3PV0A 3REGA 2YJTD 1WCV1 1NL3A 2OESA 2DY1A 2ZANA 2OILA 4V0MA 3WBJA 4A6PA 2W2VA 4AG5A 4BLQA 1II8B 1KY3A 2X19A 1GKYA 4TT3D 1IN7A 2VP6A 4ZDJA 3QEJA 2IC5A 2IX3A 1KZ7B 1VIYA 1TQDA 2QBYA 5KNBA 1VKJA 3L43A 4CVNA 4BFTA 2YC4C 5K8TA 1A4RA 4HZIA 3A4MA 1WE2A 1E1QD 1NN0A 5CM8B 5DO9A 4EPXA 5FTNA 1H8EA 5FBWB 4EUNA 2ERXA 1L4YA 1R5BA 4E09A 1A5TA 1EWRA 3A58B 5CIQA 3UWOA 1W4RA 3HP1A 4A0GA 2P5TB 1S4QA 3D8BA 3ICEA 3QG1A 3I73A 1NF3A 1U9IC 2W2TA 2VYFA 5G41A 4RFVA 3VR6A 2HXYA 1DEKA 2GCNA 1T0JB 4JBXA 1TU3A 1E1RD 4LRWA 5TDHA 5KSZA 2HYIC 1LFDB 4JBYA 4MYUA 5KHOC 4BZQA 5BYKA 2RH5A 4DEXA 3PEYA 2EW1A 2VA8A 3QIAA 2IA5A 4Q1DA 3B1WA 1ZNXA 3UMRA 4PZYA 1FW6A 4NCKA 3BD9A 1Z8FA 3B2EA 2IBMA 4RFSA 3BERA 3O8CA 2YOHA 2NMVA 1UBCA 2QRZA 2R6CA 1JECA 3DHWC 3U6BA 1J70A 3T15A 1Z6GA 4EPYA 3QF4B 2FF7A 2AD5A 2ZE8A 2VIIA 1HQYE 2J0QA 2GWHA 3MD0A 2H16A 4YMSA 4M21A 1P72A 2WJHA 3IEVA 1XU4A 4TWZA 1M6NA 1CLUA 2ZYUX 2CCGA 3D7MA 4BQSA 3GQBA 3WYGA 1OF1A 2ZPTX 3EC1A 2J59A 4Q7MB 3ZQJA 4OL0A 2O8DB 3VHLB 1CJUC 1KI8A 2IYLD 3T1TA 3TSZA 3UWKA 4AURA 3B1ZA 1TNDA 5EE9A 5L8VA 1VCIA 4M22A 1DAEA 1SKYE 1YZNA 4PPFA 1T5LA 1OIVA 1ANKA
chains in the Genus database with same CATH superfamily
2QGFA 4I55A 1V16A 2RHDA 5IP5A 6GPBA 3I2HA 3OQBA 1RYHA 1U0JA 2LVBA 4KFSA 3OQIA 5ES3A 3RUAA 3T1QA 4DUPA 4FKZA 4E08A 5IPFA 4RSMA 4LDNA 3P9KA 4FUTA 3ONFA 1YD7A 4CKEA 1TT7A 4CLXA 4F6RB 4CM1A 1ZY2A 4RPKA 6YASA 2A94A 4GBJA 2C9OA 1U2DA 1NDUA 3NJRA 3QTTA 4WZAB 3UQYS 3ZW9A 2CFOA 4C2BA 3RT7A 4RTRA 4X85A 2I62A 4J7CA 1KERA 2HK6A 1E4EA 2ERCA 4MWBA 2G6BA 2WIJA 4RETA 1HMYA 2W2MA 4AQ7A 2F8SA 2N47A 4FKMA 4JEHA 4ACBA 3V4FA 1SCUA 3CUTA 3KPJA 4CM4B 2D5CA 3G1WA 4ON9A 4V0LA 5J4KA 3ND7A 4K6HA 4PLYA 2ODNA 2HDHA 4LI0A 3JX9A 5FA6A 2YINC 2JFNA 3D6HA 5EQJB 3DL0A 1SKYB 3MGGA 1Q2XA 4IV0A 4KTVE 1SCNE 4OQMA 4XPIB 4EZBA 4F2GA 3SNKA 1XNGA 2VSFA 4ZREA 5ANRB 2YW9A 4R05A 3DHVA 3ANYB 3O9VA 4FX5A 2GD2A 1XHLA 4B83A 3OE7A 4U6NA 1P9OA 2QTAA 4UZEA 4ZHSA 2CV0A 4MV4A 4XJTA 1K2VN 3WL8A 4ZK2A 4ZYUA 3FTPA 3EOBI 3Q3EA 4KFUA 4W7SA 3WLFA 2R4UA 2CDNA 4RPLA 2WU4A 3TKAA 1AUXA 2PMKA 3PWTA 3ZJ4A 2YYZA 2OHOA 2W42A 3WZ2A 3WQBA 3HVHA 4B0OA 1NYRA 2H9YA 2POCA 4BRZA 4AJ1A 3KIPA 1FOEB 5HKKA 4PLVA 4AJEA 1SEVA 4MK4A 2P4UA 2HGZA 2H3HA 3GROA 4O2AB 3OTGA 2L17A 1ECLA 2N42A 4RS3A 1V5GA 1ZVKA 1YU6A 5IANA 3QZUA 1BVUA 2XGOA 2JW5A 4KE7A 1USGA 4BZWA 2PVPA 1MH1A 5DZSA 1CUAA 