2QP3A

Identification and characterization of two amino acids critical for the substrate inhibition of sult2a1
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
284
structure length
267
Chain Sequence
SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNIKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKEYVVDKTQLSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bile salt sulfotransferase
publication title Identification and characterization of two amino acids critical for the substrate inhibition of human dehydroepiandrosterone sulfotransferase (SULT2A1)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 267
sequence length 284
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2007-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qp3A00
4GSYA 1GILA 4JVLA 1PLLA 2Z5FA 1OPXA 3JZMA 1F2UB 2ZRFA 2ZJ8A 4WXPA 5JHGB 3T1TA 3CIOA 4JBWA 4YMSA 3K0AB 2ASEA 4S35A 3GLFB 1NJGA 2ORVA 1U90A 2QROA 2LKCA 2FSIA 2J0VA 3EC1A 4LBYA 3VTKA 4NCJA 5A5GA 3NC0C 1JBKA 3MJRA 1W4BA 3X2SA 2A5FA 3W3AA 1WRBA 3V00A 2IYVA 3QVUA 4TMZA 1EFUA 5LDDC 3TLXA 2BIFA 1JQJC 5EUMA 3VU9A 3P4XA 4M1YA 3CWQA 2BVNA 5AWFC 3CR7A 4DLYA 4Q7MB 4TYYA 3BS4A 3K0SA 1ZM9A 3ECCA 1E99A 3CNOA 4D25A 4JLPA 3R9WA 1JECA 3VR2A 2FPMA 2PBRA 3W6OA 4CGZA 2FEOA 2NPFA 1YZLA 3OAAA 5FPHA 1XMIA 4BE7B 4M2LA 3CRMA 2H57A 4I1OA 2O0KA 2RGCA 3K9GA 4M53A 1TF7A 3A6PC 3GFOA 2XSZD 3GLHE 5DH9A 2PX0A 4UJ5A 3ZZ0A 3E2IA 3ZVNA 1E96A 1WMSA 1T8TA 3RABA 5D3MA 4TLAA 2AR7A 3X1DA 1AM4D 4E03A 4A0RA 421PA 1XD2A 1I4DD 5AR1A 3CB4A 4QOSA 1X8JA 1WQ1R 3NH9A 1QZXA 4YLGA 2RB4A 1F2UA 4LJ5A 3IHLA 4PAMA 4BLOA 1TADA 2IUTA 3K0AA 3VQTA 4R98A 2ZS8A 3GLFA 4LV5B 1W1WA 1KO4A 4Q5IA 1A2BA 3T06B 4TLCA 1IONA 4OK3A 2VRWA 5BW8A 3I61A 1Q3TA 1LVGA 2OG2A 1G3RA 1AS2A 3THWB 3GFTA 1G8YA 3DOFA 2RHMA 3EAQA 4RKEA 4LJ8A 5C1BA 4S2EA 4JLMA 1D9ZA 2BHRA 1RE0A 3MD0A 4UKDA 1VMAA 1XCGB 1W47A 2R6GA 1WCV1 2ZROA 4QC2A 5J5CA 1WP9A 1Z6XA 2O5VA 1E9SA 5E7JA 1R0WA 4IVQA 1XEWX 3IIJA 3O47A 2PLRA 1VG9B 3L82B 1OXUA 1A1VA 5JI3E 2N42A 2V54A 4IFEA 4M0LA 5JSZB 2XZPA 2GCPA 3CONA 2A3RA 3C5CA 3ZQ6A 4RJLA 1AK2A 4C0HA 4RD3A 2PCLA 2J0QA 1XDBA 3RRNA 1F48A 5L8VA 1XTIA 2WBLC 4KU4A 3PXGA 4JJZA 1N6IA 3V9PA 4ACBA 5IF9A 1LTQA 1YZNA 5KO2A 2J0SA 4XWAA 4GRAA 2EYQA 5A0FA 2IXFA 1XRJA 1ZC4A 3QPVA 3TVTA 4I81A 2GESA 4JLVA 2QPTA 2WKQA 4BRWA 4UQOA 1W0JD 4CIDA 1TQ2A 2EWVA 5CM8B 2C99A 1UDXA 2BKUA 1N6LA 2F6RA 5J4YA 2B8TA 4RFVA 4M22A 3B5JA 1ZINA 3AVVA 3FHCB 2V7QA 3TRFA 1OJLA 2VF7A 1N5IA 3QXXA 4ARZB 2ZXUA 4Q7KA 1AJEA 3THWA 3BB3A 4GMDA 1B23P 4BLTA 2O8DB 1PJRA 3BERA 3WNCA 4DVGA 3ZLJA 4K46A 3SJCA 2PEYA 3RLFA 3PR1A 1ZJ6A 1RZ3A 3BFVA 4KYIB 3SQWA 1KI3A 5E7IA 4MYCA 5F2EA 3NKVA 4TT3A 3OHMA 4G5RA 4X8LA 5DISB 3V4RA 2XTMA 3IGFA 4OI1A 4P3YA 1YVDA 1NI3A 2QTVB 4Y0VA 4P31A 2ZI4A 4Q48A 3IO5A 2P6RA 3GJXC 1MRSA 4YXWA 4OHWA 4XSHA 1BO6A 1DADA 5FL7D 1FFHA 1UPTA 3P32A 4QBFA 1AGRA 4DHEA 4PO9A 4YQFA 1KO5A 2WMNB 3WNBA 3TAHA 5EE1A 5CIWA 2J7PD 3M0EA 2FSFA 3B1YA 2Z0MA 4A6PA 2BM0A 2QRNA 4HAZA 4EDHA 4YMVA 1FQKA 5KDOA 2QE7A 4OQNA 3DM5A 1ZAKA 2O52A 3LBIA 1FNNA 1C1YA 2QM8A 3KJEA 1HV8A 1BMFA 4FI3C 3R8FA 1SVLA 1TQDA 2W2VA 4AG6A 4D81A 2WKPA 5HZKA 4JS0A 5DO9A 5LB2A 1SHZA 1Z6TA 2QN6A 5KPJA 4PHTA 3WYAA 3CM0A 3PEWA 3BFKA 4PAQA 1YQTA 5JJLA 3UWOA 2BCJQ 4TL6A 1I2DA 1KSFX 2FJUA 3F5FA 4JZKA 3M6AA 1UBEA 2CEAA 4V0OA 1WBBA 2WJIA 1NVVR 4IOMA 1MKYA 1YR9A 4V03A 4URVR 1T3LA 4A92A 4KFSA 1YZKA 1KZ7B 3VKWA 2YVUA 1VECA 4PR0A 1U9IC 3RRYA 2ZM5A 4EFMA 2GVZC 1RIFA 1NNEA 1EFTA 4DC9A 1N6RA 1G3IA 5IK2A 3BD9A 1TEXA 4LHWA 4WZAE 3IQXA 3WNDA 2DPXA 4JKIA 2PCJA 3AVTA 1XEFA 4TMXA 2G0TA 4N1AA 2JLUA 3SDZA 5LPNA 2CK3A 2NIPA 2VP9A 5IHPA 2FF7A 2VHJA 1Q21A 1DS6A 3QSYA 3AVXA 4CT4B 1ZD9A 3AEZA 3B1XA 3ASZA 3Q7PA 1HH4A 2GKSA 3B8HA 3C5HA 4KFTA 4QFMA 1LFDB 4BFUA 4G0NA 2RGEA 3N2EA 4O3MA 3BJIC 4PSVA 4O2LA 2JLZA 1BIFA 1ETUA 4FMDB 1O3YA 2OFXA 5HKKD 4JL6A 1TEVA 1GP2A 3SJAA 1Q1EA 4IFBA 4KITB 3OIVA 5FBLB 3TE6A 1X1RA 2OZEA 1NKSA 4HI0E 3BK7A 1XXHE 1XXHA 1UBCA 4B6FA 4B75A 4HUQB 1E4VA 3OZXA 2JJ1D 1IOZA 1EFRD 1ZNWA 2C04A 2PLFA 4DSUA 3AM1A 4KCGA 3H0KA 1M2OB 3RWMB 1F5NA 1XD9A 1KO1A 1MOZA 2D4HA 3NBXX 4U00A 2HYDA 1N0UA 1NMZA 2GHIA 1VTKA 4NYJQ 4LJAA 1AKYA 4B3CA 3KJGA 2F43B 4MYHA 4B47A 1NY6A 5A4JA 3T1QA 1KNQA 2OCAA 2VL7A 2IWRA 2BEJA 3ZIAD 4BUJA 3IEUA 1GL6A 1TUEA 2AN9A 4M21A 3I5XA 4V02A 4EFNA 2RGAA 1Z0IA 1TTTA 1COWD 3T5DA 1KAGA 2XSZA 4ZIRB 2CHGA 1CRPA 4EQ6B 2AHOA 1N6NA 2C95A 4KVGA 3OF5A 2EYUA 4DJTA 4ON9A 2W2XA 2X2FA 1N5KA 5BN4A 1W0KD 3KB2A 1XX6A 1VDZA 2OV2A 3KUCA 1U98A 2I1QA 1JJVA 2FWRA 3AF0A 3PUWA 1U8AA 2GCOB 3IO3A 1WBDA 3X1ZA 3EPHA 4AKGA 2DB3A 2IS2A 2FN4A 1VYTA 2GWHA 2XXAB 2MMGA 5EP2A 2VHTA 2RGBA 1G6HA 2Z43A 3QF7A 1J8MF 4KSBA 4JVMA 4R7ZA 5EXTA 1JPNA 1R0YA 1ZUIA 3HR8A 4LUCA 4Q02A 2V8OA 4AIIA 1CJTC 5KHOC 4HUQA 1HE1C 4H1VA 1X6VA 3SU8A 3THYB 3F8TA 4AC9A 2HT6A 4HB0A 1NIPA 3HP1A 5C4MA 2H18A 5KSYA 3KQHA 1VIAA 1G9XA 1NSTA 1WE2A 3BH6A 1G6OA 4MKGA 4C0BA 3BOSA 4FWIB 4YC7A 1IQPA 5FBRB 3LWNA 1GTVA 4G5QA 4TYPA 3NEYA 1CJMA 2P6UA 1IN4A 1GVNB 4XJXA 4ILEA 3WP1B 2C9YA 2YNMA 4BLRA 2F43A 1P2TA 4LBWA 3FE2A 3KFVA 1ZM3A 4LX0A 2J45A 4AG5A 