3HCDA

Crystal structure of hpnmt in complex with noradrenaline and adohcy
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
publication title Molecular recognition of physiological substrate noradrenaline by the adrenaline-synthesizing enzyme PNMT and factors influencing its methyltransferase activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3hcdA00
4XUEA 3P9KA 3EVEA 2YXLA 3KPYA 1Z3CA 2JHAA 3FYDA 5EKUA 5LQCA 1XVAA 1NW3A 3EVAA 3PTAA 1YFLA 4GOND 3M4XA 2EJTA 3LX6A 1R00A 2BM9A 3DH0A 3KR1A 1NV9A 4IV0A 2ONZA 3FUTA 2YQZA 3HP7A 2ADMA 1G55A 2UYOA 3B5IA 2IGTA 4HGYA 1SG9A 2EX4A 3QOXA 5E9JA 3TRKA 4ISCA 2HV9A 10MHA 5BP7A 4E2ZA 4FT2A 3ELYA 4X41A 1EAMA 3HCAA 3LECA 3LL7A 3HCCA 1MHTA 1INLA 1UWVA 3BWCA 4C03A 2IIPA 2OKCA 1WXWA 5BXYA 1FPQA 3I9FA 4X1OA 3OE5A 4U7PB 3GWZA 5EC8A 2AN3A 3BXOA 3PFGA 3R0QA 4FR0A 5CVVA 3UJDA 4NECA 2NXNA 5HEKA 3FTCA 5DWQA 2IBTA 3CKKA 4IKPA 4H0NA 1RJFA 4QPPA 4EVIA 4YV2A 4RVHA 3IYLW 4R6XA 2FHPA 4OQEA 2G71A 1KIAA 2PBFA 2P3QA 4F84A 4ER6A 2ZBQA 3SGLA 3FUWA 4PYQA 3G5LA 4QDKA 3K6RA 3LKDA 2NXJA 5M5BA 3R3HA 1WG8A 3NWEA 2P8JA 4KDCA 1TW2A 4DA4A 2ORED 3PS9A 3LGAA 3KQSA 3FPFA 5K0GA 1Q0TA 2K4MA 4ER7A 1QZZA 3D2LA 2EG5A 3DR5A 4YMHA 3GRRA 4PYIA 2FK8A 5DPMA 2ZIGA 4QTUB 2AOUA 4GF5A 3BKXA 1M0EA 4LECA 2YR0A 5HIKA 2PKWA 3DMGA 3JWGA 3VYWA 4DQ0A 3HVKA 2PT6A 4QPNA 2ERCA 2JH8A 1D2GA 4M36A 2PV0A 4C04A 1G8AA 3V97A 3UZUA 3R9XB 4RTLA 3R24A 2Z6UA 3GIWA 3Q87B 4C06A 4QTTB 4HRAA 5LQUA 3KR2A 1Y8CA 3FPGA 3P97A 1L3BA 1P1BA 1B42A 2PJDA 4XUCA 5HZMA 5CVJA 3DUWA 3E8SA 4AZVA 4RTRA 1L1EA 3JWIA 3CCFA 5LQAA 5EPEA 2UYCA 3PB3A 1JTEA 2P35A 1XDSA 2G8NA 2GS9A 2PWPA 2AOTB 2VDVE 3M6UA 4HC4A 1OR8A 3ME5A 4OQDA 5LQRA 2QRVB 5KQRA 3DMFA 3KPVA 4PYMA 3AJDA 3MCTA 3A25A 3HVJA 4U7TB 3HCFA 5U4XA 4DF3A 2KW5A 3UJ7A 2AOTA 2GA9A 3NDIA 5F2OA 2CMGA 4L7VA 2G72A 4RVFA 2NYUA 3CGGA 3EGEA 5T67A 1G8SA 3BWMA 3T7RA 3UJCA 2PSSA 1RJDA 2IH2A 2P3OA 3A7EA 4O29A 5HIJA 3NMUF 3GNLA 2PX8A 2AOXA 3I53A 5DT2A 2EJUA 4ATNA 4AZSA 1ZQ9A 1ORHA 1BOOA 1IXKA 3EVDA 5E9QA 2V7EA 3CJRA 3DP7A 2JHCA 4CKBA 4PYJA 1N7JA 5EMKA 3LCVB 3KKZA 5H02A 3TKAA 1WY7A 4BY9E 2YUIA 2O07A 4FSXA 3GRVA 5P8WA 2OO3A 4GBED 3ER9A 3GJYA 2OZVA 5EVJA 4AZTA 2AN5A 3HM2A 4HSGA 3HVHA 5ERGB 3CJQA 3MTIA 2XVAA 4RYLA 3FTDA 1XTPA 2HMYB 3MGGA 4AX8A 3KQYA 1SKMA 1FP2A 4P7JA 1DCTA 2GB4A 3CBGA 1SUIA 3DLIA 3OFJA 5DXJA 1VIDA 2FYTA 2IP2A 4MQ4A 5DTQA 5EOVA 5GP1A 4C4AA 2FRXA 3SMQA 3GRUA 3FPJA 2PT9A 4RX1A 4DCGA 3NTVA 5EMMA 2I6GA 5FTWA 2YTZA 1NW6A 4PCAA 5GWXA 4DKJA 2NP6A 4KIFA 5F2NA 3OE4A 3KPJA 3BGIA 3BZBA 1D2HA 1UFKA 3G7UA 1EJ6A 1RJGA 1X1BA 5EIFA 5F2KA 2VP3A 4OX9Y 4R6WA 4K6MA 1KYZA 1XCJA 2GLUA 3KQPA 3KR0A 4M37A 4FT4A 3V8VA 2G1PA 3LSTA 2BZGA 1NBHA 3G2PA 3ER8A 4BP1A 3THSA 5DM0A 3HCBA 5FHRA 3JWJA 4EMSA 1JG4A 4YUYA 5K05A 2BM8A 2VDWA 4QQKA 3TOSA 2WA2A 3P2KA 1NW7A 3FPEA 5JR3A 4GQBA 2CKDA 3T7SA 5K03A 3LDUA 2HNKA 4RSRA 5CVDA 2AZTA 5EMJA 3UA4A 1VQ1A 4AZWA 3KQWA 1AV6A 1NW8A 2XYRA 5EHIA 1RI4A 4PYKA 3DLCA 3TR6A 3EVGA 3M6WA 3KU1A 5FADA 2IH4A 3BWYA 3X0DA 3TM5A 2ZCJA 3TFWA 2E5WA 2P41A 4CKCA 3TKYA 2HR1A 3KQOA 1X1CA 3MAGA 5DLYA 5E2AA 3VC1A 2LD4A 3DXZA 3BT7A 3TM4A 1RJEA 1PRYA 5D1NA 3E23A 3MB5A 1M6EX 3ANXA 3FUXA 3HNRA 3OZRA 1QAOA 1F38A 1HNNA 5DTMA 5ICGA 1G38A 3PLAE 2OBFA 4A6DA 5GIOE 1AQJA 3I5UA 4QVGA 5T64A 3THRA 5DSTA 1D2CA 3KHKA 4RWZA 1L9KA 1N2XA 1F3LA 2B25A 2P1DA 5HIMA 3E7PA 2ZVJA 1DUSA 2YXDA 3SX0A 3NVMB 2B2CA 3PVCA 1QANA 2ESRA 1X1AA 3UJBA 4BLVA 3LKZA 1P39A 1U2ZA 3LCCA 4E31A 5K0EA 3P9NA 3HA3A 1O54A 1YUBA 2F8LA 2H11A 5CUQA 3SSNA 3SVZA 4RTNA 5DSXA 3P9CA 1NKVA 3C0KA 3EEOA 2XVMA 1R6AA 3UJ6A 4PYLA 3P71T 2AN4A 5MHTA 4R8SA 3TMAA 1XDUA 2BH2A 3HTXA 4PWYA 3JWHA 4P58A 1EIZA 1JSZA 4PIMA 5C9ZA 1XXLA 2PWYA 3B3GA 4QDJA 5FCDA 5E9WA 3UJ8A 4E2XA 5EEHA 5DX1A 4E2WA 7MHTA 2GH1A 1BHJA 4A6EA 2JHPA 1KXZA 2WK1A 1NT2A 4R05A 2O05A 3EVBA 4OA8A 3AXSA 4E30A 1MJFA 3LPMA 4OBXA 3C6MA 4DZRA 2AS0A 5EEGA 5FWDA 3O7WA 1WZNA 4PGHA 3KQMA 3CC8A 5ICFA 2CL5A 1UIRA 3SXJA 3WSTA 3GRZA 1TPYA 3OU2A 4F85A 3B89A 3BKWA 4C05A 5KQSA 1O9HA 3MERA 3RIEA 4YUWA 2C7PA 1KHHA 5G02A 1NV8A 2QYOA 5FULA 2B78A 3HVIA 4FS8A 5FWAA 4KDRA 2QRVA 1XCLA 3SSMA 5GIPE 5DX8A 3KR9A 3TLJA 2IDKA 1JQEA 5LSAA 4MIKA 2PX4A 2IPXA 4IV8A 5E1OA 4WVLA 4C07A 4E32A 3G8BA 2IFTA 4FZVA 1QAMA 4ZTBA 2YX1A 3C3PA 3G2MA 2I7CA 3GO4A 3FTEA 4E33A 1R8YA 1O9GA 4YUZA 2C7QA 4Y30A 3A4TA 2GPYA 2FK7A 3NVKI 5LQJA 2HTEA 1I1NA 2VZ9A 5FA5A 1EQAA 5FQOA 3MCZA 4PCLA 5E8JA 1FP1D 2R3SA 3OZSA 2IH5A 3LHDA 2Y1XA 2P3LA 3OFKA 1G6Q1 1SQGA 3T0IA 4JXJA 4Y2HA 1KYWA 3PX2A 1RI1A 4YV0A 5HOQA 1M6YA 5ICEA 4RTMA 3RODA 1P91A 1T43A 4AUKA 4CWAA 2ZBRA 3GU3A 1XDZA 3B7PA 4BP3A 4YV1A 4HTFB 1PJZA 4KRGA 5FHQA 4YUVA 1X1DA 3EVCA 1JG3A 2NP7A 2ZWAA 5E1DA 3R6TA 2PX2A 2I62A 4KVZA 3HA5A 3KPUA 5E8RA 4E70A 2XYQA 2Z6AA 2Z6QA 3OZTA 5GM1A 2ZIEA 1SVUA 3AWIA 3B3JA 1ZG3A 3UJAA 5FQNA 5LR6A 2C7OA 3FRIA 2JG3A 3G5TA 2ZTHA 2Q41A 5KYGA 4CTKA 2O57A 4XUDA 3GCZA 3MHTA 2R6ZA 3KQTA 4RTJA 1VL5A 3EGVA 2QE6A 3BWBA 4V0RA 5CM2Z 3QOWA 4X61A 3K0BA 1IY9A 1QYRA 3BUSA 2ZWVA 2WA1A 1JR4A 5BW4A 2QY6A 4ER0A 2PGXA 1ORIA 2ZZKA 2ZFUA 