4MR7B 2H1VA 1J4AA 1OHHA 4GMHA 3QFTA 2RI0A 3QEAZ 3O93A 5K05A 3FPCA 1RMTA 4Y1RA 1G20A 3CNBA 2V03A 3I92A 4JH0A 3HP4A 4F3YA 4YHHB 3N3BC 1IE3A 3LPAA 1RVDA 4ZALA 3S99A 5CJJA 1A9XA 4CMHA 3AFGA 2GZDA 3C5VA 2C4WA 3FVQA 3K9BA 4JVLA 4O3FA 3RRBA 5DM60 4K28A 3AVYA 1ZK0A 3KD3A 1FNNA 2FSUA 2JBWA 2VPQA 2WYOA 3VAZA 4QU9A 3B5IA 2Z95A 5BSWA 5C5IA 1P4JA 1YKSA 1SVSA 2H2FA 4FHFA 3T34A 5LN1A 1IY8A 5M3BA 4UNNA 3U4GA 5C51B 1TK9A 4BNNA 4F5EA 4RTOA 2O23A 2GPAA 2OY0A 3P4UA 4B4UA 4YUAA 4MEAA 3S28A 5EZQA 4U2EA 4K3UA 1ZM4A 2JJ2A 5K0LA 4NL4H 3L1KA 5AYVA 1HEUA 1CLEA 1JMYA 3D7KA 5KVCA 3JQQA 4OMFG 1V3UA 4WMLA 3WVNA 3MT7A 1U90A 1Y89A 2JNWA 2CXQA 3VDNB 1ECPA 3D9QX 3FPAA 3M9WA 2E5LB 2JZOA 5KHLB 4JSYA 1BXGB 4JCCA 2QK4A 4UFOA 2XYRA 4XCQA 1ORWA 1N2XA 1I4LD 1Q92A 1YIAA 4MWZA 3E4DA 1GZDA 3QE4A 4B44A 4V1CB 1Z0DA 3IULA 3PEVA 1Z6YA 2DQYA 1MO2A 4MA4A 4Y2JA 5TF4A 1KTVA 2VJMA 3IH5A 1ZH6A 1SA0A 1GPDG 1P39A 3GI1A 5E2IA 4B33A 4BNDA 4KX3A 2JIZD 4RA6B 1SXJA 3V4SA 1JSLA 3A31A 1NDHA 2C84A 4CNQA 2HRRA 2SKCA 1L5VA 5CT4A 4C7MA 1YCGA 3HBLA 2HW8A 1HZZC 2GF2A 1UJNA 1T9ZA 2Y1KA 1FX0B 5C5CA 3WLHA 3B2QA 4HP8A 4IICA 4RQBA 1BH2A 1G5FA 3OEHD 5DN6D 2AJBA 4CT0A 3FMPB 4OTZA 3FTEA 1E69A 5ALDA 2ZSDA 4EX6A 4YJ2F 4EW1A 2A5YB 4B74A 3PFCA 4RXMA 5F35A 5JG7A 3GFOA 2BFFA 4JQCA 4NMWA 3QWFA 3CLSD 2WJ4A 3SYMA 2JGJA 4NATA 2WWTA 3FZGA 1OX4B 3A9WA 4HTAA 1OZGA 3A4LA 3S70A 2UZ4A 4IHAA 4UDXX 1S1CA 3FHJA 3PBKA 4DUZB 4MA5A 2JHCA 5LDDC 3JVDA 4ER0A 1R0ZA 2VTDA 1D6NA 4GS5A 2CLSA 1MB2A 3V9PA 4FFMA 4TLCA 4PHGA 1BAPA 1Z8DA 2VLIA 3JD2A 4LWQA 3T0FA 3ZE8A 4AYTA 1EEXB 2FZEA 2HZ7A 2GS9A 3VPDA 1Y8AA 2Y05A 2M1XA 5CNJA 1CWUA 3ZUGA 3CNQS 4RCVA 2WMNB 3CLUC 1LBHA 3JSXA 4D92A 3KT0A 4RTJA 1OAKA 2CC2A 4Q3BA 3MWJA 3Q3GE 4UCWA 4RZ2A 3J7AC 3I2GA 1SOAA 4OBEA 1P1BA 1GYQA 1YR9A 1NI4A 2OAP1 1N9GA 1P7WA 1KMHB 5E6UB 3FCOA 4RWZA 5EQDA 2OXIA 4BE9A 3R9XB 3LCJA 5DEOA 1ZJYA 4P35A 3L7IA 3WGOA 1E0SA 2B7CA 3A9UA 3G0OA 1Y9AA 2PRZA 4IS2A 4JLBA 1IQ0A 1OYYA 2P7IA 3K31A 2VFAA 3CXUA 1KH1A 4I5FA 4UEWA 4JGGA 1AGNA 5FOWA 2NT3A 5CH8A 3IL2A 5DNVA 3FB4A 1TZBA 4P33A 2ATEA 3DLBA 4P82A 3FKSA 4RDCA 2FMKA 2P75A 3FOZA 1P0FA 4KGXA 3LLCA 1L4NA 2P5YA 1DBSA 1GL7A 3DVQX 3KYDA 5KNCH 1AQLA 3QLVC 5DM4A 1TUBB 2NQ8A 3S2GA 5JBQA 3P52A 1Q19A 2EATA 3I6BA 4YJGB 2IGBA 3T3DA 2ZB8A 4G1EB 1NONA 5AOCA 2HWWA 2GXQA 1J2TA 1KU0A 5F5XA 3RBAA 2QAJA 2W58A 4F3CA 4KZPA 1H2BA 