1CKEA

Cmp kinase from escherichia coli free enzyme structure
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
225
structure length
212
Chain Sequence
b'AIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQVKGFSVNFERLLAEIKLVPAADALVLDSTTLSIEQVIEKALQYARQKLALA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
molecule tags Transferase
source organism Escherichia coli
publication title Structures of escherichia coli CMP kinase alone and in complex with CDP: a new fold of the nucleoside monophosphate binding domain and insights into cytosine nucleotide specificity.
pubmed doi rcsb
total genus 70
structure length 212
sequence length 225
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 1998-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ckeA00
2P6NA 4HLDA 1R6BX 2ZQ5A 4OQMA 1VG8A 1ZM3A 3AP2A 4IOKA 3FHCB 1RYHA 3QXSA 4QBFA 4HLUA 2L0XA 1AJEA 3NWJA 3LX8A 4KSBA 4Q00A 5HE8A 3AF1A 4DSOA 4PSAA 1LV7A 4TMTA 1JALA 3PEYA 1KDTA 4D81A 4KBFA 1TQ2A 2SHKA 4PO1A 3SJZA 4HSEA 2WAYA 2QORA 1BMFA 2QI9C 2WKPA 3PUVA 1W36D 2O8EA 2A2ZA 2PL3A 2JAQA 4Q1CA 3WMGA 2B92A 1Q57A 2VL7A 3NHBA 2HF8A 5EUMA 3V4RA 2VHJA 2O0KA 4HUQB 3P27A 4Q4HB 3RSLA 1X86B 2PX0A 2ORIA 4KXFB 2RAPA 1TL7C 1OB2A 2XXAB 4LJ4A 2KSQA 3LBIA 5EE1A 3OE7D 2WWHA 5KSOA 2UVQA 3BWDD 1M34E 4G01B 3LH5A 4W9MC 2C9YA 4LJ5A 1DG1G 2OM2A 3R8FA 4A0HA 2CBZA 1CR2A 5CB8A 2XTMA 4DDUA 4NHOA 2IUUA 3R7WA 3EARA 4MRPA 3SHFA 3SR0A 4BLTA 2CEAA 2DFNA 4C7OB 4BECA 2O8DB 1OE0A 2YOFA 4LJ7A 3GLIE 4NZYA 2NPFA 2PX3A 1T0HB 2P67A 1HQYE 2DWOA 1E79A 3L8YA 1NN0A 5AK0A 1ZUIA 1GNQA 2JLXA 3QVUA 2PMDA 4Q48A 3UG6A 1KDRA 2GK6A 3LVQE 1RE0A 3U7FB 1KSHA 3BH6A 1P72A 3AVOA 4FW9A 1NN5A 4WA7A 2O8DA 2HXSA 3HYRA 3UMFA 4DDTA 4LCBA 4TTPA 1SVWA 1XMSA 2CE2X 4UJ5A 1Z0DA 3AF0A 3DMDA 4QGHA 3SOPA 2YVUA 3BD9A 1E2IA 3PQCA 3QUSA 3I3SR 2J3EA 5L3SA 1G291 4YLGA 4M0LA 5DSZA 2D7CA 1F2UB 2GRJA 1P60A 1ZBDA 2IEZA 3CZPA 2N42A 4WBSA 2JLZA 3OF5A 4Q1FA 4IOLA 2ZJ2A 2VH5R 5CIWA 5KDLA 4F92B 5CDFE 3PUZA 1KO5A 2ZS9A 1VYTA 3RABA 2IYRA 4URZR 1RRCA 4JLMA 2KE5A 1DAHA 1FMJA 3IO5A 4PAMA 4I81A 4A4DA 1J90A 2NQ2C 3KFXA 5AWFC 2G6BA 4PO8A 1R8QA 1G8PA 2BBSA 5C18A 4TT3D 3FKQA 4RJLA 3KUDA 4G1UC 3TQCA 5J4KA 1ELOA 2V1UA 1NP6A 1SZPA 1XXHE 1UF9A 1Q20A 1Z0IA 1SVIA 3OEED 2IYVA 2OAP1 1R8SA 4KLNA 4XWAA 1IY1A 2DFTA 5FFMA 5BYKA 1IOZA 3TVTA 3A8TA 1T3SA 4OQLA 3G0HA 3TSZA 2ZE5A 1RVDA 4KO8A 1QHHB 1OFTA 3THXA 4MRRA 5J4HA 1VG1A 2ZI7A 2RGNC 2WMOB 2IX3A 2ZSFA 3KX2A 4IXMA 3QKSB 1LVGA 4U00A 4NH0A 3UKDA 2ORWA 4GT1A 5IRCD 1W4RA 1YJ5A 2ATVA 1JI0A 5AJVB 4PTLA 3WRYC 4HAVA 3QF4B 5JZVA 1J99A 3RHFA 4Q19A 1JQLB 1JAIA 3FE2A 4KFRA 4LJ6A 4A82A 1XMVA 5BN4A 4QFMA 4OBEA 5E7IA 3VR6A 4M9ZA 1NN3A 4KVGA 4MGKR 2WIAA 5JI3E 1AGRA 1QBKC 1YR6A 1HEIA 4OJKA 1WXQA 1TEXA 5LBIA 4OHYA 3RS7A 1XZQA 1MKYA 2QENA 5B58C 1GKIA 2C2HA 3E2IA 5SZJA 1II8A 1M7GA 1EFTA 1YZNA 2J5XA 3KB2A 5DLQC 2QRNA 5H70A 2Q3MA 1DPFA 2OUKA 3T34A 3EPHA 3ADKA 1KI6A 4WIAA 2BM0A 2ODNA 4XSHA 5F2EA 1KJZA 1W0JD 3QI2A 521PA 2WWXA 3TQFA 4GL2A 4NDZA 4LHVA 3VTKA 4BFSA 5FBVB 1DTSA 2IWRA 1E9DA 4FMCB 2ODEA 4EPYA 3GLHA 1OIWA 1XX6A 4G5GA 1Z07A 2ERYA 1YZUA 2J45A 3NKVA 4FMDF 4BE7B 1JXOA 4LC0A 3IIKA 3GJXC 4JL8A 1XCPA 3JZMA 4LHYA 3TKLA 4MQBA 2E9SA 4JLKA 5JMTA 2GILA 1OH7A 4I1VA 2QBYB 2V55B 4AK9A 1SKYE 3IQWA 1XPRA 3F3YA 3I73A 3C5HA 4BZPA 3DOEA 3ADBA 1W44A 3MD0A 4N0EA 3BERA 1KKMA 4GP7A 2H17A 2IYWA 3VX4A 3W3ZB 4KV9A 1H8HD 3BC1A 1WMSA 1E1QA 1Z6YA 4YMWA 1SXJE 3B1XA 1RRPA 2Q9BA 1H8ED 2B21A 1JEEA 1XD9A 4O0MA 5BQ5A 4KVAA 2H7VA 3FMFA 1TQ4A 2H1LA 5GVRA 2GXSA 2VO1A 4DRZA 1EK0A 4OK5A 3U3OA 4FCTA 4HZUB 2CNWA 3EAQA 1W2HA 3CX7A 2CK3A 2Z6VA 2VP5A 4ZKEA 4V02A 3Q9LA 2RGCA 3ZZTA 3L8ZA 4DIDA 2GKSA 2BKUA 1YZLA 2F1HA 4MGYR 1FP7A 3EZ7A 4MGZR 3VHLB 2G1KA 4MH0R 4JT4A 2J0UA 1P9RA 2IYUA 2V8OA 3BAFA 3R9IA 4URYR 3Q8XB 4F4IA 1EFCA 3ETLA 4JVLA 3U44B 1XEWX 3N2EA 3ZDQA 3EZ9A 4DLWA 4CT4B 1C1YA 2R6AA 4LHZA 3B9QA 2WJVA 5JEEA 1S3GA 3GJ0A 4LX0A 1IXRC 1YZQA 3WBJA 1N5KA 1RJ9A 3AV0B 2ZREA 2YINC 2QAGC 3K70B 1KI4A 1XJ0A 2EFDB 2JJ1A 2XITA 5FTKA 3M4YA 1XD2B 4B6FA 1SVKA 2VQSA 4XVQA 4EJSC 3B1VA 1CF4A 2WWFA 2IL1A 1YR8A 4MKGA 3UXMA 3X1YA 3B85A 3ZIAA 4NCJA 1E0JA 1XZPA 3CF6R 3I5YA 3ZD6A 4ZO4A 4TTRA 1P9WA 1OPXA 3CH5A 4DJTA 1FTSA 2B8TA 2HDNB 2XSZA 3K9NA 5KTYA 4LYHA 1NN1A 3I4LA 5EE9A 4OQFA 5H8WA 2BEKA 1LFDB 1XTIA 4S35A 3RRYA 1PJRA 1NLYA 2C9OA 2PEYA 5AUPB 5KNDA 2ZJ5A 2C99A 1DAGA 1IQPA 1GG2A 3WRXC 1Z6XA 3RYTC 3A1SA 1F3OA 4TLCA 4Q9IA 2ZRHA 1K5DA 4UNRA 1G5PA 1GWNA 1KJWA 2NO7A 3MG9A 1NG1A 2FU5C 1HQCA 5KSYA 3VMFA 5IHPA 4GOXA 3AQ4A 1P61B 4LDJA 1NLFA 1UBEA 3N5CA 5EE5B 1E2PA 1U8YA 3KQUA 4UXHA 1ZAKA 4EPXA 1UKEA 3CPJB 4BUJA 5GVSA 4RVCA 3Q85A 4OI1A 4OHZA 2GCOB 1E99A 4PC2A 4PHTA 1RC8A 1VPLA 4TWZA 4B44A 4ZIRB 1N5LA 4POAA 3TGPA 4CEIB 1N6OA 2JATA 4LHWA 1OKKD 4NPHA 2ZU6A 2BDTA 4ERNA 2R6GA 2OILA 1E4YA 4XTCS 4BEJA 3I62A 1IBRA 4A9AA 1YR9A 2EFHB 4V0KA 2V6JA 4IW3B 2IYQA 3ZGXA 4BZXA 4RZ3A 5FI0B 3AVUA 1E2GA 2DBYA 3K09A 1YRBA 2VEDA 3NHAA 3WYGA 1ZIPA 3GFTA 4P33A 1JQJC 3LLUA 1SHKA 3MCAA 3TUIC 2HEIA 5BN5A 1VIAA 1KO1A 2E1RA 1CKEA 5A4JA 2J0UB 4A0RA 2YYZA 4IVQA 2NO1A 1EX6A 2CHQA 3AUXA 