3HCDA

Crystal structure of hpnmt in complex with noradrenaline and adohcy
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
257
structure length
257
Chain Sequence
b'ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
molecule tags Transferase
source organism Homo sapiens
publication title Molecular recognition of physiological substrate noradrenaline by the adrenaline-synthesizing enzyme PNMT and factors influencing its methyltransferase activity.
pubmed doi rcsb
total genus 91
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3hcdA00
3GO4A 5DTMA 1YF3A 2I7CA 4LWPA 3BGDA 4AZSA 1O9HA 3FUVA 4ER6A 4QQKA 2AN4A 2BR4A 3HVHA 2NXJA 4GUAA 1G8AA 1RI5A 4X61A 3LCUA 4Y30A 5EVJA 4BLVA 2B2CA 3FPEA 3EPPA 2B3TA 1NBIA 2CMHA 1G38A 3CBGA 2H00A 5CCXA 3MHTA 1VQ1A 3LL7A 2P3QA 1X19A 3TKAA 1X1DA 4HGYA 2OYRA 3T7RA 2Z6AA 2QY6A 4PYOA 2I9KA 1XCLA 4JXJA 4M36A 3LX6A 3P9KA 4DCMA 2Z6QA 5DX8A 2VDVE 2PX2A 5DRYA 5FA5A 2P40A 2PLWA 3THRA 3PVCA 5LQJA 2H11A 2V7EA 4OBXA 3UBTA 2ZZNA 2BM8A 2ZZKA 3KQYA 3NVMB 5K09A 5GINE 3BT7A 2CKDA 3KQWA 5ERGB 4AZTA 3GIWA 3G88A 3FPGA 3EGIA 1YFJA 3DTNA 3TRKA 2P35A 2E5WA 5EHIA 1KIAA 2AOXA 4V0RA 1YUBA 3IEIA 3OFJA 4GF5A 5EEGA 3TOSA 4PYIA 4HSGA 4YV0A 1D2GA 5EMLA 5JUWA 4DCGA 2OXTA 3FPHA 5EHGA 1KPHA 5KYGA 1NT2A 3I53A 3M4XA 1P1CA 2Z6UA 2ZVJA 4YUXA 3NTVA 3DP7A 3M6UA 3G2QA 3LBYA 2AOTB 3P8ZA 2B78A 3AY0A 1WZNA 3BUSA 3ELDA 3GCZA 4IWNA 4F86A 5EIWA 5FHQA 1I1NA 3PB3A 2BZGA 3CVOA 3GRZA 2HTEA 2JHCA 2ZBQA 3BWCA 5E9WA 2P8JA 3D2LA 3UJ9A 3OU7A 4GOMD 4F85A 1F3LA 3AJDA 5DM1A 1DUSA 1L9KA 3V8VA 1JTEA 2XYQA 4QTUB 5E8JA 3MCTA 2QRVB 3FRHA 2G71A 1XJ5A 2AN3A 2G1PA 3UJ8A 3HVKA 2YQZA 2Y1XA 4QDJA 3EGEA 3JWGA 3PFHA 2R3SA 4ER0A 4PWYA 3H2BA 4U7PB 3UFBA 1KPGA 3A26A 5LSAA 3NVKI 1VLMA 2ONYA 3NWBA 5LR6A 5E2AA 3KR1A 1FP1D 3G5LA 3JWJA 3HM2A 3B89A 4X63A 3CJTA 3TM4A 4CKEA 4RVGA 4OX9Y 3GDHA 5HZMA 3I58A 3X0DA 4C4AA 3FUTA 1YB2A 1DCTA 2ESRA 3GNLA 5FULA 1I4WA 3DOUA 3R0QA 1N2XA 2GAFA 4QTTB 2GB4A 7MHTA 3EVCA 3BGVA 4GQBA 1AV6A 3FYCA 1QZZA 1X1BA 4PGGA 4V0QA 3TMAA 1SUSA 5CVEA 2IH5A 3UJAA 3KQPA 3ER9A 3NDJA 2FPOA 2K4MA 5D1NA 5EMMA 1UWVA 1U2ZA 4ZTBA 4AUKA 4RTOA 3DUWA 4X60A 2CMGA 3DMHA 1EJ0A 4HTFB 10MHA 4FT4A 5EIFA 2PT9A 3OE4A 1JG4A 2EFJA 3BKXA 3A7DA 1SKMA 1NKVA 4E30A 4LG1A 1SQGA 1G6Q1 3OE5A 2GLUA 4HGZA 2VZ9A 1H1DA 4RYLA 3P2EA 4DZRA 2JH8A 5LQUA 2AOWA 4QDKA 1M6EX 4CWAA 2H1RA 5EOVA 5FHRA 3NMUF 3PX3A 3EVDA 4R6XA 5T64A 2VDWA 4DMGA 1Q0SA 3G7UA 2C7OA 5CUQA 4POOA 4PIPA 5DXAA 4DF3A 1KXZA 3MTEA 2C7PA 3SX0A 5DXJA 1AQIA 3SSMA 3TKYA 2PT6A 3VC1A 1O54A 3UWPA 5K01A 2ZCJA 5K0NA 3PX2A 3UJDA 4E70A 5H02A 2NXNA 1KYZA 2QE6A 3SSOA 1P39A 1JTFA 5EMKA 2AVDA 3MB5A 4QPNA 3E7PA 2Y1WA 3RODA 3U81A 1HMYA 5DWQA 3F4KA 3SM3A 2PWYA 2AZTA 3FTEA 2IH2A 1ORHA 4QQNA 2O0LA 3L8DA 4AX8A 3OPNA 4L7VA 3ME5A 5BP7A 1N7IA 4FSDA 4H0NA 3FUWA 3G8BA 5E1DA 2CL5A 2UZ4A 2EX4A 1XXLA 3ELWA 1RI1A 3EMBA 5K0LA 5BW4A 3M70A 2XVAA 3MGGA 4M7RA 3DMFA 5CIYA 3NDIA 4CTJA 3AWIA 3RW9A 1KR5A 3DXXA 5KQRA 4AZWA 1SUIA 4HH4A 4E33A 3KR0A 4ER7A 3FUUA 3HTXA 1KYWA 3C3PA 2ZZMA 1IXKA 1M0EA 3G89A 2O07A 3SMQA 4EK9A 1UIRA 4LECA 2FHPA 1EG2A 4P7JA 4YUYA 5ICEA 5C1IA 4PYMA 2OY0A 2F8LA 2A14A 2FK8A 1EQAA 3IHTA 3SXJA 2O06A 1NW6A 2NNWB 4MTLA 4BLWA 3DH0A 2OB1A 4PYQA 2OBFA 2JH9A 3KQVA 5BW5A 3I9FA 1QAMA 5GOZA 2DULA 3LDGA 3GJYA 5LQRA 5EZSA 3B5IA 3KR9A 3S68A 2V74B 2FYTA 1JQ3A 1TW3A 5FQNA 1R8XA 4YV1A 2FCAA 5HOQA 4HC4A 1FBNA 2JHAA 4C04A 3JWHA 2Q41A 2XYRA 2ZSUA 2HWKA 3GRYA 4KWCA 5IKMA 1RJGA 2AOVA 4RVFA 4E2WA 4LWOA 4EQZA 2ZWVA 3ID6C 3BWMA 3DULA 3P2KA 3FRIA 4OBWA 4UOEA 5KQSA 3P9NA 3KPYA 2GPYA 2OZVA 3BWYA 1WXXA 1YZHA 3KPUA 1P91A 2CWWA 2ZBRA 4QPPA 1FPQA 4Y2HA 4YUWA 4RTQA 4FS8A 4GC9A 1NBHA 3MERA 5EZQA 2HMYB 3OU2A 5KVAA 2AN5A 4P58A 3B3FA 3C6KA 3LKZA 2P3LA 2R6ZA 1R6AA 4C07A 3EVBA 4YMHA 2BR3A 3LHDA 1WY7A 3REOA 1TW2A 2DPMA 9MHTA 3ORHA 4IV0A 5GM2A 2NYUA 3T0IA 3TLJA 3MCZA 1JSXA 3P2IA 3OZRA 3PFGA 3KQSA 3G2MA 4XCXA 3HCFA 3V97A 3WSTA 5FWAA 5K0EA 1X1AA 2IH4A 3LSTA 5CVDA 5HFJA 5LQKA 2XVMA 3HEMA 4B17A 3GWZA 4OQDA 4AZVA 1SG9A 5C9ZA 5T67A 1WXWA 4MHTA 2VP3A 2YUIA 1RJEA 3FUXA 2O57A 3M6VA 3B3GA 2ORED 3HA5A 3KPWA 1RI2A 4YV2A 2B9EA 3KKZA 4RVDA 3GU3A 5K0CA 5K0GA 1R8YA 4PYNA 1RJFA 1SVUA 2P7IA 1JQEA 3IYLW 2AOUB 3HP7A 3KPJA 2GS9A 4RX1A 3NJRA 3TPZA 4KDCA 3FYDA 5EKXA 4EKIA 2YXDA 2YXLA 5BXYA 5FCDA 3LDFA 4HRAA 1NW3A 3VYWA 5DM2A 5MHTA 1P1BA 3FPFA 4EVIA 1NW8A 2ZIEA 2PWPA 1PRYA 5DTRA 3THSA 4MIKA 1L3CA 1ORIA 1XTPA 2OKCA 5EKUA 3UA3A 2ERCA 3EVZA 4C03A 2ZLBA 2NP6A 3LCVB 1EAMA 2YVLA 4BP1A 4WVLA 3CC8A 3G2PA 5LQAA 1QANA 2KW5A 5P8WA 2JJQA 3ELUA 4GC5A 3C6MA 3EVGA 3FZGA 4OA8A 3UA4A 4DM3A 1R18A 4GEKA 2UYOA 5CVJA 5EMJA 4R8RA 3EGVA 3P9CA 4FT2A 1VP9A 2IFTA 3QOXA 2PV0A 3HCDA 4P7FA 4KIFA 4XUCA 2LD4A 3LPMA 5FQOA 3A4TA 4U7TB 1INLA 1OR8A 3A27A 3HCBA 3QOWA 5DX1A 5DT2A 1WG8A 3I5UA 3DXYA 1BC5A 2OB2A 1WS6A 2AR0A 1NE2A 2PKWA 4EMSA 3CJRA 4C08A 5K0FA 3C0KA 2XBMA 1Q0TA 2G72A 4RTPA 1VIDA 2YX1A 3P71T 3T7TA 1MJFA 4CXMA 3FTFA 5F2OA 3EEYA 1ZGAA 4BP3A 3TM5A 1JG1A 3CKKA 2IDJA 2G8NA 3NW9A 3QV2A 3GRVA 3EVFA 2PXAA 2ZIGA 2PBFA 4F84A 1BKYA 5DRTA 4RTLA 3B3JA 