2HB6A 4I4TA 4HGPA 5ALLA 1YMQA 4KR9A 5ICSA 3VU8A 3EB9A 2E4ZA 5BQPA 3ACBA 4XI9A 2ZR7A 1AGRA 2OV6A 1ZK3A 1J2EA 1SVNA 3D7SA 3IESA 4YI3A 3IQXA 5M7EA 2A3RA 4QSHA 3RIMA 4RTPA 5LQRA 5BN5A 2FEXA 3A1WA 2ZLBA 4RV5A 1B6SA 5TPZA 1VCNA 1ZC3A 4FYMA 1XCOA 1RXYA 5IM4A 4REQA 3B2NA 4GXTA 1NBHA 2AR7A 4TOIA 4ZAYA 1T6BY 3OY2A 3EG9A 3ULKA 4F4DA 4C5AA 2CXUA 3NDBB 3KQHA 4MQMA 2IV3A 4KQFA 4LOHA 1H0HA 2QD5A 5ICFA 2C7BA 3DR5A 3LCMA 1PWZA 1TMYA 3RKUA 5DCYA 3T3HA 5JAUA 1XI2A 1Z2CA 3Q9NA 5K4HA 1DC7A 4Y2QA 4G36A 1QKKA 3F5QA 1RE0A 1KAGA 3X3HA 4MW2A 1KL7A 2XRYA 4NENA 4JQSA 3CLRC 3ZEIA 2X13A 4FP9A 4WKOA 3HM9A 4Z53A 2GAJA 3NNNA 4ZANA 4WFKA 2HSGA 1E98A 3CWQA 1RJDA 1WHSA 1L5OA 2B9VA 4AKEA 5GZ3A 3EQ2A 1M5TA 1RAFA 2GPTA 3IKMB 2C04A 4NESA 4PCAA 1GZ5A 1UXOA 5EZYA 5C80A 1GKKA 1VLZA 1K5DA 3W78A 4ZZ3A 1EK5A 3DYBA 4KYUA 4B3BA 1E77A 1NMYA 5JXJA 3NYWA 5TJ9A 3PX2A 3WNVA 1GO2A 3G5MA 4WJZA 4MIYA 3TLYA 1MOPA 4JYPA 5C8DA 4IGFA 1J23A 4J0KA 1C3VA 3BB4A 4Q9JA 3UAZA 1NVWQ 1USIA 3L0ZA 3T1VA 5A6SB 3ZDDA 4QUEA 2WWIA 1FYXA 2YIMA 1VJDA 4YRJA 1VSUA 1BYIA 3HRIA 3Q3HA 3BCHA 5DBGA 5EIBD 2NU8B 5LQAA 3PIDA 5EMKA 4LWPA 1CR4A 4JI5B 4OQEA 1U0RA 3WV5A 1S2LA 5EC8A 3PIRA 4DDTA 3S1SA 1A4XA 1EXMA 4WD3A 1CY7A 1XVUA 2FQWA 3RFTA 2VWPA 3CF6R 3C8DA 2VTKA 2EP5A 3FNIA 3T9BA 4Y9RA 4INJA 4N40A 1ZI6A 2C5EA 1ZXBA 2HO5A 4XFKA 3QYAA 4JV5B 1VYVA 2B35A 4B1FA 3BSSA 5D7BA 1ZNQO 1BJTA 1E2EA 5CDUA 1EJ2A 1LZLA 5FAKA 3H0KA 4JUIA 3IIIA 4DG9A 5KTKA 1N1DA 1K88A 1DTWB 1MFPA 1Z5ZA 2IYUA 4Q4HA 2NPFA 3C5HA 4Q3CA 5EJ4A 4J6EA 3WWPA 1C1XB 2G9RA 4PX3A 4B4WA 3IEMA 1Y1QA 2JPDA 2CB0A 1NUPA 1ESDA 1V3QE 4DMRA 4TMTA 1U6KA 3LVRE 4HHEA 1H4SA 1PS0A 5FPPA 1MN6A 1GL3A 3M0EA 3NFRA 1LSJA 1SVWA 2OAQ1 2ZJZA 3LUJA 2Q0QA 3J7TA 2R4TA 3OZXA 4IIFA 4DPMA 2HREA 3NIBA 3OP4A 2XGGA 5EJMA 4EB6A 5JZVA 2R25B 3ORQA 3PR1A 3TGWA 4R1MA 1XZAA 1Z15A 3AFHA 1SJ9A 3HXLA 1X15A 4ZEVA 2QU8A 3H3XA 3HN7A 1W9HA 1ZXLA 2AZXA 1VIMA 4W6ZA 1AA9A 3LV8A 5IC5A 5CITA 4LVUA 3N7AA 4KQIA 4CLOB 4PYRA 1FS4A 2H59A 3AFIA 4TWIA 1B41A 1AMUA 1ZN8A 3BJZA 4XUGB 1XJQA 4BLPA 3EPPA 3CVOA 1Z4JA 3LOPA 2WIFA 4UMDA 4ES6A 4L4RA 4I1VA 1W1IA 1M5UA 2BFNA 1W2WB 3I6QA 1YA4A 3EW9A 1DWOA 2V58A 4RPCA 3L01A 1UK6A 3PDIB 4V0KA 2CVPA 2OV8A 5EJ6A 3D8SA 1FUYB 3LC2O 4RSRA 2EKBA 1EUQA 1L5YA 2P1RA 1O8CA 2VDWA 3HZRA 1J49A 3PHHA 4RAOA 1ENYA 1JAHA 4F60A 1P17A 5IULC 5FTJA 2Q6VA 4F4FA 1JLKA 3JTMA 1DEXA 1E1CA 