5FUBA 3SSOA 3FYCA 3NDJA 4M7RA 4CKEA 5CCBA 3DOUA 3MTEA 1ZKDA 2GAFA 5EHGA 1DL5A 1JG1A 4C08A 1YZ3A 5C1IA 3FUVA 5BW5A 4CTJA 5GINE 5DRTA 1I4WA 5LQNA 2I9KA 5K0LA 1X19A 5B1SA 5EGSA 2UYHA 1NE2A 3QV2A 3EVZA 5E1MA 1EJ0A 1JQ3A 1V39A 2OPBA 3NJRA 2OXTA 2OYRA 4GOMD 1FBNA 3KPWA 4EKIA 3VC2A 3S68A 2ZSUA 3M70A 4P7KA 1EG2A 4RTKA 1SQFA 3EPPA 4PGGA 4BLUA 2QM3A 2AVDA 2IDJA 3EMBA 3P8ZA 2V74B 2H00A 2BR3A 1I9GA 3G89A 4KIGA 1VP3A 3OU6A 5CVEA 2O0LA 2PLWA 5K0BA 2AVNA 1G60A 3AY0A 4FGZA 1SUSA 4XCXA 5IH3A 5CVUA 3G8AA 3OCJA 5HILA 4BLWA 3GXOA 5DRYA 4DM3A 4ER5A 4MHTA 3LDFA 5K0NA 3TPZA 4E2YA 4ER3A 4P7FA 3DTNA 4RTSA 4YMGA 2AOWA 3UJ9A 5EZQA 2G70A 1BKYA 3BGDA 2AOVA 3I58A 3OU7A 1KPHA 5EIWA 3KQQA 2ZLBA 3G2OA 3O4FA 4PINA 4RTPA 3P2IA 4P7GA 3EEYA 4PYOA 3ERCA 4GOOD 5E2BA 2YVLA 2VS1A 5CD1A 4RTQA 1KPIA 2PY6A 4FP9A 5K09A 4GOLD 3SR4A 4Z2YA 3UFBA 5DM1A 5EMLA 3G88A 5EG5A 3A7DA 3LBFA 5DM4A 3EGIA 3HCDA 5LQKA 2AR0A 1QAQA 3GDHA 2P40A 1ZGAA 3DMHA 3RW9A 5FA8A 5T6BA 3MQ2A 2N47A 5IKMA 1P1CA 2OB2A 4MWZA 5CIYA 1JQDA 1VPTA 4RVGA 3NW9A 2AOUB 5HFJA 2C7RA 3ELWA 2XBMA 1VBFA 1YF3A 4GUAA 3FRHA 5GOZA 4UOEA 5KS2A 1IM8A 1KPGA 5JUWA 3F4KA 2ZBPA 5E1BA 2PVCA 3O31A 8MHTA 3CVOA 1AQIA 2EFJA 2H1RA 2FCAA 4MTLA 4HH4A 4OA5A 2CMHA 3ELDA 4M38A 1AF7A 3UA3A 4CXMA 4LWPA 1VLMA 1WXXA 3P9IA 1R74A 3C3YA 3M33A 2ZULA 3DULA 5HIIA 4FSDA 4DCMA 3E05A 3PT9A 3DXYA 5K0FA 3H2BA 2BR4A 3CJTA 3G2QA 3KQVA 4HG2A 1JTFA 2B9EA 2ONYA 3IHTA 3LBYA 1ZHFA 2PXXA 3M6VA 2NXEA 3UWPA 1YFJA 3Q7EA 4GC9A 4EQZA 2ZZNA 2NNWB 4B17A 2ZW9A 5GM2A 2A14A 2PX5A 4HGZA 5KVAA 2YXEA 3EMDA 2B3TA 5EZSA 1N7IA 2DPMA 3C6KA 2PXAA 5K0JA 3REOA 1Q0SA 3OPNA 3P2EA 3U81A 2BR5A 5K01A 2P7IA 2VDUE 2ZIFA 3EVFA 3ORHA 4PYNA 3VSEA 3BGVA 1VE3A 4LG1A 4RVDA 3UBTA 1RI2A 3GGDA 4RTOA 1R18A 4PNEA 5CCXA 2JJQA 3ELUA 4QVKA 1KR5A 4R8RA 4WXHA 4EKGA 4POOA 1H1DA 3FTFA 1NBIA 1JSXA 3HEMA 3I64A 5DTRA 2P7HA 4KWCA 3FZGA 3IEIA 2O06A 1L3IA 1VP9A 3PFHA 4RV9A 3LDGA 4PONA 1WS6A 4HTFA 1BC5A 3TQSA 4EK9A 1ZGJA 5EQJB 4GC5A 2PXCA 4X60A 1L3CA 1XJ5A 1YB2A 2Y1WA 5DX0A 1RI3A 3AXTA 3SM3A 3M6XA 2UYQA 3FUUA 5C0OE 4YUXA 4LWOA 3GRYA 2XYVA 4G56A 2OY0A 3A26A 4F86A 2DULA 3IV6A 1HMYA 3DXXA 2IBSA 3L8DA 3ID6C 1TW3A 2CWWA 2OB1A 5K8VA 3A27A 3HA7A 2HWKA 4X63A 3NWBA 1RI5A 1JG2A 1KP9A 5ICCA 5DM2A 9MHTA 1R8XA 1FJXA 1NW5A 3LCUA 4KW7A 4QQNA 4IWNA 2JH9A 3FPHA 3B3FA 3PX3A 4V0QA 2UZ4A 4OBWA 5DXAA 4DMGA 5K0CA 1YZHA 2FPOA 2ZZMA 2NXCA 4GEKA 4PIPA 5D1HA 3T7TA 5EKXA 3HCEA
chains in the Genus database with same CATH superfamily
5IEBA 3S2EA 4MUIA 3RFCA 3V80A 4JJ6A 4KQMA 4DJ5X 3IAUA 1A8PA 3M5PA 1XVAA 4LJAA 4MS3B 2NU9B 4C0KA 1XPJA 4GVXA 3ND6A 1BZYA 5TMBA 3RRJA 4C6TA 4CMKA 1H8EA 2H4HA 2AEJA 3SKXA 5C18A 1EP2B 3C7CB 4J3NA 3WLLA 1FDIA 1YB6A 2HUNA 2ZUVA 3QWHA 1DOHA 2ZJ3A 4M0CA 1W29A 3PJDA 1HYHA 4EEXA 5HA5A 1JECA 3JASA 1X87A 4PY2A 3VX4A 2XMBA 3E4DA 3IAHA 3QLUC 1JR3D 4LYYA 4Y9SA 3L0IB 4KMSA 2UU9B 2J9GA 1ZOOA 2JIPA 3LECA 4QLAA 5ALTA 3LQFA 4BRSA 4YMVA 6GPBA 1RM4A 2P5SA 1RWMA 1NMXA 1GNTA 1J2YA 4NENB 4NPCA 4QEZA 2R11A 4PN3A 1KR2A 2ZBDA 3O92A 3DOFA 1NAIA 4RY2A 2BGNA 4LX0A 3EWNA 2IHBA 2N42A 3EXEB 3HH8A 3KOOA 4XUGB 3IT1A 1HTTA 3IQZA 1NBAA 3E48A 2P3QA 1FW8A 1AIPA 3BF8A 4CV0A 3WADA 3PDCA 4XVQA 4LISA 1PR3A 1FFYA 5M5BA 4KQXA 2V3VA 1WVGA 4B71A 5A4IS 3UXHA 2C9DA 3K3PA 4UNQA 1NKTA 4BMPB 4C3OB 5HVNA 2WAXA 4DR2B 3QTLA 5CITA 3TBFA 2QBYB 4Z9XA 3QEMA 4BEBA 5FWXA 1WXDA 3LK7A 4LK3A 2ZI4A 4G1EB 1JHYA 3FI0A 2YR0A 3CEJA 1P9WA 2BEUA 2PRJA 3GNSA 4O4LB 4WLOA 1RQRA 4Z9BA 4X44A 3RRBA 3WL4A 5F7OA 2J46A 5KQLA 3WFJA 1A5AB 1J49A 3L7OA 4FKZA 1KJ8A 3PR3A 2G28A 4BQFA 4PTYA 1T6NA 4ESOA 1FBTA 3BL8A 3Q2IA 1I7NA 1LLFA 1ZRMA 1XU7A 1BS1A 1V25A 4GZLA 4U2BA 4AJPA 1E5XA 4C06A 2C9CA 2DFLA 1ZIPA 2OTCA 4Z49A 3LAWA 2G04A 2HJRA 2PT5A 3CRNA 1M7GA 4XUCA 3L0SA 1BFDA 4HQRA 4ZOLB 2ZBGA 4EOGA 2JLYA 4J8PA 1TQ2A 3K8OE 3KHSA 2WR8A 4GPBA 1NXVA 1A76A 1RW4A 2HA4A 5GJBA 3BIWA 1PNOA 4XVHA 5LQRA 1BS9A 2QRPA 3NX4A 3WJ1A 1RRKA 1ZOIA 4ZFNA 3FNHA 1OLXA 4WL0A 1RQLA 1CP2A 1JDVA 2WIFA 4UEJA 3SS9X 2HMSA 3ZBUA 1E1CB 4K6CA 4FWBA 2XKKA 2BEJA 4BWVA 5BNZA 2I1VB 1M1YB 2KLBA 1NZJA 1ZSVA 4IIJB 4L50A 2BELA 4JI8B 4ZICA 3VUEA 1XA3A 2F3UA 1OROA 1L5GB 4JHXA 4YDQA 4EW2A 1R4MA 1U65A 2H57A 2DWOA 3OY2A 3PFNA 5G0TA 3ZLJA 3ADDA 1EGAA 1A5ZA 3KKZA 3TL6A 1HNWB 1HV8A 4FMPA 3IIMA 4BY9E 2Q6TA 3FNQA 4AO7A 1DKRA 1VYUA 3HLTA 4GBED 2F9LA 2OZVA 3TQQA 1QHHA 4CLEA 4S12A 4JUAA 4GOKA 4H16A 3GN2A 3OC0A 3Q9LA 3FTDA 1ZFNA 2FZLA 4HVTA 1XTPA 3KJQA 4JSTA 5DW3A 1ZW6A 2X0RA 2G9UA 3IH5A 4OHVA 4AX8A 4BPRA 2RK3A 1STOA 3ABZA 4IGKA 4L8VA 3ILSA 3ZE0B 5HUJA 1OCEA 5K8IA 2X4IA 4MQ4A 3LY8A 4XWYA 4Y0NA 1GTSA 4BLOA 4CN9A 3VR5A 3LUKA 4MLZA 4LGYA 4TQUS 1ZK2A 4H0FA 1IOVA 3NTVA 3AF4A 1FL9A 4OF4A 4CQMA 3DD1A 5A5FA 2FSFA 4JODA 1TJNA 1RRGA 2X0JA 4ID9A 4P4SB 1UOQA 3LFTA 3S2YA 4N7BA 2V8BA 3MS2A 1L5LA 3GRFA 1SPBS 4KBGA 4WTOA 4RJIA 4BV8A 2JCVA 1TKCA 3NRJA 2FSVC 2QLNA 5BN3A 2V7PA 1JG4A 2IV7A 3F6BX 3P2KA 4NFYA 4TTTS 3L4KA 2D0PB 2G17A 2OAQ1 2Q62A 3N2ZB 3C3DA 4WBNA 2HEIA 2D2VA 1G2IA 1KJNA 3BZWA 4UHJA 1BHSA 3BF7A 1NW8A 4F9GA 2VK4A 1PWXA 2H92A 3F3YA 1D1PA 1QDLB 1SQ5A 