4YGXB

Crystal structure of d. melanogaster ssu72+symplekin bound to cis peptidomimetic ctd phospho-ser5 peptide
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
192
structure length
190
Chain Sequence
PSKLAVAVVDSSNMNRSMEAHNFLAKKGFNVRSYGTGERVKLPAFDKPNVYEFGTKYEDIYRDLESKDKEFYTQNGLLHMLDRNRRIKKCPERFQDTKEQFDIIVTVEERVYDLVVMHMESMESVDNRPVHVLNVDVVNNAEDALMGAFVITDMINMMAKSTDLDNDIDELIQEFEERRKRVILHSVLFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Symplekin
publication title Chemical Tools To Decipher Regulation of Phosphatases by Proline Isomerization on Eukaryotic RNA Polymerase II.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 69
structure length 190
sequence length 192
chains with identical sequence D
ec nomenclature ec 3.1.3.-:
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04722 Ssu72 Ssu72-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ygxB01
3EULA 2VYCA 3EQZA 2FN9A 1GUDA 4MQEA 1P8AA 4D6YA 4F12A 3OQMA 4QYMA 2A9QA 3NNNA 1K68A 4MLDA 3RVKA 3N0XA 4KFCA 1ABEA 4JASB 5T3YA 3BILA 5B3JC 5FWXB 4EUKA 4KNYA 3LUKA 5T7BA 2DRIA 1ZHHA 2B4AA 4XAQA 4PICA 1DCKA 5TQ2B 4Q6WA 4WWHA 3NHMA 1D2AA 3CHYA 3A0RB 3QLUC 3JVDA 3TD9A 5JNSA 5CNJA 2PUFA 4ETMA 4NICA 4JB2A 2FEPA 2PE5A 4FB4A 3A3KA 1E6MA 1JFTA 4EYQA 3RVLA 1QP4A 4D74A 1BDHA 3QX9A 3LUAA 3NHZA 4H3KB 5IEJA 5TPZA 2IPLA 3KHTA 3MYYA 2Q5CA 4G0MA 1MB0A 1RXIA 3RVSA 1TMYA 3HDVA 3HUUA 4Q6BA 1NXPA 4P1ZA 4PZ0A 1XHEA 1BA2A 2I6FA 1LK0A 5EWJB 1U0SY 3MF4A 4MQFB 2RJOA 5DCLA 5TPWA 4ZJPA 3QEMB 1L5YA 1NXVA 4QYWA 4IILA 5TQ2A 1HEYA 4RKRA 2FEKA 3IP5A 3KG2A 3OLZA 1M2EA 2CWDA 4MR7B 4Z9AA 3OQNA 1QPZA 1EAYA 3LUJA 1ZH2A 1JDPA 1JFVA 1JX6A 1ABFA 2A9OA 4N03A 2ID7A 3NBMA 4RK4A 1RZRA 4JOQA 4YGXB 3T95A 2IPMA 3GV0A 3MM4A 2GI4A 3O74A 4RV5A 4GPAA 1QKKA 2FMIA 1BDIA 2J48A 1QP7A 4N0PA 2RDMA 4EVRA 4IGAA 4S05A 1KGSA 2FKAA 5TPZD 1FFGA 1D4ZA 3OLXA 1P6UA 5GOTA 4HNRA 2WY2D 2PUCA 1YS6A 4QICA 5EWMA 5EWJA 1LBIA 4MQFA 5I4CA 1H9CA 3QEMA 3MA0A 3OLVA 2FVYA 1D1QA 3GRCA 1QP0A 1ZH4A 3N8IA 2BGGA 1DRKA 4EYKA 3H6GA 3RVMA 4MR7A 4W5NA 1C4WA 3L49A 2PUBA 1ZESA 1U2QA 2E4XA 2FXIA 4LZLA 1Z18A 2FEWB 4TLMB 3CG0A 2GBPA 4KK4A 4EVSA 2WB4A 5HM6A 1RZRD 3QLVC 5KI6A 4QPJC 3HEBA 2FMHA 3EDCA 5IX8A 1K66A 1ZGGA 3A0UA 3LKBA 4FE7A 1FSPA 1C0EA 2QU7A 3RQIA 2R48A 2L2QA 1QO0A 2PUAA 4RK6A 2IOYA 1Z17A 5KQMA 2FQXA 3SY8A 4YV7A 3SG0A 2WMYA 5GQSA 4Z4IA 5IUJC 2M1ZA 4EGSA 3QELB 1OXKB 3H75A 4YO7A 5FWYA 5JS1A 1IIBA 5TQ0A 1ZY2A 3FMVA 3FFTA 3FFWA 4LRQA 4Z99A 3DGEC 1VKRA 2FMKA 3EAFA 3H6HA 4B09A 3RH0A 2VK2A 4KQCA 3BRQA 1JFSA 4NCAA 2TMYA 3C3MA 1YK1A 2F8SA 1FFSA 3FGZA 1NXXA 1A0OA 4DN6A 3ILYA 5C5CA 3HM9A 3LUCA 4EVQA 1B00A 3BRSA 3UKJA 4LDZA 2FLWA 3TO5A 5JNTA 3N75A 3RVRA 1JH9A 1BVHA 3JPYA 3CRNA 3QELA 4RXTA 2QVCA 1NY5A 3DLHA 5BR1A 4LE1A 3GBVA 1E6KA 4KMRA 1MVOA 4G0OA 4KK3A 3Q15C 3BREA 2PJUA 2PUDA 4LDAA 1Z12A 1YVUA 5ABPA 5BQ3A 5PNTA 5F64A 3TB6A 5JNRA 3VNAA 1JF8A 3R0JA 3HV2A 3NNDA 4Z4EA 2R47A 2IYNA 2VUHB 3G85A 3M9XA 5E3JA 1NXSA 1R8JA 4O1IA 2QVGA 4TMYA 5DKFA 3EQ2A 2L17A 1OXBB 3O2SB 1RPJA 5CNKA 2N9UA 4YLEA 1JYFA 1QMPA 4MAAA 3DLBA 1DCMA 3QK7A 3RVNA 4EYGA 3LUHA 2MYPA 2GWRA 2IPNA 2L19A 2FN8A 2WJAA 4LE0A 1DZ3A 3JY6A 1RNLA 3N6VA 3QLTA 1JHZA 5EWLB 3HZHA 3D8UA 4E7OA 4MS3B 4OATA 1F4VA 2JCGA 2LP4Y 3GT7A 3KTOA 2O20A 2MYUA 3F6PA 3LFTA 4ETNA 1Z26A 3JTEA 4RS3A 1Z15A 3I45A 3JVIA 3FFXA 1BAPA 3HXMA 3LUGA 3IDOA 1DG9A 5FWXA 1KRXA 1A04A 5ED4A 1TLFA 4WT7A 1MB3A 4FE4A 3HO1A 1U04A 4MS1B 3ROTA 3SNKA 1SXIA 4W5TA 3OLYA 1ISRA 2X7XA 5EWLA 3OLWA 2L18A 4KQ9A 3OMXA 1T34A 2LUOA 2FTKE 1XHFA 3CFYA 1W9HA 4O1HA 4RXMA 2FMFA 2JB9A 2JK1A 4PYRA 1XWWA 2IPAB 1DBPA 1P6QA 3H5WA 1E6LA 3NNSA 1YK0A 3O1JC 3DZDA 3RVQA 5IC5A 3HS3A 2FW0A 3H5LA 3HDGA 4KVFA 3T6KA 7ABPA 1URPA 5KC9A 3TMYA 2QV0A 5KQPA 1ZN2A 1QQBA 1DC7A 3K4HA 4N47A 4MS1A 3SQNA 2HQRA 3HVRA 1DC8A 5BRAA 4F3TA 4G0PA 4OLBA 2WJWA 3CZCA 1NXTA 3KJXA 3MQ4A 5JS2A 2B1JA 5B3JA 1KRWA 4XLTA 4RY0A 2A9PA 4RY8A 4L4UA 4G0YA 2F8TA 5JNWA 4RDCA 2PLNA 1ZGZA 1DP4A 1D5WA 4KPYA 3KCNA 3QLUA 4F8JA 3KKEA 4G0XA 6CHYA 2E4UA 1GCGA 5HQJA 4WXEA 3KS9A 4MS4B 1Z2DA 4DQDA 2WRZA 3D02A 4D6XA 3CNBA 1GUBA 1APBA 2MYTA 4UHKA 1EFAA 1ZITA 2QSJA 1Y1LA 3URMA 1ISSA 1Z13A 4W5OA 1NATA 3CS3A 3Q7RA 3E3MA 4Q7EA 4Z0NA 4E7PA 4WXMA 1JDNA 1TM2A 4LX8A 2ZAYA 4HYEA 2MYNA 1YIOA 2WWVD 1U2PA 3ROFA 4WZZA 5CNMA 3UUGA 2HQBA 4OLAA 1QO0D 1M5TA 3QX8A 2H0AA 4IMJB 3JPWA 4XXHA 2OQRA 4MR9B 3DGFC 2E4YA 4MPTA 5DTEA 5CNIA 4L85A 2PMCA 3CLKA 2JVIA 4M88A 3HCWA 1Z25A 2RGYA 1S8NA 2JBAB 4KREA 1NXOA 1KMIY 3C3KA 3LKVA 3Q41A 4MQEB 5KWSA 5C5EA 2W42A 1FQWA 2NT4A 1EWKA 2NZVG 4Y9TA 1SXHA 2OENG 5CHYA 4W5QA 3C97A 4IRXA 5IULC 3KSMA 1P2FA 2HJ9A 2R25B 3GWGA 3IP6A 3IP7A 4XARA 5TQJA 4Z9BA 4W5RA 1RXEA 3N0WA 2AYZA 3H5IA 4G0QA 4MRMB 4IMIB 4ZYLA 1PUXA 3QLVA 4Z4CA 1M5UA 2ZWMA 3H1EA 1CHNA 1EHCA 4JB0A 4MR9A 1AB5A 3VNBA 1PNRA 3RVJA 1QNLA 3UK0A 2MSWA 4ETIA 4P98A 3F6CA 2A9RA 1EWVA 2LIVA 3B2NA 3G1WA 2JBAA 3C3WA 4TN5A 1E2BA 3LUDA 4RZSA 3SAJA 3HK2A 1M2FA 3T8YA 2PUEA 2KYRA 1U8TA 3LTEA 1FFWA 3OM1A 5TPWB 3M9WA 4H3HB 2JRLA 4LE2A 4N41A 4OBBA 2MSLA 2FQYA 4OG2A 2PKXA 4MYRA 4RK1A 4MRMA 4RWEA 1AB6A 1TJYA 2GKGA 3Q7TA 4G97A 4XFKA 