5K03A 3FPJA 5ICFA 2BH2A 3GGDA 4G56A 4RTKA 1FJXA 4PGHA 2P3OA 3BWBA 3K6RA 3DR5A 5B1SA 1TPYA 3SGLA 3CGGA 4E2ZA 1VP3A 1G60A 2YXEA 3LGAA 4RTJA 2G70A 2VS1A 1ZKDA 2ZULA 3ELYA 1AQJA 1XVAA 1N7JA 1PJZA 1KP9A 1MHTA 4CKCA 1Z3CA 2P41A 3ER8A 4KIGA 3CCFA 1ZG3A 3C3YA 4FGZA 2HNKA 2P1DA 3E8SA 2EG5A 5E8RA 3GRRA 3RIEA 2FK7A 1QYRA 3OZSA 3O4FA 2NXEA 4RTRA 4BLUA 2WK1A 1V39A 2PXCA 2AS0A 3G2OA 3M6WA 4PCAA 4MWZA 5E9JA 5EPEA 4NECA 4RTSA 1JSZA 4IKPA 3T7SA 2NP7A 4HTFA 1G8SA 2IIPA 3OCJA 3G5TA 4QVKA 3PT9A 5CCBA 5F2NA 3VC2A 2JG3A 2IDKA 3MAGA 5M5BA 1NV9A 3PS9A 1NW5A 3R6TA 4FSXA 4FR0A 5HIIA 5DSXA 1DL5A 2UYCA 5FWDA 3O7WA 3DLCA 3M6XA 5CVVA 2BM9A 2XYVA 5EG5A 1VL5A 3M33A 3MQ2A 1QAOA 2ZFUA 4KRGA 2I62A 1BOOA 5GP1A 3EVEA 3HCAA 3TR6A 5CVUA 3HNRA 5E2BA 1R74A 4PYKA 5GIOE 2QM3A 1B42A 3GRUA 4P7KA 5E1OA 4RTNA 2AVNA 1AF7A 3GXOA 2OPBA 4PYLA 2N47A 2B25A 4OA5A 5HILA 1XDZA 2NXCA 4R8SA 3TFWA 3UJ7A 3UJBA 5DTQA 2EJUA 3OU6A 4DKJA 5E1MA 4PONA 1D2HA 2ZWAA 4ATNA 4E32A 4EKGA 5FTWA 3R3HA 5E1BA 4P7GA 3KQQA 1IM8A 2ONZA 2WA1A 5HIKA 3R24A 3FTCA 5F2KA 1ZGJA 3HVJA 4KVZA 5E9QA 4PINA 2PX8A 3I64A 3LCCA 4IV8A 5K05A 1XDUA 2FRXA 3KQOA 5DM0A 5K0BA 2C7QA 2IBSA 3OFKA 4BY9E 1EJ6A 3VSEA 1R00A 3DLIA 2PX5A 5ICCA 5FADA 2PXXA 3P97A 1L3BA 3BZBA 4Z2YA 3IV6A 4RTMA 5CM2Z 5T6BA 3HA7A 2IBTA 2PJDA 1F38A 5G02A 1ZQ9A 1X1CA 3LBFA 1XCJA 4GOOD 1BHJA 1ZHFA 3SSNA 4X1OA 5EC8A 5FUBA 2QYOA 4A6DA 4E2YA 2ZTHA 4RSRA 1T43A 3LKDA 1I9GA 1L3IA 5DSTA 5HIMA 3O31A 5JR3A 3G8AA 3OZTA 4OQEA 2HR1A 4CTKA 4E2XA 2UYHA 4KW7A 2ZW9A 1UFKA 3SR4A 1JQDA 4CKBA 2BR5A 5GWXA 4DQ0A 1KHHA 2PY6A 3ANXA 3AXTA 4QVGA 3SVZA 3EVAA 3UJCA 4ER3A 3UJ6A 2WA2A 3KU1A 1Y8CA 2QRVA 3PTAA 4RVHA 5HIJA 5GIPE 1O9GA 3KR2A 2GA9A 2VDUE 1D2CA 4KDRA 5K0JA 3PLAE 4K6MA 3HCCA 1NW7A 1RI3A 2IPXA 4DA4A 1VPTA 4M38A 4HG2A 4A6EA 3CJQA 1JG3A 1JG2A 2UYQA 5DX0A 2P7HA 4YMGA 3E23A 2O05A 5K8VA 2PX4A 1KPIA 2ADMA 2AOTA 2PSSA 3A7EA 5DM4A 5U4XA 4C06A 3BGIA 2IP2A 1YFLA 3DXZA 5DPMA 5C0OE 1YZ3A 1M6YA 5LQCA 2EJTA 2YTZA 3NWEA 3Q87B 2ZBPA 3JWIA 5IH3A 3B7PA 5D1HA 4C05A 3UZUA 4PYJA 3ERCA 3KQMA 3LECA 4O29A 5EEHA 5FA8A 5EGSA 4RWZA 2HV9A 3KQTA 2PVCA 4MQ4A 2I6GA 5HEKA 1VBFA 5DLYA 8MHTA 4GOND 3FTDA 3AXSA 4GBED 1QAQA 3DMGA 4M37A 4R6WA 3EEOA 3HA3A 3BKWA 4FP9A 4YUVA 2C7RA 3E05A 1XDSA 3A25A 2GH1A 4PCLA 5KS2A 4XUEA 3R9XB 5ICGA 3EMDA 1IY9A 5EQJB 5CD1A 2IGTA 1RJDA 4WXHA 4GOLD 2ZIFA 4FZVA 1VE3A 1SQFA 3BXOA 1JR4A 3KHKA 2PGXA 3TQSA 4ER5A 4XUDA 1HNNA 4R05A 1FP2A 3HVIA 3MTIA 4PIMA 3HCEA 3KPVA 3LDUA 1NV8A 3P9IA 4X41A 2OO3A 4ISCA 1L1EA 1G55A 4RV9A 2YR0A 3Q7EA 4E31A 3K0BA 2JHPA 1RI4A 1EIZA 4YUZA 5GM1A 5LQNA 2AOUA 4PNEA
chains in the Genus database with same CATH superfamily
1L4YA 1YIOA 3MUEA 2QF7A 5D8DA 5CB4A 3EF0A 5A0VA 2FLKA 1JQAA 1RVV1 4IHJF 3QE0A 1CCWA 1G5PA 2FZCA 2IHTA 1BQ4A 4ER6A 1IIRA 2AN4A 3BB1A 1BXGA 1MIOB 4PAMA 3FPEA 3GJ8A 3TUIC 3JPWA 3VI4B 2WFLB 3H0CA 3ZDYB 4HX2A 4DJ5X 1UJCA 3MHTA 4LI0A 1G19A 2REQB 2CXQA 2VBGA 1RP7A 3OE7D 4J1TA 4O2BB 5EP1A 5C7YA 4EBBA 2J30A 4FC7A 3HYNA 1AGXA 3HB1A 9LDTA 5GJVC 1PNRA 1M76A 1H9CA 4UXJA 3NNSA 5FA5A 2C3OA 5LQJA 4MPTA 3T4PA 2VRBA 4LZLA 1EXDA 3H7AA 1MOZA 2W8BA 3O8QA 4GLJA 2N3ZA 3H6KA 4TVOA 5J2TF 4HL6A 2HJ9A 3Q6NA 4RPIA 3L5OA 3EGIA 1YFJA 3GFVA 2AFIA 2V3WA 4G5RA 1HX7A 2AOXA 2XEXA 1XR3A 2BEJA 3IEIA 4ZXPA 2FMHA 4KNVA 5BN4A 3T3DA 2ZWMA 2P5TB 4PY2A 3BC1A 5CFOA 5EHGA 3VDQA 5GPBA 4EEKA 2I6XA 4RJLA 4A91A 2B78A 1HDZA 3ONFA 1EX9A 3VYSB 4IDOA 1P2VA 4OMUA 4C6SA 1QH8B 2HTEA 3ZC3A 4F85A 2YYAA 2OWDA 3PGLA 5ALEA 5JFTA 4Z3OA 2AFIB 5LVAA 2P67A 2GN9A 2DFKB 4HQLA 2XYQA 4EG4A 3LPDA 4KP7A 4HNGA 5SYMA 3FX2A 3FCSB 3QKRA 3ZI7A 1P6QA 4EQ6A 2ZM5A 1XELA 2PUDA 3ILHA 1OBCA 5TE9A 1N6NA 3PFHA 3CH5A 3VYVA 3VR4D 1LB1B 4PWYA 3RKRA 2C2KA 4RHEA 1G9XA 3NBAA 4IS3A 4TKUA 5M29A 1XTVA 5LA6F 3SBXA 2WINI 3R0XA 4ILKA 4JJ4A 3TBHA 1C0PA 3BB3A 2C4MA 2RARA 4FCVA 1A9RA 1WL8A 1T3HA 1KVRA 3G1TA 2JFYA 1E6UA 4N39A 3O9MA 3QSYA 1QS0B 1E2JA 3FDXA 1N0HA 3IUQA 4X95A 3L4BA 5JJ5A 4RACA 5AK4A 3RVNA 1QYVA 4JC0A 1QZZA 3ITKA 4FX5A 2QLJA 3WLAA 5I7FA 3IE2A 4V0QA 1YOBA 4DT1A 4LFAB 4MV4A 4WY5A 1PG2A 2HCTA 1XDDA 1VI6A 1G0NA 2HF8A 2P91A 3M81A 5B4TA 1J22A 1J7KA 4QUJA 2O8EB 4MPRA 5G0VA 2R68A 5IASA 2QV0A 1FFCA 3OQHA 4PHTA 3DUWA 4RTOA 3ZKWA 1EJ0A 4AECA 2EOAA 4MOWA 2VWGA 1DC8A 1UBGA 1WPQA 3H5OA 4OHRA 4URYR 5FP0A 5I9MA 3F7NA 4OHFA 3KJQA 3S2SA 1Z5NA 2LIPA 4HGNA 2R8BA 1KOFA 1E77A 2FQYA 2KQUA 1O03A 1ZIYA 4PBRA 3C43A 2FEKA 1VOTA 4E5KA 3TLEA 1LJUA 2YVQA 5AKLA 2XGOA 1HKUA 4BVHA 4G0UA 2OG2A 2J48A 4QGBA 1XD9A 4RIIA 4ZJYA 2C4HA 4PXYA 2X42A 5IAJA 5F52A 1PFWA 1J49A 3IE0A 5H0IA 1I3CA 2YWCA 1H3NA 3BREA 3DFUA 5EI5A 4U00A 4Z8YA 3KL4A 1TYAE 1YQ9A 4K3VA 1ND5A 3E61A 3GFGA 2Z58A 4MVJD 1PKEA 4IHJA 4XR4A 1ONPA 4H6WA 4MUEA 3E7PA 1PR2A 3ZG6A 3EC7A 5BMVA 5I8WA 5CYOA 2B8EA 4W9NC 4DAOA 3NM4A 1KDVA 2VJDA 4KMMA 1NBMD 3AMVA 4KQMA 1ORHA 3W5UA 1Z4NA 2WP0A 3G8YA 4ZA2A 3PUYA 1MX3A 2W83A 3CN7A 4OXQA 2IUUA 2V7BA 4EF5A 1N5JA 5BW4A 4N5DA 4LVCA 1EGAA 1NF2A 3OZIA 1ISGA 3EDQA 4MV0A 3BAFA 3IIIA 4YJDA 1ZUNB 2WQ6A 3J7AC 1KR5A 1QF7A 4CM8B 4NZZA 2HA5A 2UVQA 3IPLA 1FVHA 3CH7A 2V0CA 2I7TA 3FUUA 1P19A 1CYDA 