3QY9A 4X91A 3TR6A 3TZCA 2I3GA 1I3NA 2JI6A 1NYRA 4WDRA 2ZCJA 1KP2A 1J5PA 2IYAA 3GD5A 3HU2A 1KYVA 3EG9A 4HUTA 3DXZA 4BX0A 3H5VA 3T06B 3BHNA 2HRQA 1XA4A 1U4SA 2R1ZA 5L6LB 4E5UA 3JR7A 4DGQA 1YAJA 2E21A 4O25A 3RTBA 3WWEA 1SC9A 2I4MA 1HDIA 4B81A 1JMKC 1A9YA 1QQ5A 1WABA 2FEMA 2HFKA 5JLAA 5IRCD 4WUTA 2BSQA 1MZVA 2ACVA 2XJ9A 1A9ZA 4H15A 4KFTA 4D99A 3I9MA 3EPJA 3EA4A 4G86A 4MQFA 4UBJA 1F2VA 1RVV1 2ZSEA 1RPTA 3NTRA 3NOQA 4C76A 2JFFA 2O5VA 2VSYA 3V7NA 3CRW1 4JBWA 4F1WA 3OF3A 3PG5A 4KPUA 1J33A 1U8CB 5EE3A 1DRUA 1ZD5A 5D5QA 3LUCA 3EZ7A 3AHCA 7AT1A 2Q5IA 3QVUA 1DPFA 4WGFA 4DUGA 4DB4A 5IEJA 3B1KA 2EJVA 4G23A 3HPQA 4JCOA 4LZZA 4HGRA 4N4AA 5DT9A 5C8XA 4R2JA 4HNUA 2JA2A 3H3FA 2ZJ8A 1LDMA 4J6FA 3ZNNA 2O8CA 4AX4A 3LLSA 2WUEA 2O0KA 1Y63A 3L8FA 4GX2A 3J7TA 1QE0A 3AF2A 4YO7A 4L15A 1VMAA 1LDYA 4IDHA 5KWIA 3INTA 2P2YA 3SJUA 4EG3A 1JIKA 2WPDA 2HM7A 4R05A 2O2CA 1PWZA 2GI4A 3I72A 3KT3A 1WUJS 3BSWA 3PNBA 4K87A 3RBXA 4E30A 1VMKA 4GP6A 2POCA 1RM3A 1GOTA 2DT5A 2QVZX 4LOKA 4FS3A 4MYDA 5EEGA 4C88A 1F8UA 1N6PA 1ZI6A 2XYGA 2C2YA 4JLAA 5GV8A 2Q4TA 4PAOA 1PHRA 2C84A 2P9JA 3NUQA 2O14A 3D6AA 3U44A 1KJIA 4AULA 3DMTA 4X1KB 5H80A 2RONA 1HXHA 2QM8A 3GRZA 3S55A 5KJ6A 4C21A 3V8EA 3TD6A 5KQSA 3N3AC 2CXRA 3AOGA 1E1QA 4JQSA 2OV1A 3AIOA 4FR5A 4PLGA 4HH3C 4U63A 4UOQA 4KDRA 5HZGA 2VDQB 3PDUA 5ITZA 1A9PA 3BFKA 2WICA 3FX2A 1AZWA 4NNPA 1R0XA 4O5OA 3G02A 2C2GA 1E94E 1L1RA 1RYMA 1V2HE 2BI7A 4EPRA 1DAHA 1JXMA 3NRCA 3ZGOA 2X8JA 4J2HA 1CJBA 1XJWA 5I45A 3ONDA 4W7HA 3E1KA 3AHJA 4BO6A 4UHEA 5BWMA 3EIOA 4CBVA 5CDFE 3INRA 4JKYA 4Q01A 3OT1B 1F9EA 5EI5A 2PUFA 4DNFA 1ICIA 1O0SA 4UEOA 4AXXA 2HPAA 3KTAB 5FA5A 2CLMB 4LE0A 1SCDA 1FP1D 2QRKA 2R3SA 4JFRA 4GRIA 1R7RA 5CH8A 5BOSA 1XT6A 1G6Q1 1RDFA 3DS8A 4KEAA 4JXJA 5AKXA 3U7EB 1C9MA 2D5CA 5F21A 1S8AA 2PZLA 4UUPA 5ESRA 3SQMA 1I7SB 1OWOA 3T0FA 3ILXA 4Z9AA 3TTSA 3GU3A 1FEZA 1EUDA 4BP3A 4F4CA 3H9BA 4I3FA 4PSVA 4XJSA 1Z4NA 4N0MA 2R0QC 1ENPA 3GC6A 1GLNA 4PS0A 2I62A 5FR1A 3BTSA 3RLFA 3VPAA 5CDTA 2E6KA 5LP6F 2GUWA 3OMXA 2JGKA 3J81A 4N7JA 1JIJA 2ZYRA 2DFPA 3BAZA 3OBIA 4FJ1A 4OXRA 3CW8X 1YDHA 1N6KA 1SVIA 3OKPA 2Q3LA 4XEHA 5KTKA 5LR6A 1EINA 4TV9F 1ONOA 3E2PA 5KCMA 3HXPA 2AL7A 1DJOA 2F1OA 1X2EA 1I9CA 2R6ZA 2Y9MB 4DM4A 4RTJA 4R01A 4J7CA 2DFDA 4BNLA 3QOWA 2GVDC 3R0IA 4LFAB 3DT8A 3IKJA 3K0BA 3O3NB 5DCLA 4Q7JB 1SU6A 3D3WA 2CVPA 5MN4A 1DXOA 5B1IA 1COZA 3TEFA 2ZZKA 3B1ZA 4F04A 4E11A 5JCXA 1NN5A 4KN6A 1Z34A 1JDTA 2W00A 3DOUA 4PC7A 2V1UA 2DBYA 3BJEA 3GMTA 2AUTA 3C3CA 3ER6A 4NR0A 3TNJA 1CRZA 4LZPA 4Q19A 4UKDA 3RSHA 1GSOA 1FZQA 4G0MA 5JAPA 2FPGB 4IJUA 5DRTA 2PO5A 2M2IA 4PZ9A 4Q9IA 4BMOB 2HHLA 3EVNA 5KYWB 2WJ3A 3ZCQA 1QO0A 2V58A 5BQPA 4QZVA 8OHMA 5JCZA 1UANA 5CCDA 3L4JA 2HCFA 3SZRA 3QELA 4ME6A 4JLBA 2IZ1A 4FBLA 4UQPA 5DW0A 1CR0A 1I9GA 1L5FA 2ILTA 1I3KA 2C3UA 3A6DA 3PENA 3U3ZA 5K0BA 3LRPA 3ZHCA 2IIBA 3ZHSA 4EY4A 2EFDB 1G5RA 1KWGA 1AU9A 3G8AA 5KHLB 3EFOA 4MHTA 2CLIB 3LDFA 1M34B 4NTZA 4ER3A 4CEHB 1X77A 2JGMA 2A0FA 1CF2O 2ZB7A 4NHOA 3UUGA 5L95A 4D0RA 3RTDA 4MRVA 4TN1A 2JVJA 4D3XA 4ZTUB 4FGSA 2ZVPX 4RJTA 3BQ9A 3BM5A 4N6GA 4E4RA 2NZYA 3O4FA 2BFCB 3GFGA 1E6EA 2II6A 3OCVA 4LYFA 1ZJWA 2Q4OA 1CIPA 2WM3A 3E5MA 3CZRA 3SVTA 2AG8A 2AZMA 1Z0SA 3QVGA 3ZUPA 4Q34A 4YHHB 3MT8A 3LBFA 3ZJVA 3EGIA 3MEQA 2IPLA 3K31A 3AR9A 5LDGA 3ESXA 1HEIA 4JBLA 3TF5A 4KR9A 4TT3A 2IP4A 1N8NA 1ZL0A 2ZDQA 5IKMA 1NVUQ 1NVMB 2DG2A 3WB1A 1JEEA 1KAOA 1M66A 2C9YA 2BFWA 2OBNA 4P4NA 2GJAA 4RO0A 5A02A 2NSDA 5LUBA 2Q1UA 4M99A 4OIMA 5DASA 2QE7D 1KEUA 3LUBA 1F17A 1ONSA 3UPDA 3VR6H 2XWBF 5H4GA 4EJSC 2V0GA 3PGA1 5WRFA 1ISFA 3RI3A 2ZYWX 3DCNA 3REFA 5ENVA 4TKVA 3EXIA 4REOA 4DV5B 5DHQA 4LGVA 1USWA 4U7FA 4RHFA 3TFQA 3S8EA 4C1BA 1IHUA 1SXJD 1ESCA 3OE1A 3OOEA 2X0EA 1LLCA 2FUKA 3EEIA 1O6FA 4JB3A 3WFZA 2BSXA 4DTCA 2AR9A 3ZQJA 1DADA 2DHQA 2J7PA 4G0XA 1WSDA 1L8LA 4OXYA 4W9RA 1UMKA 3FCYA 4BNZA 2GCEA 2Q0HA 1M2NA 3KD3A 4WV3A 3VJLA 2ZWIA 2JEOA 1J9ZA 2IUTA 4LHEA 4S1OA 3OQIA 3JQPA 1HYBA 4B7ZA 4JY7A 4KIJA 1BJRE 1I0IA 1NVEA 3D6JA 5JD5A 3UCEA 1U3TA 5KX5A 4M3NA 2J6CA 4S2EA 5HQJA 4ESVA 3SVLA 3DKVA 4R9UC 3WGJA 1BXRB 2OBBA 4ALKA 1M2HA 2CF5A 3UMBA 1CY2A 5K7SA 1WDTA 2QG9A 3UEOA 4CKWB 3ACDA 3GLHA 1I7DA 3UUFA 5BQOA 4IBOA 1XLUA 2O7NA 3GCGA 3QBJA 4JKOA 3Q7QA 4NSNA 2P7HA 1N3BA 2GRJA 2UZAA 5J43A 4KQ6A 3PFHA 1PLJA 4BPBA 1E96A 1EXNA 2QTMA 3TQSA 1LBHA 1RYZA 3FROA 2DT8A 4ZIRB 2VA8A 5C8DA 4BVEA 1GNLA 4ZO6A 2CHQA 2HJWA 2NZUG 2OSBA 4JI0B 2QN1A 4CF6A 1PCXA 3REGA 1VHDA 2CD7A 4HDSA 5GQSA 1ZGHA 2WJ6A 2C1EA 3VR4A 4ETNA 3PTZA 1V5GA 3FUUA 1JMVA 1OYOA 3OLYA 4C0XA 1NR5A 3OLWA 3NQ41 2XYVA 2V03A 2GBLA 5DULA 2FZ5A 3WY9A 1XXHA 3T9CA 3Q9UA 1ND5A 2H3EA 3L5OA 3QEKA 4V2IA 1E1RD 1CZKA 1T9CA 2FPMA 3KBOA 2HWKA 2NXWA 4YRIA 3O47A 3WMWA 3S29A 5IC5A 1SR8A 1P7CA 3LRXA 4NNJA 4RZIA 3LX8A 4B80A 1KORA 4CUJA 4ETWA 3F3KA 1BDHA 2HGZA 2JH9A 2ZI9A 3KLPX 1V8OA 5DXAA 5REQB 1DIOB 2XITA 4P31A 4HQNA 5CA0B 1ZN7A 4B4KA 1OREA 3ICVA 4GGPA 1NG1A 4KPYA 4B74A 3EVEA 2R87A 1PTKA 2ZGVA 4TLMB 3BMCB 1DCFA 2XWPA 3C41J 4IDNA 3BWVA 1OYWA 4JS0A 3HGTA 4UUNA 4ZVSA 1BW9A 1U0HC 2PZMA 1QYXA 3K5HA 