4JAVC 4TLLB 2HQOA 3HSYA 1CEYA 3QEKA 2PL9A 2QZJA 1UDRA 3Q9SA 4RY9A 4MS3A 1WETA 3LOPA 3A10A 4G86A 2PAFA 2NT3A 1DCFA 1YS7A 1EWTA 1Z2EA 4OTZA 4S04A 2JVJA 1YMUA 4ZMSA 2E4VA 1PEYA 4RK7A 1YTUA 4MGEA 4YS6A 2YHBA 2RJNA 5KQLA 5EWMB 4DADA 3CZ5A 2QW1A 3EJWA 3MMNA 1QQAA 6ABPA 3EODA 1DJMA 3GL9A 3N53A 1L5ZA 3Q7SA 3ILHA 4UHJA 2MSKA 3H5VA 3MIZA 3C6QA 3F7NA 1GCAA 2E4WA 4RXUA 1F51E 4ZMRA 1USGA 1BDJA 4G0ZA 1W25A 2E4ZA 1DBQA 5BRJA 2ID9A 1PEAA 2XDYA 4H60A 5JNVA 1ZVVA 2HPHA 4RK0A 4KV7A 3H5TA 3O21A 2P9HA 1JLKA 1JL3A 2R4QA 5FBHA 3SM9A 2VUIB 3I09A 4NCBA 3CU5A 4YR7A 5HSGA 2QR3A 4HNSA 1YMVA 2FSPA 4RKQA 1SD5A 9ABPA 2JVKA 2NZUG 1Z16A 5JNUA 1DBWA 4MR8B 2FLKA 2IKSA 4GNRA 3EGCA 4YWHA 3O2JA 3O2QB 3H5OA 3T38A 4F06A 5FWYB 4JA2A 3OO1A 5TQ0B 2P4UA 4KZKA 5KC8A 3K9CA 1MAVA 1NTRA 3LUFA 1ZDMA 1NXWA 3CTPA 1PNTA 5DLEA 1I3CA 3OM0A 1USKA 2IDMA 3O75A 4YP9A 4XASA 3I42A 3BBLA 5D2CA 2HSGA 3E61A 4EYOA 3KYIB 1D1PA 5KQGA 5TE9A 3IPCA 1A2OA 2PL1A 3CKMA 1PHRA 3L6UA 1LJLA 4IF4A 1CYEA 3JS5A 4F11A 1VLZA 2H3HA 2FQWA 2CHFA 8ABPA 3OQOA 3OMWA 4PE5B 3S99A 3P9YA 3HUTA 4CBVA 5IUKC 3RVPA 4MR8A 4YRZA 2QXYA 3CG4A 4MLCA 1USIA 3LMKA 5IBQA 3IP9A 2NUBA 4ZPJA 4NQRA 4Z4FA 1DRJA 4O5AA 3I5AA 1VRVA 4MS4A 4Z4GA 3KYJB 1JBEA 3O1HB 5IEBA 3IPAA 3KLOA 3H1GA 2V0NA 4NV3A 1SXGA 3M6MD 3GBPA 5HKOA 4N0QA 1JWLA 2PUGA 4JP1A 4ML3A 1ZAYA 4RK5A 2GX6A 4N76A 3N0RA 4KRFA 4RSMA 4Z4HA 3H1FA 3TX6A 3F73A 4PEVA 1VPWA 3DBIA 1GLGA 5DGCA 4YCSA 4HNQA 1LJUA 1TVMA 3FDFA 3OO0A 3O1IC 4WUTA 2LPMA 2CD7A 3GYBA 4EY3A 2M98A 2LBPA 2YHAA 3RVOA 1J56A 1MIHA 2CHEA 3KLNA 4RU1A 1JYEA 5IUNC 1LBHA 1SRRA 3HJFA 3W9SA 2AYXA 3GA5A 5FBKA
chains in the Genus database with same CATH superfamily
2PIAA 1PT9A 2YV5A 2PSDA 3KB2A 4RACA 4PNEA 4Q39A 2I4NA 1CZLA 3ZNPA 1GUDA 1XTVA 3CEHA 4Q3CA 3RSLA 3ZY6A 4D8UA 2FUKA 1JVNA 2YJ4A 4IO0A 1E3JA 5H3CA 3C6KA 4JU9A 4KNYA 3RABA 3VZCA 3QPUA 3DHEA 4C0HA 5T7BA 2XOKD 4DJJA 1YDMA 1E61A 2XWBF 2X3YA 4ISCA 1DCKA 4MDEA 3HTXA 5EIFA 3LYLA 2GYYA 2Q2WA 3VR6H 4I4LA 1MW9X 2ZVDA 4YCJA 1ZYUA 4G41A 2V7GA 3JVDA 4ND4A 2I1LA 3ROEA 3V2IA 3WQRA 3AKYA 5H8WA 1NT4A 4WDRA 3ROQA 3EVDA 3O94A 1NWCA 3FZGA 4H08A 3T4UA 2F4NA 4LMAA 4P7KA 5AVVA 3EIHA 3U7QA 3ZWDA 5EJAA 3MMZA 3NETA 4UTNA 1QC5A 4QT4A 2QPAA 1WMAA 1CE8B 2VPZA 1VI2A 1XDSA 1MB0A 3IB3A 1EQAA 4V0OA 2OLJA 5EOVA 4DIDA 4Q6BA 1DXQA 1C3EA 4TLBA 1MVLA 4LDRA 4J9UE 3D2LA 1JE1A 5LXTF 1N2BA 3E5NA 1QHEA 2B3DA 3VKHA 4B3GA 2Q5EA 1QBGA 2PUTA 5FLXA 4X84A 4X93A 5BQXA 2JJ8A 1RC1A 1TYBE 1YGPA 2FEKA 2FPKA 4IEFB 4RZHA 4Y1FA 2HLPA 3PU6A 2EZTA 1Y1TA 4MGYR 4QTXA 4P31A 4RKEA 3KL2A 1VLJA 1MH1A 2ZATA 1DDOA 1V9LA 2BFOA 3DE6X 2E87A 5YASA 1NONA 3UQZA 2IQIA 3W5SA 1M6VB 1UH5A 3DXZA 3G89A 3PZRA 2E4AA 5LBTA 4RIIA 5SZIA 1IUKA 1N2CB 5CT5A 4CN8A 2AFHA 2YCLA 1GKIA 2MR6A 2RBKA 1SXJC 2AFIA 2FKAA 1NRXA 3G59A 2FQ1A 1HEIA 3I39X 3NORA 3RIXA 2YNMD 1KYIA 3I01A 3RREA 3P8ZA 5CDYA 5GOTA 4C5BA 3DJYA 1K9VF 5H59A 5LNK6 1IPEA 2PUCA 4DCJA 2DHRA 1K89A 3SJAA 3O8RA 3QEMA 3O03A 1TNDA 4B7ZA 2VPTA 3IVRA 2BGGA 1XRJA 1U02A 3AIOA 3AF4A 1AUOA 2CJWB 3ZHZA 5LU9A 1UMCB 4LDJA 1GAEO 5EJ5A 1HM5A 1U2QA 1Z3IX 3Q40A 4FWBA 2MDTA 2I65A 4PLTA 3TL6A 1NBME 4WESB 3ZCXA 5ERYA 1E4VA 3CJTA 3MWKA 4KK4A 3OFSA 1AKMA 3IKVA 5EGNA 1DV2A 3NBYC 1IUPA 2OMKA 4GIBA 4JC8A 1IOLA 4HCJA 2QVLA 5A9TA 3UWPA 1W581 4FOTA 4AP6A 3GQBA 1CDEA 1X7YA 3HUFA 3PT9A 3D3QA 5F1PA 4EENA 1DJNA 1WQ4A 2YWCA 3D6NB 3SLGA 3N3AC 4LAFA 4Q1BA 1BJTA 2JAOA 3MFQA 4UUBA 4W1SA 4KG7A 3CUVA 3I9V6 2FWJA 1ZM2A 2PXXA 3QKIA 2AEJA 4O4HA 2ZRMA 1PL8A 5CJPA 4O1MA 2FPLA 1G6HA 1GDHA 4MI3A 1PR5A 4YEDA 4E46A 3H75A 2OR3A 1L1QA 4HJXA 4N5IX 4GKKB 1IY8A 1NBEA 1ZY2A 2M6SA 3FMVA 4NABA 2G08A 5T41A 1K0UA 3L04A 4TSFA 5FB3A 1CQXA 1V4VA 3PVCA 4YCAA 1SEPA 1AZLA 1J0BA 4ARCA 2MWMA 3OT1A 4BNUA 2ZUBA 5AI4A 5AVTA 4BJ5A 3AQ4A 2VUUA 2IYUA 3UC9A 3ZI0A 2BM9A 3CEAA 3R77A 4X94A 4M53A 1H2FA 2CNWA 3FLMA 2QY9A 3GRUA 5M5BA 5E0KB 2HFKA 5IK2D 2MSCB 3E1SA 2E7ZA 3E7FA 2EP5A 2IUSA 2GYVA 3LHFA 4DXHA 3ED5A 3A1UA 4BX8A 5G1OA 1SG0A 2QRNA 3KTAA 3U3JA 4EELA 5JNTA 3ND7A 2QX9A 3AWIA 4LJKA 1FNDA 3DVAA 1XWIA 4CLOB 3ZCSA 3E84A 1AK9A 5GINE 1U0NA 3WSWA 4AZ0B 1BZYA 3AVUA 1GZUA 4JLMA 1II8A 2G40A 3DAFA 5F3RA 4R8LA 4CM1A 3C2QA 5LJIA 3DNPA 2Y1OA 3TIVA 3IBCA 4KWCA 4GPIB 2OMEA 2DFNA 3IP3A 3KWJA 4Y7DA 5PNTA 4OQYA 4MV7A 3RVBA 4BPBA 4KDEA 4KQGA 1PJSA 1KDYA 3VNAA 2VNHA 3EQ7A 1R37A 3MQFA 3UMRA 2OAEA 2WA1A 2F1HA 3QWAA 3W3AD 1CY1A 4MB2A 4B48A 2AW5A 4I5FA 4N82A 4HBZA 2FCRA 4TMYA 5A03A 3KTFA 1IUNA 3EQ2A 2R85A 3NG1A 1I3MA 3JVEA 1ZMRA 4Q3AA 5AJYA 1WMSA 1XB2A 2UUOA 2F1JA 5BUZA 5AOAA 1Z2PX 3FTEA 2AE2A 2MYPA 1Y48E 4EY4A 4FYMA 3WL7A 4LXHA 1JHZA 1X1SA 3JD4A 4WNCA 4YJKA 2MHCA 3D8UA 1NY6A 4DLTA 2ZIUB 4MGZR 3RAJA 1P33A 4KYUA 3THOA 1QO9A 5IF3A 3ETEA 4LXGA 3CX3A 4RVOA 3UV6A 1OVMA 2A35A 1CF4A 3U7FB 2D5BA 2C95A 1UDWA 5CFNA 4MDFA 5HS4A 3NTXA 2CLIB 4EQZA 4RTRA 2EFCB 2P9YA 1X7WB 2H2AA 1NOIA 1V11B 3GU3A 1GRCA 1PFYA 3BICA 4U2FA 3HO1A 3Q12A 2I66A 4ZCPA 1VJ0A 4IOLA 4PTZA 5BV2P 2YL2A 1EVZA 3FWYA 4LOAA 4Q7MB 4ZQBA 1PI3A 2EC5A 2IP4A 1FTGA 1IONA 4HNGA 4ESHA 3RU9A 2L18A 1SBZA 3OMXA 3B1JA 2FN7A 4PIMA 3OJXA 3ZHUA 1DC4A 4H0FA 1HO3A 1XEAA 4QSMA 2CV1A 3IT0A 3ZBPA 2XA2A 4I4IA 