4YGXB

Crystal structure of d. melanogaster ssu72+symplekin bound to cis peptidomimetic ctd phospho-ser5 peptide
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
192
structure length
190
Chain Sequence
PSKLAVAVVDSSNMNRSMEAHNFLAKKGFNVRSYGTGERVKLPAFDKPNVYEFGTKYEDIYRDLESKDKEFYTQNGLLHMLDRNRRIKKCPERFQDTKEQFDIIVTVEERVYDLVVMHMESMESVDNRPVHVLNVDVVNNAEDALMGAFVITDMINMMAKSTDLDNDIDELIQEFEERRKRVILHSVLFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chemical Tools To Decipher Regulation of Phosphatases by Proline Isomerization on Eukaryotic RNA Polymerase II.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
molecule keywords Symplekin
total genus 69
structure length 190
sequence length 192
chains with identical sequence D
ec nomenclature ec 3.1.3.-:
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04722 Ssu72 Ssu72-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ygxB01
4YRZA 4MQEB 4KFCA 4LE2A 5ABPA 2R48A 1NTRA 3CKMA 3QEMA 5GOTA 4MQFB 2L2QA 3CFYA 2O20A 1H9CA 1NXTA 3IPCA 1GLGA 1JDNA 1EWKA 1YK1A 3IP5A 2FEKA 1APBA 3ROFA 3LUKA 3CHYA 3LMKA 4ML3A 1JWLA 4NCBA 4F3TA 3K4HA 1BAPA 5DLEA 5JNRA 4RY8A 2PUDA 2MSKA 3O21A 3F7NA 3BRQA 4YO7A 1S8NA 4RK6A 4RDCA 4JA2A 2FLKA 2PL1A 4F12A 3LUFA 1PNTA 4EY3A 1DCFA 3GRCA 4MS1B 3OM1A 3RVQA 1WETA 2Q5CA 4HNQA 2XDYA 4W5QA 2L18A 3LKBA 1ZN2A 1NXSA 2FMIA 2FMHA 3H5WA 4RWEA 2WY2D 3F73A 1VRVA 3BBLA 1GCAA 3MA0A 4N76A 1GUDA 5TPZD 4WUTA 3H5LA 1C4WA 2QVGA 2VUHB 3C3MA 1FQWA 1PEYA 5EWMB 1E6LA 4DQDA 1E6MA 4TLLB 1SRRA 3D02A 5JNSA 2FMKA 5IUKC 5TE9A 2W42A 5B3JA 1YMVA 1TVMA 2ZWMA 3DGEC 1MIHA 4MAAA 2R25B 4E7OA 1TLFA 1NATA 4JP1A 4G97A 1IIBA 1YS6A 2H3HA 3A0UA 4QPJC 4Y9TA 2PLNA 3QK7A 1EAYA 1P2FA 3ROTA 2PUAA 3GT7A 2WWVD 1VKRA 3EGCA 1P6QA 3I45A 1C0EA 1U2PA 3JPYA 4N03A 1ISRA 2M98A 1GUBA 5FWYA 5IUNC 2LIVA 5I4CA 4PICA 1QNLA 4KV7A 2ID7A 5CNIA 1YVUA 4D74A 3TX6A 1DRKA 3SQNA 5TQ2B 1TM2A 4ZMSA 1JFVA 2E4VA 3KS9A 2A9OA 2CD7A 3OLVA 2PUGA 1NXOA 3LUCA 4N0QA 5BR1A 3N8IA 3QEKA 2WRZA 1DZ3A 3T8YA 5GQSA 5FWXB 4W5OA 2JRLA 4HYEA 1RZRA 3T6KA 1QP4A 5EWMA 1L5ZA 4OBBA 4LRQA 2B4AA 5B3JC 2QV0A 1FFGA 1YMUA 3CLKA 4F8JA 5JNUA 1OXKB 3O1HB 3HM9A 5EWLA 5HSGA 1BDJA 1DCKA 1VLZA 5DCLA 1JH9A 1JDPA 1L5YA 3QX9A 5BQ3A 2WB4A 2IPAB 3LUJA 3KG2A 2IKSA 1QO0A 5TQ0A 1LK0A 1KRXA 2WJAA 3FGZA 1USGA 2FXIA 4NV3A 5JS1A 3I42A 3URMA 3OQOA 4Z9BA 4MQEA 4EVRA 2FKAA 4XLTA 1JLKA 1A0OA 3RVLA 3GA5A 3O2JA 5BRAA 3OMXA 4RZSA 3TMYA 3MMNA 4WXMA 3T38A 4OATA 2F8TA 3E61A 1ZITA 2NT4A 3FFWA 5KI6A 2L17A 3QX8A 4MS4B 2JVJA 2ZAYA 4FE7A 2E4XA 2IPLA 4E7PA 4PZ0A 5TQ0B 2MSWA 3SM9A 4F06A 3HS3A 3CU5A 5IEBA 1DBPA 2QSJA 3HZHA 1BA2A 1CEYA 3MM4A 3JVDA 4EYKA 4Q7EA 4OTZA 4P1ZA 3K9CA 2FEPA 4WZZA 3KLNA 4Z99A 3QELB 3HVRA 3CNBA 1U8TA 4OG2A 4RK7A 1RXIA 2RJOA 3KLOA 1D1QA 4ETMA 1ZVVA 5JS2A 5IC5A 1LJLA 4P98A 5FBKA 3EQZA 4KZKA 8ABPA 2P9HA 3CRNA 1U04A 2ID9A 3QLUC 4GNRA 4MLDA 5TPZA 5IX8A 5FWYB 1T34A 1NY5A 2YHAA 4N47A 2OENG 4N41A 1ZH2A 4RXTA 1BVHA 2KYRA 3F6CA 4IGAA 4RXMA 5DTEA 2A9PA 2RDMA 3QLVA 2JVIA 4NCAA 3O74A 4LX8A 5EWJB 1PEAA 4XXHA 4ETNA 5C5CA 1M2FA 4ZPJA 3RVJA 3CZCA 4IMIB 1MB3A 4TN5A 2GWRA 2JK1A 5TQ2A 4UHJA 5JNVA 4Z4FA 4MGEA 1QQAA 1JYEA 4Z4CA 4RK4A 1NXPA 2QZJA 3FFTA 4G0PA 4MRMB 1FFSA 4IMJB 4W5TA 1PUXA 1LBIA 1TMYA 4S05A 3Q15C 1A04A 2WMYA 1BDHA 2PAFA 3HEBA 4D6YA 1JX6A 4D6XA 2FEWB 1MVOA 5TPWB 2JBAA 3GV0A 3JTEA 1CYEA 2FSPA 2HPHA 4IILA 3SAJA 1VPWA 2TMYA 3GBVA 4YV7A 1QMPA 3EQ2A 4YP9A 1Z12A 4UHKA 3LUAA 1M5UA 1P6UA 4FB4A 4Z4HA 4XFKA 4JB0A 5D2CA 3Q7RA 2VK2A 4M88A 4ETIA 4L85A 3H5OA 4EYGA 1Z2EA 3OQMA 3KYIB 3O1IC 1F51E 4MS3B 2PUCA 3HJFA 3DGFC 4RKQA 3LFTA 3QEMB 3N75A 1K68A 2FQWA 3M6MD 2B1JA 4EGSA 4CBVA 1QKKA 1RNLA 4WXEA 4G0MA 4NICA 5TPWA 1TJYA 5IBQA 5PNTA 3LOPA 4MR7A 1ZHHA 1FSPA 4LZLA 4IF4A 1KGSA 1D4ZA 3T95A 4GPAA 4MLCA 1JFTA 4PYRA 1J56A 3L49A 2AYXA 3H6HA 5T3YA 2PL9A 3RH0A 4KPYA 1JL3A 3GWGA 2X7XA 4WT7A 3HUTA 2CWDA 2FN8A 2VUIB 2E4UA 4MS1A 1QP7A 3KTOA 2IOYA 5F64A 3JVIA 5BRJA 4DADA 1LBHA 4RS3A 3M9WA 4Z4EA 4XASA 5DKFA 5ED4A 2J48A 4HNSA 3OLZA 4B09A 2QVCA 2L19A 2IPMA 2LP4Y 3E3MA 4QYWA 3SY8A 6CHYA 3HUUA 1NXXA 2NT3A 2IYNA 2MYNA 3NNDA 3HCWA 3S99A 2GI4A 4RY0A 1URPA 1NXWA 1XHEA 4O1HA 5JNTA 4KNYA 2QXYA 5FBHA 4RU1A 3LUHA 4KMRA 4KVFA 2GKGA 4H60A 4TLMB 1QO0D 3GL9A 3UK0A 1SXHA 2PJUA 4G0XA 4RKRA 3IDOA 2F8SA 4G0YA 5EWJA 4H3KB 3ILYA 3KSMA 3CS3A 4MR8B 4MPTA 4RXUA 3LTEA 1EHCA 3BILA 3MIZA 4EVQA 3O2SB 3KJXA 4F11A 3DZDA 4JAVC 1YK0A 2FQYA 3BREA 5CNKA 2GX6A 3W9SA 4EYOA 1QQBA 4Q6BA 4OLAA 1DG9A 5JNWA 3MYYA 1RPJA 3C3KA 2HQOA 3CZ5A 5KWSA 1QPZA 2RJNA 3H6GA 4TMYA 5KQLA 3EDCA 3HDVA 5DGCA 2FMFA 1DCMA 2V0NA 3O2QB 3VNAA 2PUFA 1RXEA 5EWLB 3N6VA 3HK2A 4RK1A 4W5NA 2JB9A 2LUOA 4LDZA 2YHBA 3FMVA 3RVMA 5HM6A 4W5RA 3I09A 1OXBB 1E6KA 2AYZA 3HV2A 4LE1A 5IULC 5T7BA 4OLBA 1W25A 1ZGGA 1QP0A 3RVKA 3SNKA 1Z15A 1Z18A 1Z25A 2FTKE 4KREA 2FLWA 4RK0A 2QW1A 1MAVA 3H1FA 2HJ9A 1M5TA 1BDIA 4S04A 3OM0A 2OQRA 3H5IA 4Z4IA 3Q7TA 4YCSA 2FN9A 2LPMA 1ABEA 3RVRA 3TO5A 2NZUG 2H0AA 3CTPA 1HEYA 3EAFA 4FE4A 3EULA 4KQCA 1ZY2A 3HSYA 4G0ZA 1Z13A 3EODA 3O1JC 1FFWA 2JCGA 4YS6A 1E2BA 4ZYLA 3QLTA 3N0RA 1DC7A 3IPAA 3RQIA 3TB6A 3C6QA 1JHZA 4JASB 3Q7SA 