4YGXB

Crystal structure of d. melanogaster ssu72+symplekin bound to cis peptidomimetic ctd phospho-ser5 peptide
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
192
structure length
190
Chain Sequence
b'PSKLAVAVVDSSNMNRSMEAHNFLAKKGFNVRSYGTGERVKLPAFDKPNVYEFGTKYEDIYRDLESKDKEFYTQNGLLHMLDRNRRIKKCPERFQDTKEQFDIIVTVEERVYDLVVMHMESMESVDNRPVHVLNVDVVNNAEDALMGAFVITDMINMMAKSTDLDNDIDELIQEFEERRKRVILHSVLFY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Symplekin
publication title Chemical Tools To Decipher Regulation of Phosphatases by Proline Isomerization on Eukaryotic RNA Polymerase II.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 69
structure length 190
sequence length 192
chains with identical sequence D
ec nomenclature ec 3.1.3.-:
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04722 Ssu72 Ssu72-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ygxB01
5B3JA 4OG2A 1KRXA 1AB6A 1EAYA 4MLDA 2PUAA 4EYKA 1PNRA 4LZLA 3G1WA 3OO0A 1DCMA 5TPZD 4YR7A 1SXHA 1D4ZA 2PKXA 3QEKA 3LFTA 1P6UA 4LDZA 4OBBA 2IKSA 4RDCA 3GBVA 3LUFA 4M88A 2AYZA 4KZKA 2PUCA 3CKMA 1FQWA 3N0WA 2QVCA 1PEAA 3M9XA 5JNVA 4G97A 4JAVC 3EQ2A 1TM2A 4LDAA 1ZDMA 2I6FA 3CU5A 3ROFA 1RZRA 5DGCA 1P2FA 2TMYA 2A9OA 4Z4FA 1ZHHA 3KLNA 4LRQA 4OLAA 1Z2DA 1TVMA 3FDFA 3OQMA 3HXMA 2ZWMA 2IDMA 4YRZA 4KV7A 3NBMA 2GWRA 5DTEA 3RVKA 4KREA 3R0JA 4MR9A 4XARA 5PNTA 3UUGA 3OLVA 4JB2A 3CNBA 1M2EA 1Z17A 3H75A 4FB4A 3T95A 1DBPA 1UDRA 5BRJA 1JHZA 2HQRA 3QLUA 2FEWB 4XAQA 5F64A 4EYOA 2E4YA 2FLWA 1DC8A 1NXVA 4HNQA 4N0PA 4WZZA 1HEYA 4MS4A 3GRCA 4W5QA 1FFWA 3EODA 1T34A 1GUBA 1U0SY 2E4XA 2FQYA 4RK1A 2FMHA 3CLKA 3JTEA 4MRMB 4Z4EA 4Z4CA 2FW0A 5IBQA 4MS1B 2NT4A 3N6VA 3OLWA 4TMYA 3HDVA 3JS5A 5C5CA 2ZAYA 3HK2A 2FMIA 1R8JA 4MS3A 8ABPA 4GPAA 1LBHA 3HDGA 3FFXA 5TQ0B 2H3HA 4RXTA 1DBQA 3SG0A 3W9SA 5TQJA 1JH9A 2PL1A 4KK3A 4RKRA 1S8NA 3URMA 4F12A 1VPWA 2LIVA 3L6UA 4MPTA 4N41A 3OLZA 1AB5A 1LJUA 2HJ9A 3M6MD 3Q15C 3DBIA 5JNWA 4DN6A 3HEBA 1QMPA 3H6GA 1ZH2A 4HYEA 3LMKA 3O2QB 4E7OA 9ABPA 2R25B 2FSPA 2WB4A 4ETIA 4ML3A 5KWSA 4O1IA 3IDOA 1YS6A 3LUGA 5EWLB 5FBKA 2NUBA 3KG2A 4N0QA 5CHYA 5DLEA 2QZJA 3F6PA 4RY0A 3DGEC 2CWDA 3SY8A 4ZPJA 4W5TA 1SXGA 3DGFC 3T6KA 5KQPA 4RXUA 2M1ZA 3KCNA 4Q7EA 4MQFA 1U2QA 2FN8A 4JASB 3QX9A 3S99A 2IPMA 2WRZA 3F7NA 3HUUA 3MIZA 3OQNA 3I45A 3HUTA 5ED4A 1IIBA 3F6CA 2JVJA 4XASA 1EWTA 4TN5A 3H5VA 2B4AA 5TPWA 3JPYA 3JPWA 1ZESA 2JK1A 4Z4HA 1KGSA 3M9WA 3O74A 4H3HB 3A0UA 4UHJA 2LPMA 3LUAA 1Z18A 3BREA 4S04A 1BDIA 3QELA 4Z4GA 1LK0A 1JDNA 4NCBA 4YP9A 3CS3A 4RK5A 2LUOA 3D8UA 1FFGA 1D1PA 2HSGA 3UK0A 1BA2A 2RDMA 1K68A 1DRKA 3QX8A 1GCAA 3SM9A 4KQ9A 2QVGA 2WJAA 4YCSA 2JVKA 2PUFA 3DZDA 4IILA 5IULC 4Q6WA 2QV0A 2HQBA 1Z16A 2MYPA 2JRLA 3EGCA 2PUGA 4EYGA 3QLVC 4PZ0A 3O21A 4RK0A 2FMKA 3B2NA 1URPA 1A04A 1PUXA 1YVUA 2FN9A 1A2OA 1MB0A 2L17A 2QW1A 3Q9SA 4YO7A 5D2CA 5EWJB 4RY9A 5FWXA 3HJFA 3TB6A 2X7XA 1F51E 3KYJB 3OM0A 3MA0A 3UKJA 4WUTA 1CEYA 2N9UA 3A3KA 3JVDA 2H0AA 3OO1A 4KNYA 1W9HA 4P98A 4NV3A 5FWXB 5T7BA 3O1JC 3H1GA 2FTKE 2WY2D 2YHBA 3HSYA 3K4HA 3KTOA 2OQRA 5CNMA 5JS2A 3KS9A 1DZ3A 2LBPA 3EDCA 5DKFA 3N53A 4OLBA 3TD9A 3A0RB 2VK2A 5I4CA 2PUEA 1SXIA 4RWEA 4OATA 5KQMA 5IUNC 3Q7TA 3TO5A 2PE5A 4NCAA 1ABEA 1M2FA 2GKGA 3E61A 4LE2A 1JYEA 1TJYA 3EAFA 4S05A 2IYNA 4NICA 3CZ5A 1VLZA 2PAFA 1K66A 2IOYA 2P9HA 1Y1LA 4MR9B 2BGGA 4YV7A 2FEPA 4QYMA 2RJNA 1YK1A 3A10A 3KSMA 2E4WA 1JX6A 2L18A 4RS3A 1XHEA 4LE1A 4PE5B 4MQEA 5IX8A 4L85A 2PMCA 1USGA 4MS4B 3QEMA 4KFCA 3FGZA 4YS6A 3CG0A 3NHMA 1Z26A 1EHCA 3O2JA 5KI6A 2AYXA 5B3JC 1W25A 3QK7A 4G86A 1ZGGA 4W5RA 4IGAA 4RY8A 4QPJC 5E3JA 4MGEA 3C3KA 3C6QA 1QO0D 3O1HB 4MS3B 4MR7A 5EWMA 3KLOA 2CHEA 1MIHA 4KK4A 2MYUA 5JS1A 3F73A 3C3WA 3EULA 3CG4A 2MSWA 1PHRA 3HZHA 5IC5A 3FFTA 3Q41A 3OMXA 3RVQA 4Z9BA 4N76A 2A9QA 2QU7A 1GLGA 5TQ2A 2A9PA 1B00A 3H5TA 1CYEA 3FFWA 3EJWA 4WWHA 4Z99A 1JDPA 1NXTA 1YK0A 1WETA 1Z12A 3GT7A 1LJLA 2JVIA 1JFVA 2LP4Y 4PEVA 4G0MA 3T38A 1NXPA 3CZCA 3NHZA 4JB0A 1D1QA 3I09A 4WT7A 2DRIA 3OQOA 1YIOA 5IEBA 4F3TA 2WMYA 2JBAA 4ZYLA 3H5WA 4F06A 5T3YA 3OM1A 3C97A 2NT3A 3KHTA 4PYRA 5IUJC 2NZVG 4RKQA 3OMWA 2XDYA 3QLTA 4EUKA 3LKVA 3RH0A 3E3MA 1XWWA 1JBEA 2QR3A 3N0XA 1ZH4A 4MQFB 1BDJA 3ROTA 2JB9A 2HPHA 4E7PA 4EVQA 2QXYA 1BAPA 4PICA 4D74A 3IP9A 3N75A 5JNRA 3DLHA 3VNAA 5DCLA 2FQXA 2M98A 3MF4A 1PEYA 2OENG 4XXHA 1QO0A 5FBHA 1EWVA 4ZJPA 1E2BA 4Z4IA 4RK7A 1P8AA 3L49A 3QELB 4IMJB 1BDHA 1NTRA 2PL9A 4O5AA 4TLMB 5GOTA 1QP0A 5FWYA 1JFTA 4HNSA 1GCGA 3MQ4A 1DCFA 3RVSA 1E6KA 4ETMA 1MB3A 2FKAA 2RGYA 2VYCA 4G0PA 3H1EA 3H5LA 1ZITA 1QQBA 1RXEA 2R47A 1RXIA 1JWLA 1RPJA 1ZGZA 1J56A 3CRNA 3GBPA 4FE4A 4RK4A 5CNKA 1ZY2A 1QNLA 4OTZA 1USKA 3TMYA 4KQCA 5TPWB 6ABPA 1MVOA 2R48A 2WJWA 4P1ZA 2WWVD 2IPNA 4G0QA 1C4WA 5KQGA 3EQZA 2A9RA 1OXBB 2E4UA 2MSLA 4KMRA 1QPZA 3ILHA 4RZSA 4YGXB 4RU1A 1DG9A 1RNLA 4KPYA 5KQLA 1A0OA 1Z13A 1L5YA 4MR8A 3O1IC 1DRJA 1MAVA 1PNTA 1U04A 3N0RA 4EGSA 2VUHB 5GQSA 3MMNA 2YHAA 3P9YA 1JLKA 3VNBA 2L19A 1M5TA 1C0EA 3C3MA 3JY6A 1D2AA 3JVIA 4MR8B 5HM6A 5JNTA 5JNUA 4Q6BA 2FQWA 1P6QA 3O75A 1M5UA 3H1FA 3IP7A 1Z25A 3Q7SA 1L5ZA 3RQIA 2F8TA 1TLFA 3NNSA 4D6XA 2JCGA 