1WCIB 1YBHA 2K2QB 3HI6A 1WPGA 3CNQS 4MEAA 4R98A 3I01A 4DDHA 4YT8A 1IXKA 4EY7A 2ZZMA 4Q4JB 1JGTA 2XADA 5B58T 1W581 1PJBA 5A7HA 5KBYA 3CO0S 5LP6C 2KX7A 3TZKA 1W36D 4PYMA 4CKXA 4D02A 3R3JA 3A1SA 3IHTA 3AB8A 2BZ1A 1G17A 2C2YA 1PT9A 4IIDA 1W4AA 2D54A 2YUTA 2CV1A 2KWIA 2PAFA 4AJ9A 2WHPA 1SVMA 3FB4A 4DR6B 5J59A 4B71A 1P81A 5FPSA 1TTQB 2I2FA 3QP9A 4O2LA 5EZSA 3RJ5A 3VU8A 5CA1F 1W48A 5HFNA 1PAUA 2YXNA 5JMOA 1UCFA 3ZWWA 1RM5A 3U4HA 3K53A 5F1YA 1DMSA 1NQTA 4C88A 5ALIA 4EJSA 3IHWA 1NN3A 5TQ2A 3RTGA 4AKTA 2GHTA 3OLVA 4MW5A 2HHAA 2JAWA 2JHAA 3S27A 3L8ZA 4BRZA 4ZANA 1NOJA 2XYRA 1NY6A 1XZQA 3C7CB 2CF6A 3QPCA 4FKZA 4NYIQ 5EIHA 2VUTA 3ZS9A 2H65A 5C53B 1U5CA 3IIEA 4RVFA 1TAUA 4IYRA 1J00A 5DN6A 5LBUA 4A8JA 1Y6FA 1EVIA 4QARA 2JVKA 2ZYHA 4GPTA 3FD8A 5FYQA 4JVLA 3QVWA 3BWYA 2WT9A 1D9ZA 2VUUA 2XEDA 1GOTA 3ESRA 3P9YA 4QJBA 4AQDA 1PTJA 3VSBA 3VKWA 2VAXA 4RTQA 3FTPA 3T52A 3JCZA 5B3KA 4UPDA 2WWXA 2J5BA 1VC2A 3GJ0A 4G2NA 4RAOA 3TEMA 3TOCA 4CUKA 3NH9A 3GUHA 3UAOA 3W9UA 4LY3A 2Q6TA 3P0EA 2A4MA 5HS6A 3ZCXA 3HDYA 2WJHA 1RYMA 3TCNA 2DJIA 2ONCA 2QTFA 1MTZA 3AEKA 1XAJA 3GT4A 5M34A 1W4RA 3QPBA 1FSFA 3FCCA 3T0IA 2IPOA 2VP0A 3P2IA 4TV8F 1OBHA 3G2MA 3V97A 5LMNB 3WRXA 1KL7A 4QFBA 2J09A 2GXAA 3M1LA 5L3VA 1N1EA 2FMXA 1KI9A 3B6EA 4AZVA 5G53C 2AKAB 4U2DA 3RABA 1BMFD 1S8AA 4AMGA 3KYBA 1YS2X 2GFHA 1JKFA 1FYFA 4LN1A 4Z4HA 3EA4A 5EUBA 1JQEA 2XWJI 3KPJA 4QUIA 1F2DA 3UW3A 4KDCA 1L1RA 2ZSDA 4NEGA 3CA8A 3VFDA 1F9EA 3LIIA 2UVPB 3BF7A 3CR8A 4OOFA 3KO8A 3WLKX 4KSYA 1BH6A 2BISA 5E4JA 3SX4A 5LYJF 3KYCB 2A0FA 3D4OA 4BFSA 3VJMA 2PKYX 1EFVA 2PWPA 3HUUA 2ZR7A 2ZYAA 3NGMA 3L6DA 4TRJA 3B1VA 3GRKA 4GPEA 1AQ6A 4PYRA 2ZLBA 1DC6A 1AK9A 3PC7A 1YCDA 3BD6A 2ZWOA 4UXIA 5HE8A 4DQUA 1EHCA 2GK7A 3NV7A 1CW2B 2Q4BA 3L79A 1V1MB 1XMJA 4RULA 2X5KO 1WQ3A 2YHUA 3D1VA 2E4AA 2UYOA 4GEKA 4B3BA 4R3NA 3V4PB 5A02A 4JL6A 4CETA 4L5AA 1GZUA 1J07A 3HBFA 5C2JB 3QKIA 4YRKA 2PV0A 1FUKA 2G82A 4C20A 2AZDA 4R41A 1XL1A 1JVSA 4TWBA 3R1IA 4GMFA 3QOWA 4IGIA 2XIQA 1PL7A 4EMSA 2P5UA 1WS6A 4IMPA 4UVHA 3WYBA 1NC3A 3DEKA 3ZHBA 3DMTA 5AVSA 5IN4A 5CNJA 5KYWB 2BFPA 1BJTA 4HTAA 4BFCA 3HA2A 2FAXA 1DKOA 1FP4A 5TS2A 1P74A 1SKQA 5LDDC 1V3UA 5DLPA 3GRVA 4DM7A 1WO8A 1ZAKA 3JAWB 5EJAA 3MCUA 2J3KA 2B2XA 1ZNQO 3RIYA 1GTVA 4G67A 4U6NA 1OXSC 4G5HA 1C7IA 1E2EA 1G6KA 1XZIA 2PZJA 2MSWA 2BSXA 3CZQA 1HG0A 1Y9JA 3FPJA 3HJUA 2Q46A 4LMRA 4XWYA 3LHFA 1QIGA 1W0CA 2F67A 1YJ5A 1DT5A 1E2KA 3E22A 4LPSA 4M1ZA 3E3NA 2BDTA 3ROTA 1UPBA 2YXEA 3HU1A 3I12A 4KI0A 3RYFB 1SWVA 2ASVA 1AQJA 1ZRSA 1J0XO 3S2YA 4D9HA 4KAJA 5B1DA 2YQ5A 3ER8A 4MW9A 3CLSC 5KJFA 2FG5A 4WD3A 5HR5A 4LGMA 1BCRA 1NNUA 3SJAA 4GI7A 1U4OA 4PCVA 4JLBA 4MS1B 4F3TA 2HN9A 3Q7TA 1H69A 2QUIA 1EFAA 2D1SA 4JQZA 1ZEJA 2CBZA 3M6WA 3ZWPA 1E3JA 4BRUA 1ZIXA 2CLKB 4HK4A 1KORA 2C20A 4G5FA 1BKSB 3EA5A 1PFQA 5EXDA 3O2SB 2GFQA 1VE7A 2O2SA 1I3MA 2WUEA 3LFHA 5AM0A 3FPCA 3AEQA 2V4ZA 2CHGA 3B3AA 3HR8A 1GRNA 2D1TA 4TKVB 5EERA 3WADA 3C24A 3VC2A 1G2OA 4PVDA 4EPVA 3CLUC 3K4HA 5SICE 1W25A 2ZBUA 3KOWA 4Q7MB 1ISPA 1UPAA 1AB6A 5CJ2A 1UBMS 5IARA 2Q2QA 2PZEA 1GTZA 2WFMA 3SJUA 3DQQA 2CMKA 4IUDS 4JI6B 3C6YA 3IV9A 2LGJA 1RAIA 4IXMA 5BN1A 5IYZA 1C7RA 1P80A 2QG9A 3DBRA 2ZFUA 1CZOA 3KZVA 4KQ9A 1G6OA 2C8VA 3FZYA 3OQIB 5TQJA 3G85A 5FLEX 2CV2A 3BEOA 2BGUA 2B1QA 3F71A 4LBZA 1AUPA 5LCXA 4YYZA 3KQUA 1GNTA 1KZ1A 4PPFA 4CQJA 3RVMA 4E2YA 2QLBA 2ZBVA 2FEMA 4KV7A 4X91A 3H5VA 4REQB 4YCLA 5C37A 4YXWD 1F5SA 4AKEA 2GVNA 3GJSA 5B1EA 2Q7DA 5FTWA 5KNCH 3WOVA 4Y6LA 4P7GA 2OG1A 1T0UA 2COKA 5TJ9A 2V0NA 1WM1A 2DLDA 4PS0A 3OIFA 4Y2XA 5DCUA 4CL8A 1LBEA 4L07A 4MKHA 3ICVA 4F5EA 4TKUB 4YAGA 3C8ZA 4RMJA 4OHCA 3V5NA 1BRTA 4RPCA 2FRXA 4ZAGA 1OFUA 3G3EA 4O2AA 5DF1A 5E6UB 4A73A 1PUXA 2W6OA 4LOKA 3DLIA 3QENA 1JEYA 3M3HA 3BMNB 3CGWA 1WMDA 2PTGA 1S2GA 4TXLA 3B1FA 3D6FA 1L3BA 2AW5A 1LVHA 1T6ZA 1AKVA 1N3IA 4S1OA 5JAUA 1MV5A 1G5RA 1W35A 2IBTA 3MUFA 5DNUA 1J21A 2BI4A 2W48A 1UC8A 4CIDA 1R6TA 3GC6A 1TDJA 1X1CA 2G67A 4L3WA 3THWA 4NIMA 3ZCSA 2ZTLA 1KNQA 3LYLA 4ENSA 4NULA 2BFCB 2IYFA 2J3DA 3K1AA 3DBHA 1JFFB 3L7IA 4A6DA 4UTZA 3GLUA 4RZHA 2V55B 1NG1A 2RHRA 1J2RA 3NIFB 4OQEA 3IQEA 3LHSA 1VL2A 4HFNA 4OQNA 1UMCB 2CWDA 3I04M 1QORA 1CVRA 2JGDA 3DVQX 4I1VA 4F6LA 1L5VA 2PYDA 3EFOB 4HDSA 4MRVA 1YQXA 4WKBA 4BMZA 1FDSA 3E5RA 3HXKA 4GXQA 2PEZA 1TUBB 4QULA 4XCQA 3LDAA 3X2SA 3EZLA 1BXZA 4AWAA 5GIPE 4DJAA 2W8BB 1D2CA 3A6HA 4PR0A 4C7VA 3AUJB 3IP5A 4EUFA 5A4JA 1P2GA 4DB2A 4E5DA 1E2HA 2VJOA 1M7HA 3GP8A 4P98A 3H2KA 1CUJA 3KV3O 1F1JA 3Q7IA 2ZSKA 1U0TA 3R6GA 5GY7A 1WB6A 1RJ9A 1JZTA 5B2EA 3A4VA 2RGYA 3UAVA 1PQ4A 3E2PA 5SYAA 2IZ7A 5FFMA 1PT5A 2W6PA 2OD7A 3AEYA 1WB9A 1QLWA 4Q3AA 4A3SA 2PL5A 1Y1KE 1VBNA 3H1TA 4JVNA 3TW0A 5G41A 4ARAA 2WBLC 1E9BA 3DOCA 1R4ZA 2FSHA 1JR6A 2DHDA 1BDBA 2BGMA 4CZ2A 5E4FA 1Z6PA 5IYZF 1GPAA 4CNBA 1G7CA 5B57C 1N6KA 4LQ4A 3FNHA 4K9DA 4PCLA 1GUZA 4TTJA 2DPYA 3HJCA 3N0XA 2B4KA 3ORSA 5HJ2A 2F3UA 1MT0A 2HIGA 4CN9A 2TRSB 1RQLA 1LEHA 2ZETA 2XDQB 4F93B 4J90A 1GYQA 3QWBA 4OI2A 1STOA 1Q0LA 3RFCA 5BMOA 3OQPA 4PIMA 2UUAB 3UB3A 3KKLA 3MCAA 1LQ2A 1K5HA 5J2UB 3Q0TA 4CF3A 3P9IA 4OY3A 4JJ6A 3UUWA 2YFYA 