5K2OA 4J0IA 4MWGA 2C95A 4O0LA 3U3DA 2F3PA 1GR0A 4AL4A 3LYLA 2X41A 3EY9A 5BMVF 2AZ4A 1KDRA 1REQA 4BNNA 1T5DX 2CNKA 2WMYA 5DGCA 2HLNA 1SUWA 1HTWA 3AESB 2X8BA 4YIKA 3K1YA 5JVDF 3V4RA 3ZHUA 2O0MA 3K2BA 4NE2A 2XB2A 4QU9A 1NVVR 2J3KA 1HO3A 1UZAA 1LK5A 2A8YA 3ICWA 5AVKA 2ZTSA 2NXNA 2BTQA 2OGZA 4QGHA 3AFOA 4RPGA 1U0SY 1TEXA 1FNMA 1KMQA 1U5AA 3HA2A 4FBMA 3UQYS 3SXUA 5DBHX 3ZCSA 1QR6A 3I9V6 4EHHA 4QKQA 1FDRA 1UBMS 2AFHE 4BC0A 3LLCA 4PAQA 4BNTA 2C3PA 1G5TA 1OQAA 2O7QA 3TJZA 2C94A 4NKRA 2JIOA 3QPWA 3R23A 4QDKA 4DQXA 1PO7A 1G9XA 4PPNA 2FWNA 1XE3A 3PDHA 1W36B 2GO1A 4EGQA 2PRYA 2XRYA 2PEZA 2QXYA 3WYCA 1CX9B 3N2KB 1T9AA 3VNVA 1OHHD 2GZMA 2YZKA 3FCAA 3MWKA 4QD3A 1DV2A 2WM9B 1HK7A 1CUHA 3OT5A 3R75A 1YCDA 2Z3WA 5JAUA 3GOQA 3QBVA 5CX4A 3QU9A 1CWUA 1KE2A 4MS1B 2BHSA 2BFFA 2NAPA 1UJCA 4RA9A 3KYDA 3WL7A 3TSWA 1KH1A 3DZCA 2FNAA 4NXNB 3QBDA 4CHTA 2WU8A 3R40A 3HP4A 4IJVA 1OLSA 1KI7A 2P2SA 5SZKB 1UODA 3A2NA 5B7QA 4FMBB 1GKUB 1LPOA 1EYZA 2AXPA 1JKFA 2QRUA 2YHAA 4UNPA 3VO2A 2QTZA 1HDYA 1FS5A 1AO0A 2C2ZA 1N4AA 3TI9A 2J9ZB 2ADOA 1Z56C 2YWDA 3NP7A 4GDMA 1VLHA 5CK4A 3DWFA 1QH0A 3SLKA 4DBZA 1EP9A 1SCUA 1ODFA 3FOCA 4UNSA 1JTVA 3K1AA 1QIHA 3C24A 4EHFA 1L5VA 2C20A 3UVEA 1CRQA 4BV9A 4GZ5A 5CBPA 4LXHA 1RZVA 3WLJA 3EIQA 4YT4A 1EFPA 1PS0A 5IHPA 2YV4A 3Q0IA 4EGCB 3KJGA 4RVFA 5EL0A 4O4JA 1NVWQ 3BDVA 3CGGA 1M1NA 3F4BA 4WKOA 1PJ4A 4JUFA 4AN1A 3VZPA 4DFDA 2PZGA 2FR8C 2V7UA 2FRDC 3ZLVA 2AT1A 2UKDA 4B3GA 1PJ8A 5TV2A 1TA4A 5C4GB 4ZT7A 1PNQA 4PV7A 1PI3A 2GCGA 2Q2QA 1EBUA 4QBFA 1GQOA 4ZYZA 4I9NA 4LAFA 3TNYA 1IWOA 1V3UA 2H4ZA 3G79A 4HAXA 1A1VA 1VYHA 3H5TA 1XTUA 3BRWA 3FYUB 3KKMA 2Q6KA 3C3MA 1FVOA 1I3OA 3A1DA 3GRPA 1FTSA 4FDVA 3USCS 5TVKA 3VRHA 1P3Y1 1Z5UA 2J3HA 3QMVA 3LPLA 3SHFA 2WIBA 3TSYA 4D8UA 1M2OA 1SBYA 1TYEB 2EKZA 1F12A 2NZVG 2O5RA 3QVXA 3U4IA 4ND6A 5TR9A 3TFWA 3TW6A 2IKSA 4ZYUA 2HR1A 4CIYA 4CEJA 3P0RA 2R4QA 4WLVA 4XSHA 1WZUA 1JIVA 1NN0A 2CKMA 1NW6A 3DDNA 4J0HA 5C5DA 1A9OA 3KYCA 3OJOA 4MPJA 3DV0A 4C2AA 5J2UF 1BYUA 5G4KB 5AW5A 2CLKB 3LJKA 1Q7RA 3V8QA 1SAYA 1UKVY 3LT4A 3MELA 1NBMA 1K3TA 5C5IA 1KK3A 4KK4A 4FI3F 3SF8A 3BICA 3QKSB 1XNHA 5EXSA 3O8DA 1H4SA 3V4ZA 3C4VA 1M5TA 2ZRAA 3FB1A 2B7BA 4NFHA 3ONFA 5JR3A 2CKDA 2NUBA 3T7SA 5DXFA 3T54A 4TSRA 4NMXB 3IXLA 3DEYX 3U39A 3UA4A 2GFHA 2X2EA 1CE8A 3KQWA 4G0UA 4K9LA 4EVRA 1KQFA 4RY0A 5IDYA 4PYKA 2BJHA 2QL6A 1D0SA 1UPAA 4MA4A 4RMJA 1LY1A 3OQVA 2IA5A 2ZTUA 1E61A 1XKXA 2H48A 4MW7A 4NJMA 4Q4HB 1WCWA 2NZJA 4GYYA 3IR7A 1ATZA 5CLGA 2QWXA 1AKEA 4TLEA 1SEPA 1NQOA 5E2AA 3M0EA 1KAQA 3CX3A 5ALUA 4AG6A 3C7KA 1CIVA 1NQ5A 2CBXA 1P1FA 2H29A 3ZV4A 2INGX 3FETA 4MV6A 2W37A 4PANA 4AF8A 1Y9EA 2RGXA 1YBAA 3ONVA 1QV7A 2ZSAA 1A7JA 4DQUA 2J9XB 4NDNE 4NYIQ 4S0ZA 5A6SB 3N2EA 4BO5A 4LF6B 1OFVA 3O21A 2GYWA 3BH7A 1N2XA 3DQZA 1AKRA 4RD3A 5DNEA 1NUHA 1BAPA 5HIMA 4FUTA 1YR3A 4DCJA 3GNQA 2P77A 3DAPA 1KZHA 3PVCA 1QANA 2I1WA 1U0JA 4WCFC 3SX2A 5DF1A 3X44A 4U7WA 4GMXA 4M83A 2COKA 2DSNA 4ZCTA 1MFPA 4F11A 3L1KA 2CNWD 3ASZA 4ZKDA 2I03A 4TVOA 2DBZA 3H97A 4S1NA 2W5UA 4TYWA 1PLLA 4QM7A 3I83A 4IXNA 2PLFA 1TECE 3BWDD 4U7HA 1YGYA 3EZ2A 4NFSA 4ZVVA 3JPWA 2XB4A 2IW1A 4NY1A 5HS6A 3IUEA 3LIPA 1R4NB 2WF6A 4EIWA 5J59A 4ZRNA 4WNIA 3DHEA 3HJHA 5F3DA 3K6SB 2DKOA 3GQBB 3GUHA 3QKTA 3NHBA 2JHPA 4Q48A 4L22A 4RZ2A 3QX7A 1OX4A 4YGYA 4BNMA 1Q1QA 3EVBA 5E6RA 4A8TA 1OI7A 2NT3A 2IDZA 3C6MA 2AS0A 5KOJB 3PE4A 2GOYA 4IVQA 4UNNA 1WB4A 4MVJD 1B1CA 3W8FA 3DDCA 3TR5A 2BP7B 3GAZA 3WLEA 5HRAA 1XCGB 3HKBA 4U0KA 2CL5A 1NMZA 2BCEA 2D5AA 1KARA 2UZ0A 3SXJA 2IEZA 5F3WB 1ENZA 2PKRA 4GLJA 5JSFA 4L2IA 1S4MA 3PZBA 5E0KB 1HBJA 3EZ9A 4HMOA 3Q3VA 5JDCA 1TXGA 3KIPA 1SMKA 5FI1B 2YJ6A 2RG1A 3U4QA 3FNGA 2QYSA 1NJ8A 3TLJA 1TZMA 1X94A 1YA8A 2G3YA 1GGVA 3MAAC 4YAKA 4HAVA 4K0RA 3BERA 1FZTA 8ATCA 5BY2A 4H27A 3IBTA 4RVSA 3BXGA 4X3PA 1QFXA 5EP1A 1UPBA 2RAFA 4OUDA 3UJNA 5KHOC 4FHCA 3ANLA 2FK7A 1OI3A 1NLFA 3P9ZA 3ZWWA 3ROTA 1I1NA 4K03A 1KJWA 1Z36A 2Q8QA 1WPGA 2OL4A 1UIMA 5FBZA 3VAYA 3QTBA 2VHJA 4L0DA 1PT8A 2MSLA 5BWCA 2KBEA 2QVBA 3G59A 3H11A 4DRXA 4H6WA 1QLWA 1RI1A 4IDBA 4DQKA 5BN5A 5G41A 1JB1A 2DQKA 3MYRA 3A4IA 3VPSA 3HJFA 1DFHA 2A9PA 1J39A 1O95A 2F4NA 4ZVOA 1XDZA 2R1VA 1N2JA 4AN4A 5JHHB 3NAMA 1XNJA 4FHFA 4EY3A 2PGOA 1N92A 1OTHA 1USVA 5E1DA 4JYMA 4Y1FA 5CTJA 3EUEA 3HA5A 3KTFA 3U4HA 1RT9A 2DFNA 2G07A 2Q4BA 1T29A 1U2GA 2WHPB 3CBQA 5ITZB 1NQVA 4B87A 2W2LD 3E35A 3BCUA 2GEJA 5IM5A 3GRAA 2C7OA 3T1TA 3L6RA 4BBJA 4ZK2A 3IAEA 1ZN9A 2NPIA 1R27A 4HH0A 4KJXA 4XUDA 4YCBA 1QFYA 3ZXYA 1CYEA 4TMFA 4DVJA 3IE0A 1UK6A 3R3JA 1RM5A 3V5NA 1RJWA 4FDTA 4X61A 1V8BA 3D6MA 3L02A 4LQCA 3PXEA 4JJEA 3WOVA 5ITWA 2AI2A 2W6MA 3ND5A 2BEVA 4ACAA 1ORIA 1VG1A 4CCSA 1Q20A 3DBLB 3FPSA 4ZPXA 5BRJA 3TZLA 3TTUA 2OO5C 3DQQA 2D7JA 3IQFA 5EHGA 3HJTA 5AIBA 2HCJB 3MTQA 4HXFB 1HMPA 5JCJA 1G2OA 1Q92A 2D8AA 2YYYA 3FNBA 3FPCA 4IICA 4BE7B 4V0MA 8AT1A 1EDEA 1XV5A 4L6IA 4NLLA 4PRZA 4U2CA 4HN9A 3GMIA 4YFYA 5AIAA 3SZOA 1QK5A 1DC7A 1EJ0A 2X22A 2R7KA 3NJRA 3D7SA 2ZUDA 3O82A 4GMGA 2GVNA 3R3UA 3BC1A 4OIFA 5H3LA 3ZY6A 1E2BA 1TM4E 3JQ6A 5DK6A 3RIHA 4P0PB 1QHYA 1C7IA 1ZO8A 