1VKRA 2R4QA 1ISRA 1I3CA 4W5OA 1KRWA 1OXKB 5KC9A 4EVSA 2RJOA 2MSKA 4XFKA 3LOPA 3BBLA 3MM4A 3KJXA 5IUKC 3LUJA 2MYTA 3SQNA 2CD7A 3HCWA 2PUDA 2J48A 2IPLA 3H5OA 4EYQA 4YWHA 5CNJA 1D5WA 1Z15A 1DCKA 2MYNA 3N8IA 4H60A 4MQEB 4Y9TA 2VUIB 3LUHA 1YTUA 3BRQA 4G0ZA 2IPAB 2PLNA 4F8JA 3FMVA 4ZMRA 3I42A 5BR1A 2HQOA 4MRMA 3QEMB 4W5NA 7ABPA 3LUCA 3CHYA 4LX8A 4Z9AA 1JL3A 1GUDA 4MS1A 4G0YA 3LKBA 4LE0A 3RVPA 3O2SB 3IP5A 3I5AA 2FLKA 3ILYA 2FMFA 2PJUA 3LTEA 3HM9A 5TQ0A 3BILA 4DADA 4IRXA 4ZMSA 1ABFA 3MYYA 4NQRA 2FXIA 6CHYA 1YMVA 3OLYA 4N03A 1E6LA 5JNSA 3GA5A 4MR7B 5EWMB 4DQDA 2FEKA 1QP4A 2GX6A 2L2QA 3RVNA 5C5EA 4YLEA 3SNKA 2E4VA 1VRVA 2NZUG 1LBIA 1U8TA 5KC8A 5TPZA 1YMUA 5CNIA 4MLCA 4QYWA 4MYRA 4TLLB 4KRFA 1ISSA 5TQ2B 1TMYA 1QP7A 2GBPA 3H5IA 1JFSA 3TX6A 4F11A 2B1JA 2P4UA 5EWLA 4IF4A 4HNRA 3CTPA 1ZAYA 3QLVA 4EY3A 1JF8A 3RVLA 3QLUC 1NATA 1DJMA 1KMIY 3GWGA 4L4UA 4GNRA 5IEJA 2ID9A 3HS3A 1XHFA 2JBAB 4JA2A 5TE9A 5BRAA 3OLXA 1DP4A 4RSMA 1NXXA 3RVOA 4XLTA 2E4ZA 1ZVVA 1QKKA 4RV5A 2Q5CA 2KYRA 3H6HA 3G85A 2W42A 3Q7RA 2PUBA 2FVYA 3K9CA 4H3KB 3KYIB 5BQ3A 3HVRA 4B09A 3IPAA 4CBVA 4WXEA 1Z2EA 3DLBA 4Z0NA 3GV0A 4EVRA 5HKOA 1YS7A 3IPCA 4UHKA 4N47A 2O20A 1RZRD 3GL9A 4D6YA 1NXSA 2CHFA 5ABPA 1EFAA 4RXMA 3HO1A 2F8SA 3GYBA 3RVJA 2GI4A 1NXOA 3BRSA 1NXWA 3NNNA 3HV2A 4MAAA 4O1HA 4JP1A 4FE7A 3RVRA 3NNDA 1BVHA 3LUDA 1H9CA 1ZN2A 1FSPA 4ETNA 2QSJA 4KVFA 5FWYB 5HSGA 1F4VA 4WXMA 3T8YA 1QQAA 1JYFA 3SAJA 1DBWA 1FFSA 2V0NA 3IP6A 3KKEA 3LUKA 4RK6A 4IMIB 5HQJA 3CFYA 3D02A 3RVMA 1APBA 4G0XA 1U2PA 4JOQA 1DC7A 1SD5A 4G0OA 5EWJA 1EWKA 1SRRA 1NY5A 4QICA 2ID7A 1USIA 1CHNA 1E6MA
chains in the Genus database with same CATH superfamily
4MIKA 3UMFA 5IU6A 4C0KA 1SU7A 3FZYA 4RDIA 1ZMXA 4FYPA 1HFEL 1R00A 4AF8A 1YZKA 4IJMA 4CM7A 1O8CA 2LKCA 5TJ9A 1XRQA 2GJ4A 1ZD1A 5A9SA 1H2YA 1T5IA 1XCMA 4F2HA 4AW9A 2AXNA 2C94A 3IERA 4QOJA 5C32A 3LJKA 1V9LA 3FROA 2PKXA 3OBBA 3ZY4A 1WRBA 2NGRA 4YMIA 4CLOB 1ADFA 4IUCS 3VAZA 1KK1A 3W8RA 1XU4A 3LUFA 5BPHA 5TB5A 3HBLA 2H18A 1C7ZA 1FQWA 1J2RA 3KM0A 3OPQA 5E7MA 3USZA 2FJ0A 5H0IA 4PIMA 3KJZA 1V8PA 2OB2A 4LDAA 3AEZA 3U3MA 4DMRA 4EECA 4Q1CA 1IWPB 1ZHHA 3EZLA 4PC2A 4UAGA 2YV1A 3JZMA 1CNFA 1HNNA 1QH9A 4JSTA 4PYQA 3WI7A 5BW8A 1VJ0A 2PFSA 2ZJAA 4R83A 1JHAA 4ENVA 4C7OA 3VKGA 2W4QA 2WE7A 2H06A 3JZFA 4JJ8A 5F5XA 1LWNA 2GEUA 5JRDS 1MW8X 2VDPB 2WZCA 4KL8S 3H75A 1GQ2A 1M8KA 2FX3A 1E4YA 2OECA 4GBJA 1OR8A 5JR3A 1L5QA 3A1TA 3AEYA 3FUXA 2PD6A 4ZVOA 2VPIA 3CLTD 1JAIA 4BE7B 4LK3A 1BXRB 1FFWA 4P3NA 4TMWA 4F7DA 3COPA 4AMVA 3D6NB 1WP4A 2EZ9A 4E07A 4EBFA 4RK1A 3JTEA 4BGIA 5LKRA 2SICE 4IXDA 5EZYF 2OB1A 1NT4A 3EG5A 2Z2XA 3F8WA 5ER6A 5FQNA 3X43A 2QRMA 1NUPA 1ND6A 3N8DA 4C01A 3AL0C 4FPXA 4QREA 3ZVLA 2HMAA 1QS0B 4C5BA 2B4KA 1T4CA 1XEWY 4I8DA 1IH8A 3R4CA 5D51S 3HDGA 3ZPXA 3ZXUB 5ALDA 2V4ZA 1L3BA 4C87A 3JQGA 2ZPAA 3JQAD 3EASA 3QEOA 4HPWA 4OXQA 4MKHA 3O93A 3SR0A 3AI3A 4ZQBA 5CEFA 8LDHA 4FEEA 1YVRA 5T67A 1LK5A 4GC9A 2RAVA 4LQDA 121PA 2P9ZA 2WT8A 3USCS 5CM2Z 1SXQA 1IUPA 2R6GA 1QB8A 1XVIA 1KPGA 4TWAA 4I4NA 3HNPA 4MK4A 4Q1EA 1FUKA 4ZEVA 3QNUA 3FR8A 1CLEA 4ETIA 1IZ0A 4EG7A 4C30A 3NYIA 1VE1A 3FFBA 2IYUA 4IGFA 3K2EA 3S3TA 1AZLA 1B1CA 3BGIA 3KG2A 1P7WA 3I01M 3QYJA 4WGFA 1RW4A 5EXEA 5IHPA 2VP5A 3B1JA 4HKTA 2RHTA 1IHDA 1L5GB 1F38A 1NFRA 2G88A 2ZRGA 7GPBA 3U6KA 3I62A 1Z73A 4MV0A 4F92B 1J70A 2VDNB 4B2IA 5A7FA 1GFSA 4NMLA 3GY0A 6YASA 1DTWB 2QQ5A 1YCDA 1Z83A 2JFVA 4EATA 1DUIA 1O95C 1RRVA 4YEDA 5B4TA 2UU9B 2K4MA 4NNJA 3QFHA 4BATA 4UPEA 3ON5A 3MIZA 3ND7A 3RO7A 3VKWA 3VSCA 2PG3A 3LHKA 4IXTA 3F74A 4FFSA 3P9ZA 7MHTA 4HSGA 4MCJA 4K6KA 4RA6B 3C1OA 2BRUC 1HE3A 3B13B 3O74A 1IZ7A 3EYWA 4I2NA 1KDVA 2FN4A 1Z18A 4K7JA 1J1UA 1R6UA 5DBOA 1CB7A 1NW9B 3Q6IA 1HMYA 4F84A 4EA8A 1LK0A 2XBMA 3IGFA 3ABZA 3T3PB 3ZQ4A 4NCHA 3BH0A 3R6WA 3AHDA 2Z4RA 2YINC 4V3CA 3IAXA 3Q7QA 3RC9A 2BGJA 2XH8A 1DCTA 1JHPA 4HWKA 4QJ5A 4X85A 4KITB 2W8BA 1NBWB 3CINA 1ZNQO 4OB7A 3X0DA 1LH0A 1II8B 4U7GA 2RHGB 3H2IA 1TW3A 4TXNA 1TF2A 2H5LA 5AVYA 1SU8A 4MIOA 4NFHA 2EERA 3DCJA 1U3GA 1AQ6A 3DZDA 2M6RA 2W6ZA 3KUXA 2QV0A 3KD3A 5LQSA 5ALIA 3DFKA 3ZDAA 2MYPA 4I0WB 3K20A 1LI7A 1WPXA 3PENA 2CKMA 5CCEA 1JAYA 4YUWA 1WB9A 4N6OA 1A2OA 1PW7A 2QX4A 3ZZ0A 1E61A 2Q6LA 1FP7A 3HJFA 1EB8A 1FFXA 1HFKA 4QPNA 3G2IA 4GXTA 1CEEA 1QHNA 4D99A 4KXLA 2GAAA 3O8RA 2FG6C 1UWLA 1ZJ6A 2OMKA 3MRTA 3BWYA 4FD2A 4I55B 5J59A 3KSUA 2OV2A 1VA5A 2EU8A 4FC6A 1W9HA 3PGVA 3H11B 5B5SA 3U44A 1HX7A 3O1JC 3O4RA 1K4YA 4E88A 2PSEA 4LRYA 4OXXA 3MWEB 4RQAA 1I7LA 1KAMA 1OW3B 3LCJA 2IOQA 1E7MA 1T5LA 3RBVA 1IFXA 5LOVA 4KNWA 4RLFA 3TS1A 1A9YA 5H82A 2GPWA 4IG4A 3RK1A 1AQUA 5KHOC 4GKKB 4FMBB 2PE5A 3E4CA 4DRXA 4Z2YA 4UU0A 4PYMA 5KX5A 2PZLA 4C03A 1U28C 3NVAA 4OX9B 3ZYCA 1FUIA 1KKMA 2OFOA 2QRJA 3WY9A 2H0QA 1YQEA 2Q6VA 4H6PA 2PAFA 4NCIA 3VV3A 1L1QA 1AG9A 2R86A 2X1VA 1BMTA 2WSLA 4W1SA 4U7WA 3WGZA 1Q1AA 2WHQA 2WHPB 1WPRA 4EA9A 1XI2A 2W0SA 1BCRB 4GE0A 3C98A 2BBWA 4JP2A 3RBAA 4XGRA 4CMIA 1YGYA 3PHGA 3QPVA 2BFFA 1NG1A 1T8YA 1YHYA 1AZWA 1XHEA 4O2AA 2Z2KA 4MQEA 1ZWKA 4XI9A 4DSUA 5JXGA 2RGBA 1JDTA 4D4HA 1O87A 3A26A 1PJBA 2XE8A 1WQ4A 2Q5IA 4F86A 3AEKA 3HKDA 3W77A 4AZTA 2WG1A 1VJCA 