1M1YE 1NAIA 4GXQA 4DSAA 4KWTA 2HJWA 1JJ7A 1TK3A 4CEHB 4J3JA 3OAAA 4BN0A 3LO8A 4UHBA 4EHNA 2OHFA 1JHMA 3RYHB 4HYQA 4XVCA 5KHAA 3UH0A 1JLHA 3VOAA 5AESA 3PXBA 1Q14A 3KB1A 3C2QA 1T24A 4NZZA 3V00A 3V7YA 4AL4A 5E1DA 4B6OA 5CA1B 1DJNA 1UMCB 2I6TA 1PJ8A 2B8JA 1T13A 3DEFA 1UT5A 4IDHA 1MNAA 4Y18A 2BCJQ 3EQZA 3A3NA 2R2AA 4NPHA 1JR3E 1WTAA 1FMLA 1TYZA 2R87A 3BGSA 1IMJA 1YIDA 2H2WA 2WFLA 3PEFA 4N82A 3WSTA 1NY6A 3PNKA 5KCZA 1MO4A 3FLMA 4JLUA 3VO9A 3DF7A 4RHXA 4B8YA 5FPKA 2QTRA 3ELUA 3NWPA 3QPDA 2IVZA 5IT4A 3MUOA 3V1UA 1OFTA 4G0NA 3SC6A 5I4CA 2RAVA 3O9MA 1OREA 1WMFA 3OMXA 2ZUBA 3SNHA 3GN1A 1OA0A 2RFLA 2OCXA 4DC9A 4D0GA 1HSZA 4DHEA 2CHQA 3TZ6A 3OVMA 3CSSA 3DCYA 3F2IA 3VI3B 3LBYA 1RHKA 2PMWB 2ET6A 4ND2A 1QQAA 4B3JA 1HUQA 3TIIA 4G65A 3I4LA 2A8YA 1I0LA 1N7GA 2D3TA 1AZSC 3M2PA 1NVXQ 2QTLA 1WZIA 3FPKA 2C58A 1N1EA 2RGBA 1W0JD 2JCGA 4MW1A 5TV2A 3M4ZA 1BOFA 1F4PA 3CX6A 2G0NA 2FOLA 4L3WA 4XSHA 3WAKA 4BNWA 2CHGA 3O8OB 3O8QB 2WABA 4PYJA 4YV2A 2CNNA 5HQ3A 1ULZA 9MHTA 3IHWA 3QSYA 4ESEA 2ZYTX 1A5BB 2P6OA 4I4TF 3OJOA 2VRNA 4C04A 2FWMX 2HD4A 2JI8A 2X7JA 4H7EA 3TEFA 1ZRNA 2PWYA 3PGMA 2UYQA 4JD5A 4BDTA 2KSQA 5JWOA 3I4FA 3EYWA 1AO0A 3R75A 2NV2B 5FFMA 1YQDA 3ETJA 4UE3S 3WHKA 4ZOEA 5EJGA 5E8JA 2CXOA 3Q5DA 1TEXA 2XCUA 1KI9A 3E2PA 5DSXA 1IWOA 3TOVA 1U8TA 4QL3A 4DIMA 4F04A 4DCOA 3HVKA 5AO9A 1XVAA 3WQRA 4EHKA 3C5WP 1WDKA 1J2UA 2J87A 2XXBA 3F6PA 3MF4A 4WNIA 4ZI5A 4D41A 4B7UA 1TI7A 1CDOA 2AD1A 1JA9A 3ZV4A 1OIXA 1ZP6A 4AG3A 4F5WA 3VO2A 3OZRA 2JFVA 4JR1A 4KRXA 3MQ4A 1QPBA 1QYIA 1T3TA 2Z98A 2AFIA 2QQ0A 1IZZA 5CX1B 4JQZA 5EOVA 2IDJA 2W4QA 4H9GA 2IW3A 1V1JA 2E1RA 5AD1A 2HQ1A 2C95A 3DBIA 3USES 5DASA 4GX1A 1GPBA 2VJLA 2AJ8A 1SUSA 5BQXA 3A3YA 2BMFA 4MW9A 1J33A 1TZMA 2HH9A 3NR2A 2WTXA 5AW7A 5D1NA 2NO7A 3JAWB 3X1XA 3BE5A 4HGRA 1R50A 3M3HA 1YFKA 2O1SA 2CLCX 4UHFA 4KACA 1JW9B 1YASA 4XGQA 5AVOA 1X8LA 4QBGB 3SF8A 3VZBA 4YUYA 1NBIA 3QEBZ 1HDOA 2V4UA 1YDMA 1K68A 1YZLA 5BN3A 3JTEA 2O8DA 1S2NA 4BNXA 4PR0A 4HNGA 4UNQA 2MYTA 3ZHUA 5CDFE 1VLVA 2Q9UA 2Z5VA 3SXUB 3V8QA 2CD7A 2QMOA 1YR8A 2B6HA 5D00A 3SQWA 1WMEA 4WKNA 2BJHA 4QPDA 5TQ2A 5JNLA 4GG1A 1YULA 6ABPA 4DR2B 3HCNA 1FEZA 4W5TA 3E27A 2IH5A 4BAGA 4CQLA 1Y0BA 4GFDA 4CPDA 1X87A 4PAWA 1R0CA 2AZMA 3K72B 1IUKA 2HIGA 3BTSA 4GI7A 3T35A 3D6AA 2GTPA 1LVHA 4KJXA 3O4HA 2Y0PA 4XIYA 5DHPA 3TZHA 3BXGA 2PRIA 1P7ZA 3OQPA 4D8XA 1PZMA 