3FTQA 4REQB 3FPBA 3SJUA 5JG7A 1U1GA 1HDZA 1HI9A 1CF2O 1F9AA 1QIEA 4FS3A 2FY8A 1K6JA 3DZDA 4B46A 3OIUA 4B17A 1I1HA 2HDWA 5KKCA 4RD3A 2HF8A 3ANMA 4PZYA 4A0HA 3IEMA 5F9HA 4FM9A 1RFLA 4N47A 2IX3A 3PQ3A 3SQNA 4RC9A 2XD9A 1DPGA 5AHOA 4LWOA 2ABWA 5FR1A 4EDFA 1TZJA 4RELA 1MOSA 5BORA 5FL3A 1XDZA 1JA1A 3EJ6A 4GQAA 4ZVOA 3TSAA 2GK3A 2PT7A 4KNWA 3CUTA 3ONEA 4WINA 5LQNA 5LA6B 1THGA 4FILA 4OM8A 3KU1A 3ND5A 3UJDA 1Z5VA 2HEIA 1NSTA 1ZZGA 3VU9A 3DBVO 1P0IA 3KNZA 1QHXA 1V25A 5KTTA 3W6UA 3PEYA 1JHQA 3UYKA 1Z2DA 1DBVO 3IAS1 2B4QA 4KR3A 1E4EB 1QZZA 3ONNA 4D6XA 2RK3A 3CNBA 1A9QA 4K26A 4TS9A 2AHOA 4YRTA 3UB4A 5B58C 3O6VA 2LW7A 3NDPA 5AKHA 2M6LA 1W0JA 2GO7A 2XCRB 3G8YA 1TQ8A 3URMA 3IMFA 2R6ZA 5J3JA 5KMGA 3MAJA 1RTKA 1NATA 4NBRA 1YT5A 4O6VA 4JT9A 3QYAA 4Q21A 1PW7A 3GFPA 3RC1A 1P0MA 1XDGA 4MQMA 3ICOA 5MGNA 2NU6B 5A0VA 2FETA 1J8VA 2O1XA 1G5IA 3T7RA 2GGSA 1GITA 3DS8A 4L4ZA 4C5CA 3KUKA 2ZAOA 2C4UA 3T7TA 3Q3HA 2Q7DA 3A2KA 1F0KA 4XPZA 1RWPA 3IAM6 1XD2A 4K05A 3CNOA 4LY0A 4NFLA 2X0RA 4Q4DA 5HMMA 4X6UA 1GPUA 4MR9B 5A4MS 3EVAA 2QMQA 3ZBQA 1XTSA 1YZNA 1HDYA 4EFLA 4OK6A 4HD8A 1QOZA 2QTVA 1FA9A 1F0PA 3QNUA 3EHEA 1A9ZA 1TM3E 4R7TA 3WWPA 3HADA 1VKJA 1ADCA 1COZA 2JBAB 2YUTA 5A3VA 2UU9B 1YL6A 4EX7A 3BXGA 4TSFD 1HDXA 3QFTA 1ND5A 2NZVG 3D0KA 4H6PA 1SXHA 3RU7A 4PX5A 3NI2A 1ZK4A 3D5EA 1I0LA 2GJAA 5BXYA 5KAMA 2ZUWA 1A8IA 4FDLA 4EG7A 1HE2A 2XF8A 2BM1A 1UQRA 1NU6A 1F3LA 3N0WA 1Y8QB 5EXEA 1TK3A 4E2YA 3C6YA 1CCWA 1YR1A 2VZEA 3Q10A 1BH6A 2AFVA 3A14A 1Y7PA 3AHCA 4RD6A 3KKLA 4X9XA 5FI3A 4NAHA 2D4AA 4JT2A 4YX9A 1PR4A 4U63A 1ZM9A 4AS1A 3O84A 1CRLA 1ODSA 3CJQA 5AKJA 3KQNA 1QZUA 1TZCA 1H8HA 2WUEA 2J41A 3N5CA 2PGNA 4PQGA 3T8YA 5ICMA 3JATB 4C03A 4QPDA 5L3SB 3C5WP 2HAEA 1BC5A 1O08A 1TZBA 3FVVA 2JFOA 1I9CA 3OM1A 2XX3A 2R9VA 4ZARA 4LE2A 4UMVA 5KU7A 1G55A 2FHSA 1X8LA 2YHUA 2AOUA 5AW9A 1SHJA 1MQ9A 2D13A 2Q0QA 4K2AA 4QGFA 1DWOA 1JDTA 1HSZA 3ANYB 4PO3X 4QT0A 3DL0A 3S81A 1Z28A 2G82A 2QN1A 2JGRA 2V55B 1S4QA 1QH8A 2EYQA 2VXBA 3IXQA 1JBKA 2X4GA 3LT1A 3DDHA 4CQMB 2GEJA 5IXJA 1WOYA 4HXYA 1C8KA 2BP7B 2P9ZA 5I9NA 4IFBA 3FOAA 3ZN2A 2Q6KA 1E1CA 3F6RA 4IDEA 4ND7A 4DGSA 3ZJTA 1IBRA 1D4FA 2EU8A 4O2LA 2W93A 1UUFA 3Q4GA 3EVBA 2YHBA 5EG5A 5HDQA 3WLHA 2V5UA 1Y9AA 3HI6A 4MEJA 4BEBA 4F96A 5C1PA 5KQLA 1Y9ZA 3EODA 3LXUX 4CCSA 1I7SB 3N53A 3I73A 5A9SB 4IMRA 5BW8A 1UMBB 2F3TA 1RHMA 3GGSA 1S4MA 5BVGA 5JSYA 3VO1A 2AW3A 4DJFC 3JD0A 5IPFA 4YPOA 1TTTA 4NARA 2H18A 3NT2A 3RLIA 1GR0A 4H4CA 3UEOA 2R6CA 4ZJYA 4KH1A 4IRMA 2YIDA 4YQZA 5IYZF 4F1WA 4N5LA 5ALSA 3AIKA 5C5DA 4RTQA 2YV4A 4KX5A 3G2OA 3H8SA 4OL0A 3OTIA 3CUYA 4Y67A 3SM9A 1M2JA 4FBLA 2PGIA 2SCUA 3CVYA 1GT91 1ISMA 1SFRA 1ND6A 1VRCA 2QZ4A 3GCZA 4FLEA 5TEWA 3OIFA 1YMVA 2RIRA 2BE7A 3TSYA 2OO7A 5JNUA 1C2YA 4HVAA 4F93B 2GHRA 3NWPA 3RRFA 3SD7A 4B2PA 1Z82A 4KCGA 1J8QA 1E3WB 4OUDB 3RKSA 1OPXA 4LUCA 3HJTA 4HR7A 1BXGA 5FWYB 4ZALA 4AO7A 2JA2A 3DDSA 3D7KA 3OCUA 1ZDMA 1PG0A 1P9NA 3I1YA 2I9PA 4NYMR 1I3CA 2Z5VA 1JLHA 3OM0A 5CG2A 1QANA 3I32A 4R9NA 1D2HA 3CZAA 4IRUB 4DLZA 2IEGA 1Z0AA 3PC3A 4EA8A 2XMGA 1Y7IA 2BLNA 3IMCA 4P93A 3FAZA 1A96A 2J46A 3E70C 1CS0B 1LJLA 4R98A 5BSMA 1NN3A 3Q85A 1B2LA 3BULA 4LTNA 8ABPA 2PMFA 5LQJA 1MN6A 3S99A 1W47A 2IDJA 4B9AA 1YDHA 1CS4C 4GDFA 2ACKA 2QUKA 1B2RA 1M67A 5EN4A 3A9CA 1NUAA 1RRGA 2LRHA 4Q3EA 2FSIA 5EXSA 3RVDA 1SHTX 5KCMA 5LDGA 2QXYA 1U8UA 1QRTA 2WLTA 1IRIA 4D0NA 4DR6B 1KJYA 2ZRIA 1OH8A 2RAFA 4MS4A 3EN0A 3KYJB 3LFHA 1BEEA 3GFOA 3UMSA 5HBGA 3WLOA 1KAOA 6Q21A 4ZO9A 3U7EB 1NJ2A 5IEBA 1RRKA 1T9CA 1QYIA 3ROPA 4D4KA 1TCVA 4EHFA 1WW2A 3FB4A 1UWVA 4NY1A 2ZKIA 5JC1A 4IFEA 3RUCA 4P7BA 1ZH6A 4IWXA 4Y18A 1Q1EA 1IJBA 4HXEB 2C83A 4GYKA 3GFGA 5U9CA 1L9KA 3PUIA 3CEMA 1OLXB 1KEEB 1PZHA 1C1XB 3MXTA 4LMPA 3B38A 4UJ5A 1WUYA 3M82A 1Z36A 5TB5A 5F3WB 1NVVQ 3EF1A 1OYWA 2OWEA 1VFNA 2VTKA 3D8RA 2PX3A 3KIPA 3RVOA 2WHRA 3GZNA 5CA1F 4RVDA 2FZGA 1FDRA 3DM9B 4E4YA 2DUNA 1IB6A 3TSZA 3ME5A 1N2JA 2Z56A 4GVXA 4R1NA 4F7DA 3S7ZA 1FQOA 2SNIE 3EOBI 3HDJA 4H18A 5AP9A 3HDYA 3T9FA 4D9FA 3IS3A 1Y8AA 4QJ4A 5FYQA 3TOCA 1IYZA 4HRAA 1WCXA 4QJIA 3JARA 4O2BA 1P8AA 4Y9UA 4ZOLB 4JYZA 5LUBA 4KFCA 13PKA 3S4YA 5BN4B 2GXQA 3P4UA 3TI7A 3AP1A 1P7YA 1UJ2A 3E3AA 2GYWA 3LQ1A 3UMCA 2ZB4A 3V1YA 3ZY2A 5BT9A 3WQHA 4HQFA 5EJ8A 5D01A 3HLTA 4WKOA 5JIBA 1Q15A 4PO8A 1Y1PA 4CFSA 4C7JA 5AW3A 1LW7A 4YT4A 2XA9A 3U1BA 3KR2A 5JNSA 3U49A 3MN1A 3ZEAA 4WKGA 1G9SA 4OGGA 3LYUA 3NJRA 2CLHB 4ASUA 4EYQA 3ENVA 3WLIA 1JFTA 3OHSX 3COVA 2ZG6A 4TZTA 2BGNA 5HJ2A 4YR9A 5E4TA 3LL7A 2P0EA 3KXLA 4I66A 5KWVA 2Q5CA 2XZPA 4A91A 2RK4A 1V3QE 1PGQA 2NG1A 5KWEA 3TJMA 1WM1A 4P34A 3WLQA 3LZDA 4JK3A 4DIMA 4F4CA 4P1ZA 3KSZO 5JYCA 3VGJA 2E9SA 1QG4A 1YQGA 1YQXA 4YRSA 2VTBB 1TOAA 3PD0A 3NT5A 4FXOA 4CMAA 5JXWA 2VZLA 4QYWA 4ZZIA 1JEQB 2PX4A 5CYFA 1S1CA 2FMXA 7REQA 1OC2A 4P6VF 5FA8A 5K03A 2VF5X 1P4RA 3HXLA 4C14A 4DV6B 3HCRA 3OF3A 4KN6A 2DFKB 5LWHA 1C1YA 5GWXA 3NBMA 2CHQA 2MSEB 4UNPA 4DNQA 1F1BA 4BLPA 4XH9B 1BQ3A 4G63A 4Z5XA 3LF2A 1NR7A 4P32A 2GCGA 1MORA 2ZB8A 3VR1A 4BX9A 1QKKA 4UEJA 1W96A 5HR5A 2EAUA 1ZUNA 1PLJA 4BP3A 1PWEA 3WDKA 5E7MA 1E0AA 4X62B 1IY0A 1WLYA 1L4GA 3M4ZA 4POOA 3O31A 4DV5B 3DEJA 4PYKA 