3KYJB 3PEEA 1VJTA 4LE0A 2VJQA 2WWTA 2O20A 2QXYA 3RQSA 4M9UA 4TTRA 3URMA 2GNAA 3AUKA 5DK6A 4Z1OA 1QZTA 2I7CA 3HSYA 2QL7A 3ENVA 4PXSA 3VGPA 4K9QA 4DJFC 4EFKA 3FUVA 1UXJA 2BFAA 2D8MA 1UMDB 3LP8A 1N5DA 4H7PA 4JLNA 4N5LA 2F43B 4C4PA 1DP4A 1SUCA 1X0XA 2C58A 1U63A 3LBAA 2GHQA 3K1TA 1S2DA 1O4WA 1QPGA 4TKLA 2QSYA 1SHZA 3H2SA 1T9AA 4L9RA 4A26A 2QU8A 4G0OA 1YZKA 1A0OA 4DCMA 2W11A 3GMTA 4M1WA 5KNBD 5F12A 3RHZA 1EA5A 1YACA 3UT6A 1FY2A 1TIKA 4LXXA 5K09A 2IYAA 3MTDA 4ASUD 3EZYA 2OUKA 4AZTA 3ESYA 4R2KA 5JBNA 5LLSA 3MG9A 3GPCA 4DR2B 4PZYA 2HLDD 2UYGA 2YFKA 1HLPA 3C8UA 3RUDA 1HETA 4N1AA 4F12A 5EJ6A 3WYDA 1NVVQ 1S02A 1VRVA 5AJYA 2R6CA 4DNOA 4Y2PA 1KY5A 3QPWA 4PSVA 1TQ4A 4W5OA 3JAKA 2C7VA 4REOA 1N5IA 4Y2UA 3V3TA 1Y1QA 1E6MA 2H4YA 3PIIA 1I1NA 2PZAA 2R8EA 2LDBA 1Z83A 2W6NA 2ZUVA 1J09A 4BVLA 1F3LA 3H1PA 2C99A 2I3DA 4RSHA 1E0SA 2HK7A 3OKPA 5FNVA 3WR5A 4CCWA 4LC9A 1NVMB 4Y2VA 2D5BA 1J0AA 4FN5A 1U3UA 3EFOA 3PWKA 4XCVA 1SXJD 1EXWA 1Z4IA 3THYA 5EN4A 1M73E 1VJRA 4FYVA 1FUUA 2O8DA 3UFBA 2K7FA 1P7ZA 4A16A 1NQUA 4HGRA 2VTDA 4Q39A 1VLMA 2G04A 4HV4A 2V6MA 4MI1A 1P44A 5JMTA 1SD5A 3HM2A 1N2CB 1YNOA 2NZVG 4J3FA 1A2BA 2H1CA 2XGSA 2IXGA 1WXIA 4GXNA 4D3XA 3PJRA 1Z6TA 4BJ5A 4MS1A 3ZCPA 1FFWA 2ZBFA 3WLJA 3KOOA 2PA3A 1MW9X 4TOIA 3UMFA 1JR2A 1SBYA 2WHQA 1NUUA 1YJAA 1ZUIA 5DBHX 1OH5A 5IXYA 4GR5A 2G08A 2ABWA 4FXPA 3TLCA 2P4UA 1U0GA 3AR5A 4MKRA 3UKDA 4AZ0A 1L7EA 4MW0A 2Y71A 3F2IA 3EULA 4HTFB 4OIMA 4OQQA 4FT4A 5ENVA 4QM6A 1L7VC 5JCZA 1SKMA 3GLTA 1NLFA 3A7DA 4UNPA 1NKVA 1Z7GA 1SQGA 2JAOA 4HGZA 2Z2ZA 3L8YA 2R8PA 1VIYA 4GP6A 2L42A 3VTKA 4FK8A 5CFMA 1DEKA 3D02A 3R7WA 3NMUF 4ABTA 1QYWA 4I6EA 4C0XA 3K6KA 4QG3A 2Z5VA 2ZDGA 3Q9UA 2EZ9A 5ICSA 5IFKA 1OHHD 1E8MA 3TQOA 4PIPA 3HJGA 3JD0A 3WMEA 1KRHA 3ZGZA 1NRXA 1RE1A 1PWXA 2BCGY 1KXZA 4RD3A 4JC5A 2VTBA 2PZKA 2VPIA 4ND1A 1K08A 3ZE0B 2W42A 1I51A 2WNSA 3CE6A 4G5GA 4K9SA 4O4IF 4OU4A 3IA7A 3CWCA 1O54A 4HDAA 4NBNA 2CD7A 4WN3A 4UHCA 1CS4C 1KI4A 4RSMA 3S40A 4F4JA 2D1FA 1D2RA 1D7AA 5TQ0A 5MF6A 3SIRA 4D92A 3L82B 4M46A 1Z6YA 5BR4A 2XUPA 1ACMA 4U2BA 3ZU3A 2J9YB 1M10A 4L7QA 1E58A 3CRMA 3TQQA 3ZWNA 3UFXB 1IJFA 4ZJPA 3MWDA 4P0QB 1G4HA 1M6NA 1HNZB 3ZXYA 1T5HX 3ME5A 3U3XA 4EA7A 5PGMA 3JQ9A 1M2NA 4YP5A 2XUGA 4WXYB 4DLAA 3PC3A 3DLAA 1F8UA 3FPKA 2ZRHA 1YHNA 4OYRA 5EWLA 3OQJA 2FN7A 1U2GA 4BNKA 4GOXA 2H17A 1ZJZA 3D6MA 4G85A 4Z4IA 4Z8XA 4CIXA 4ZYLA 4B85A 1H4TA 3IAEA 4ZAYA 8OHMA 3U1BA 1T91A 3SMQA 4ZI2A 4ZVLA 4AD8A 3PD7A 1PJ4A 4BYGA 5I4CA 1Q0PA 1U0JA 3U44B 3U4QA 3GPDG 4R9VA 2JANA 3TR0A 4L73A 1UDCA 3RT1A 1MPXA 1N2SA 5KJCA 1FVOA 1D0SA 2EKDA 4LXHA 1CJSA 3IQWA 4F4CA 2CLDX 4RL6A 1H2RS 4RJJA 3H4IA 3SQMA 2PJRA 4JDPA 2BVNA 1QIKA 3GJYA 3DEIA 3K16A 5IT0A 5IM4A 4QLAA 5C31A 5AI9A 3U7QB 1Z5GA 3DKIA 1H0HA 3FGPA 4BIIA 4BQQA 3MGCA 1UP4A 4LSWA 3MMSA 4U2KA 2X9VA 3TQRA 1USKA 2PS3A 3QLTA 4KWIA 4PLCA 1GKYA 4KYTA 5CVTA 1OFHA 4R71A 3VU0A 3A9CA 3K96A 3WDSA 2CVHA 4N76A 1MVOA 5JQGF 1JEAA 1E2FA 1U81A 4G84A 3IT2A 1A8SA 4I7EA 4RZ3A 4TYQA 3PZRA 1L5HA 1DO0A 4ALMA 4BFXA 1H1LA 4W4TA 2UU9B 2ZBRA 2AQKA 5H9WA 1A9QA 2GZAA 2OCXA 2EIXA 3O84A 3ZDDA 2FE4A 5DN6D 2PJUA 1AUOA 3LLUA 4Q4HA 2VDQB 3DDOA 2PH7A 4P4UA 2QNIA 3ISTA 1DWPA 1BCSA 1SUAA 1C1XA 1XF9A 4YRGA 1MB4A 2XCTB 1WU7A 2CVFA 2Q1XA 5JY1A 3WL4A 2I66A 2CKMA 2H8KA 4BQSA 4A8PA 3R6DA 2Z2KA 3EG9B 3CB2A 1IUNA 121PA 3WQSB 3UENA 5CVDA 3V1KA 4BIMA 3DMTC 4HRXA 4KR9A 4INJA 1L8OA 3LC0A 4TX1A 4P0PB 2IEAA 4W5TA 2Y9PB 3JQEA 4FD3A 3OFND 3LYHA 4LC0A 4NLLA 4RVDA 3PJDA 5BT8A 5KX5A 2B5WA 2WTNA 3WHLA 2PVSA 4M21A 4PRKA 4FNGA 3EAFA 3TPZA 1R6UA 1IXSB 2HPZA 3RVBA 1FFBA 3DVRX 1X1TA 1FFYA 3P32A 1CT9A 5A2GA 4G0WA 3CF6R 1KARA 1HZZA 4QU9A 3ZI4A 4CV0A 5KU7A 2WOOA 1L4LA 3JWPA 5L40A 1BS1A 3DCYA 5MHTA 2XECA 4Q3NA 1R4AA 2ZIEA 2E55A 3ZH2A 5BQOA 4AWXA 5LDHA 1XBTA 2WAOA 3DOOA 4MZXA 4C03A 5D85A 1B41A 1PJCA 3PHIA 2ERCA 2FPRA 3L84A 4RKRA 3RRZA 5JANA 1QYCA 3IURA 4YIHA 3DMNA 4A0SA 3LZDA 2WWIA 4DLPA 2QM0A 3K92A 1Y3IA 2VWHA 3FZGA 4OBBA 1R18A 3CMCO 1J5PA 1TQ6A 1K98A 5DEIA 3HNPA 2EDAA 5AJXA 3QPVA 4KBFA 3F5MA 4AJNA 3W9YA 1US8A 1Z5PA 3NFRA 5ALRA 1KI1A 3O4IA 1R6VA 1OPXA 1TCUA 4TVSA 1TF7A 4J76A 3WSVA 3FHCB 2C97A 5DX1A 4GL4A 1WMEA 1M1YB 3HRHA 1QGAA 4N0MA 4BRSA 2OB2A 2XMQA 4NOLA 2C94A 1C3EA 2CL0X 4PEVA 4C08A 5K0FA 5K3EA 2VIIA 3A10A 4MQ5A 2GEBA 4X44A 2JEZA 3P71T 4B47A 1KU6A 4XUGB 4CR6A 3RD5A 4R7TA 1M2EA 4GSLA 4CU5A 3L6CA 4BYMA 4ZKDA 2Q9UA 1KWGA 1XKXA 4IDBA 3ICOA 3QV2A 4IIXA 3M4YA 4J6FA 1ISIA 2JCSA 3BRCA 1UP7A 3TAUA 4AY2A 1H1TA 2YWDA 3C5VA 1Z36A 2GJSA 1UXHA 3GG2A 2ORVA 3NTRA 3RREA 1JDVA 1UBFA 4KWHA 5KVCA 3BMNA 3D4NA 2XGJA 2VP6A 1YOVA 4UU7A 4EPTA 4PO3X 1YASA 4ZDKA 3H97A 1E18A 4DXAA 2IKSA 1F0PA 3DR5A 3MOIA 4EB6A 1XEWX 3RS8A 3U7EB 5HUHA 1KNXA 4E2ZA 1VP3A 1Y63A 2HU8A 2IIBA 3BDVA 3DVSX 1QKKA 3EY9A 3MBIA 4UUOA 5DVZA 5FKJA 1DEOA 2V7QA 2RGUA 1JF8A 4HAUA 2ZTMA 4MB0A 4Q4AA 3ACDA 3DMDA 5LZ9A 2VBFA 1AC5A 1QONA 2RONA 1ZZEA 1GJRA 2HRQA 4JMPA 4Z4FA 2PZLA 1FUYB 1JRLA 4M9ZA 1W5FA 1SHTX 4ZT7A 4LXGA 1PO7A 3WYGA 1TKCA 4RTRA 3GJXC 1V39A 1T9GR 2C84A 2B5OA 4BAGA 1N5LA 1IZ9A 4GLOA 3RRYA 4BO1A 1VE1A 4GSKA 3DQPA 1OYYA 4IQGA 1F17A 