4AULA 2P78A 2NTVA 4EJSA 2JKYA 3S7ZA 1R4ZA 3SFVA 4E32A 3FOCA 1E1KA 2WJYA 4WWHA 5B57C 4N7JA 3IAFA 1ZFNA 1K86A 1X92A 2VT6A 4FMCF 4GYJA 2BGWA 1OZFA 4Z0TA 1E2BA 3DG9A 2WMDA 3ABRB 2QZJA 4BY9E 1EGVB 4TWJA 4DMCA 3SX2A 3RJTA 4C6HA 5CUQA 1F60A 1ZCAA 1Y6ZA 4DWOA 3DA8A 3OM0A 4GE0A 5H9WA 2Q3HA 1JQKA 1QRRA 2HIMA 1A0OA 2W83A 1SWVA 3RODA 3RS8A 2A1UB 4R71A 3PHBE 1BCSA 4BC1A 1WIWA 1WXGA 2VPWA 3BA1A 1AK2A 4J0EA 5DCWA 2IYNA 1ZKDA 2DLCX 2QZSA 1H2WA 1SCQA 4H3VA 1W52X 2V5AA 3D8TA 1REQA 4GVLA 4PTZA 4EKIA 4BV3A 1E9VA 5L3QB 3ZWWA 4G1FA 5AVXA 2ZSUA 2XMDA 3DAPA 4CKBA 4N76A 1G17A 2DZDA 1G4AE 3NXKA 4IWNA 5FPQA 5T8KC 5ALEA 7REQB 5CB4B 3HJNA 4CTMA 1FF9A 4U7PB 5JV5A 3FD8A 2VJBA 4LJ8A 5EPEA 4RH1A 4UZSA 1Y1TA 4WDQA 4BVKA 3IE2A 4L9RA 3U4AA 2QAGA 5BV7A 5FWXB 1ZCJA 2WWFA 4R5HA 2JG3A 1M5RA 1L4LA 1P9RA 2ZB4A 4QHSA 4URXR 4JJEA 2JASA 1VGQA 3D5EA 5TR9A 2IU3A 3A3KA 3B12A 5FL7D 2RJOA 4HB4A 1LNZA 1X7XA 3ZJUA 1NNI1 4GIBA 1N2CE 4KGDA 2A1IA 5T4EA 3UGQA 3R8FA 3NOQA 1U31A 2PXXA 3EMBA 3PXGA 2D1FA 4BVGA 4MUBA 3E35A 1Q3KA 3QQPA 3DEHA 3R4VA 4DQXA 5T4HA 3R6TA 4EM6A 3RAJA 3WG9A 5KTOA 3GLIB 2GPBA 1FP1D 4WKGA 2DVMA 1R4MA 1DRVA 1J1IA 2NU6B 4OIFA 4HQOA 1GZHB 2PZEA 4U02A 5BT8A 4RY8A 1S7CA 2K2WA 1ZIPA 2OAGA 3E7PA 2P68A 3Q41A 5FOTA 3S27A 3TLGB 4A6XA 1O6CA 2A0XA 3IEKA 3TQCA 1OGYA 1WWKA 4HNQA 4R69A 3JSAA 2OFXA 4YRMA 3OOYA 2AOVA 1T4CB 3IYLW 5KJCA 3IVGA 3GAFA 4LHXA 5MHTA 3PDCA 5BSEA 1DX4A 5JTUA 4DLYA 3LXXA 3QTLA 1GGNA 1Y8QA 3GT0A 4A91A 4BPRA 4YUXA 5EMNA 1TM4E 1Z6XA 2D0PB 3IT2A 4GR4A 5B58T 4EFLA 1EXNA 1EE9A 3R6WA 5KYVA 4EEZA 3LF1A 2AK2A 2CY0A 3RIEA 1Q57A 3VKVA 1MZVA 1NPDA 5IMBA 2V5UA 1ZW6A 1CIJA 1UXJA 1H05A 1H5NA 1A8PA 1I01A 2HSEA 2XVAA 3HVUA 1F9EA 2YHSA 4GZ6A 5H81A 2UKDA 3RSZA 5KB3A 1HDZA 5ERGB 1E9AA 1WVIA 4NJEA 2YR0A 2ZWPA 1PN3A 5J1SB 3DMGA 4RCZA 2E49A 3FKQA 3PCTA 3K1JA 4ENPA 2O54A 4OMCA 3ZW8A 4RDIA 3UHAA 2BISA 4HG2A 3LBIA 3ITDA 1BRTA 2BTQA 4Y2VA 2C20A 1JN0A 3H5IA 3HLKA 3Q5EA 4K3VA 3GRVA 2XUJA 3WYCA 4YCAA 2VL7A 5EMJA 3ZWDA 4RXTA 4AMYA 3E70C 1LBIA 4GOLD 4PINA 3EEOA 4RVUA 3QE3A 3DD1A 5EY5B 5CVCA 1CIPA 3TXYA 3VYTB 4CW7A 1BVYF 5FTMA 2P91A 2QUJA 3EAGA 4MYTA 3L8FA 3N05A 4NX2A 3G8AA 1LPNA 5AUOB 1UOOA 3P1JA 2YTZA 4HDCA 5ALWA 1XELA 4BFCA 4QWWA 3E1GA 4O8CA 1U81A 2IEIA 3MYRA 2ZATA 3I53A 2UUOA 4D6XA 3CIFA 3NUGA 3MAGA 5EXPA 1KS2A 4N5HX 3JWGA 3C74A 3VYUB 1MX5A 3QPCA 5DHRA 3ZD9A 3WKEA 4HAYA 