3C97A 3OO0A 2PMCA 2NUBA 3G85A 3HDGA 4JB2A 3QLUA 2FW0A 4RV5A 1EWVA 3JS5A 3R0JA 5TQJA 1SXGA 4XAQA 3B2NA 4MS3A 4DN6A 3KHTA 1PHRA 3OMWA 1AB6A 2PKXA 4MR9A 4YLEA 1NXVA 2MYPA 9ABPA 1DP4A 3N53A 3RVSA 4Z9AA 3FDFA 6ABPA 3H5TA 1ZGZA 5CNMA 4WWHA 2A9QA 4L4UA 2PUBA 3JY6A 4O5AA 2N9UA 5KQGA 1Z2DA 5HKOA 1U2QA 4EUKA 3Q9SA 4G0OA 2FVYA 4XARA 4G0QA 3OLWA 3IP7A 3DLHA 4EVSA 1ZESA 5IUJC 3CG0A 3HXMA 1ISSA 3JPWA 1PNRA 3A0RB 2JVKA 2QU7A 2MYUA 1U0SY 3IP6A 2GBPA 1K66A 1SD5A 3N0XA 4MRMA 4MR9B 2I6FA 2MYTA 1SXIA 4Q6WA 2HQRA 3OO1A 4RY9A 4YWHA 1KMIY 4Z0NA 1ZAYA 3OLXA 1YIOA 2E4ZA 3FFXA 3DLBA 3IP9A 2QR3A 4MS4A 4KK4A 3RVNA 4QYMA 1JFSA 1GCGA 3A10A 2NZVG 3LUGA 1USIA 2FQXA 1DBQA 1RZRD 1D1PA 3UKJA 4H3HB 2R4QA 1UDRA 4N0PA 1DRJA 3KCNA 4PEVA 3G1WA 3ILHA 4ZMRA 1D2AA 1XHFA 3NBMA 2E4YA 3BRSA 1A2OA 3CG4A 3KKEA 3O75A 1P8AA 3H1GA 2BGGA 4RSMA 1M2EA 7ABPA 3NHMA 3M9XA 3OLYA 3I5AA 3UUGA 1Y1LA 4HNRA 1Z17A 3NHZA 3N0WA 4KRFA 2HQBA 3A3KA 4IRXA 1D5WA 3QELA 5IEJA 1JBEA 4LDAA 4PE5B 2R47A 3NNNA 2RGYA 3Q41A 2VYCA 3GYBA 5FWXA 3RVOA 2E4WA 1R8JA 4LE0A 1ZH4A 1Z26A 4MR7B 3NNSA 4Z4GA 2MSLA 2CHEA 1Z16A 1DJMA 3LKVA 2DRIA 4RK5A 1F4VA 5E3JA 4MYRA 4KQ9A 3VNBA 1DC8A 4YGXB 1JYFA 3H75A 5CHYA 5KC9A 3MF4A 4EYQA 3SG0A 1EWTA 1ZDMA 3C3WA 5KC8A 2PE5A 3D8UA 4G86A 3EJWA 1DBWA 2M1ZA 3DBIA 3KYJB 3HO1A 2HSGA 5KQPA 1AB5A 3F6PA 3QLVC 4O1IA 2IDMA 2IPNA 1KRWA 1YTUA 5KQMA 2LBPA 1EFAA 2PUEA 4KK3A 2P4UA 4MQFA 2CHFA 2JBAB 4ZJPA 1XWWA 1W9HA 4NQRA 1USKA 5C5EA 5CNJA 1YS7A 3H5VA 3L6UA 1MB0A 4QICA 3OQNA 3LUDA 1CHNA 2A9RA 3H1EA 3MQ4A 3P9YA 3RVPA 1LJUA 4MR8A 4YR7A 1JF8A 1B00A 3TD9A 3GBPA 2WJWA 1I3CA 1ABFA 5HQJA 4JOQA
chains in the Genus database with same CATH superfamily
3W06A 1Z62A 4OB6A 2JFQA 3INYA 1GFIA 2MSDB 4KXQA 4L7QA 2FZCA 3QWAA 5DXFA 3DSRA 1IOVA 4EPWA 3ILXA 4URXR 2GTPA 1O6BA 2VQ3A 1DEHA 1K5GA 3BD9A 1J2EA 4PAOA 1GTL1 4BUJA 3LV8A 1RXWA 1SFRA 1YK1A 1JG7A 4CF7A 3TTYA 1KYWA 3ROFA 1HRKA 2COUA 2UZ1A 5BNTA 2V59A 3ZU5A 2A0YA 3VTZA 2Z4RA 4RZIA 2JS7A 4DMGA 1EDOA 4QU9A 2NTEA 3F0TA 1I2MA 4EIWA 1JRLA 3FKQA 4U7TB 1LRLA 2RSLA 3TBKA 1XMOB 2JPDA 1R4ZA 2FHSA 2QLNA 2CN1A 1UFKA 3VGPA 5H02A 1DCFA 1JECA 3HXPA 3WLQA 3UKDA 2G71A 2NSYA 3OD1A 1PFGA 3FPBA 4U3JA 1ES9A 4W5QA 4FT4A 3GWZA 1Z5OA 3B7GA 2X8BA 3DWFA 4PC3A 3RGGA 1JEYA 2QP3A 3CLTC 5CT8A 1XRPA 3WWYA 4M1SA 3SFTA 4BQEA 4E2ZA 4ZEMA 1L5HB 3DO6A 3HCBA 4OQDA 4PTZA 5DEOA 5K3FA 1X77A 1PL7A 1YQWA 3UQYS 4AY5A 4DQDA 4P6VF 4ZI7F 2W83A 1U8YA 4CL0A 1I0IA 2ZUDA 1VZ2A 4XA8A 1U7OA 1L5LA 1XZLA 3E1SA 3LY7A 1T2UA 4F2HA 4LZPA 3NHLA 1IRXA 3NCTA 1L7OA 4XX1A 4QYIB 3AM5A 4FXOA 1B74A 1NP7A 2AMJA 2PA0A 1GQ2A 2B34A 2MOKA 2Z2JA 3JU3A 3M0EA 3SXUA 1GNPA 1N8NA 1WOMA 5PGMA 1J1IA 1ZX1A 3WB0A 3AIIA 3F6RA 3DMNA 3HUFA 4P82A 3JQAB 3VH4A 2OM2A 2QTVB 1U0BB 2EF1A 2A59A 3TOSA 1JPVA 3KJGA 3A6JA 3OD5A 4ZDJA 5I7FA 3I9V6 4ZPXA 3T54A 1M10A 1MVLA 1QNLA 3MJTA 3S2SA 6REQA 2OLKA 1D2GA 1W85B 2VQSA 4AQDA 1JNXX 4BB6A 1KFEB 5BSMA 3IV7A 4CQMD 5K9ZA 5A5GA 4IHQA 4O2BF 2CJWB 1DHRA 2F1IA 3T5CA 4N3AA 1ECGA 2M2IA 3JD4A 4ONEA 2C2OA 5LMNB 1V8OA 1SKAA 2CFTA 4CWAA 4X94A 1N4DA 3QU7A 1OAAA 4L4XA 4LC1A 5FUVA 3UFXA 4D80A 1XRLA 2BRUA 3VUEA 3WGVA 1KR2A 2OG1A 4M4SA 4MWBA 3K72B 4YRGA 5KTRA 1R0KA 2ORVA 1ETUA 3D6HA 3FLEA 3A32A 4EW3A 4LRQA 2QV0A 3O4FA 3D8TA 5GGXA 5IM4A 1ZGHA 1MR3F 2OLJA 1VLZA 5DCLA 3W90A 1O57A 2IPAB 1P7VA 1MFPA 2CVOA 3TD2A 3V2HA 2BFMA 4LCEA 1Y1SA 4F3YA 3F5FA 5JS6A 5HFNA 4LF6B 3GJ3A 1QO9A 2JCVA 3QNUA 3IEVA 2FUG6 3A28A 1SZDA 2CNBA 5EJ9A 1U2RA 2OCDA 4LBZA 1U2GC 2V5VA 1ENOA 1Z4LA 1ZN8A 1MAUA 3STVA 2IKQA 4ABTA 4BX9A 5A7GA 3RS4A 2DUWA 3PL1A 4MROA 4DR3B 1RYZA 1A95A 2GM4A 3D5QA 2OUKA 5CPFA 3ZQJA 3K35A 1RM0A 1ULAA 2OESA 3GPIA 2HNBA 2QTNA 3KPJA 1FVXA 2HA3A 3KUDA 3N87A 2X0DA 1PNOA 4XZ3A 1NMQA 2QX8A 1U7PA 3G17A 5ALXA 3RJMA 5LVAA 4ZOCA 3RSSA 3QE9Y 1QS0B 3C16C 2B4QA 4OFZA 1GTRA 1W581 2GASA 3W5JA 2OZLB 2F9LA 2OAGA 1T3LA 3VC1A 4BE4A 2X2PA 4R8MA 2Q6LA 3IDSA 5FNVA 3KKNA 1XCOA 3FZGA 2PMDA 1K0FA 1U4NA 2VNHA 1IN7A 3NPMA 3OEEA 3P4UA 4K3VA 3RUAA 4NABA 1CIVA 1K08A 2BGWA 1CSEE 5EEGA 1JHMA 1TF5A 3KDPA 1WCWA 2Z30A 3KKQA 4FC6A 1KVUA 1Z7GA 2GJ4A 3I6IA 4CZ2A 2BYTA 1W8DA 1QTQA 4EJFA 3EDYA 2VS1A 1E1LA 1PFWA 3W3AA 4X1IB 5GONA 3R7AA 3AFNA 2Q1SA 4MLDA 4JJEA 2OENG 4OP2A 4P34A 4P4TA 1SQ5A 3EVEA 4UU7A 1SEPA 2PFGA 2ZU0C 1PV1A 4YONB 1O95C 3SFVA 4HLUC 2ZAGA 4NESA 3TIVA 1IQPA 2GPAA 4JLBA 2B8EA 1DDOA 2JZOA 5BV0A 2VKQA 3PFKA 5DFAA 1BCSA 1K3FA 4WY8A 5DTEA 2JVIA 2PBRA 3I28A 4AJ9A 4DRXB 2PBZA 1JP7A 5EKUA 4GRIA 3VC7A 1DRUA 1D9ZA 2JGKA 3WGLA 3CUYA 1NMSA 1N0WA 4A82A 1EQUA 3W79A 4O0MA 3CF6R 4LK2A 4L0CA 2PU7A 5DM70 10MHA 3AB3A 5BT8A 3CUSA 2VZEA 3DM9B 5ALIA 2KLBA 2ONZA 3V4OA 5DGXA 3MWJA 1QR6A 2FYTA 1P73A 5ALMA 1YO6A 5BWNA 1PJ3A 2GZAA 4PX3A 3TSWA 3GPLA 5ALZA 4HEA6 2AZ4A 4ZA2A 1EFPA 1PUXA 4E09A 1X94A 4ZWNA 4S05A 2A2ZA 3CA8A 4J4BA 1ONOA 3ZDDA 1R5BA 1JX6A 1SIWA 1ZJJA 3B6IA 4D6XA 2DF8A 1WD7A 4TMTA 4EJMA 2PTHA 1M72A 3SAJA 1X70A 3DVRX 5IAOA 1T1RA 4R1OA 4EJSB 3R3WA 5I7RA 1JXOA 5JCJD 1X6VA 3ORYA 2X0FA 3V1YA 2AJLI 2BAGA 3W5SA 1ZGBA 4REQB 4GO1A 3SNHA 4CL8A 3PWTA 2VK2A 3MBOA 5B1IA 4WN3A 5A5FA 1SKUA 1L3IA 3EOZA 4EB3A 5A06A 2IUEA 2WA2A 3FNIA 4LA4A 1DO2A 