3T5BA 3I6YA 1FK8A 3GN2A 2AJDA 5D84A 5JAIA 3JQBA 2CXUA 1TJNA 2HSWA 1QP8A 2PNFA 4QICA 3SVZA 3U7JA 2D00A 4DF3A 5BVHB 3GLRA 3FYUB 2VNJA 5BWMA 3M89A 1C9YA 3RV4A 3E9RA 4RW0A 1SNYA 3I8OA 1TCCA 3AV0B 1C4WA 1P2BA 1RHUA 2CJYA 4UU1A 3ZWKA 2WKQA 3IRVA 4AJEA 4GSLA 4WAUA 1JGTA 3VR3A 1JT2A 2WD8A 3WMEA 2OP1A 2WWGA 4EVSA 4JUFA 4MWEA 2BFPA 4V0RA 3EF3A 3WHKA 2QP3A 2GASA 4G01B 1TCAA 4CU2A 2RHDA 1RTTA 4LJLA 2NSDA 1A8SA 1BO6A 1CNFA 2VDMB 3ZD6A 4JQCA 1LU9A 1ORTA 1PFGA 3E35A 1T1RA 3KPYA 4LC1A 4S0XA 2G07A 4WV3A 2FGKA 2OYRA 3EA0A 2QVXX 3UBMA 2IOYA 4F45A 2OWDA 3KEOA 1Z4IA 2V97A 5CEEA 3SY8A 4YV7A 2RGCA 4DLAA 2XNKA 1CQJA 4CKBA 1C9JA 3MRXA 3FLBA 1RWOA 2D7CA 2EWWA 3IP1A 3CMCO 4UUNA 2UVQA 2Y1LA 3K8QA 1BFDA 3W0LB 1BVUA 1ONBA 5C1IA 5ICSA 1EESA 2TMYA 4E3ZA 4YNBA 2VSXA 4DN6A 2ZAIA 1A0OA 1A2KC 3L4JA 1NQUA 3PC8A 3K1AA 4Z0HO 3PZBA 3ZDZB 2IW3A 5JSZB 2KS6A 3M7IA 2VQSA 1R3UA 1CZHA 4NSNA 1M33A 1EG7A 4FD2A 5FNVB 3QX7A 3RTBA 2VRNA 3TO5A 5A5FA 1VDMA 5C53B 5B3KA 4WJLA 2QVCA 4OMFG 3Q5EA 2LCIA 2QPTA 3IAXA 5DHQA 3ANSA 1GZ7A 5FFFA 5BYBA 4WIAA 3FRHA 5K8TA 2QOEA 4UVIA 1J49A 2O5VA 4ZAXA 1XZNA 1XYVA 4QPNA 2NUTB 2PGLA 1H3NA 3MB5A 1UKEA 1KJZA 4Q9AA 4QBHA 4CF4A 1EFUA 1VECA 2PYIA 3K70D 2Q29A 3E7XA 2IEBA 2NZYA 2ZZKA 2NTJA 3QG1A 1I7DA 1O97D 1U1FA 2FZVA 3SDSA 2HT1A 5IJWA 1P1FA 4RABA 1OASA 3CLRC 1X7GA 2EW2A 1E9DA 1MJHA 4D3DA 2EF1A 1AE1A 1NW5A 4TV8F 3AUFA 1WF6A 1Y82A 1AF7A 3A9TA 4J3JA 1PQUA 1PKEA 2Y9MB 1XVTA 3MJRA 4MQBA 2K2WA 3RG8A 4L5BA 3HWRA 3NIBA 1G4UR 1ZJ4A 3ORFA 4MP6A 4JR2A 4U6SA 3ZS8A 1NJ8A 5TDHA 4GZLA 4POAA 4TX1A 5ES3A 3JVIA 3V80A 4ZVVA 4BY9E 2P6NA 2A9JA 5DLPA 4MYUA 2H08A 4OK5A 3T0IA 4BYMA 3COJA 4Z7OB 3NEAA 1KDZA 1Z0SA 1EUZA 4KL8S 4M0EA 2ACWA 1HL3A 4FFNA 2HKIA 2YVAA 3S1AB 1A5ZA 3WLKX 5EXPA 4JLWA 1XCGB 3ZV3A 2BF4A 3DAYA 5K0LA 3OEED 3UMMA 1CUBA 2NSJA 2BCGY 2P91A 2VH1A 2FWIA 2ZIZA 4MHTA 3PNQA 2NADA 3U3RA 4EW6A 4CEHA 2QR5A 3ZV5A 2AVDA 3TM4A 1I4DD 1XRQA 3BMQB 2G76A 4ASUD 2YMPA 4TRRA 3CFYA 4YV2A 2A9FA 5C7IO 3DMYA 4G3XA 2I33A 4NKRA 2JB9A 3ONFA 2VFAA 3KFLA 4DE5A 5AVZA 1HR0B 1YUMA 1UDXA 3MUEA 2IYQA 3R3JA 1PYGA 3CX4A 2GXAA 3BN3A 2J09A 3PUYA 3Q5GA 3K70C 2O3SA 4IXDA 1ZC3A 3ORSA 3JQPA 1CUDA 4UXHA 5EAIA 4AURA 1QB8A 2B4TO 4M7OA 4BO6A 4R2MA 1U8FO 2OZLA 1URPA 1WSDA 2XMBA 2D3TA 3N58A 4QXPA 4CLXA 3V4RA 1UK9A 3AM1A 2PD3A 2AJTA 2GBLC 2VK1A 4V1CB 4IW3B 1H9BA 3BD7A 1HFEL 1ZSNA 4L78A 1I32A 4E0BA 1EK2A 2UUAB 4ALKA 1FRQA 4CQNA 4ARIA 1NFFA 3HGQA 4DIBA 3X0DA 3KP1A 4OXIA 2EKLA 4OHPA 3ZZUA 4Z1OA 3KJXA 1QHHA 3S2GA 4QU8A 4UKDA 4ZWNA 1JHOA 2QM0A 1NJ5A 5I9BA 5JY1A 4EHBA 4NMHA 2LCQA 2QE6A 1DHRA 2A9PA 3BTUA 1IHYA 4FFBB 4KE6A 4JOBA 4PXYA 5EP1A 4E11A 3LWBA 3SC3A 2PLNA 3SYTA 4F9GA 2MR5A 1Y7TA 1ORIA 1EXMA 4X0EA 4BTEA 5AUNB 4BFZA 1ADJA 4HP8A 5H1YA 2VQFB 3OUTA 1A88A 3CN9A 4MVXA 4RESA 3MG9A 4KLNA 2NTVA 5HGJA 1GCIA 4OGFA 4WERA 4Y6QA 5JLJA 2WM8A 2QBYA 5TRTA 4AQ7A 3CUKA 1WMEA 3DMGA 1UBSB 3IH5A 4RLQA 4AMUA 1RBQA 1W5AA 1N77A 3I4LA 4O25A 1STOA 4EW2A 1KJIA 3NC1C 3ZDFA 5JJIA 3IILA 2PMEA 4LYFA 1E9CA 4JMPA 1AV7A 4L4RA 4AF8A 1TKRA 2Q3JA 2CF5A 3L0IB 2P1RA 2C9BA 3H5RA 4IVQA 5DX1A 3C1TA 1C50A 4LI3X 3AB7A 4M0DA 4MZXA 3UATA 2YJTD 1FLDA 1YGYA 4P22A 5CUQA 3FGNA 2XT9A 4Z3OA 1L0BA 1PT5A 5AWFC 3K6SB 3GRRA 4RPLA 1A95A 2C4NA 1R0BA 1QTQA 4OLAA 1YU9A 1CRWG 1TMOA 2H0AA 3DAGA 5ESXA 2WUGA 4MAMA 4M87A 3TBHA 1YZHA 1XKQA 2DAPA 2GZMA 3AXSA 4YP5A 1H2EA 5KOJA 3ER6A 1W1UA 2O7RA 1T29A 3P9KA 3W8EA 7GPBA 4FE3A 1N6IA 2IIPA 2OKGA 4M88A 2GNAA 3O3OB 2Q3DA 3NV7A 1TYCA 3GLTA 4HDNA 2ZTVA 3NXKA 4RA6B 1RLOA 2DPMA 3CMMA 3FVRA 3TEJA 2QD5A 1ZJ5A 5A5DA 1YRLA 1GZ5A 1B8NA 4YJGB 2G1UA 2HA6A 3G8DA 1IK4A 2ZUSA 3GNSA 3IP6A 3IXLA 1IL0A 3KSDO 1U9CA 1U8CB 1NULA 1JIUA 3I4CA 4C7XA 1P3JA 4GOLD 1USWA 2IYOA 1DVRA 2LKCA 1QRAA 2CXPA 2OZVA 2WT9A 1NUQA 4QDXA 4N1AA 3JQBC 2J59A 4XVRA 4CTOA 4FDVA 2H0RA 3CX6A 4JLJA 4TROA 5COBA 1OB5A 1FSGA 2YJGA 1NC1A 1UAAA 1YE8A 3U5ZB 2O2XA 4XM2A 2J32A 4LNUB 2EXXA 2VWPA 1KQFA 1ESCA 2RC6A 1BCRB 2RGBA 1CDDA 1H2HA 3PPIA 1HDGO 2EKZA 2OFOA 2WVHA 1N8SA 3F7OA 4GXTA 3ST7A 3HKDB 1X9HA 1IU9A 3INGA 3V2UA 4CHGA 3A9RA 4D0RA 1CEXA 4KQEA 4F4HA 3E4CA 4DJEC 2ZDGA 1LSJA 3RKRA 2OLEA 4TLEA 3H97A 3SM3A 4B2YA 3RKUA 4D80A 5JZOA 3ILSA 1HEUA 4KYVA 4DT1A 5D3QA 4JGGA 2ODBA 3LCJA 5JHHB 2EG5A 3ZOKA 4DSTA 1C7EA 1DIAA 4WBNF 4G4JA 2PKXA 5I4IA 2X8JB 1ODTC 4LV8B 4BLUA 2HNBA 4Y6OA 5EKXA 2JG3A 1MRSA 4W7SA 4IZOA 5DX8A 1QCYA 3FD8A 4RHUA 2X0IA 3I6ZA 1MJ5A 3Q88A 5IKPA 3TG2A 1INLA 2HQOA 4FD3A 1L7VC 3GK3A 3L1JA 1ZGHA 3HSYA 3ZWVA 4CGZA 5CJ2A 4WLUA 5CX1A 2VYNA 2YBDA 4IICA 4E32A 3DPIA 1BU8A 1E9RA 4PX3A 3DF7A 3TNJA 3DHVA 5FPSA 2E4VA 3QJYA 2ZUEA 5H9WA 4YMUA 3PEWA 3LCUA 2DQ4A 4DUYB 3PC8C 4G0UA 3GDOA 2VP0A 3VYUB 1W2HA 1M2NA 1R50A 2QP4A 4OHWA 4ZXPA 3ILHA 1OWMA 4FR0A 3G6KA 1SVNA 4N0EA 1IM2A 4RANA 4B4WA 3TLKA 4D5GA 5IJ0A 1B76A 2C0QA 1K3FA 1YUBA 3OU2A 1K5GA 2VDRB 1WZNA 3GJ7A 2GZAA 4KP7A 4F5ZA 2QLNA 2D5CA 5BR4A 1DELA 1V39A 4MGHA 1V43A 1K7FB 1RT9A 2F64A 3GP5A 2PS3A 2BDEA 3ZVRA 5EJ6A 2YJZA 1THMA 2UUPA 4KV7A 4ENQA 4WOCA 2ILVA 1K63A 3TVDA 2C2MA 5E95A 1GEGA 4JA0A 2ZIEA 3G8BA 4WY2A 3A1NA 4WY8A 2ALJA 2NQTA 1DEOA 1A50B 1P2DA 4DBZA 4EHJA 4TV9F 5BMOA 1Z16A 3KUUA 4YRGA 