5GJVC 4JLBA 4Q03A 1ZUHA 5F9FA 1CEEA 3RS5A 3ADBA 3K8YA 3A4LA 1N25A 2FGKA 1M8PA 4ZIRA 4NP6A 3T5GA 1ODFA 4E07A 4GPTA 3NDBB 4EQ6A 1O87A 2BV3A 3KTAB 3U3MA 4ZI2A 2J87A 2BMDA 2F1HA 4YMTA 4GMXA 2IC5A 3UWKA 1Z63A 2ODBA 1Z28A 2HT1A 2QI9C 1NG9A 3LXXA 2IA5A 3HPRA 3I8XA 4Q01A 4DKXA 1S96A 2ANCA 2GCOA 3B82A 4U7DA 4TZ6A 1W0JA 3NBFA 5JFGA 4HAWA 3NG1A 2QUZA 4BEJA 2XXAA 1IXSB 2JASA 1GKUB 2HDNB 4UNQA 3U4QB 3U3JA 2CE7A 3AKDA 2Q9AA 1XCPA 2RGNC 2NO1A 4TMVA 3B2EA 1TF2A 2JLVA 2GNOA 3P26A 1G4AE 3THYA 1GAJA 4D26A 2F9MA 1Q3HA 3GJ4A 3BB4A 3O8BA 2A5GA 2ZE8A 1RFLA 3TUIC 1VCIA 3SC3A 2KE5A 5AUOB 4PHGA 1ZYUA 2YYZA 4KLZA 1U0LA 1ZBDA 5E7MA 2Z83A 4IXNA 5IDVA 3QBVA 4URZR 2XZOA 2OESA 4EPYA 2D7CA 2JJ8A 3K09C 4NTZA 4UNRA 1QHHB 1N0WA 2YOGA 2QENA 4OHZA 3A8TA 1K5GA 2F1RA 4OYHA 1G8FA 2JJ2D 5FL7A 5JBQA 1KSHA 1LS6A 2I4IA 2R6CA 1FOEB 1CIPA 2W0SA 4AYTA 2FG5A 2J7PA 5L3RA 2JATA 2AKAB 2QAJA 4B34A 2GAOA 5CK4A 1F60A 4PANA 4DLTA 2F9LA 1PVOA 4GOJA 3FMOB 4IDNA 5FTKA 1E9DA 2JLQA 4IKEA 1KK0A 5DHAA 4OL0A 5CJPA 2BWJA 1DAHA 1QHXA 2IYSA 4XOIA 3U4QA 3K9LA 2ZQ5A 3SJBA 4ERNA 5JWOA 5KDDA 1Q44A 5DN6D 3CRVA 4BLPA 4EFLA 2ZYVX 1S8FA 2IT1A 3HU3A 5HE8A 5CM9C 1S3GA 3T12A 4RZ3A 4P4TA 2J59A 1JNYA 2GK7A 3IPYA 1MH1A 1H8HD 4IRUB 4WOPA 2ZIAA 4B2PA 3GJ8A 1G41A 4MGYR 3ZYCA 1XTRA 1XZPA 4TWZA 4NMMA 2VP6A 2ZANA 2A9KA 2XTNA 1LV7A 3L0SA 4IW3B 1AZTA 3W34A 3SS8A 4F38A 4HDCA 1NVUQ 3H86A 2DBYA 1KKMA 3LD9A 2Q3FA 1KO8A 3UG6A 2GXSA 1ZM2A 3S1AB 3GQBA 1QHHA 3NXSA 1JXMA 1KK3A 4QGAA 3EWSA 3SI7A 3EW9A 4BASA 3EZFA 3WMFA 4A6XA 4ZPXA 3QKSA 3KXKA 4LBVA 3X1WA 2EFEB 1RVDA 3QXJA 4FCVA 1IAQA 3FFBA 3MMPA 2BBOA 1GNRA 4MKIA 1YZGA 4EAQA 3K70C 1XU4A 1EK0A 2JIZD 1R5BA 4NE2A 2QGNA 1VKJA 2Z4RA 2D7DA 4GP7A 3ZQJA 4A36A 4US0R 1HUQA 4Z1MD 4YDSA 4TZ0A 4OHVA 5E3HA 5HKKA 4Q1EA 3FMFA 3I32A 4EJSC 2PJZA 3FFAA 3Q72A 3SYNA 3ZS8A 4URUR 3DPUA 4IDPA 2H1LA 5JS7A 2FH5B 3K53A 2YHSA 3IIMA 2NZ8A 1OSNA 1L2TA 3BE4A 1IY0A 1GDDA 2IYQA 2JJ1A 3U3OA 1EFCA 1G4UR 1HYQA 2WAXA 1GITA 4DDVA 5SZIA 1IHUA 1EFRA 3AKEA 1CR0A 2B7BA 1Z5ZA 4UNNA 5B64A 1XTSA 3MWKA 2PT5A 3HYTA 5HTKA 2IF2A 2OAP1 4TYQA 5EE5B 3L43A 4P4SB 1DTSA 4B3XA 4A0GA 3EZ9A 4EPVA 4U5XA 3CKLA 4DBLC 1E0AA 1SVOA 1ZCBA 4QGFA 1D6JA 5AJYA 4DXAA 2PX3A 3DM9B 4BZPA 1KDOA 1RJ9A 1CTQA 3ZIAA 1NSFA 4NYMR 3LA6A 3G5UA 3RS7A 4NYMQ 5JCZA 1Z47A 2YWFA 1Q1QA 4KBGA 3QG5A 4JT4A 4LC1A 3DZDA 1ELOA 1COWA 2BEKA 1KI6B 1E9EA 1TF5A 3P20A 4Q7JB 2V6JA 4Q9LA 1VHLA 3Q85A 5TY0A 3U3KA 1NMYA 3AUXA 4LV8B 2G88A 4HAXA 3O8RA 3F3YA 2XZLA 1CF4A 3MUFA 4QNMA 2DYKA 4LJYA 1W0KA 3MG9A 3BIFA 2ZR7A 2VSXA 2WSSA 3VMFA 4N0DA 2R2AA 1XJQA 1G19A 1PLKA 2OBLA 4KHZA 4TSFD 3MWJA 4OK6A 2BJVA 1Z0KA 2AWNA 2HJVA 2ODWA 5L3QA 2ZE6A 2FFAA 2CVFA 4N0EA 1E2EA 3VKHA 3SNHA 3T15A 1RRGA 3CH5A 1W4RA 4KYUA 1E0SA 4DRZA 4V0ME 4BGDA 4V0MA 3GLHB 1EGAA 4PSKA 1RYHA 4NBSA 1X8LA 1G5RA 1JPJA 2G6BA 2C9CA 1GG2A 2UVQA 3T1OA 4C9BA 2ZITA 4D4MA 5D3MB 4Q47A 3PUVA 5HCIA 5JCPA 2A2ZA 4V0NA 5K8LA 2IS1A 1II0A 2NMVA 3UMRA 3A4NA 1W36D 2NO6A 2O0HA 1XD2B 4FXPA 1P6XA 2JA1A 4NCNA 5FL3A 3FB4A 4P4SA 2EQBA 4ABYA 4C0QC 1NF3A 2YOHA 4ACAA 4DUGA 4BFWA 2L0XA 4TQUS 3WBKA 4DCSA 4IOLA 4MH0R 4JL5A 2HEIA 2AXPA 2ZJ5A 3JVUA 4G1UC 3WHKA 1SXJD 5KSOA 1IY1A 1SVMA 5TV2A 5KNBA 1E98A 1G3UA 1Q22A 1Z6YA 3DMNA 2QPOA 2WIAA 4MYUA 4FCWA 1G7SA 1T3SA 2KI5A 2ZAOA 3LXRA 1WF3A 5HE9A 1JR6A 3CBQA 1KI6A 3K0CA 1Z06A 3AV0B 2IBMA 4AYXA 3KKPA 1Q20A 1W4CA 1N5JA 1CR4A 1E2QA 2J41A 2P5SA 4A0FA 4RZUA 4NONA 2BMFA 4BZQA 5J4KA 4H9GA 2JEOA 1W5TA 3IPXA 1E2HA 2DWQA 3UMSA 4K81B 3Q9LA 4X8OA 4ZDKA 2RMKA 2ZUBA 3PFIA 4MQBA 3HWSA 3K9NA 5FOSA 5CIQA 4BFTA 2QORA 1MABB 1X8KA 4DLSA 1S3SA 1E0KA 2CVHA 1HQCA 3R9IA 1BOFA 4DDTA 2JLSA 4DCNA 3FDIA 3JVVA 2Z4SA 2QP3A 2CMKA 1DG1G 2EU8A 4DLZA 1FNMA 3AF2A 2DY1A 3NVAA 2EFCB 4LHZA 1NMXA 5AUQA 3FGNA 4CW7A 3SOPA 3GLHA 3Q3JB 1E69A 2IS6A 2WKRA 3ZGXA 1UBFA 3DDCA 4TLBA 4RZ2A 4X8HA 1OIXA 3AVPA 3SJZA 1OIWA 2OXRA 5AUPB 2I1VB 3DKPA 3KXIA 1FMLA 5KTYA 1TQ6A 3KDSE 3P27A 3N5CA 2ERYA 2R65A 3OEEA 4B6EA 1N2CE 2ONJA 1P7CA 4FIDA 1OFTA 1WDTA 2CL7X 2LCFA 4M1WA 1UKVY 4Q4JA 2ZRIA 1OH6A 1M1YE 5H70A 4KODA 4ZV4A 2JJ2A 2GBLA 4GZLA 4MYTA 2ZSFA 4RSGA 1D5CA 4AY2A 4PZLA 1GRQA 2OFOA 1N6KA 3RAPR 1OFUX 2ZVQX 4CEIA 1SQ5A 4OHXA 2VYFA 3HR7A 3CRRA 4RKFA 1N6HA 2WWIA 4XWKA 2GDJA 2ZS9A 1FP6A 5AJZA 3NIBA 1G7RA 2RCNA 3QQ5A 4NHOA 1KKLA 3RSLA 3D8BA 2ZYTX 2OM2A 4I1UA 3IUYA 4M1TA 1DAEA 1MABA 4GOXA 3EX7C 3U7GA 2IEZA 2ZJBA 1G7CA 3ADKA 5FOWA 4B33A 2ZI3A 5DN6A 1LB1B 1XP8A 1ZM7A 3SE0A 1CJVC 3WMGA 1QHGA 1NY5A 1Q1ZA 1H8HA 1XD8A 1XF9A 2ZJAA 3VHXA 3RC3A 1UKYA 1Q0UA 8OHMA 4HUTA 4MRVA 1ZD1A 5IRCD 3LW7A 1AS3A 1A2KC 2QP9X 1AIPA 1OW3B 3KXLA 4DLXA 2C77A 4DCUA 2VP2A 2W00A 2D62A 2ZU6A 4ZI3A 1VG0B 3H4MA 1GRNA 2XTZA 2QT0A 1IY2A 5FUVA 3AP1A 4HZUB 2YZ2A 4ITRC 3NBZC 2O8BB 3EIHA 1J7KA 2QG6A 2ZRAA 4XTCS 3LBHA 5HR5A 3BORA 1GRRA 1QHSA 2JLYA 1S9HA 4B2LA 1SKYE 3TR0A 3KJIA 1T91A 2GEDA 4YMWA 1DARA 4JVNA 2ZRNA 5E4FA 2WM9B 2XOKD 2NG1A 1V43A 3OE7D 4D6PA 3DVLA 3KKNA 4WAUA 3GFPA 3UATA 2O0JA 3I73A 4B35A 2REBA 4TLEA 4TTPA 3TUJC 3VHLB 5JLJA 2HJGA 4LPSA 4BQSA 2JIZA 1E1QD 1AGPA 1E9BA 4ASUD 3LDAA 1E2DA 4KFUA 4ZDIA 1TAGA 4G5GA 4Z1MA 2VEDA 2C78A 4FMCB 1UBGA 