2B4AA 2XF8A 1ANKA 3KXPA 2L18A 4ENWA 1GZSA 4JFAA 1N2CE 3V2IA 1WOMA 2O0LA 1JJAA 4YRZA 4RJKA 1IG3A 2FX2A 2VF8A 4LOAA 4YAWA 5DMHA 4ESEA 2BISA 4RESA 4EYGA 1JALA 4URZR 1S2MA 3D0OA 1M33A 5AVOA 1IXSB 3AYXB 3IS3A 1HI9A 2EYUA 1TLLA 4RTSA 3Q8MA 2AOWA 1CUIA 2HMVA 3ECCA 3OZFA 4IJQA 4X62B 1NJSA 5JAQA 3OU7A 1T2FA 3OCCA 5HMMA 3G2OA 4MWTA 3T5MA 3SXPA 1N36B 4GKKB 4HGQA 3JQ9C 1DHTA 3GA0A 4XGIA 3U1VA 3V7YA 2VS1A 3AZQA 3RHZA 1XYYA 3GAAA 1GV1A 5CB0A 1J7KA 3K2EA 5H4HA 5A0FA 3V32A 1W2WB 2OD9A 1KSHA 2LXNA 4RMNA 4XYGA 3RT7A 4B3JA 5B4UA 2EZ9A 1A9SA 2VK2A 2WSBA 1E2NA 2CFOA 3AP2A 1G19A 2FMKA 1NP6A 5EFOA 3VU3A 2DR2A 1Z2PX 2HWYA 2LCIA 2REOA 2WQZA 3PIRA 3CEMA 4F06A 4Z4HA 3CT4A 3C6BA 4Q4CA 5ALKA 5JECA 2EP5A 2ZM5A 1JHVA 1CPYA 4RS3A 4K8RB 2RHDA 4GUAA 3PC6A 2XI4A 1GDHA 4QJ3A 3ANSA 2PS1A 5LD2C 2WINI 1X42A 4LF8B 2OQIA 4URVR 1RLTA 4JSYA 4Q9KA 4ZEOA 3VPGA 3HU3A 5HKKA 3OJXA 3OQNA 4ID3A 2ZTVA 3KVNA 3TX6A 2HLDD 4M38A 5DWVA 2PS0A 4PN7A 4Q37A 1TT7A 1H0KA 3DULA 2ZE8A 3E05A 3U6KA 5HCNA 4ZCPA 4TV9B 3DFKA 4HX2A 4ZT3A 2XRFA 4QYIA 4ZRMA 3T1YB 2XZPA 3OEYA 5F7JA 5FTNA 3L1UA 2EZ4A 2Z95A 2B69A 1F14A 3P4UA 4GNRA 4ROSA 1T8WA 2RKOA 4Z7NB 4QM6A 2ZUBA 4RDCA 1KY3A 3RFXA 4B17A 4FPXA 2V0NA 4XB6B 5FJIA 4AO8A 2BMAA 1IBMB 1SHKA 3A6FA 1CUSA 3C6YA 3OMWA 1XAGA 1U99A 4MAAA 2OK8A 4NVRA 3P4XA 1MORA 2I99A 2REBA 2GPJA 2QW8A 4HYYA 4IDDA 5JMPA 3GCXA 1LH0A 3K0KA 4FMCB 4TXMA 4Y3UA 1CR4A 2HSEA 2WD8A 3V00A 1M2KA 2QR3A 2DBRA 3WL5A 1XU9A 2W9XA 1EEHA 1H1DA 4O3FA 3PC4A 4EHJA 2H1FA 1VZ2A 3LHKA 4G5FA 5DTRA 3ETEA 4OHCA 3F78A 4XM2A 4ZXPA 3A3OA 3L1VA 3NEYA 3JQGA 2YH2A 3A1SA 1YB2A 5MFZA 3D6VA 1N9ZA 4H60A 4Z8YA 5A3JA 3JTEA 1E58A 3IRVA 2B2NA 4IMJB 2XAUA 3GLFB 3QUBA 1NF8A 4BRWA 4UATA 5B5SA 1O97D 1LTHR 3RWMB 4BMSA 1QLHA 4P32A 4WXEA 3O4VA 5JSYA 2FF7A 4XYLA 4YFVA 1B2RA 2ONKA 1XLWA 5HJ5A 1KAGA 3ZOKA 5A5VA 2VPWA 1SPXA 2BF4A 3AF0A 4R5MA 4Z4IA 3ZE7A 2JGLA 5E3JA 1UQUA 4B2IA 2IV3A 1L7AA 4R0VA 3G5UA 3PHJA 1J20A 3WNCA 1H2BA 4FB5A 1KP9A 2ID9A 4L27A 2J0VA 2NZXA 2ZR0A 3M82A 4W5RA 2HU8A 3LUFA 1KZ7B 4RAOA 3C5CA 2QX9A 4TS3A 2PSHA 2BVNA 2A9VA 1UP6A 2Z5GA 3L6CA 2GXUA 3MJTA 3OUZA 1RPAA 4F3KA 4RF4A 4MJXA 2VYFA 1E9DA 3WWOA 3ADCA 1XRQA 1HKUA 5IBQA 5LQCA 4BECA 1KVSA 2Y2VA 1IZ9A 1UBTS 3IIIA 3CPJB 3DDUA 4RD0A 1LTQA 5DKFA 1YFLA 4QJIA 4UVGA 1SD5A 3NUZA 5HK9A 4N5LA 3CLSC 1M75A 5B3JC 2BMDA 3FUTA 4CCAA 4PLCA 3ZZTA 4EENA 3ZCVA 3N0XA 4BNGA 5K8UA 1T1JA 4DCVA 2C03A 2QAGC 4QHTA 1SG9A 5E9JA 5AYVA 2DWPA 5SY9A 4E51A 4F71A 2XTZA 2YHBA 3TRHA 4MCAA 1N77A 4F5YA 1I4DD 1XPOA 1GPUA 2BUCA 4MVJF 2GPBA 4RV5A 1SZCA 4MWEA 4GOXA 4B3DA 1R6DA 1YZUA 5JS1A 1CQJA 4HF7A 1L5HB 5THXA 4B45A 1WXWA 3S1AA 4X1OA 3ROEA 2FRVA 3OE5A 1W0KA 3BXOA 1ML4A 2WAAA 3DTVA 3QFHA 4P4LA 2GX6A 1KQOA 3BULA 1T35A 3PYXA 2TRSB 2B8JA 4EVIA 1GRVA 2AZDA 3Q3JB 3TLXA 1OPXA 3IP9A 3ASYA 4R6XA 3RGGA 5K45A 2OV4A 1RPJA 3MPUA 3FJYA 3ROPA 4GRDA 1EWRA 2L69A 3E0QA 1AQUA 3LKDA 2JLAA 5C46F 4GP7A 4OXXA 1L4LA 2GEDA 1UCFA 4KDCA 3WLFA 1QRUA 1VIYA 4XYMA 1CTQA 2JANA 1ELOA 2XTAA 1Q0TA 4O2AA 3HR8A 1U8EA 1IH8A 5DNCA 4GQAA 4MUFA 3JCZA 5F3RA 3OBBA 2FK8A 4P92A 3ZI0A 1KVUA 1IEVA 3C85A 2FDCA 1X9GA 2HJSA 3T12A 3ZZMA 2D7CA 4ND3A 3RRFA 3NYWA 2FV8A 1GQYA 3FHCB 4AKGA 1BX1A 1OXUA 1YQDA 5KYUA 1W1WA 3HI4A 4Z4QA 1G8AA 2Q1XA 2OXRA 3IP8A 3N8KA 4L4SA 4IVNA 4Q3CA 4UMDA 3SNKA 4DIBA 2AKEA 4DANA 4Y9UA 3KOMA 2E4VA 2ORIA 5C7OO 3UGTA 1V11A 3NEPX 1T0BA 3CZMA 3JAKA 3JD2A 2NU6B 3NNNA 4OJMX 3BB3A 4K9MA 3I92A 2NV6A 4HYQA 4OJKA 3AHFA 1K3FA 3B60A 2VAWA 4PAMA 1Z8NA 1VSVA 2UYCA 3KXLA 3O8QB 2J3MA 2VDVE 4EEKA 1H6CA 1Y3BE 1A5TA 4K5QA 2Z9DA 1HA3A 1YBHA 1ZRSA 1JJBA 3ANNA 4UARA 1IHDA 3HCFA 3GV0A 5DN6D 3LHSA 4TTVA 3NDIA 5CDUA 2G76A 2GN1A 3PP8A 3PD0A 4L7VA 1SIUA 3WB2A 2NZWA 4UUAA 2PSSA 2EATA 1T9BA 2IH2A 4C1NA 3NMUF 4RD6A 3CCBA 4IHKA 3PA6A 1GL6A 2AJBA 4W1PA 3T4EA 3X1MA 4OLBA 4WAUA 2PSEA 1EX6A 4IXWA 2NO7A 3OC6A 1ORHA 2VP5A 4KLCA 5A9SA 3EW9A 3H4TA 4EPXA 4XARA 3WX0A 2FGJA 2NADA 2W11A 4HRXA 1BS2A 4Q9NA 3ZBPA 4Z51A 1G20B 2DX7A 1JHZA 3L46A 1HEYA 3HC7A 3O0TA 1YJXA 5EVJA 4IH9A 4JLUA 1NC3A 1PG0A 3S81A 2YVQA 3KEFA 3FCCA 3JYNA 2RK4A 4D9GA 1A96A 2VRWA 3I9LA 3KQYA 5BMVB 4F91B 5E4FA 2VAXA 5J4VA 2RH4A 5MGBA 3UBTA 1CJTC 3ZG6A 1N0VC 3IQIX 4JELA 2VR1A 4WNYA 4DV2B 5JVDB 1RWQA 2QR2A 4INJA 3W06A 3NV7A 4CV3A 5G3ZA 5DGTA 4DCGA 3U7RA 5A4AA 5AW0A 2Q4EA 3VR0A 5BVHA 4R71A 1Q19A 3K0CC 4DKJA 5HKAA 1PU2A 1EFKA 4MH0R 1QNFA 1JKJB 3G13A 1THMA 4ZVTA 3AT1A 2Q3BA 3HWX1 1ADBA 3H8WA 5NLLA 1XVTA 2G5TA 2GA8A 3CNLA 2XXBA 4E07A 4EVQA 3RJ9A 1XD2B 1WMAA 4H6XA 2QZPA 4N6OA 4G63A 2XGJA 1XN4A 2O50A 2JAUA 5EWLA 1YACA 5TQVA 5EY5B 3C2QA 1NI4B 1QG0A 4OX9B 4E03A 1RR6A 4X7PA 3WK7A 1UC4B 3GPCA 2IOQA 2B5VA 2R62A 3L9WA 4JR2A 3A1VA 1TO6A 4NPAA 5KTRA 2UUBB 1HX7A 3QMPA 2B4QA 2VYVA 1DEAA 2Q99A 3CLTC 4DDKA 1EDOA 4XFJA 4YAUA 1QGED 4I08A 3TPFA 1YQXA 4BBAA 3UWKA 2WIDA 2CVHA 2W22A 1N4DA 2J4DA 2JGIA 3BVPA 1Y4DE 3DDOA 4IH4A 4QUGA 4LF5B 4KUEA 3RUPA 1F5NA 1AQLA 4KO2S 1KBQA 5EVCA 1OC4A 4GT1A 3TM4A 1VJ1A 1XVUA 3A70A 2GD2A 1G42A 4X84A 4RBNA 1VB3A 2OLEA 3N2GA 4KK3A 4IAOA 4AK9A 1SBCA 3OPXA 4CLDA 1QVAA 1VE9A 2X76A 2DYKA 