1GKUB 3EIQA 3THYB 1NRJB 3B2EA 1D9XA 3H84A 3AH8A 3C8UA 2OT3B 1DO2A 1XEWY 3SJCA 3NTUA 3VX3A 4LWZA 1E2HA 4F93B 4IDPA 3SNHA 4ZDWA 5L3QA 1GRRA 2ANBA 2CMKA 1NJFA 4RD4A 5FOTA 1WDTA 3UWKA 5HKKA 4TZ0A 1Q0UA 1VG0B 2IA5A 3PIRA 2QAJA 3K0FA 2MSCB 3GFOA 3X1WA 3RC8A 1G6OA 4GOKA 4PXAA 5FOWA 3AM1A 2GA8A 1JR6A 1Q1QA 4P31A 3J81k 5A5GA 4A6PA 1LF5A 2O5VA 2EYQA 3SFZA 2O8EB 1GNPA 4K46A 5L3VA 2HLDD 1N6HA 5LB4A 1TX4B 2PT7A 2JIZD 1U8AA 1MH1A 5FPKA 3E70C 3UWOA 4WW0A 2XAUA 1RKBA 3T5DA 1XJCA 1U99A 4HAYA 4NMMA 4PSKA 4E5UA 1DBSA 2J7PA 2XNDD 4B3CA 5FH9A 1E2FA 1ONBA 2ZSDA 4QM7A 4MUBA 2F1JA 4QJ4A 5DGXA 2EWWA 3AKCA 3M1IA 1N0WA 3TMKA 3KXIA 4YMUA 3NEJA 4QGFA 4AIIA 4Q18A 2C5LA 1F6BA 2RGNA 5A0FA 4F38A 4C9BA 4JJKA 4R98A 3GFPA 3ZJYA 2FF7A 1SHZA 2VHUA 4BRWA 1FUKA 4GBMA 2W58A 1S1CA 2VRWA 5CYOA 2V6IA 3KJHA 1MO4A 4PQFA 4AG5A 1II9A 1UM8A 1KKLA 3IHLA 4QBGB 5DNYB 3C15C 4C0KA 4OHWA 4LHXA 2B8WA 1WB9A 1MABB 1W0KD 2GWHA 2QY9A 2I1VB 5CLQA 2XXAA 2QN6A 2QL6A 3ADCA 1OHHA 1KK2A 1CJVC 2YC2C 4HUQA 4HUTA 5CJPA 3GEEA 3FHTA 1SXJD 2JA1A 1P62B 1U98A 4M1KA 2JIZA 4LZZA 3I32A 2PCLA 2Z4SA 1KSJA 3PG5A 5CK4A 2ZRCA 4W5WA 2AXNA 5KNCA 3B1YA 2ZJZA 1L8QA 1RIFA 5ANRB 2G88A 4QGAA 4UQOA 2W00A 4CRWB 3L43A 2J7PD 2XNDA 1QG4A 2PJZA 2GXAA 4AWXA 1D2MA 1P73A 2R6DA 3CX6A 3D8BA 3HU1A 1SXJC 5E7JA 3A36A 1VHLA 3L0SA 2OXRA 1DADA 1T8UA 3IO3A 4B3XA 4RD1A 3TUJC 3U4QB 4LPKA 1E2EA 2IHBA 4ZCMA 3LDAA 4Z1MD 2WBLC 1ZU4A 3OFND 2X77A 1IHUA 4M9SA 1N6KA 1JEDA 3THXB 2YZ2A 4PQYA 3OAAA 3K0CC 3QBVA 3LQQA 5H1YA 1B23P 3NC1C 3F8TA 4QJ5A 1A82A 4RD0A 4XH9B 3KJIA 2VBCA 4AKGA 1YHNA 1G5TA 1GL6A 2RHDA 4R7ZA 2GVDC 4EJSB 1XEXB 3QXCA 4L16A 2KBFA 1P2SA 2OEPA 4HB3A 1SGWA 2A7QA 4MYTA 1GM5A 2XX3A 1Q12A 5TY0A 1W0KA 2ZRPA 1NIJA 2A30A 1IXZA 3NC0C 3ICQB 4PZZA 1OFHA 3CR7A 5FBQB 2MMGA 1LTQA 1SXJA 2CL0X 3KUCA 1YQTA 3QJYA 2ZYUX 2MSEB 3DDCA 1U81A 1U0LA 3B13B 3BIFA 4DEXA 4Q9JA 3RS3A 2ZVPX 4M21A 1E94E 2MSDB 3QKRA 4YXWD 1UEJA 3U7HB 3VKGA 2GJSA 2F43B 2EFGA 2GK7A 2XNSA 1ZINA 4BZQA 2BM1A 3K9LA 1MV5A 2QROA 4ZI3A 2Q21A 4I1UA 1PLLA 3VQTA 1A5TA 4OQNA 4JMPA 4O2RA 5FTLA 1D2NA 2XZLA 1M2OB 5SZKB 2GJ8A 4BFUA 3NBYC 4KU4A 2F6RA 1OH6A 3AVQA 2YOHA 1G3UA 3B6EA 3EPKA 1G18A 2F9LA 3BH0A 3ASZA 1ZC4A 1W36C 2ZI3A 3CPEA 4Q9HA 3UANA 4LJAA 3SQXA 1KO7A 2BMFA 3A1TA 2EFEB 3MWKA 3L2OB 1Z8FA 3IILA 4DC9A 2I1QA 3CZQA 2VHTA 2J41A 4IDQA 2QZ4A 4MKFA 1HY3A 2D4HA 3IIJA 3OEEA 5EP3A 2HCBA 1ZNYA 3DOFA 2AFHE 4OI4A 4KITB 2BEJA 4CGZA 4Q4AB 2LKDA 3PUXA 5JBQA 421PA 1OXUA 4QJ3A 4Z54A 4RZXA 1N0UA 3KZ1E 4C3ZA 3W5IA 3ZZ0A 2ZRIA 4IRUB 1XF9A 4B32A 1E1RA 2IS4A 3GPLA 3REFA 5JJKA 2VHQA 3TIFA 1ZC3A 1XEFA 3GLFE 1IM2A 1A1VA 4HLCA 4DB2A 1X6VA 4KSCA 5EQTA 1FX0B 4B2LA 3L0IB 5C46F 2JLRA 3SI7A 1HV8A 4U7DA 4D2IA 5TMPA 2PZGA 1OXVA 2Q3HA 3DHWC 2FFQA 4QHTA 3WP0A 3ONWA 5DI3B 2JDID 4BLPA 4AYXA 2WJJA 1LW7A 3KKMA 4XWOA 3X1DA 1O87A 3BB4A 3LXRA 2NIPA 4B3FX 5DE3A 4LV5B 4TSFA 1JB1A 3O8CA 4DCVA 1I4LD 1DOAA 1AZSC 3TK1A 3LLMA 2OG2A 3IDQA 3NBZC 4GPTA 4HI0E 3VKWA 4O3MA 3LW8A 3MLEA 5EXTA 3FTQA 4EFLA 2ASEA 4R9UC 1TADA 3K53A 1FQKA 3LBHA 3ZLJA 4ZKDA 4JVSB 4PHGA 2OLJA 4HZUA 5E4FA 2XB2A 1HH4A 4IDNA 2P0EA 1JAHA 2FPKA 1U2RA 1YZTA 5J40A 4R71A 1Z6GA 3PR1A 3WNCA 3NBFA 5SZIA 2AHOA 2W0MA 2IBMA 2J59A 2CLSA 3FMPB 3HU3A 5FBLB 1OXXK 5TV2A 3TSOA 2ZRAA 3RRNA 4LV6A 2GAAA 5B30A 1UBGA 1GOTA 3AUYA 2BKEA 2J1LA 3TVDA 4AI6A 3QF4A 1RRGA 3U44A 2OHFA 1JNYA 1NBMD 3QG5A 4EPTA 1GAJA 4XOIA 4DUGA 2O8BA 4OI0A 2EFCB 1RYFA 2BHRA 2QP9X 3CKLA 3KJGA 4H9GA 4HEJA 1FQJA 2BMDA 2JDIA 3O47A 4JLBA 4Q4HA 4X8HA 3ZS9A 5EP1A 3U60B 3B7GA 2HCJB 1G1MA 4ABYA 1Y3AA 2J0VA 1ZW6A 4G5RA 2A3RA 3JZAA 3K0SA 5FBWB 5GJVC 4QXAA 3IEUA 4F4JA 2CLCX 1W47A 4IEEA 4TMVA 2NO6A 4NP6A 2ZRMA 2A5YB 2J0QA 2C96A 1G6HA 4W5HA 3SYNA 1BO6A 2O52A 2WZQA 4OL0A 3W6OA 2IS6A 2BCGY 3P1JA 3GEHA 3MWJA 2RKOA 2CK3D 5HZHA 4C7OA 3EZ6A 2FWRA 4DVGA 1N3BA 3CONA 4ESHA 2TMKA 2GETA 1KI8A 3CPHA 1N6RA 1S96A 4JS0A 2CHGA 1Q44A 4EJSA 2G77B 2PMKA 2VA8A 5FUWA 2R65A 4F91B 1G21E 2D62A 4OJQA 1DE0A 1NY6A 4TMWA 4UXIA 2HJGA 4V0LA 1R5NA 5FUXA 4E22A 1Z47A 2ZRNA 1E3MA 1NBMA 5H68A 4CF7A 4HB2A 1OFIA 4PO9A 1IN6A 2PZFA 4MUAA 2W83A 5FI1B 3GLGA 2GF0A 1X8JA 1Z6AA 3K0CA 2JJ1D 1AS0A 5G40A 1NMXA 1S9HA 2AWOA 2OFXA 4XVRA 4BFTA 1ZU5A 4HYYA 3ZH9B 1KZGB 1KHTA 4ZV4A 4XVUA 4X8OA 1D8TA 1TU3A 2A9KA 1KK0A 2FN4A 4LJYA 5EP4A 4D25A 3KXLA 3TBKA 3PEWA 1W0JA 4DLYA 2BC9A 2X2EA 3BB3A 1ZNWA 2Q9AA 2C9CA 1W49A 2XJ4A 5J5CA 4L4UA 3WXMA 1QHYA 3OIWA 5KOYA 2XTNA 4DSUA 2GTPA 5D3QA 3M6AA 1CJMA 4YDHB 3QKSA 5B2ZA 4NYIQ 2D06A 4DSTA 2FV8A 1D6JA 2IUTA 2G3YA 2OBMA 4K81B 4WXPA 1FNNA 2VLIA 3FFAA 1W4AA 4V0NA 2ZJAA 5ELXA 4URUR 4BASA 2GJKA 1EWRA 3TNFA 2ZANA 3K09C 2ZYWX 3P32A 2DHRA 3NH6A 2ORVA 3D3QA 2C04A 1LF0A 2NZ8A 1UKVY 2MMCA 2N1BA 1E1QD 2QAGB 1K6MA 1XTSA 3CRRA 1NI3A 3RLFA 4BLRA 1EGAA 3DVLA 2WWGA 4IVPA 4JZKA 4PC3A 3BOSA 4PFSA 3GP8A 1OKKA 4B43A 2WICA 3VR4A 1G4AE 4X8MA 4IKEA 4NYMR 5KO2A 3ZVNA 1MRNA 3KKNA 2QUZA 2A5DA 2QM7A 2P6RA 5CM9C 5EUQB 3QNUA 5GJWC 5LPNA 1KI1A 2ZRJA 2CNWD 1XPUA 2QT0A 3LVRE 1Z5ZA 2GCNA 3EXAA 1EX7A 1GP2A 2ZR7A 2F55A 1M6NA 4C4PA 1XTKA 4N1AA 4B6EA 1VMAA 1CP2A 3VU9B 4B3DA 1E9SA 2CVFA 2J0SA 4Q5IA 3H1TA 4EQ6B 4IXNA 3VNVA 