3DKVA 1Z2CA 1NL3A 5BWMA 5JECA 4BFVA 5FI0B 2IYLD 4B3FX 2IUUA 2BBSA 3IILA 4L15A 5DLQC 4UNSA 4IDOA 3VX4A 2BC9A 4PSAA 1CU1A 5EZ6B 1Z07A 1TUIA 1ZIOA 2FSGA 3MWLA 5FPTA 4KJZA 4QL3A 4CRWB 5K8UA 2QQEA 3HYRA 1J2JA 1ZP6A 3TKLA 3LX8A 1U0HC 4F92B 4P0TA 2WOJA 3GJ5A 3L8YA 5FOUA 6Q21A 5AK0A 1W36B 2IF0A 3WXMA 1T9HA 1P9NA 1KJWA 3TSZA 5BYJA 5BN5A 3IBGA 3QXCA 4LYHA 3GLIE 2NQ2C 4HZUA 1L7VC 4LC0A 2IYUA 2JDID 1ZNZA 1G8GA 4LYAA 5J40A 2WJYA 2O8BA 2B7CA 1II9A 1T8UA 4RZXA 4Q9KA 5FBQB 2D2EA 3PG5A 3SHFA 2WJJA 4EPXA 1KSJA 5C4GB 3U7FB 1XXHB 2QNRA 2FX3A 3RYTC 2ZI6A 4XSGA 3GLGB 3RRZA 3AVOA 3EZ7A 5CYPA 2H16A 3KKMA 3QJYA 4O2RA 1YRAA 4MGZR 4TSFA 1HTWA 1NVVQ 1LF0A 2YC4C 5EUQB 1OE0A 4EPRA 4IVRA 4A9AA 2DR3A 1UADA 1CP2A 3FKSD 3EPKA 3QOFA 2Q9BA 3VR4A 2VH5R 3GCGA 1N0VC 1W2HA 4LRWA 1NRJB 1CJKC 3NC1C 4GZMA 2FDCA 4LYFA 2H17A 1EFHA 4C30A 4GL2A 1UKEA 1VPLA 2YINC 2R62A 1NVWQ 5CDFE 4PC1A 5HZHA 5JEEA 5DSZA 5H1YA 1P61B 4C7OB 3RANA 3ZZUA 5EQTA 1FTSA 4LZZA 4HATA 3NDPA 4HEJA 3H2YA 4DSTA 2P67A 2WIBA 3A37A 4C0AC 2XJ4A 1D2NA 1SXJE 2GXQA 1SXJA 2FMXA 3MAAC 2NOAA 4JLAA 1GIAA 2IX3A 4CF7A 2CXXA 1U8YA 2A5YB 3AF4A 5B58C 4TTRA 1KDPA 5GVSA 2XAUA 4GP6A 3LQRA 1HQYE 3IBYA 2WJGA 4MRSA 2OLKA 3EIEA 4IDHA 1DEKA 4C0SA 4RD0A 3AVUA 3AB3A 3GLGE 3GLGA 2NGRA 2CLDX 1JAIA 2XB4A 1ZNXA 3MGCA 1NLFA 2ZVPX 2OE2A 4JSYA 4R9UC 2GJAA 4MA4A 2A30A 4P32A 3RDPA 4B74A 1US8B 2CDNA 1WB9A 4TTQA 4B48A 5JWRA 3U5ZB 4Q00A 3E70C 1VIYA 2HXSA 3VNUA 1LY1A 4EPTA 3FMIA 2ZE7A 3TJZA 1VCOA 2FZ4A 2GZDA 4DT1A 1KJZA 3M1IA 1XTKA 3C41J 2D74A 1OLOA 5JZVA 2GJ9A 3TGPA 3KQUA 3QKUA 4JIMA 5CK5A 3HJNA 4R71A 2CL0X 4HSEA 121PA 1MV5A 2A78A 4M1KA 3GMTA 3PCRB 2G77B 4QM6A 2GJSA 5E95A 2VLIA 4C7OA 3FHTA 4NYIR 3QVVA 2FPKA 4M9XA 1XMJA 1M7BA 2R6AA 3RS2A 4UXIA 4NYIQ 2WSSD 2QMEA 2JLWA 2R44A 1Z0AA 4A8JB 4JKYA 1FUKA 2J1LA 1JR3D 2PH1A 4PHFA 1U2RA 4A1FA 4GNKA 4RY2A 3RS4A 4B2IA 2IHBA 2GILA 4L9SA 2CCKA 1GM5A 2WWXA 1E9RA 2QPAA 4U02A 4M8NE 4PC6A 1G7TA 1F3OA 2GAAA 2G1JA 3C8UA 3GEHA 1BKDR 2G1KA 4V0KA 2VP0A 1G3MA 4TN1A 3THXB 5KOYA 2QZ4A 1CXZA 1US8A 4DDUA 4ZDWA 2DWPA 1R8SA 2ZRGA 1C4OA 1SZPA 2AD5A 4RD6A 4URYR 1EX6A 3PJRA 4AI6A 3BWDD 3OIUA 2GCNA 1ZM4A 4DUGD 3CX6A 2JAQA 4LI0A 1G291 1BYIA 2AL7A 4XVRA 1NN3A 4GBMA 1G3QA 1QG4A 4GT1A 1T0JB 2B6HA 3W6PA 2H8KA 4Q7LA 1QHIA 4OI0A 1KY3A 2VQSA 1W5SA 3R20A 1WXQA 2HV8A 1JQLB 4Q1CA 2ZSAA 4A2WA 2ZI5A 4B3DA 4MDFA 3U61B 3W3ZB 3W6NA 3WMEA 5AJWA 2HCBA 5FH9A 3AP3A 4NL4H 3B9QA 4W5WA 1OXSC 3EWAA 3K9HA 4F4JA 2GTPA 2GEVA 3E5HA 4D4JA 3QXSA 4A8JA 4D4LA 4OHYA 1R10A 4LDJA 2VTKA 2FZLA 1ZMXA 2WWWA 2PT7A 1SVKA 3W5IA 4D0GA 2Y8EA 2KBEA 2QU8A 2HXYA 4QHTA 3ZVRA 1GNQA 3I1FA 3TR5A 1XNJA 2XOKA 1MO5A 1DAKA 3A4MA 2ZI7A 3PV0A 1BYUA 2ZRHA 1OFHA 3OE7A 3CNLA 4A4DA 1WA5A 2FOLA 1J70A 1DG3A 1IM2A 1G8PA 5JWHA 1P3JA 4US2R 1LW7A 1II8A 1J90A 3CUEF 4OQXA 3THXA 3QKTA 2J5XA 1E1QA 1G21E 5L3SA 2J0UB 5SZHB 4ASUA 2AD1A 2RH5A 3TBKA 4CYMA 2ZYUX 1W7AA 2OO7A 2WZQA 3ICEA 4HLQB 2A7QA 3LH5A 4GI7A 3C15C 3ONWA 4QHSA 2OAQ1 3OEED 4TLDA 4XWOA 2BMJA 2V55B 2F1JA 3B85A 3CLVA 3A1UA 1Z0DA 3ZH9B 4JLJA 4MKHA 1NP6A 3QG1A 3TW8B 4PPNA 3I92A 1H8ED 5K8TA 4QKQA 4TL8A 1I4TD 1XMVA 1GZSA 4LWZA 2IYZA 1XEXB 3QKSB 1JJ7A 2W6ID 2P6NA 4QG7A 1DO0A 2J46A 4RD1A 3SQXA 3IHWA 4IOKA 3EZ2A 3W8RA 2C2HA 4NDZA 1AA9A 2OBMA 1CULC 3FYHA 3QPWA 5B2ZA 5TDHA 1Q12A 2P65A 2DHRA 4AKHA 2UKDA 3UIEA 2JDIA 3AH8A 2YKGA 5DI9A 4IHQA 1QBKC 1XJ0A 1W2GA 1NBMD 2K5UA 2XNDD 4HAYA 4LHVA 2R8RA 2BCGY 3QBTA 3V4FA 4AD8A 4BFXA 1A4RA 2OXCA 3R7WB 2WSMA 1L4YA 3BH0A 3MLEA 1T6NA 4Q18A 3FVQA 3U60B 4K8OA 2DFTA 2B92A 2GJKA 4I4LA 3C16C 1XPOA 4PO8A 2P3SA 1KMQA 3NTUA 4B76A 4W7SA 2QA5A 3KUDA 2J0UA 1RYFA 3PITA 2ZAMA 1OKKD 5FI1B 1M6NA 3NBYC 3B13B 4FN5A 3KQNA 2CCGA 3ETLA 1GKIA 1D2EA 1RJ9B 4UJ3A 2G9NA 2F1IA 4Y0AA 1ONBA 3FKSA 2KBFA 2PZGA 1KI2A 2IYXA 4WXRA 4PPGA 1UEJA 4I1VA 1JALA 3LLMA 4MDEA 2YWGA 4IDQA 3KJHA 4PFSA 1R0XA 1J99A 1G8HA 5EJEA 2FA9A 3M4YA 5CLLA 1P2SA 1XEXA 2N1BA 3TH5A 4A15A 4AWXA 4XVUA 2YV5A 3QI2A 4EIWA 1YHNA 2OUKA 1NJFA 1M7HA 3LV8A 4TMTA 3AUYA 3T1VA 3VFDA 3VKGA 2EVWX 3ASYA 1ZNYA 3AGPA 5FTJA 1IBRA 1E9AA 4DLVA 2V9PA 3QKRA 4CEHA 2ZJYA 1K5DA 1VHTA 4HAVA 2QMUA 2WHXA 1AZSC 2KB0A 2QMHA 4RCYA 2YWHA 2QSZA 4TQAA 1UJ2A 2P2LA 1ZRHA 1ZUNB 3VR1A 3R7WA 5L3QB 3B1VA 1ESNA 2V6IA 3B78A 3ZVMA 5DE3A 1KDRA 3PENA 4DLWA 2HLDD 3ZVLA 3CRQA 4TQ9A 5BXQC 4UXHA 4AK9A 5GVRA 4KO8A 5TB5A 1SGWA 2CHQA 4A0HA 2ORIA 1CRQA 4JL8A 1R5OA 3C4JA 4KFRA 3VAAA 2W83A 3HU1A 1OF1A 2W2TA 3ADCA 3G0HA 2ZRJA 3SBEA 2F7SA 5TXGA 3GP8A 3RWOA 5JEDA 2GETA 1L8QA 1S1MA 2AKYA 3H84A 1DAGA 4PO1A 2B21A 1UAAA 2A5JA 1YRBA 4LHYA 2ATVA 3CF0A 4CDGA 2QMOA 1QF9A 2AXNA 4B44A 1ZW6A 4ESVA 3FMPB 2BBWA 5FBVB 5TVKA 4DEYA 4D80A 4URXR 4PC3A 1N5LA 2ZSBA 4DSOA 1SHKA 5AUNB 2VA8A 4XD7D 1E2NA 2FSHA 4RD4A 2HF8A 1KI8A 3K0CC 1P73A 4RFSB 1F2TB 4ZCIA 1EX7A 4JBYA 2PZEA 4FINA 4CEJB 4NKRA 1JXOA 2IK8A 4NPHA 2IHYA 1R7RA 4XTRA 5EE0A 5EZ5A 4QJ3A 3KKQA 1G5PA 3LW8A 4DB2A 3TSWA 3P1JA 4FMDF 4G01B 2HUPA 4BEBA 4Q19A 1JR3E 4XIGS 1JR3A 3CR8A 2P5TB 3K0EA 2QAGB 5CITA 1Z29A 2G3YA 5FPSA 2FU5C 221PA 4E5UA 2QTHA 1IN8A 3UG7A 1XTQA 3OFND 5FTMA 2ONKA 1PUJA 3RHFA 3Q7QA 4OJQA 1SVSA 1L4UA 1SVWA 4W5JA 5GJCA 