1LGYA 4I5FA 3BYZA 2GYWA 1K6XA 1XEFA 1T2EA 2FWIA 3FOBA 3MJHA 2KI5A 3PNMA 4TLBA 4CF5A 4W5RA 2HH9A 1DHTA 3DTVB 1JWAB 2B35A 2V7UA 3B9RA 4U2GA 1TADA 4WMLA 3C6QA 1AC5A 4XD2A 2O0JA 4KB5A 1XRLA 1JRLA 3TAHA 4A6EA 1OH6A 3D2AA 4CL3A 2QSYA 2ZBRA 1GR0A 2ZB7A 3IOMA 4HQOA 2XR1A 5D3ZA 3NPAA 1NMYA 2R9VA 1NUQA 1OUMA 3LT4A 4OQYA 2J7KA 2QV7A 4U9IS 2EVWX 3CMCO 3B7GA 3FUCA 3BMQB 4DB2A 1Q44A 3RAPR 4ALNA 1NXTA 1QHXA 1AX9A 1Z7EA 4ZV7A 1TAGA 3X2FA 4M1WA 1P9WA 2LP4Y 3PUIA 1BVYF 3B6EA 3UICA 1WMFA 2I1VB 3IBYA 3VZQA 4BNUA 2ZRBA 4CCWA 1G20E 2L0XA 1XVLA 2WF7A 3BTSA 4DYDA 5UKDA 4NJOA 4YCMA 4D9EA 3A1UA 5CLQA 3FI0A 3KQSA 4YRJA 1Z9BA 2JBAA 4LMPA 5T3YA 1NX9A 5LQRA 1XIVA 1W0KD 3RTGA 2ZUFA 4DAOA 5EZ6B 3WS7A 1MJFA 1MTOA 4KTTE 4FGUA 3ZV5A 3BEOA 4Y0AA 1I36A 2DPYA 2PA3A 3KEOA 1NV9A 5B1EA 2PGDA 7YASA 4OV6B 3H1TA 4AUMA 4TMTA 5HF5A 1ANKA 1H1DA 1ZW1A 1J8DA 1KBOA 5JISA 4Z9YA 1ULUA 3GPLA 2GXAA 5IW8A 1AKEA 3CCFA 1JEYB 2G6TA 4P3OA 1O94A 1JEEA 4LZJA 2DWCA 3V1YA 2DBYA 4XXHA 4RY2A 2XJ9A 4WXHA 2F43B 2HR1A 2QM3A 4HEA6 1A69A 3Q12A 4JOCA 1VE9A 2RKOA 3EGXB 1L4GA 3FBGA 2DJ5A 4Q93A 4LCJA 1R5BA 3LQ4A 1X7ZB 2UXBB 5H59A 4PPGA 3FHJA 1BE6A 3FG9A 3KZXA 1JSZA 2G72A 3SSMA 1DCFA 3TW0A 2IZ1A 3H65A 4TVKA 1MB3A 2QRGA 3ETEA 1UFRA 4UAJA 2WF9A 4U6SA 1G2OA 2IUTA 3H5LA 4JC4A 4W99A 5AWFC 1NBIA 3DYBA 2NAPA 2F9LA 2PSJA 5KAMA 4QVIA 2YZ2A 2FW8A 1R0LA 4GI2A 3TJMA 4CR8A 4WOJA 1EIZA 3HC7A 5SZHB 1KMHB 3OP1A 4H35A 3A9SA 4MP3A 3ZWCA 4BNWA 3WFIA 4K26A 1OBCA 1R0YA 4UM8B 3P2IA 3H13A 4CEJA 1J1ZA 3PPWA 4GPTA 1AKMA 1J97A 3I2GA 4FGZA 4EHFA 1RRMA 1UJ4A 3RS0A 4D25A 4X61A 3SF8B 1HNXB 4R9SA 5ITWA 1YQGA 3UK7A 4ARAA 2GKSA 3GLUA 1DB3A 3IMFA 4UM7A 2ZIXB 2JZNA 4NONA 1J00A 4Z49A 3NFRA 4X41A 3JQ8A 2OD9A 4K40A 4INOA 3SBOA 1N5KA 5GQSA 2WMDA 4DIUA 621PA 1NKSA 2DPXA 3ORFA 4XR9A 4N82A 3LOQA 1DIAA 5EG5A 3H2YA 3EOZA 2QLJA 2QUAA 3JVIA 3TLKA 1IHUA 4D4GA 3H4VA 3ZDRA 1Z8NA 2EP7A 2OK7A 3NBUA 2HK8A 2YUIA 3WLOA 1VCMA 1TZ2A 3UJAA 4JEIA 3FI9A 3PT5A 3NNSA 5FDFA 4YYEA 3K4QA 4FFBB 2G76A 2WYVA 5I9IA 4R3UC 4FMPA 5C8DA 4JJEA 1REQB 2PY6A 3IVRA 2PV0A 3A3PA 2MYTA 2VFAA 2GGSA 1MNQA 2BFPA 1P3DA 2ZB3A 3BL6A 3DF9A 3EF0A 3PF9A 1E9CA 1YI8A 3JRWA 4RCZA 4C0XA 1UQRA 5EZYA 4BB0A 1XK6A 2J5RA 1VIDA 1EA7A 5JWHA 10MHA 4QOSA 1WOMA 4NZZA 2VF2A 4AKIA 1NYTA 4OHWA 1YJ5A 2OAGA 2Q5QA 4G0ZA 3TDMA 3BDIA 3LHSA 3USES 4F8JA 2IBTA 4W5NA 2E49A 3QEMB 5FPSA 5SY9A 4MIEA 3KOOA 3IXQA 1FTYA 1U3WA 3AB7A 3W7VA 3CGWA 3O94A 4I5IA 4BMDA 1L4FA 2IYRA 2Y4NA 3O2SB 4IIXA 2FLKA 2DB3A 3BULA 2I4NA 3ND8A 1PDVA 5SZKB 1HUQA 4EY4A 1FDOA 2IF0A 4NQRA 5BO5A 3OFJA 3OLYA 2PU5A 4ZCQA 1K27A 3G5UA 3HR7A 3PR1A 4OQDA 3WDLA 2WICA 5MN6A 2C7RA 3RVNA 4H1TA 1FP4B 4MWZA 2H4WA 4YLEA 1OTXA 1KOGA 2PAAA 4S35A 4WZBB 2V6IA 4MYRA 4QOGA 3EG9B 4X94A 1C7JA 1RAIA 1TMYA 2GPAA 3AERB 3PNOA 4Y2JA 5I7UA 1S2DA 1MJHA 5K4HA 1XLVA 2GZ1A 5AQEA 5FKJA 5EWLA 1TYCA 5DTJA 5AOAA 3S2GA 4QGSA 5B7GA 4JROA 1RADA 4CV3A 2J9GA 4K05A 1I2DA 2OHXA 2P9TA 4KAFA 1WKCA 4W8HA 5BN3A 1K8YB 4HMPA 3LDUA 4GZLA 1XQVA 1N1GA 3E0XA 4QSHA 2WIJA 3TZBA 2J3QA 2ID9A 4BP1A 2Z2IA 5TR9A 3PPYA 3DE2X 5E7QA 2ZB8A 4TL7A 4XLLA 5DYWA 2O19A 3KTAB 3RVOA 4EEKA 1EFRD 3HDQA 2ANCA 2Q5CA 1ZICA 1KC3A 2JFZA 1D4FA 2V8BA 1UMDB 3E9DA 3EUFA 4NENA 1Q1GA 4TV9B 4B2LA 3UIEA 1D3AA 2B99A 2QAGB 4OREX 4PFSA 4KRGA 4UHHA 2QB5A 3EDMA 3WX0A 1HDRA 3FUVA 4L5CA 1C7EA 2HADA 2HSZA 3HCPA 3K8ZA 1C3OA 3TAUA 4URVR 4DDHA 5HJEA 5JD5A 2AVNA 1J49A 4KZPA 4V38A 521PA 1Z35A 2HJWA 5DHUA 1A71A 3C4JA 3UB2A 1SHLA 2CHFA 2C8LA 4D0LB 1T8WA 5CDFA 3S1AB 3TZKA 1ZRHA 1OY1A 1PRYA 4R2XA 1MPTA 1NXOA 4H7JA 5GGXA 2R8ZA 2I99A 4CJXA 2BTQB 2PGJA 3T5PA 4LTDA 2CBZA 3FYDA 2RCNA 2OAQ1 4A2WA 1FSPA 1QF6A 3QKTA 3H1PA 3PHJA 5EFOA 3VH3A 4J2HA 2V6MA 2J0UB 2A0WA 2WP0A 5EZSA 1XMOB 3VR2A 2HPVA 2OV6A 1H23A 2O3JA 3PXCX 5EQDA 1LLQA 2PUAA 1FFAA 4MYTA 2EZ8A 1IL0A 1KO8A 3HJGA 3ZJTA 3NP9A 1DOAA 1K5GA 3WLHA 2IP4A 2INGX 2ES4A 4EZBA 2GCGA 2WV9A 2I2AA 3AF6A 3DVQX 1EWKA 2BYTA 3D3EA 3S8MA 2QG9A 2RARA 4UTPA 1KYQA 3ZH9B 2JIQA 2BGWA 1I1NA 4WA8A 1OH5A 5IVHA 5JSQA 4M98A 2EFJA 2CDCA 3K2BA 1EAYA 4YP6A 3H04A 1YL7A 2DR3A 2H5IA 1IPHA 2AX3A 1OBHA 2ORVA 3FNIA 3VGJA 4Q18A 4EKYA 1W34A 3DB2A 2DBZA 2OD2A 2NPFA 4BVLA 2JFUA 4DABA 3D3WA 2VP0A 4YJ2B 1XDGA 4G8CA 2H11A 2DUWA 2I29A 2J9ZB 2QAGC 5L45A 2VWGA 1QF9A 2Z04A 4RJ2A 1GPUA 2B7BA 2QJTA 3EH1A 2F9MA 4LG1A 5KJCA 1PIWA 4FBMA 1R88A 2D5IA 4U5QA 2WVAA 2HJHA 3TYXA 2O9JA 1ZI9A 4MV3A 3WJAA 4CHGA 3O6VA 1P2FA 3PC2A 4O4IB 4FHFA 4QE3A 2AFIA 2BFMA 2JJ1A 3EEYA 3GK3A 4MV1A 3K9QO 5F21A 5JAZA 3THYA 3OQMA 3HXMA 2SKCA 4LJ7A 5G1NA 2YVAA 4HNVA 4FHCA 2XGOA 3JWGA 3L3BA 4ZVTA 3ZU2A 1KYWA 1ZWLA 3DG9A 3X2EA 1U11A 1XXHB 2P75A 4OUKX 5HJ7A 3DEHA 1VKOA 2Q1UA 1OFUX 4J9VA 1ZXBA 4YR9A 1G8KA 3FCCA 4YBZA 3DWEX 2FZLA 2HQRA 4DM4A 1IN7A 2EYQA 3FR7A 1L1FA 3AF0A 2VCEA 3H9GA 2VL7A 1UOPA 1P44A 1B41A 1USWA 2A2ZA 2H65A 5HMLA 3WGYA 1WZ2A 3W2FA 2AD1A 1EX1A 1ZZGA 4NH0A 4CPDA 4MQBA 5AUNB 1V3VA 4MRPA 4HTFA 1P5ZB 3RQSA 1D1SA 3CLKA 1YCGA 4MGKR 4L6CA 3JV7A 1K1EA 3KWJA 4Q39A 2EZTA 3I1YA 3UN1A 2BGMA 4TMYA 2WHEA 3JS5A 2Y1FA 3DKKA 5CITA 4LFAB 4G23A 4EITA 1XNHA 5F51A 3LH5A 4IXMA 2VTBB 1Q0TA 2OSVA 1XJQA 2EEPA 3GUCA 3HXTA 4C1BA 3WBKA 4KK3A 