1SIOA 1Q1EA 4IDCA 2I76A 1VDZA 4MP6A 5FWAA 3SJ7A 2JLXA 3HO6A 2EL7A 4R41A 1C8BA 2NZJA 5BSRA 4J75A 5JSFA 4XQGA 1TT5A 2QTTA 4IDNA 1ZH8A 1U3FA 4YJKA 2CVHA 4DQ0A 5HIJA 1A97A 3W9YA 3N2GA 4NICA 3FPFA 3NT2A 5PNTA 4U2KA 221PA 2FSGA 1FTQA 4I1YA 1YR8A 2HNKA 4MR7A 1L7EA 3CKKA 1MX1A 4DLLA 5AVVA 5HTOA 1FSPA 2PIAA 3KHKA 1NDUA 4OL9A 4DSOA 1RTTA 2YIJA 1J56A 2A92A 2JLBA 1JR6A 2AFHE 4IOKA 1D1TA 2G7MC 1SQ6A 4BQFA 5KOJB 2IEAA 1NW9B 4HEA1 5EUCA 2WW8A 3FYTA 1BVRA 1JEEA 2Q4OA 4YECA 5LB2A 3UV3A 3WQRA 4LCBA 1W59A 2CE7A 2ERYA 2ZCUA 3QUBA 4O6VA 5KPJA 3JZMA 1IZYA 1OXTA 4BO8A 3CKYA 3I73A 4IFEA 3LCUA 3ZBTA 4K46A 3IPRA 5G4KB 3OLZA 1FNBA 2QZZA 1ST3A 2VSFA 5TGDA 3BRCA 3KQSA 1A7JA 1P2UA 3HUUA 3IVCA 1G291 1G5HA 3P9IA 2IYNA 3UKOA 2ZVPX 3WSTA 1KFJB 2AHOA 4HFRA 1F2TA 5AICA 4F1WA 4ZCLA 4B85A 3S2IA 5LUBA 4O1HA 2O2XA 3RFVA 4C5BA 5HP4A 1SVUA 3PUZA 2P90A 1SU6A 4FX5A 4OFXA 2AT1A 2WMDA 3ZD9A 4RU1A 4DV4B 2C4TA 2GN4A 3G1UA 1H6CA 2P77A 3UMRA 4I55F 3LCVB 2C54A 1TIKA 3H83A 5JWOA 1B8UA 3DL0A 2VZ0A 4Q7QA 2P11A 3FYUC 4DPKA 2X86A 3TAXA 2EHDA 5EHNA 3F3MA 5CD1A 3K5PA 5KYYA 5JJKA 1HC7A 2XECA 4A23A 2DPLA 4Z3OA 1YB2A 3KCQA 1U7HA 3VZSA 3ILVA 5LYJA 4QM6A 1HG0A 4NECA 1XMIA 4YCDA 2PV7A 5FBZA 1TQDA 3WG9A 3MJRA 3OPYB 1F14A 1EP9A 2OUIA 4H08A 1UBCA 2XUAA 5T8KC 2GBLC 1VSUA 4LJ8A 3ESRA 4HAXA 4LJAA 4RZ2A 4Q3OA 1OBVA 2VDQB 2R2AA 3T3GA 2BEWA 5K6AC 4DV3B 2DY0A 5ITZA 2VH5R 3FYDA 1H2XA 3HO8A 5IJ0B 2AC4A 3T94A 3T06B 3OUZA 2G76A 4R31A 3OTHA 5T4HA 3R6TA 3TLKA 4D0GA 3ZBUA 2B8JA 3KALA 5JTUA 2REQB 3S4YA 2IU3A 4JD5A 1VG9B 4C7OB 1LRKA 4XWYA 4M0FA 4GG1A 2GLUA 1IN1A 1KS2A 2BFDB 2DLNA 2J5RA 1MOPA 3G8YA 3G5AA 4JUIA 1Z18A 4R1UA 3EXHC 3MMPA 3QKWA 4TUYF 4G2NA 1QANA 5HJ2A 3T0GA 3VOTA 4DW8A 1OHHD 2I2BA 3FKSA 2OHIA 4UCXA 1QK5A 4R81A 4LJ7A 4FUQA 3CLHA 1II8B 3L1HA 2X0EA 3ZNNA 4R7TA 4E5YA 1OA0A 4IICA 4NFSA 1P3Y1 4J76A 2BE7A 2A7QA 2AEEA 1U5BB 4UPDA 5AJWA 5BRNA 2DCMA 5HZMA 3ER6A 3PWZA 4YRTA 5DJ5A 1FK8A 1FFWA 4D56A 1T9ZA 4YS6A 1ML3A 4HRVA 4WBSA 3GCDA 4G26A 5AHXA 2OCIA 2G5TA 4X1KA 1ZAKA 4A4DA 4D81A 2QX7A 2V3VA 3VR1A 2X3YA 5AW7A 4TM8A 4NOJA 1P4RA 5DU2A 2AZMA 4JI2B 1W49A 3QLUA 4J4HA 4WXYB 4RV5A 3T3DA 4ZTUB 1N2BA 3GUUA 4BLPA 1NVAA 3UAOA 3C98A 4WN9B 1M2NA 2DKFA 3UT5B 4B43A 4BQSA 3K96A 4JLPA 3IILA 1U1IA 3H2JA 3LECA 1Y3BE 1C3XA 2MYPA 2X4DA 4YJFA 4D99A 2GLXA 3L6EA 1U1EA 3SC4A 5B58C 2C7PA 4OHVA 2CD9A 1S9HA 3JWJA 4AT1A 1IN4A 5JXHA 1LUAA 4UVGA 3PEEA 5D5PA 2NNWB 3O8QB 1SUEA 3FTCA 3R76A 4YCMA 4EGJA 2ZXFA 1RLTA 4XARA 1BJRE 5I5GA 1FTGA 2CL0X 3R5JA 2IV7A 3DAHA 1TMOA 3IP7A 4E6EA 2W8ZA 3LYLA 2FV8A 1PWXA 4JH0A 1XRSB 2FX3A 4AKEA 2R1VA 5DNUA 1PNRA 5IF3A 3C6XA 2J85A 2Z6VA 3Q0EA 4CU2A 4QVIA 1KFCB 2UXDB 4RD3A 4B9AA 1QIFA 1SD5A 2G77B 1KL7A 3T3PB 4JFRA 3RVBA 5F7XA 1JN0A 4Q1VA 1NFRA 1KFBB 4X1KB 4BBZA 3BOSA 4F2WA 1H4SA 2Q7DA 1OGYA 2Y3IA 1GPAA 1HE3A 3FSJX 3PUWA 3O4IA 3STTA 3VR2D 4FDVA 2J87A 1Y7LA 2C99A 3EOAI 2BHLA 3OEYA 1GCGA 3TNLA 3TR5A 3TZQA 4C4AA 1WMFA 3ST7A 3E5RA 3ZE8A 2ZKIA 4BJ5A 5CVCA 3JXEA 3QXHA 3TRJA 3H8SA 3DYVA 1NKSA 5JRDS 4DQUA 1ZG3A 4XJTA 1IEWA 3BZBA 4HN2A 4XOIA 5ELXA 2IOHA 2VYNA 1YHYA 4Z7NB 4NR0A 3KCNA 5AI4A 1P0PA 3BEOA 3GGGA 4UNNA 4DSTA 4R51A 1XAHA 2BPOA 3M1AA 1HGXA 1LK5A 1IJFA 2CYBA 2W2LA 3LQKA 5TARA 3ZOKA 4DV1B 1Q1AA 1R2QA 3VR3D 3KD2A 2QTWB 1KP3A 1RT9A 3RS8A 4QOSA 2XVZA 4URVR 4TVKA 5K8VA 4OIMA 1KE2A 1HNZB 1U94A 3RRBA 3OJLA 3LYUA 3DE0X 4HT3B 3P2YA 1KMHB 2QD5A 5I45A 3Q8LA 4GOMD 4MZDA 3N0WA 3G5TA 1J99A 3CE9A 4MSUA 1XHLA 5CDTA 3K30A 3INGA 3PL5A 2W6IA 4DCCA 1Y9JA 3K0FB 4ZK6A 1V8FA 3EF1A 2X76A 3ANSA 3VR6H 1UFQA 1BFDA 5DOZA 1GTVA 3HL0A 4JOBA 3PGLA 2EFJA 4L3OA 5FWXA 4ALKA 2ZBGA 2V6MA 2AKAB 3P7MA 4UARA 4WVFA 3UWOA 5CA1F 1L4KA 3EGDA 3OU7A 4S1PA 5AXBA 1ZCAA 5ED0A 1SC1A 1VC2A 2DQYA 5L3ZA 3TLYA 2CJYA 3DVSX 2WUVA 1KYVA 1AKNA 7ADHA 3BTOA 3FYCA 1GPUA 3B3AA 2BHSA 2G9VA 4GKJB 3WLMA 1EWTA 3GNLA 4CFZA 1ZDMA 2FN4A 2FPRA 2QQ5A 1UM8A 3NBFA 5ES3A 3TRFA 1U7UA 2GA8A 1Y5MA 2W22A 3ESZA 1K75A 4XWKA 3CRRA 4OSEA 1ESNA 2UAGA 1Z2AA 4L8VA 4C4TA 1O0CA 4BNXA 4RIFA 1FP2A 2PUEA 7MHTA 3I9MA 1EQ2A 2XYRA 1N3YA 1A9TA 1H8HA 1JQBA 4NPCA 4EPRA 2PMFA 1BE1A 5CNJA 3T7AA 4YPOA 3X1WA 3CUEF 3SZ3A 1VMAA 5LQAA 3KAQA 1MB0A 1UXOA 3WGOA 5SY6A 1LS1A 1W9MA 3H1EA 3OQVA 3PGJA 2I4OA 4NS1A 3IE0A 3LIPA 3MCVA 2WJWA 3MWKA 3AL0C 1X7XA 3ZHXA 3WLSA 1NL3A 1OQAA 2Y0EA 3CNLA 5K8JB 4R3UC 1ESZA 3WXMA 2QLFA 1JSRA 4HKTA 1XLVA 3U7QA 3EGEA 5A9SA 5IFKA 1NNI1 1JLLB 1QE3A 1UEJA 2NLOA 1TTHA 2WAOA 4G5OA 4IG9A 1ZC3A 2H4XA 3EZGA 1GRVA 4K8RB 3V32A 4BMZA 1ZK1A 3EZYA 2L2QA 1JSCA 4Q1BA 4YQZA 5JROA 1NXTA 2AW5A 3VNUA 1YOVA 2AXNA 5LOVA 2ATVA 3WQHA 1QO7A 3CR7A 3NVDA 3FTEA 2NM0A 2ZAMA 4YASA 4CV2A 4OHFA 4QDKA 2R8PA 2Z5LA 3QMMA 3TKAA 5AMXA 1H9AA 2JGRA 1BAPA 3LA8A 1HMPA 1F5SA 3FYUB 3F7NA 1X80A 2RKBA 1UT8A 2ORED 2QMQA 1Q22A 4U9UA 4TSKA 3G2PA 4B3IA 5FF9A 1KC3A 4C7VA 2VNSA 1QIJA 5ERGB 1Z38A 4PFKA 3LUFA 3LGSA 3VOBA 1X7XB 1Q7BA 2GK3A 2H1WA 2LWIA 1V5FA 3GGDA 2J3MA 1T3SA 3A9WA 2DBQA 1IY0A 3ESDA 3PVZA 3ZLTA 4BNHA 4DYHA 1WX1A 1HNXB 1H1TA 3HCAA 4R6WA 3OSZA 1B0ZA 3EGIA 3MT7A 1T3ZA 4MUYA 1WUYA 1UPUA 1O08A 2C4HA 1BW9A 2EATA 3BXXA 3ICCA 3WGZA 3MMZA 3TZ6A 1C4WA 4G25A 4B83A 4ES6A 5HKKA 3ZCVA 