3AV0B 3LGXA 3MJCA 1KMHB 1DDGA 2HUPA 4OU4A 1XZFA 2L17A 5EZYA 1AQJA 5FFNA 1RXVA 2FFJA 5EKTA 3RWBA 3T5PA 3GN1A 4I66A 4JT2A 4JLPA 1I13A 3SYRA 2M6LA 2TMKA 4Q9JA 1HUQA 2C3OA 3IX7A 5L7TA 4A2PA 4G89A 2Z58A 1QLJA 1DUSA 2XEXA 4HZIA 1JIQA 2YXDA 3SBEA 4H31A 2NIPA 4D3SA 4IQFA 4J4BA 3IDZA 1O96B 5ALQA 2XLBA 2QU7A 3COJA 2CLSA 2XUGA 1F4VA 3OQBA 3IIEA 4DCCA 2OBYA 2WM2A 1RCFA 4IDOA 5JSQA 1NNI1 1Q1GA 5T4BA 3JQAA 4JL6A 1XEFA 2ILVA 2V1XA 4HQ0A 4N5NA 4GXQA 4ZTZB 3P9CA 3ASVA 4OI1A 1JPNA 1E89A 1MC4A 5EJ8A 1JH8A 5DHRA 2IW3A 4ND4A 2BBOA 3OMLA 3I9OA 3R77A 4PWYA 1LPAB 3IILA 4M1OA 4TROA 3TSOA 2YV2A 3UO8B 3UW1A 3W9BA 3E61A 1VIVA 2ZJ5A 1KTVA 2BW0A 2OLKA 4MGIR 3WBKA 3WQQA 5E9WA 5HWSA 3OJEA 3ZJ5A 2GNAA 4MAFA 2GBIA 5E6SB 3WLPA 1KKLA 5J2UB 2NGRA 1PFKA 3DF7A 2VJNA 3U4AA 4A36A 1B6GA 4MIEA 1I5OA 4X90A 3STWA 4TKZA 4CG2A 1UFOA 5T8KA 2IU6A 1NRIA 5GJWC 1GKKA 4P5DA 2J31A 3E22A 3O7WA 4U2FA 2I8AA 2XB9A 3KQMA 2KE5A 3W6OA 4JP5A 2YW2A 1QGDA 2VF4X 5IHXA 1JN0A 1BWPA 3GLHE 4DUGD 3L4BC 5ES3A 1Q21A 1TPYA 4IIGA 3U4DA 4G5SA 4O2BB 1O0BA 3N9IA 1TQ4A 4L8LA 4LC1A 4QTXA 3SCZA 3JYPA 2PNJA 2RC5A 4GNKA 4KPGA 4UNIA 2QJRA 4WZBA 1OAOC 1FLAA 4MYCA 1RHKA 4M88A 3H8VA 1NZFA 2O4UX 2JNWA 3SQXA 1CRPA 1IDN1 4K2HA 1OB2A 3PA8A 3EGXA 4DLLA 2PX4A 3AJRA 1XCBA 4EB6B 3L4SO 3K09C 4XPIA 3QG5A 3C3PA 3GEBA 4B0PA 2I7CA 3L04A 1F8FA 2I4LA 2XUOA 1O9GA 4C30A 2VBFA 2I4NA 2WYWA 4JBHA 1DDIA 3K96A 4MUHA 4Y30A 5LQJA 3URMA 2GR9A 1ZCJA 2P91A 4Z53A 2HTFA 3PDWA 5CNKA 3FHOA 1YHZA 3PRYA 1NJ2A 3NBKA 4AF6A 1WM1A 3FPBA 2F62A 3T0IA 1WBBA 4L9SA 1R0LA 5TQJA 1T1EA 4MI3A 5HOQA 4WJLA 4D42A 2EBUA 4C7VA 4EBFA 3M6MD 3GEMA 1KZ1A 2R5FA 1NOIA 4FSHA 3VAAA 2XUDA 3MGKA 1TQDA 3N5KA 2NP7A 5BYKA 3R6TA 1I51A 2QJTA 4MRRA 4XKJA 4HQ6A 1SBNE 2IOFK 4I2NA 4MVJH 1OGYA 5JNSA 4E70A 2XYQA 4U6NA 1X7DA 3DL7A 3PYMA 2ZAMA 2NSJA 2VP4A 3CKMA 1SVUA 2YQ5A 5AK0A 3DHNA 3KS9A 5HW0A 3IBGA 3BWXA 3G5TA 3P27A 1S4QA 1H4QA 1C9JA 4YO8A 5FI5A 1IWPB 4GX0A 4YALA 4ZAXA 3MBKA 3K6KA 2Q49A 4JROA 1UBOS 4P0TA 4LGCA 5IFLA 2XNDD 4D6YA 4OGGA 1HG0A 1RKQA 5HFNA 1IY9A 3D5TA 1KEEB 4UCWA 4E5VA 4AJNA 2QY6A 4P3PA 1RTTA 4QJ5A 4YMUA 1Q84A 3CUUA 4DV7B 4NX2A 1Q15A 2P6UA 2V6FA 5UKDA 4QQRA 1Z4OA 4FFSA 3DE1X 3OKAA 5C1IA 3FUVA 4MKRA 4CG3A 2BEWA 1MABA 3E84A 4F60A 2I9KA 4XGKA 1XK6A 3LO8A 5EGSA 4LDRA 1TIPA 4RE5A 5AKYA 4Z0NA 3DKRA 1P1RA 5E1MA 5T4FA 2PMDA 2XQJA 5AM3A 3FOFC 1LCIA 2P4QA 3HY6A 3M83A 3DJFA 3AVUA 4GGOA 1CLUA 1E3JA 4EKYA 1SQFA 4WN9B 1RHRA 2IYUA 4TSFD 3EMBA 3R7WB 5K3FB 3F1LA 1PGJA 5CG1A 4XFKA 1E1LA 1JG6A 1YE5A 3WSWA 1P9OA 5CT9A 3HV2A 3LT5A 4PTZA 1DGQA 2WILA 3TBKA 3ZVLA 5IH3A 4FGZA 1X3SA 3OD1A 4ZOBA 5EJ4A 1UBRS 5CVUA 1LBSA 4PLYA 4QLOA 1U1EA 5DRYA 3TR0A 2WYUA 5K0NA 3F9RA 2X7JA 2ZUUA 2HDWA 5KWEA 1JDPA 4WHMA 2HO4A 3L92A 4REMA 3X1WA 2Q29A 2B4TO 2B98A 5JE8A 5EZQA 4D9FA 1B0ZA 1BKYA 1Q0LA 2FZ4A 2WDPA 2JJMA 3QFRA 4E14A 3R7DA 3T4PA 5IK2A 3D4IA 3AR6A 1A7AA 4P7GA 4RDHA 1XFAA 4RK0A 1U04A 3D59A 5GZ3A 2X4DA 3V46A 4TV8F 1FFSA 5LZ5A 721PA 5JFTA 4ITVA 1IHXA 2FQWA 5BUCA 4KZKA 4GOLD 1VGRA 5IAGA 1NUAA 4JOSA 4K9QA 2R1TA 3A7DA 4M9CA 2YN0A 1K1EA 2VF5X 3IDSA 4TL9A 1XVVA 4COKA 3TZ6A 5ELXA 3NAZA 4EG4A 2VDJA 1T8RA 1I2AA 5B7NA 1N2HA 3BXZA 1XKQA 2XMQA 5T6BA 2WE7A 3JVEA 3NH9A 2N47A 1B2LA 1ZINA 1P1CA 3EH1A 3T9AA 1FUIA 2D5LA 2IYXA 2OB2A 4MWZA 4DMLA 5M7EA 4RVGA 1JPUA 3AEKB 1Z62A 1S9HA 3F5SA 1QX3A 4C4YA 5LU9A 4FEGA 3P20A 2TECE 1P1HA 3ITEA 4I55A 1E77A 4G5XA 5BQ5A 3IUNA 1F3OA 1Z4JA 3OJ0A 4CM5A 5HQ3A 4INOA 2F1KA 3VDRA 4F3NA 3FDXA 2K87A 1QP4A 4YJDA 2RHWA 3MXOA 1WX1A 2ZAYA 1T6BY 4K6KA 2ET6A 3UMVA 2FVYA 1N3LA 4XR9A 2QMQA 3PL1A 3C87A 1WP9A 4KE9A 3BREA 3IIJA 3FHLA 3AQ4A 4BLRA 1RXEA 4YQEA 1O2DA 2VHXA 4D4KA 1OH5A 4QGBA 4TVBA 1I36A 1YZTA 5IAOA 1BWSA 4KSCA 2C7BA 2YMPA 1SG0A 4GC9A 5FX2A 3CUWA 1B8VA 1CRWG 2E49A 2BY4A 2IU3A 3I2KA 5DM70 2A14A 4A26A 1C0LA 1GFSA 2XIQA 3KU4A 2UDPA 3P19A 4M1KA 5BO5A 3ZY4A 3PCRB 1QG2A 4Q7QA 3GGPA 2QD5A 2VP6A 1MAUA 3VR3A 4UMEA 3FSJX 3PUYA 4BFSA 1FJHA 4S1WA 3G2LA 3BBPA 1NBME 3GGDA 4OK3A 7GPBA 2PZBA 4W7SA 2NVUB 2MSDB 4DSOA 3OCZA 2XCSB 5HP4A 4QVKA 5CAEB 4LC9A 1WSAA 4QGAA 3R9IA 1S01A 2WNSA 1F7VA 5IJ9A 3SIRA 1CERA 4X1IB 4XX1A 1AS2A 2NT4A 3HKCA 3LUJA 3L84A 2BHTA 4DLWA 4V2UA 2VEDA 2X8AA 4A23A 3GR6A 2R68A 4EJFA 3GLGA 1E3QA 4F7WA 5FUXA 1H2HA 1TO1E 4D9HA 3PXBA 1BGWA 4QYMA 4HJRA 1DMSA 1JLLB 1BO6A 3F6SA 4JJ7A 3SM3A 4AQYB 1KO5A 2OG2A 4KYVA 4LJ5A 3RJMA 2VNJA 4GE0A 4EA7A 5ADWA 3GJXC 1Q16A 5FOXA 4LUCA 2JFBA 2OY0A 3LWNA 3SBDA 2QN2A 3EB9A 2GJSA 4WESA 3U9SA 2FSVA 2ZS9A 2JFNA 4F5DA 4Y2TA 1OTXA 2AFIA 1MIHA 1A9XB 3T34A 5I7RA 4G8CA 4EYEA 1FVHA 2NQ8A 4BAUA 1NQXA 1YB4A 2WI8A 5JATA 3RJ5A 1TM5E 3LD9A 3W6NA 4GR4A 1OY1A 4KXFB 2QP3A 4GIBA 5DM2A 4F6RA 4B8YA 1U7XA 4PZZA 1GDDA 2DOKA 4D2IA 3NNSA 1RZRA 2FPOA 1E79A 4MQLA 3BE6A 1YMVA 4PLPA 5K3EA 2BFDA 3GZTB 1J22A 1EXWA 2Z1DA 4KPEC 1OYYA 2Q4RA 3B6MA 3AETB 2A5JA 2QTGA 2BSAA 5HF5A 3T5AA 3I01A 4RGYA 5E4YA 1L2TA 3DNFA 2BCJQ 3HPRA 1E7SA 1G66A 4L3WA 4RHUA 3SOZA 5IDQA 1F8XA 1LD3A 2QRNA 4IO1A 5I48A 2WJAA 3W9YA 1ZGBA 1YR9A 2PL9A 4OGKA 3HXTA 4QJBA 1CEYA 1TADA 3B5IA 3HL4A 2EX4A 3HCPA 3FWKA 3LH5A 