3ACCA 4FFBB 5E9JA 3RAJA 2P2ZA 1CUCA 3IALA 3T7SA 3ABQB 4OLAA 1P4SA 2VLBA 3OCJA 2QPLA 1K4MA 1Q1QA 4L2IB 1Y6ZA 1OW3B 3Q41A 3PT9A 2RHJA 3DFIA 4ZZ3A 1RMTA 4IVNA 4CLEA 3DHWC 4BVGA 2JIBA 4AO7A 4FYIA 5JDCA 1WSWA 1NV9A 1Y4ZA 1KMQA 4ITUA 4C5CA 3DDWA 4U3JA 3K70D 4WIAA 1DQZA 1V26A 4WNAB 3WIEA 5FWDA 4F4UA 1CF2O 1KK0A 3I3SR 4OJTA 2JLZA 1V11A 4MO9A 4A0FA 3AEQB 3M5WA 2GRJA 1SULA 3TG2A 2FPGB 3NOQA 1B8VA 5EG5A 3WSWA 1MX5A 2XE6A 3BCRA 2VBCA 3CU5A 3AUXA 2QQ5A 3OP4A 3Q4GA 4OQ4A 4QPDA 3I8XA 1OROA 4DIUA 1MQ9A 3SYTA 3GLIB 3OEHD 2YHIB 3E9ZA 4FM9A 1WW8A 2QUAA 4WTOA 3DHNA 4IG9A 1CUSA 5AICA 1BH2A 1U1CA 1W4BA 1Z6AA 1ULSA 4QHSA 1V2HE 2C04A 3O4GA 4FFLA 5E1MA 4F1WA 5IDXA 1KKUA 3KXKA 5CIQA 1ORRA 1SC6A 1HWYA 1PBTA 2ZATA 3KQQA 4KXXA 4DS3A 3WBKA 3AEZA 3CINA 1AO3A 4HVAA 2YIVX 1E0KA 1ZGJA 5EMHA 4H9GA 3GT0A 5HA5A 1NZDA 3PUKA 3V4FA 4HY3A 3EZNA 4F7WA 1BXRA 3ET4A 3ADBA 1SCNE 1VPLA 4NFLA 1GDTA 2H0RA 2EKZA 3WIDA 2BJHA 2JAHA 2VJLA 1JHAA 1ILEA 1JAZA 4B7AA 2G5GX 2ZPAA 5AUOB 3IV6A 4B34A 1F0NA 1I13A 4M87A 1N6LA 2CDCA 2OBXA 3C16C 4P3XA 6ABPA 1GGNA 1AQLA 3EOBI 3PFBA 2RE8A 2C4NA 1R88A 3M83A 3MTGA 1RAHA 1XCJA 4HEJA 4E1BA 5IZCC 3AHHA 1XZPA 4R5HA 3I01M 1N1MA 4GMXA 3L4EA 1HA3A 2QYOA 4I46A 4KB5A 3SZGA 4HLNA 3BSYA 4AP6A 5AKJA 3LUAA 4FFRA 3QEBZ 2EG9A 2HC9A 4CTKA 1X7ZB 1YZNA 1QP0A 3VAAA 2R1TB 3UHPA 3WLIA 2OSVA 1FRNA 4HNHA 4QJIA 2RD2A 4ARUA 1IJBA 2Q50A 3D3QA 1HO3A 3AO0B 3E6AA 4FYWA 4GZLA 4S0XA 3TIXB 3CFYA 4RVHA 2IX3A 4JXZA 4FZ3A 1ZD8A 3CLKA 5LB2A 4E15A 2Z4SA 2I2BA 4K6MA 1WUKS 3R3VA 2C5BA 6ADHA 3THOA 4B81A 5J23A 2X0RA 3LPNA 3RWOA 5JEDA 3THXB 3D4PA 3QY0A 4ITRC 3WIOA 3IQXA 2YYZA 3SEZA 2Y68A 3EXEB 4LGVA 2PSSA 3GB9A 4S2UA 4BJ3A 1USGA 3ES9A 3L6BA 5DPMA 4O4JA 2ZRKA 4RVNA 3TXXA 4GRIA 4J16A 2HTFA 4AQYB 3GMDA 2XE4A 5D1HA 1Y4SA 2RB4A 3HU5A 2M6LA 1UXIA 5B1YA 1PZMA 5LQDA 5AUPB 3U7JA 1IULA 4O4JF 421PA 2IEGA 4M8IA 4DNXA 2I6GA 1VBFA 3UH1A 3FM9A 2ISCA 4HB2A 1F51E 3ROPA 3TQFA 2WDZA 2X3UA 3QLUA 2VSYA 4DV1B 4RF3A 1FP7A 3Q3EA 2QS9A 1CE8A 2EGHA 5AVYA 3E05A 3KSRA 5LQSA 3TSWA 3TNDA 3KZ1E 1GTG1 2ZYGA 5JPDA 2RHDA 4L6AA 4WXHA 1MF7A 4BX3A 4WECA 1XWIA 3LZ6A 1HOXA 3RWMB 4A36A 3G1UA 1SCIA 2C2MA 4EI7A 2XUHA 1NR5A 3MTQA 3UTDA 3HL0A 1T2FA 2WE8A 4ED9A 1E79D 1JMKC 2F8TA 6YASA 2MJLA 4RS4A 3RF6A 3INGA 1PIWA 2PUGA 3ZHQA 1MQAA 4RPLA 3TW8B 4WZAE 4BKMA 3W5HA 1RXVA 1CUWA 1PWYE 5K3CA 4B1FA 1QIIA 5IHPA 3DOFA 1DVRA 3IHLA 3WDKA 1Y3HA 4C14A 5AESA 5HKOA 1P0IA 4PE5B 3JV7A 3Q7EA 2PIAA 2FFJA 1DKPA 4MMXB 4DPMA 1D9XA 1IL0A 1SXJE 1U5BB 2EF0A 1LLFA 4GNRA 1K2VN 4E14A 4EKNB 4ARSA 5FTJA 3VISA 5JC8A 3UQZA 4NE9A 2GPTA 5G3YA 2J3QA 3MRTA 4BBJA 1NU8A 3V3KA 4ODIA 4B6FA 1K6XA 1KETA 1RI5A 2ZIZA 5ERYA 1DOAA 3FBTA 1XNHA 1V7CA 5CCXA 4N3CA 2II6A 3AR2A 4DG5A 2ZBDA 1WB4A 4TUYF 2H06A 1ZXLA 3CUWA 4MGEA 4PSDA 5H8WA 2J33A 1RQXA 1V1MA 1Z68A 2X4GA 2WIJA 5B7GA 1YB1A 4GICA 4R1UA 5CHEA 5DRYA 2FW0A 2ZRIA 3AM4A 4UTPA 1E0DA 1EE1A 5AVTA 1GCIA 4CMBA 1T0HB 2DUNA 2ZZKA 3B53X 2NTNA 1TM2A 4RK0A 5THQA 4DA6A 1B8UA 2HYDA 4INZA 5AVXA 4P7BA 1Z7WA 2KMLA 1D3AA 3FPGA 4LTMA 1ZJWA 3DHEA 4JA0A 4W7IA 5JSZB 1KIAA 3PWTA 4NG4A 4ZOBA 5EEGA 2CHVA 1Q7TA 4QUHA 4YAWA 3GLGA 1D2GA 3HPQA 2IIVA 4JJAA 1JJFA 2HV8A 3KWJA 2XQFA 1VLJA 4FMDF 3EIOA 5JAIA 5FI1B 3QU7A 3N1UA 3TTVA 1KGDA 2AN1A 4HNTA 2GK6A 4V02A 2EV9A 1B0UA 2E4VA 3ZK7A 1PU2A 4MPJA 4X97A 3OOWA 1W44A 4K9MA 6AT1A 2Q28A 4Z7OB 2A30A 2C07A 3W1EA 5A4KA 2GSDA 2PSHA 2V98A 3DD5A 2ZEJA 1SMKA 1L9KA 2HM7A 3V8VA 3TI7A 2JK0A 2DFDA 2ZSAA 3NAZA 4MAMA 1V16B 2QTVA 1G6HA 2VLIA 3CEPB 2HD4A 4R1TA 1IRIA 1E89A 3N6XA 3HVKA 1XD2A 4F91B 2R3SA 1V5GA 2ZQZA 2ZYIA 4JI0B 3A26A 1GZVA 5L7TA 2CVZA 4A4DA 2X1VA 3I9V6 1OB5A 1BE1A 1DIRA 3NWBA 2O2HA 4LF8B 1FP1D 3CHYA 3TM4A 3W4JA 3HG7A 3BBLA 2C2WA 4YMIA 1JS1X 2P4EA 5HZMA 5FRDA 1T8TA 5JZVA 2H31A 4BX2A 1SM4A 1EA7A 4ALIA 1OI7A 5JSZA 2FZVA 3EGOA 1XZCA 4PFKA 1H05A 1JBEA 3MS4A 3LK6A 3PE3A 4HF7A 4C01A 1ZHOA 1BMQA 4K5QA 5CA0B 4NONA 1N2CA 2WHEA 3L6RA 3QUSA 4B6QA 2JFVA 2VATA 1ZRMA 3D6TB 6REQA 4IM7A 3NDJA 4L72A 3CNBA 2DFPA 2JLBA 2QVXX 3QWFA 1WULS 3I52A 1NVVR 3OBIA 3QFRA 4YJHB 1DV2A 1XCOA 2OBLA 4WSOA 1H22A 3S44A 3S99A 1K3FA 3B2EA 4ENRA 4QFMA 2HU5A 1SC9A 4AIIA 3E4DA 2JGNA 2NVUA 5EIFA 3VDXA 1X70A 3RLFA 1LPAB 1TYBE 1YUNA 2H7CA 4UBOA 1KE1A 5I48A 2H5JA 3N9IA 3KKPA 2QTCA 3DA8A 2WJAA 1LPSA 1C7FA 2WKRA 5DIZA 5KHLB 5KYUB 1RMQA 2VDWA 4OAPA 4X1KA 5CAEB 1T0JB 5LD2C 2W43A 2VEDA 3OLZA 5A5DA 1HE5A 2GK3A 1ENOA 1CQJB 1T0IA 1VYHA 2I2XB 3WL7A 1RW4A 3CKLA 4CTMA 5CA1B 1MKYA 4TWRA 2VZ0A 2YIJA 1QR2A 1PQYA 4ZT2A 5LU9A 2X4IA 3DG9A 2CHQA 2JBWA 4ARZA 4GYWA 4EUHA 2DC1A 2QXUA 4Y0AA 4EEZA 1QIDA 2MSKA 2OM2A 2W2LD 4HKTA 5T4HA 3FOEC 4DQKA 1ZD5A 1JIVA 1GL9B 2EBUA 4J0FA 4B75A 4PPQA 1T35A 5DWQA 4G5OA 4MUGA 5HYVA 5KAMA 3GY0A 3TRIA 1GTSA 3L4BC 1P9OA 4D9MA 1DRWA 4L3VA 2HIHA 3F8WA 4NEQA 4P5DA 3DEFA 2NACA 4WGFA 2RHOA 2XVZA 1M1YE 1RC0A 1XCGB 4NV3A 1NJ2A 2J6BA 2BFFA 2MHCA 3IPYA 4ONEA 5AW3A 3EIQA 1B00A 1XWWA 1ZGZA 3PCXA 3FSRA 4HH4A 4C6TA 1KA9H 1XPJA 2HCRA 2ACKA 4O25A 4P08A 1CR6A 1UBLS 4WKCA 5HIJA 2G25A 3O21A 1NY5A 2BIFA 1F8YA 2G06A 3PJEA 5KKAA 5CYGA 1RT9A 3TMYA 4B2IA 3RYIA 3OQMA 1EUDA 2QW1A 