1W0KA 1JZQA 4C3VA 1GPKA 1AZTA 3QYJA 2OHIA 3K16A 2YTZA 5DHFA 1H8ED 1FBNA 5TQ0B 5BNWA 3FI0A 3GGCA 4TKZA 1MX3A 5GMOA 5K4GA 1Q17A 5IJAA 4LCEA 2BMVA 2QLTA 5ELXA 2HLNA 2P2DA 4FINA 4BQNA 1CUCA 2HHJA 4DYHA 5ENDA 3HP1A 5AR1A 3OCWA 4I1IA 4D4JA 2Z8YM 3G5AA 1N3IA 2HK9A 4L1KA 3BBLA 3JQGA 2HSGA 4CETA 2F9LA 4NVRA 1TUBA 2HDNB 4P92A 2O3UA 3S29A 3EX7C 4IF4A 4XWKA 3CVVA 4J2OA 1R9NA 2RE8A 1OVGA 1RU3A 3GGOA 3HEMA 5K3CA 4B83A 2C5EA 5AUOB 2ZSUA 1E6EA 4GBGA 2DXIA 2FWBA 1D4OA 2OSBA 2ZE6A 4Y1EA 2GQ0A 3EVFA 2Z0MA 3L0BA 3NTOA 2E89A 3L6DA 4YRZA 1A9YA 1W88A 1OAOA 1IBSA 1FP6A 1GA4A 4BNDA 4I6JA 3PHHA 2YJ6A 2XBLA 3IP9A 3B1VA 3D7RA 3UGJA 4XEUA 1R27A 1FVXA 1ZNYA 4FGJA 3DDCA 2ODWA 3LT5A 4Z4GA 1Q0ZA 3QSGA 3UAZA 1JBEA 1TEXA 2FP4A 2YFYA 3EW7A 3FYDA 3KZVA 1HMYA 4LSGA 4C2AA 4FSHA 1E20A 4MGIR 3GLGA 4GICA 2GX6A 2AXQA 3HK2A 4KRFA 3GQVA 3UFXB 3VR6A 4AJOA 4EYSA 4ACBA 3TVYA 2ORWA 3AFOA 2J0EA 1AGPA 2B82A 5TEVA 5ARCA 5FX2A 1H1LB 2FV8A 3G79A 2ZUVA 3DFMA 3I9JA 3OO0A 3N2GA 1CRZA 1E6CA 4QYSA 4OA5A 2CXSA 3URKA 3LP5A 1KKMA 4Z1MA 3AH8A 1P61B 3S7TA 2UZ3A 3ZG6A 3SZRA 1E8NA 3F7MA 4EKGA 1N6OA 4MPJA 4TQAA 3GW8A 2Z6VA 1K98A 2WF6A 4MKXA 2GVDC 4JLDA 2XE4A 2OGZA 2W00A 3TKLA 3RRZA 1CQWA 1WMDA 1R6BX 3ENWA 4LFAB 1SVKA 1NF9A 3GOHA 2R8OA 2R4TA 5ECWA 1G8AA 1F1JA 3HCEA 1X80A 4IV5A 2WZCA 4MK4A 4QRIA 5C8YF 1E8DA 4KFRA 3THYA 1DX9A 2C3PA 3FYSA 1HE4A 4NBNA 1SIUA 4DLKA 3A4YA 1OHHA 1ABEA 4KGDA 5T3YA 1M6YA 1QIMA 2HMSA 2R8XA 1P2SA 1WW8A 3PX3A 1SR8A 2C9ZA 4QOIA 5DGDA 5FHRA 4DCGA 1KYVA 1SWVA 5GV8A 3R5KA 2OILA 5TQ2B 2I8AA 4Q6WA 4RSRA 2CW5A 1YDEA 2P40A 1P45A 4JVNA 4NZ9A 4BB9A 3T5GA 4B3HA 5I7SA 3OC0A 5CNJA 4BE9A 4EZBA 1W46A 5CFPA 4BBJA 1Q0HA 4PAWA 3KKNA 2UVPA 2YVQA 2IHTA 4U2GA 3TKYA 1Z8FA 2NP7A 3SC6A 2AMJA 3HBMA 5KNCH 1PJ2A 4US0R 4O4IF 2OP0A 1CR4A 3AK4A 3FIJA 4DCSA 3HA7A 3Q5DA 4DVJA 2BMDA 1LC3A 1U6IA 2DFVA 1UFVA 4X60A 5JADA 2O9JA 3HH8A 3VDMA 2G09A 4CEJB 4PM4A 4ZI2A 2POQX 2WZBA 1BD3A 4QDZA 1XDUA 1G16A 1EFLA 4UJ3A 4E2ZA 2WQ6A 2GA9A 1V3UA 2ZJBA 1FU7A 1NE2A 2AD1A 4URVR 5IZ4A 2Z2KA 2HL6A 3NFRA 4UCXA 1YB7A 3W2GA 1NV8A 1U5CA 5ETJA 4EJSC 3IP5A 2F00A 2HLDD 2OFPA 1G3QA 2CEKA 2EKDA 3KG2A 3PEFA 4P36A 3L1UA 3VC1A 4C0JA 1G8KA 4DLRA 3LUJA 3U37A 4A8PA 1PZFA 3OJEA 2QX8A 2DH6A 2YYSA 3OZRA 4NH4A 4BVEA 2QN3A 1FMCA 1Z2AA 3MGKA 3MM4A 3PS9A 1WW3A 3TOZA 4DV3B 2Q3FA 1PZXA 1WB5A 1WDKA 3CZQA 3KOXA 5CLQA 4BGEA 1Z6PA 1ADBA 1ZI6A 2IF0A 5AI5A 5AM1A 3EFOB 4ROTA 2Q3CA 4KXYA 3UOWA 4BKOA 2FE4A 3KOWA 4C0XA 4EVRA 2OV8A 1YOVA 2Z8XA 3FE2A 4CFYA 5KJCA 1GNVA 3SS7X 2BFEB 3AKDA 5EINA 3V4FA 5KHOC 3G9XA 4JSTA 3OX1A 1CZNA 1J9EA 2XWQA 3QG5A 4XQGA 3N2NA 5LYJB 1VKNA 2HCJB 4M1QA 5K9ZA 5EXTA 5DOVA 2IU0A 3EQ9A 1VE3A 3SOZA 1NMZA 3PHGA 2NYVA 4MIKA 3F5DA 2O8FA 1M1YA 2WAYA 2LKDA 3FN4A 5IT0A 5ECYA 3KDSE 3EDQA 1IPFA 5EP4A 1T26A 5I8PA 1RACA 5G0UA 4BKRA 1Q1GA 2XXAA 3TUZC 1R4MB 4G24A 4DMMA 4IQ8A 3MYRA 3SJBA 1S9HA 3JAWA 2W5UA 3HCCA 4BQIA 3ZZNA 1Q21A 3TR5A 4F97A 1ZGGA 3GCXA 2EQAA 1HGXA 1TC1A 2W2KA 2MU1A 4U7GA 3CVWA 4CEIA 2GOYA 3HNRA 2L2QA 3EZ6A 3OIGA 4PCLA 1NNI1 4Q9IA 1XRLA 2HB6A 5DM70 4AVYA 2IXTA 5FBRB 3JYLA 1A9XA 2JIRA 5AW1A 3CPEA 5CLIA 2EZ4A 1KFKB 3U4DA 3BEOA 4AP9A 1U31A 1W0KD 1W4LA 3SZGA 3O5AA 2R79A 5JS1A 3V9PA 3R3HA 5LLSA 2ASEA 2XF2A 2ZRQA 6YASA 3NVAA 2HJWA 3SHOA 3PDWA 1P7WA 2AWOA 4JEHA 3RUFA 4LZWA 3PJRA 1JLRA 1AGRA 1U3WA 2ZYSA 3HDQA 4IJWA 2P4QA 4BVLA 1RABA 1T5DX 4D9CA 3NXSA 1IEVA 4B3DA 1O6FA 5LQUA 3PX7A 4DAOA 2OVBA 3BG5A 1L1RA 2JI7A 3JZAA 3PQ6A 1NZDA 1YS9A 1ZS9A 4IVRA 4N18A 3RYIB 3FY4A 4BVBA 5KSOA 4RDIA 4OCZA 1Z6XA 1SXJE 1U3CA 1WCV1 3JSAA 3KSUA 3LRTA 2WSMA 4ND2A 4YHBA 4BHTA 5ITZB 5MN4A 3DTVA 1M8GA 1S7GA 4REMA 1Q50A 3UMVA 4TKMA 3NHSA 5IHPA 1BVHA 2JFNA 4CF3A 3AW8A 3AR5A 3TDMA 4ZOBA 3L82B 4I9GA 4X44A 2JBHA 3MBOA 1WCYA 3VO2A 3PA6A 2J0QA 1QVVA 3A3YA 3DW3X 2R66A 3CH7A 1ORDA 4J0HA 2ZGVA 2CZGA 1YVUA 4KHZA 1POXA 3OUUA 4WZBE 4X97A 3Q0TA 3SMQA 9LDTA 2WQ7A 4UD2A 4Z7QB 1JQKA 3PJDA 3Q3VA 3C3YA 4YP0A 1RBMA 3VAAA 1E89A 2YOFA 4KN5A 3HKEB 4PZDA 3W9YA 4AJHA 2WWXA 5K7SA 2IYNA 3TSCA 5E6SB 1T6BY 4TZKA 2ZSAA 1NXSA 1R4NA 5CM8B 3SYRA 1FX0B 1SQ5A 1LXCA 5LOVB 1RAEA 1W1IA 1RKXA 2HRZA 1PWXA 3O2SB 3PT5A 4H31A 4NX2A 4PLVA 5H9VA 1YJXA 5HMLA 4BUJA 1QMPA 4MAAA 1KBOA 2I5PO 3BWCA 2DBYA 4L0QA 3A9VA 5FJJA 3B1YA 4FNMA 4BVAA 5KWJA 3GHHA 4Z1MD 3SYKA 2OUKA 3A6GA 4CKWB 1VCNA 3DR5A 4I1UA 4YASA 1YONA 3PGLA 4B6SA 2FOIA 5LQAA 2NNLD 4JKYA 4C4OA 2XB2A 1C0PA 1J8MF 4NCJA 5I5GA 5JSUA 3ZE1B 2SECE 3EGDA 3UYLA 4IOMA 4XOUA 2OC9A 2RSLA 3ESXA 2RJ3A 1ZC4A 1WB9A 1BJRE 1Z74A 3OCYA 3IEIA 4NG4A 2J4FA 3QUTA 5CLHA 1EZ4A 4RS3A 2E6UX 4DDTA 3IJEB 3GLHE 4HAVA 5BN5A 2ZYUX 2IS4A 2WHEA 3LUGA 5CCBA 2I3BA 2RGRA 3T52A 1L5WA 4HX5A 4M0LA 1OHHD 2I1WA 2OSVA 3ZX5A 2BFBB 4NZPA 3CUSA 4I8XA 2QT9A 1M6WA 2V4MA 4GVLA 4YJFB 4EUFA 1PL7A 5JCJD 2EGGA 2P8JA 3EYWA 3ND6A 5KOYA 3O47A 1L8OA 1WY7A 1I6KA 1M10A 3AHEA 4JL5A 1SXIA 2LTAA 4O4LA 1KMNA 1OAOC 2GUGA 2I6UA 3C5VA 3OLYA 4PQEA 3OJ0A 3P97A 5FL7A 5EWLA 4D8YA 3OLWA 4YRIA 1LV7A 2REOA 3NIDB 2VT6A 2CNDA 2ZJ3A 3WADA 1Y4UA 3FOFC 1SPXA 1C9DB 2AA3A 1N5KA 4C07A 3ZDYB 3EGIA 1Y1RA 3D3KA 4RLSA 4JQYA 4Z54A 2QRJA 1RHJA 2EL7A 4J0QA 5HG0A 1PO7A 4E1BA 1IDOA 4UOQA 3WRVA 