4I50A 3VZDA 4TTRA 2HW8A 2WTMA 1T9GR 4WXRA 1YZKA 2ROQA 2J4CA 3UXEA 1ISGA 3RIMA 2ZZNA 3V2IA 3STHA 3ZZ0A 3BJZA 4RVFA 1NATA 2PMWB 4MDFA 1FJ2A 2PVSA 5AFSA 4U7DA 3H5AA 4W8GA 4N5LA 1QH8B 4UUMA 2W2QA 1BCSB 1CEEA 3C3JA 5CM2Z 5REQB 3HKBB 1HA3A 2PS0A 4JKYA 4ZT4A 3DDNA 1GA6A 3H9GA 1WMDA 3WAGA 3RU9A 1P6QA 1XNHA 1C0EA 2OGWA 1YJ8A 4BKUA 2WP8J 3LZ6A 1B76A 1E96A 5CVUA 5FTWA 4CKCA 2WQ6A 4NBNA 2CZQA 3UOAB 1J9EA 2QNRA 1M1YE 1ZOPA 4IJVA 2Y9PB 4EMSA 3O73A 3Q3EA 4PTLA 4TV8F 3EPKA 1LWOA 2DWOA 3R6GA 1W8IA 5HIAA 3A9TA 4D74A 3WLRA 2DVMA 1YUMA 1D2HA 2R8EA 3PT5A 4F4FA 1H2EA 1PT5A 1F3LA 1N6KA 1FX1A 2W4QA 4Y0AA 1TPYA 1MO4A 4A7PA 4C7JA 3LUCA 4H6PA 1ZEJA 3IESA 1T5LA 1ZNWA 2GN0A 4EPYA 3DEIA 3BXEA 3OT5A 4BN5A 1OLUB 3E23A 4J94A 1P5FA 5BWBA 4RBNA 3WWZA 1L5ZA 1Q15A 2C4KA 1VXRA 4NJMB 4Y1RB 5G0VA 3WO1A 3QJYA 2V6BA 2RD2A 1EM8A 5FDFA 1ZOSA 3WK9A 1W76A 3EXEB 1X9IA 3I3SR 2FSSA 5BQ3A 4QM7A 2WVJA 4HOYA 3KSZO 1U0GA 3N70A 5EYPA 4CKXA 2IKSA 3BICA 4YUXA 1OGJA 3O7MA 1UJ2A 4AP6A 1R0LA 2Z2KA 4RM2A 3V3KA 1KI3A 4BBJA 4Y3UA 2MMCA 2GS9A 3A6FA 5I51A 1OIXA 2I54A 4XLTA 2Q3BA 1UFOA 4MW2A 5JDIA 1F48A 4ZEWA 4FGZA 3M9LA 1T2FA 1NC1A 4NH0A 3DOHA 4JNKA 5B7PA 4XGIA 2J3EA 1I3OA 4F0JA 2H5LA 5CDGA 1KEEB 1ODFA 3E61A 3HSSA 4CUJA 1F17A 5D51S 1DSSG 1P5ZB 3BMQB 2C2BA 1E0SA 3JQDA 3VFDA 2C2YA 2F2TA 3D43A 1O4VA 1LDNA 2MSWA 4C01A 4D5EA 3WAKA 3R9XB 3TLAA 2D3WA 2F67A 2FJUA 1Z37A 4PIPA 5K3FB 2GAIA 3ZXSA 9GPBA 5HRAA 1D4OA 2B0CA 1PG5A 4R05A 2OKGA 1XZKA 5H4HA 4EAQA 3MYRA 5B3KA 1VYUA 2ZBFA 2WSSA 4D98A 5JXGA 5CDHA 1UBKS 3CX4A 4KG7A 1JFFA 2E5WA 1ZM2A 3CNBA 4U3JB 4IIYA 1XT6A 1JAXA 1SCNE 1GT91 2GJ9A 2J9FB 3FPCA 2FAXA 3WZ2A 1J25A 1TJ3A 2IXGA 3ME5A 1D1QA 1KORA 2ADMA 5KNLA 2ZZMA 1CNMA 5ECWA 4IIJA 5IC5A 1T0BA 4ENQA 2Q9UA 1Y1TA 3Q10A 4Q01A 1U9JA 3VR5H 3S44A 4DF3A 4Q9DA 2PKQP 2EARA 4G1EB 4ACAA 3CRNA 5ADVA 3WL7A 1AK9A 1TUIA 3GA7A 3OIYA 3OQJA 3PQFA 1EGVB 4DAEA 5C80A 5AUQA 1Z56C 2GUWA 4C3OB 2LCIA 4EOGA 1TLLA 3AHJA 3HLYA 4L74A 4EUHA 1Z2PX 2J9XB 2QD3A 1N0UA 1GPWB 2HDNB 2RG1A 4BGVA 4NCAA 1RU3A 5FTLA 3PI6A 1OLUA 1UK6A 4Q9NA 4D9JA 4M6WA 4W1QA 1HDGO 1VIAA 2WTXA 3QXJA 1RMYA 3V7YA 1X7WB 3QY9A 4Y1EA 1X8XA 3ZTYA 4BIIA 1U0FA 3TCKA 2II6A 4EEXA 1LDEA 3LL7A 3O90A 4MV8A 5HZGA 3MD0A 1M34A 5ECYA 4EZEA 3EVDA 4RZXA 2QPLA 3EXAA 4M0PA 2C84A 4OKIA 1EEXB 2B30A 2G9ZA 1KZ6A 2Z5FA 1ONSA 2GPNA 4NATA 2IH5A 4P4SA 4IDQA 5IZ4A 4D9HA 1X13A 4UD6A 4C4ZA 4EFKA 1BRTA 3WRYC 2PZMA 2ZYUX 4KIGA 1KHTA 3I9KA 1FP6A 1G21A 2OAP1 3L1VA 2GN9A 1W47A 1RMQA 2XOXA 1SY7A 3FZEA 3M34A 3PVSA 2YWBA 4TXLA 5IYZA 1SCUB 2CXHA 1E1NA 4DLZA 3L84A 1CERA 3RS9A 4YMLA 4UUBA 4X7BA 4JB0A 1UEIA 4N9WA 1P62B 1XXLA 4A1OA 1FA9A 1XPJA 4YBZA 1YWGO 3S27A 1HETA 4ETIA 1NUUA 3HWWA 3OQMA 1NN0A 2GN6A 4GPIB 1Y3FE 1S7GA 3CPJB 5NULA 3W2GA 1FZTA 4U00A 2PUCA 1VL0A 3HJFA 4G24A 3OCVA 1C7JA 3GEBA 1GZ3A 2REXB 1TMGE 1Z6ZA 3AP1A 3VSCA 3HVHA 4QWMA 5KSOA 4UAUA 1SOVA 3H87A 2PSHA 4J1TA 2I3BA 4TT3D 2C3YA 1PV4A 4RVUA 1MN6A 2FUCA 2I5PO 2B6NA 1IWBB 2YMQA 3BDAA 3NB0A 4AS2A 3QH4A 4OJNA 3SBOA 16PKA 3KZCA 3OQ1A 1BNCA 2QAIA 1HE8B 4GPAA 4PYRA 2MCFA 1Q0HA 2INGX 3L49A 2PZLA 2VIIA 2CV2A 4N8SA 3EY4A 5KSZA 3HFRA 1V5GA 3JALB 4KPYA 1YH3A 4TMFA 1GVHA 1KXZA 4FZVA 1CS0B 1I6KA 4BNKA 2VHEA 2QF7A 2VBFA 2M32A 3O92A 5L6MB 4FC7A 3TMKA 3FHLA 1IXYA 1D4AA 6AT1A 1UJNA 2BR4A 3A1VA 3WMWA 4AKTA 4AWXA 4BBPA 3LYHA 3PD7A 5HK9A 4CIAA 3IDFA 2BSQA 5C8YF 2ECPA 2PO7A 2OCAA 5MN5A 2C5LA 2EFGA 1QTNA 2HADA 2QTLA 3QE4A 1WCYA 1QU3A 3L02A 3I4LA 4GE3A 4HQFA 4UCWA 3ZTWA 1LFAA 1QG0A 2V54A 5F9MA 1CDDA 5EZYA 5E6RA 3JQ9C 2DFLA 1N9ZA 4CT4B 4H60A 2N75A 4KVGA 3WSWA 3EXG2 2YMPA 2DXIA 4JEUA 5FTMA 3ZDQA 3IDOA 5T6MA 2CKDA 3NOVA 4PY2A 2I55A 3R0IA 4MO9A 1QDLB 3QU4A 3C5WP 3NAGA 4NH4A 1KI8A 1UODA 1P4AA 4MR8B 3V00A 5KWJA 4XJSA 1YR1A 2PSSA 2UZ1B 4ZVQA 2IZ7A 5GOZA 1O95D 3KB1A 5LR6A 1CULC 3JQRA 2P5SA 2Z2XA 4HUJA 4N1AA 1B2RA 3REQA 4IZHA 2W2VA 2DBRA 1GYQA 2HA2A 1TVKA 3D3JA 4RHEA 4WXHA 4E5NA 3C8UA 5J58A 1Q84A 3KSAC 4CTKA 4DBLC 1YQEA 3DXYA 2XB9A 3PNSA 2B4KA 3PNOA 4Z86A 2YJZA 3VAAA 3A3YA 2IBMA 2PGIA 2RJNA 4L75A 2R87A 1QAMA 4OP1A 4XUEA 1VGVA 1LLQA 3FKJA 2ZXEA 4LXTA 4C4YA 4A8JB 2PUFA 2C3PA 2VCHA 1KP2A 4BQOA 1IHOA 3EWSA 1TD9A 1F6DA 2YX1A 2JIPA 1YVEI 4HWKA 3TNDA 4UMFA 4CIYA 3K53A 2ZOSA 1W34A 3AEUB 3RJZA 3LBIA 5HM6A 1E5QA 1X87A 5CIWA 4DBZA 3T0FA 3DHEA 4KKVA 3F6EX 5J2TF 2CNWA 3MXTA 3G1TA 4Q9AA 3USCS 4MW4A 5JD5A 5F9HA 3RODA 2A3NA 1U2ZA 2JD2A 4BNFA 2ZJ7A 4P0QB 4Z1OA 3K31A 2HU2A 3EQ7A 4BV2A 1NPYA 4C2AA 4ETWA 4ZIRB 1LSJA 2UZ3A 5FL3A 3RWOA 5ALYA 3RRFA 1KZ9A 4MW5A 1GT6A 3BHJA 5C53B 3OUUA 5TB5A 2R66A 3CH6A 3DFKA 3V8QA 1Q92A 5BN1A 3CZ9A 4F4UA 4HHEA 1J2TA 4DILA 1ZCZA 2VXCA 4UAJA 5FA6A 4ZYLA 4X7MA 1EJ6A 3KLMX 1JHZA 4JDUA 3D9QX 3IVMA 2VNAA 1QYIA 4WY5A 4YJ3A 4HFNA 5EMMA 1CJVC 4QVGA 3RS3A 5DTJA 2FPPB 4RETA 4XAQA 5B6JA 4CL2A 3QPUA 3RSCA 4BO2A 4DN6A 2RGRA 1I7NA 2O3UA 3KT6A 3QPDA 4YAGA 1N6LA 1JJ7A 6ABPA 1WXDA 3C2QA 2IDJA 4PZ9A 1H3NA 2Z43A 5SY4A 1ZGZA 3L6CA 3VC3A 2XPCA 1TW2A 4ZV4A 1OE0A 2N9UA 2WQ7A 4QEZA 5DT2A 4YRPA 4M7WA 3I83A 2F1OA 2ZJYA 3P32A 4TUYB 3TB4A 2RC6A 2HU7A 3ESYA 2R8YA 1N2SA 3TXAA 3W9UA 4BTEA 1DTWA 2MINB 2RONA 2WKWA 4NYIR 4RMHA 2WIKA 4RPCA 3HR8A 