3T15A 4V0MA 4BWYA 2ECKA 2OE2A 3GLHE 4LBYA 1OV4A 2Q0HA 2JLYA 2D2FA 2GVZC 1HT1E 1M1YE 1VTKA 1KSGA 4DDVA 2XTZA 2ODWA 4JT2A 5C2JB 3HWSA 1DO0A 1J70A 4B48A 2D74A 5JWHA 1ZVQA 4Q7LA 3RS5A 1FFHA 1VHTA 5HKKD 5J4YA 4BRUA 2FGJA 1MOZA 1L4UA 3NIBA 3EA5A 3GLFB 3HPRA 3MWLA 2WWYA 1XTRA 2Q3FA 2XJ9A 3FMIA 1COWD 1II0A 1UKZA 2XEXA 3NXSA 3KKOA 2D7DA 1FTNA 2H8KA 1K8RA 2VSXA 4QNMA 3KXKA 2HLDA 3PVSA 2ZETA 3QQ5A 4Q1EA 4GMXA 3IHWA 2A5JA 1S9DA 1XCMA 1N6PA 1CR0A 4P32A 4A92A 3CX8A 3SHWA 1Z0KA 2IYSA 4RD2A 3QEJA 3QKTA 1KMHA 4DHEA 4EFNA 1Z2AA 2QPOA 3SZRA 5JEDA 3V00A 3AVTA 2BWJA 2WJHA 3OESA 1Q1ZA 3SC3A 2FSGA 1NVVR 1VIYA 1G64A 1TF5A 4B3BA 1EFRA 3ZQJA 1NL3A 3SBDA 3KQHA 1E2NA 1E2LA 2GEUA 1TU4A 4JLDA 1FL9A 4L9WA 4A2QA 5DISB 4V03A 1ZM7A 2ZEJA 3EWAA 5HZKA 5TVKA 1G7TA 4IOMA 2IF2A 2QGZA 1JR3A 1XEXA 4KYIB 1U9IC 4PPGA 3B60A 1KK3A 2A5GA 4AKIA 1SVOA 1KSFX 4OHXA 4V0OA 5EXXA 4LPSA 1COWA 5FL7D 5JLJA 2BBWA 4K8OA 1IN4A 5F3WB 5JCZA 2GXUA 3RC3A 3OEHA 3P4YA 4XSGA 2FFHA 1W4CA 4IDOA 4TYPA 4BFVA 2BJVA 2CHVA 2GBLA 1M74A 4U02A 1MABA 1AK2A 2JCSA 1Z3IX 4JSTA 4B35A 3UK6A 3CNLA 3GLGE 3H86A 4JL5A 5KPDA 3OFNA 1D2EA 1NSTA 1P75A 4US2R 4HLQB 3C5CA 2QQ0A 4TL9A 1TUEA 1NG9A 3FMOB 2IS2A 4RY2A 1QHIA 4C2TA 2WSSA 3DKPA 3AGPA 2OSBA 2FA9A 2BMEA 3VR3A 1R0ZA 2YWHA 1KNQA 3DO6A 4LK2A 5J4LA 1CR4A 1BOFA 4KAXA 2Z5FA 1OXSC 1XRJA 2P6UA 3IIMA 4JJZA 1AIPA 3LAWA 3U3RA 3WYFA 1JR3D 1YZGA 3RS2A 2N46A 3ZD7A 2OCAA 4CIDA 2HXYA 2BV3A 1KJYA 1XB2A 3E5HA 1Q21A 4ZDJA 2ZVQX 3D31A 3Q5EA 2G0NA 3IPYA 1E9RA 1YU9A 2BVNA 5HCNA 5IK2A 5SZHB 3AF2A 2QG6A 1WBDA 3RWOA 3ZVMA 3WYAA 4B33A 2QGNA 1FUUA 4KBGA 1JBKA 1S0UA 4B71A 1VYUA 2W0SA 2NTYC 5FUVA 1B0UA 4LYAA 1BKDR 8OHMA 1ZM2A 1KAOA 1E98A 3H0KA 1J2JA 2RCNA 3THWB 1QHSA 4C0HA 3WP1B 3WNBA 1CXZA 3W8NA 821PA 4LBWA 4D6PA 4WAUA 2X2FA 1A4RA 3HR8A 1R0WA 4GDFA 1OW3B 2H5EA 4ACAA 4M8NE 1N2CE 1JPNA 4NONA 3B9PA 3SQWA 1HA3A 1J8MF 3OIVA 5FBRB 2R2AA 2AN9A 1VCIA 3AVPA 4C0QC 5CM8B 3C7KA 4UXJA 5LD2B 5FPTA 1SKYB 1Z63A 5EZ5A 2FSIA 5JWOA 2C98A 2ZU0C 1W4BA 3K0AA 2QMOA 1GDDA 3KDSE 3WHLA 2AX4A 4CVNA 3GEIA 2JJ2A 1IN8A 1S3SA 5AJYA 1VKJA 5IF9A 3A4NA 1QVRA 1G17A 1Z0AA 1DVRA 4ZDKA 3F0TA 3QENA 1KYIA 1QZXA 2ZITA 3FFBA 4JLAA 2OXCA 4HB0A 5C4GB 2RGDA 3EA0A 4DEYA 4ZCIA 3K9HA 4F4CA 1R5BA 3AEZA 4DLSA 3SU8A 3TLXA 4JKIA 3KQLA 1BIFA 1P4SA 5KPJA 1F60A 3LXXA 4RSGA 3O8RA 2HF9A 4Q9LA 4M4SA 1CRQA 1US8B 1J7KA 1G9XA 2ZRBA 2QTFA 4TT3A 4M1TA 1P7CA 1CLUA 5TB5A 3AVVA 3QKUA 4QHYA 1IJEA 2UKDA 4W5JA 1T6NA 4IDHA 1FNMA 4DCNA 2IUSA 5TXGA 4B76A 1VCMA 3CB4A 3SDZA 1XXHA 1PUIA 1VG9B 2F1RA 4GRAA 2C95A 2JGNA 3WBKA 3IQXA 1ESNA 1PLKA 1FX0A 1PLJA 2QP4A 4UNPA 5KSPA 3T1QA 5JRJA 1D9ZA 2ZPTX 1G20E 2JJ2D 2X19A 2GXQA 4OKSA 3LQRA 3VKHA 4HZIA 2R6CA 3SFVA 3CRQA 5FL3A 1KI6B 3PV0A 4JLPA 1QF9A 2ZRGA 2GEDA 2QM8A 1P2UA 1Z83A 4TQAA 3B1ZA 2VP2A 2NO9A 1R4AA 1G3MA 2JASA 2V1XA 4EPRA 1OXTA 3S1AB 1KY2A 3HDTA 1GKYA 1E9AA 1NF3A 4OK3A 4PPQA 3LNCA 3N70A 1G7RA 1GRQA 1Q22A 4L15A 1KMQA 3VAAA 4A6XA 4B73A 4DCUA 4DBLC 4LYJA 4PC7A 4NYJQ 3QVVA 3GLGB 721PA 2LWIA 1XTQA 1UKYA 1W2GA 1FOEB 1WP9A 5FPYA 3X2SA 1CJTC 2VIIA 2BMJA 5LB2A 4CDGA 4HAWA 4Q1DA 3SYKA 5F9FA 2NZJA 4CW7A 2G83A 4HDOB 5KHOC 5JHHB 5FTMA 1YKSA 2ZR0A 4FXPA 621PA 3TH5A 1VDZA 2CDNA 2GCOA 4P4TA 3ZS8A 4JYBA 5AUOB 5G53C 1Q1BA 1RPZA 1HURA 2P3SA 3Q7QA 3FGNA 3REGA 3NH9A 2C8VA 1ZRHA 4JVNA 4Y0VA 5E95A 1XNJA 4S2EA 4C0LA 4Q4JB 1KOFA 4GZMA 1I4DD 4MDEA 2H92A 3FYHA 3CNNA 1QHHA 5DI9A 1UPTA 3CF2A 4JLVA 4GOJA 2AD1A 3A1VA 3EC2A 5EP2A 1AQYA 1VCOA 3PEVA 1ZJ6A 3WHKA 2B7CA 4AKEA 3AKYA 5K8LA 5KYKA 1N5IA 4IJMA 5CB6A 1W46A 1H8HA 1X1SA 1T5IA 4TQ9A 1E0KA 2JJ8A 1GRNA 1PZNA 2W6ID 3A4LA 4A1FA 2OFOA 5LD2C 3A4MA 3RS0A 1E2JA 1HUQA 1OLOA 2JLQA 1WCV1 5DO9A 1NNEA 2A78A 3CM0A 4RZ2A 1NVUQ 2ZJOA 1OYWA 4HDQB 1A2BA 1H65A 1S1MA 4DT1A 2X8AA 3EIEA 1XMIA 2IXFA 4P3YA 2V7QA 3SJBA 1Q3HA 3GJ6A 1FZQA 1R0YA 3A58B 4DWJA 5AJWA 4H1VA 3CW2A 2WPDA 2X1VA 2YHSA 2R8RA 1CR1A 4NCIA 4D26A 1GUAA 2J46A 4FMCF 3I61A 5KNBA 4KJZA 1WBBA 1JJ7A 4A8JB 2OCPA 4LSGA 4TMXA 5FTJA 3BXZA 4ZI2A 2O8BB 1C4OA 4LRWA 4TN1A 3TRFA 2O8FA 2QAGA 1Z0JA 2R6FA 4PZYA 1G5RA 3AP1A 3U6BA 3IEVA 2ZS7A 1BYIA 2J87A 3QOFA 3PENA 2RH5A 3BGWA 1ZP6A 1QDEA 2WHXA 4TL8A 4DLVA 1QVAA 1S8FA 2ERXA 3X1XA 2RGEA 4D82A 2OCYC 4GSYA 1R0XA 1XJQA 1KTVA 2D2EA 4IFBA 4L8GA 3W8RA 2WTUA 4HAZA 2ZJYA 1JJVA 1IY0A 1GL7A 2QP3A 1E0AA 1FW6A 2Z4RA 3RANA 1T8TA 2W6IA 2KB0A 2RGBA 5FOSA 3A6PC 6Q21A 1IXSB 5KSZA 5HTKA 3A1UA 4UKDA 1W5TA 3ZIAD 2O8FB 2F43A 1CS4C 2D3WA 3NVAA 4FCWA 2ZSBA 2FZ4A 2HT6A 1CIPA 2ZUBA 5FR2A 2V7QD 3GJ4A 3R9WA 3BS4A 4QGGA 4R2HA 2ZI4A 3ZYCA 2IYYA 2DB3A 4PQRA 1XBTA 4ESVA 4JIMA 2QE7D 4N0DA 1N6IA 1Y63A 4KYUA 4G3XA 5BWMA 3U2QA 3TJZA 4PR0A 5AJZA 4Q7KA 3GCGA 4MITA 1KO8A 2CCJA 4FINA 2HUPA 5J4VA 3FKSD 3K70D 3CH4B 4QL3A 3EX7C 1EG7A 5FTNA 4DCTA 2O0HA 3C4JA 3LO5A 1SVSA 2W6JD 2PBRA 4DT1B 1X3SA 3LA6A 4DSNA 3FB4A 2ZR9A 2JLWA 5J47A 3IKJA 3NG1A 4OYHA 1Q3TA 1P2TA 4PC6A 1NKSA 2P5SA 4RD3A 2CCKA 3R20A 1H8EA 1CBUA 4RCYA 2CXXA 2RGAA 1RFLA 2ZS8A 4OI2A 4US0R 2ZRDA 3GJ8A 4B75A 4EPWA 121PA 1T91A 4GNKA 4D4JA 3NDBB 3WMFA 5BN3A 1G7CA 3W9YA 4MDFA 1ZMXA 4NBSA 1OIXA 1G3RA 2YNMA 4KHZA 4M1OA 4EIWA 3AVYA 1RW4A 1CEEA 