4QE3A 4DM7A 4HFMA 1FQKA 1PEDA 4J2TA 5I01A 4L3VA 1HY3A 1MOQA 1U1CA 3ELYA 2XNHA 3QKRB 5ENZA 3QNWA 1EBBA 2QL5A 3I2YX 4ZVQA 3FZYA 1GG8A 2I4TA 4PG7A 4KTTE 4OHMA 1CUCA 5JCPA 3U9TA 4TT8A 3EFHA 5I9BA 3I9FA 3RANA 1KC3A 2P9GA 4QQFA 1ATIA 2Y6UA 3PFGA 1COWA 1LX7A 1NXOA 4FZ3A 4EX7A 1G5IA 2DH6A 1S2DA 5HEKA 5KDOA 3PIDA 1PUJA 2B4KA 1M2VA 2BMVA 2YWCA 3LUDA 1EWVA 1MNAA 4FYHA 4HGNA 4MXDA 2Q1WA 4MV9A 4NONA 2XCTB 5KOIA 1ZHOA 1PZNA 2QJOA 1GRRA 1VJ5A 4QDXA 3T7DA 3VDQA 1JWAB 2Q0SA 1TCAA 2P9HA 3H0EA 4YJ2F 3TQIA 4BRUA 1X9HA 1R16A 1PP4A 3ZCRA 3E7FA 3SGLA 1EGMB 1EWKA 1VSTA 2GBPA 2PUJA 4RPJA 1W46A 4TTJA 4YCMA 3BD9A 4XQGA 1G64A 4JB2A 3CSSA 4LI0A 5DMXA 4ECAA 4B4DA 5JEDA 2RHCA 3TL3A 4M53A 1C7RA 1YNSA 1ISMA 3W05A 2XGOA 5JU6A 1SD1A 1DRWA 2MU1A 2HDNB 4GI5A 5CA1F 4N3BA 3SC2B 4B3IA 3N7UA 5DPMA 2W43A 4OLJA 2AOUA 3UV7A 4ENQA 2O3QA 2OG1A 1D2AA 2EKQA 4J1QA 4WPGA 1MIOA 3QU5A 3KVVA 4BC1A 2OOSA 3HYTA 4X6XA 4QXQA 3CXRA 2GYVA 1Z6XA 3QU4A 3IO5A 4LFBB 1MVOA 5A4MS 1QGOA 3LQ1A 2OHGA 4WSOA 3ZCPA 4EB3A 3EMVA 2P0EA 3B12A 4FWIB 2WP8J 4L5CA 2DLCX 2PRIA 4UE3S 3IULA 4P84A 1JFRA 4MI6A 4Y2GA 4EGJA 2H1OA 1CQIB 2ZB2A 3LRTA 5DNAA 2Y0PA 2R79A 3AVVA 3DEZA 3PUKA 4N5MA 4OOEA 3TMYA 5TT0A 4R40A 4OJQA 1FPMA 2Y2UA 3KPVA 4URFA 3D6HA 2C82A 4XLZA 3QA9A 4PVCA 3S7TA 3U4CA 4EHDA 1GTL1 4I1IA 5K6AA 1HLPA 1QK4A 1U7UA 2AOTA 2GA9A 4DL9A 4EUNA 3GLIA 3OQOA 1HE2A 1XRNA 2PUTA 3LPAA 2O2DA 1ZH4A 4XX0B 1NUQA 3S2ZA 1CUEA 1FS4A 2QN9A 4DADA 3BD7A 1TO2E 2RCNA 3S5JA 1X38A 5B2ZA 1Q7EA 4QOHA 5KYXA 2W6ID 5FL3A 1Z0IA 5DT2A 1ESZA 2BFNA 5AO9A 2AF4C 3TLZA 1ZCFA 1UWLA 1H8ED 4MVCA 5CPBA 4B46A 3FOBA 3LP5A 4CKBA 1UBEA 1LNZA 16PKA 1TE2A 3EUWA 4Y6GB 3O7MA 3FGNA 4W99A 2F90A 4LZAA 2V5UA 1X7WA 1UDBA 4FYKA 6AT1A 1C9DB 2PMEA 1T9KA 1E6LA 1QXSA 3ZHBA 4J1TC 1E9VA 2PBLA 2EGHA 1A5BB 4RA6B 5I7HA 1BX0A 1B8OA 1TM2A 2DE0X 2W2PA 2HF7A 4UPVA 3WO0A 3LP6A 4HB4A 4F56A 4ZC8A 2AQ8A 4P7JA 4DNPA 2I4IA 5I4IA 3E5RA 4DV6B 2JLBA 1T5HX 3OFJA 3K5WA 4QT0A 2FYTA 4V0ME 4C4AA 5JO0A 2QI9F 1YO6A 3FVTA 3NS7A 4U1RA 2FPSA 5CVTA 3WGQA 4CETA 1F2UB 1XZ8A 2ZT6A 1GDTA 1GUBA 3ZVKA 4YRPA 1MAHA 5FTWA 5GWXA 4Z0HO 1C81A 3ON5A 5LWQA 2XXAA 1W2GA 4K9DA 4A16A 4I8IA 3LF2A 4NJEA 4B3FX 1XMPA 2GASA 2V97A 4I46A 3RYFA 1NRXA 3T38A 4FT4A 3LSTA 2HLHA 1HGXA 3RAEC 1DTEA 1SC1A 5ESDA 4BO2A 4JI5B 1V1RB 3ER8A 3WLHA 4C4PA 3R7LA 3PNLA 1XN1A 5D00A 3RQIA 1W49A 4K05A 4RK1A 1SA0B 3TQFA 1Z38A 5JS6A 1K8RA 3DPIA 2ZUEA 1F0PA 1NLYA 1POWA 3UJPA 4R51A 1DBPA 4FHGA 5EJGA 2XA2A 3A1CA 4LPSA 2R6R1 4R8MA 4I1YA 4BWFB 2KJQA 3M6FA 2FU5C 1NLUA 4KQHA 4NV0A 1XQ6A 2GERA 1KQ3A 3EF1A 4YXFA 3BOSA 3WWPA 1YDMA 2Y1DA 3LNCA 4E7OA 3UOGA 5GAJA 4QG7A 5BV8A 1J4AA 2WWFA 4M0KA 2P2DA 4WASA 4PQFA 1CUVA 3LKBA 3LO5A 4XGNA 5A1TA 3B70A 1BE1A 5F1PA 3QQ5A 4CEIA 3JAWA 5EZ6B 5HYVA 1S3GA 3DM5A 3UMRA 3UNXA 5EGNA 1UPXA 3OZRA 4G1UC 4BP9A 5BUQA 3HCOA 3OQPA 4W6QA 2A5YB 2RGGA 1FQOA 2VLIA 4TYPA 5HXAA 1ENYA 5DSTA 1U7PA 2C2XA 2X1MA 3X1JA 1EWQA 2Q5QA 4GMFA 2Z8XA 5F4BA 3RG8A 3EQ7A 3E6AA 1JHPA 2WIKA 1YS2X 3CWQA 4X65B 2PKQP 3USES 4B4WA 2JK0A 4XM1A 4ZGBA 2A88A 2WD7B 4Y2SA 1N2ZA 3UJBA 3ZIDA 1ST3A 2AF3C 2IOHA 2G9VA 4PC1A 2AMFA 2OFOA 3SVZA 1KSFX 1XCMA 1F0YA 2Z57A 1Q2XA 3ZV7A 1YSCA 4DT1B 1RNLA 4QXOA 1VMDA 2P2CA 3F47A 4G84A 4UTZA 3EEOA 3DNPA 5HSGA 4J1NA 2AG0A 1ZUHA 3OI7A 4URYR 3I04M 1PBNA 1PWYE 5CP8A 1S2IA 3SU8A 2WG0A 2FFRA 1DRKA 2VH2A 2HMTA 3CS3A 3EQ9A 3RV3A 1J25A 4G0NA 1OXKB 2QTVB 3TEJA 5ITVA 1Y5IA 5FCDA 3TECE 1E2JA 1V8DA 1JHMA 4JEIA 1QF9A 1V7PC 3WA7A 4OREX 4LVOA 4WNAA 1WF3A 2GN8A 3O1JC 2HQ1A 1U9JA 1G4HA 3KUKA 4XDYA 4AVYA 1H5QA 1TAGA 4JUIA 3UWDA 3OHMA 4GPTA 4LNUB 4E0BA 2Y0DA 2B61A 2X4LA 3N7AA 5HPYB 4AC9A 3WWZA 4CQMD 3LPCA 2GPWA 3NWOA 3QEAZ 4OHWA 4KQ9A 3ZGXA 3LOPA 3SWWA 2A1TR 5FNVF 5H7XA 4X20A 4PFQA 1ZVVA 1PVVA 1GTMA 3HY4A 5BV1A 2IS4A 4MR8B 3M6IA 1GGMA 3RIEA 1Z6ZA 1A4UA 3HR4A 4KIUA 5JDIA 2QYOA 4NZPA 4Q4JB 1MQAA 2MHCA 4FS8A 3LU1A 4TWIA 5JG7A 3RS0A 4JN6B 3RV4A 1PJCA 3VSCA 1D2EA 2QTTA 4UW9A 1XO1A 2BGLA 4GXNA 2V7TA 1WEKA 1LBEA 3N39C 4HNAB 1TTPB 3HFRA 4RF3A 1FDUA 2CXTA 5G0WA 4RL4A 3UT5A 5BXQC 2OFFA 3SK0A 2FQ1A 3G8BA 3M1IA 5LZ7A 4V38A 1QAMA 3TCNA 1AURA 4BN5A 2IWHA 4RADA 2WT4A 5A4DA 5BNWA 2JIBA 1W94A 2D06A 1PL0A 4CKYA 1C1YA 4PQEA 3C97A 1VXRA 4XA8A 5CGZA 1CUYA 3WP0A 3ZW8A 1P18A 4EL5A 3WLQA 1FYFA 4ZZIA 3MLAA 5GGXA 1ISSA 5CGQB 4L72A 2O8EA 3IKMB 5ALMA 5B36A 5LNK1 4F4UA 2CHVA 2AB0A 4AF7A 2VH1A 5EA2A 3B9BA 1TFRA 3ITDA 1XD8A 2DMRA 1VPWA 1M6YA 4M1YA 1Z18A 3U5TA 1UMCB 3WGNA 4WXRA 4G1FA 3KZNA 2JF0A 2E5LB 1MG5A 4FCVA 3DZKA 1XF1A 1WR8A 1MX9A 1N2BA 2BWJA 2GD0A 3H6GA 3ONWA 2XKAA 4IV5A 4C5CA 3EVCA 4QGGA 4LYEA 5KMGA 4O1HA 3L0DA 5E0OA 3KSZO 1L5NA 3KJHA 5IWCA 1N5KA 2PFSA 1XQXA 3KPUA 3WBFA 2B34A 1GY8A 3C8MA 3N8DA 2IL1A 3CRVA 2GKGA 2ERYA 3IERA 3R7FA 4BQNA 5JC8A 4OXNA 1P29A 4TMWA 3VO1A 3OO0A 1G4UR 2GZDA 3WMGA 5B3JA 2P9YA 3AOEA 4HMPA 4IKEA 4Q1BA 3FRIA 4AYXA 3W8DA 1R0WA 4FINA 4O3MA 1ORTA 1BEEA 1GGEA 1VBNA 5CW1A 4FX2A 2JCBA 1FU8A 3KQTA 5IPFA 1VL5A 2AC2A 2HWUA 2SCUB 4RH0A 1WPQA 1JQJC 3T94A 4QU5A 4DREA 1C2YA 1D07A 5BSVA 5EQTA 5HJEA 4UUBA 5BW4A 3E1GA 3VSDA 1KYQA 3A6JA 5J4LA 