4MTCA 4ESHA 2EZ4A 4LXUA 2ERCA 1NN0A 4OHCA 3W5UA 2W6JD 3FDJA 4ES6A 3DBIA 4D4KA 1C0LA 2IWHA 2IH5A 4DN6A 2FXVA 1LPMA 1CUEA 4I6EA 1FYWA 3NEJA 1ORRA 1RQXA 3OFSA 5L40A 2Q8PA 3AY7A 4JC5A 4KBFA 4MUGA 3WK6A 1E1DA 4JLUA 3GJXC 5IF9A 2AR7A 2PH1A 5GOZA 4PS1A 3HDJA 3OZXA 3DL2A 4XVRA 5AKIA 1QTRA 2D7DA 4B3GA 1YS6A 3LUGA 4NS1A 4TVOA 5FX2A 4H31A 4R1LA 3QOYA 1L7AA 4IDHA 3GCWA 1I51A 2VBFA 4PVDA 4BMVA 2Z4TA 1MC1A 3DBRB 2BM9A 2ZR7A 1AD2A 4G9GA 4NYJQ 3NUGA 3WV5A 1UXIA 1QG4A 3I9JA 4ECAA 2ZIEA 3PGLA 1M33A 4I1UA 2CXSA 2HN9A 3C15C 1ENYA 3D6VA 1RVV1 3P9PA 1KIMA 1JDSA 1JUDA 2J3EA 5HILA 4P3KA 4HWPA 1Z08A 1B6SA 3B20A 4OMDA 2HC9A 4PLGA 5JHGB 4UE6A 4FZRA 1UT6A 4LA4A 4II2A 4UBMA 1F3OA 2B4AA 2PZJA 1ORTA 3CF2A 1TM1E 3MERA 4E5VA 5REQA 1ZESA 3GO4A 3PQEA 3G8AA 1E5VA 3LLVA 3R0IA 1KGSA 5BQFA 3L0PA 4GOOD 3LO5A 4TQGA 4WBNB 3A0UA 3OD5A 1KKUA 1OXXK 1WZEA 1CUIA 3DFZA 5DX8A 3ZK8A 5IK2D 3NRCA 2YIDA 1WD7A 2PLFA 1T9AA 1WPGA 3ZU5A 5TVKA 1E0SA 1O6FA 5D01A 3C6ZA 3WBJA 2JDID 1G6KA 4BKRA 2YMMA 2V5VA 1BEZA 3AEQB 4QGGA 2O7VA 3G79A 4LGCA 2GZHA 5DLDA 3VI3B 3X1YA 4F1JA 2ZI5A 4FONA 4CUZA 3KZ1E 1BA2A 2OOSA 4D42A 1Z29A 2E85A 3DBLB 5HRCA 1VYUA 4ZMBA 3RI3A 2B0CA 5KPDA 3WKBA 2CCGA 2LKDA 5AQ1A 3DOUA 4ICIA 2C2YA 3IALA 3Q10A 4PW0A 4RIGA 2JRLA 3UO8B 3LFHA 4EFDA 1ZG3A 2VKQA 2HT1A 5FUMA 3NRBA 1UZAA 4QQ8A 3Q9SA 3LRPA 3SHQA 3UAOA 2P5UA 5ES4B 4QL3A 3VOBA 1UJ6A 3BCUA 4D3XA 4AMBA 2UYYA 4HEQA 3KYJB 4Y18A 4W1RA 2IWRA 1P33A 2MSNA 1SZDA 1KAHA 4YJGB 3CLSC 4DEYA 3BXXA 2B4QA 2O7SA 2NU8B 3P4XA 3WKAA 4ARZA 2YBDA 2WY2D 2I3DA 1PAUA 3AVYA 5HQTA 2LBPA 3EDCA 1UBCA 1AHIA 4TRNA 2X1HA 3OPNA 2I33A 2XTZA 3TD9A 4DDUA 1E6WA 4BMNA 6NULA 1DQRA 3TNFA 3BMNA 1PFYA 3IILA 2IUSA 2GZAA 3LTNC 3MUOA 2V59A 5BXQC 3HDYA 4NCAA 2RHRA 1ABEA 2A0FA 2XUOA 3O8OA 4C0BA 4G84A 1JBQA 2NVWA 3NLLA 2HGZA 2IYNA 2QVZX 4G8DA 4NICA 4ZQFA 4L3VA 3MQFA 1C81A 2BZGA 2QTGA 1F5NA 4CU2A 2QAIA 3QHPA 1GL7A 1I1QB 2I8LA 1D04A 5L9AA 2ZYWX 3E81A 2IOYA 3GVHA 3WLPA 5U1PA 1V1MA 3NANA 1Z3IX 3W3AA 1FK8A 4X1KA 1NG9A 1E0AA 4IEFB 3OCZA 1ZUNB 1HYGA 1PWEA 2RGEA 3AMVA 4G0VA 3OTWA 2R5WA 4A9AA 4K9OA 1XU7A 1GCOA 2CUTA 4HV4A 4REQB 3AYZB 3AHHA 1GUZA 1XTUA 3L05A 1N0HA 1MMFB 3D9QX 3PFCA 4GP6A 4IMRA 2RC6A 3TQOA 4EDFA 3BF7A 1O6ZA 5IK2A 3S55A 1A9XB 2VP3A 1USGA 3UTCA 4J4HA 3G9XA 1EESA 1QK4A 2WUVA 4FXPA 4N49A 1ZA1A 4AYXA 2YDYA 1NOKA 3S27A 4D0RA 2IH2A 2UZ1B 2XQIA 4IEIA 3DB1A 4DV5B 3RYFB 3ZH2A 1XD2B 3HP1A 3RJTA 3EZFA 4WOCA 3QUAA 2W48A 1G7CA 5BNWA 1J8MF 3NEYA 1VHTA 1HZZA 2Z08A 3STHA 5KTMA 1R6TA 4DV7B 1L9KA 1D1TA 2GN8A 2YWGA 1N2BA 4YDQA 2W2LA 2F4NA 4MUAA 4IIEA 1X80A 2GK3A 2OM6A 5DX1A 1SCUB 2YOFA 5FT9A 4CIVA 1B4DA 2CDAA 4EP1A 3QXXA 4FILA 3GXOA 4D0GA 3AU9A 3PQ2A 3M2TA 5DDIP 1E4EB 1Z6GA 4RIFA 2QU7A 4ZAWA 2PL3A 3JQ7A 3RWMB 1M6VB 1PTKA 1XL0A 4TLAA 4F5YA 1K9SA 1JECA 4WNYA 3SXPA 1QDLB 4Z99A 1EGMB 1HORA 1JDPA 2CHGA 2PDAA 3K6RA 4H7EA 4MWEA 5C7IO 2BDTA 5KYXB 2RHBA 3UMRA 4J7UA 1RHJA 2A8YA 1L7BA 1UFQA 1XB2A 2WAXA 2WIFA 3RYCA 2X14A 3WYBA 2JPDA 4CQMB 1M8PA 1R3UA 3P9IA 4NU0A 3VH1A 3OQOA 2XKJE 5IYZB 2V5UA 1E5QA 2FW9A 4YIHA 4JYMA 2C0QA 5AJTA 2ISCA 4F06A 3KHTA 2QX6A 1GV1A 1JQ3A 3PA6A 1WF6A 1OI3A 2NZVG 4FGKA 4PGMA 3SJZA 3U9SA 5KTPA 1PFQA 1KH1A 3QLTA 4LBZA 3HMQA 2IXTA 3U3ZA 3VKFA 2Z5LA 3NHFA 4YRBA 2HPHA 3GLIA 1BIFA 2E3JA 1NMEA 3N75A 1E7SA 1T1JA 3BD8A 4YLYA 1ML4A 2VHYA 3UG6A 1L7PA 1QLWA 4MZDA 1LCIA 2JATA 4D8YA 3CPJB 3FKJA 4LOJA 4LYDA 3QXSA 4TN1A 2MTBA 1N3BA 1R4MB 2YY6A 3PWZA 4DBZA 4FYYA 1TCUA 2P8SA 2Y2VA 3L0DA 5NULA 4BFYA 4EPXA 4BKOA 1WMSA 4LHSA 1NTRA 4FDMA 3GLSA 4O5AA 1JU9A 4WEQA 4ZAFA 5BQ5A 3VSDA 4BBPA 4E11A 2I9KA 4O2BB 4AIIA 5CB4B 2G28A 3TLBA 3DDUA 4CW7A 3K6SA 1ZH0A 3KEMA 5E1MA 5IKOA 2JHAA 3D8NA 3KEFA 5AKXA 3LK6A 5B1YA 1Y1SA 1WSWA 1D2RA 4M38A 1K7XB 3TE6A 1OZHA 2NO5A 3C3DA 3K0FA 2J45A 3T06B 1RPJA 4NBVA 1ZGZA 1J56A 4ESEA 2XMGA 1YZQA 1JSLA 1KJZA 5EA2A 5KNDD 1K5PA 4RIIA 1KZ6A 1CUCA 4RK4A 3D81A 4XD7D 5HJ5A 3P52A 4GM1A 1JQEA 3QVTA 4OTZA 4HQ6A 1O97D 4D2IA 1P72A 4QU5A 1A9SA 3G9UA 5JZOA 8ATCA 3QPBA 2WWVD 1F6BA 3P4UA 5CK4A 1EP9A 2MSLA 2H8GA 2REQA 2XGSA 3OY7A 3KPVA 1EFLA 3T61A 2O2YA 4CHTA 2W2KB 1U2SA 5GJWC 3U7EB 2YMLA 1ZOOA 1YA8A 1E1RD 2NSYA 3RRMA 3STVA 2BHRA 2C95A 3BZBA 2A33A 4F6LA 5A2QA 3JXEA 2WIGA 3C3MA 1AQNA 1XMJA 3HR8A 4HUJA 5JNTA 2VR1A 3KFLA 4CM5A 5ICSA 5HS4A 2O8EA 3W5IA 4NBTA 1Z07A 4UFOA 2QIPA 3MRVA 3O75A 2C4KA 4C7XA 5CFLA 5EERA 1R0SA 1X39A 3RS7A 3BSWA 3L01A 1I6WA 1Z0FA 3DSRA 1ZINA 3I37X 4MGHA 5FADA 2JCGA 3F4KA 4OX9Y 2J67A 3MFYA 5EUCA 1ISPA 5EJ4A 1IY0A 1XTZA 3FPKA 1IZ9A 2BJHA 3OT4A 1NY6A 2XB6A 3GG2A 2IS1A 1XDDA 4FBLA 4HQ0A 4XFKA 4F3RA 1KWKA 3W5DA 1GGHA 2QL5A 1QV6A 3F6BX 2J48A 4YAWA 2PUDA 1ADYA 2V65A 1HNWB 3R5XA 3ITNA 3BIJA 4JSRA 4P35A 2KX7A 4YCNA 4JNKA 1GD1O 4MA0A 3BFPA 3ESRA 1M73E 1ODIA 4ZFNA 4S1NA 4P3XA 3ICPA 2AE2A 3BXGA 1R0ZA 1UC9A 2K7ZA 4MYDA 5FOQA 1FMCA 4E6PA 1PJTA 1ST3A 1N2ZA 4V1CB 2ACVA 2GARA 1XZAA 3HKBB 1QJCA 3ILYA 1F48A 4Y67A 3BRWA 5AVUA 1CUWA 1I24A 1PYDA 2H2HA 1HL7A 2ZYTX 3DR3A 4NJEB 4RHUA 4ZMSA 1HR0B 1JHRA 1A4IA 1HQCA 1X1TA 2CVHA 1NL3A 3I9V1 4MVWA 4RELA 1NVFA 3KQLA 1XKTA 3PC6A 2VSYA 2J9RA 2PSDA 5A06A 4HNAB 2AOTB 1FXSA 1PUIA 4RJIA 4BZQA 4A8HA 1WNTA 