2FZLA 1GPH1 1KJ8A 4NFLA 2W2KA 4MEBA 3NHPA 5T57A 3EMBA 5ICFA 3M5PA 5D01A 3OX1A 1K66A 3N0XA 1AKQA 4ZYZA 4RTJA 1SCJA 4L5JA 3MILA 1YNSA 3UT5A 2CHVA 1TB4A 2JJYA 2O0KA 3WGTA 4YWHA 3DUWA 5C4MA 1SQGA 5AOCA 3WLKX 1U4OA 1GTSA 4OX9B 4FOOA 4YUWA 3KYCA 3UAVA 2N1BA 1E5VA 4DBVO 3H65A 4G8DA 2CXPA 2O5EA 4HNHA 3VU3A 1A2KC 1GZVA 2P78A 1ZI9A 3WLEA 3C6MA 3KKKA 5DBGA 1WPRA 1CJBA 2E7ZA 3TI9A 1DAPA 2BI7A 2GUGA 3D7KA 2FR0A 3UKJA 4LRTB 3FTDA 2HFJA 1YR2A 5K03A 1X1SA 3N86A 1G55A 1V5WA 4YMSA 4B3GA 3N59A 1KYTA 3CLVA 3RSGA 1D9XA 1CY1A 1VG8A 2ACEA 3BULA 4I4LA 4ZVUA 4C2TA 1L7VC 3HPRA 1NUSA 2GEBA 1R6UA 4OOFA 1RTKA 3ETDA 5K8UA 2OB1A 3NTRA 4KVAA 4MWEA 1HG1A 1XC7A 3F2VA 4ARBA 5E2BA 4DG8A 2XMSA 5D1NA 2P1RA 4Q03A 5AW8A 3D54D 4H1HA 1RJEA 3UH0A 1HYQA 2AEFA 3ER8A 1WB5A 1GY8A 1RFLA 1KYXA 2CNOA 1DT5A 4JOCA 2IA5A 1QGOA 2HHLA 2YVKA 3E2PA 1WD5A 3L0CA 4Y2XA 1L1FA 4D0RA 4D92A 2F90A 2ZT8A 4WZ6A 3SF8B 3Q2IA 2D0PB 4PSAA 5B1HA 2WZBA 2XB4A 2AL7A 3QKUA 2O1SA 4AO6A 3RYCA 4AC9A 1YS2X 5JQGB 2ODPA 1GUZA 4QYSA 4NJOA 1D04A 1R6VA 4KWHA 3WLTA 5HQ3B 2AZDA 1M1UA 1IHXA 1P74A 3GY0A 4OHYA 5AW2A 1IEVA 3AM4A 4DTCA 1ECBA 4KO2S 1FQOA 1GN9A 3WBJA 1PQ4A 1JU3A 4FR0A 4GGPA 1SKQA 2WHPA 4Q4HB 5K99A 4IOLA 5D3ZA 2Y1EA 2CLMB 1QCCA 3UPDA 4DJ5X 4KFTA 1G9SA 1AB5A 2QUAA 4L9AA 1V1JA 3UB4A 1QM5A 4PBSA 3RUEA 1J09A 1BE0A 1LPMA 1U28A 2I33A 4HSGA 1DIBA 1KDRA 2AXEA 1Z68A 3O9VA 2JBAB 4PTYA 3S2YA 2GKSA 1W4AA 1GRNA 1ZZGA 1XWWA 1W9HA 3EZFA 4YT8A 1U8ZA 2QUJA 4DR5B 4V0MA 3G0IA 1I4OA 2JLAA 3EFOB 5LZ8A 1P1BA 5T4BA 2PGAA 3MMXA 3RFTA 2ETXA 1DAGA 1OTYA 1WU7A 2GR9A 3VNRA 2CV0A 2FCRA 2J3IA 1B00A 2BFWA 4NCNA 1D8TA 1QOQB 1YONA 1TGYA 2A5JA 1TECE 1SC6A 4BZXA 3NEYA 3G6KA 1RQ7A 2QN9A 4B4VA 3G2KA 4IKPA 4YJDA 3E5MA 4TKVA 1AKRA 1QCZA 1U1DA 3OX3A 3NYWA 3O8OA 1XR3A 5HGJA 3TRKA 5ALFA 4MKFA 2V7XA 3ESXA 4E07A 4NDAA 4LYAA 1BX1A 5DTIA 1IZ0A 3AVOA 4FIZA 4LMPA 1E9SA 3GYGA 4KIWA 2Q5IA 1UJ6A 3PHLA 2NUPA 5C5DA 3QE0A 4FT2A 2HL6A 2X8AA 3U7EB 5DLEA 4ALIA 1N1EA 1WPXA 3FR7A 1L2TA 1N3LA 4KE6A 1LK7A 3K2BA 3CPSA 3EY9A 4LGVA 1LQUA 2EWMA 1BDMA 4G4GA 4L3WA 2P4HX 4RHCA 1E7RA 4LV5B 4GOOD 2I22A 1QX4A 2R2GA 4HEJA 4L9SA 3R7SA 5LIPA 1BH6A 2IUFA 3MZ0A 4FOSA 2NU6B 2VPYA 3OQIB 3RBZA 1VXOA 1E2GA 2D2IA 1G4AE 1EFRD 3GJTA 3IIJA 3M3PA 2OHXA 5B36A 1P2TA 1YJQA 5ILOA 2QI9F 3L7KA 5BQOA 1R74A 2QN1A 2ZBRA 3AL3A 3OWOA 4Q34A 2ZROA 2VUHB 3JQ8A 4E5KA 5FTJA 3J81A 1JVBA 2EHJA 5FQNA 2XI4A 5TE9A 2O3TA 1EH5A 3R2JA 1GQQA 1TYBE 2EJCA 3P94A 3JZFA 4MAFA 3WRVA 3ZLVA 3U09A 1ZUIA 5ALJA 4IVRA 4E7OA 1AVTA 3KJHA 1T9AA 1F0YA 3ZV4A 1NLMA 3I2GA 4JBHA 3JARA 2V7QD 2O8BA 2QRVA 2JFBA 4R1QA 3AESA 3ZW8A 2HRQA 4CF3A 1U5AA 2PZJA 1EAYA 5JW6A 2ATIA 2ZETA 3DCNA 2JA2A 4AMZA 3FCUB 2BUCA 1FMFA 1VLVA 3DQPA 2H2AA 3VPDA 1ISRA 2BLLA 3BH0A 2M98A 1YQUA 3OX4A 4KR3A 4IUDS 1GUBA 2DBZA 2PLWA 4FNOA 1H94A 4UW9A 5KTYA 3RUPA 2XE4A 4M1MA 3UC9A 1JQ5A 1PJZA 3AKZA 1KEPA 4BZZA 1IVYA 1P17A 2JFNA 1E2LA 4GKVA 5CAEA 2YJ5A 2VK1A 4B6JA 4S35A 1U98A 3E48A 5JRZA 3KS9A 1SBTA 5E0KB 5JAIA 3L7CA 3FPAA 3K6SB 1JEAA 1S8OA 3ZX4A 4DLSA 1GL6A 3C1AA 1V1MB 2IT1A 2J3KA 1E4EB 2QE7D 3IAUA 4TTAA 2ZWPA 3TSAA 3ZY3A 5TGTA 2JRLA 1COWA 4JIMA 3X2SA 5JI3E 1W5SA 4HDMB 3D2CA 3G2MA 4F8JA 1WHSA 1X7YB 4K9KA 2GWHA 3TIFA 3MCAA 4CMBA 3PQ5A 1N78A 4XWAA 3A4LA 4II2A 2XUHA 2HREA 3CLUC 1VGRA 4P3PA 2I8CA 3NM6B 3IODA 2X5NA 3A04A 5AO9A 1O03A 1TK2A 4LZWA 1KYYA 1SURA 2NO6A 1YKFA 4A9AA 1B73A 4Z9BA 3MRTA 3ZIAD 2FW6A 2Z9DA 1Z5ZA 2F3QA 3ETEA 4UBIA 1EE2A 4B5LA 2WUDA 4C0BA 1KI2A 4F91B 2CLFB 4QREA 2O19A 3CEAA 2NXJA 1EXMA 3WNQA 3UJ9A 1PEKE 2WUGA 5IKPA 3KD3A 5FOSA 2CVPA 4O63O 5KI6A 2QUBA 4EWLA 2ODTX 1Z4MA 3NG1A 4EUEA 4YRAA 2CF5A 4WMLA 4RD0A 4NBUA 2G04A 4MQ4A 4TGLA 1AGPA 1EDEA 1HYHA 4ZAXA 2GB4A 3H9QA 3KUUA 4WCFA 2N47A 1S9DA 3KVRA 3EEBA 3IR5A 5KWVA 3K1TA 4A6DA 5DNCA 3D1JA 1TAGA 4QPPA 4BO9A 5AVQA 5JIBA 5T67A 2C3MA 2C1EA 5K0CA 1UPFA 2VLIA 3F8SA 2XKBA 3K8QA 3KLNA 4PVDA 4CEHB 4IWXA 1ZJZA 2PO5A 3FFAA 5C8XA 5CB6A 2H17A 1Y6GA 1AC5A 1GFSA 1ZH0A 4GPEA 4RK7A 2K2WA 4BVFA 2X2EA 3K4QA 2VP5A 1O8BA 2VTVA 2DR3A 2FDRA 2QL9A 4LFBB 1E0JA 3T5PA 4BGIA 1GN8A 1CDOA 4C1NA 4QELA 1VJ5A 2V7BA 4NE2A 3JR3A 5EJ7A 5CPBA 4YCCA 4HGOA 1N0IA 4BMPB 1L9XA 4INZA 3HB0A 3NJ4A 4HLDA 3PXGA 3IUSA 5KYKA 1Y6ZA 1CBUA 4XX0A 1GSOA 3E8XA 1M2WA 3IVAA 4RXTA 4A8JA 3UMMA 5L3SB 4PYMA 5IM5A 2Y1OA 4RZ3A 1I4WA 2GKOA 2J6HA 4BMDA 2EX4A 1TUBB 1YL6A 3GCZA 2VHYA 5AJXA 2QL6A 2VAVA 1DJOA 3AJDA 2BHRA 5A6SA 4R71A 2Q4RA 1G7RA 4RELA 1KY2A 3EGVA 2GLTA 4ZD6A 2AJBA 1RI1A 4PCLA 3ZBQA 2YN0A 1QK4A 4L5IA 3C8DA 1GZHB 3AIMA 4Z4FA 3NIDB 1WRBA 3I8OA 4N65A 4RV9A 3R7WB 4BNJA 3AF1A 1Y6QA 1LI7A 1QIHA 1RI2A 1VFNA 2KQUA 1QYXA 2HBQA 4ZCPA 4QECA 3WMEA 1GNQA 2YBDA 1UKYA 1N5KA 3TAUA 2NVBA 1TYAE 2JBAA 1GFWA 4TTPA 4JQOA 3W8EA 1EGHA 4Q05A 4OYRA 2VYVD 1WQ4A 4N5IX 4PQFA 1MO2A 1NYLA 2IEGA 1NSTA 3D6VA 3EQ2A 3OH8A 1RBZA 1TCUA 4UAVA 4FB4A 1M5UA 5GADl 4XFKA 4XEHA 2CEKA 2I3ZA 4ZGGA 4FE3A 5E6UA 2C2WA 4GVLA 3MWLA 4MUGA 3H7AA 5JZ9A 4AIIA 4I1IA 1G98A 4WLOA 3ZS8A 1SVSA 1UBHS 2J09A 3C5EA 4KLNA 3BK1A 1TYDE 3HPQA 1JKIA 1K7CA 3DCIA 2Q8PA 3M6MD 3AFMA 3N6XA 1FY2A 4KAXA 1XA0A 3ZQUA 2A9FA 1DBVO 2F48A 2VHQA 3IRUA 3QGMA 1AH2A 3V9PA 1K98A 2V74B 5BSFA 