4PG7A 3NCTA 4RABA 1FFBA 4RGQA 3WIUA 4NBRA 3FBTA 4IIHA 1XTPA 2I8CA 1NT4A 3BWCA 3CO5A 2E7ZA 1RAAA 1CQXA 2XLCA 3OCWA 4EENA 2C5HA 4NBSA 4EG6A 2ISSD 3U7QA 4HVCA 4HWPA 4XARA 1JDUA 1P6XA 3OZAA 4TUYF 4YP6A 4IDGA 2WTUA 4RD0A 4AZ3A 3P0RA 1S2MA 4PIPA 1W44A 1XJ0A 3L46A 1FX1A 3HTXA 4M4SA 3PC7A 3O4FA 1JL3A 3UCFA 3W5AA 2FFHA 2UUAB 1KBZA 3KC2A 1U2RA 4FGKA 1LX6A 1XAGA 2X1VA 1G6KA 1YJ5A 4WCFC 1F0PA 3NGLA 1ILEA 1BHQ1 1EK2A 3KR1A 5REQA 2ECPA 2A6PA 1SUEA 2WWGA 3NBUA 1XTTA 2CD9A 5H3LA 1RAGA 1U1GA 5I9BA 2VHVA 1J39A 3AI2A 1O96B 2MIIA 3VOBA 1XPJA 2GD6A 3D8NA 3E5RA 1C0LA 4KWEA 1EP1B 4UU1A 2AG0A 2EGGA 1RRMA 2JVIA 2Y2UA 3EW7A 4YC7A 4A8PA 3DL4A 5E3IA 3UGTA 4FQ8A 4LGYA 1BIFA 2FSSA 3QW2A 4DC0A 1QOZA 3M1LA 4JBWA 1T2CA 3L0DA 1IBLB 2WTEA 4LKRA 2P3QA 4AD8A 4O1HA 4KR3A 4O4JA 1GR0A 3BRCA 3TKLA 1U04A 4JSRA 3EBLA 5K9ZA 1N32B 3KQMA 4UULA 2HMWA 1ZOLA 3V1MA 2Y1DA 3KLBA 2ZEJA 5JE8A 3H11A 3EZXA 4HDSB 1OBHA 3GGSA 3FLEA 1YRQA 3LC1O 1JX6A 1CFJA 4P3NA 4JYZA 1EESA 5G53C 3ESQA 5JRZA 3NH6A 1GRCA 2Q3EA 3RVDA 3GQBB 2Q8NA 1I6KA 1MABA 1ULHA 3I4CA 5CT9A 5AHKA 4BO3A 1UBGA 2E4AA 1K1EA 1P7VA 4PCVA 3CH7A 3RKRA 1IZYA 3ELYA 3R40A 1NJ6A 1OI2A 3IQFA 4BO7A 1WB5A 1GSAA 3A36A 4TKVA 4DKXA 1NI5A 4QOGA 4YV1A 5GADl 4I1PA 3U7FB 2KE5A 4BXOB 3LDFA 4YRZA 3PUXA 3ZK9A 1IY2A 2Y71A 2R1UA 3GEMA 3P8ZA 4M1ZA 4E5KA 3MCAA 3T7TA 4F9GA 2J85A 5A2GA 2C2WA 3H6KA 4IDOA 4YMLA 4UQLA 1RWKA 3LBAA 5ERYA 4XIIA 2C2BA 4C4YA 1JI0A 1Y1LA 3EZNA 4LOKA 4GX5A 1BX3A 2RONA 4E5SA 1PJCA 4W8HA 3GYBA 3BIJA 3UAGA 1MU0A 1EGQA 3GGGA 2FWJA 2AG6A 2D1YA 2V74B 3JW8A 3KEQA 5A04A 2Z08A 3UJ6A 3JALA 2X77A 5ALHA 4YRCA 3RS5A 4PANA 1TEHA 3KHKA 1PV2A 4DANA 1FE8A 3L8YA 2COKA 4MQBA 3WTBA 2RK6A 5KUTA 4RGYA 9ABPA 3TX2A 3PGKA 3UMJA 5ADUS 3V3TA 4N3AA 3HP7A 1EX9A 3MFYA 2TMYA 1D0VA 5C2JB 2K2QB 3IAHA 3OIYA 4WOJA 1EQUA 3H1TA 4N12A 4BMOB 4ZK6A 3VH1A 4HI0E 3CHYA 2NYAA 3QUAA 4DAEA 2OPHA 3IUNA 3HS3A 2R1TA 4FYXA 3GHHA 4ZAZA 3TLJA 3WL6A 2R97A 1KORA 5TMDA 5AW3A 5KWSA 2P0EA 1GZ4A 2AC2A 3ZE7A 4EHAA 2A86A 3IC5A 2GPJA 2H63A 3KVOA 3U9LA 1DJMA 1XTKA 3TOSA 1SQ0A 1FJ2A 5TARA 5KYYA 5CHEA 5F9HA 4X3CA 3CH6A 4QPJC 3A6PC 4K9QA 2ZU6A 1RYZA 4ITVA 3T7IA 4OK3A 1R7RA 3QXHA 1VB5A 2QV0A 3AVVA 4RZHA 3U48A 2AG5A 5JATA 4G0WA 5C7LO 1UDXA 1Z2AA 5I7FA 2J6HA 3OPVA 3ICWA 3B6EA 1P2VA 4EB3A 5TQ0B 4FGJA 2NQ2C 1LDYA 3PUHA 3KHTA 2NVOA 4OY3A 3QMPA 1DRJA 4I99A 4NYMR 3GDFA 4U8HA 