3B53X 4QEZA 1GIAA 5KC8A 1LQ2A 4KBYA 4NZ9A 1F9AA 1U0EA 1PT8A 3VTAA 3R3XA 1A96A 1N2XA 1W47A 4MI1A 2H31A 5DJ5A 1XQWA 5T57A 4RE5A 4HNUA 2HBRA 1BN7A 2I1WA 2R00A 2CHVA 2ZRFA 4G5SA 2CK3D 4NATA 4PC7A 2DY0A 2V1XA 5FUXA 4J3NA 3SOZA 5F73A 1B3RA 3TOXA 3TVTA 4E1VA 1FIUA 1EXDA 2OCLA 3DT8A 4B3DA 2R65A 3EHEA 3HP7A 4KRXA 4NYIQ 3S7ZA 2C0PA 3WP1B 1X8JA 1P7VA 2BR5A 2HLHA 3CRZA 2EQBA 2VJMA 4IUDS 1EGHA 4IVQA 3TI9A 4Q00A 2HA3A 4GOLD 4YRCA 3MHTA 4ENWA 4XYEA 1GT6A 1RQRA 4PLZA 3UKDA 1UXOA 1E77A 1M3SA 1X7XA 3IKVA 4OQFA 1FSGA 3P5BA 5GVSA 1E62A 1EUCB 1LF0A 1NRIA 1YJBA 3EW7A 3M6AA 4M99A 4RPLA 4RVNA 5DBEX 3T4XA 3NGLA 3ZWOA 1N0UA 2XEDA 4I50F 1QR2A 4POAA 2IEAA 1X7YA 4GL4A 5T4HA 2A4MA 3OSUA 3IULA 4YMVA 1M1NA 4Z0NA 4UZFA 4MQUA 5EKSA 4EVRA 3SE0A 1WTCA 2AVDA 3TOVA 1YS7A 1M2NA 2PFGA 4ITUA 3IQZA 1Z4PX 3CT4A 3GEGA 3OEHD 4AP9A 4RTPA 2H0RA 1KGDA 4DDVA 1PNVA 4IDBA 3LC0A 4BC0A 2OV4A 3OCCA 4P84A 1O54A 3JASA 1DE0A 3I5YA 3KZKA 1A82A 4ZOLF 4YAGA 1LVGA 2HWYA 2ASEA 2Y71A 1O4VA 2NO4A 3JALB 4CL0A 3DEYX 4RF4A 1PE0A 4FTWA 4BQOA 1YQWA 4LY0A 3JQAA 4CMKA 3EK2A 4QOIA 2QQ0A 5E1BA 5BV2P 3HCFA 2JJ2D 1JYFA 2OV1A 2ZIGA 3MTBA 4ZOBA 5EIWA 4RK6A 3MAAC 2ZI6A 1P73A 1V2HE 4DLKA 1G21E 1W96A 3Q2IA 1SBIA 1VL0A 1T6XA 3DZHA 2GK4A 4X3OA 5ENDA 5L7YA 2EBWA 1EEHA 3AUAA 2HMUA 4HWGA 3LYHA 4P6VF 3ZWYA 4N0DA 3KWFA 3OZCA 1K3TA 2AFHA 3QKUA 2VBCA 5BWLA 1CHNA 1MRZA 3A9RA 4BQRA 4AM8A 5T8KC 3IC5A 4W5HA 4A6XA 4MEBA 3LXRA 4YN3A 1EFPB 1P9RA 1PKXA 2C2OA 3IXMA 1ADCA 1N6IA 3KQOA 1IBMB 1UMBA 1NF2A 1XK7A 2C9MA 2OWEA 1MU0A 2PS1A 1R5NA 1XMVA 2G8NA 4P7BA 3OIWA 4LZLA 3I6YA 4CLDA 4A0FA 1A97A 4B3BA 4LPSA 1ILWA 4BPRA 3COSA 2Y77A 3E53A 5AW5A 1D4ZA 3FVTA 1CY2A 1XDSA 2H5EA 5B6PA 2FWMX 2YL2A 2XEXA 2FPGA 1A98A 4LISA 4KZKA 1NMSA 2XVZA 4AO8A 2GVDC 3D3NA 3R74A 1TX4B 2B20A 4X93A 3K1AA 1PEAA 2HQ1A 1T26A 5JNVA 1JLLB 2LE0A 3UG7A 2QS9A 2WIAA 3VHXA 3FXAA 4FNOA 3BHMA 3OICA 5AM2A 2RGGA 2DPLA 4OLAA 1FNDA 5LXTF 4W5JA 4F4FA 3TZ6A 3UMBA 3LWNA 2CLMB 1E1QD 1ZD5A 2R8OA 4K03A 5DTEA 5K3AA 3UWSA 1GKIA 4LWQA 2J09A 4TQAA 1PVOA 3AGPA 3CUVA 3KLBA 3NBQA 4I8IA 4HH3C 3ZDEA 5CLGA 3RUFA 5IBPA 5LLDA 4E51A 3I73A 3K0KA 4OQPA 3W4JA 1W9MA 2W70A 3CUTA 4A15A 1ISGA 5DNUA 4WZZA 4YMGA 1WLYA 4GOND 1ULSA 5AIAA 3UBMA 4P58A 3D8RA 4DEVA 1Y5NA 2LR0A 1T34A 4RKEA 4EARA 4XUGB 4YMLA 3RC2A 2C7OA 1RBYA 3HY4A 4G1FA 3WHKA 4ZJUA 4Z4EA 2VDUE 3UJ7A 4GX0A 3D59A 3HZRA 4BRUA 3OC6A 2C7QA 1YUMA 3HADA 1Z34A 1L8OA 3ADPA 5FBQB 3ZWMA 8ABPA 4MS3A 5FYDA 3OURA 1YR2A 1GPAA 3P4YA 2FP4A 1IK4A 3KJNA 3HY3A 2ZT7A 3QVUA 2WKPA 2XB2A 3ZHOA 4RKFA 4RKRA 1BQ4A 1S8NA 1T0BA 4FJ2A 3X1WA 4D02A 3SXJA 4I9NA 2DBRA 3D8BA 4MW6A 5HIIA 3EGOA 3I6IA 4HDAA 3X3HA 2B30A 2RIPA 4DA6A 3PZRA 1R6XA 5EIBD 1O9BA 1KIAA 4L2IA 1KP9A 4JH0A 4KMMA 4JR2A 1P45A 2Q4BA 3O2QB 2W6ID 4PGHA 4FZ5A 4XVUA 2J33A 5DXAA 5JNLA 2D59A 3BD6A 3MINB 1RXUA 4GKJB 1WCWA 4LWOA 1ZM2A 1UMCB 4KBGA 4HATA 1ENPA 1IXSB 3DE1X 4QDTA 3D2BA 3DE3X 1PZGA 2FPMA 3VU8A 4Z9XA 4BCCA 3F6PA 3CX7A 3SDZA 1CNMA 1NVWQ 4ZPJA 1T29A 3FVVA 4B74A 4GQBA 2ZWPA 1ZJYA 2VYVA 2YJ6A 1F4PA 3DDHA 4RXUA 5SZIA 3D43A 4XSVA 3LF1A 5TGDA 3KSBC 1MDFA 1WZNA 3AR3A 1BU8A 1VB5A 3ZWAA 2YH2A 1E2GA 3WB0A 4N0MA 1UUFA 2EJCA 2IZZA 2FUCA 3VC3A 3SC2B 2GTPA 1VFNA 5LIPA 2D4AA 1E5XA 5B53A 5DOVA 3ANNA 1AE1A 1GYRA 1FUYB 3VDNB 1TA0A 1JXMA 1A1SA 1N2IA 2HDHA 2Z95A 3I6ZA 3O8NA 3OTGA 1PGPA 2X2FA 2OLEA 2YQ5A 3M9WA 2XMCA 2ZYGA 1GGJA 1B6TA 1CUSA 4OGKA 4M9CA 3C87A 1N77A 2O0HA 4B5KA 4YRKA 5AICA 1E69A 3ASYA 3QELA 2M6KA 5LP6C 3H3JA 3ZDDA 4W6QA 3DLTA 2NUAA 4B3HA 3GJRA 1JIQA 4UCQA 3ZBTA 1A5BB 1GGNA 1VIAA 2HJSA 3D8UA 3L7DA 1UPUA 4MYCA 2VRCD 4D9MA 3S40A 3B52X 1QGOA 3AF4A 3OOJA 5HHTA 1OYWA 1PYOA 3B6MA 3LWBA 4MUIA 3DBVO 4ZRMA 2QVGA 2AOWA 4HZIA 3ZTYA 4J0CA 3WRXA 2H2IA 4WADA 1K6EA 1LQUA 3NU1A 2WUDA 1YDGA 4BDSA 2P2GA 1Z0SA 1JQAA 2DQ4A 2ZYRA 3OE4A 3EHDA 3O21A 5KMGB 2JFNA 3L84A 2PMDA 1PZHA 4LVOA 1I2ZA 1SVKA 5HQ3B 3MCAA 1SBHA 2XA1A 3IOEA 2BWJA 4GGMX 4KFRA 3GQVA 3K9BA 4I5EA 1HLPA 2LCQA 1K0UA 4OKNA 1NRJB 5K5EA 4BUJA 4U00A 2IH4A 1YAJA 2ORYA 4FMCB 1JAXA 4GOXA 4L5AA 4TM8A 5CT8A 1H2RS 1U8ZA 1W29A 4A4DA 3P71T 3GCXA 3ZCRA 4FCVA 4NV3A 5BWNA 4EJSC 3AJAA 1WY5A 2Q7OE 3UFBA 2FTKE 4U2KA 2YHBA 1Y9JA 1WTAA 3L7KA 2VQFB 1NSFA 2GCPA 4GICA 1W0KA 3ZIAD 5ALSA 2WIDA 4P4GA 2IV2X 3WA6A 2PUEA 3PFFA 4HDKA 1Z45A 4QTYA 1W2GA 4CMHA 2NYAA 4FLFA 2I76A 2C4WA 2NZXA 4G4JA 4M0DA 5IVPA 3VA7A 4TUYB 3E9QA 5TNXA 1RPAA 1M2FA 2W2OA 2AB0A 2C83A 3E61A 5TT1A 5AESA 4AROA 3IUYA 1JHQA 2WB2A 4PLWA 1ZIDA 3NM6B 1SU4A 4BUZA 3JAKB 4X95A 2BLLA 4MDYA 2QA5A 2QUKA 1N0IA 4BUCA 1JQJC 3DE0X 4BQIA 3CX4A 1YBAA 3FTPA 3LPNA 3FSRA 1H9AA 2P9HA 1WHTA 1QWOA 2WU0A 1MR3F 5ALWA 4U6QA 1EXVA 3DHVA 2BZ1A 3CPHA 5JXHA 5KSZA 4YAOA 1X14A 3QEJA 3SSOA 3FLMA 3I2IA 4UUOA 2Y27A 2HK6A 2EL7A 1NW3A 1ITZA 2HF8A 4KSCA 5L95A 1A3CA 1IHYA 3K16A 2QM7A 4BVHA 3F49S 4J16C 3HDTA 4R2LA 1IM5A 2GBGA 3ZY6A 3HI4A 3NVKI 2EWMA 4FVTA 3IIKA 2JAHA 4XE5A 4XPIA 4B48A 1Q83A 1Q22A 2ZOSA 3O73A 1DUVG 4LF6B 4K0KB 1VE7A 1XNJA 3QKSA 5A62A 2WD9A 1QQ5A 3Q4GA 4JI8B 1S5PA 1KQ3A 1YTLA 4PZLA 1NW7A 5I01A 1J39A 4BEJA 2IPOA 4H4EA 3B5JA 1U2TA 1TKBA 2A30A 2VEOA 3PPVA 4EFLA 3IPLA 2D7CA 3EMKA 3GP5A 4OXNA 4C3OB 2XYVA 