2C4WA 1R1DA 4BNJA 1SCUA 4L72A 2GO1A 1NUSA 4XIFA 2GJ9A 2C7BA 3HS3A 2AB0A 5C8XA 3LLMA 1TDJA 4GZMA 3I6MA 4LRUA 4YCBA 4R1MA 2PXCA 2AN4A 1XEXB 2PLAA 1QUFA 3AR7A 3BGIA 3HM2A 3Q8WA 3FZNA 2OTCA 4PSDA 3DLTA 5F2KA 2B8WA 3CW8X 4A8JB 1ENPA 4EGJA 4INAA 1D2RA 3B9BA 4OYRA 4XDGA 3TLGA 1VIAA 1X7ZB 4PHTA 3UMFA 2XI4A 4LEIA 1S3IA 4MITA 4TYPA 1FTSA 1C3XA 4YP1A 4G9GA 4Y1RB 5EFZA 2W4QA 1XQXA 2SKEA 5DYNA 3C3EA 2FK8A 5A5VA 4UHFA 4ZAYA 1R0WA 1PX2A 4YCMA 4ZI7B 1NN1A 2PMBA 3VR0A 5AOCA 2XBUA 1PQYA 3UKDA 2Q1SA 1ENZA 1AKEA 2G67A 4M9UA 5JNWA 5L7TA 1AQ6A 2V7XA 3LOUA 2PMWB 3L6OO 1XZMA 2Z2XA 3W6OA 2LXNA 3EXHC 5E3IA 2O3QA 4LQ4A 4H7HA 3STUA 3VHXA 1XSEA 4Q66C 1GUYA 1TQHA 1KAHA 2FXVA 2QDKA 2UDPA 3BJMA 3MRTA 4UHKA 3R9IA 4X64B 5IMSA 3PXUA 3E8MA 3X43A 5E9WA 2VDNB 1HUQA 1RZVA 4FEEA 1PLLA 4KXXA 4L50A 4AN1A 1GR1A 3RJTA 5MDHA 3GPBA 2W90A 2GNOA 4V1CI 3QQPA 4BO8A 3IOYA 3BQMB 2MMGA 3DKIA 4FJ1A 2CLKB 1MKYA 4ALLA 4QM7A 1XTUA 4QFCA 1R6TA 3A4VA 1FXUA 3P9XA 3FUWA 4N4AA 1PU2A 4PC6A 3V3KA 2JLYA 1KYWA 4CQLB 4H7JA 3O82A 3A7EA 2WWVD 4PLFA 4DV7B 4EL5A 2G8LA 2AYYA 2PD6A 4Z7NB 4TQGA 3VZPA 1AUPA 5CB0A 2RHCA 4DG8A 1RKQA 5T3UA 3KUDA 5THXA 4N7BA 2A8YA 4I4TA 3BQNB 1KAQA 2E4YA 2V58A 3VR4A 3WJ2A 4BFTA 3U4GA 1W5SA 2WU0A 2OEPA 3DEKA 1KJJA 1PFQA 1RKBA 3LBNA 4INJA 1UBHS 1VBFA 4RKYA 3TW8B 1YJBA 4DQ0A 4I5EA 4QVGA 4Y2VA 2QUZA 1GQFA 3GXOA 1I51A 3HPRA 3T1QA 5A6SA 4ZO7A 3U4AA 1KMIY 4D2IA 2C9DA 3T61A 5KYUA 5C5EA 5TMPA 3K2QA 1LS6A 5IULC 3O4VA 3EUWA 1YSCA 2ACVA 2RHWA 3WWCA 3M3DA 1V2GA 4M6WA 4AULA 1M2KA 1ZBQA 1XTIA 3IOCA 3ZE6A 1S2IA 3VJRA 1J2EA 2H65A 1TFRA 4BO7A 2XYPA 1JBQA 3G5TA 4HN2A 4DHEA 2AR9A 2OFFA 1ISJA 1JFFA 5K3EA 3GPCA 4TM7A 4CG3A 4QOFA 3GPDG 2PL3A 4K9NA 1QZ3A 1QHIA 1W87A 2C9MA 2P2ZA 4F1JA 3DTVD 1E5TA 2X41A 4PFJA 1P0PA 1FDUA 1Y89A 2QN9A 1L7QA 2OKCA 5EXXA 3UJAA 1U4SA 3LQKA 2FW1A 5FULA 1LB1B 3WRYA 3WYNA 2CNOA 3UJ8A 2C4TA 1YR6A 1U3UA 1VPEA 3C3WA 5A6VA 3VKVA 4RZSA 1W34A 2FEMA 2IF2A 2OV4A 3FNBA 3GEGA 3DFUA 3C3XA 5CA0A 1Y8ZA 2Q1WA 2VF7A 2V3WA 5TPWB 4COKA 1Y1SA 4AY2A 3MPOA 3FMIA 3VFDA 1BDMA 3KM0A 3IAS6 1NZFA 4FDAA 2AH5A 3L7OA 2JS7A 5K2OA 2XVYA 4JC4A 5FV4A 4WGGA 3ML1A 2CLOB 2AR0A 1KKLA 2GN8A 3AHJA 3JQCA 2I4OA 3UTCA 4ZDJA 3AFMA 3G2NA 4H17A 4F85A 2ZANA 1SHKA 4MJLA 1GZVA 3DBHB 5FD8A 1J5EB 4TXLA 4UEKA 5C1DA 4BNLA 4JC0A 4XGNA 1L4MA 3QOWA 2JI9A 1K8ZB 1ABBA 1HYBA 4XRRA 1VP9A 1NQ5A 3I6BA 4MVJG 3UICA 4EUNA 5AVWA 5EIWA 1EWTA 2ORED 3OQHA 1SKAA 2HRQA 4R1PA 3O8OB 3QBTA 3KVVA 1E7MA 3HBNA 4XGQA 1QAMA 1PEYA 3MERA 3QVGB 1EDZA 1XKTA 2IXGA 2RFLA 3BE6A 4QJ5A 4QQRA 3VA7A 2Z98A 2EV9A 1EI9A 4DIOA 4Z51A 5C8ZA 2QW1A 3EJWA 1S2GA 4MW0A 4EECA 5E4FA 1CUVA 2NOAA 3D3WB 1JDSA 1CZUA 1LBQA 1B6SA 1SIBE 2G5CA 2AFHE 2Q9UA 3DXXA 2ZKLA 4JELA 1GCAA 2D1YA 2E4WA 2AFIE 2QRVA 4RXUA 4ZVSA 1XMPA 2CXNA 2Z2JA 4BO4A 5BN1A 2PYDA 2YOHA 2JJ1A 3AZQA 4ILEA 2WFAA 2PGJA 1ESEA 5TF4A 2HWKA 3STHA 2ZSDA 3BH6A 1XEWX 3P2OA 2XDYA 4MUAA 3SXUB 3OWOA 1FLVA 4QM6A 2ZR8A 5KYWB 3ZDBA 3WG9A 4EG5A 1YQDA 2BDUA 1W48A 3INNA 5EY5B 3FB1A 1JG1A 1L8AA 3JWHA 2CXTA 3WYCA 1WD5A 1U7WA 1EB9A 3RYFA 4R40A 1J39A 3C5CA 3O92A 3WGOA 4AMVA 4L75A 2H4YA 2Q1XA 4Z4IA 3TYXA 4OQDA 2Q0SA 3S2UA 3AL2A 1YS1X 3Q3EA 4DREA 5JAPA 1DBWA 1KIFA 2FLKA 1FRVA 2QLJA 1ATZA 4FP9A 2FI1A 2FPWA 1LD3A 4N5DA 3FUVA 3O2QB 5UKDA 4PN7A 2PJRA 2OORC 1G1MA 3NPAA 2IYSA 5KSWB 2IEIA 3CX7A 4JFAA 1NTRA 3ICPA 4PQYA 3UZUA 3X1WA 1O8CA 4GSYA 4WDQA 4E5MA 1MC4A 2ZB3A 5K8CA 5JROA 4WEQA 3P20A 3WNQA 5HDBB 2GJKA 1ODCA 1ZM7A 4YH1A 3BMOB 1QFXA 3W06A 3I42A 5CYOA 5D2CA 4X3OA 1HT3A 2FX3A 1F48A 5DU2A 4IVNA 5AOBA 3IPCA 5TE9A 4NENA 5A2QA 4A8HA 4KQ6A 2C59A 4HS9A 1DB3A 3OCXA 3OA0A 3PNPA 3DMHA 1D6JA 1HV8A 2A4MA 5E9AA 1H2AS 3RRXA 1ADGA 1T4CB 3WJAA 2DQYA 1Z5GA 4IR7A 3GLUA 4G5HA 2NXNA 4U2CA 1YJAA 2JFUA 1VE1A 2I4TA 2YJ5A 3MS4A 4HRYA 1VRVA 2VRBA 1FMLA 2XQKA 1XTQA 1COWA 1ZN8A 3M6LA 3GZ4A 4MYCA 3ZV4A 5HZGA 1BEUB 1OX4A 3FCSB 5EERA 1BWQA 4YA6A 3DT6A 4PG6A 1XTPA 5EUQB 4DSAA 2VATA 5H3HA 1ZBDA 3Q8MA 1I2MA 1I01A 4OJYA 3TX6A 1M3SA 4TYYA 2ONKA 2CE2X 2OZEA 3U7IA 2B1IA 4DIEA 1PVVA 1L9XA 3FGPA 2VWQA 2YIJA 3ZU6A 1GLGA 1DG1G 1EUDA 2WSSA 3IDAA 4P3OA 3FDFA 1Y6RA 1NRJB 1YVDA 3O1IC 1KP9A 1XLVA 2HREA 2VHCA 4NNJA 2XUKA 2Y0CA 4U39A 1W19A 4MYDA 3WYGA 4DYDA 1C1HA 1NSFA 5DNDA 1MIHA 1FCJA 1FOEB 1GKKA 1QG6A 2H00A 1SZCA 1PJRA 3KVRA 5AXAA 3DMTA 3VR4D 5CB8A 1L8QA 4KQHA 1WCIB 1QO7A 1H5QA 1IXSB 1LRLA 1WQ3A 2G0TA 2H1WA 2VQDA 3JD1A 4JJEA 4PANA 3W2EA 2JA1A 1RQNA 1TCBA 4S35A 3QSYA 1OR8A 2FGJA 4OV6B 2Q3LA 2J7PD 2NACA 2FR8A 3A6EA 1ZNXA 3DE0X 1R00A 4B0OA 4GLJA 2P79A 2PZMA 2B4AA 4WOBA 1S5PA 3EWSA 3EZ9A 3AY0A 2R6JA 3H0EA 2P0YA 3N6XA 1U80A 4O2AB 2R7NA 5E9QA 3A0RB 1MW8X 3VPBA 3T1VA 3JALB 2J9FA 2JC3A 5AVJA 4CM9D 1WS6A 3ZNOA 2Q4BA 4N12A 1E2EA 1O5OA 4RAOA 3SBOA 2WI8A 4CKZA 3WL5A 3PCTA 4ARVA 3PPWA 4GM1A 3B51X 3IT3A 5ENVA 3STXA 3LQRA 4E6EA 3I61A 4CM7A 2GCPA 4I1YA 1JPNA 2LGJA 4QO8A 4G09A 1MF7A 2Q9AA 3RVSA 4OB7A 4R54A 2EBHX 4KYIB 3Q7EA 3DZ8A 2G72A 2TRSB 5EEHA 5AYVA 5J2UB 5JJCA 4AZVA 3GJ4A 1SVMA 3P9SA 2R6FA 3LT4A 3OCZA 1Y6QA 2PX6A 2BEVA 1KZ9A 5CDFA 4K9DA 1DFIA 2REQB 2JGKA 1CUEA 4X20A 2ZWIA 2NU7B 3VPAA 1YFLA 4LRYA 1QOPB 1Z4KA 3HXTA 5DB4A 3CF4G 5EESA 