1SVMA 3U7GA 1PV4A 2QE7A 2GNOA 4BEBA 3PCRB 2NOAA 3I92A 4D0NA 2CL7X 2ZAMA 3ND9A 4RFSB 4YMTA 4US1R 4WZ6A 1ZM4A 2OFWA 3FDIA 4EQ6A 1KGDA 4TMZA 5EXPA 5P21A 4FCVA 2REOA 1YRAA 3T5GA 1JXMA 2OAQ1 1EFRD 4DLTA 1TAGA 2ZAOA 1NLZA 4X8LA 2W6JA 5JS7A 2HV8A 3LFUA 5CITA 4TYNA 3NBXX 1GFIA 4Q9KA 1R5OA 1G41A 2YJTD 2AK3A 4Q66C 3GLFA 1NJGA 5DHAA 2OBNA 1E9BA 3EPLA 2NO0A 4CEJB 3KTAA 2BCJQ 4PZLA 2ANCA 2HT1A 2ZSEA 1OFUX 2G9NA 3RWMB 4ARZA 3B82A 2Q9CA 4C2UA 1QHXA 1V5WA 1CU1A 2YOGA 4QOSA 1OSNA 4AYTA 3CRMA 4NCKA 4DLXA 3LBNA 3W3AA 1OB5A 2H57A 5IT5A 3MWYW 4ZPXA 2HJVA 1OF1A 3GJ3A 4YMSA 2XSZD 3L82B 4AD8A 5C4MA 4QG7A 1ZCAA 4A0GA 1EXMA 2FNAA 3D7MA 1P9NA 1U90A 2IWHA 1KK1A 1Q1EA 1F2TB 3FWYA 1OH5A 3D6TB 1BYUA 3F5FA 3MAAC 4CYMA 2G1JA 5G41A 3SS8A 2DPXA 2CCGA 4RKEA 2FPMA 3EG5A 1N0VC 1GILA 2EW1A 3ZVRA 2WVJA 4WVFA 4WZAE 4NE2A 1RJ9B 3Q72A 4C30A 1JECA 3OZXA 2IK8A 3EC1A 3T06B 5LDDC 2BBOA 1NVWQ 4Z51A 3DM9B 3PITA 2QSZA 1GNRA 1Z29A 4JL6A 1AZTA 2VSFA 5HR5A 2QT1A 2P5TB 2PLRA 3SE0A 4MYCA 4URWR 3AP3A 4JBXA 3OIUA 2FOLA 1ZIOA 4DKXA 3GD7A 2GEVA 1KAGA 1DELA 1ESMA 3KJEA 3L0PA 3MSXA 5CK5A 2DFKB 3SJAA 1KDOA 4Z8YA 4EKDA 2FSFA 3C16C 4HAUA 4OK6A 4Y0AA 3S1AA 2PT5A 1G7SA 1UADA 1TQDA 1OHHD 5D3MB 3B5JA 2BBTA 1MRSA 3AVXA 5CYPA 2QSYA 3KFVA 1HYQA 4P4SB 4A8JC 3JVUA 3P26A 2EU8A 2WJIA 1KI7A 3K0AB 2ONKA 3RAPR 4TL6A 5DN6A 5JRZA 3R9XA 2QA5A 3ZVLA 2P2LA 1CRPA 1PVOA 1UEIA 1MT0A 4RCZA 3OHMA 3MJRA 4V0ME 3QXHA 4Z1MA 3T1OA 5KU1A 1J8YF 1ZNXA 4AKHA 2B7BA 1SQ5A 4MKIA 3E1SA 3JVVA 4NTZA 5CJ2A 3VR1A 4URXR 3BFVA 3UMSA 4CZ2A 3CWQA 4A2PA 4DIEA 4LV8B 3LRPA 1E9CA 2QMEA 2XOKA 1RRFA 3Q7PA 1C9KA 3K9GA 4NYJR 1SXJB 3SBEA 4FIDA 4R2IA 1F5NA 2KI5A 2I3BA 4TLBA 2NPIA 4KFUA 1QG2A 5M04A 5DYIA 3X1ZA 2F3TA 4GI7A 2IYXA 1LNZA 4MYHA 2WKRA 2F7SA 1VYVA 2HYDA 2WSMA 4QKQA 4C0JA 5EE3A 1FP6A 1MO6A 1TMKA 4L9SA 1JPJA 1SVLA 1TEVA 4ZDIA 2XZPA 1XXHB 2C03A 3GQBA 1US8A 4IOJA 1R10A 4MRSA 2ZI9A 4I1OA 3K0FB 3CNOA 2CE7A 3W6NA 2PLFA 5IDVA 1L4YA 3NEYA 4LBVA 4MYUA 4C0SA 2REXB 5AJXA 5L3QB 2OO7A 4LBZA 4PX9A 2VF7A 2YC4C 3AF4A 3DL0A 1ETUA 1TQ6A 2GJ9A 4EDHA 4BFYA 1JR3E 1WRBA 1E2DA 3ZZUA 3V9PA 2WWIA 2CVHA 4LUCA 3MGCA 2O8CB 3CF0A 5EZ6B 2DY1A 4A8JA 2WSSD 1Z06A 4IHQA 2XOKD 2QNRA 2ZUDA 1W48A 1G8GA 4Q03A 5EJEA 2FEOA 5B64A 2EYUA 3UG7A 4DB4A 4E07A 2F1IA 4JVMA 4F7WA 4KFTA 5EE0A 1IONA 2C78A 1XWIA 4PSVA 3QF7A 1T9HA 2ZXUA 2UZIR 2WWWA 1BS1A 1AN0A 5L3SB 1G3QA 3AF3A 3LD9A 1DARA 2VP9A 2WOJA 1GIAA 4MGIR 4P0TA 3PJRA 3U7EB 1DAMA 1YVDA 3SYLA 2AL7A 2YWEA 2K5UA 3I8XA 5IK2D 3VR5A 1WQ1R 2ZE6A 3CBQA 1M7HA 1P2VA 3A1WA 1ZNZA 2ONJA 3QXXA 2CLDX 5AR1A 4CEHA 4TLEA 4FI3C 1G8HA 1E69A 4TTQA 1I4TD 4GFDA 3LY5A 3RRMA 4PHHA 5CDFA 4Q02A 1A2KC 3IUYA 2V3CC 2ZUCA 3G5UA 3OAAD 1S4QA 2FPLA 4D0LB 3HYTA 2FEMA 2YWGA 4NKRA 5K8TA 3KQKA 2Y8EA 3QPUA 3QPVA 5FPSA 2JLUA 3AGQA 4MKHA 3K70C 3N2IA 2ATXA 1YZKA 2ZJBA 4LY6A 4YQFA 4D0GA 2GAOA 3PEUA 4ILEA 5JJLA 1V43A 1DG3A 1CTQA 5JSZB 2V9PA 4D4MA 3QXJA 5KDOA 3GLHB 2VP6A 2YV5A 2I4IA 3TW8B 5E7MA 2ZSAA 3CUEF 3RRZA 3QEOA 4NCNA 3W34A 1NBME 3PUYA 3WMEA 4BLQA 4Q21A 4IVRA 4OQXA 4AYWA 3CR8A 3EZ2A 1OH8A 1UJ2A 5HE9A 4YXWA 2EQBA 2ZROA 4RFVA 3UATA 1X8LA 2EVWX 2H16A 4E09A 1O3YA 1TF2A 4DLRA 2CL6X 2WV9A 4QHSA 1RZ3A 4PAQA 2GF9A 4XIGS 4GZLA 3I72A 4Q01A 1E96A 2FFBA 4FD2A 1TNDA 1ZM9A 5JSZA 1G19A 3ASYA 3QPWA 4D4KA 4I99A 2Z43A 3EWSA 3O8DA 3PXGA 2GZAA 3OE7A 1R7RA 4NCHA 1T3LA 2J9RA 3CLVA 4DUGD 1Z6TA 5DI3A 3VR2A 3DPUA 2XGJA 4LGMA 3W5JA 5FOXA 1BH2A 2KBEA 4A36A 2FG5A 2O0JA 2C77A 4UNSA 2FSHA 3H4MA 1LB1B 2W2VA 3R8CA 1E2KA 4U5XA 4G5OA 3NDPA 4TYQA 1IAQA 1I2MA 1N25A 1OJLA 2W2TA 4ACBA 1E79D 2QRZA 4JBYA 1P6XA 3BFXA 4KCGA 2QPAA 4DLUA 1KDPA 4A0FA 5KUTA 4KFSA 3T35A 1T5LA 3EW9A 5AUNB 4PHFA 4CEIA 4BQSA 2AD5A 5F9HA 4JLNA 1DEKA 4FWIB 4J0QA 1UDWA 1ZYUA 3T61A 1E1RD 2DWQA 2KWIA 4LOAA 1QRAA 3AKEA 1WF3A 2DR3A 3U3KA 4RD6A 5TDHA 5JFGA 1N6NA 4E03A 1AKEA 1F48A 4IEIA 3W90A 4XWKA 1Z2CA 4TMKA 2ZYVX 1HTWA 1IN5A 3HR7A 4LYFA 2DYKA 4GP6A 4TLAA 1G16A 4M9XA 3LWNA 5FPHA 1TTTA 1XU4A 1OIVA 2RMKA 1CJUC 4YONB 2VYFA 1CULC 1XCGB 4YMVA 2XZOA 4CEHB 1WE2A 4P4UA 1WA5A 3RNLA 4Q4AA 1SKQA 5FR1A 1KI2A 4QC2A 5GADl 3FOZA 4EUNA 1E2QA 3P4XA 5HPYB 2ZM5A 3ADDA 1TPZA 1HT2E 4H1UA 4FMDB 1AKYA 4TSFD 3VFDA 1DS6A 2PH1A 4Q4LA 2FDCA 3T1VA 2IF0A 4RFSA 3IGFA 5AUQA 1UFQA 1U9IA 1U8ZA 3I5XA 3R7WB 2WKQA 1EWQA 3AVWA 4A2WA 4QNRA 4DXAA 2RGGA 1ZCBA 5L8VA 1GITA 5JWRA 4PPNA 2O8CA 1X1RA 1XD2A 1M8PA 4JYCA 1E9FA 1UBCA 3ZQ6A 3DMNA 3DM5A 4M22A 1GL9B 1OYYA 1L2TA 5HCIA 3K1JA 3GMTA 4TLDA 1KO4A 3HU2A 5L3RA 4TYWA 1XFAA 1AGPA 4HAXA 5BYJA 3LW7A 1QHNA 3QG1A 1DAEA 4DZZA 4MRNA 1ZUHA 2F9MA 1NIPA 1W1WA 4M1WA 3TAUA 5JHGB 5EXSA 1XP8A 4BFZA 1EESA 5JS8A 4RKFA 1IY2A 2B6HA 2G0TA 2QQEA 4HATA 5CIQA 2ZJ8A 2VSOA 2OBLA 2R62A 1AA9A 3OIYA 4TZ6A 4IFEA 4TQUS 2RGXA 4CEJA 1NVXQ 1P5ZB 1SULA 1Z28A 4M9QA 4Q4JA 2FE4A 4B2IA 3HP1A 2P65A 4M1YA 1T3HA 3SN6A 3BB1A 3BFKA 5F98A 5CLLA 3VHXA 2GHIA 2GZHA 1LS1A 2BIFA 2FZLA 3B8HA 2AR7A 1GVNB 4EPVA 2FJUA 2RB4A 3GJ5A 3O8BA 3G82C 1L7VC 4XTRA 3DEFA 3DKVA 4Z8XA 3T12A 3H2YA 2WPDD 4G0NA 5DYGA 1XD8A 3RS4A 1A7JA 1E2MA 2ZIAA 3SEAA 1AQUA 3AB3A 4NL4H 4ZCLA 3PFIA 2FX3A 2RHMA 2DWPA 1EFHA 2IW3A 2VP4A 5K8UA 4AG6A 