4MITA 1VYVA 4QBHA 1N6PA 4JLKA 2AK2A 2IYTA 3WY9A 5F3WB 1KNXA 2RKOA 1I2MA 1E3MA 3UXMA 1J8YF 5CJ2A 1Y63A 2GZAA 3KX2A 1E0JA 1LF5A 4PZYA 4TL7A 4Z51A 3KQLA 2XITA 4DCVA 1KGDA 1YZQA 4G3XA 3UANA 3EA5A 4ZKDA 4DIEA 1FTNA 3CH4B 2NTYC 3U7HB 4Q4JB 3O8CA 4POAA 1CR2A 4OK5A 1D8TA 3DHWC 1PZNA 4Q21A 1Z6AA 3WRXC 4A82A 5C46F 4PZZA 3MWYW 3I3SR 2GBLC 5FUYA 1TQ4A 1UFQA 4L5BA 2B8WA 3LQQA 1G17A 2O8CA 1T5LA 3MRSA 3TUZC 4CEIB 4PC2A 3TK1A 2ZETA 4RFSA 3ZD6A 2WJHA 5BYKA 1F2TA 2GF0A 4AURA 4CEJA 4EPWA 1XCMA 3CZQA 1ZIPA 5DYGA 5DYIA 4Q1BA 1KIMA 3CNNA 3PVSA 2BDTA 3MFYA 4IVPA 4F4IA 4QGGA 2ZJZA 2GZHA 3GJ3A 3WP0A 2NPIA 4C3ZA 2G83A 2QAGA 4ZDJA 2FV8A 2QSYA 4PPFA 4L8GA 5EXSA 4QRHA 1HT2E 4KV9A 4M9SA 1ESMA 1DVRA 2JLRA 2OLJA 2O8EA 4J0QA 1VYUA 2Z6VA 2YWEA 4C0LA 1OHHD 2DFLA 4EKDA 4OKSA 1NG1A 1FX0B 3EXAA 2R6FA 4KSCA 1SKQA 3UPUA 4BFZA 3K0FB 4TYWA 4PX9A 1E2MA 2XNSA 2F55A 1Q57A 3WYFA 3ZJYA 2IEYA 1IN5A 1P62B 2ZI9A 3ZZTA 4KXFB 2MSCB 5K8IA 4PQFA 3REGA 2IYWA 2MMCA 1ZU4A 4W5HA 1E94E 3KQKA 1XMSA 1OYYA 1SKYB 4HLUA 1H8EA 2VIIA 4LHXA 5B30A 1RRPA 2CBZA 5G3YA 3B7GA 3BXZA 2X2EA 3IEVA 3SZRA 1R8QA 2W6IA 3CRW1 4FCTA 4OQFA 1OYWA 2OCYC 2PMDA 1QVRA 1IXZA 1VCMA 3VX3A 3K1JA 2ZSDA 4HYYA 2FPLA 5BQ5A 3EG5A 2D06A 3GLFE 1NBME 2XNDA 1NBMA 1TNDA 2C98A 4GFDA 3A36A 3CF6R 5ANRB 3CX8A 1DPFA 3ADDA 2ZRLA 1C9KA 2ANBA 3WBJA 2ZUCA 5EP1A 3IQWA 1OT3A 2BKEA 3EC2A 4HB2A 1YU9A 1EXMA 1ZU5A 4QNRA 1G64A 1G5TA 1KK1A 1YR6A 5L3VA 5M04A 1SVIA 1R5NA 5KUTA 1FP7A 2HYIC 2Q21A 1FX0A 1S2MA 4N3NA 1D2MA 4Q9JA 4B43A 3E1SA 5KSPA 3K0FA 1OKKA 1JAHA 2IYYA 3CO5A 3DO6A 3W9YA 3GLIB 5AJVB 1GL7A 2VPPA 4RD2A 3EPJA 2FNAA 3A58B 5C18A 3BC1A 1IJEA 2MSDB 5FPKA 3HU2A 4LYJA 4WW0A 3QIAA 3NWJA 1OXVA 2IUSA 2IXGA 3PQCA 3D7MA 3BH7A 2EW1A 1M7GA 2KWIA 4QJ4A 3TSOA 2X8AA 1A82A 1KTVA 1FQJA 1F6BA 2ZRDA 3I5YA 4IEEA 2CLSA 2CJWB 2HF9A 3AGQA 3DMDA 3MJHA 4AYWA 2ZREA 1KY2A 4Z54A 5H8WA 4KAXA 4WBSA 2V4ZA 2ZEJA 4ZO4A 1VG8A 2C96A 1MO4A 2QTFA 4I99A 3RC8A 2IS4A 1XBTA 4DWJA 3AVYA 3BAFA 4IJMA 5J4VA 4R2HA 1Z0FA 4UNPA 2Q6TA 5G40A 5JS8A 2YJTD 1FMJA 3N2IA 4FWTA 1NN1A 2HLDA 4OI2A 1P9RA 3RVBA 4CVNA 2VF8A 4TMKA 4JMPA 5GADl 1R2QA 4LGMA 3D3QA 4P4UA 1E1RD 2ZUDA 2WMOB 2ATXA 3J81k 4OI4A 2E9SA 3VR5A 1UDWA 3RS3A 2DFNA 1XB2A 2ZR9A 1U94A 5TMPA 2KJQA 3SFZA 5J4HA 1QHYA 2J9RA 1W36C 2C03A 3T34A 4QBGB 3GLIA 4OQLA 1XJCA 1P75A 4DB4A 2JGNA 3LVRE 1BH2A 2RGXA 3LBNA 4ESHA 1SXJB 1X1SA 5JSZA 5KDLA 1DE0A 3U6KA 4A2PA 1SXJC 3GPLA 1CS4C 1Z6GA 3KKOA 3A1WA 1DOAA 1XZQA 2OILA 4L16A 3LFUA 1U0JA 2DCUA 2PZFA 3LVQE 1AN0A 4D0LB 4XH9B 4QBIA 3SHWA 4XD7A 2CCJA 3QUSA 3ZD7A 3HPQA 5CYOA 3EARA 4G5OA 1G1MA 4YMUA 4I1SA 5CB6A 1NLYA 5GJBA 2CJWA 2ZE5A 2BOVA 3N70A 1KHTA 2NZJA 3B6EA 3VNVA 4LJ9A 2IL1A 2W6JD 3A1TA 1VCNA 4DZZA 4B32A 4PAOA 1E2IA 2CNWA 3FKQA 3WRYC 1KDTA 2H5EA 3NEJA 3QPUA 3C7KA 4DT1B 1UM8A 1P5ZB 4ARZA 1PLJA 1XWIA 4F91B 1W46A 3OFNA 1OH5A 2O8DA 1A5TA 2ERXA 3CPJB 1EESA 1Q1BA 5KYKA 4YONB 4II7A 5FUWA 3LO5A 4YDHB 1K8RA 3WHLA 4B3BA 5CDFA 5KNCA 2QT1A 2TMKA 4E09A 1K6MA 621PA 5DI3B 5FOTA 5LB4A 1KOFA 4KVAA 3I72A 2RAPA 2XX3A 1Z0JA 2RGGA 3QE0A 1NVXQ 5FTNA 3GD7A 3O8DA 1P9WA 2NO0A 3PUZA 1RRFA 4H1UA 5CLQA 3F0TA 3L0OA 5C2JB 1S4QA 1E4YA 5JMTA 4OBEA 3LY5A 5FBWB 5AJXA 2LWIA 4Q4HB 4WA7A 2EWWA 4L9WA 1GWNA 4F4CA 2CL6X 3U6BA 3BRWD 821PA 1QG2A 1E2GA 2AWOA 3IIKA 1KI4A 5UKDA 1OB2A 1CKEA 2EFDB 3NHBA 4MUBA 1NKTA 2ZRKA 4JLNA 1DAFA 1DO2A 2YOFA 3Q8XB 5DNYB 4R2IA 3R9XA 3AVWA 3A1SA 3EPLA 2O8FB 4LK2A 1Z22A 2AX4A 2R6DA 4BLQA 1E79D 1JB1A 1FW6A 3AF1A 3D31A 1RPZA 1FL9A 1U81A 4NH0A 4OJKA 1CBUA 3P4YA 1X3SA 5B57C 1Z3IX 2Q3HA 3AKYA 1KK2A 4NCIA 1CLUA 4C4PA 2QBYB 1CJUC 3FPAA 3L2OB 3W5JA 4IEIA 1TPZA 4FW9A 3TAUA 2XJ9A 4ZKEA 5SZKB 2E1RA 1XFAA 1P60A 1OHHA 4C2UA 1X86B 3KZ1E 1ZCAA 3I4LA 1U99A 2QQ0A 3ND9A 4JYBA 4NYJR 1YZTA 2PL3A 1E2LA 4BRUA 2FFHA 4DLRA 1HY3A 1U9IA 1JI0A 5F9HA 5DI3A 2ODEA 3THOA 2ORWA 4TL9A 3BFXA 1T3HA 1LS1A 4FD2A 2C5LA 1QVAA 5EP4A 1KYIA 5DHFA 5F98A 3G82C 3OIWA 4A8JC 4PPQA 5BN3A 2WTUA 3OEHD 1R0ZA 1Z08A 2GF9A 3TVDA 3GEIA 5FOVA 3I62A 3B60A 2OT3B 2N46A 1E2PA 2WPDD 4JJKA 1UF9A 2P0EA 3BBPA 1KJYA 2ZRCA 4Q4HA 5FOXA 3K70D 4QM7A 5EXXA 4P33A 3PIRA 3TW4A 3OIYA 3EASA 2ZTSA 4C0JA 2D3WA 1EWQA 4JYCA 5ELXA 2REXB 1RC8A 1II8B 2QM7A 2E87A 4GDFA 1TX4B 5L3SB 2XB2A 3W90A 2C9OA 2VSFA 4JSTA 5P21A 1W48A 2WWHA 2ZS7A 4JLOA 3L0PA 4CZ2A 3L8ZA 1W49A 2J3EA 5LBIA 1GNPA 2GXUA 5HPYB 3LNCA 2O8FA 5JJKA 1JEEA 4NCKA 3ZS9A 2IWHA 1AKEA 1S0UA 1JEDA 1V5WA 5EE9A 3CW2A 4URWR 1FPMA 1GL9B 3RSOA 2G0NA 2X77A 4V0LA 2C8VA 2QBYA 2V1UA 3PEVA 4HDOB 3L0IB 4NZYA 4WIAA 4ZCLA 3WYGA 1OXTA 2WWGA 2VBCA 2YC2C 2GXAA 3TMKA 3KB1A 3AKCA 4MRRA 3PEUA 4OQMA 1P72A 1ZC3A 3R8CA 2JCSA 4PXAA 1OFIA 1NIJA 4GOKA 1QRAA 3SFVA 2IW3A 2Q0HA 1R6BX 3U2QA 4WZ6A 1GKYA 1YJ5A 2ZJ2A 4KI0A 4Q1FA 4RCZA 5EE3A 4LV6A 2VP4A 3GJ7A 2EFHB 4BWYA 1TU4A 4HLDA 2AFHE 4TMWA 3SEAA 2VP5A 1YZUA 2KSQA 1XTJA 1P4SA 1YKSA 2FFBA 4M1SA 2ECKA 4Q66C 3AF3A 1GSIA 1KO7A 1DAIA 2EFGA 2R9VA 2WAYA 1NN0A 2FFQA 4MGIR 1GOTA 3X1XA 2QGZA 2CLCX 1G18A 3OESA 4Q1DA 4Q9IA 1IJFA 1D9XA 4QJ5A 3TNFA 1Y3AA 2UZIR 2ZRMA 4B73A 2QL6A 2NO9A 4PHHA 2WWYA 3C14C 1AQUA 1KSGA 1MR3F 4L4UA 2ODNA 4HDQB 3AQ4A 4LCBA 2ZR0A 4HB4A 