2F1JA 2MJLA 2Y1CA 3BXZA 4LZLA 4ECAA 1CRZA 4J9UE 1MJFA 1R4MA 2OOKA 3HNRA 3VHXA 5LQJA 4IHJA 5JBNA 4R0NA 4WZBB 2Z6AA 4FMBB 2P3QA 2NADA 5E1DA 5DM4A 1BN6A 1KZ7B 2FX5A 3SMQA 3TEFA 3CIFA 2GOYA 4JFAA 1Y6FA 1H5QA 3COYA 3DULA 5K3AA 3U39A 5BRJA 1PF7E 2F59A 3F6YA 5TLSA 4RS3A 4JBLA 4KLZA 1WAMA 4L8FA 4C4PA 4R8KA 5BSEA 1GA4A 3OEWA 4W8HA 4KDCA 2AVDA 4XASA 4ZQFA 1JHQA 5F5XA 1GG8A 2J45A 4B09A 2QVCA 1T26A 4WNAA 4GKBA 4CLHA 4FNAA 3QFFA 2IPMA 2NXWA 1BD4A 2ODNA 3HYCA 4YTEA 1Z4QA 1QJCA 4ZVOA 5KDLA 1I0LA 5KDOA 4RY0A 1WB9A 1T43A 1URPA 5IVDA 3W8RA 1NXWA 5D6OA 3ASUA 3A9UA 5FBHA 3TLBA 1VSQA 3VH3A 3T1YB 3ROPA 1RQ2A 4TLMB 3N0VA 5LDGA 5LOVF 1N34B 2WU8A 2P3LA 2H9YA 1PTKA 2QNBA 2WE7A 2VJKA 1YAHA 3FROA 1DB3A 5AM5A 1KEEA 2IHNA 1XV5A 1WB6A 2DJIA 3KSMA 3TPFA 1MF7A 1JAIA 3CV3A 5FADA 2VHXA 3B89A 4X7RA 3RTEA 4A92A 4OQYA 1S8AA 3ISJA 4FOPA 5CG2A 3BAFA 4W1RA 2AVNA 2HXGA 4K9SA 2PX3A 4XDYA 1IOLA 1IQ0A 1G2OA 2D74A 2BEVA 1VJDA 1WUIS 3EJ6A 1IH8A 3P2KA 1EZZA 4FYXA 3HDYA 3F5QA 3I53A 4DQVA 1FYDA 4L57A 3Q98A 4QUIA 5AJYA 4OY3A 4YBRA 2QRPA 1TX4B 4QG7A 3OE1A 1VI6A 4WGFA 2M6LA 4EJ6A 3BHMA 1Z0FA 1ULHA 1P4HA 4F3RA 3HDVA 5KVCA 5EWLB 4FXPA 5EIHA 1LPNA 4RK1A 3WKEA 4OK3A 1HPLA 2J07A 3SS7X 4E12A 2DEUA 4IYRA 3MFYA 2SICE 4DV5B 1T4GA 1SQ0A 4XQ0A 4UFOA 3AM1A 4YCBA 3FMVA 2G9RA 4I5DA 2VWQA 1OXBB 3FZQA 2AYZA 1C0IA 4XGNA 4BX3A 1Z5VA 5H70A 4TXJA 3KO8A 3LLVA 1PFYA 1AO3A 2ZANA 1Z25A 4KREA 3E7DA 1L8LA 1UKVY 3PTAA 3ZU2A 3H1FA 1QQ7A 3CCBA 4BWYA 2EEPA 2C95A 2Q4EA 4PM4A 4WVLA 4DBLE 1A8UA 5CBKA 5A5VA 5JEDA 3CNEA 4D82A 2IL1A 3VSBA 5HS6A 3PIDA 5EE3A 3Q7QA 1ZUD1 2VUSA 5HQ3A 2OM6A 5C34B 2YVLA 2JASA 1KJYA 1OZ0A 2CHQA 3DE6X 4OXXA 2E2WA 3C6QA 4OMFG 1J2RA 6Q21A 5AKLA 3JWGA 3HE3A 5IT5A 3I72A 2XH8A 4FZ3A 4QU5A 2H5IA 1U80A 4WV3A 4CRWB 1SHLA 2HGSA 3I6ZA 3EQ9A 3W5BA 5J23A 3JAMA 3UJHA 5CX1A 1KGDA 1Z6GA 3L7IA 4DCPA 3TTSA 2OC9A 5DWDA 3AZPA 2A30A 3RS7A 2PKXA 3A1UA 3AUYA 1VCNA 1JR3E 2D0IA 2E21A 3KELA 4PO1A 3N53A 5EXDA 3TJRA 3VAYA 4WADA 3UGTA 2QSZA 3K2IA 1BU5A 5FLXA 1QHHA 2QG4A 4JC4A 5LB4A 3EXEA 4A6EA 4L0QA 4CHGA 5IS2A 5A3VA 4NCXA 2ECOA 2DUMA 3FSEA 1Y8AA 4IDBA 4QT0A 4TQAA 5AI8A 2PMEA 2G63A 4UU1A 4H1WA 1OIWA 3EXFA 1J7KA 1YE8A 2NQTA 4DIBA 2V1UA 4V0OA 2IVFA 2RGXA 3GFQA 3DBRB 1CQJB 3WDSA 1KAGA 2NYRA 3COSA 4MV7A 8LDHA 2BKXA 1CJUC 2F7SA 1JG6A 1TGVA 2ZIFA 3F1LA 5DBEX 5TS3A 5HZHA 4DUGD 4QBKA 3ZE0B 2G08A 4E5UA 4GH5A 1HE4A 2X1MA 3WGIA 3AHIA 1KI4A 5U4QA 1ZAYA 2ZIGA 1DXOA 3MLAA 3IP9A 3BC1A 2QY6A 4QFDA 4EECA 4BNVA 3PICA 3MWGA 4JR0A 3GP8A 3QU2A 2EG5A 1YR6A 2OXCA 3Q9UA 4NK5A 4TWBA 4CMIB 1PGNA 2AN3A 1IHDA 3EBPA 5AXCA 1ENPA 4FQ8A 2QU8A 3BCSA 3ILSA 5AVZA 3HL4A 4N7MA 2DT5A 1JILA 3ZJYA 3ZGNA 1YR3A 3ACCA 4NG4A 4UZEA 2H4FA 1A5AB 1U7DA 1KMMA 3IDAA 2V03A 3TQCA 4B2YA 1D4FA 1Z4IA 3SSAA 4ATNA 3MIIA 4EW1A 4D0NA 3PJRA 1CDEA 2OHGA 1E1DA 1WKCA 2GNPA 2FPIB 3ZY5A 4TT3A 2QN2A 1JJIA 1Z6YA 1DCTA 3H6KA 4OXIA 3BPSA 1Z22A 3QEOA 4OXQA 1XDBA 4M0LA 5HHTA 1UZMA 1AF4A 2B8WA 4MUAA 1CY2A 3NETA 2CEAA 3VYRB 1SG6A 4COKA 2VKTA 3RW9A 2Y92A 4UTVA 1XZQA 4K0RA 2F3UA 2HQBA 4B48A 1X1AA 4A15A 3TQTA 2TMDA 2OLEA 3DVAA 1LJ8A 4MDEA 1DEAA 2WV7A 3QEJA 2NMVA 2LGJA 1XDDA 2QPAA 1EKXA 1NW3A 4GMFA 4TMKA 2YOHA 1G7TA 3TL2A 2KW5A 4Y1GA 2O0HA 3P2IA 2WV9A 4N5DA 3C7KA 2P79A 1TYEB 2AFHB 4E2FA 2C9OA 4LZAA 1HMYA 1KHHA 3WL5A 3JW8A 3AF2A 1RP7A 1TRHA 5GJVC 3PC8C 1X0XA 1YACA 1ORIA 1PAUA 2HV9A 2VPWA 3KWLA 1UMBA 4K9PA 4XFJA 2PL5A 5TF4A 3OPMA 3OPQA 3C3WA 2VOJA 4LWZA 5BNIA 1E9VA 1EFHA 4KR0A 4BJ6A 1DBWA 2VQ6A 2ZVDA 1T5IA 4OQPA 3HFSA 1C7RA 2QG9A 1GPLA 3LD9A 2JARA 4M86A 1BFKA 2AJDA 4MGZR 4NMXB 1JLLA 2WBLC 2XBUA 2DU8A 1YQ9A 2Q46A 5G02A 4WBNF 5HYVA 3D6AA 3LHIA 1E3QA 1F60A 1JYSA 1Y6JA 2H9AA 4OJKA 3NC1C 4KEAA 5DCYA 5EVCA 3WI7A 4BGEA 5MGNA 3OZBA 1EUYA 3VKFA 1HKUA 3OJCA 1SCIA 3AEUA 3OT4A 2Z8ZA 1G8YA 2XRYA 2ZT7A 4W9MC 1GZ7A 1KI6A 1HBJA 2WIAA 4TV9F 4AMUA 3QV2A 4UZSA 4ZT6A 2GCGA 3RYIA 5DM2A 1FUYB 2AN9A 3NDRA 3LCRA 3W3AH 3HJCA 4ZHQA 5AIAA 4LFAB 5TMBA 1C41A 2DQSA 1T9HA 4LHVA 3TUZC 4KFCA 1V1RA 1PX2A 2P68A 4RKFA 3W2HA 5F4ZA 3N7TA 4HDNB 1MOQA 1Q77A 4QDZA 4Q9KA 3RF7A 3MNFA 1DUVG 2XMDA 4C29A 1NDHA 2HCRA 2NACA 2OBBA 2AFIA 5D3KA 2FZ5A 4NZPA 3H4TA 4ML3A 1JJAA 2WSSD 1HXHA 1USVA 4EG3A 5BUSA 4L51A 1JWLA 4F3TA 1N33B 1JTVA 2ET6A 2YWXA 4F4DA 3AEZA 3AETB 4GQIA 2EKLA 3EZNA 5AJTA 1XJQA 3VTKA 1J42A 4Q3KA 2VPPA 1F3OA 4M21A 4RK6A 5A5EA 4B3HA 2CLKB 4WZAE 4RVCA 4C0AC 4RTRA 1G63A 3WNCA 5TDHA 3QRWA 5KKCA 5DBIA 3FLMA 4LKRA 4HNQA 4JMPA 2NYVA 3QVLA 5CT4A 4ADSG 2PD6A 5LD2C 4OGLA 3ZLJA 3LKBA 4B47A 4OXRA 1U6KA 5H5JA 4U1RA 1L7BA 5JT1A 1KP9A 1JG4A 1NLFA 1DIHA 2PX2A 1UUFA 3FNQA 4KSBA 4HYQA 2F64A 4EHJA 4HYYA 5EZYF 1M34B 2XSZA 4FNMA 6NULA 4TL6A 2NZWA 4W5HA 1K7FB 3HCDA 1IK6A 3MSCA 2Y0PA 1UJ5A 5B3LA 1HV8A 2OD9A 2OL4A 1NWCA 2GZMA 3A36A 4XDHA 3EHDA 3WBBA 3WICA 3WOHA 5BMVF 1H2BA 4QPJC 3KOUA 4RIHA 3N2LA 5DCWA 1T1JA 4C6TB 5CR9A 4N12A 2EF0A 2FW1A 3HDTA 3QK7A 3FAKA 4TSRA 4NEQA 4B32A 2QIOA 4QOHA 3UHPA 3ZI4A 4BKRA 2HSEA 1N9KA 2YOFA 4O2AA 4RA9A 5D5HA 1GITA 3OZIA 4WJKB 5KTTA 1ATIA 4KQJA 1DC5A 5FWYA 4OIFA 1ND6A 3DZKA 3LI2A 3CZQA 3QU9A 4LXYA 2CXUA 4TT8A 3S29A 5ADWA 1ZA1A 4FW8A 4ZO4A 4AFNA 4EFNA 2OP1A 2B7CA 2K2QB 