3FVQA 3THYA 3HJNA 2IXEA 4PC1A 3WY9A 4WZBE 4RZUA 1DAIA 2VHCA 2BJWA 3HPQA 1DAFA 4G5QA 5FOVA 2WAXA 1W7AA 3MJHA 4LJ9A 1XPOA 1E32A 3I1FA 5KDDA 4C0AC 2A5FA 1K5GA 1I2DA 2REBA 3BH7A 1G8YA 1XMJA 3EASA 2OLKA 4EFMA 2PJRA 1TF7A 1KIMA 3GJ7A 3K0EA 221PA 5GJCA 4TL7A 1IJFA 5GJBA 3CWZA 3EIHA 4UNQA 4G5SA 4OHVA 1ZD9A 3TUZC 1GSIA 5FUYA 3AKDA 2ZI6A 1KZ7B 4M53A 3QSYA 2Z83A 3BE4A 4WOPA 1DAKA 2ZRLA 1E6CA 4M1SA 4AURA 4LC1A 3CRW1 3U61B 2QTVB 3BBPA 1E0SA 2IT1A 4Q7MB 4B47A 3T1TA 3UMRA 3VNUA 4DLZA 5FOUA 1U0JA 4QRHA 3QIAA 5C1BA 4WXRA 2VTKA 3MUFA 5DHFA 3THOA 1MO5A 4MRVA 5G3YA 4ZIRA 1KY3A 4D80A 1GTVA 2NGRA 3BJIC 5JI2E 4II7A 2ODBA 1EFUA 2GESA 3KL4A 4DCSA 3IBGA 4PANA 2ZRFA 3BORA 2V4ZA 3BRWD 3FKSA 2PCJA 4W7SA 4BFWA 4KLZA 2FH5B 4JBWA 2OESA 4Q7JB 3KTAB 1Z08A 3LV8A 4BLOA 1YR7A 4FWTA 1XDBA 2QTHA 2QPTA 1UBFA 3B78A 3MFYA 2Q6TA 4NU0A 1Z0FA 2CJWA 4N3NA 2AWNA 2LCFA 3V4FA 5UKDA 4BGDA 4D4LA 3MRSA 2QBYA 2WJYA 1NMYA 3DZDA 4L5BA 2AK2A 4M2LA 3TSWA 3FHOA 5FL7A 4ARZB 2VF8A 4HDCA 2QMHA 2PZEA 1YE8A 4YDSA 4JKYA 2FGKA 1F2TA 1TUIA 4DDWA 4B74A 2LKCA 3QBTA 2IHYA 3Q3JB 3OEHD 2JEOA 3K8YA 4M1MA 1KI3A 1ZD8A 3EZFA 3I8SA 1S2MA 4A15A 1UAAA 3B1WA 1P3JA 3U3JA 1IN7A 3LX5A 1N5JA 1PUJA 2BOVA 2WM9B 2CJWB 1NVVQ 5DH9A 2W2XA 2JLSA 3RVBA 1KMHB 1X8KA 2VP0A 4ON9A 1Z22A 4ITRC 3KQNA 1U0HC 4XJXA 4P4SA 1NKTA 1II8B 3UPUA 1GZSA 2NG1A 3L0OA 4KI0A 1UDXA 4LJ8A 2WMNB 1M7BA 3DZ8A 3TR5A 2UZ3A 4BLSA 1CJKC 1E9EA 4QBIA 2IS1A 2AKAB 1NSFA 2FMXA 1FPMA 1FMLA 4HB4A 3GLIB 1AM4D 1F2UA 1G3IA 1KI9A 1HE1C 2AKYA 2WOOA 2ZTSA 2QU8A 2E87A 3PUWA 3RSOA 4URVR 3EPJA 5JECA 2ZE8A 4HLUC 4EAQA 1W5SA 4BFXA 2Z0MA 4B34A 3QKRB 2WIBA 4MA4A 4XD7D 4AC9A 2PEZA 3VU9A 3ND8A 4NYMQ 3U5ZB 2HYIC 1HE8B 2IC5A 2OZEA 3GLIA 3MMPA 5JCPA 5E3HA 2WJGA 2R44A 4PPFA 2IYLD 2XB4A 4B3GA 2YWFA 1NY5A 1NMZA 1MR3F 2NMVA 2J7KA 2IXGA 4Q1BA 2GJAA 3C41J 1N6LA 3UIEA 3ICEA 2ZRKA 4FMBB 2FFAA 2ZE7A 4LI0A 3KKPA 1D5CA 5TARA 1KNXA 2ZYTX 2IYTA 4QBHA 5BW8A 4ASUD 1XTJA 4JLJA 3Q5DA 4QM6A 4B2PA 4YC7A 4NYIR 3FPAA 5DIFA 4O25A 4BPBA 4JLOA 1QHGA 2EWVA 3CO5A 1ZUNB 2IEYA 1G4UR 2V54A 3IBYA 2JLVA 1ZD1A 2R9VA 3U4QA 4PAOA 2AFIE 3ECCA 1ODFA 4Q47A 3U6KA 2QEQA 2GCPA 1E4VA 2OV2A 2IYZA 1G8FA 2DFLA 3BK7A 3THWA 4XD7A 2GDJA 5G3ZA 2GBLC 1OT3A 3RDPA 2VPPA 5JJIA 1W36B 1AS2A 2AXPA 4TYYA 3QE0A 3U3MA 2GZDA 4KODA 4FN5A 1AS3A 1T0JB 4JSYA 1BMFD 3W6PA 4C0BA 4CT5A 5DN6D 4Q1AA 1LS6A 3TW4A 1U94A 1ANKA 3IPXA 4UJ3A 4UNNA 4AY2A 1T4GA 2DCUA 1VECA 3CRVA 2OCBA 3KKQA 3P20A 2YKGA 2H18A 4ASUA 2KJQA 1LY1A 5BXQC 3C14C 3QY0A 4I1SA 2ZI5A 3M0EA 4GMDA 3TR0A 3TE6A 5B57C 1MO3A 3CIOA 3TAHA 1R2QA 1VCNA 3KB1A 5D3MA 2QMUA 5K8IA 3WNDA 4O2LA 2F3RA 4I4LA 3A37A
chains in the Genus database with same CATH superfamily
2P6NA 2DR2A 5HRAA 1KMCA 3NORA 4EKYA 1Z73A 1CNMA 3K9WA 2K7FA 4YYEA 3E9QA 4IOKA 1PWXA 3ZCTA 3OQIB 4AO7A 1JWLA 5HE8A 4RIHA 2EG5A 1GADO 4OMFG 2FQYA 4DSOA 5A7FA 3PQEA 4EHAA 4ZI7B 3CWCA 5CG2A 2OXFA 4YR7A 1JALA 1UBHS 4L5JA 3DL2A 4MW7A 2I71A 5KYGA 1A9OA 3ZE8A 4KBFA 2O6HA 4MEBA 4ZARA 4EYSA 1D2CA 4BQQA 3CHYA 1VLMA 5GONB 4HSEA 4C78A 2C2KA 2BL4A 3K4PA 2I3DA 2QORA 3GA7A 2FK8A 3E2PA 2QI9C 2OECA 1SUAA 4OUDA 3P9QA 3PUVA 4XGQA 4BDTA 1LEHA 1M33A 4DNQA 1A9ZA 4PGMA 1OX4B 2XUHA 2VL7A 1SMKA 3B6MA 3LUDA 2HF8A 4XE5A 4A1OA 2WSIA 1J6UA 2I62A 2DAPA 2O0KA 2ZTHA 3LC7O 2RE8A 2V6GA 1Z35A 4KWIA 3P27A 3RUPA 2PX0A 3GJYA 1V6SA 1Y5MA 2RAPA 4RF4A 4W1QA 3K2EA 4CQLA 4EUKA 4EUHA 3WZMA 1C9EA 1JTEA 3DMGA 3D64A 3V3TA 2D4AA 2WKWA 5KSOA 3WA7A 3HXMA 3BWDD 3ZWAA 3ZDXB 3LH5A 3O8OA 4F8YA 3BXXA 1NNLA 4W9MC 2C9YA 2NZWA 4IJVA 1VGQA 2YBDA 1ML3A 3QFCA 1XNQB 3AMVA 5E6SB 2G08A 3NRCA 3EY9A 5PGMA 3D6VA 4HDRA 5F12A 4DDUA 2IDJA 4MRPA 3SHFA 4OMDA 4E12A 4LDNA 3SR0A 1JJIA 1USKA 4JX8A 2CEAA 4XRGA 3QWFA 4OTZA 4EWLA 1Y9EA 1IEXA 1UC4B 3G5TA 3UZUA 4P7BA 3DC7A 3WGHA 1O1YA 3LL7A 4QTXA 4WGGA 5LYYA 1HQYE 4IFIA 2WF6A 1ZUIA 2DUJA 3KD3A 4Q48A 1EMDA 2I5PO 3PCXA 2X0IA 4IS2A 4WA7A 2HXSA 3C87A 5DM4A 2D1FA 3I28A 1K27A 3ZPXA 4DQKA 4TTPA 4DDTA 1NXPA 2GEBA 1Z0DA 5TS2A 5JPIA 1HYHA 3BD9A 3FTCA 1TT5A 2CL5A 1Q92A 2ENWA 2VKTA 3PQCA 3IHTA 3CUUA 4L0MA 4YLGA 3ED5A 1RABA 4DG9A 4N41A 2VK4A 4M0LA 2D7CA 5K51A 5BW5A 7YASA 2GRJA 2O19A 3UNXA 1UMBB 1CK4A 2E4UA 5L7YA 5I6DA 1YIOA 3H6GA 3OF5A 4Q1FA 1SCQA 3KWFA 3TFQA 3T5TA 1SCNE 3OFVA 3RTGA 2VH5R 3WICA 4CU2A 2RH8A 3PUZA 4RTNA 3SX4A 4G4IA 1OXMA 3URKA 3JQRA 2Q7XA 4IL5A 1DAPA 2VHYA 4Q9AA 3GCDA 1PD1A 3I04A 1XUOA 4B7CA 3KFXA 4PSUA 2JJQA 1G8PA 5C18A 5JFOA 3GAAA 4TT3D 1ELOA 5AO9A 1EPUA 3BHNA 5B37A 3AZQA 2HA0A 2E4AA 1F5SA 1UF9A 4MJ7A 3ABSB 4BS9A 1IBLB 1TIBA 2O50A 3QTTA 1G0OA 4B7ZA 1Z0IA 1A7KA 1R8SA 2JGDA 3V7FA 2YN2A 1PBTA 3O7MA 3W6ZA 4GBJA 5BYKA 3HUUA 3SEZA 4MWCA 4UAJA 3JPYA 5JXHA 5JLAA 3Q3IA 3JWEA 2X2PA 1RVDA 1XTUA 2OD2A 1DX6A 3AG6A 1U0RA 2QIPA 3OE1A 4KO8A 4RX1A 4WLOA 1YUMA 1VG1A 2FMIA 1I7NA 2WMOB 3D7KA 5KNLA 3KX2A 1PT9A 4CKYA 5CW1A 4U00A 1ZWKA 4UTRA 4EELA 2A9VA 1M34B 1W4RA 3QITA 3DVSX 4U1RA 3WRYC 5JZVA 1GUFA 1J99A 3IP8A 4KFRA 4LJ6A 1UFVA 2A1UB 3D3WA 4N9QA 2NTJA 2PL9A 1XMVA 2V7TA 2AS0A 4QFMA 1JKXA 1XLVA 1NN3A 3KT0A 1T9KA 1I2AA 3NTVA 4KVGA 4MGKR 1CDOA 5CRIA 2WIAA 4BEWA 2G0AA 1QBKC 3AM4A 1HEIA 3K7EA 3NM6B 1TEXA 3FF1A 3RS7A 