3VR6A 3OAAD 4D0NA 1DAMA 2WOOA 2OHFA 4PC7A 5D3QA 1QHNA 2BM1A 2QRZA 2X1VA 4M1OA 5JHHB 4B71A 2DWOA 3LLUA 1OIVA 3B9PA 4MGKR 3CX7A 4HB3A 3CPHA 1Z83A 1E1RA 3QENA 5KU1A 1HE8B 1T0HB 3U44B 2XEXA 5KSZA 1IXRC 1I4LD 3EZ6A 3REFA 1ZVQA 2IXEA 3DEFA 1IN6A 1KMHB 2WWFA 3W8NA 4M9QA 4JVSB 4DIDA 1HA3A 2QY9A 5HCNA 4M9ZA 4Q4AB 3SYLA 3QKRB 4ZCMA 3B1ZA 1KI7A 4CEHB 4LJ6A 4WVFA 4BZXA 2OEPA 1DELA 4MKFA 5FUXA 3HDTA 1H65A 5J4LA 3EA0A 2UZ3A 3D6TB 3FOZA 5IT5A 2BBTA 3T61A 3CF2A 3IDQA 3PEYA 1YR7A 2X19A 1OV4A 1KI1A 2ZPTX 3DOEA 3BGWA 2NO7A 2VHQA 1UKZA 2W0MA 2GEUA 3KTAA 1EG7A 4IXMA 5H68A 5KPDA 4LJ7A 4D4KA 4M1MA 3GEEA 4IOJA 2AK3A 4WZBE 5SZJA 4PTLA 1AS0A 2GRJA 4A2QA 1YE8A 1OB5A 4HAUA 2IYRA 3RNLA 3AVQA 3KL4A 2VO1A 3CZPA 4D2IA 2W6JA 4JLDA 2I3BA 1RRCA 5FFMA 2XGJA 4HLCA 1G20E 3TQCA 2RGNA 3MCAA 2GA8A 4LPKA 2CHVA 5TARA 4FMCF 3VR3A 1NLZA 4Q9HA 3A1VA 2OSBA 2OCPA 3PUYA 5FTLA 3TIFA 1E2KA 2REOA 1OH8A 2ZRPA 3RRMA 4QXAA 4F93B 2Q3MA 3BB1A 1FZQA 4BFSA 2ZJOA 2ZRBA 3U44A 1PUIA 5JRJA 4HZIA 4M4SA 4B3GA 1HT1E 4DLUA 4MUAA 1KMHA 5FPYA 5DIFA 4BECA 2V1XA 1XEWY 2GJ8A 2PMKA 3NH6A 4Q4AA 5GJWC 3K09A 5JRZA 4LY6A 3ND8A 2LKDA 2V3CC 3AP2A 4JT2A 4PQRA 1LNZA 3H1TA 2D2FA 2OBNA 2VHCA 3QF4B 1GFIA 3CWZA 4C2TA 2V7QD 2GVDC 4KBFA 2BJWA 3JZAA 1E9FA 3QXHA 4DCTA 4DDWA 2F3RA 2BMEA 1MO6A 5DGXA 3SN6A 3K70B 2PEZA 4AKIA 2ZSEA 1GUAA 1BS1A 3UMFA 4MRNA 4NCHA 3LX5A 1T4GA 1ZD8A 5FR1A 4MRPA 5J47A 3CPEA 1R4AA 4AKEA 4TT3D 2FE4A 4EJSB 2MSEB 1YR8A 2ZU0C 3Q5EA 4NU0A 1XPRA 2HCJB 3DZ8A 4C0KA 2PJRA 1TMKA 1TU3A 1Z8FA 2VHUA 1KZGB 2FEMA 2JLXA 1FUUA 2F3TA 3TQFA 1E79A 1N3BA 3NHAA 4YXWD 1OXXK 4PQYA 1HEIA 3ZDQA 4Q1AA 3PUXA 1UEIA 4EUNA 2DFKB 2VSOA 3QEJA 1S1CA 3QNUA 4F7WA 2WJVA 1QDEA 4Z8XA 1PV4A 4RVCA 1MT0A 1M34E 1TL7C 4UXJA 1RKBA 2SHKA 1M74A 1SULA 3SBDA 5LD2B 3EIQA 1ANKA 2AFIE 2RHDA 5G3ZA 2O8CB 5EXPA 5LD2C 1E6CA 4XVQA 3SR0A 4BLSA 1E9CA 4KLNA 721PA 4BPBA 2QE7D 1VG1A 4Z8YA 3U7EB 3QEOA 1KAOA 2GK6A 3IKJA 1U8ZA 1AQYA 4QGHA 1DBSA 2Q9CA 5G41A 1BMFD 2FGJA 3S1AA 3X1YA 1MO3A 2A5DA 2CNWD 4LBZA 2H7VA 2H92A 2RGDA 5EP3A 1E32A 3QF4A 2CE2X 3OEHA 4O0MA 1W44A 2J7KA 2OCBA 4US1R 4O25A 3GJ0A 1E2FA 2QAGC 2WPDA 2ZYWX 2WVJA 3Q5DA 3MSXA 4DEXA 3VU9B 2OFWA 4Q4LA 1KI9A 2O8EB 3FTQA 3UK6A 4W9MC 1IN7A 4BFYA 3SYKA 1OH7A 3KFXA 4X8MA 5G53C 3UKDA 1P2VA 1B0UA 3LAWA 1N6OA 5JJIA 4EJSA 4G5SA 4LJ4A 4QHYA 4E22A 3GJ6A 4D82A 1S9DA 1XPUA 1MRNA 2WICA 3U3RA 1HURA 3DL0A 2WV9A 4JBXA 1W4AA 3RS0A 5CB8A 3FHOA 5FR2A 2QEQA 3T35A 5IK2D 5KNDA 4TYNA 1NN5A 3FWYA 4LOAA 4FMBB 4LSGA 3B1WA 3QY0A 3LRPA 521PA 1A7JA 1Z2AA 1RW4A 1P2UA 4DSNA 1G16A 4CT5A 4HLUC 2CK3D 2QP4A 1T5IA 1E2JA 2W58A 3ICQB 5JI2E 1EWRA 3I8SA 1CR1A
chains in the Genus database with same CATH superfamily
4BGIA 4GSYA 4JVLA 1DDIA 5HIJA 3KUKA 2Z5FA 5KYTA 2ZRFA 1BD4A 2BFCA 2IGBA 3EVAA 5DBEX 4DSZA 3T1TA 3GYBA 3NUGA 1FJXA 1LPMA 1T9GR 3GELA 1RPAA 4N3AA 1CJSA 2ASEA 2O2HA 2TRSB 3MERA 5GM2A 4CMIB 4YCCA 2ZZMA 3RBXA 1U90A 4NESA 4R1QA 1K7EB 2LKCA 4EUHA 2PG3A 4CF5A 3RAGA 2VBGA 1FBNA 3WNZA 4DAEA 1JBKA 1EFPB 2HNKA 4LE2A 4H3VA 1V4NA 1W4BA 3PFHA 4QO8A 5DHSA 3GZ4A 5A7HA 2PT9A 5KYUA 5TMPA 3QVUA 4W5NA 1EFUA 1GHTA 3H4IA 3TLXA 4BTLA 3VU9A 4N6OA 2HLNA 3ZV7A 2BVNA 3K2EA 1KYVA 3IQDB 3ICPA 1M8GA 2OKCA 2Q3BA 4QYWA 1PI3A 5EI5A 3S2SA 3QVJA 4TXLA 5D51S 1FE8A 3TFWA 4RK5A 5AOBA 4EG7A 4ZTUB 4HR7A 3K0SA 3HSSA 3M1YA 3LMKA 4J1TA 1JBQA 1JECA 2IPAB 4QELA 5ENZA 1UXHA 2DFPA 3EUAA 3W4IA 3ET5A 2HPVA 2EXXA 3KT8A 2R3SA 3WGTA 3BHJA 3GCDA 3KT3A 5EWMB 1UOEA 3B12A 4A8TA 5E9WA 1VLMA 3HJGA 2EQAA 4BE7B 3E27A 1Z13A 3D6VA 5LOVF 3G0GA 3CRMA 4OD0A 3W9UA 4R05A 1JFSA 3JQFC 4MV5A 2VJNA 4I1OA 2O0KA 1ZN9A 1PR5A 1XKTA 2QV0A 3SIWA 3WXBA 5F21A 1DWPA 2GF2A 2QD3A 4IHAA 5IN5A 3A6PC 1Y3DE 3ZZ0A 3ZVNA 2R5WA 3E2IA 2X3UA 4N9QA 2IP4A 2B4AA 4N5DA 1T8TA 2O50A 3FZYA 3PEFA 3X1DA 2HCFA 4TLAA 4I9FA 2XIQA 1XD2A 2L19A 4UHDA 1I4DD 3FDZB 4Y6LA 4CXMA 3CB4A 3SVZA 4QOSA 1X8JA 4MI1A 3NH9A 1QZXA 5IWAB 2RB4A 1LDYA 3A6HA 2XCQA 3BA6A 4I36A 4PLGA 3G59A 2IUTA 5DTQA 3S28A 4WCFB 1Y3FE 1HORA 3VQTA 4CMIA 4DARA 4LV5B 1K0FA 1W1WA 1DC6A 3ZWCA 1JPUA 2ACKA 1A2BA 4A0SA 5J2UA 1UBUS 3O74A 4TLCA 2C00A 1WXHA 2VRWA 4ND2A 3UUEA 1HDYA 3KWMA 3LOQA 2OG2A 4B7AA 5K01A 2UVDA 1EFPA 1XA4A 3I61A 1SUFA 3TZCA 3WO1A 3AEUB 4OU4A 2PKRA 2RHMA 3U4IA 4DR7B 4RKEA 2H9AA 4WGFA 3TMYA 4RKRA 2PXCA 2PRKA 1PDOA 4S2EA 2PWPA 1A1SA 1SG9A 4IIYA 1PJCA 3USZA 1Q0RA 3MD0A 1TIBA 2ICAA 1RACA 3WB9A 1I4EB 3RT1A 2P1RA 3OQ6A 1QO0D 4MIYA 3ZY4A 4KIGA 4JI3B 4GYWA 5CCDA 2R6GA 1RXWA 1QKKA 2IXBA 1ZS9A 1O0BA 5J5CA 1C9MA 4LOJA 3CF4A 5EQJB 4AJOA 1XEWX 2Z57A 4H77A 2PLRA 5EWMA 5JXWA 3LLSA 4C6HA 4IFIA 4CM3A 1GCUA 1NYTA 1OXUA 1UOQA 3DOCA 3EDOA 4C22A 4EA7A 4DA0A 4WKPA 1BEUB 5I6DA 2GCPA 3K2BA 3NAZA 3C3AA 2ZTLA 5HILA 1QX4A 5EJ4A 3U49A 4RD3A 2BUCA 4F72A 3SKXA 2PCLA 3KZCA 4PXYA 4W9NA 5LQUA 2EC5A 2VJQA 4ENUA 4KU4A 3UWMA 3C6YA 1C0EA 2NYUA 2H1IA 3GY0A 1E7WA 4IQ8A 4W6ZA 4DS3A 1N6IA 5T8KC 2XCUA 1H6AA 4FYWA 2CL5A 4Y2JA 3W5VA 1ODIA 2HC9A 5JNTA 3HVHA 5IMBA 3A7EA 4FB4A 3RJMA 3QPVA 2YXNA 4EHDA 2BF7A 4C14A 2QPTA 5ALLA 1WHSA 5CM8B 2BEVA 4MR7B 2FVXA 4WCFA 4X9XA 4YVFA 1DQZA 4RFVA 5J4YA 5JJBA 1NE2A 2VPWA 1A5SB 4HS4A 3B5JA 1FDVA 1Z2PX 3K32A 