3THWA 1AKUA 2ZFUA 3MGBA 2PLNA 2BKAA 3FYCA 4M7RA 4TXLA 5FT9A 4CMIA 4CKEA 2EZ8A 2PGJA 5CB4B 4JR1A 4C6RA 3WI7A 3WIOA 2X15A 4D8VA 1C3JA 1U2PA 2PK3A 1SUFA 1ZD4A 1D4ZA 1GPLA 1NM5C 2KS6A 2A5DA 5JQGA 4V0SA 4WKGA 1CB0A 4YH1A 3WAKA 4DZTA 3AVTA 2HIAA 1Q14A 2BRUC 2J6IA 4ZRDA 3JWPA 5LA6A 1ZAKA 3NEAA 4RPKA 1J0DA 2BT4A 2Z3VA 4AUEA 1QIFA 4EPYA 4ZZ0A 2KBFA 2V74B 5LYYA 4CGYA 4JEMA 4K88A 1DBWA 4KUHA 3DB1A 3TUJC 2UZ1A 3CZ5A 3S0JA 4KH1A 3O2SB 1G60A 1E1QD 3WYGA 1V5WA 1Q74A 4LRUA 3OX3A 2W6NA 2I2BA 2I2FA 4UDXX 2GXQA 2XW6A 5PGMA 3LS2A 2VT7A 1YL5A 3PUJA 4QECA 3DTNA 3A05A 3LVRE 4R3WA 1SELA 4MHSA 3ZDCA 1PZHA 1XUOA 3KG2A 2ZIAA 4LJ4A 5AKEA 4KR6A 1G4AE 3CO0S 5I7AA 1RFLA 2RBEA 1K7EB 1WXIA 2DQSA 3EZNA 4LYJA 5JMOA 2RKWA 2QP4A 3OD5A 1RXCA 1LQTA 3O1IC 2V6BA 4QEKA 3PNPA 4OLHA 3AILA 4HB0A 3O03A 3AUTA 3OOSA 4ARSA 1NSTA 4CG0A 3DT9A 4Y6QA 1PR2A 1CQXA 2QPLA 3V55A 4ZCMA 5K09A 5DM1A 1WHSA 3LDAA 4LE1A 3G88A 5A71A 1GT6A 5JNLA 4F8JA 1X7XA 1GPBA 3UAVA 1I3MA 1T3HA 4IDAA 4OQZA 3RSZA 3DMHA 3HM9A 1ZIDA 3CYFA 3OKFA 5J47A 4AJJA 3IQGX 3GDGA 3IXQA 5JTUA 1AGYA 2R5NA 4A91A 4M9QA 5ALGA 4KKVA 2Y92A 1Y5LA 2YCLA 4KTVE 4PIVA 3VDNB 5EIHA 3X43A 4C01A 5CNJA 3T99A 1RYHA 3RDPA 2XGGA 3MAJA 5HX7A 1VG0B 2Z30A 4MVJG 2PVCA 1CUFA 5TGZA 4FQ8A 3YASA 4R9VA 4UM5A 4MTLA 2JBWA 4NBWA 3WNVA 1N9GB 2QM7A 4ENVA 1JFVA 1TU0A 2CMHA 3ELDA 3QOFA 4LCBA 4BGVA 7REQB 5CURA 3FVWA 4X8MA 1V1MA 1IZZA 1E2GA 2E4ZA 2FF5A 2OZLB 3PWZA 1U0BB 4KYTA 1ODLA 4AAYA 2WKPA 3JSXA 5BSKA 1SJ9A 1GVHA 4U2GA 1H6AA 1AN0A 3THWB 3AY6A 1GPDG 2ONYA 1ZHFA 2FR8A 1NW9B 2W48A 2FRDA 5B6JA 1QIGA 3WYEA 3LP8A 2UUOA 4MO2A 3V4FA 2CUKA 3OFSA 1NC1A 1ZUNB 1NF9A 1ZIOA 1K7XB 3N59A 5ALNA 3NGMA 3I52A 3RSCA 1IB6A 5FBKA 1PFUA 1M8GA 2VP2A 2XHZA 4Y2VA 5F73A 3VSEA 1VE3A 2BBWA 5KWVA 3ESRA 1RI2A 2AMJA 4M1ZA 4C3VA 3V1TC 3F6RA 1UC8A 3H6HA 1VLZA 1KR5A 1YQQA 2JJ2A 3D8NA 5CM8B 1TLTA 2O0HA 1G8PA 1KL7A 3D8RA 4NYIR 4S0XA 3TL2A 3UF0A 5KU7A 1OWNA 4TMZA 4BMXA 1QGUB 1DTWA 4M54A 1XD9A 3E9ZA 3T7KA 3UWOA 1V1JA 2NO4A 4HTFA 3N0WA 4TTSA 3GFOA 2Q6VA 4H6VA 3ZLTA 5BV0A 2R96A 3BG5A 2WWRA 3L6BA 1DFGA 2HHCA 2WHXA 3VAZA 5EHZA 3PEYA 4JV5B 3N86A 3WLTA 2WM8A 2QSUA 4NDAA 3OSUA 2J85A 2YIMA 3NYIA 4EA6A 4ZO4A 3GHHA 2R00A 3O9VA 1SBZA 2G6TA 5JASA 3DDSA 1KOGA 4G56A 3HE3A 2J9RA 3BEOA 5JSZA 2WDZA 3IMCA 3LT2A 2L82A 2VVTA 5JPIA 3R4CA 3ZK8A 4PX5A 4V39A 1H69A 2IT1A 2PCJA 1Z2DA 4L0MA 4RABA 5I6DA 3MA0A 4X63A 4ZAZA 5JCOA 1OVMA 2OZKA 4TV8B 5H3CA 4WADA 3HG7A 1RVDA 4F97A 2RKBA 1ILEA 2ZJYA 5EJ9A 3AG5A 1ZBDA 2VDMB 2WFLB 3ZHYA 2UZ4A 4TT3D 1YDEA 1QG4A 2CXHA 1P0QA 2PQ6A 2Y0BA 3Q88A 1GAXA 5I7SA 1PEYA 3NOXA 3OZIA 4IOLA 4BNVA 2YWXA 2CC2A 1WV1A 4P81A 3MXTA 1LBQA 1M7BA 3HL0A 5FUYA 3TE7A 3CWZA 1UMDA 5H0IA 2RIRA 4DY6A 3EVAA 1K7YA 3BHMA 3PFFA 2HX1A 3KR1A 1TL7C 1UKCA 3PC8C 1YVEI 3QF4A 4O08A 2AK2A 1A4RA 4TUYA 4LZOA 5F33A 3RFUA 5EYPA 1E3TA 4ZI7A 1SHJA 1AMOA 3WK6A 1T25A 3ROZA 2YQZA 4LHSA 2A9RA 1CDEA 1ZL2A 2R6JA 2EIHA 3INNA 4AM8A 3AC0A 2GILA 1BVUA 1ML3A 2XT0A 3GUVA 3FPLA 4JJ4A 2F1IA 4XIIA 3WGYA 3M1YA 4E2ZA 1FDTA 1A04A 2H16A 3W90A 1W52X 3H6KA 1M1UA 1V7ZA 4FD2A 4FX5A 5JSHA 1Q77A 2B1IA 2JD0A 3EASA 1P7WA 2J7PD 3HJBA 3D2AA 4NH4A 3ZH2A 3BMNB 4FR0A 5DK4A 4UE6A 2SHKA 5IVIA 4OM8A 5A1JA 4JLJA 2G1UA 1GTZA 3K9NA 2A59A 1TT5A 1EDDA 5HQTA 2FPKA 4YV2A 3VH2A 5LB2A 4CNQA 4AECA 2ICAA 1YQWA 1V45E 2N1BA 4OXIA 4HZUA 2DBQA 4N9WA 4M76B 2DPHA 3NGXA 4WBNF 4DR5B 1U7ZA 4Y2YA 4QTYA 3HCRA 3JW8A 4L78A 3LGAA 3PFCA 2O8NA 1F2TA 2I1LA 3A06A 4GYWA 1DKLA 5K0GA 1MC8A 1BWRA 2A9QA 1J8YF 1T2NA 4KI7A 4R1MA 2JW5A 2QPOA 3DUFB 4PYIA 4U9UA 3IP3A 1GILA 1FP4A 4JOBA 5F76A 3RFFA 2C4MA 2XDQB 3EYAA 3JYQA 2OHFA 4DQ0A 2AE2A 2ID8A 2WJWA 2XDAA 4GP9A 2PT6A 3S1LA 3W5HA 4BE9A 1R5JA 1MO5A 3TUZC 3VR4D 3CPHA 4LYGA 4WXMA 2WIGA 5DB4A 2HBYA 4JLSA 1T2CA 5DBGA 1IPFA 3EFEA 4EKNB 2ZIXA 2QMUA 3EOZA 4RMGA 5GGYA 2WUWE 2YN4A 1G17A 1L3BA 1B8NA 1U0TA 2LBPA 1KZYC 5IJZA 3DVSX 5IF3A 3AEUB 1T10A 2G4VA 4NCKA 2EG9A 1UJBA 2JHFA 4ZJPA 3ZVRA 4PEVA 4HC4A 1YZVA 3B1WA 1HTBA 2VHTA 4DJJA 2GEBA 2HN9A 3BE4A 2DPXA 3KKLA 4RSHA 1G8FA 3MUNA 3TGWA 1XRJA 1RXUA 1YQUA 2HA5A 4XWTA 4AY6A 2F17A 5LB4A 4CDMA 1HE1C 2NYUA 5G1PA 3T7RA 1GCAA 1NMQA 3QKUA 4ZA2A 3PUXA 3CEPB 4G4SO 2ONJA 4BS9A 4QTZA 1EZZA 2A5GA 1FTGA 1DQRA 4R2XA 1NXPA 2BDEA 3I53A 3RKSA 5ARCA 2WMOB 3BMQA 3SHTA 3WV5A 1XRPA 4C14A 2CFSA 3PC3A 4HPJB 2IYRA 1ZM4A 3D4PA 4B3MB 3HZOA 4GW3A 4GPD1 2QB5A 1OV4A 1U3GA 2G8LA 4KQKA 4NZYA 1YR6A 1V95A 3ZDAA 4CDRA 1DO2A 2GK7A 2NO1A 3N58A 5P8WA 2X2FA 4DA9A 3GJYA 4UTPA 3B3QA 3HVHA 2OM6A 3RS3A 4EFLA 5IX8A 2O54A 3W77A 1KETA 1Z08A 5K9ZA 3T3OA 3W5JA 4EL0A 1KO4A 4DBLC 3ED1A 2ZP1A 2FKNA 2IP2A 2REQB 4WY2A 5DTQA 4BLQA 2NWQA 4FK8A 1WSBA 4YRLA 2WRZA 5FORA 2FQXA 3FPJA 3G0BA 3L1JA 4XWGA 3S2IA 2DUWA 3OZDA 4JQZA 2I2CA 1D0IA 2YICA 3KQKA 4LF7B 3UUWA 1RJ9B 4NK4A 3A6LA 4DUYB 1SC6A 1LRJA 3BB4A 1HLGA 5IU6A 2E4YA 3OOHA 2VJKA 4H7JA 5F9FA 1UM8A 3OOYA 1D2MA 1RYDA 2PJZA 1M8FA 1TKAA 4RQUA 4IUYA 4R6WA 1P81A 5KNBA 2ZYVX 1XCJA 1P31A 3MUEA 1J2RA 4JC4A 4CF3A 3B6KA 5FLXA 2QJFA 3KDPA 4OPMA 1QE3A 3A9TA 4O63O 2GK4A 2A1UA 4BP1A 4AICA 2Z9CA 3OEHD 1P62B 4FDMA 1P45A