1DWUA 1E1LA 4RH1A 2UZ0A 2QHXA 1ISRA 1CDZA 1G21A 4I5GA 4WH0A 5KKNB 3BRCA 4RA9A 4YRCA 1EFTA 2VJKA 2WJAA 3S1SA 3KB2A 2C2WA 2FWMX 2PVPA 2EBHX 5H70A 1MLDA 3KOXA 1JPUA 1NBWB 1X7XB 2DSNA 2HU5A 2QLLA 3BCHA 4QU5A 4ZZIA 3ZTYA 4G4GA 3EPHA 4D1YA 2WA1A 1U9CA 1WCIB 2ODNA 3FA2A 3HZOA 4WIAA 1WXDA 5A5EA 5F2EA 1NF9A 2IGBA 5E6SA 1E5TA 1UP6A 4ISCA 5I4BA 1UFRA 4JDUA 2AT1A 3TQFA 1PR0A 2ZBDA 1ZFNA 4RMGA 3VTKA 2BYTA 1DTSA 2IWRA 3GROA 2G7MC 4X94A 5IXYA 4RJTA 2JPDA 3CUKA 4G5GA 4OLBA 4P7KA 3MRVA 4MUFA 5BT9A 5ITSA 1QVVA 5IS2A 1WIWA 2WM3A 3FF4A 3GJXC 4DYDA 1CUYA 1P0IA 3KXPA 2UYOA 2CBXA 4MINA 4MQBA 3EK2A 2R7NA 3CVJA 1Z8HA 5DZSA 3UHPA 3P71T 5EMMA 2QBYB 2V55B 2ZVDA 2R8YA 3VC7A 2FR1A 3MGBA 3ZDFA 1M6YA 1D4FA 4QLBA 1PDWA 3C5HA 4YAOA 3DOEA 1CE8A 1LPBB 4WZAB 1U4SA 1W44A 3L8HA 4YJGA 5E2AA 4X66B 1LSUA 3ZHSA 2QVXX 2A59A 3IQGX 3WADA 1KKMA 3P97A 3RVLA 3VX4A 1MB9A 4MV8A 1USIA 1WMSA 1E1QA 1MB3A 1ZG3A 3QGMA 1Z6YA 4HQ0A 1SXJE 4L74A 2PYZA 4U63A 4YMWA 3T7SA 4DR6B 3A9WA 3IKLA 2WQ7A 2HPZA 4TTVA 1GN8A 1QOZA 3IP3A 1MD9A 3GCZA 1JEEA 3V97A 5IAAA 2H1SA 5BQ5A 2GM4A 4I3FA 1E7WA 3JD3A 2NZVG 2H1LA 2JGKA 2OGZA 3FTPA 3GRVA 2C31A 4O63O 2IPXA 2RHWA 3FYDA 4DRZA 4J9UE 5HIJA 1EBUA 2YQ5A 2YXPX 2ZDGA 4MUKA 4U2BA 2QQGA 4OP3A 4DZRA 2A92A 3GYBA 2A3NA 3Q9UA 4OJTA 2CK3A 2Z6VA 3B6KA 3I53A 3RK4A 1T36B 2RGCA 5IJZA 4X1KB 1GG5A 2CXQA 3UO8B 1FP7A 1B73A 1BD3A 5AKGA 2Z2KA 1XDDA 2G1KA 1Y98A 2ONCA 4ZAGA 1LDEA 3DH0A 2F8TA 5LA6B 2IYUA 3PRJA 4G4JA 5EVCA 3BAFA 5BXYA 1DKMA 1L8XA 3HBNA 1M6EX 1GZ5A 3GHYA 3PC7A 3PDWA 1KOLA 2BGKA 4URYR 1J2UA 1RQ2A 2W2PA 3AL3A 3FLMA 3WB0A 1EFCA 4J1TC 4TKUB 3U44B 1W52X 3VBEA 1P1FA 3EZ9A 1D2GA 2OD7A 2H0RA 4DLWA 2CMDA 2EQAA 2Q6IA 3AJAA 4HQRA 4KDEA 3WR5A 3B9QA 2XXJA 1XZDA 2I2CA 5JEEA 3BCUA 3DT9A 1L7MA 1MC1A 3GJ0A 4OCZA 4QPDA 1J39A 1IXRC 4UC0A 3LJKA 3NAZA 3PQ8A 5A1TA 4WLVA 4QXRA 3LZDA 1J5XA 2CC2A 3AV0B 4GC9A 1N78A 1KI4A 1XJ0A 1LSOA 3M4YA 3MWDB 4P54A 5C5CA 4B6FA 4XVQA 5D01A 4GX1A 4A10A 3OM1A 5EZQA 2DSTA 4K5QA 1E0JA 1A9QA 2P9EA 2XPCA 2XTAA 3CF6R 4QICA 3OO0A 1NZFA 3ELUA 5BRNA 3V8BA 4TTRA 3I5YA 3ZD6A 1J0DA 3CH5A 4TXNA 1FTSA 4FSHA 1M2VA 1V6CA 3K9NA 1JFLA 3AU9A 1NN1A 4B80A 5KTYA 4OQFA 3W7BA 3BMOA 3M4JA 4L6CA 1XMXA 4GMHA 2AFHA 4W4TA 3RRYA 3ZI0A 3ZWDA 4OQDA 2C7BA 4N76A 3D6JA 1VP3A 1YRLA 1HQDA 2C99A 1DAGA 1IQPA 1GG2A 1O6ZA 1VP9A 3L4KA 1QDLB 1QPGA 2VAPA 4P5PA 1JEQA 1T10A 4IIJA 1TCCA 4Q9IA 4XFDA 1K5DA 2RGRA 3KEOA 1DIRA 1KJWA 1I4OA 4Q16A 3HFRA 1FMCA 5A3JA 5H4GA 1T1SA 4TQGA 1A8QA 2HHHB 4WOCA 5K0BA 2WNHA 2ZPAA 3CW9A 3HN6A 3VR4H 4LDJA 3V4SA 3LF2A 1PEAA 1UBEA 2VDWA 1U8YA 1W6UA 5COAA 3PI7A 2W2LD 3II6X 1CUFA 3OLYA 4LQLA 1EFPA 4ZZ1A 3JWHA 3Q85A 3FTNA 1XXLA 3X44A 3S40A 4PHTA 1RC8A 4B44A 4CPDA 4F2PA 1YZFA 1N5LA 2AYZA 2PA0A 2PR2A 1PG0A 3EHEA 1L4LA 4POAA 4R81A 1Z2EA 3PGVA 3TGPA 1N6OA 4CEIB 4NPHA 4KXVA 2R6GA 3BRQA 1E4YA 4LZNA 1STOA 4PZDA 5AI4A 4A9AA 2PH7A 4AQYB 5ERGB 1SXQA 2ACKA 2QIOA 3TCXB 3WIOA 4IW3B 2IYQA 2Z30A 2JHAA 3JQAB 1TIPA 4CODB 3LUFA 5FI0B 1TAUA 3AVUA 1E2GA 1TKBA 3WYGA 1J9ZA 1Y1SA 2R8EA 3LLUA 2WUWE 3MCAA 1AX9A 1ICEA 4DL9A 4DKJA 3U19A 2XB9A 1XPJA 1YIDA 1OBVA 2Q29A 1N9KA 2CUTA 1G4HA 2X6QA 1FFEA 3NJRA 4OHPA 3H4VA 2WSBA 1E7MA 4KK4A 3DXZA 4MQFA 3C8UA 5C5IA 1OZAA 1N9ZA 4HS4A 1DO2A 1C2YA 3IP1A 4D8VA 4JI2B 1D1PA 4KXYA 4BC1A 1YB2A 4ZK6A 3Q40A 1HFWA 3NTUA 4KTTE 4HGRA 3OE4A 2A9FA 4DQDA 4MV5A 4EY6A 1E2HA 1EM6A 4DR1B 1HNXB 2XAAA 4Y2HA 4CKBB 4HN9A 2DHEA 2IRWA 2Z3VA 1GRRA 4RD4A 3WO0A 5HKKA 3UWKA 1RYDA 1E5DA 1VG0B 2IA5A 2PWPA 3Q0TA 2NXWA 3HDGA 3K0FA 3X1WA 1ONSA 4E32A 4GOKA 2I4TA 1P19A 4ZA2A 3G7SA 4ZYVA 1Q1QA 4GF5A 1JBEA 1U11A 4J0HA 4P31A 3G1TA 5E8JA 3TZCA 3L77A 1LF5A 2O5VA 3M6MD 4H7EA 3WK6A 3IAS1 4Y1EA 5CDUA 4X7BA 3S27A 2JIZD 4QQ8A 4WESA 5CGQB 4ZZ0A 4MA0A 4P0PB 5FPKA 2V59A 3EXHC 1JG7A 3HHPA 3SVZA 4C05A 4NHEA 4UTNA 5A0TA 1XJCA 2R1ZA 4E5UA 2IXAA 1DBSA 4RVHA 3FI9A 5EIFA 1DDOA 2AVDA 5MFPA 4UMEA 1ONBA 1R6VA 4PYIA 5JAHA 4ZAVA 2VJBA 3M83A 3PLNA 4KH1A 5DGXA 4JODA 1U0TA 1ZAYA 4Q37A 1QF7A 3UT6A 4DA8A 3OPXA 2RC6A 3JWIA 4TOIA 3GX1A 1RBYA 2I65A 4YMUA 1T24A 4MVJI 4XGNA 2GPSA 4V3CA 4G5FA 1H1DA 3JD2A 1PVVA 4QGFA 5CLJA 3PWTA 5A0FA 2XXBA 5BRAA 3J80A 2NYVA 2OHXA 1G5HA 3WG9A 4R98A 2R5WA 3MCUA 1B0AA 3ITKA 4WXHA 1DUSA 5BYBA 3QYFA 3ZJYA 1C0PA 1SHZA 1FJHA 3R76A 3GT0A 2OBXA 4GBMA 1NBAA 2HWYA 5K8VA 5KWJA 5HKOA 2Q6OA 2G09A 2WD7B 3KJHA 4QJBA 3VR0A 2FPSA 3RGGA 1RHJA 4DCJA 4X85A 4IUBS 5GY7A 3EJ6A 5HX7A 4EQZA 5JS2A 1EZ1A 3L1UA 5KNDH 3C48A 3ZW7A 1KVQA 1W0KD 2GWHA 2QY9A 3H1FA 4IQ4A 1XNRB 2XXAA 1CNEA 4OYRA 4JI1B 2ZCVA 1B3BA 1EUQA 4OX9Y 2B94A 3C3JA 1KK2A 1CJVC 1VJTA 4HUTA 5BWLA 3HEAA 1Z16A 3RM3A 4LZZA 2YRXA 5CK4A 3GFQA 2AXNA 2W22A 3AOGA 1MBZA 5AT1A 2ZJZA 5ANRB 4YP7A 1AKUA 2AYYA 2ZXFA 4QGAA 4NS1A 3L43A 1MG0A 1MT3A 1NJ8A 1QG4A 2J7PD 4IUCS 1P73A 3DEZA 4HGZA 3TPFA 2YRFA 4R2KA 4YRSA 3ER9A 3D3JA 1VHLA 2LR0A 2W7TA 1DADA 1YDGA 2OA0A 3U9TA 1M8JA 1QH1A 1T35A 1W85A 4KGZA 3RK1A 3VZDA 1TECE 3LDAA 3OFND 3QVXA 5JNVA 4BY9E 3UFXA 1N5OX 5IYZF 1JEDA 4IDEA 4XYEA 3V8MA 4DUYB 3T54A 1SCAA 3VYSB 3OAAA 1MEJA 5A9SB 3K0CC 5FLXA 1EFAA 5ADVA 3PX3A 3LQQA 3VXKA 4A91A 4MV1A 3NC1C 1RDFA 5JNLA 2P3QA 3JZFA 3HBLA 