2B37A 2QRVA 1I13A 1IB6A 2I34A 3QU5A 1WU8A 2RH8A 1F4LA 2VT2A 2MSWA 3GJYA 3N28A 4OB6A 1C30B 4YPFA 1EGQA 3VPXA 4BL5A 1IXRC 4YTEA 1PQYA 4Z51A 3U1TA 2G1KA 2D1SA 1S9HA 2QTHA 1RQ2A 3JR7A 2AG1A 3KQVA 2AOUB 3EJWA 3SK0A 2I7CA 3QF4A 4C05A 1YV9A 5M5BA 5ESRA 3ORYA 3RUAA 1E2HA 2JKVA 5KWIA 3SEQA 4JUFA 1JFVA 5U9CA 3WE7A 2GCIA 2XUGA 3H2ZA 1CJCA 3ELDA 4M9ZA 4PRZA 4RMIA 4WQMA 1RXVA 1BWQA 1H8EA 5KYYB 1YRLA 2DFLA 4HFMA 3ERCA 1KO5A 1Y80A 3SIPA 3RTBA 1M2WA 2ZBUA 4DA4A 4I50A 1RM4A 1V1RB 4X65B 5ALFA 3ASUA 3H5WA 3EVFA 4OIFA 3OM1A 4NCXA 1HI9A 2M9MA 2O3TA 1DBVO 4LI0A 4I3HA 1TT5A 5DM60 1H5NA 1TCAA 3R6GA 3FKQA 3JR3A 2ZYUX 2R5NA 4ARVA 3FDXA 4PXSA 2ID4A 2IHTA 2OBBA 3FB1A 3IP9A 4P81A 4WUVA 1NVXQ 1XZEA 2XYPA 5A9TA 3LQRA 3R5FA 4J6FA 4A73A 1TK2A 3EIQA 4JWKA 5A6SB 4ZOLA 2AW5A 3N6XA 3U7HB 1C8LA 2P6MA 4DR6B 5TY0A 1BHO1 1G8GA 4LNUA 2OGUA 4L7VA 4BFCA 4KR3A 1FBTA 1IJKA 1XE3A 3AUTA 3KVVA 1RYNA 1U4SA 4MUKA 1BXKA 1QORA 2OENG 4IH1A 4OXRA 1DC4A 2Y0CA 3AY6A 3CLRD 3WRWA 1YS1X 4TKLA 1PDWA 5CXSA 1VBMA 2FWNA 4WSOA 3VVLA 1CJMA 4HWRA 2D1FA 2BH9A 2O2DA 5GOTA 4GKVA 1OAAA 2G7ZA 1JFTA 3JQBC 4Z7OB 1E96A 2MDTA 1PQWA 2PXHA 3PUJA 5A02A 3CVXA 3L0OA 2FYTA 3RW9A 1BSVA 1E9AA 1XCJA 2VYCA 3EAGA 4MZXA 1ZITA 1SUIA 1X8KA 2B4YA 2C04A 4V39A 4K6OA 3PXGA 4BRWA 2AKEA 1J5PA 3MCZA 2XUKA 3GJQA 4YI3A 2Y1WA 4C4TA 5CDGA 5CTJA 1TU3A 4P4SA 4B7CA 4L1KA 4KXQA 4XIIA 1H0KA 1MC5A 3O82A 4UOQA 5A3VA 1XZJA 2R48A 1F14A 3QZUA 1ORDA 4AJOA 3HYLA 3OE7D 2AZTA 1NPDA 4URXR 1U99A 2R7MA 1ZNZA 2WYIA 3CCCA 5FUBA 5BVHB 2OA0A 1A0OA 4TV8B 4DDMA 1O03A 1T2VA 4LOLA 1E32A 4I4LA 2ZI3A 4L5JA 1PNTA 2BM0A 3AX6A 5HE8A 3UJ6A 2VK8A 5LXTA 1XYVA 1KSFX 4L0MA 1JLKA 2IHBA 5C2JB 1E7RA 1Z06A 2VAMA 1ZVQA 3OIDA 4GLFA 4GXQA 3CISA 4CODB 1RM0A 2VJAA 2VDVE 1ZR4A 1BDBA 2PPVA 4HB0A 1VKJA 2I67A 2QI9C 1E0KA 3MT9A 5FWNA 1I3CA 1UBMS 1IBKB 3NGXA 2HPAA 4ZALA 2O8EB 4GAEA 1G16A 1ZP6A 1U0GA 2P9BA 5JWRA 2FRVA 4AKEA 4Q66C 1FTNA 3PKJA 3AUFA 1C9DB 3DFFA 2ZSKA 4EB8A 4LW8A 3AUUA 4DQKA 5A4IS 5AW9A 5J5AA 3DMTC 4BJ6A 3M6WA 3I9NA 5KJ1A 4GYWA 1CZNA 1J5XA 4RLQA 5JJLA 1BE0A 3KYCA 1JEQB 5DHQA 1F1JA 3L1IA 4E13A 4HDRA 1LU9A 2YFKA 4WASA 4BFZA 4ZMRA 3ENVA 3AUYA 2HQOA 4R2MA 4HPXB 5G02A 4KQMA 3V4PB 3K0CC 3NTLA 1Q2UA 1RDFA 3INTA 1MJGA 4MS1A 5EXTA 4A7PA 1WE2A 4R6XA 2SKEA 3QMMA 4XA8A 5I8ZA 4OPMA 4DIKA 3PJRA 2R8YA 5EJ7A 1YR9A 4F4IA 3QTBA 4LWZA 4AUNA 4GI1A 1A8UA 4MW4A 3DLPX 5B3KA 3GLFA 4J3JA 5CFNA 3D4NA 1V1JA 1KOJA 1N8SA 1YNSA 1R0BA 2YNMD 3GLVA 3GU3A 2X1LA 3KYBA 5CIQA 1U7OA 1VE3A 3K0AB 4MAFA 2DPMA 2IYAA 4FXOA 4QM7A 3OETA 3QPAA 1ZM3A 1GM5A 2H85A 4IIBA 2EQAA 5LMNB 3ZK7A 2OV3A 4Q48A 3CWCA 1QP7A 2VHTA 2ZIFA 5LFAA 4LF7B 2CVZA 3GROA 3OFVA 2WUGA 4BO7A 3H9CA 4JELA 2CMGA 3D54D 5AJXA 4HFNA 4I6JA 3VOTA 1A7AA 2VLIA 4JKOA 3IVGA 3CIFA 2P69A 4K9KA 4REOA 2AXEA 5AVJA 1Q3TA 1H6CA 3SHVA 4B4VA 2ZGVA 4D82A 2NU6A 4GOJA 4KQXA 4B3JA 2AC4A 4IRMA 1C3XA 5E0OA 1SVWA 4IFBA 1ENZA 4M8IA 4XTRA 4LZAA 2FR8A 5BRAA 5FTLA 4G3XA 1WBJB 2XF2A 2OSBA 1AUQA 4H7DA 5FBLB 3VDQA 1JILA 3QFRA 4CTNA 1DEXA 5DNWA 1LDGA 1VJDA 2NXWA 2I2WA 3AT1A 3Q7RA 1QZUA 1DXHA 3CWQA 1CULC 2AJCA 2ZTVA 1T4GA 1T2NA 3DAYA 3KZOA 2FY8A 3DCYA 2AXPA 3EVZA 4IZ6A 3DDWA 1B43A 2VF7A 3TE7A 1QG2A 5DXFA 4C21A 1TQ2A 3IAM1 3GLHE 1PWZA 2AI1A 4M53A 1T2FA 1T3TA 3THWA 2I6XA 4EH1A 3NZEA 3VVMA 4EG8A 4DLVA 1TTTA 1ZM7A 3EZ9A 4B76A 5K0BA 1NXSA 1W36D 1EFAA 1K06A 3IBFA 3E7WA 3EPHA 5C8XA 3SZOA 4B3XA 3MG9A 1L4MA 4MHOA 3UAVA 3FKSD 4DIOA 4P7FA 1E1MA 1UJ5A 3I0MA 5CW2A 2WEKA 1IN6A 2N47A 4EDHA 1K7SN 4URZR 2YC4C 5FF9A 5JBNA 1RKQA 2Y6UA 2C88A 3HP4A 2ZWVA 3QE4A 1I32A 4QOHA 5GV8A 2J6HA 1U65A 1FLNA 4KIWA 1ZUIA 3BCHA 1I4LD 1RI4A 1ZD3A 1PL0A 2YY7A 2W6JA 3L0ZA 3HN7A 4UUPA 3DL4A 5KSOA 1AM4D 3VR4D 3CFYA 3D02A 3GG9A 2VUTA 3IHWA 1RRGA 3OIVA 1I4WA 3H0EA 5CGZA 1U02A 2W22A 2IEYA 1T6NA 3DFMA 4FFDA 1E20A 4GFDA 2ATVA 1V8BA 4YAJA 3OTOB 2V7BA 3O90A 4TS3A 2EX4A 3HVJA 5DF1A 1QCZA 3WRYC 4AI6A 2NPOA 3AKCA 3LO8A 3S8EA 2KE5A 1U2ZA 1C1YA 2ID7A 5EPOA 1UBNA 1GZVA 4FZJA 4HLCA 4RMNA 4EY6A 1ZQ1A 1NBAA 1THZA 3NWOA 1P4AA 1DV1A 2QVXX 3W7AA 2FGJA 2FUG1 1NBEA 1LD3A 1EVIA 4B2YA 1K86A 3E27A 3K32A 2IY7A 3KT8A 2QNBA 4FU0A 2GRAA 4PZZA 5FUQA 1WU7A 1MO5A 3REOA 3V7FA 3P20A 4RVOA 5F1OA 5C46F 3Q0IA 4M88A 4IUBS 2HIAA 4GG1A 2HHCA 3CKMA 3T15A 4QM6A 1ISFA 4Q1FA 2FSVA 3M9XA 4M1KA 5EVJA 3TUZC 5DGCA 3ZCVA 3IQGX 3NCTA 3EXG1 2FZ5A 3QPWA 4Q1BA 3EZ2A 5HCNA 3AETA 1B8VA 1OYYA 2D3WA 2P9QA 3AI2A 2ZWMA 3T35A 4A5OA 3ZWDA 3Q2OA 2EARA 4HEHA 4ZQEA 1DL5A 1KE2A 4HT3B 4FK8A 1VIMA 5HRAA 2XQVA 3KHUA 5PNTA 4OSEA 3E7PA 3UUGA 5B4VA 3RC8A 5AUOB 2CL7X 3R3ZA 2A84A 3R09A 3FY4A 5C18A 4YMWA 3U60B 2Q3HA 2JDIA 2I4RA 4XIJA 4K46A 2X9QA 1Y33E 3MWGA 3AVTA 3U3XA 2CVPA 2Y92A 1HV8A 1LBTA 3A9TA 3IXLA 4LJ9A 3CWZA 1PWYE 3FF1A 1IE3A 2PA0A 4GMHA 4RFVA 3U26A 1BHSA 4IIGA 5JDCC 2F1RA 2R7NA 2XCUA 3EODA 3JQ9C 5DIZA 2OHOA 3RREA 3D4BA 4P5PA 1OF1A 3Q9NA 3SC6A 4DMGA 5H68A 2GN1A 1ZD2P 5IZ4A 4XJVA 1IQUA 3IESA 1JIJA 5MN4A 3URKA 4ZDJA 4RVHA 1JWBB 2Z2JA 1U81A 4MCHA 4WZAA 3ZW8A 2RG7A 2IHZA 2VTDA 3UXYA 3F4BA 3RHTA 4RDHA 1XPRA 1Z2AA 2HRQA 4JP3A 2PL1A 1L1RA 3DWIA 5JDIC 3SKXA 2P7HA 2OPHA 5KWEA 3IA7A 4PSKA 4G4IA 3DNPA 1LEHA 1KJIA 1T13A 1GAJA 