3RGGA 1Q7TA 3QY0A 1SHLA 3PNBA 1OLOA 1WAMA 1ZBDA 3QVSA 1WNFA 1UFQA 2GLTA 4I1OA 4LV5B 2YUTA 1CW2B 3H99A 3WHPA 4XGNA 2XDQA 4XRGA 1QKJA 2DBZA 5J4YA 3VTZA 1TU0A 3WXMA 2GVZC 3IP7A 3UO8B 1YFJA 3TLEA 4QJBA 2UUCB 3K4HA 1M2FA 4I4CA 1K4MA 5BSUA 3E18A 4B6JA 5L51A 1G64A 3RVJA 2C4NA 1T36A 4E15A 3NAMA 2PUAA 3W4KA 3SBEA 4KLAA 2XSZD 3OQHA 3GLGE 1Y8RA 3JQ8A 4F1WA 3VJLA 4HPWA 3MGKA 3HRKA 3L0SA 4WRRA 1PG5A 3JQDA 4FNAA 2JVKA 1RXWA 1Z0UA 3IJPA 4C08A 2PUFA 2B1GA 1U0OC 4OMUA 4IG4A 1RRCA 1DDGA 2I67A 3T95A 3DNPA 3EMDA 4BEJA 4EG3A 1K5GA 1TTTA 3G8CA 1ZRHA 3WWDA 3L4BA 4ZARA 3M9XA 1PVOA 5E9AA 1WO8A 1TAGA 3LT4A 2I9KA 3VMMA 2G1UA 5TLSA 1PR1A 2B1RA 3H7AA 3MXTA 1C3OB 2VBFA 5JNTA 1CETA 2HCRA 2UVDA 4N39A 1OAAA 3GPCA 2W00A 3TNYA 3U4DA 6AT1A 1W4ZA 2IZOA 4Q93A 5LOVB 2VP0A 2WKPA 2F9LA 2V7PA 4KMMA 5FPTA 2DM6A 4NF2A 2IYOA 4G5HA 1VYHA 5ER6A 2GCGA 3FF1A 5DT2A 4MGZR 1E1LA 2EGUA 3RWBA 5KTTA 1R8QA 2ZIWB 1HLGA 4B3RB 2QE6A 3UXYA 2FU5C 5JADA 1WXEA 5L4NA 3U31A 1JTVA 1WZEA 3MUNA 2QYHA 1QHFA 3CS3A 1MEJA 1ENOA 3SS9X 4P53A 1NW4A 4QIHA 3DBOB 3OF3A 3B1YA 1WU7A 3PXDA 1SCJA 1VSTA 3UGJA 3ZQUA 3F97A 3N75A 1A9PA 1BW9A 3KEGA 5LM3A 5CFZA 3MTGA 3EFEA 3PQ6A 4MITA 1T4MA 5L7WA 4LNHA 2WDZA 3X2EA 3TQSA 1RT9A 3LBFA 3EF3A 1CUUA 1HG0A 2Q0XA 3PUWA 4UAGA 1V41E 1CU1A 3IDQA 1M1ZA 3SSOA 1PAUA 3FX2A 3THWA 2BMDA 4HYYA 2B1QA 2XQGA 5EWMB 1T91A 3C6XA 4CR7A 1Q22A 1G7CA 1W2GA 1YZQA 2C1EA 2IHJA 2FZGA 2I54A 2A9OA 3PRKE 3NHRA 2HTFA 5LLSA 3WLEA 4XYLA 3AI1A 1JZSA 2BDTA 3PFKA 5JSKA 4YMVA 4UBMA 4C0XA 3CXRA 3DZHA 3ECCA 1W19A 2QXUA 4HXGA 5KX5B 3LSYA 2I2XB 3DZDA 1KEKA 1LB1B 3HH8A 3KAKA 3B89A 4DL9A 2AVNA 1PFWA 2Q99A 2C4TA 2V6FA 1E0KA 4HRYA 1D09A 1E5QA 3D02A 4L6IA 2D62A 4PSDA 3FA2A 1QGDA 1ENZA 5CB8A 3PTZA 4TZ0A 1Z5WA 4GGMX 5LB2A 1G19A 1NQVA 3HO8A 5DGTA 4M1OA 4LTDA 5JD5A 3CCCA 1ZVJA 3TE7A 1ZWKA 1JSZA 1Y3HA 1ZIXA 1UPAA 4GPIB 5I7AA 1NBAA 2G70A 2Z8YA 1FXWA 3SE7A 4G4IA 1VKHA 1UP6A 1JEOA 3S2ZA 4U6SA 1VL0A 4K9OA 1R8XA 5IBPA 4G5QA 1WNTA 1ZR2A 1FL9A 1SU6A 1NKVA 1C1HA 5ECGC 3ROZA 2NTJA 5KINB 2F3TA 2PV0A 2IHZA 4ZQHA 1V26A 4KV9A 3NAQA 4OB8A 4OLHA 3E9QA 3R7WB 4JELA 4RVGA 3WRYC 3WLIA 5JS1A 4Z3DA 1NIPA 2H1HA 1NKTA 1ZEJA 1LTQA 3E2IA 3EXHC 1DLJA 4EO4A 1M83A 1ONPA 4OSOA 3UQZA 2NU9B 5FIUA 1F2TB 3AT1A 2H7YA 2GNOA 1HYEA 1RQXA 2QTBA 3KJIA 2PD3A 1T1RA 1GQRA 1ND6A 3DZGA 5IK2A 5AXBA 5CBPA 4KGZA 1KPGA 2H4ZA 3EFOA 2N46A 4EATA 