3FHCB 1VJ0A 2Q5EA 3ED5A 5DV9A 2VF7A 1N5IA 3KAPA 3QXXA 1JQ5A 4UMEA 2RI1A 5FXMA 2PBZA 1ODKA 3AEUA 3BGIA 1DHRA 2OV3A 4GPAA 3BERA 3ZLJA 4HN4B 3SJCA 3MSCA 3PR1A 5EAIA 4G4SP 5KSWB 1KI3A 3EJWA 4INOA 2HO5A 2VEOA 3DEJA 5E7IA 4BMDA 3DD1A 3RO7A 1EVIA 2G9ZA 3WDKA 5A0VA 3H04A 3LFTA 1KZ1A 4X61A 3WGYA 4CPDA 1AU9A 4UEWA 4YMTA 3PF9A 1J6UA 2A9PA 4UBMA 2RSLA 1FCJA 1IEWA 1YVDA 4Y0VA 3GT3A 4P31A 3VH2A 4GLBA 1ZK4A 3EEQA 4TV8B 1ECLA 4H6XA 1BDIA 3JAWB 1CF2O 5DU2A 5T41A 1MRSA 1L4EA 4JBGA 4PGFA 1T26A 1PGNA 4XSHA 2BEWB 1M6EX 1YBFA 1E5QA 1ZHFA 1ETHA 4JYZA 3RUPA 1UPTA 3NIDB 3P32A 4QBFA 4UTZA 4DHEA 1EB9A 1ZMRA 1NW4A 1QF6A 2F8SA 1U3FA 4XUGB 4YQFA 5JZBA 3A3YA 5FAXA 4A27A 3LTEA 2VPXA 3L7MA 4J1QA 3L02A 2AOUB 3TN7A 3JD0A 1M1XB 1CUBA 1FQKA 1G63A 1LBEA 2HU8A 1K2WA 4QXPA 2X2PA 3C1AA 5FLEX 3P94A 4OP2A 4CMGA 3MS2A 1NBIA 3LRTA 5BRJA 3HZZA 1UBNA 1H1TA 2VOJA 3CKYA 1HV8A 4V3CA 1A8IA 1TD9A 2B5OA 3ZE2B 5A6SB 1JDPA 1TQDA 2W2VA 3JR7A 4LJLA 3I04A 2WKPA 5HZKA 2PVCA 5KPJA 4PHTA 3BIJA 1XLTC 4RYDA 4MLCA 3TW6A 5GZ6A 2DLCX 1EDOA 2QN9A 4TSKA 4BZWA 3JYQA 4COOA 2Y4NA 5JJLA 5I01A 4UVHA 3UWOA 4HX5A 1KSFX 2C1EA 3ZHZA 5E8RA 1WVMA 2FJUA 3F5FA 1JFRA 1IZZA 1RD4A 3K2IA 3OLXA 4JZKA 3M6AA 4RIIA 2H5LA 4RF2A 3T3NA 2P91A 3DLHA 4A26A 3ZE7A 1O54A 2E82A 4IV5A 4U8HA 8ADHA 2UZAA 1V45E 1P2FA 4UTNA 1KJ8A 4KWIA 2GBCA 1T3LA 3PSAA 1YZKA 3VKWA 1C0IA 3E2MA 3ZK8A 1FFCA 1U2DC 1U9IC 3SR4A 2ZM5A 2C2BA 2P9EA 1EFTA 1R0KA 4Y9SA 1N6RA 3B6KA 4D9HA 3JAWA 4E1AA 3L6UA 4ALIA 3HB5X 3OJFA 3G13A 3GAMA 3L4BC 4MWGA 2VPTA 3IQXA 4WZAE 1SRQA 2OVBA 4B2YA 1ABBA 1BS2A 3PWKA 1SHUX 1ULBA 1BDBA 4I4IA 2ZBRA 3L40A 4Y2YA 3BSFA 3OC6A 3AXSA 4FX2A 2XWQA 2VP9A 2HHJA 1TUBB 1Q21A 4WY2A 2BGRA 2VQFB 1ZD9A 4HDNA 1S2NA 1N75A 3B1XA 4F6RB 2PUTA 2C4KA 3Q7PA 2AOUA 3C5HA 3KLNA 4GKJB 1KMNA 1RWKA 1IWBB 4OATA 1ZRNA 4G0NA 3UUFA 1ZXBA 3JQBC 3BJIC 4DUZB 4O2LA 5KTRA 1BIFA 2XF8A 4LFBB 3TPCA 1O3YA 2W37A 2SECE 1LQ2A 1EP1B 3M5WA 1VLJA 2CNLA 4EW3A 3ZDAA 9MHTA 3L1HA 3UPTA 1GP2A 3BWMA 4F8EA 2DCMA 3I5AA 3PFNA 4NMHA 5A6SA 1Q1EA 4AQ7A 1LK7A 4DV4B 3OIVA 4EG1A 1X1RA 1OWOA 2OZEA 3BFPA 3E3NA 4QQKA 5JS2A 3RWBA 9LDBA 4RIEA 4HNAA 1XXHA 4B75A 4W1SA 3AUUA 3O75A 4HUQB 1E4VA 1V41E 3GRAA 3OZXA 2FR8C 1PBNA 2C59A 3QFFA 3NM4A 4JYPA 3GGJA 1NPDA 4KK4A 2FFJA 3OX3A 1MA0A 3NQ41 4DSUA 5ALGA 4UEQA 4HXEB 1XIVA 4ND6A 2D4HA 3NBXX 5E1BA 1YQ9A 4UUNA 2HYDA 2CWDA 2PT6A 3BJMA 1JT9A 1NMZA 3G8CA 4HNHA 4L95C 3G7NA 2E55A 2I2BA 1RM5A 1VTKA 4JT8A 2I2FA 1AKYA 1N8TA 2VHEA 4HSGA 4IWXA 4ER7A 5JFOA 4B47A 2ZAYA 4IIJB 3C39A 2IWRA 2ZJ3A 3IEUA 4PBTA 2XUIA 1U80A 2AN9A 2BMWA 5JPIA 1LBSA 3T8YA 4EFNA 1ADGA 4IGIA 4MLDA 2AFHB 2ZFUA 3QOXA 3CUUA 2X6QA 2B5VA 1Z0IA 3F9CA 1COWD 3T5DA 4ZIRB 4AP6A 1FRFS 4FFLA 4IIVA 2CHGA 2AZMA 3EIXA 3IR6A 3DWEX 1ISPA 1SXQA 2DBVO 2C3OA 4D9NA 1TUBA 2GMWA 1VJRA 3JU3A 4NF2A 3JQCA 2W2XA 4LJKA 1WPGA 3KB2A 2CF6A 1XELA 5F4ZA 1U98A 1IRXA 3ZWXA 1C4XA 4FKBA 3FOBA 5DLPA 3EPHA 2ORED 4TKZA 1UT6A 5HM8A 1QZUA 4YASA 2GEFA 1I6LA 2MJLA 1FDWA 3GGDA 3MNFA 4JOCA 4EP1A 2XXAB 1EVQA 1USKA 2WTAA 1NR5A 4ZZ0A 2F17A 2C5BA 4LRSB 4FNAA 1DUVG 1K97A 4OHPA 3GCXA 3OMLA 4QJBA 3KDAA 3T4UA 3T9BA 3WR5A 2K4MA 4R7ZA 3RB8A 3M9XA 3ZCSA 5FI3A 1JPNA 1ZUIA 5HUQA 2WSYB 1E6MA 4LUCA 5DGIA 1M54A 2DOKA 2CLIB 3VKVA 1CJTC 3CXRA 4AIIA 2VDPB 2ZT8A 3ZZNA 4HUQA 3THYB 3HDQA 4HB0A 5DSXA 2O57A 3OQVA 3CS3A 2HA0A 3ENWA 4AJ4A 3IQHX 4ZJYA 1G6OA 4MKGA 3SX0A 2XYHA 4HGOA 1DKMA 1QO0A 4DMLA 4P53A 3Q7TA 4ZP1A 4R1TA 2VT3A 1GTVA 1POXA 2JVJA 3BK2A 4G5QA 4IFTA 1CJMA 1SD1A 2M1ZA 2P6UA 2YXLA 3HBJA 3I0NA 2PJUA 4N0MA 1OYVA 1UM9B 2R8PA 2PDAA 3FOWA 4ILEA 1HNZB 1P2TA 4MPTA 1E5LA 3OJOA 4IIJA 1JQAA 3KVVA 3FYCA 4CV0A 4Z4HA 2P78A 1RWPA 4GWKA 4LX0A 2J45A 1J2UA 3DMGA 5KNBD 5C3UA 4NZPA 4Q03A 3WGNA 1Z37A 3RS5A 4S04A 3G2QA 2AFHA 4E5PA 1P8JA 5CU7A 3D64A 3I3OA 1CSEE 3K8YA 3A4LA 4PZEA 4J4TA 4QUJA 2RG7A 3HEAA 4WESA 4ZRMA 2FGKA 1M8PA 1Z4NA 2J9FB 4ZIRA 3HA7A 1PFUA 3T5GA 3VSEA 2PMCA 4E07A 1FTYA 5E9AA 4ZI2A 3KB8A 2PRZA 1RLMA 3KZKA 1NC3A 4BP8A 2FEKA 2IC5A 4JB3A 1OXKB 1YI8A 3AFOA 4UM9D 1IOVA 2OV1A 2QL9A 3ZV6A 1MGOA 1TC1A 4WZBB 1CV2A 1NG9A 4GAEA 2AJBA 3QU9A 2BRUC 1A5AB 3WGJA 1X39A 2GN8A 3SEFA 4QUDA 3SSOA 1MBZA 1C8BA 2YV1A 4OFZA 2E18A 3O95A 4HAWA 3SOZA 3V1LA 3ZGLA 5DCYA 3ZN2A 4BVFA 2XXAA 3JQ8B 1LK5A 2OCLA 1M6VB 2XZDA 3MOGA 1YNSA 4R69A 1KJNA 1KR2A 4NBUA 4Q3NA 2BHSA 1XDZA 2EW8A 2NO1A 5HIIA 1TF2A 5LDHA 1YB7A 3UN1A 1ULSA 3AJ8A 3PHHA 3P8ZA 4O5AA 3VYVA 4ZOQI 1VZ2A 5A2GA 1G4AE 2AIRA 5AOAA 2UZ1B 3I9V1 3THYA 2CXOA 1GAJA 3A2LA 3NHRA 3QA9A 2G63A 1EP2B 1V8FA 3GJ4A 4XFKA 2ODQA 4UASA 5DWVA 5JW6A 4X00A 2A5GA 4JP8A 3TUIC 4UAJA 2X7HA 5HQTA 1RABA 4DJEC 1Z39A 3KOYA 1TLLA 4OKNA 2J0EA 2P40A 3BE6A 2EERA 2YYZA 4CMEC 4Y7DA 3GK3A 1U0LA 1PX2A 4IDBA 2IDKA 2PX6A 5IDVA 3SEQA 1Y8AA 5A03A 2XZOA 2OESA 4EPYA 4L9AA 3TI7A 2R86A 4UAVA 5EIHA 4NTZA 3ZXYA 3WISA 4ZZ1A 1IZ9A 2JFUA 1QHHB 2J85A 1DV1A 2LRHA 4Z2YA 2AJ8A 1C2TA 1G8FA 1FDOA 1KSHA 1MENA 1WUKS 3REQA 2VAMA 2AGVA 1X7YB 4TTIA 5FORA 1NF9A 5J63A 5JR3A 2IBSA 1ZVMA 5BW5A 5HQJA 2J9ZB 4FT4A 5FCDA 2XHZA 4CL8A 5DX0A 1FP4B 1JXQA 2XGSA 3IS3A 2Z09A 1FMCA 2QAJA 1N1EA 1WB4A 4FFWA 3U9LA 2H5JA 1L5SA 4BBAA 4WZBA 5KYNA 