4Y1RB 2JLRA 1I9CA 4J49A 3ROEA 3I34X 5AI5A 5FOVA 4AZ3A 3HHEA 2QPLA 3E3NA 4G0NA 4RPIA 4ZAYA 5KEIA 3BXEA 5ER9A 3BHNA 4KWIA 1T3SA 3SR4A 2JFBA 3CH4B 3VVBA 1U6JA 2DFPA 3EEFA 1A5ZA 1Y1QA 1IATA 2QTTA 2QD4A 4H4CA 2XT9A 1E3DA 1FSFA 5KOIA 3FOWA 1CR0A 2RGXA 1K6JA 3C14C 1DKMA 1XWIA 2GBLA 1NULA 4WPGA 3B6ZA 3W06A 4B81A 4DLXA 2DG2A 1AZTA 4ARIA 4WNAA 3OP4A 2Y1EA 5HOEA 2JIMA 3OT5A 3QVMA 4RTSA 1ZC4A 4HGYA 3ZZTA 5LQNA 4CT0A 3G7SA 8OHMA 5EHQA 1JG2A 1SIBE 3S2ZA 2NQ2C 3QXGA 3VR5H 1SK8A 4C0HA 1PZNA 2RB4A 1JHYA 4O59O 5EJGA 1JR3E 1EHYA 3DM9B 3AR8A 3H16A 5JC8A 4CCYB 4MQFA 3KK0A 4ZK2A 1JJVA 1QK5A 2ONCA 2WF6A 2FF5A 3H9JA 2XA2A 3Q7IA 3BD7A 2YW9A 1L9XA 4IDNA 2ONZA 2YWBA 4CEHB 1EWTA 1TYZA 3IBTA 3JPWA 4OKSA 1KOLA 2P0YA 1GNLA 1XDWA 1BNCA 2IYEA 2XA9A 4RNCA 1MO2A 4Q21A 2VH2A 4RVCA 3C1AA 1ODCA 4E32A 4ERNA 3LLMA 2FMTA 3QYAA 1VSQA 1SIWA 3VZBA 4YJHA 2GJ9A 2XKKA 2IL1A 1JDNA 4A0QA 2JI6A 5H02A 3EZXA 4YXFA 1KEEA 3BMCB 1U7UA 1UPTA 1XRRA 4L72A 4E03A 4TYWA 2H7YA 4M86A 1FFGA 3NXSA 2CCJA 4EGQA 1LFAA 4X7RA 1T5BA 3LDGA 3A6JA 3QX8A 1FNCA 1NBMD 5GZ6A 4NZYA 5G0WA 1K2VN 2PUFA 4YAFA 1W46A 4IILA 4OQLA 5AMXA 4PLPA 1X1DA 2MR6A 3EGCA 3TLZA 4BBAA 4L3OA 1OU4A 2PVSA 4RM3A 4DZRA 3NWJA 4RK0A 1E3MA 1A04A 1PUXA 4LJ8A 3OJWA 1MB0A 4OJKA 2L17A 4NL4H 4OGFA 1E66A 5TPWA 4H4DA 4B7UA 2COEA 3CUEF 3LT0A 1EVQA 2YJ3A 1J25A 3GFSA 3JD2A 4HZUB 2H08A 5E6UA 4KVAA 3RK0A 2DE0X 1II0A 2CNBA 3V8BA 1W0JD 2A9JA 3K1YA 5E4YA 1NJ2A 1WBDA 4MPRA 3DC7A 2IU3A 5CVEA 4Z0PA 1P7YA 3Q2KA 5DNVA 4LJSA 1OWMA 4J94A 4YCDA 3HBAA 5JQGB 3TK1A 2A86A 4PQEA 1CK4A 2QTNA 1YVPA 5SYMA 4BO6A 1D5CA 3O3NB 2FWJA 3K4PA 4B4UA 1XVTA 3SKYA 1D8TA 4FFMA 4HQKA 4F3NA 4HQLA 1C41A 1ZCFA 2H2FA 16PKA 1C4XA 2V7GA 3GC6A 1GZ3A 3K9GA 3OCUA 1TO6A 5EIOA 2Z1DA 1P18A 5G3YA 1EI9A 2EGUA 1XX6A 3AB3A 4LXTA 4O33A 3CRRA 3ECCA 1OREA 3KQHA 2PMFA 2WD7A 4HYQA 2B6NA 2CL0X 3FPLA 4IDEA 3BKWA 3MCWA 4UDOA 3F5SA 3PEUA 5LU8A 3F3SA 1LPNA 3VYRB 1UOEA 2FRXA 3W90A 4KXWA 3A10A 2VYQA 1PTJA 1XAJA 1YZ3A 2IXEA 3N87A 1IZYA 1HM5A 1WHTB 2NXJA 1PT6A 2P78A 3OTHA 1S2IA 4JI2B 2Z2ZA 3EIEA 1PUJA 3ESXA 4NFSA 3O3MB 4X7PA 3RANA 4LS3A 3RRFA 4IFEA 1CUDA 2WJIA 1LNQA 2A0XA 1IXYA 4JLNA 3UJPA 5J4VA 2GZSA 4MUEA 1RXCA 1SCKA 1EHCA 5I9NA 5JFGA 3GEMA 4MVJI 1EM6A 1ID1A 1W25A 1NC3A 5KNDA 4XD7A 4RY8A 5E3JA 5ALKA 1C29B 4LQCA 4A92A 4D56A 4S1PA 5J2UB 4CGYA 3D6MA 3LX8A 2R1VB 5KNCD 1DAGA 4Q9LA 5EINA 1CY6A 4DIDA 1QE0A 1DJOA 5EZQA 2V0GA 4HGQA 3PVCA 1E60A 1YSCA 1M2JA 3KPJA 3VUFA 4ALMA 3RVQA 3AV0B 4Z9BA 2IUFA 1OPRA 1OU0A 2NG1A 5C3UA 5K7SA 2A9QA 3NKLA 3E0QA 3IIMA 2I7DA 3HBNA 5HVNA 1E1RA 3EQ9A 3PUYA 4Z8YA 4Q16A 7REQA 1WUJS 4L3WA 3PP8A 3BG5A 5FCDA 2R8RA 2BLNA 3IHLA 5FV7A 4G6ZA 1U94A 3OT1A 1D7OA 2W83A 3JVUA 2HEIA 3FOAA 3LYLA 1JDVA 4IG9A 5D85A 3GGGA 1FNNA 5FTMA 4DKJA 1JE0A 3QLEA 2XMDA 2AN1A 2MINA 1V6AA 5IUJC 1RFGE 4AECA 1U3VA 2QL9A 2RGRA 3AY3A 4HJXA 5HMMA 4DJTA 3CSSA 2WWXA 3WO1A 3RH0A 1RHQA 1MV8A 3PS9A 1TZCA 1CDOA 1GGMA 3IVCA 1HSZA 1NP3A 2CVQA 3OH8A 4JYBA 3I53A 3IYLW 2X8BA 3E5MA 2XCIA 2P2SA 4H1UA 3W4KA 1XLTA 4YB8A 5JXWA 5JNRA 1TT5B 3W78A 4TWIA 3TQFA 2Q3DA 4PNEA 2VWQA 4QJIA 5KNBA 5F12A 3TOSA 4WZ6A 5F7OA 1HKHA 3MF4A 2GRUA 2VA8A 1XELA 5FBHA 4DIFA 1DDGA 1L5FA 1MZVA 1VL5A 2FUKA 4RZ2A 1SB9A 3RRZA 4ZJPA 1O9GA 2DWUA 5A4JA 1ODKA 4ZOLB 3WB1A 4RZIA 5I6DA 4IOMA 3LC1O 5DMHA 1AKWA 2PL9A 3Q72A 5G0TA 2PJRA 2XOXA 2NTEA 4HDSA 3JAWB 4MVJF 1GCGA 3HB4X 5EGSA 3UH0A 5EJ9A 5MGNA 2NO7A 2QRQA 5CRIA 1YZVA 4ETMA 1W1WA 3IMEA 2RGNC 1HT3A 5ISMA 3CJTA 3PNBA 1Y6JA 2DPHA 4LMBA 5THKA 1TZJA 2H59A 3TUJC 3ZEAA 3OQPA 3CCBA 2C92A 4WTOA 3ZCTA 2KQUA 3C8DA 1CUUA 4M0MA 5CEJA 2ZQZA 2P90A 3GN1A 4QAJA 4D9FA 4ZRNA 1Y3CE 1ZY2A 2LDBA 1QH1A 1IBCA 5C8YB 2P0AA 2VJCA 2GK6A 3EWAA 4JLMA 5AKEA 2QYHA 1TVCA 1ZXLA 2AI2A 2G06A 3DHYA 3D3KA 1OLSA 2XVAA 1XTIA 2VYND 5CJ2A 2OYRA 3HMKA 3NAMA 4K3VA 3SZ3A 1RCFA 4ZCMA 4OK3A 2D1QA 4IGEA 1WXFA 3IPRA 5KCZA 2BUCA 3PEVA 3ZY2A 1AXEA 1SUFA 1YB6A 2NADA 2VATA 1NSYA 3C74A 3GGDA 2ZB4A 3T1OA 2LNDA 2QJRA 4I5DA 3OI7A 4MDHA 1H0RA 4CT5A 3VNBA 4NDAA 1G20B 5AXAA 4J7AA 4ZRDA 2NAFA 4J1SA 1CUXA 3PITA 3O8CA 1PNQA 4AJ1A 1Y5RA 2DH6A 4DWWA 4G1CA 5LXTB 2SKDA 4DLWA 4PHTA 2F8TA 2D2IA 1CQIB 3ER6A 3FSGD 3WYEA 2DBVO 5ES3A 1K3UB 1UBRS 2VPPA 4M1TA 3CT6A 3OEHA 2RHHA 2A14A 4BNNA 2Q3JA 2XDQA 4U39A 3ZOZA 1Z4OA 4LV5B 3II6X 2A5DA 3ETGA 4MKFA 5F77A 1Z68A 2CD7A 5CM9C 2W00A 3H5OA 1ZCAA 1CYDA 3SYTA 3LY9A 2ABWA 5EXDA 5L4LA 5KSPA 5EJMA 2P2ZA 3TR5A 1AGRA 1WXIA 2OHIA 2VUIB 3JTMA 2JJ2A 4LZPA 1CS0A 3SJCA 4Q7LA 5IKXA 2H2AA 1I0IA 1R0RE 1CRWG 1M2GA 1TZBA 1Z6ZA 2BHSA 3LT2A 3LU1A 4X66B 9LDTA 2BI7A 2Z8YM 3G3EA 5FI3A 4BBJA 2J6CA 1ODLA 3DH0A 3EQ8A 5HK9A 1I7QB 2HSJA 3PEWA 3L41A 4ZI3A 3NS7A 4LEIA 1N34B 2CFOA 1XPOA 5EPUA 2CFRA 3Q8XB 4BNFA 5KTNA 4MB2A 1UOQA 3MJ4A 1NRXA 3C3BA 1E8DA 1QAOA 1KY3A 4AZWA 4YP5A 5EWMB 1DUSA 3ELUA 1JKJB 1ND5A 1N7GA 4NVRA 2L42A 3SVZA 3A27A 4G4SO 4CLRB 1ZD9A 1O89A 1A7UA 5CVDA 1YE8A 4LRUA 1YFKA 4RA9A 3DV0A 3Q7PA 4G1BA 1TIKA 4U2DA 5FPYA 2UVDA 3L9WA 5A5DA 2QENA 3H5IA 4LXXA 1JU3A 2Z98A 1ACJA 1JJBA 2OV8A 3R3JA 5FR2A 4LDQA 3CTPA 3NTRA 5CHEA 1VMIA 4MV7A 2F3SA 2YWRA 1G19A 1Q95A 3PE3A 3CUYA 4DLNA 1JF8A 2V7QD 3A2LA 2H51A 1YJXA 3PX7A 4B7AA 