1HDIA 4HHEA 4TN5A 3RFTA 4P32A 3T3MB 3N2KB 3B20A 4Q7QA 3ZD8A 3V4ZA 3IKTA 3DSRA 3OESA 4KHZA 5HMLA 1F4VA 3EHEA 3L01A 1OAOC 2YZ2A 3LF2A 2C0PA 2W2KA 4L3OA 4PU0A 1U0OC 3MJTA 3OZFA 2D3WA 1DIGA 2H2GA 3PXEA 4B3HA 5I01A 2CXOA 1ZLYA 4YCAA 2ZRBA 1X77A 1OKKD 3L7AA 3O2NA 3WMRA 4LX8A 3NWOA 2TMYA 2X14A 1ZR4A 3PV0A 2I6TA 1DPFA 2FYTA 1Y9EA 3E03A 1OBVA 3H3FA 4LXTA 2W4IA 3PYLA 5ALMA 4C1BA 4Q3LA 2FCAA 1B3RA 1AKWA 4BQIA 3WBFA 3QX7A 4KWEA 4KQ2A 1IHPA 2JJ2D 4U7JA 1W1IA 5C1PA 5HK9A 2Y1EA 3DFFA 4UJ3A 2SHKA 5CT4A 5JFGA 3FWNA 1AGPA 3UK1A 3RARA 1AA6A 2Q5QA 3P2KA 3ZJVA 3FRIA 3ROZA 1Q0HA 3M5DA 3R5XA 1ILWA 4FGWA 2J4FA 5B6IA 4ND4A 4ZVUA 3F73A 3UO8B 4B0PA 1XMOB 2Q3HA 2IZOA 1E62A 1JPJA 4XLLA 1R4NA 1WDKA 3MERA 5EZQA 1XNGA 4LYGA 3QE3A 4KO4S 4TLDA 2RAFA 4YQFA 1UWKA 2AN5A 4OFZA 1JU4A 5KVAA 1KJ8A 5DBOA 3V33A 3ILXA 2AMLA 4DUGA 2JFFA 2NYAA 1OIXA 1XRNA 5HSGA 2DPMA 3BH7A 3AI1A 3MCZA 5C1OA 1JILA 2IUYA 4G81A 1AKUA 3WGLA 4IF6A 3NGLA 3H8VA 4J0JA 2Z57A 1UBEA 1HFWA 3MWLA 4I9FA 4OL0A 2GEJA 4YRCA 3FYUA 1YXMA 3M6VA 2ORED 4O5OA 3KM0A 1DKNA 2QXTA 3OECA 4CM4B 1CR4A 4ICIA 4UD6A 3IIKA 3IMEA 2F3RA 3OE1A 2W6MA 3OSZA 4UNQA 5FIUA 1LV7A 4RLHA 1YMUA 1WOYA 3VNUA 2CJYA 3VZQA 1BEEA 1OU0A 3RANA 3U5ZB 3RGWS 3I61A 1SOWA 2IC5A 1U7WA 2AMVA 1ARZA 4HH0A 4WNAA 3FY4A 1JKJA 1PV4A 5JAHA 1ODCA 4ZOCA 5DTRA 3EQ2A 1EWVA 3IBFA 4BFYA 2OKCA 2J4CA 4UASA 1ABEA 4WN9A 5ALFA 5B5SA 1D09A 1E32A 1XLUA 3LCVB 4B6GA 3R40A 1QXSA 3WA6A 3A2MA 4JODA 2IRWA 4R16A 4YONB 4B73A 2V6BA 3ESZA 3HFJA 3UA4A 5FUWA 4AG3A 5LU8A 2RH5A 1JDNA 3GAZA 3DE3X 1HQDA 2CNWA 2R79A 3CNEA 1EGVB 4XA8A 3WHIA 4EPXA 5JRZA 3I1IA 5EQFA 1ATIA 3T0FA 4DDMA 2NU6A 4HDRB 2QT1A 4FYKA 1ZA2A 4GNKA 1U80A 7ADHA 1SA0A 4F5YA 2OORA 2QN2A 3O47A 3DXYA 3VHQA 3AZOA 3WGTA 1NE2A 4FUTA 2DR0A 4MR9A 3R7SA 1S9DA 1I0LA 2Q5FA 5D7NA 5FWXA 1U2GC 4S04A 5FLXA 3GLKA 1KMHA 3O92A 3WYEA 1ZJYA 2DKOA 2B98A 3TD9A 3FN4A 4H59A 1HC7A 4V0MA 4AJLA 2ZOSA 4LDRA 1U9IC 4D5EA 5DP1A 4YCCA 1R2QA 2GOYA 3L1KA 5AOVA 1UM9B 4KL8S 3AM5A 5EY5B 1M83A 2Q4DA 2D00A 1TFUA 1ULUA 1ODTC 1ZINA 3RS4A 3PGXA 2OZLA 3IAAA 1HE8B 1L7AA 2YH2A 3PXAA 3BK1A 1OKKA 5JWRA 4X20B 2QTHA 3SGLA 2G3YA 3VRHA 3Q85A 1KZ6A 4UW9A 3SC6A 1E6CA 4FTWA 3RK4A 4YDQA 2OAEA 1BS9A 3RBXA 6LDHA 4F2HA 1G4AE 2QA5A 2PGNA 4WASA 2JLAA 3COSA 4R5MA 4B79A 4R1OA 1U8ZA 3KXLA 4NX2A 2C54A 2GT1A 3IPRA 3T7DA 2R751 3DFMA 3I2KA 4IJWA 3OX3A 4WFJA 2VKQA 1NHGA 4U3JB 4AQ7A 1M2VA 3C97A 3DMYA 3GZNA 3CPSA 3KB8A 3PF8A 4QBTA 4UAGA 4XTCS 1P7WA 1Q22A 5EPEA 2EIHA 4LHYA 5E7IA 3VR2D 2WRZA 4BU1A 5K45A 1RS0A 3ZV4A 3FWZA 3LI2A 1SC1A 2I7VA 2W6CX 3CZ9A 1PGQA 4KXLA 1AD2A 3D43A 4GO1A 4QVKA 4RM2A 1AZSC 2JJ1D 3ISVA 1ZX1A 5F3RA 1SRQA 1Z73A 2P9ZA 3HZZA 3IVMA 4LX0A 3SBDA 3HK2A 5EUMA 1F9AA 2YNMC 1B3BA 1KH2A 1QLHA 5BY2A 4ZICA 5AM3A 4LHVA 3EUEA 2NMVA 4RXUA 5DSXA 1X9HA 1JVBA 2CDRA 3BL6A 3O7WA 5EGNA 4F45A 1BHQ1 1XZFA 3CG0A 2AUMA 1SXJB 1KMMA 2BM9A 1QX4A 2YMPA 3ONWA 4PHHA 5CVVA 5DBEX 4DYHA 4EHJA 2BE9A 3RG8A 2W7TA 2LRHA 2PGDA 3MWJA 4IXWA 3EVEA 3JARB 2QY9A 5BYJA 1TK9A 3PUXA 4KMOA 5K2OA 1MD9A 2ZYSA 4N5HX 3UJPA 4QE3A 1UZNA 3L7MA 7MDHA 4Z9FA 3HDQA 1HH4A 1I32A 2G1AA 1G8YA 1M6HA 1ITZA 3QXJA 1FEZA 4ERNA 5IP5A 5H1YA 1SR8A 1S2IA 1AKMA 3ZDAA 1VJCA 4DR4B 3SE0A 2A9QA 2FPIB 2I2CA 3PL1A 4IV8A 4NV0A 3F3YA 1MO4A 5KJ1A 5KYKA 1XDUA 1Y8QA 2VHUA 5D5QA 1AT1A 1M75A 2RI1A 1Y0BA 1H2FA 4GGMX 4Q05A 3VI3B 4HQKA 2RBEA 2E85A 5KSOA 3PQ2A 2I67A 1REQB 4MWSA 4Q9KA 4OGFA 2NO5A 1K89A 2PHZA 4OHVA 1N2GA 2OV8A 4YJ3A 5DEOA 1HG1A 2JBAB 3RK1A 1XT6A 4IDPA 4G41A 3SZ3A 1WKCA 1BA3A 1BHJA 1SBHA 1VIVA 2C3UA 2P0AA 2VQSA 3BQMB 2PGOA 3ZCUA 7YASA 1SAYA 2ID9A 4ZREA 3W9BA 4AYTA 4YRNA 2WM9B 4BNDB 5SY4A 3O31A 1Z6XA 3T4EA 3GJTA 1THMA 3GLGB 1QIEA 1IBCA 4MUNA 3TTYA 3H3XA 2AD1A 4PZPA 1ZCBA 3UG6A 3QY9A 4C0HA 3QBEA 2ONJA 1KAQA 4DSOA 4DRXB 1KZYC 1VRCA 3GCDA 4G1CA 3OX1A 5I9LA 4QATA 3SDBA 2WA2A 5A62A 1X87A 2GX6A 1NVGA 1TM1E 3UVEA 1A27A 2VDUE 3JWEA 1Z22A 2CBGA 4HNVA 4BBAA 3WJ2A 2PGJA 5ULLA 4S1VA 3COJA 1B6SA 2NVWA 4XB6B 1ML4A 1YZQA 1Z5UA 2A7QA 2WJVA 3C41J 1N75A 3IIMA 4ZI7F 1KPIA 1PWHA 4BS9A 4C06A 5KSYA 1FTNA 5JI2E 1QQ6A 2HRRA 1BWPA 5C0OE 5A4DA 5IH7A 4UCFA 3T3OA 5KX5B 4QBKA 5LQCA 3Q87B 5CNMA 4JEIA 2P5SA 2HMVA 1IXRC 1XTKA 1M54A 2PZGA 1GZ6A 3DEJA 3OCZA 4XD7A 5JH7F 1ZMBA 3KQTA 1OXVA 3PI7A 4YIKA 5ER6A 5F76A 1MJGA 3K32A 8MHTA 2DFTA 4RE5A 3DDCA 4GBED 5CW2A 3JARA 3UK2A 1YL7A 3TL3A 2REBA 4EAQA 5EHNA 3VMFA 4EJ2A 3FCAA 5AQ1A 3G82C 3HABA 3BL5A 4HNAA 2IGTA 3R9KA 5A06A 3TSCA 5DTEA 4DQVA 1W5EA 1SUPA 1PL8A 4C4ZA 1BX1A 2P9GA 3IDZA 1PQWA 1W76A 5DFAA 5ITZA 3REQA 4ER5A 1V9CA 2FFQA 4X1IA 2CE2X 2PMWB 3SIWA 5HBGA 3TZHA 4B35A 3MTIA 5G1NA 1E7MA 3GCWA 1OXXK 4B09A 3F5QA 1JLLA 1TNDA 2BM1A 1L1FA 1GAQA 2DBZA 1I2ZA 2R6DA 5ALOA 1RIIA 4OK6A 2CLFB 2JHPA 2ZI6A 2IU4A 1GQSA 4YP7A 4D4MA 5CT9A 1KF0A 2BP7B 1XA3A 1VKJA 1A8HA 3UYKA 3BIOA 3ZZUA 1EQUA 2B1IA 2OC9A 5DCLA 1IUPA 2B4YA 4WK4B 4RF4A 4A9AA 3VC3A 2PUWA 2AZ4A 2TMGA 4X61A 2RK4A 1ZJ6A 3W6ZA 2B3TA 5BVHB 4QUGA 4Q3CA 4HBGA 3TNLA 2FOXA 3BSFA 1LXCA 1JNXX 1UBNA 3L1JA 4NZYA 3VNRA 3C15C 3WC4A 2JLWA 1JIXA 1WPRA 2QROA 3F3SA 4X6YA 3LX6A 5A04A 4P36A 1GLNA 1D04A 1Z7YA 