2VJNA 3FBGA 2H07A 2SKCA 3KJEA 3UGKA 5FPYA 3PXXA 4WCDA 2A78A 4D8TA 1WVMA 5JXWA 2FJ0A 2OK7A 4HXGA 5FYDA 5SZKB 1IM5A 3V6LA 3P2EA 4IH9A 4ILKA 2WWFA 3H1AA 5DYYA 2Q1XA 3KKLA 2LV8A 4UBKA 3UJAA 4BB0A 5IPFA 1AMNA 3MGCA 4OHPA 3AZQA 3HWX1 5JNUA 1ESCA 1AY0A 1E8MA 2ZJ5A 5CM8B 3DZ8A 1UM9A 1DZIA 3ZBPA 4ZMBA 3LG2A 2R6R1 3PTLA 3GUZA 4DMCA 2C88A 1SXJE 1GNRA 5DYIA 4B4DA 3CZRA 4H7HA 4US2R 3LCJA 4G9BA 1FLNA 1E5TA 4F60A 1W46A 2BBOA 4F9TA 2CLEB 2QUIA 1QGDA 2CMHA 3DFUA 2SCUA 2Y0CA 3G0GA 4MWSA 2BKEA 1OVMA 4W9NA 3KK0A 2X1HA 3NU1A 3PUHA 3D8SA 2IYYA 3O2JA 4YJ2F 3RGWS 4C89A 2Q49A 3LXMA 4JENA 4RZSA 4JNCA 4BJ1A 4V0RA 2IY9A 1I36A 1A5ZA 1M2OA 3UB3A 3BMOB 4R98A 3PDIB 2L17A 2YV1A 4ARAA 2VNKA 2E87A 4IG4A 1C1XA 3VRHA 3RIYA 5IJ9A 3FJOA 1Y9ZA 3ABRB 1VP3A 2VTBB 3L0PA 4UUQA 2Z3WA 4X5OA 3KZXA 4ZI5A 3NBZC 1DQNA 2R7KA 4GYKA 4B81A 4JC5A 2FSVA 1CEYA 1K5PA 3OFKA 4P1ZA 3JYOA 3HZOA 1G2PA 3GFFA 3K9CA 1QTIA 2R7MA 2EBFX 3U37A 1KWKA 3A6DA 4GLOA 2NUAA 1EZ4A 4EABA 2HMTA 3BFVA 1I3KA 3QUAA 1AMUA 3I34X 1U6JA 2H9IA 1Z45A 2FZKA 1ZSNA 2C29D 1FDOA 3DMGA 3OHSX 3C45A 4IR7A 5EYPB 3C1TA 3HV0A 1X19A 2PPVA 5EL0A 3B3JA 3EVGA 1SRQA 4G8CA 1AGNA 1E0DA 4I46A 4RULA 5CITA 4MVJH 2EFEB 4GNRA 3NTUA 4IDEA 2QYTA 5TPZA 3TJMA 1XNGA 3JQQA 1IAQA 2IS4A 2QWXA 3ENWA 1W96A 4FYYA 3AHEA 3UCEA 4E22A 1CUVA 3A2MA 5AOVA 2JGLA 4IGAA 4P93A 4RXMA 3SZMA 2C5HA 5KIAA 3O74A 1M67A 1GQYA 3N5KA 2VC2B 1PS8A 2PQ6A 2CWWA 1UP7A 4HZUB 3W6NA 2BP7A 3Q3IA 1VCHA 4HQOA 1EAMA 2A33A 3H11B 4IMIB 3G0BA 4YXWA 2G07A 3LWZA 1DOHA 4C20A 1ELOA 4UHJA 1E61A 3UF0A 1ULSA 4KIFA 2BGIA 4TVSA 2PRYA 3GH1A 2G0AA 3RYTC 4UBOA 4X84A 4QGGA 4C07A 3K94A 1GPJA 3RAJA 4W5TA 3DAYA 1YRLA 1PUIA 1TMYA 3RYIB 2PWPA 3AF5A 2PH5A 1UXKA 5ICMA 1GO2A 3I0ZA 3TF5A 1WXXA 4C06A 2E18A 3JTEA 2YY5A 2FA9A 4AG5A 1V1RB 4K9QA 3PPIA 5JYEA 1EZ1A 2P6NA 2A3RA 3BE6A 4KE8A 4K9LA 4ZYUA 2HJGA 3I0MA 3LUAA 4IFBA 3M3DA 1T2NA 2V5AA 4QBIA 2IV3A 2HIAA 5JATA 4J1SA 4C08A 1T5BA 5AK3A 3H5OA 4ZAFA 3JASB 4AJJA 5CH5A 4MVJI 1KVSA 5FXMA 5JPIA 1BWSA 2OV4A 4YDSA 4EHDA 1XYVA 2PT7A 5TVKA 5EMLA 3I6BA 3LPAA 1FRZA 3HCRA 1QVRA 3DC2A 4GX5A 4H18A 4I2NA 3RT1A 2IHTA 1G4UR 2C5GA 4D3YA 1V48A 1L4HA 1NW6A 2E85A 2XADA 2B1JA 3ZWPA 3SJCA 1FX0B 4B6GA 3B3QA 1ULZA 4GE0A 2ONCA 3KZKA 4LMBA 4EKGA 4KITB 1STOA 2Y0BA 1GR0A 5FBRB 3GEEA 4GKKB 1I33A 3C70A 5JZBA 2DPGA 1G3UA 1ZW6A 3RIGA 3VPXA 4CMCA 4P84A 1XNJA 2KE5A 3K0CC 4MV4A 4YYZA 5LPNA 2HO4A 1USUA 4QBHA 1UAYA 4CEJB 3V4FA 1OZHA 1DFIA 5BNWA 5HW0A 4BU1A 4X1IA 3OZAA 4S2EA 2IUUA 4JP3A 1X2EA 1XQVA 3H86A 3GG9A 3KYBA 4H1VA 4KIJA 4Y2VA 3ZWNA 3RYHB 1NKTA 4HXEB 3KBBA 1VJTA 4LDQA 4UMEA 1NMZA 1KDVA 2QX9A 4IIVA 4QUJA 2JLWA 1QHFA 1BEEA 3P0JA 4BLSA 4RTOA 1NI4B 1ZCJA 4IWNA 4Q3LA 1K8QA 4RE6A 3EUEA 1FYWA 2WJHA 1LF5A 3JASA 1QAQA 4HGPA 4HXFB 1BCRA 1I7DA 4N82A 1YCGA 3HTXA 4QYWA 1KARA 3D4LA 2DM6A 3AV0B 5I8WA 5K4GA 2XB8A 2YL2A 4TMXA 5FTNA 2R1UA 2P2NA 1LD3A 3I01A 1Y7PA 2C00A 2TS1A 1GKYA 3PKIA 1BDBA 2ZTLA 4OQLA 1QE0A 2YBEA 3GFRA 1F5NA 1UP4A 4P3XA 4YRFA 1E3LA 3TN7A 5KVVA 4ZT2A 3IP3A 4WHMA 3ZDFA 3FX2A 1NR7A 2O2GA 3DHVA 3AF3A 3L6OO 3OM8A 4HWGA 4JB3A 3BE5A 4W9RA 4G0YA 3WV4A 1NBEA 4DREA 5BUQA 3L8HA 4Y2PA 1CZLA 3P4XA 4CEJA 3OM9A 3NT5A 2H1IA 4GZ6A 4H7IA 4UU8A 3GF4A 3K7EA 3L41A 3P9XA 3U80A 1EHCA 721PA 1YOVB 2Q0XA 4OO3A 5CB4A 3R5KA 2CLIB 4OEHA 2QRZA 5AD1A 1E79D 1SUFA 3E5NA 4IDOA 4F11A 3DZDA 4JAVC 4KDEA 1K88A 2VT3A 5B7NA 1R0RE 5DF1A 4B4OA 3U17A 2AEJA 4EYOA 5K0NA 3DTNA 2I1QA 2BGUA 5EKXA 2QAJA 3TCNA 5H9WA 2LRHA 4Y8VA 4UTOA 1P0CA 3IKLA 1OLXB 3Q3JB 5JU6A 2XIQA 2VAMA 2FI1A 2FMFA 2PT5A 3G82C 2FPXA 4X45A 1SD1A 3DMRA 2CZGA 3HLKA 5B12A 4RKWA 2NQ2C 1GGMA 1GRRA 3O9MA 4K1LA 4V38A 2XT0A 4WLVA 3KXPA 1QHGA 5FOXA 4Q1EA 1ACMA 4CMHA 3PX7A 1OFIA 4WGGA 1QP8A 1C1DB 3C1OA 3WKCA 1BU8A 5T7BA 2Y8EA 5K05A 1NSFA 3PU6A 3JCZA 4HATA 5GIPE 3LQ4A 5DOVA 2FTKE 2P2LA 1VYVA 1MZVA 2GO7A 3KBOA 4PZLA 2X40A 3E2IA 3KLBA 1YRHA 1HDCA 2VDWA 4IJQA 4RK0A 3TGWA 4I81A 3W8NA 1TTQB 3G89A 2XGSA 1E3MA 5I7SA 2LPMA 3PEVA 1Q16A 2IY7A 2NZUG 1SVMA 1PU2A 1TO6A 1CLUA 2O7SA 3ZWKA 4X1YB 3EAFA 3GQBB 3FMIA 4I5EA 4RDHA 5CEJA 5EIEA 4RF4A 4GPD1 4LQCA 5FPSA 3S7TA 2YCLA 3MQ2A 4DUZB 1C4XA 1C1XB 4ZZ3A 1HTWA 5H9VA 3F3YA 4RQBA 4TMZA 3RC7A 3R8CA 1XU7A 3IEIA 1XWIA 5KYGA 1C8KA 3TXXA 3Q7SA 5B64A 4YR9A 3LF2A 4OGKA 2FOXA 1ZNYA 4KTTE 3AU8A 4MX8A 4QLAA 4ZCSA 1JB9A 1UL1X 2COEA 3BA1A 1G7SA 3D5EA 4MVJG 3KUCA 1LS6A 3EG9A 5TQJA 5CFOA 3B2NA 1JI0A 4MS3A 4ZARA 3CRMA 5BXQC 4CM9A 3UY4A 3NALA 3VPSA 4DIMA 1Q0RA 1MABA 2PXHA 1JIJA 5JJIA 4HQKA 4AECA 3FAZA 3W0LB 1W5BA 4DC0A 1H2AS 1SMKA 5FV7A 1D6NA 2EJBA 3PC8A 1QRRA 3NYQA 5DH9A 1PSZA 3OZXA 3PJDA 4LJSA 2FVYA 4OSPA 3VJRA 3PG5A 2ZDGA 4KQKA 2FPSA 1ZK4A 5IUJC 4CN9A 1Y1KE 3AF0A 1K8ZB 1J24A 3CNNA 1TYCA 1V71A 2P0YA 3C3PA 3EH2A 3JPWA 3QTTA 2XA1A 4HLCA 4MRRA 1P81A 1QX3A 2JIZD 3I6QA 3G2HA 3PPWA 3B1KA 4G1CA 4MR9B 1CY4A 1Q1BA 3DYIA 1XA3A 1Q7RA 2CZCA 3GLHB 4Q6WA 5KKNB 3M89A 1DXQA 3O9ZA 3O84A 4YH1A 1WSDA 4ND8B 5E3IA 3HUEA 5EIBC 4DMFA 4XYGA 3IPLA 4K9DA 1Z2CA 2BI4A 1C9NA 5KJ6A 1AZTA 1MQSA 1T0IA 2CXTA 3IERA 4UMDA 4YJ3B 4FGUA 3RF6A 3RVNA 3VSEA 3DTVB 3X1YA 4L0MA 4B4WA 4XDZA 2IIBA 3E6AA 4OYHA 5DNWA 1Y8ZA 4EG0A 1KDOA 4K3UA 2FQXA 1XUOA 