1JG6A 2R6AA 3IA2A 3D4NA 3LRTA 3LDAA 2D0IA 1E79A 1XDWA 5HDBB 1AQJA 2YH2A 4WECA 1C8VB 4AJKA 5CFOA 1E9EA 2E48A 3NM4A 2IK8A 2ONJA 4KGVA 1ZD5A 3OZDA 4Q4AA 3CPSA 4HWKA 4LRXA 2PM8A 3LT0A 4UFNA 1GL6A 4UM8B 3RT9A 2Y0DA 3WHLA 2A30A 4DDWA 3C45A 5I7HA 4G5OA 3ZKAA 2PX3A 4P4GA 4EVRA 4PPYA 1GPKA 4H1UA 5ELXA 4E3ZA 5T57A 5IT9A 1RHUA 5DT9A 1E9RA 1OZ0A 2QB5A 4QGAA 1X94A 4BYMA 2Z4RA 1QGED 1I9CA 4NDZA 1UDWA 4QDOA 5FOSA 2ZT8A 2J08A 3FN4A 3N0TA 5JCPA 3RAGA 1YQGA 3ZTWA 1MG5A 1FMJA 4OYRA 3BORA 4D1YA 1OXMA 1AN9A 3QU5A 2KB0A 1P4GA 2YDXA 3UPDA 4A7PA 4HAXA 1AMNA 3N07A 1IM8A 3K96A 4LVCA 3VJKA 1N5KA 2HA6A 4BNZA 4CMJA 4DNFA 1N36B 3B82A 3JATA 4U2CA 3VC7A 2C7PA 1QBKC 1SPXA 3O03A 4FYJA 1W4LA 4I4IA 3J81A 4ND8B 1G3IA 3AF6A 2ZP1A 3SOZA 2HMVA 2HGSA 2ADMA 4WLUA 3VXKA 2OCGA 2QX4A 4IDDA 3OCUA 5CB6A 4EIWA 3TW6A 4O08A 1DWQA 3Q87B 1V39A 3VOSA 4Y8VA 5JVDB 121PA 1T2FA 2VJCA 3D7LA 3J80A 4I1UA 1OD6A 2IOQA 2FGKA 2VXCA 3QFHA 1G6OA 3KQTA 3ON5A 3NYRA 1OFUA 3T12A 2CZGA 1XRRA 2Q3JA 3C3AA 3DNMA 1KHTA 1X77A 3HCOA 3KTAB 3UHOA 3LPNA 3MQFA 1S3GA 4O4LB 3UFXA 1YZGA 3FNHA 4YPVA 2J9ZB 3D2BA 2Q21A 4IQGA 1ZEMA 4CIVA 5K2MA 4KFRA 1WSBA 4KR7A 2YL2A 4LYDA 4QXRA 4BJ5A 3H9EO 4Z4IA 1YZYA 5AVVA 1NOKA 3L0CA 1PLKA 4MVJE 4B7CA 5LXTB 2J3JA 2D59A 3O3NB 4WLFA 3ZZUA 5ALJA 4DLAA 2HRQA 3GVHA 3JAKA 4HAOA 4TKLA 5AW0A 1MENA 2JIQA 2XR1A 2YIDA 1L4BA 4L85A 1OC4A 5ER9A 5BR4A 4IH1A 2FUEA 1Z07A 5AVZA 4RBNA 4BGDA 2MWMA 2IBSA 1LPPA 1N5RA 3TN7A 2QTGA 3Q9UA 3W9SA 4JC8A 2WM9B 3MWLA 1IATA 2GUGA 3C5CA 3FSGD 1DBVO 1SMKA 3C16C 3KJZA 4HRAA 3KHUA 5H82A 3HWSA 3I6YA 3GNQA 3OQ6A 4YAFA 1DJQA 1US8B 1FRVA 3CZCA 3IDZA 4C88A 1H9CA 1AY0A 1K4YA 2B98A 3EGDA 2R96A 3LD9A 3MFQA 3C48A 3QXSA 4UVHA 5EWLA 3COSA 4Q7QA 1AUOA 2B1IA 2FW1A 2WJ6A 1NURA 3D54D 1JALA 5EN4A 4ETWA 2Z6UA 1VJGA 2ODEA 3LWZA 1JDVA 2YJZA 3K09C 1NSYA 1W49A 2BSAA 4HX9A 4RAQA 4MRAA 4IJKA 2Q7DA 1RWNA 1W5TA 4Y2UA 1MUUA 3MRSA 3MINA 3RU3A 1GG8A 5DN9A 4ATNA 2VP5A 4ZT6A 3QUBA 2JGAA 1LK7A 1NUUA 4PZCA 4XX0A 3UV3A 4DAOA 3PXEA 1B43A 2C3MA 3CJRA 2DTXA 2PZAA 3QX8A 2IY9A 3OIDA 4YBRA 1P1IA 2KLHA 4DUGA 1MW8X 2AL7A 2FMIA 1G5QA 1X0VA 2IEZA 1E6EA 2VJOA 2XH8A 3L7CA 4UMVA 4I9HA 5DMHA 5GOTA 4DBVO 5EIXA 4KFTA 4UTZA 1KU6A 2BZ1A 3UM9A 1CUXA 4D4MA 1YE5A 5FAXA 5LWHA 1Q1NA 1FLNA 3BD6A 4RZIA 3KQKA 4BLVA 3A4NA 4O6VA 4C0WA 5FOUA 5HWSA 4CEJB 5JXIA 3GZNA 3HFGA 1SKUA 3T94A 4DEYA 1UJCA 1D9XA 3M70A