3KJIA 1EQ2A 1DOHA 1RM0A 5AESA 4R8SA 1G5TA 2AMJA 4EJSB 5BSFA 1SD5A 3D3NA 2EP8A 2WYVA 3WGOA 2FZCA 1BXRA 3DLCA 1P2SA 3HN7A 4HB3A 4HVCA 2CLEB 1TUBA 2GS9A 2LZ0A 3EUEA 1QZ3A 4FIZA 3LUGA 3N0XA 2H1OA 2ZRPA 3GP5A 5AKJA 3S5JA 3OQVA 5ULLA 5IFLA 1P0FA 1YACA 2EZ8A 1KMMA 3CR7A 3ICQB 1U6IA 1Q19A 3GRPA 2XODA 1SXJA 2CL0X 3KUCA 4M0PA 3QUQA 3WHIA 2I9KA 1JG4A 1U81A 1U0LA 1U8CB 2JFGA 2SKEA 3B13B 2FMHA 3GCWA 4P35A 1WV0A 1E94E 3RS3A 2O54A 1L8LA 1DPGA 1Z74A 1KWKA 4R31A 3E22A 1S4MA 2P5UA 3GBPA 5I8ZA 5DM70 3U7HB 3EB9A 1SHJA 3L05A 2W6NA 4HXGA 2QVLA 1R0BA 2WHPA 3VNRA 2R4TA 1D0VA 3H87A 1PDVA 4K3VA 4MKZA 2QW0X 2V9CA 2BM1A 2VWHA 3H19A 3WXBA 4P3KA 3WJ1A 4ENPA 4IDBA 4FJ1A 5LOVA 1OI7A 4ZMBA 2VZ8A 2C0QA 2WD9A 2OPBA 3G2QA 4OQNA 4M76B 1XVAA 4O2RA 5AKKA 4Y30A 5FTLA 1D2NA 3F7TA 4TUYA 4OGLA 1NPYA 1A98A 3NBYC 4X1IB 3R75A 2DBRA 5EKSA 4EBFA 1OH6A 2F6RA 5KKCA 1X19A 2ZBFA 2YOHA 2P41A 2AKEA 4TT8A 5GWXA 1G3UA 4UUBA 4DLLA 3LCMA 2AF3C 4E7OA 5M7EA 2NNLD 1G18A 1VPDA 3K2QA 4IGIA 3TW8A 3BIJA 3CPEA 2BLNA 1NAHA 3DVQX 2BMFA 1BRTA 3BGDA 2X9GA 2XCRB 1B16A 1TTHA 1SKMA 1YBAA 2JLAA 3CZQA 5IJ9A 2NSYA 1ATZA 1E4EA 3GWGA 1UT5A 3QE2A 3VBCA 3AR2A 1VI6A 3K16A 1QZZA 1KDYA 3DC2A 3GRCA 5EP3A 3GNLA 3DOFA 4TV9F 5AI0A 5C1OA 3KWJA 4CGZA 4K86A 5IU6A 3VC2A 3PUXA 5AOAA 5JBQA 3S2YA 5FQOA 2VPQA 1S2OA 4RZXA 1HFEL 1YV9A 2I34A 1Q16A 3KZ1E 1ENPA 4C3ZA 1N9GA 3MUNA 2LW7A 4FQ8A 3ZZ0A 3ISJA 4OHCA 2J3LA 1K7CA 4RQAA 5COQA 5A5DA 4B32A 1E1RA 3E05A 4F4DA 1CUUA 3REFA 2Q5QA 1XEFA 4JGGA 4J16A 3STUA 5A4IS 2PZAA 4HLCA 2HZ7A 4J1SA 4MIYA 2DFVA 5EQTA 1FX0B 4B2LA 1V5EA 1NM5A 5EKXA 3BXOA 3EGDB 2ZYGA 3SI7A 2HRCA 2ADFA 1VL6A 1DT3A 2C5SA 2FQQA 1PHPA 2PANA 4OSOA 3AEKB 3ETDA 4JK3A 5T41A 1TM3E 2B2NA 2GRUA 2Q3HA 1JE1A 2Y9MB 1CFZA 3WP0A 5JMWA 1J8QA 1PL6A 2RAFA 1L5KA 2JDID 3ILYA 5E1OA 4PZAA 1V2HE 1ZMTA 1JJBA 1DIHA 2NACA 3KKMA 1O87A 3NIFB 3QLUC 4GKAA 5IC6A 1KTIA 3LXRA 2I1LA 4DLNA 4F2GA 1AQJA 4DMFA 3O8CA 1JB1A 3KTFA 4N6NA 3KZOA 3T7DA 2Q0SA 1DEXA 1HWYA 2VQ3A 1IY8A 3UAZA 1FDSA 1VZ2A 2UYQA 4B4VA 4EG0A 4O3MA 3MLEA 4JP3A 3DJFA 4PQGA 1JG2A 3LBHA 2UYGA 1XZCA 4BVEA 3HFSA 3VYWA 4PHGA 3GR6A 2IV7A 1XVVA 4HZUA 1V9LA 5EVJA 1JBQA 2JI4A 3WSTA 4BVFA 2CNDA 4E11A 1Q84A 3LSYA 3MAJA 3NHUA 4C1BA 1FFDA 1I14A 5BORA 4H35A 2D54A 3UB3A 1XHFA 3WHPA 4BBPA 2WFLA 2PX2A 2VA9A 3HV2A 3PR1A 3QPDA 4Y2GA 3WNCA 4R71A 1E1YA 5JO0A 3DP7A 3OOEA 5E9QA 2IBMA 4ME6A 1U0NA 4XWGA 3E0XA 2CNLA 2GAAA 1H2HA 3O1JC 3WGTA 1UBGA 3B3FA 2W5UA 3KV3O 1REQB 2J1LA 2FCAA 2B4KA 1H6CA 2MYNA 4MPJA 4X95A 1WZ2A 5DLDA 1U9JA 5JSUA 5KHAA 2W2QA 3CGGA 1SVNA 3FX2A 3QG5A 4X1IA 2YVQA 2IH4A 4HBGA 3LZ6A 4XOIA 2GOYA 3DOUA 2VF5X 4UNIA 4MMYB 4WCFC 4DUGA 4OI0A 1RYFA 1I6LA 1VKRA 1WU8A 2BHRA 2VT7A 2Z9DA 3KJGA 5AMXA 1UJMA 2BMDA 3IRVA 1VZ3A 4GR4A 1GV1A 1JV2B 3P9XA 4ER6A 5IDXA 5EP1A 3L4JA 2JFUA 3U60B 3NPAA 4KW7A 4HH0A 1G1MA 2HCJB 3BA6A 5FORA 3ZZMA 2ICAA 1ZW6A 2QVCA 3CKMA 3NETA 2P9YA 3Q9NA 1Z7EA 5FBWB 4AJOA 3B36A 4GOOD 2GNPA 1VL1A 2RHLA 3GQVA 2CLCX 1W47A 1VMIA 2FZGA 4NP6A 2W6ZA 3AY3A 1ZA1A 1G6HA 5KNBD 2O3TA 4UAVA 2CXUA 3EQZA 1BO6A 2O52A 1PK8A 2WZQA 2C7VA 4IILA 4OL0A 3EBPA 4R68A 5G1OA 1ESEA 1AHIA 3WIEA 5HZHA 4FVTA 2GH1A 2H0AA 3TPCA 4ISBA 3EZ6A 3NP7A 3EEFA 2E3JA 1U1IA 3L8DA 4ESHA 1E6EA 3A9CA 4C9BA 3B12A 1A76A 4EY8A 1GZDA 4JS0A 1SR8A 2CHGA 3FBWA 2RBGA 5DLYA 2VPWA 2BM8A 2H7XA 4EHIA 1KARA 1YQXA 3E7XA 5CFQA 2O2CA 4F2DA 2COUA 4EHKA 1A1SA 3CU5A 3FFTA 3HJUA 1HYBA 2G77B 5CT6A 2VA8A 5DYYA 1I10A 2R65A 1YL5A 4UTOA 2BKVA 1NY6A 1B76A 1GPLA 2HJGA 3DAHA 2M2IA 3OLCX 3T9DA 4E22A 4X6YA 1ZL0A 4HGOA 1AKQA 1PJLA 5IAOA 3C6XA 1ECJA 2CV0A 5KC8A 3COJA 5KQMA 4PO9A 5HW0A 1Q1AA 4MUAA 5KWIA 2QT9A 3ROMA 3E3NA 3HVUA 3B48A 3L5KA 1JP7A 2XCOA 4LNAA 4FFWA 3FWPA 3UMCA 3A6LA 1FFXA 4GRIA 2C4UA 1BDHA 1ADJA 2C3MA 2ZTMA 4BNNA 4XWTA 1A04A 4D79A 1MORA 2NXEA 4RDXA 3GRZA 2ZIXA 1KK0A 1QOPB 3QHQA 3V4OA 1Y6FA 2P9FA 2V98A 4D25A 3HVIA 4I1RA 3K4QA 2QVGA 3GZNB 2BC9A 2HDHA 2X2EA 3BB3A 4UOQA 4X61A 5KNCH 3LCCA 2UUCB 2Q9AA 2XJ4A 2A35A 3CF4G 3ON5A 5KJ6A 1Z5WA 2BJHA 2L18A 5KNDD 1PQWA 1QHYA 4YRMA 2WYIA 4REMA 4EF6A 5C8XA 4DSUA 2C3OA 2VN8A 3MMSA 4XVHA 3QE3A 1L7PA 1NP3A 3IODA 3QKSA 2E82A 4H4DA 4RF3A 2NUPB 2A94A 2FV8A 3G89A 2C4VA 4YJ2F 1QZUA 3RKSA 1FNDA 1X42A 2BDEA 2G3YA 3H2GA 3QSGA 2CWWA 2PSSA 3LP8A 1ZD2P 4PG6A 1Z0ZA 2VUSA 4IHJA 4V0NA 1CHDA 2BFOA 2BTOA 1SQ6A 3DXYA 4KPUB 2GJKA 4KVFA 3TNFA 4QYSA 3L79A 5K0LA 1A71A 2ORVA 1E5XA 3UQYS 3UT5B 4BIMA 4R0MA 2NZ8A 1YJCA 5AOCA 3L7JA 1RZRA 1Q1NA 1RWXA 2MMCA 2N1BA 2QAGB 1K6MA 1XTSA 2Z2XA 3CRRA 3IB6A 3R3ZA 1EGAA 3SIPA 1ZQ9A 1FVFA 2ABWA 5LWQA 3BOSA 4RK5A 5K2MA 1ATIA 4GVLA 4OHKA 4QSHA 3DBRB 1RI2A 5B1DA 3EZYA 4B43A 1G4AE 1M10A 3GB9A 3AB8A 4MPTA 4X8MA 5AK6A 4DIMA 4MWTA 2QUZA 2H0QA 2AFIA 1WDMA 3LBAA 3PXCX 2YMQA 3SQDA 1HE5A 4EJ2A 3JQAD 1SCUA 1RMQA 1XPUA 3C5WP 4PLHA 5EEHA 1HSZA 4FR0A 1P3Y1 1Z5ZA 2GCNA 3EXAA 1J0BA 1EX7A 3DDZX 2VG8A 4FOSA 2PK3A 1CVIA 4ND4A 5B4TA 2WF5A 3ZJVA 1J0AA 4IGKA 1WVGA 3S4YA 2EIXA 4N1AA 3EDMA 1CP2A 1P7VA 2POQX 1DMSA 2J8ZA 5C8YF 4OQEA 3TLEA 1WZNA 2H2AA 2XUZA 1YZYA 3BZUA 1VE5A 4Q5IA 4H7JA 4R3NA 4YECA 4ZT5A 4EQ6B 3VNVA 4JOBA 1SAYA 2I2AA 4V0MA 2V7GA 3HKBA 4CL8A 3WL4A 2SBTA 