2V4UA 1L5FA 4RTPA 1YZYA 3PDCA 1Y3DE 1SC3A 1GQOA 2QENA 2ZUBA 4N0PA 3HP4A 3WZMA 3ONDA 4AJIA 2UUBB 3JRXA 5AM4A 2C2ZA 3PHIA 1V7QA 4E21A 4XYLA 2E4YA 1NF8A 2YY6A 4HFJA 2JFUA 3MUFA 4OLFA 4IX1A 2IQIA 2I8LA 2CUNA 4RSMA 4WNCA 3ZEIA 5DTQA 2BFEB 2WWIA 3B38A 1G17A 1AT1A 3A70A 1CVRA 4HGQA 3C8MA 3HMKA 4MKRA 4N3NA 5JMTA 2G70A 2EGGA 4QUHA 3I5XA 3HDJA 4EF6A 4HS4A 3TZBA 3ZHCA 5JAZA 4B34A 1BQ3A 5TMDA 3UXYA 1AQNA 2OORC 1DELA 4LISA 1U2TA 5EHXA 1JBEA 3ZJTA 2GD2A 3LT0A 3ZVMA 3GVCA 4DCJA 4C6HA 4F2GA 4Z7JA 2E82A 3AYZB 3RK4A 5JVDA 1Z26A 3DEYX 2BMDA 2EBWA 1F0PA 2WHYA 4OH1A 4GYYA 2GZ3A 5M2QA 1IBKB 1VLJA 1PR6A 2FFJA 3FWHA 1A9OA 4RK5A 2X6RA 1L6RA 2EP8A 3IUBA 3BFXA 3UNXA 2LDBA 4TTTS 2BFPA 4RC9A 2HC9A 2VTEA 2Y93A 3H75A 5LCXA 2V4MA 5TR9A 4M83A 2PM8A 1BZYA 2SNIE 2Q5OA 4N6NA 5E9QA 3ZZMA 1N2GA 4KFSA 4P92A 2FPWA 4JYCA 4YMWA 2I87A 1GU7A 1W1UA 1O77A 4FIDA 1OZGA 2P5UA 1ZC4A 2XUKA 4M60A 2JI7A 4Z3DA 1V3UA 1KO8A 5DYTA 4C04A 5KQMA 2LBPA 2MIIA 3ZX5A 1KQOA 1EUZA 2A88A 4M1WA 4PZCA 4LGYA 3JQ7B 3AKDA 3RYFA 1IBRA 1YJ5A 4P8RA 2VBGA 5KO2A 2E9SA 2F17A 2FWIA 2W2NA 1O8CA 3ITNA 4K2AA 2W70A 4F46A 1VG0B 4C7OA 3OFJA 1DKLA 4NG5A 2R84A 1FYXA 1JKJB 1ZI6A 4NCIA 1S3GA 2V98A 3I76A 2ZSAA 4A03A 4CM8A 4Y2JA 3P0RA 4MVJF 1E3WA 2X15A 3KC2A 4BLTA 4BLRA 4NPAA 2ZE6A 4WFKA 4YLGA 4YAUA 4XVHA 1FSFA 1U9IC 3CX3A 4S12A 2VSXA 3S2UA 1VHJA 1SVLA 3F7OA 4YFYA 4JOQA 2C7GA 5DGCA 3TMAA 3W3AD 2QJWA 1QV7A 2OSVA 4N54A 1TAUA 4LE2A 3EVTA 3BHNA 4ZQEA 4JX8A 5K8TA 1XJ5A 4M8NE 3E9CA 4CF6A 1GSIA 1VPVA 2NPFA 1K7YA 2VEOA 5IKEA 1JH8A 5F7ZA 1RR6A 5KNBD 2P9CA 3QEMA 2ESRA 3B3GA 3L82B 3UAXA 5HZKA 3TGLA 2XZLA 1H2WA 1WMBA 2O20A 4U6NA 3UAGA 4AUEA 1GLGA 2GJ8A 1DRWA 3HRIA 2C9DA 2WD7B 5KHLB 2OAQ1 3FH0A 4YJ3F 2YWEA 5MHTA 1KEUA 2W2TA 4JVMA 1WIWA 2WR8A 1RM5A 4KXWA 1G5FA 3AUAA 1H6DA 2NTJA 1EP3B 1RVV1 1NQAO 4LI3X 1VLMA 4V03A 5FFMA 2W8BA 3VHXB 3VJMA 4I8DA 2DHCA 3CW2A 3QOYA 2R8ZA 4QGAA 3ROGA 1T8WA 1YL5A 1R5OA 1N3IA 4I9UA 1Y5IA 1JHYA 2VH2A 3PK0A 1QDUA 4M7PA 2DH6A 1IPEA 1DT3A 4LQ4A 5DI3B 5DP1A 5DTRA 5EPOA 1H22A 3R23A 1S2IA 1KDZA 3P0FA 5BPHA 3GJSA 4JDPA 4F2DA 1H4TA 3GDWA 4KJXA 1EUDB 2YASA 5FKJA 5BSUA 4ARZB 4EP1A 2GEDA 1OFHA 3MAAC 4CM4A 1MDFA 2HMAA 2X2FA 4YB8A 3TTVA 1GTG1 3BX1A 4OQEA 2DC1A 3G2LA 3EGXA 3KETA 2AN5A 4ESEA 5L7TA 1JVNA 3SQMA 3SYRA 4B6FA 1ZONA 3DLCA 4F6CA 1X9GA 3DGEC 1KETA 4EELA 3CLUD 3R3YA 4L5CA 4UVEA 4AD8A 2Q3JA 1T2CA 1ZFNA 2L42A 1I6MA 2GT1A 4DVJA 3A6LA 3ITKA 5CD9A 3C7AA 4RQAA 1I7LA 4D8VA 1EHIA 1PNQA 2PLNA 3P26A 2AJCA 4HQ6A 4NZOA 1V8PA 3VDQA 1PUJA 3PXBA 4DIKA 3JD2A 4HAYA 2HPVA 1ZMXA 5K0GA 3LBFA 2PL3A 5K0EA 3H5NA 2O0MA 3GDFA 4BAUA 2O6LA 1XMJA 1HFWA 2GN1A 3C3EA 4N03A 4RWZA 5C5IA 4OQMA 3R8XA 3AF4A 1RHKA 4K03A 4AY3A 3ZWOA 3K9BA 5GONB 4JS0A 3VPBA 3RRMA 4EAAA 4J0EA 4Y6PA 3DEAA 4OMDA 4P7FA 4UHEA 2W71A 3FG9A 4CKEB 2WB2A 4BECA 2XJ9A 3ZJUA 2ZSKA 3C4VA 1TM2A 1TKBA 3WL3A 1T6BY 1XDSA 2ID8A 2QUZA 5IBPA 4AJEA 4QZVA 4FWBA 4M2LA 1CZKA 3CEJA 2ZB4A 5ALQA 3QLEA 4M6WB 4GP6A 2QROA 4Y98A 1UFRA 3CF2A 1HEIA 2IF0A 2VWPA 4GLJA 3SHOA 3V46A 4PX2A 2OXRA 2B83A 3P97A 1N2CB 2P35A 3L1UA 1P1FA 3TIGA 2NQ8A 2CXQA 1RACA 1JEQA 3DFZA 3NIGB 1DCKA 3DDCA 3A1SA 4W6QA 4NZ9A 4CG0A 4EITA 1P60A 2XXBA 4EUNA 3KG2A 3H9BA 3L9XA 4G5RA 4GECA 5TQ0A 2J7KA 1SHZA 1XZMA 3FGZA 3UWKA 1GP2A 1QE5A 3GW8A 4IMRA 1JQEA 4HY3A 5BMVB 4V1CA 3GLQA 4R3WA 1VE6A 4WE3A 2H16A 3F8TA 2BM0A 3RREA 4ICIA 4CQNA 3WGNA 3Q5DA 2FK7A 4RCYA 5BV2P 1LI4A 4EATA 1L4EA 1IRIA 3C7CB 4AN4A 2R6GA 3BWEA 2HSJA 3B9RA 4KIUA 1NAHA 2ZUFA 3PA6A 1T8RA 1Z82A 1BGXT 2DTDA 5H3HA 2X22A 2X8JB 1XFAA 1XL1A 2GK4A 5F5NA 3S40A 3VZQA 1XMXA 5BORA 5JS8A 1CW2B 1OV6A 3ADKA 3NM5A 1SWVA 4OGGA 5G0SA 4QTZA 2J08A 1SBQA 5HILA 5KOYA 4MGIR 3O4JA 2ODAA 1OR8A 3SLRA 3TPCA 4EK9A 4AYWA 5CBPB 3FE2A 4BO6A 1NN3A 4BPRA 4Q7EA 4JN6B 4EW6A 5AI5A 4C30A 1QRUA 4Z99A 1QQ6A 3MBKA 4JKIA 1V45E 3DA8A 4DPLA 2P3OA 3NW9A 2BMVA 3L0BA 3UJBA 5EAIA 3JZDA 3ZU3A 4E5SA 3NAMA 4ETMA 1ZVVA 4F6RB 4HNUA 4BV9A 1WABA 1RAAA 2IXEA 2P69A 3A9CA 3IKMB 2SKDA 2XHZA 3EFEA 2D8MA 1HDXA 3M6VA 5CT6A 4DJDC 3C4QA 1TEZA 1NY5A 1KO1A 1YZUA 4Q3DA 4CLRB 2AC2A 3AW8A 4IDAA 2H8GA 4MP3A 3O83A 5CXQA 2M6SA 2QN3A 5L7YA 3ZK7A 2DAPA 1Q0LA 1V1MA 3DM5A 4CKYA 1T5DX 3MINB 3ODPA 4HUQB 3ICVA 4RFSB 3CWQA 2OO3A 5AP9A 4QRHA 5TGZA 4UFPA 6REQB 3QE3A 1M2FA 1GKIA 3M1YA 4K9RA 4UHHA 1Y42X 1MC4A 1JT2A 2OCBA 2WKSA 4TV8B 1GAWA 1ZMRA 2H7CA 1JQAA 5IDYA 5CLHA 1MX5A 4Z51A 3OKAA 2XDQB 1G0OA 1D07A 1Z4NA 1TIBA 4M98A 1XJCA 2B92A 3R9WA 1NXPA 4V0QA 4ER6A 3U60B 2WHRA 3M3HA 2XUQA 4K6MA 1U0EA 2HLNA 3Q15C 4EMUA 2ORIA 2WG0A 2F3SA 3N2KA 4MUJA 1RYDA 1CLEA 1US8B 4GXRA 3UWMA 4ZEXA 2WU0A 5B3AA 1CUSA 2RHHA 3X2EA 1ENYA 3PIRA 3HCNA 2ZRJA 5BWOA 1W36D 4YP9A 4ZVRA 4CYMA 1XQXA 1OAKA 1ZSVA 1P44A 4Z4HA 1ACJA 3TVYA 3CN7A 3RUFA 3AIOA 4M1QA 3PEUA 2Q9BA 3IOEA 4J0DA 3O8DA 4L85A 2NO1A 4WZAA 1DKNA 2V6FA 3KYIB 5G3YA 4Y18A 5JCZA 4JI8B 1OBFO 2G1UA 4A2PA 3CJRA 2ZR8A 3DZJA 4KDRA 5CA1A 1PD0A 4C0WA 3EUFA 1KMNA 1ITZA 3LFTA 4E31A 4QQ8A 3WKAA 1GGKA 3SP1A 2GN2A 2WKQA 4UDNA 4RD6A 1RNLA 1J8YF 2VRBA 3G5MA 4G0MA 2JCXA 2XCUA 4I9NA 3LOPA 1EK1A 2OZEA 3W4JA 4IV8A 3MS4A 1KKMA 4UUOA 4R1SA 1YCFA 4RADA 4WECA 1HK7A 2PWZA 3GJ6A 1KMCA 4IIXA 2YQ4A