2LPMA 2J5XA 2VVTA 4AKHA 2WTBA 2Y1DA 4YMLA 3PWZA 1JR3A 2P40A 4JWKA 3PVCA 2ZZNA 1BXKA 4ZO8A 3NVMB 1EJBA 1J4AA 1XL0A 2DY0A 3CX6A 3KUKA 1BD3A 3MINB 4K6CA 3VNQA 1IBKB 4ZMRA 1FA9A 3FDZA 1XMSA 4L5YA 3VZBA 3SN6A 1OVMA 3LJKA 1M2KA 4FJ2A 4X9XA 4MPDA 1Q74A 2VG8A 3ACBA 3EZ9A 1YUBA 4MV5A 5K3FA 5JQGB 1HPLA 3TI9A 4HSGA 3M49A 5BPFA 3SZOA 4MV6A 2YMQA 1L4FA 1UK9A 5JASA 2QG6A 2JFOA 5JNSA 3ICQB 1W0JD 5FWXB 3LBYA 3QFSA 2GERA 4MB6A 3KBBA 1KSFX 4YRZA 3FLEA 4QU0A 2CYBA 2V7UA 4FC6A 4BB0A 2BZGA 4QHTA 1JMYA 5SZKB 3HB9A 4EFDA 5DM1A 2BFNA 2R8XA 5L7WA 2OAQ1 1D1TA 1DBQA 2OAGA 4KLAA 3B8HA 1EDZA 1SU8A 4WINA 5IHXA 5IK2A 1M72A 1EQ2A 1DKLA 4CQLB 1NQAO 1AHIA 2R1VA 1SOAA 4Q03A 4LKRA 2AG8A 2E4YA 3M89A 3KEQA 3HJFA 1IPFA 4ER0A 1G16A 2UKDA 1J20A 3LFTA 3HGQA 4KLCA 5IT4A 1OLSB 3LP5A 2QSUA 2QMQA 3MT9A 4XW2A 5TARA 4N0DA 1TQHA 1FQOA 3AVOA 4G0MA 4XVHA 1RE0A 2HXSA 4JWTA 4QNMA 5BUQA 5JWOA 2OO7A 2VAPA 4OQXA 3GFTA 3CJTA 4PBTA 1GSHA 3L8HA 5CLHA 3NX4A 1G4UR 3TZEA 4MUYA 2XTNA 3USCS 4OX9Y 3EISA 2J59A 2QGFA 3FH0A 3OX4A 3FNIA 4NCBA 2RGXA 5AJVB 2A5JA 2MYPA 3RADC 1XZNA 4HWRA 3ZXUB 5CB4F 1FMFA 5KYNA 1NJGA 3FWKA 5FAKA 2IHBA 4W5HA 3EAQA 3GOHA 4KUHA 3O1LA 2P9FA 2XVYA 4O4JB 5AJZA 1SBZA 5H9VA 3AVPA 2CY0A 4FKBA 4H15A 1TMGE 2VUSA 1LNQA 3GWGA 3DTVA 2IH5A 5EMMA 3Q6MA 2FEOA 1QFYA 4DVJA 3WGIA 2ZXEA 1TO2E 4MICA 4XGQA 3OJXA 1JQBA 1TVMA 3FPLA 4PZZA 2Q7OE 4ENUA 1KRWA 3SYLA 1B0ZA 1T0BA 1O96B 3N58A 3ZNOA 3Q6IA 1CIVA 5JNLA 1W19A 2X5OA 3X43A 2JD2A 3AILA 3M4JA 4JJFA 3LXRA 2BMWA 4H31A 1T5SA 1WB5A 2CNKA 3OVMA 4WBSA 2H1RA 5GAJA 5FHRA 1O87A 3PQ8A 4RJTA 5LXTA 1Z29A 2PH3A 1XU7A 3RSHA 3PPIA 3ETCA 2IHUA 2M9MA 4G89A 4P4LA 4P4SB 2BRUA 3IJPA 3FMOB 3OPYB 3ZDXB 3SX0A 1ZU4A 5DXJA 3Q5GA 2DUMA 1O95C 3GLFB 1C81A 2C4WA 4JIGA 1GG2A 1ONNA 1W29A 2XRMA 1U90A 2XDYA 1XA4A 5JNWA 2CLIB 2F1OA 2ZYTX 1CRZA 3HFRA 1U4SA 1Y8AA 2VAWA 3PHCA 4RF5A 1A9XA 1OZFA 3CRQA 2J9ZB 3U81A 2GZMA 2OAP1 2Q5JA 3DWIA 2FR0A 1PHPA 1ZMOA 2GCEA 3N8HA 4O4LB 5K3SA 3IESA 1CS0A 1N3LA 4J4HA 3SM3A 4YPFA 4WW0A 3CY6A 3NIDB 2NUBA 1ODSA 1P9LA 1O5IA 5A71A 1CRQA 1CF4A 1NVUQ 3WLLA 3EZXA 4AAYA 5B36A 3Q0EA 4XIGS 4XEUA 2IVFA 4DC0A 5LYJA 1PR5A 2VJBA 1XNJA 5BQ3A 4FI3C 4HMQA 3UHOA 5JNRA 3GFRA 1SUIA 5AVUA 1C1YA 2HDHA 4UEWA 3EF3A 4G2TA 4CFZA 2QUZA 2SCUB 2YS7A 2WF5A 3ASVA 1WMFA 1IIBA 5WRFA 5EL0A 2ZB7A 4YRTA 3FLAA 5IEBA 4IGKA 3HR7A 5COQA 1BN6A 1TA9A 4LECA 2O48X 4IFIA 1J33A 1E5VA 2Y4NA 1U0HC 1JJVA 4ZIRB 4UAJA 5J1TB 1XZKA 1JN0A 3CURA 2Y4OA 4TZKA 1HNXB 4KDFA 3RV3A 1FS4A 4ZHQA 1Y34E 5SZIA 3WFZA 2YWRA 2VF2A 3KQVA 5BW5A 1LTQA 1E4OA 1OZ0A 4ZXFA 2Q0XA 3WO0A 3BXGA 3K9LA 4M9QA 4LF4B 1EIWA 5AXCA 5E6UA 1N6IA 1IG0A 1VKHA 5IBQA 2DWUA 4E6EA 4UMVA 3IVXA 1E9RA 2NU7A 1GCGA 3KIPA 4KI7A 2CZGA 5E0KB 1R8XA 3OZ7A 3WDLA 2UXDB 2EBWA 3ETEA 3HXTA 1CJUC 3NAQA 4HR7A 4KLRA 3GLIA 5IDWA 2ZR9A 1QP7A 2IA5A 4HAYA 5ESWA 3ZZTA 2W6JD 4UTXA 3QHPA 3BWMA 3D0KA 3FDJA 2V1XA 4J9UE 1RRFA 4PZUA 2ZI7A 2WZBA 4OBWA 4C0JA 1THGA 2QRHA 5EIBD 4JEHA 2P1RA 2WKQA 2CWWA 1HE4A 3O1HB 3P9PA 1H42A 4GC9A 2P2YA 1OA1A 2N42A 3EPRA 4KC0A 4P92A 3GLSA 4WZBB 4DMHA 4B3RB 3WA7A 3DBLA 1LK5A 1JLHA 2R6JA 4X62B 1HDXA 1YT5A 1NF3A 5B7NA 2ZKIA 2XRYA 1ZNYA 3EY4A 1V3VA 1U3TA 1WY7A 5CM9C 5JYDA 2CD9A 4LDNA 1UJ6A 3KSZO 4CLHA 1YZYA 1PLJA 3GGGA 3KKNA 3DBIA 4QTXA 2XCQA 2REQA 2ZUTA 3GDWA 2HR1A 1G59A 3VZCA 3WLNA 1Z0FA 4IXNA 4YDHB 4DCTA 3I6QA 4OQDA 3NKVA 1PZGA 2E82A 5E3HA 5C9ZA 4AY6A 4BQFA 1SB9A 1IAQA 1NX9A 3HA5A 3IMGA 1VL1A 1UJMA 3KLBA 1NXQA 3GVXA 2JZCA 1NIJA 2O8BA 2OWEA 3FYDA 4BQPA 2YXLA 3A3OA 3LBHA 4IUYA 4MVJP 3VTAA 1ZESA 3ZLJA 4I50F 4X3PA 5LC1A 4WWHA 1VKNA 2AJ8A 1LNZA 1EB9A 1NJ6A 1A98A 1HL3A 3GVIA 3HUDA 4FB5A 3ZHTA 1W5AA 2BSAA 3PENA 1WHTA 5FO0A 1GM5A 2QQ0A 3EDYA 3K2IA 4J0DA 4OB7A 3C4JA 5BV2P 2OLKA 4J7UA 3CVYA 2H2HA 1ORIA 1TUBA 2G7MC 3AVXA 2QTRA 5EKUA 4D4IA 4NBSA 2EWMA 2YVLA 4R7ZA 1I7SB 4WVLA 2PKCA 3UEOA 3BS4A 3ZV5A 1QANA 4QBIA 5IJ0B 2JCGA 1PGOA 2YQ4A 4B3SB 5E7JA 3BXEA 1GG8A 5LZ7A 1Z16A 1UP6A 1YE3A 3UJ3X 3JQFA 1GPUA 3D4BA 4MVJE 3RIHA 3V1NA 5K6AC 5J1SB 1OGJA 3GGCA 2H9IA 4DLSA 1A8UA 2GTPA 1NXTA 2QJWA 3PFNA 1G2QA 3UC5A 3UBMA 2IU6A 4ERXA 1QHXA 1NM5A 3QPDA 5BN3A 1YE5A 1EX1A 3AF2A 2MDTA 5DT2A 3ZD9A 1HFJA 1V3TA 4M7PA 4YPOA 4RFSB 4TMWA 4ALJA 4Q15A 2Z09A 3D8SA 2YX1A 1XTIA 5DGCA 1J2EA 5KYXA 4AJEA 4FE7A 1J99A 2BC9A 1U1IA 4BMVA 1MABB 4J2OA 4MGYR 4Y7CA 2R00C 2IE8A 3LHIA 2DPGA 4ZV7A 1QE5A 3MC1A 2NAFA 2X5XA 4ETMA 4A2WA 3INYA 3WE7A 2PGLA 3LLSA 4D26A 3RCBA 4U02A 4RTLA 1HGXA 3B9PA 3PEYA 4EB3A 3V1UA 2NN3C 3QELB 4Q66C 5ICFA 2KJQA 2AI2A 1WTCA 3L93A 3QLEA 3W7AA 4ZVTA 3QQPA 2AT1A 3CTMA 4JUCA 1LPMA 2ROQA 4TV9A 3N74A 1EP1B 2ZWPA 4TLLB 1DO8A 3IQGX 5HF8A 3SHVA 1U7UA 4S35A 2AEEA 3DNPA 3NKLA 4F2WA 3AM3A 5EQTA 1GGVA 2VTKA 1IB6A 3D2BA 3IUJA 4M0KA 1JDBB 4IIUA 5KO2A 3Q3GE 3BFVA 3Q5EA 1MJGM 2I7DA 3MAAC 1TUEA 4TYPA 5FNZA 1Q17A 1SZDA 4KGDA 3BHNA 1QYRA 4G0QA 3T9CA 3O4FA 4F2PA 1H2HA 3UAGA 1V95A 2WTEA 4KQGA 2PXCA 1LDYA 1IOVA 4FHEA 4PCAA 3UGQA 4AF8A 1K6JA 3HO6A 2O19A 1WBJB 4UE3S 1EINA 3RBZA 1A4UA 2JW5A 1HT3A 1V3QE 2AGVA 4G86A 3ZXIA 5KX5F 1J23A 3H5NA 4BC0A 3PFCA 3SK0A 3ZX5A 2MIIA 3GPBA 1QU2A 1Q1NA 4KE7A 3AGQA 