4B17A 1JRLA 5KWJA 3DZIA 5JNSA 3EZXA 2R00C 3V9AA 1YQGA 4IDNA 3CVOA 1E9DA 3C8MA 2JLQA 3MBOA 5F3RA 2WKSA 3NHFA 3MS4A 1L1EA 3BUSA 1Z82A 2BZGA 3JQ8A 3NFYA 3OPNA 4WNYA 1M6VA 1QHXA 2HZBA 4OH1A 1VB3A 2AQHA 2BFMA 4TSRA 4UC0A 1KYTA 3ZI0A 1IMJA 1B8UA 1ZMTA 2G7ZA 4BLPA 4I08A 4Y6GB 4EFLA 5AVVA 2IT1A 3OM9A 2ORYA 5HE8A 5CM9C 1S3GA 5K2MA 2FPXA 1X1QA 1PZEA 2QLNA 1W2WB 3H2BA 1TM3E 3O1JC 4LRUA 4O2AB 4WOPA 4XGRA 1XMOB 3G2IA 1B41A 3ZYZA 3VJKA 2UZ1A 4B2PA 3QLVC 5BNIA 1S2DA 3VU1A 1G41A 1KWKA 1H2YA 2BGTA 2EZ9A 2GPNA 4TWZA 4NMMA 3S8EA 3ORRA 2X4LA 4FIZA 4RQTA 3AU8A 1CF9A 4AY6A 3IXQA 4Z3OA 1HDOA 1Z68A 1F6DA 4RVHA 1V3QE 4ZYUA 4RVOA 3LI2A 4IW3B 4MLPA 3SS8A 4XVHA 3KPJA 4B0OA 4IUYA 1DFHA 3HVUA 3MXOA 4GBJA 3RCBA 3ZJVA 4YRQA 2ZB7A 3I01A 2Q3FA 3DR3A 1CHNA 1KO8A 4OV6B 4NJEA 4BIMA 1QS0B 3S1AB 1QHHA 2Z98A 3R09A 1JXMA 3JPYA 2XMZA 3SI7A 4FFVA 1LH0A 4BASA 1X74A 3PQDA 3WMFA 4F2WA 2OECA 4TTAA 4RV9A 3C85A 4I5DA 1X7YA 3FF1A 4OXQA 3SHOA 4JMLA 4URFA 4L73A 3RJ9A 1HLPA 4CKXA 4EBFA 5AVXA 1J39A 5AM2A 1ZXLA 3FFBA 1FP4A 4KUHA 1PJQA 2BBOA 4JB2A 1JW9B 3K70C 3UHFA 4A3SA 4IQ0A 1NOJA 2HPHA 2XMCA 1U2EA 3IH5A 4NE2A 2QGNA 3ZWYA 5CDYA 2RH4A 4A36A 1M76A 3U1TA 2FLVA 3AIOA 1ZMBA 1P74A 3EFEA 4MZXA 5G1PA 4Z1MD 5LL6P 4TZ0A 3K2QA 2IIPA 1P2GA 3CLKA 4BNGA 4RHFA 1R4ZA 4WKBA 5B7QA 1E3QA 3VNAA 2PNJA 3SYNA 1U28C 4XLZA 1J0XO 2F1OA 2YVQA 2P9QA 4PFJA 4URUR 3MINB 3DDWA 2OXIA 4CKWB 1JN0A 4C20A 1WZ2A 2YHSA 3K5IA 4KUGA 4O2AA 1IY0A 2IYQA 1EFCA 5SYMA 4HOYA 2Z8XA 1DJLA 2Y0DA 1IH8A 3MMZA 4TKLA 4RE6A 4M9RA 1RQXA 2FSVA 3LECA 3ES9A 4TM7A 2B30A 1R12A 3KOWA 2FF5A 4P3PA 5C7LO 4Y2SA 3GW8A 3MWKA 2POCA 3TTSA 2W4QA 3VVBA 2O3UA 5HTKA 4AROA 1RYBA 1RHQA 5EE5B 4P4SB 4NOMA 2WTBA 3L6OO 5CXUA 4A0GA 3EZ9A 1XZMA 4PYRA 4EPVA 3CKLA 1ZCBA 3ZNNA 1NUAA 2PA3A 4B3JA 2E49A 2L69A 2HU5A 1RJ9A 1CTQA 3N7TA 5F35A 5HFJA 1JKXA 2WHPA 4NYMR 1QS0A 4R0MA 2QN1A 3RS7A 1QCYA 2RC6A 1Y8CA 3MCVA 3NTOA 3DMTC 1Z47A 2YWFA 4FZ5A 5KKAA 3LTNC 4IGAA 3ORQA 1COWA 5GGXA 1L4LA 2IUEA 3D8NA 4X84A 3P20A 3WIBA 3M6LA 1NMYA 2GKOA 4N54A 2XZLA 2RONA 3WIDA 5B6PA 3ZW9A 3MUFA 4L7QA 1QORA 5ALHA 1L5GB 1PVDA 4UM9B 1J33A 2Q2WA 1GV1A 1FF9A 1W4ZA 2BM8A 3MG9A 2PXXA 3VMFA 4LISA 4LXHA 4LQ4A 1M8KA 4JJIA 1VE7A 3QE3A 4YIHA 1ZMOA 3CUKA 4OK6A 1JJIA 4ZJZA 3OPQA 3K20A 5I7WA 1RQPA 1K8ZB 2AWNA 4JJFA 4G67A 4BBPA 4GYKA 4ZREA 2XYQA 1P81A 1U8FO 5EJGA 5LLSA 2ZE6A 3CNHA 1JG4A 1YRHA 2YMMA 3ESQA 3OTGA 4GBGA 2FCAA 3VZRA 4E94A 4XUCA 1ITZA 3Q0IA 4RYLA 3MINA 3RHSA 1GLNA 1NW5A 2CB9A 3OPYI 4Z2AA 1YQUA 3LDHA 4IV0A 2VF4X 4EX6A 2X1MA 4BGDA 4V0MA 3GLHB 1UXIA 1VSQA 3BSSA 2G6BA 2C9CA 2OZKA 5F7XA 4YRTA 1X1AA 2ZITA 5EIOA 1CY0A 4G0OA 5D3MB 4Q47A 1VI5A 1OTHA 4C9BA 1J0DA 3PUVA 4GSKA 3PXXA 2BY4A 4HUJA 4FDLA 1RU3A 4V0NA 3U0VA 3OUTA 5JCPA 2EG5A 3A4NA 3GT0A 4FXPA 3WJ1A 4M37A 3LHDA 5LBUA 4P4SA 4WLEA 2EQBA 4DUGA 2FQYA 5D6OA 2I3GA 2D8AA 4DCSA 2ZJ5A 2NQ8A 1I2AA 2V7VA 4RK7A 2WRZA 3H05A 1SVMA 5E6SB 3KEQA 5KNBA 3PJFA 1E98A 3P96A 5ALFA 2WIAA 2AF3C 3L8FA 4WERA 5HJ7A 1T3SA 2Q8NA 2DWCA 1V95A 3LXRA 4I1YA 1PG5A 5KJEA 4D45A 3CBQA 2IZ7A 3K0CA 4UOEA 3IEKA 4RTRA 3AV0B 3KV3O 2EP5A 4FK8A 1RPNA 2C7GA 4MUFA 5BT9A 1CYDA 3FSRA 1KF0A 2Y6VA 5MN6A 2BMFA 5EEHA 1F0NA 3EGOA 2JEOA 3IPXA 4K81B 4FHCA 3VSBA 3HFGA 1HDRA 4DF3A 1L7AA 4MQBA 1BU5A 3HWSA 3JAMA 2V45A 1I36A 3Q3GE 2LXNA 5TGTA 3DBLB 3IMGA 4FZJA 4M98A 5DGDA 3IT3A 1JL3A 3RJZA 5C5IA 1O1YA 3HCDA 2HHAA 1XDWA 4K9NA 1C4KA 2Z4SA 2CMKA 1BE0A 2DGDA 4CR7A 4HMQA 1YRLA 1ZRSA 2JJMA 4LHZA 4MK4A 2HBRA 4CW7A 1U8EA 3GBSA 3GLHA 5AVJA 1B0AA 3Q3JB 2RK3A 3FUUA 4AS2A 1FLDA 2IS6A 1ZHOA 3ZGXA 1LD3A 1WMEA 1KEVA 1IPFA 1MRZA 1OU4A 3DDCA 2R7MA 5AKHA 5FA5A 2BD0A 4D42A 2ECFA 3WQSB 3IEXA 4Z7NB 4Y9RA 1YA6A 4YRMA 5ALXA 2I2XB 2I1VB 3GT7A 3H17A 3OP1A 1C50A 1AUVA 3P27A 1E3DA 1YMVA 3N5CA 1M2EA 4B6EA 1AT1A 1RXCA 2WYUA 3HFJA 2ONJA 1N2CA 1CW2B 4Q4DA 5DLEA 1R00A 4YRPA 4MUEA 1OFTA 1WDTA 1F8FA 3LFHA 5ITSA 4M1WA 2YBEA 3HO8A 3LT2A 5E6SA 4Y6OA 1YB1A 1RKVA 4AUNA 5FO1A 4KODA 2JD2A 5H70A 2GBLA 4GC9A 4OHOA 3L1IA 4QUEA 4Q39A 1D5CA 2WUDA 4RSGA 4UFPA 3NT5A 1SKAA 3V7WA 3KSMA 3RQIA 3NKFA 1GRQA 4DLKA 5LQDA 2OFOA 1N6KA 3RAPR 2CXQA 1SQ5A 2DUNA 2PR2A 4KOAA 4RJIA 4WEOA 1DIGA 1CQIB 2HMSA 4OHXA 4KR0A 2ONCA 4GWGA 4P80A 4WRRA 3CRRA 3F7OA 1G8MA 1N6HA 4RKFA 5LQSA 3L7LA 2GDJA 3MILA 4EL0A 4YP9A 4E1BA 4FEAA 4RV4A 2E2WA 2Z5GA 1KKLA 5KQPA 3E1GA 4KXQA 2HGSA 2WQ7A 4I1UA 1X7DA 1PT5A 1Q91A 3P0FA 4IEFB 1OTXA 4YAEA 4MDHA 3DBLA 5ALUA 3T9CA 1KIAA 5P21A 3EX7C 1G2QA 2IEZA 4KRYA 1PTKA 5IZCA 1TOAA 1PJZA 3UMCA 4BNIA 2QN3A 4GOOD 1ZM7A 4MPPA 5IVKA 2BAGA 3MCTA 1CJVC 1V6SA 4NDNE 3IOBA 2NZ2A 4WY8A 3ZLTA 1KEWA 4QA9A 3DG9A 5MGBA 1SC4A 1UKYA 1XZDA 4Q82A 3WGKA 4UQLA 4RY0A 1QU2A 2WJ6A 4LRTB 1AS3A 1A2KC 5JC1A 1C3XA 1AIPA 5HNKA 3FCEA 2ZUSA 3KXLA 2OORA 2QSUA 2QUHA 4NAUA 4CFZA 2JGIA 2VP2A 2W00A 4FYJA 2FB9A 4ZI3A 5G02A 4DBVO 5BN5B 1IY2A 2I2DA 3H5WA 5BSVA 3NC4A 1X80B 3HKDB 2YZ2A 2I4MA 3UB3A 1PEDA 5KQMA 5KTTA 1BVHA 3LPDA 2O2JA 5HGXA 1B7GO 1UFVA 2O8BB 3EIHA 1J7KA 2QG6A 5F51A 3CVUA 1IHYA 3AHEA 3TVYA 2X8WA 5J43A 1QHSA 1DWQA 1S9HA 2JLYA 2ZAIA 4RKYA 3OD5A 3TR0A 1H5QA 5E1DA 3KCQA 4GPD1 4ILKA 2WWVD 2X0EA 1OI2A 3TLJA 1DARA 2ZRNA 2OPHA 