4PZLA 3V6LA 5A5EA 1GARA 1NHGA 4FEGA 1JFVA 2QJWA 4GC5A 4HKTA 3JYOA 4B3BA 4IH1A 4CTMA 3CW9A 2HF9A 1JQEA 1YA8A 5DM4A 4Y6SA 1T6ZA 3HQ4O 4AXXA 4YFYA 4EY8A 4WXHA 3CO0S 5GOZA 2GI4A 3WGQA 2FZLA 1BS2A 4MW7A 1IVYA 4AUMA 1BDIA 1I9GA 1E9EA 2VR1A 3VPFA 4MIEA 3UPDA 2R8EA 4EAQA 1VLLA 2BGIA 4HDMA 3DV0A 1G5TA 2BTQB 2Z5FA 2WFMA 5AJWA 3SXPA 5CT6A 3T1YB 1FFGA 4B7UA 2OXRA 1RI5A 1BMTA 4FNAA 1N1MA 2G9ZA 1SB8A 3GBSA 4FT2A 3UJ7A 1JLSA 1C7QA 1JA9A 1LNZA 1P72A 2Z57A 1P18A 4N7MA 4WUVA 4ZDWA 4LC9A 4M4SA 4FR2A 4YBRA 5I7FA 1DKQA 1BXZA 2K87A 2AD5A 2W6OA 4B71A 2I2CA 4HZGA 2FPPB 4R2JA 5M2QA 2EFHB 2OPHA 2JJ1D 1ZD1A 1F4PA 4ZDKA 3VU8A 4KGVA 3EDCA 2X1HA 1S2NA 4QTUB 5HE8A 1Y34E 3CV3A 1OXVA 1QIDA 3EIWA 4XM1A 3WRYC 3ZU4A 4F5DA 2J31A 2H51A 1EWRA 1QS0A 2G63A 3WNCA 2BSAA 2CXHA 3EG5A 2ST1A 4P5EA 4DNPA 1GKUB 1Z17A 3MUNA 4QG3A 1OZAA 1H2RS 4JJGA 2F3RA 2XVZA 3UWMA 3SG0A 1CDZA 4MWZA 4Q1CA 4QU9A 2WWTA 1VMEA 3OLQA 1YMQA 3PNOA 1I7LA 5HFJA 3TQHA 3KVOA 4YUAA 5CEJA 1N34B 3DPUA 3KXPA 1CJVC 4G5RA 1V6AA 2GVZC 1GAQA 8ADHA 4ZIRA 3UAYA 4FW8A 2Z5LA 1PDVA 4KODA 1X94A 2X9GA 4WOPA 5GJWC 5DT9A 1OTXA 1ORRA 2VNIA 4LS3A 3PFCA 4MAFA 1IB0A 3BRQA 1J22A 2CVHA 1YK1A 1Y80A 2R8ZA 5EJ7A 3DE7X 4CCYB 1DWQA 1FRNA 3D9QX 3VDRA 1NR1A 1QTIA 1EG2A 3E1GA 2F6RA 4D56A 5HJ5A 2IH4A 3F96A 3KRTA 5KX5A 1V5FA 1W2GA 4UARA 3T3HA 2R87A 1UM9A 1OTYA 1D2MA 4J0KA 4XIGS 2UUCB 4PY2A 2BSXA 1JH8A 1C3LA 1T8SA 2WD7B 4QXAA 2J67A 1V1MB 1N8KA 5SV2A 3U61B 3KD3A 4LVNA 4XSGA 5KVQA 4BO1A 5KVSA 3AHDA 4AZWA 1GPNA 1A5AB 1DUVG 1JJVA 3R9KA 1EWQA 5TT0A 3HJRA 3I5UA 1TC2A 5HYVA 1IN6A 2FYTA 1ZD2P 2J0UB 2JW5A 1O89A 1V16B 2OGSA 1Z07A 3IOEA 4PAGA 1KY5A 5U4XA 4EH1A 1G21A 1YCGA 4YMGA 5HIKA 3PFGA 3DBOB 3OG9A 4NMWA 4OFBA 5FPQA 4ZEMA 5B6PA 2EATA 4EL0A 1K7CA 2QMEA 1OI3A 2IFTA 2H59A 3MCAA 4LRTB 4U6NA 2JAQA 1R6AA 1J90A 1JW9B 3PYLA 1JYFA 1R5OA 1GRRA 4HQRA 4O4JB 3DLBA 2B21A 2RHRA 3EGXB 1Q92A 2L19A 4YDRA 1KS2A 1T0PA 2GD1O 3N5KA 3MT8A 4L0MA 3QLTA 3SC2B 4OL9A 5EQJB 4TVBA 1IH8A 1MA0A 3IA2A 1RDFA 4G8DA 2X0JA 2GLTA 5H02A 3TLYA 2JANA 4RA9B 3PBKA 3WMRA 2ZAGA 4IDGA 4C76A 2UYHA 3DE3X 3GFQA 3Q3JB 4ZAGA 3F2VA 3OJWA 2J5BA 3N6RA 3O3CA 4AQDA 1S3SA 2P9BA 1HETA 3MTIA 3FR8A 3I62A 5G4KA 1H4VB 1GFIA 4UM9B 1IATA 1Z2OX 3DNMA 5K3FB 3EBPA 1UKVY 1VZ3A 1SZPA 3U62A 2C2BA 3DYVA 4XB2A 4CV3A 1YZKA 4BX2A 4ON9A 2F43B 4KO1S 1TJ3A 4CG0A 1E2IA 3R2JA 4RH1A 4TLDA 4I6GA 4YMLA 1YS4A 4RHXA 2VBCA 2X7XA 1QCDA 3BXHA 2WINI 1RLJA 3AR3A 5DW0A 3AFIA 5FAXA 5JQGF 2I71A 4I0WB 3ESYA 1W9HA 4YJ2A 3HPQA 1RE0A 5GGXA 3AF3A 5K8IA 3OX3A 2Z6QA 4JL8A 1XWWA 2IPAB 1P5JA 1XGKA 2ZUCA 3OKPA 2HBQA 4EMUA 1XMQB 3RVQA 4HFNA 2YHIA 2P5SA 2FR1A 2PQ0A 2AJ8A 4X1IA 4NU8X 1HT0A 1Z37A 1AUQA 4Q4AA 5I7WA 3LT2A 3KBOA 3FZYA 3JZIA 5KC9A 3EC7A 1JG3A 1SBYA 3FBGA 4CEIB 3G0HA 3B12A 5F1YA 2JJ2D 2XUHA 4DZZA 3EGOA 4ONEA 1FFEA 2L42A 3HVRA 2HNKA 1BJKA 4V0LA 1KRHA 4QWMA 4M99A 2QM7A 2R2GA 3HFJA 4FHZA 1BD4A 3FYCA 1N5LA 4G0PA 3IAEA 4YCDA 4CV1A 4BNNA 1XCMA 1E0DA 1ONSA 1SBQA 3VPXA 4H4EA 4WN3A 2OV1A 3VOSA 3PUJA 3DMTC 4RNCA 1KWKA 1OXTA 2YFHA 2HA7A 1SG9A 2QORA 3NTUA 3RARA 3O4JA 1Y3IA 3NOQA 1V5WA 3PQ4A 4ND5A 1ZGZA 4N3BA 4ALJA 2OBNA 2JKVA 4W9NC 4JZKA 3HKBA 2YJNA 4AKTA 2I29A 2J9YB 2Y05A 4X7RA 2FR8C 3AHIA 2WNHA 5FOVA 4WXEA 4MUYA 1W94A 1GVHA 3VO8A 3PFBA 1WIWA 2GPTA 3K53A 4TRMA 5AVUA 1JAXA 1APBA 4OYLA 2PZEA 1TECE 1VXRA 4NECA 4R2XA 3WI7A 4UULA 4Z9XA 2XUGA 4G89A 1ITZA 1SXJB 3A2LA 4AZ3B 4EBFA 3OU6A 3P9NA 5CM9C 5KNDH 2X77A 1ISSA 4ZZ0A 1XRPA 2Z6UA 2IYPA 4BXOB 1TW2A 2AL7A 3E3MA 5COQA 3NEYA 3PUKA 1Z0JA 4WXMA 3A70A 3OA2A 1W30A 3ZQUA 3C4QA 5LIRA 2D2VA 2FK7A 2ZAYA 1U7DA 3OE7A 3NBKA 4Y0VA 1M0SA 2B8TA 2H17A 1EPUA 3JQAD 3DFIA 3G0IA 2PFKA 4TTVA 3SYMA 5CXXA 3GHYA 3R3ZA 4ABYA 2JGDB 2HPAA 2BPOA 4HYTA 2XUFA 3L7IA 5AHRA 2C7RA 2WF5A 4DCNA 5AVRA 3HR7A 3MJDA 4FZ3A 3NTLA 3ZIDA 1BX1A 2HUNA 2RGDA 4C0WA 1W35A 3TQRA 4TS1A 2RGYA 2ZUDA 4GH5A 1U5AA 1W85B 3AVWA 4MV9A 5BY2A 2V9PA 2ZPAA 3AC0A 1NOKA 2QUJA 3MWJA 3R6GA 2BMAA 2C9OA 2ZQYA 1HNZB 3UMJA 1A1VA 1RIIA 3KSMA 2GTHA 1U98A 3R44A 3SCZA 5FLYA 2BFWA 3UH1A 3VM6A 3IP7A 5FEMA 1SC6A 4XVCA 1Y5IA 1P9LA 3DMNA 5TQJA 3SF0A 3LVRE 6AT1A 1PN3A 2BLLA 4OU4A 5AIAA 3C74A 3JASA 4IMIB 1XZCA 2QQGA 4Y98A 1CUFA 2FPSA 1XPOA 1IM8A 1GG5A 2ZSIA 4NI5A 4G1BA 1YWGO 4J6EA 4JKIA 1JXAA 2V8BA 3CF2A 3E9DA 3GLHB 1II0A 3CYFA 1ZHFA 3E2PA 1KZ6A 4P98A 3F6CA 4DA7A 3DG9A 1XD9A 1Y33E 1EINA 3G1WA 3R0ZA 4Q9NA 4GPEA 2W2NA 4YLGA 5EJ4A 4Z49A 1E2BA 1X7XA 1LPPA 3DCYA 4RPHA 1GU0A 2K5UA 2PUEA 1KXJA 2KYRA 5C7YA 4WKPA 1ZM3A 1S8FA 4YJ3F 2ESRA 2GD0A 4GMFA 4GI3A 2QXTA 3H86A 4NRDA 5GP1A 3CVJA 1U0BB 2GEKA 3K2BA 5JAOA 3E9NA 3AJEA 5AM4A 1HOXA 2ZBDA 4OY3A 2AEEA 5DJ5A 3ZI7A 1ODKA 2D1SA 2IZOA 3QOYA 1OLSB 3IUJA 3KJNA 3W5JA 4YVFA 1CZRA 1GZDA 2WYHA 3Q7TA 5C8VA 4B4DA 3CGGA 4BV9A 2VSNA 5IN4A 4GX5A 3V1NA 1G0NA 1TEHA 2GK4A 3GARA 4FKZA 3LRXA 4X63A 4N6NA 4BWFB 2P2SA 4M9XA 1Z73A 3C4JA 3LH5A 4G4SP 5EZ5A 1UWLA 3QUBA 4F3CA 1SK8A 2G70A 4OHMA 1K5HA 3REQA 5AW6A 3A1WA 4U5QA 1UC5B 1TVKB 4X7BA 3GEBA 3SQMA 1GL7A 4DCPA 3M6WA 3IUSA 4C0BA 2IOHA 5IG2A 1W1WA 4URYR 1P7CA 1KL7A 1CNEA 3L6EA 3UXMA 2NUAA 4WN9A 1SUPA 3P2MA 3TE6A 4ALIA 4GKAA 6ABPA 2HF7A 3D8NA 5HZHA 4D0GA 3RG2A 3Q7SA 