1M2OA 4TQ9A 2X7XA 4ZOLB 4X7MA 4PRZA 3TZ6A 4F4IA 3KAJA 2PX6A 2HY7A 3NHWA 4OB8A 2RH4A 4XYMA 2V7QD 4HAZA 3UN1A 3PQ6A 4FZJA 2NPFA 2QTLA 4TLMB 1FU8A 1XZAA 5G4KB 4EARA 1LI4A 1ISSA 1JMVA 1ST3A 2IE0A 2Q7XA 2XI4A 2XYVA 1NGSA 3CW8X 2CVPA 3PDCA 1U1FA 2INGX 3RM3A 3WGGA 4YXFA 1RWBA 1BOOA 2QOEA 3SOPA 1M34E 1YI1A 5FWYB 4MNTA 1DAIA 1GV1A 4JU8A 4GM0A 4V39A 5E2BA 2PLAA 1DCFA 1H94A 2EZ4A 3U7FB 3MAJA 1O6BA 4RZ2A 1RWNA 3I9V1 4Y2GA 2XMPA 3WLSA 1XDZA 3TFWA 4R8SA 3JASA 4V0KA 3UJ7A 2X15A 2MOKA 4MWOA 4BDTA 3EFBA 2QJOA 2JJYA 2PMEA 3VOAA 2V7PA 4CW7A 1REQA 4EJ0A 5JXWA 1SHUX 2CHFA 3R3HA 2HHCA 5E1BA 3NDBB 4DJEC 1JDTA 4YY3B 2JGMA 4TLAA 3KQLA 5K0TA 4OFWA 3K0CC 1BFUA 4ADSG 3CLRC 1EHYA 1N8NA 2WSYB 2OBBA 1E1QA 4CFYA 5J4YA 3MTBA 3SKYA 1F12A 4INPA 5D2CA 1YQUA 3O90A 1XK6A 1XUOA 2NO1A 2P2SA 2R8YA 2HDNB 4I5GA 1BOFA 5CK4A 3MJEA 2PUTA 2JFHA 3DPUA 3HKBB 4GZ6A 2CB9A 3K15A 3QSGA 3W6NA 1S2NA 3DAGA 4Q1AA 1N6HA 1EUQA 2WM8A 4GOOD 4JUAA 2C9BA 2Q1SA 1P4GA 1S3FA 4NMXB 1T3ZA 2WAYA 3ZV7A 5K4GA 4N0PA 5KVQA 1ESCA 1CY6A 1LZLA 2B0CA 4UE6A 1UADA 1PQUA 3BWEA 2UXCB 4BO4A 1EK0A 3BXFA 3G8AA 3H65A 2WB4A 1X7XA 3L0CA 1TF5A 2VHVA 3OCCA 1NN1A 1DG9A 3EGWA 1HFKA 3GH1A 1NVXQ 5E0OA 3P0IA 4X64B 1JLMA 2BD0A 2NADA 1I1OA 3OP1A 4P81A 4EHNA 4Z4GA 3QIAA 1DWOA 3ZIAD 3RTCA 2CUZA 3ENKA 1SUFA 5DWVA 1KAHA 1ZH4A 4CEHB 5ARDA 3WP1B 2OGSA 4DA4A 2ZQ5A 2OZPA 1N9ZA 1ZK3A 2JIMA 2TYSB 1D8AA 4HB0A 4J0EA 1YBMA 2WQZA 5A6SB 2V03A 2AUTA 2NVBA 1AUVA 2ZREA 1BWQA 2CXXA 4L16A 1N2ZA 4IZ6A 3G5AA 4UCWA 4CUZA 1OC2A 4S12A 4H3HB 2QYTA 2O8BB 2IP2A 2LNDA 1XZHA 2WF7A 1CERA 3B2NA 3OH8A 1QR6A 3GUYA 3LA6A 1T4DA 2MTBA 3LF1A 1XVVA 4L85A 1LPOA 3M9LA 3NWEA 3QG5A 4OJKA 3SXUA 5LNK6 4I4IA 5M04A 1DMRA 5EHZA 3KQMA 3LECA 5G4KA 1O2DA 1TZCA 2HV9A 3SZUA 1O97C 1SCBA 2VXOA 3FJ1A 5JT1A 2WW8A 4HYYA 2QRPA 4BXOA 2G1KA 2WJPA 2IF2A 2N75A 3AXSA 3DMGA 4N7RA 2W6JA 3EC2A 5KVSA 4YUVA 4BVAA 1GNQA 3F4BA 1T9KA 2VRNA 1JFRA 1TTPB 2Z4TA 4XUEA 4QZVA 3FXAA 1IY9A 1Q6YA 5B1IA 5GZ1A 3R9XB 1RRCA 2YW2A 3ZHXA 1QG2A 3IT1A 3L7LA 3M7IA 4IW3B 1CB0A 5HF9A 4ETWA 1RAEA 4Q7JB 2B8TA 4Z3KA 3AJRA 3G9TA 3O8RA 1NQVA 2AV6A 2FPPA 1MEOA 3WFJA 3ONEA 4G1BA 1M5UA 1XKQA 4BNNA 2OTCA 1VRWA 3CF0A 5D5PA 3W4KA 3MLEA 4KH1A 4ISCA 4Y9RA 1HYGA 3UANA 4Z1MD 5FDFA 1E3LA 4E31A 1EIZA 4KQWA 2IV7A 3ADPA 1U7OA 1IWBB 1ECCA 1OAOA 1S8FA 4DANA 3E0QA 4ZAXA 1KOGA 3GGPA 2DPLA 4LWPA 2IYTA 1H9AA 3A4NA 3BXHA 1W46A 4PICA 5LOVA 3R5JA 5ICMA 3HVHA 1G8AA 1E3IA 3LCUA 3G9XA 3MJ4A 4ND7A 5J58A 3UB2A 1DEXA 2CMHA 3SG0A 2J9GA 2GJ4A 1JSCA 4TTPA 1X19A 3TKAA 3FUCA 4FR5A 3BF8A 3KK0A 2I03A 2YZMA 1HK7A 5C8VA 5I7EA 4JXJA 5E9AA 1MZPA 1YC5A 1ZPDA 3KUUA 3HN7A 4AZ3B 1E61A 3AJAA 4KUEA 4YRAA 2R87A 1E4VA 1OUMA 4AROA 3UGJA 3UAWA 3UK7A 1W9HA 3V7YA 2R4QA 1E1QD 4DM4A 4IKEA 5L95A 1CE8B 1E7QA 4YALA 2Q9AA 3N0WA 1ZGCA 4ON9A 1M0TA 5ERGB 1R0XA 1X1RA 1TA4A 1VYUA 3DGFC 3TW4A 4DKXA 1RFGE 1WMBA 4FHZA 3TRKA 2V3VA 4EA6A 4DWJA 5D3QA 3RS3A 3OFJA 4KG7A 4OI0A 4JBNA 4ND6A 3DP9A 2QP3A 3NHUA 1QO7A 3IQHX 1FJ2A 4YJ3B 5EMLA 2DEUA 4DCGA 1K5GA 4WFKA 4HQFA 5KYGA 1W49A 3I53A 2HHLA 1FSSA 1SKYB 1SIWA 3C1AA 3NTVA 3PDJA 3GPIA 4G0NA 4RL4A 2AOTB 3PDWA 5IN5A 1ZWKA 1QBKC 2JARA 4CUJA 4BMDA 5JJBA 1EM8A 4FYPA 4MJXA 1TRKA 3BWCA 1DARA 2C77A 4I5IA 1FFDA 3KLOA 4IV5A 4HYEA 2I1WA 2PRYA 3QUTA 5EP4A 3O38A 4HRVA 4QWMA 1DUSA 2I29A 4UBNA 1P29A 4ALNA 1CZUA 2QRVB 3TNJA 2YDYA 3FCOA 5BYKA 4E5NA 1FJHA 3E9CA 4XIYA 4YRDA 5K51A 3QITA 3J7TA 4KPYA 5LSAA 1RNLA 4C6HA 3ZE8A 3O1JC 3FOFC 2DE0X 2ZWIA 4D43A 4DV7B 1N8KA 3BWDD 3OJOA 4ZRDA 1ZAYA 4BBPA 5K4AA 1RHRA 4N03A 4D81A 4Z6KA 5LJIA 1DKRA 4HH1A 3LYAA 1QDUA 3KT6A 3FUTA 4MARA 4KDEA 1NTOA 3HKDA 4J1SA 3DOUA 1DAPA 3PNQA 2W2MA 1NJ8A 5T4FA 3LD9A 3HXMA 4D3SA 3U26A 3R4VA 4FDVA 5KWEA 4RAQA 2GHIA 1M9NA 3V8QA 3ND8A 4L0CA 4MP3A 2HJHA 5CVEA 3ZY5A 3U61B 1NMEA 4OKSA 3ITEA 1NWHA 4JEMA 2XNCA 4NBRA 3HO1A 1PR3A 1QIHA 1THZA 1YOVB 2X0IA 1A9SA 4KREA 1HFEL 1ORVA 1IU9A 4L28A 2EFJA 4J9VA 1UDAA 1J0CA 2P5YA 4I1OA 4BLOA 2FN4A 4B32A 5DNYB 3FPAA 3KSUA 1IB0A 3DWEX 2OUIA 2VZ9A 1TRHA 2RGBA 1D6NA 2O3RA 3P2EA 1CPYA 2JH8A 4X6LA 4CKWB 3BDIA 2F6RA 3HDTA 4L9WA 4KO3S 5T64A 3ZWQA 4NCXA 1Y6RA 1QGED 1GEEA 4D1YA 1ZYUA 3GEIA 2J1LA 5ALNA 1RLJA 3N8DA 1KDZA 1DFIA 1SB8A 3DM5A 1MT3A 1GGFA 4LQDA 3SCZA 1W0JA 3LXMA 4CJXA 3HH8A 2ZCJA 2DQZA 1ABFA 1GDHA 2FRDC 2YHAA 5H02A 2Z9CA 4L0DA 3IAUA 4UNSA 4NNPA 1Y6GA 3SSOA 1JTFA 5H7XA 4A2PA 2B1RA 3M4ZA 4MB2A 1HMYA 1E3DA 2RMKA 3R77A 1H5NA 3GNQA 4MV8A 1OREA 2PWYA 3FTEA 1GKIA 1HDCA 2BHNA 4WPGA 3V9PA 4F56A 4AX8A 1IBRA 2EW8A 3K94A 3TFQA 4BTLA 5BP7A 1UKYA 3O2QB 4C4YA 2CL5A 4RU1A 4DUYB 4WZ6A 1RI1A 1T36A 2WJJA 1GITA 3F6RA 2WD7B 5AK6A 1IUKA 3MD9A 4E7OA 1RYNA 2IEDA 2Y2UA 1U28C 2VH5R 3ILSA 3I05A 3LSYA 2IOQA 3OOHA 1Y8RB 3OZXA 3PGJA 5IVDA 3VDMA 1OCEA 1ODFA 3QRWA 3HTXA 4AP5A 1LLUA 3AG6A 2ZJ5A 3T8YA 1MDBA 5BN4B 1NNLA 2Q29A 1M0EA 4BGDA 1OXUA 1RADA 4M7OA 3ZDZB 1U2EA 2FHPA 3UMYA 2QRKA 3NBZC 1Z2NX 2BV3A 2W2LA 2ZE6A 3KFXA 3WNZA 5CBPA 2VDWB 1V2GA 2Q4TA 2OXEA 5DBGA 5JE8A 2HUPA 1P7YA 3M0EA 5JTUA 3K35A 2D7JA 3OOYA 4INAA 3PP8A 5IU6A 1D4AA 1NJ5A 2Z2IA 4I3GA 1Z74A 2C9MA 4LWZA 4Z3DA 2EJWA 4KFRA 4DUGD 5JBQA 3DZ8A