4WCFB 2ZVJA 4JVNA 1W48A 1CHDA 2PMKA 4O5OA 1TUGA 2NMVA 3AR5A 3R44A 4HAOA 1CERA 3K3PA 3IUBA 4L4UA 4GNRA 2J1LA 3PB3A 3ZGNA 1GN9A 3UOAB 2C3UA 4WRRA 4Z7JA 3CNEA 1UBJS 1F06A 3Q1LA 1FMLA 1WSBA 4BMYA 2W2NA 2MU1A 3FNEA 4ASUD 2NU6B 5D5QA 1E1NA 1HDOA 1N57A 2E4ZA 1DFIA 1RLOA 3HWSA 3L4EA 2Q6OA 3WHIA 1LV8A 5LMUB 1O0BA 1C3EA 2VHXA 5FOXA 2ZXFA 1U6IA 1GRVA 2NACA 1VPVA 3HVRA 1I4TD 2AG8A 3GJZA 2Z9CA 4GXRA 1DI0A 4HGNA 1E3EA 3OMLA 5IDWA 3DJFA 1KZHA 2BD0A 1ZGHA 1Z7GA 2QGZA 2ZUBA 1KMMA 4JS0A 3ZNNA 3QV1A 4UHKA 4AUKA 1S2MA 4BGEA 4BQQA 1NQXA 4D6YA 2PR7A 4Y2HA 1SCDA 2WBLC 4QRHA 2QK4A 5TMPA 2O3RA 3IT3A 3B6JA 1BO6A 1DMRA 3FJYA 4DDWA 2CXUA 3QU2A 1NM5A 3HV2A 1X3LA 4HDCA 4GSLA 4Q1AA 5AHKA 3M3DA 3B7PA 4A8JB 4GZ5A 1V2GA 4TPKA 3TW8A 3AWIA 2GASA 1E9EA 3I0ZA 3OVMA 5JAUA 1LDBA 2PUVA 1K5DA 3ZZ1A 4FIZA 3IP6A 3WNQA 5AIBA 2XHEA 5HRUA 2GDZA 4N39A 3ZHRA 2HYIC 1MNAA 3G9ZA 1Z4NA 2R751 1FU7A 1K6MA 1RWBA 4G0XA 2FF7A 1M75A 1OT3A 4JC0A 1WP9A 4DG8A 1SCAA 4A2QA 1WDKA 1MVLA 4WCFC 3U3OA 1PSZA 2DKOA 4DDTA 5CYPA 5FOSA 1U7ZA 2VN8A 4J07A 3GHYA 1A5SB 3HJNA 3QWAA 4O0LA 2AJDA 1FBNA 3W04A 2M6SA 1U9CA 1YB1A 3L8ZA 1IOZA 1IULA 5I7AA 1Q7CA 1JPUA 3KJFA 3GFBA 1OB5A 5A0TA 3H2GA 1L4YA 3FWNA 1VLHA 4HRAA 4QBFA 1PR6A 4TWJA 5LA6B 4YR7A 3D6AA 4K9LA 2ZSDA 5A5VA 1TUEA 3LP5A 4PCAA 4ITRC 4RDCA 1QFZA 2QGNA 4L9WA 2IIPA 4QT0A 2UYCA 2P9CA 3LK7A 3NALA 5ECYA 3WXBA 4EPVA 5AI6A 3A1NA 4Y0NA 1B0AA 1QFXA 1T1RA 1TM2A 2IE0A 5DGTA 1U7TA 2BFDB 2H7VA 1L8QA 3A7EA 3WLSA 3R76A 1IY2A 4DRZA 5K0FA 3U16A 2YZ7A 1XMPA 4UM9D 2WAOA 5JCOA 2FPRA 5HCUA 3DQQA 1RYDA 4IKPA 1MEOA 3KV1A 4A8JC 2EX1A 3QMWA 3ZWPA 821PA 1DEAA 1LPBB 2GYYA 2A88A 3CNBA 3DWGA 1GJRA 1UQUA 4JGBA 1JQKA 3QMPA 4L8LA 3DDOA 3OZWA 1BH2A 2IU6A 4XIGS 3S2FA 1UDRA 4B43A 1HURA 1XEXB 5L3SA 4F93B 3HYNA 1MABB 3KR0A 4J1TA 4KXXA 4R3WA 3RUIA 1CJVC 3AP3A 3IKLA 3R1IA 2Y6VA 1V4VA 3QUBA 2VRCA 1OX5A 3MT0A 4HS9A 3TZQA 3L4BA 2HGSA 3FCSB 1NYLA 2UYHA 3TCKA 2IZ6A 2HMWA 1U0SY 3IJ5A 1X7WA 5A9RA 1KI9A 3TIFA 1NQAO 4O4HB 1YF3A 2ZSUA 3EFOA 3JYHA 4MRMB 1P7ZA 3INRA 1BC5A 2SCUA 4H0NA 4WK4B 4Y7DA 3VISA 3WIBA 5LU9A 2UUPA 5IBQA 5GP1A 4DJJA 4B3TB 1U7WA 2LV8A 6REQA 4UBLA 4W5WA 2AN4A 4X8MA 1ZI8A 2I22A 3V4LA 4AWAA 4DSNA 3DEJA 1NKTA 4Y3UA 1DQZA 2E6KA 2KS6A 4LWPA 1ZUD1 3HBMA 5IH7A 4D0NA 2YKGA 3OX1A 3ANLA 4KKVA 3MCVA 3NHRA 1TVEA 3CKYA 1XCGB 3MILA 1QFJA 1ZFNA 1F8XA 2PK3A 3Q11A 5D8DA 4OHXA 4XRRA 4D9HA 3Q15C 4ZCPA 5JCZA 2H4FA 2B34A 1SCJA 2ZETA 1UC4B 3SICE 3HEBA 3OKCA 3PKZA 2PR2A 5JRJA 1I7PA 3NOOA 5BSTA 2VKTA 2PGNA 4K81B 2N75A 3TFOA 1FTQA 1QC5B 1M66A 5FBVB 1T5TA 4O1IA 1F0PA 2CZGA 5KB3A 3ORQA 4WECA 1ATZA 4MGIR 2Z09A 4JN6B 5SV2A 2TSYB 3W5JA 3U9TA 1YBFA 4EB6A 2GTIA 4PNPA 1R2QA 5ALMA 1IB0A 2ZI7A 1SOVA 4PZUA 1EE1A 1U4NA 1FW8A 3AQIA 1P7PA 1C1DB 4TXHA 5LYJB 1Y8ZA 2XUQA 1TD9A 1NLMA 3DEIA 1TPYA 3RRNA 5ERYA 3RV4A 2H63A 4BNJA 1Z63A 4JJ7A 1LNZA 1JXQA 2PKYX 1DO0A 2PL5A 2A1UB 2LWIA 2YR0A 3ZHSA 2WRZA 4JI1B 2XNCA 2JLBA 2V96A 1UBSB 4ON9A 3GD5A 2VUSA 2JVJA 1LWOA 1UDAA 1GYPA 2H4XA 4L8WB 4YAKA 2NQTA 4TVSA 1KJQA 1SAYA 5DW0A 1SOWA 1BQ3A 1NRWA 4P0PB 1F5SA 1N2OA 4U5XA 3NHYA 1I33A 4MW7A 2GCNA 1P4RA 1ZGJA 4MVJA 2P2LA 4WNCA 5FPQA 1VZ3A 1Z2NX 2VT3A 1EA5A 1T6ZA 1KIFA 1V3TA 2HUNA 1QHHA 2IEZA 4OIMA 4YC7A 5EXXA 3BWMA 4HAIA 5H80A 3UJDA 4FCTA 3TKYA 3VJRA 1MTZA 1OBOA 2LUOA 3AESA 1QSGA 5FOWA 2GDJA 3Q8WA 3TRJA 1O57A 4XWGA 1CDDA 1OC4A 5GAJA 3ELWA 1SQSA 2WG2A 3F46A 2O06A 4NIMA 1GFWA 1Q77A 1C0KA 2X2OA 2PIAA 1KEEB 2QD5A 1ADBA 2XUJA 3GRUA 1YJQA 4QTUB 3ZU6A 1EP3B 1QYVA 1EM8A 4HK4A 5D6OA 3SZLA 2PRKA 4MWBA 3A2KA 4EL5A 2X8LA 3EC1A 3OFKA 2A5JA 2QN9A 4MP8A 4FR0A 2HIMA 4NG5A 4QNMA 3HVHA 2AEFA 3SJBA 3A6EA 3BERA 1QPGA 3MJEA 1TA4A 1PGQA 2GN0A 4ZVRA 2FN9A 1OOEA 3T5MA 1MOPA 3D6JA 2X6TA 3OJXA 2CNWA 3O3OB 4PINA 4O63O 4UUAA 1INLA 5D5PA 4OUDB 3TB6A 4BFLA 1P0FA 4CQLB 1Q1ZA 1U2GA 3B2QA 1SKQA 1HDXA 1HDCA 1LFDB 1Y8QA 2C78A 1M7HA 4TKVA 2C5AA 1GTL1 2CJXA 2YXNA 4M1OA 1ZN8A 4N3NA 3V4ZA 4YECA 3P9XA 1UT8A 4ZT7A 3TGPA 4LZWA 2XZOA 1AK2A 3KRTA 4K9SA 1ULAA 3QBVA 3PDIA 4AQYB 4NBSA 3I8XA 3K31A 2P27A 3T7JA 1OASA 2CUZA 5CCBA 5K3CA 2GPTA 1KP2A 3VTKA 4MKIA 1GPBA 1TJPB 1LBSA 3AFIA 4TYMA 2XV1A 4D4LA 3P0HA 4J3FA 3FNGA 5K3FB 4NOJA 1G7RA 2D62A 3PWKA 4R01A 4IR7A 4YAEA 3WL5A 3I28A 2GKGA 2QE7A 3KHSA 1AKYA 3FYSA 4HO1X 3UF0A 1JVNA 5BUCA 2V03A 1ICIA 1SCNE 3AJ8A 2VF5X 2CNNA 1DPFA 4Z3OA 3ICOA 4TTPA 4P86A 3GFGA 1QV9A 4C04A 4ZIRB 4FS3A 3ZQ6A 1I3OA 5HF6A 4ZO6A 2VF8A 2PGXA 3IODA 1YFZA 2FZCA 2YVQA 2O8CB 4I1YA 2R11A 3I2KA 3NHKA 3QVGA 2PTHA 4RMHA 3ISVA 5EI5A 1QU3A 1CE8B 2IEDA 4J03A 1NN5A 3RNLA 3SLRA 2WE8A 3R6DA 4H1WA 3DFUA 4YRSA 1J0XO 5KNBH 5LM3A 3AINA 1GXSA 1FU8A 1IZZA 1CUBA 1I7SB 2QN8A 4P7GA 2Z30A 3VZDA 3BZUA 1WZIA 3EXFA 4RCVA 5EE5B 2HU2A 2E5WA 1H42A 4RDXA 1QU2A 1YS9A 1G3IA 5AK0A 4MYHA 3O2JA 2WDZA 1TF7A 1JS1X 1MORA 4DPLA 3CMMA 1EFVB 3I04A 4R8VA 5EP1A 5AVOA 5B3JC 4H9GA 4AMGA 3D1JA 2NYVA 4KH1A 4IZHA 3CLUC 2FH5B 3G02A 3DNFA 1Q20A 1TM7E 2BP7B 3DVSX 3IMKA 1XJWA 3CE9A 3N74A 1Y6QA 4H08A 1M8JA 1Q7TA 2GXQA 2QMEA 4ARBA 5JS1A 3C3WA 5KSWB 5KYWB 1HF3A 4I9UA 2WTNA 2JA2A 3DA8A 3MEQA 3T1NA 2ISQA 3I3OA 3IDFA 3IT2A 4J0HA 3I61A 1Q7EA 1S2LA 4CMGA 3NDRA 2YZMA 5C4GB 1MX1A