1JKJB 2WM9B 3GIWA 4RTLA 1NXVA 1JDTA 3P2EA 1QONA 4K88A 4ZYVA 3I6IA 3O0DA 1NOIA 3F96A 5G0UA 4D6PA 3QW2A 2FZKA 3STYA 4WAUA 1DBRA 1ULUA 3I73A 1THGA 4FUQA 2WT9A 2YVAA 4TTPA 4AMVA 5JLJA 2HJGA 1NE7A 4LPSA 4KKVA 1AKVA 1AGPA 1E9BA 2NTNA 3LDAA 3MS7A 3FH0A 3W7VA 3WZ2A 2H65A 2Y2UA 3L8HA 2F67A 5EQDA 1ESCA 2BJHA 3ZI4A 4ZDIA 1TAGA 2AFRA 2PX2A 3B53X 4Z1MA 2HADA 4DR4B 3KTOA 3OKPA 2FRDA 4FMCB 1F9AA 1Z33A 2ZLBA 3MWEA 3OX1A 3VA7A 1Z2CA 1YSCA 4RA6B 2C7QA 5BWMA 5E7QA 4BFVA 2IUUA 1VRVA 4L15A 4C6RA 1U2GC 4OFXA 2D6FA 2HQSA 4YDRA 2BC9A 5JLAA 3VDRA 3H7AA 5EZ6B 4D6XA 3MWLA 1QUFA 3I9LA 3FLEA 3PT5A 4DDKA 3R5TA 5DNEA 1LDBA 1CS0B 2VUIB 3HYRA 4H1TA 3TKLA 1U0HC 2HBZA 1I9GA 3LDUA 4P0TA 3W5DA 1NR7A 3FSEA 2X23A 1WQ4A 6Q21A 1Y5NA 5AK0A 5LA6F 4D44A 3L05A 1XVIA 1XXLA 1KJJA 1T9HA 2CFOA 4OCZA 3TSZA 4EY5A 2Q0XA 5BN5A 5AW5A 1X80A 3HKDA 4DRYA 2QV7A 1PF7E 1ICEA 2IYUA 3L4EA 1G8GA 3NX4A 4LYAA 5GQSA 2CUTA 3LK6A 4LNHA 4QODA 1L7OA 3N3AC 3EGCA 2EKZA 2O8BA 2H1OA 2B7CA 1Z2OX 1HOXA 3EQ8A 1PUXA 2FW1A 2AI1A 3A2MA 2WJAA 4E5NA 4M46A 5A5DA 1Y34E 1DB3A 4YRCA 5FBQB 5ADUS 3K1YA 5KYXB 5IXYA 3LM8A 3L8DA 3P4UA 3SHFA 2WJJA 4E7OA 1BVRA 1CZOA 1HDZA 4H3KB 4Q7EA 4RHUA 1F2VA 3OD1A 1L7BA 4P08A 4UTOA 1JKJA 2ERCA 1YZFA 2QNRA 1RAIA 2G5TA 3FCOA 4PYIA 3HWX1 3R0IA 3RRZA 3CLUD 1PHPA 5A5FA 2IU4A 4G5HA 3WADA 1I3CA 1IG3A 3HH8A 1XLWA 5IDWA 1YRAA 1TJ3A 4BX9A 3HKEA 5IBCA 1HO3A 1PTJC 1XZFA 4DLYA 1RADA 4KQ1A 5EUQB 4TPKA 1OBVA 4NDAA 1TKRA 2Q3JA 4FOSA 4RVNA 3QTTA 4N48A 2W48A 1V16A 1A8SA 1ZZEA 3GEMA 4RGVA 1QANA 4FW8A 4RA6A 5CVEA 3Q11A 2JBAB 1UJCA 2Q9BA 2FTKE 1N0VC 1KKUA 1LJ8A 2JK1A 3DTYA 4MS4A 3P7MA 4GZMA 5AVQA 5JNLA 3AG5A 3L7JA 4C30A 5JZOA 4G0UA 1VSVA 1PZHA 3QZUA 4CKBB 1CS0A 2VRCD 3M6XA 4CG2A 4D5GA 4Y98A 4EQZA 1VE6A 2P9YA 1NVEA 4PC1A 2JGAA 3L7NA 1P61B 1LLCA 1FS6A 4M7OA 3ZZUA 4E5SA 3GLKA 5EQTA 1HDGO 1RLIA 1WCYA 1JIQA 4CF4A 4D7AA 4HEJA 2VHVA 3H2YA 2KM1A 2QYHA 4L8VA 3ODPA 2XJ4A 1GPH1 2CJPA 2CLMB 1E18A 3OKFA 4MKXA 2BGMA 1SXJE 2GXQA 4TWJA 3MQFA 2GZSA 1U8YA 3K72B 3AF4A 4QASA 5B58C 4OXXA 1KP2A 4FZRA 1WVIA 1R3DA 2CGEA 3DVSX 1M2HA 3CCCA 4MHSA 5FOQA 1NC1A 1M1NB 4OXRA 5JYCA 4IIGA 2WJGA 4C7BA 4MRSA 2C54A 1B0ZA 2OLKA 4MKRA 5EUBA 3AVUA 2AMVA 2VTDA 3ZNQA 2VYQA 4G1EB 2NPOA 1HETA 2CLDX 2EFYA 1ZNXA 2XB4A 2Y0CA 3CEJA 3MT9A 4ZYZA 3GPDG 4JSYA 2GJAA 3HY6A 4JC0A 4XM2A 3W2IA 4F9TA 4P32A 3RDPA 3UGJA 1J23A 2CDNA 2DP4E 3I2HA 4B48A 4BATA 1WB9A 1JG6A 3U5ZB 2C2ZA 3WRYA 1YXMA 3E70C 1VIYA 3H9EO 4ZQBA 3RT7A 4AUKA 2WP8J 4KBYA 1FFDA 3PYLA 1N1MA 1WTAA 3P9SA 2YZMA 4DMGA 4ENRA 3G68A 2YNMC 3QVMA 3R4CA 2D74A 2JBAA 1U7UA 2W8BB 3IUMA 3NUQA 2PUWA 2HSWA 4P4NA 5HP4A 5HWSA 2JKYA 4FLEA 1QE0A 3HJNA 1Y98A 3GF4A 3HB1A 3C6BA 3RU3A 1W35A 5IVIA 121PA 2A78A 3UO8B 4CKBA 3GMTA 3PCRB 2GJSA 3F6EX 4FP9A 4GF5A 5E95A 4K6FA 4X1KA 1J06A 1Z6QA 2G5PA 4Y6PA 1MVNA 1RYZA 2F48A 1M7BA 2WFLB 4NYIQ 2WSSD 4Y2RA 1U3WA 3LWDA 2JLWA 4WOKA 3WKDA 3HJCA 4RLSA 2R44A 3D4IA 3KNZA 3D6UA 4PO3X 4QEZA 5GIOE 4BX3A 1EA7A 5LZ4A 5EMNA 3ZHOA 3WIUA 4ZK6A 1NRWA 1KPGA 3M3HA 4GNKA 4NE9A 2HMUA 2IHBA 2Y9MB 5J2UF 5B1YA 2CEKA 4BNLA 1O89A 4WUVA 4BNVA 2CCKA 2RHOA 3AK4A 2WWXA 1G8SA 1M1NA 1XQVA 1P9OA 2WIJA 2D59A 1QMPA 1QV9A 2I4RA 3GL9A 3LY8A 4CKZA 3FB1A 2JCXA 2FX2A 3LT5A 1A76A 1F3OA 4MZDA 5FWYA 4XWWA 1BKDR 4GE0A 1YI0A 3BIWA 2VS1A 3AIIA 4Y67A 4V0KA 4IUDS 3WOVA 3ZHTA 5A3QA 1HNXB 4WBXC 4K9QA 4WLVA 1BQ3A 2DWPA 3WLEA 3ZKAA 1P1JA 3WLTA 1EX6A 1AD2A 2Q5CA 1TJ5A 3PJRA 3BWDD 1VBNA 4AI6A 2GCNA 5ERYA 1SHJA 2BL4A 3EDCA 1ZM4A 3IP8A 1ECGA 1DPGA 2JAQA 4LI0A 3H6GA 5EIEA 1BYIA 2AL7A 1UOPA 5JASA 4Z4FA 1F38A 1NN3A 2DQYA 3R2JA 2W8BA 1L6IA 2G4LA 3HU5A 3IAS1 3N2YA 4ZO7A 3LC1O 3WX0A 1V8BA 5A3SA 3W6PA 1P7ZA 2CUZA 4AQDA 4YDQA 4G0QA 1QRRA 2NZXA 3NJRA 1P5JA 3ZWPA 5TLSA 4OI0A 2VQSA 1A2QA 4Y1GA 3C45A 2HV8A 1E8MA 1S6YA 4QX6A 1MX5A 1J1UA 1Y3IA 2ZSAA 3IUPA 1X7HA 4ALMA 2A1TR 4A2WA 3MT7A 4QDJA 4DY6A 1YL7A 3N2LA 1X94A 2FK8A 2Y0EA 3LLVA 1MDBA 4DYHA 2HCBA 4R4JA 3A10A 5FH9A 3PE4A 4NL4H 2C29D 3IT0A 4YP1A 2WFLA 3EWAA 5JZ9A 1EQAA 1JG2A 1P5FA 2GEVA 2HJRA 3A9WA 3EGVA 4HWSA 3PTAA 1X0VA 1XZLA 2C2KA 3OY2A 3UFBA 4U7PB 4E32A 2XZTA 3PC4A 1GTL1 4LDJA 4B5KA 5KNDH 3WQQA 2WWWA 5FEMA 4M38A 1OILA 4PCUA 3QPDA 4TZKA 3B51X 3TIIA 1A3CA 2IV7A 4CTMA 1SVKA 1XCLA 1N4AA 4X64B 5BMVB 2QU8A 1Y1TA 2HXYA 4YWJA 3ZVRA 3QPCA 4F21A 5BOSB 2JFHA 3A4MA 4UM7A 5BV1A 2ZI7A 1ISRA 3ZY3A 1NGSA 2C83A 1GVHA 2UZ0A 1EQUA 3TG8A 2FOLA 2IUYA 4MB0A 1IM2A 1G8PA 1GCGA 2NT3A 4HGNA 3GPBA 3ZHXA 4F1WA 2V7TA 2CFIA 4OQXA 2B1JA 2J5XA 3QKTA 1G21E 1NI4B 2J0UB 2XT6A 4L0CA 1D07A 1NDHA 3OQPA 1LRJA 3HDYA 3RAJA 4CYMA 4D5EA 3KZXA 2WZQA 3ICEA 1H2FA 4PRYA 4KHPB 3TBHA 4MP8A 1SA0A 3GU3A 2HHHB 4XRGA 5T4BA 3OEED 2I6UA 5H16A 1FVXA 2V55B 3CLVA 1N8KA 4MWTA 5IBRA 2CC2A 1Z0DA 4AKSA 1U5AA 2Q5HA 3B89A 4JODA 3WIEA 3QG1A 2G5GX 4HVAA 2VH2A 3TSCA 5AK5A 3I92A 2LIPA 4OH7A 1IU9A 5ALKA 4TL8A 1I4TD 1XMVA 5EHNA 4NG5A 1AXRA 4HBZA 3VJMA 4WDRA 4BWGA 1XEXB 1Y48E 3LHFA 1ZH8A 3QKSB 3UJ6A 1L5RA 1EK2A 1JJ7A 3IR5A 2XMDA 3GFFA 5DCLA 5B3JA 1GGHA 2QZPA 4YMGA 4QJIA 4QQRA 4RDIA 4C2BA 2F8LA 4IOKA 2MSKA 3EZ2A 5AW2A 3D3JA 3W8RA 4CLEA 4GMKA 2TMDA 2OBMA 4NDZA 4BQRA 4XVCA 1HNWB 2W2KA 1Q12A 2P65A