4LRSB 4BWYA 2ECKA 5BSTA 3TI9A 2QD3A 1Z7GA 4S1TA 4EEZA 1OV4A 3EISA 4EG5A 2D2FA 2GVZC 5AVSA 4O4IF 2DKFA 1TKCA 2EJUA 5DWQA 4DJJA 2P4QA 3HWSA 3HO1A 1HF3A 3AHIA 2D74A 4Q7LA 4WUTA 3D1JA 3L04A 2BFMA 5AW9A 3ER8A 4FYMA 1BXKA 1L4UA 1MOZA 1MW9X 2P69A 3AY0A 1QIKA 3GVIA 5DFAA 3GLFB 4M9RA 2XDAA 5EFOA 4YRFA 3MWLA 1IN1A 1XTRA 2Q3FA 5DKFA 5F33A 4RM2A 3RJZA 1UKZA 3ZJ4A 3C8HA 2H2GA 2D7DA 3ZHTA 3ZHRA 3WV4A 2VSXA 2R60A 4NAVA 1KA9H 2DPYA 2WUGA 2WUVA 1KMIY 2ZETA 2WVAA 3V1TC 4AJPA 3H2HA 3QVSA 3STHA 3LS2A 4RW0A 4Q1EA 2VK2A 3UM9A 3JQAA 3IHWA 5M5BA 1S9DA 1N6PA 2EP7A 1EVKA 4AJNA 4MAFA 4QAQA 3QEJA 4NDAA 3FIUA 3PKIA 2BRUA 3VJLA 5IVHA 2FLKA 1P5RA 2QPOA 3SYMA 1EDOA 3AVTA 2Z6UA 3KVNA 3U3XA 3GYGA 2XRYA 2B1GA 3PXDA 3BIOA 1VIYA 3KYBA 1G64A 3F6CA 4R8KA 3H5NA 3PNMA 4J94A 3VPFA 4I19A 3ZQJA 3AM5A 3G0GA 3KQHA 2Z5VA 4FKBA 4K6HA 1QUFA 4OJYA 4B46A 4F56A 5KTSA 5C7LO 3V2GA 4DFDA 2B34A 1MGOA 4EW2A 5HZKA 3NAMA 3HKCB 1FSPA 3ZWCA 1FXUA 5C81A 3JALA 4G36A 3GUYA 1HL7A 4KYIB 4PPGA 1U9IC 2LXNA 4DMHA 5K8UA 1F38A 4V38A 5L4SA 1XMQB 3MJVA 2FUKA 2XUDA 5IULC 5AP9A 4DDMA 5EWLA 1KSFX 5FL7D 5EXXA 5JLJA 1COWA 1V2GA 4XYMA 2QLMA 4Z4FA 1WTAA 2P11A 1YL7A 5IZCA 3RT1A 5K5EA 2IP2A 2WD8A 2EZ4A 2C7GA 1A8PA 4G1VA 4EGAA 1U8EA 5F78A 1FDIA 3O4JA 4MV9A 2FFHA 1QYDA 1DJLA 4L4RA 1XQ1A 4QE3A 4MUIA 2BJVA 4P08A 2ZQZA 2FPRA 3EUWA 4HWKA 5EWMA 3P9CA 2P2CA 4U02A 1PWYE 1O95A 3AYXB 3JQBA 1MDFA 1U8FO 2D00A 2WM2A 3GARA 1Z3IX 3P8ZA 4UU0A 4BMDA 4BAUA 2JIQA 5CYGA 2GJ4A 4CLXA 4ZALA 4C3UA 3M33A 3I30X 1QLWA 4KE9A 3GLGE 2PUFA 3O38A 3EUFA 3RT9A 5BSVA 5DCUA 5F3DA 1GZ7A 1BWRA 2QMZA 3ACBA 5IT0A 4P53A 2IHZA 5DGCA 4DOMA 2R2GA 4RY2A 3T4PA 3OIFA 4I2VA 3H5AA 1T4CA 1ZUNA 3TM4A 3GPDG 2PMBA 2VJCA 3UQZA 1FFGA 2P2YA 3TLKA 3VR3A 3V2IA 4ALLA 2YWHA 3TXAA 3DO6A 3LY7A 1BOFA 1SCJA 4KAXA 2OBYA 4M0UA 1A4UA 4JJZA 1PJBA 3LAWA 2IBTA 1JR3D 1VKNA 2WD7A 2N47A 2GARA 1AHHA 1GU7A 3PKZA 3RS2A 2N46A 4ZJUA 1F0PA 3ZD7A 4RA6A 2ZJFA 1XB2A 1ZK3A 3T3IA 2GCGA 3RFXA 4W99A 4ZDJA 1SZJG 1YUNA 2G0NA 3W9SA 1QK3A 3MGKA 3T0FA 4B7UA 1XZHA 3SBXA 1DI0A 5HCNA 1ESZA 4J8PA 5KTTA 1ZCJA 5LZ9A 2MT9A 3T3MB 3OETA 3UB4A 3LOQA 3AFMA 3RWOA 3W5BA 1WBDA 3PXBA 3L8EA 1TM1E 2WUFA 3TRHA 3W4IA 2QGNA 2ZJ7A 4KBGA 5DBEX 4V0QA 3OFKA 1JN0A 4NENB 2W0SA 3WS7A 5H5JA 5FUVA 1JI3A 5IDWA 4LYAA 4PQEA 2C2MA 1BKDR 4WK2B 2EX4A 1ZM2A 2BDUA 3F71A 3H04A 4ZD6A 3H0KA 5LMNB 2HI0A 3Q7SA 1QHSA 2ZLBA 4C4RA 3I0ZA 3WP1B 1QFZA 2LTAA 3M5PA 5EQDA 1SOUA 2J3QA 4DV5B 3NT4A 3X3HA 4N4AA 1AC5A 4J4BA 1UXJA 3U9SA 4LBWA 1S2GA 4NZOA 4WAUA 3RHTA 1VB5A 4D6PA 3QEAZ 4WJKB 4L2IA 3HR8A 3AHDA 4Z86A 5HKLA 4KREA 4TS9A 1C41A 5TGZA 1ZL2A 4PXYA 1IQ0A 1QH0A 1TKAA 2GN0A 2QTRA 4HS9A 3DR3A 4UBMA 2XGOA 3GWZA 3L6CA 4M8NE 2XKJE 4NONA 3GNQA 5H9VA 1MB4A 1HDRA 1NM5C 1I2CA 1J8MF 3Q5GA 2BFBA 2R2AA 3D0KA 2AN9A 4K2HA 4KR6A 1SPBS 2E4XA 4UXJA 3GMSA 1SKYB 4Y2YA 1Z63A 1QDUA 5HQ3B 5EZ5A 5JWOA 5CFLA 2V65A 1ZCFA 1W4BA 2ZU0C 1WSAA 3DBHA 3N8DA 4J7XA 5KNCD 4XLTA 4E30A 1ABBA 3CUSA 3ZHCA 3GEIA 2A67A 2CNNA 4UCQA 3HYCA 3SC4A 4HQLA 3KE9A 4KO4S 3LHDA 3NQ41 1QVRA 4G1EB 1G17A 1Z0AA 3RSGA 2G71A 4ZDKA 4BGIA 1EJBA 2ERCA 3KETA 4BO5A 3FLBA 1QZXA 3HQ4O 4ZVLA 2GD1O 5B36A 1Z5VA 3DE3X 2ZUSA 3GF4A 4ESOA 2OBFA 3EA0A 1ISJA 3N8IA 5TMDA 1R5BA 4QSMA 5DBGA 4L07A 4DLSA 1BCSA 4JKIA 3TLXA 5HXAA 4LMAA 2VXCA 2QX7A 4S12A 5KPJA 1EDZA 3EDOA 4R1TA 1BCRB 4KO3S 3QWIA 2RIRA 3Q9SA 1RQLA 4K9PA 4Z4QA 1T9BA 4WT7A 3ZJUA 3S2UA 5KYWB 3FTDA 1CRQA 5FLYA 1J7KA 1T2UA 4NMWA 3AM3A 1USWA 1XROA 2WJ4A 2ZRBA 4KJXA 4TT3A 2P79A 5HNKA 3B9RA 5TB5A 5F2NA 3V1YA 2ZAIA 5CTAA 2QS9A 3VO9A 2GA9A 1NBHA 3PNLA 1EZ4A 1MA0A 3R5SA 4QHYA 4YALA 3VO1A 5EKUA 4YR9A 4YJ2A 3H5RA 1T6NA 4R2LA 2ACWA 3U3ZA 1FNMA 3SXUB 2OQRA 3B70A 4YACA 1BE0A 3CUTA 3FRHA 4RPJA 4B6QA 1RXSA 4ESEA 4N3GA 1VCMA 4C43A 3C3MA 2F1RA 1F20A 3LZCA 4HNHA 3IQXA 3CIFA 3RT7A 1ESNA 2JI9A 3UYLA 5HM8A 4NBRA 1PLJA 2HIGA 4AF7A 4UNPA 3M3DA 3T1QA 3PWZA 1D9ZA 1CQJB 2I7TA 3RTAA 1M67A 1FB5A 2GWRA 5LQSA 4NF2A 1G6Q1 1KI6B 2G8NA 1AY0A 1ESCA 2XT6A 2HHCA 4RPHA 4S0ZA 2QM8A 4D46A 1GQQA 2ISSD 3JVIA 1P1BA 3HO8A 3QJ5A 1E6LA 4TQAA 5D3ZA 3H5WA 2AZMA 2R79A 3WGZA 3BE5A 4MQ5A 5AHWA 3ND6A 4HLNA 1GXSA 2DHCA 2ZBEA 3WVNA 1KY2A 3HDTA 2QW1A 1GKYA 1NF3A 3LQYA 2ZGVA 4PPQA 3FH0A 3LNCA 3BPSA 1FRFS 4M49A 3ZX4A 4BKUA 4WK4B 4DBLC 1UDCA 1Y89A 1KMQA 2ZYSA 3A6GA 4XIFA 3VAAA 4R7GA 3UGKA 4A6XA 1ODCA 4PC7A 3QVTA 4GQAA 5DX0A 721PA 1KRWA 4CIBA 1XTQA 1NU6A 2QTWB 5EJ6A 2X0EA 4BJ5A 4IHKA 2CXSA 2D1YA 1LLDA 3X2SA 5ESWA 2OOKA 821PA 3GH3A 4CDGA 1I3CA 1Z37A 1N1EA 4S1WA 3SYKA 3EE6A 3HKDB 2W71A 3FPLA 4OAQA 2UYHA 621PA 3TX6A 4Z4GA 1MJFA 2VXYA 2CDNA 2H6EA 3ESQA 4HNRA 1WHTB 1NXXA 3AI7A 3DYBA 4P4TA 5U4XA 4AIRA 3RYIA 1G5FA 5AUOB 1SUCA 4DWOA 3ESRA 1OMOA 1C7QA 1C5KA 2W9XA 3VTZA 2SKCA 1RPZA 4U2DA 1K4MA 2AUTA 4FLEA 4EK9A 4G8CA 4EYKA 4LRYA 4TZ0A 3HADA 5KNBH 3QZUA 2B4YA 3AHCA 3OKCA 4B75A 2HADA 3MPOA 1G20B 4AJIA 5E95A 1KHHA 1MOQA 1TO6A 5FQNA 4Q4JB 2WTXA 1WDKA 4HRYA 1LBQA 4IF4A 3WLEA 4KYVA 4KVZA 4L27A 1QCYA 2IE0A 2VJDA 1Z7WA 2H92A 3FYHA 2TSYB 1QHHA 5DI9A 1UPTA 4J91A 3W06A 3O75A 5KYXB 4R1UA 2Y2UA 4ND7A 4UHKA 3NNNA 5TPWB 1J06A 1AQYA 1I94B 3PEVA 1ZJ6A 1Y8RB 1M6WA 1Y8QB 3CZCA 3WHKA