1V8DA 1VQ1A 1EK0A 1NSYA 1EUYA 1NPTO 1TM5E 2X42A 4G5SA 3NP9A 4HGYA 3KQYA 4KGZA 4ZMRA 5BV0A 3AFGA 1F6WA 1NMQA 1UBKS 4UBNA 4ARAA 1YKGA 4J0JA 4CLEA 5BMVA 3IKMB 3PGVA 1E4OA 2R7LA 2P2YA 2NO4A 3GJ6A 3FTPA 5ESWA 4HH1A 1BXRB 1JLKA 1JL3A 1AVTA 1XC7A 1X8KA 2XCOA 3MUFA 3LWNA 3NEPX 4L57A 3EASA 2X4DA 3NBZC 2EJWA 1A7KA 3TXAA 2NAPA 2FSPA 5K0EA 1BNCA 1K7SN 4YXWA 3LKZA 1W5FA 4FYXA 3WAJA 1U9YA 3CEPB 4K46A 1I5OA 2ORYA 4FYIA 5C31A 4B3RB 2DGDA 1FQJA 2E5FA 4Y2RA 3ES9A 4NCNA 1KI9A 4LW8A 3ZU2A 6REQA 4BOYA 5JYEA 1JIJA 5F21A 1TA9A 2H85A 1AK1A 2B34A 4FSXA 4L4YA 2AQ8A 4C7BA 3EZ2A 2PA0A 4Q4HA 5T64A 2YN0A 5ALHA 4E1AA 4MROA 3JVUA 1C8BA 1ZQ9A 1TVCA 1MO6A 1Z6TA 1RBZA 4KPUB 4CQMD 3PFNA 3CKMA 1GQQA 1NW6A 1CYEA 4Q3LA 2CJXA 2PS9A 4L2IB 5F1KA 2Z1NA 4PQFA 3LC1O 4G84A 4C4YA 3ITDA 1GXSB 2N42A 4QU0A 1WOMA 1ZA2A 2A3RA 3PFFA 3VDQA 3UGQA 3NATA 2FW9A 1YVPA 3FKQA 4FGWA 3VPGA 4ES6A 1RD4A 3N2IA 2FUNB 3GNTA 1VE9A 2G0NA 1Z0UA 4H7PA 4LVCA 5DEOA 2DY1A 2BEUB 3QVMA 2O0JA 1QORA 4TMZA 2A84A 3CC8A 4U2EA 1G8HA 2EP7A 3O9ZA 5IVDA 4CMIB 4HNAA 3T0GA 3MJTA 4CM8A 2WMDA 4D43A 3M81A 4DEVA 2PUGA 3DWGA 4PYNA 3DOCA 2AI3A 1E58A 3HVHA 3OZVA 4N7JA 4QFMA 3RE1A 4EEXA 4RX1A 4HDKB 5JH7F 2FG5A 3DCIA 1XMSA 2IDKA 3SQLA 421PA 2CUZA 4ICIA 3IIKA 2CYBA 2WPNA 1OA1A 4X8HA 2JGMA 4AQYB 4R0NA 5D00A 4QOEA 1TVMA 3EARA 4HTFB 1EWYA 5KNCA 1G38A 1IULA 5B6IA 2CD7A 1EX7A 4DSNA 2QB5A 3OE7D 4RPJA 4PFKA 1IG0A 4TPKA 1I6MA 3T99A 3H5NA 3VMFA 4DIUA 4NULA 3ZDEA 5IJZA 5EJGA 2GAOA 4RU1A 3EIFA 3VPDA 1QTRA 1S01A 2ZBVA 4OLJA 3QOXA 2IYFA 3C1OA 4DANA 4OI4A 4A27A 3DOJA 2YR0A 1JI0A 2B5WA 1QC5B 1DOHA 3M1AA 2HSZA 3PNVA 4H15A 4I2NA 2WJGA 1I1QB 2P75A 2ZLBA 4KPEC 3C5HA 3RUHA 4CKXA 5I9IA 4MVJP 1U0HC 3UA4A 3KETA 1MTZA 4G1VA 4HNTA 2V3CC 4WH0A 4ZANA 4H7DA 1IZ0A 1UOQA 2WUVA 3C1UA 4A6XA 2BHSA 3QFSA 5DSZA 4YT5A 4EPRA 4G1FA 3VR2A 1RHKA 2SKCA 2HXGA 4O8CA 3LBYA 3I3OA 3SKVA 1L4HA 4LOIA 5CH5A 1CUUA 1E1QA 2C54A 2AZTA 1RXSA 2HPVA 3A1FA 3K72B 4JB2A 4JKOA 4CCAA 1NPDA 1EM8B 4OLHA 4WX2B 3T06B 4OX9Y 3DXYA 1CB0A 4IL5A 1V0JA 1HH4A 2FQQA 2I4IA 2NXJA 2ZTMA 1QB7A 3B6IA 3B60A 4FZVA 4QA9A 3ZWWA 6ADHA 1MDBA 2UYQA 1AH2A 2AFHB 1G8PA 2C0CA 2AFIB 1TMYA 3OPYA 4X6XA 3FVTA 3H9UA 2NP6A 1JR2A 2XSZD 3BH7A 3L0YA 1G19A 4C05A 4WA8A 3B5EA 1U0SY 2X9VA 1JB9A 2VOEA 3QEMB 3BFPA 1JQ3A 2KWIA 2PV7A 2OBLA 2J3LA 3GJXC 1RYMA 3PDUA 3V32A 5CLFA 3GEIA 4CKEA 4DQUA 4ER6A 4WECA 5E8RA 3EEQA 3MTBA 3CRVA 4LN1A 5B3AA 4US2R 2J8ZA 3N2ZB 5EKDA 3LHIA 1OROA 2ZIXA 2ZBUA 4KVZA 3T95A 2L69A 4WK0B 2IPMA 4HXFB 4OFWA 2P69A 3PQ5A 1D9ZA 1D0SA 1F2TB 2CB9A 3RBAA 3ZPXA 4DAEA 3TIFA 5IVHA 3VNUA 1LDYA 2EQ5A 3AETA 3NALA 4QVIA 2I91A 1Z0ZA 4LG1A 4QEZA 3FPFA 3GELA 2PH7A 2DP4E 1D6NA 1DAHA 4C6RA 5LYJF 5BP7A 2ZSKA 4O8ZA 4JJIA 1BG6A 2YOGA 2Z4RA 1W5EA 3DKKA 1HT2E 2C4MA 3GXBA 2R68A 3HZRA 4LSWA 2FP3A 3H04A 3DTNA 4LBYA 3ZXIA 3RVMA 2QL9A 5IP5A 1GTVA 5IN5A 3L7YA 3ZGZA 1G2OA 1ORHA 2A0WA 2QLLA 4Y2SA 4L8LA 3WB1A 2ENWA 2IH5A 3L0CA 4P3YA 4QNMA 3F47A 2XNCA 4HH0A 4WADA 3K0EA 4LXYA 1QHNA 2B0CA 3OT1B 3HEBA 4WFJA 4PTLA 2PRKA 4PGHA 4Y6PA 4B4OA 1OFUX 1LQTA 3LBIA 3QKWA 3BIXA 1Y3CE 3A0UA 1DCTA 4ZV7A 3T1OA 2D8AA 4LWPA 3H8JA 4DY4A 2CL5A 4EPVA 4PCVA 1HL7A 4V02A 2PUAA 1DV1A 1M8FA 1K7EB 5L4LA 1T36B 2Y3IA 3B82A 3NRBA 2PGXA 2P2CA 3E81A 3KTAB 3SP1A 4YXWD 1XRMA 2WU8A 3DVAB 4EGSA 4H16A 3A9WA 4LZZA 4ND8A 5B4UA 4DUGA 5FWAA 1THTA 1HYHA 2MINB 3L02A 1II8B 4JNCA 5JMOA 4F2HA 1L4NA 1U9JA 4CTKA 4QUDA 2FMKA 4H7IA 3TZCA 3AYXB 1I0IA 1KFCB 2ZS9A 4UAVA 1KJWA 1ZD8A 5CLJA 1JU4A 4NCAA 4PWYA 1JFSA 2Y4NA 4ZZ2A 4DWWA 3FGZA 1NNEA 3A04A 3ZHXA 3F8TA 4I55F 3ICWA 3ILYA 3AJ8A 4CN9A 4YAUA 5JVDA 3NGMA 3VOBA 2EIHA 4FYJA 1UPXA 3DQZA 5JI3E 2CCKA 2QMUA 3TAUA 5KEIA 1F17A 4UUMA 3IJ5A 5GIOE 2IZZA 2XR1A 4LDZA 5BV1A 3ZCRA 4H6VA 5ICGA 5ELMA 3D2CA 4PNPA 4HF7A 1A3CA 3A9SA 1EXWA 4L8WB 4XB6B 5JISA 1R74A 1W4CA 1E6KA 4KXQA 1WBJB 1ZGAA 1RCFA 1GA6A 4G0OA 1VE6A 5L40A 2JIPA 3PNSA 5HFAA 1AA6A 1OYVA 4ESOA 3ZEIA 3EAGA 4YUYA 2VTDA 3LF1A 4TTSA 1SM4A 2Q9CA 2CEAA 3IDSA 3OZIA 1BX0A 2DX7A 3OPVA 1IHDA 3B52X 1J99A 3CZ9A 1CKEA 2N75A 3U4CA 3DDWA 3K9FC 1VC2A 2VUHB 3GWZA 1RZUA 5C46F 4RTPA 2ZYGA 3F9RA 3EWAA 1TYAE 4JH0A 4UUAA 3NOOA 1Q16A 1RPJA 4GOND 1QIKA 2X14A 1ZJJA 1DIOB 4CMKA 3AUSA 4LY9A 3U6BA 3TL3A 4CFZA 3LX4A 4WNAB 4IDDA 1J2RA 2QE7A 3LUHA 4PLYA 4KV9A 4R4JA 4OHCA 1M54A 2X76A 2LNDA 1VZ2A 1E1RA 1XAHA 1ZEMA 5GJVC 3QE3A 2W2VA 1XRNA 1GRQA 1CY8A 1YJQA 1ES9A 1QRRA 3SZOA 4KDCA 1J2UA 1E2MA 4MO9A 1Y6ZA 1WLSA 5FA5A 5TVKA 1OSNA 4A2PA 2O1WA 4CMGA 4YMSA 2MYUA 2W4IA 2Q7XA 2WWFA 3D4BA 2WU1A 4ENSA 2PMKA 4BLTA 1RM3A 1CR6A 2G77B 4HFMA 2Z9BA 5EIXA 2OCDA 2C2GA 3AU8A 3IQWA 3B1WA 1VPDA 5EKUA 2QMOA 2RAPA 1UAGA 2HJSA 3L3BA 5AM2A 1E5QA 2C7GA 3HU3A 4LYAA 4HDOB 4V2IA 4JI1B 2JFZA 3R20A 3I4FA 3ESQA 3ZHRA 5TS2A 3MRSA 3JAKA 1E77A 4KO4S 2EFYA 3GFRA 3HA3A 3VR2D 2AXNA 2O19A 3ASZA 1XKLA 3R8CA 1E1QD 3PG5A 2FOLA 4IAOA 1LFAA 3BTVA 5U1PA 4BQEA 3EBLA 1ECJA 3H05A 1XHFA 1SUDA 3QNMA 2PZBA 4GP9A 5FR2A 4E5YA 4NESA 2ZBEA 1XELA 1JPJA 1IIRA 2ZU0C 4EKIA 3FA2A 3RJMA 4KN9S 5KDOA 2I7DA 5IT5A 2QMZA 3WVNA 3DD1A 1W49A 1Y5LA 3BE4A 3LWZA 1N5MA 1XQYA 2P3OA 1I3OA 2Z1DA 5IC5A 4UNRA 1N3LA 1XO1A 2IZ1A 1Z62A 2B25A 2WU4A 4JBLA