1CKEA

Cmp kinase from escherichia coli free enzyme structure
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
225
structure length
212
Chain Sequence
b'AIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQVKGFSVNFERLLAEIKLVPAADALVLDSTTLSIEQVIEKALQYARQKLALA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
publication title Structures of escherichia coli CMP kinase alone and in complex with CDP: a new fold of the nucleoside monophosphate binding domain and insights into cytosine nucleotide specificity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 70
structure length 212
sequence length 225
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 1998-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ckeA00
2PMDA 1U0HC 1N5IA 3DOEA 3K0EA 4DCTA 2J7PD 4KITB 2VHTA 5BW8A 1LF0A 2YC4C 5C4MA 3EPJA 1WDTA 4BLSA 4QJ4A 5E4FA 3WBKA 4DCNA 1ZM3A 1XZPA 1Z0JA 2F1RA 2MMGA 2P5SA 3NBYC 3FPAA 4IJMA 5BN5A 4BLQA 4OI2A 5FI1B 1GNQA 1AKYA 3BWDD 1HT1E 4LBWA 2HLDA 5KHOC 4S2EA 4QGHA 4ASUA 4BFUA 1VHLA 2WOOA 1G8GA 2E1RA 2FPLA 3NHBA 3RHFA 1XRJA 3SJZA 4B2LA 1KIMA 1CTQA 2DY1A 2K5UA 2IXFA 5FUXA 5SZIA 5EP2A 4RY2A 4LRWA 4BLRA 2AN9A 3QKUA 4NU0A 1G9XA 2B8TA 2IS6A 1P75A 1N6OA 2R6GA 2FG5A 3TKLA 1P61B 2ZUDA 1CR4A 1JR6A 1OPXA 1G7CA 1TF5A 2JGNA 4PQFA 4B3DA 1D2MA 1P62B 1OH6A 1GFIA 1XTQA 5CM8B 2NO7A 1OSNA 3SC3A 2Z5FA 4QJ5A 3QSYA 1XTKA 2G3YA 2R44A 3ZVMA 5DI3A 4YC7A 1TF7A 2Q3MA 1RVDA 1SZPA 5AUQA 2GK7A 4XWOA 1OIWA 4CEJB 2UZ3A 3AKYA 4M0LA 5L3VA 1KMHB 3R7WA 1XPUA 2JDID 3WYGA 3THXB 2GCNA 2OBMA 3ZVRA 3K09A 5CLQA 3PIRA 1R8QA 2QAGC 3KFXA 4JLMA 4ACAA 4MYCA 2FX3A 4D6PA 3EA5A 3C4JA 1ZIOA 1SVOA 4LHWA 4QBFA 3BIFA 4MKGA 3K70B 2ZIAA 5G3YA 1UKVY 2QPOA 3BH0A 1VTKA 2BMFA 2O0JA 1P7CA 3TE6A 1U8YA 3KKNA 3MWJA 1XXHE 3GLIE 3LY5A 2J5XA 3PXGA 4A15A 1T0JB 4A36A 1ZD8A 2P6NA 1ZINA 3E70C 3QBTA 4NCIA 1LS1A 1S96A 1ZU5A 4DKXA 1E9SA 2Q9AA 4KFSA 3RANA 1R4AA 2CVHA 3MUFA 4FW9A 2ZI3A 2LKDA 1P60A 1XXHB 1J2JA 4B3GA 3CZQA 4QRHA 5FUVA 4GT1A 4PC2A 2ZJ5A 4MRPA 2XAUA 1XD9A 4Z8YA 3PUXA 3KXKA 4A2WA 2NO1A 1UDWA 3PQCA 5G53C 3DPUA 5TXGA 3BC1A 1ZW6A 2GJAA 2CL6X 1GITA 2OBNA 1CEEA 3Q72A 4MGKR 3EZ7A 1XMSA 1N0UA 1SKYE 4HAUA 4DDUA 4GPTA 5JRJA 2FZ4A 2H92A 2IX3A 4FMBB 2B7BA 2IBMA 3KUDA 2WWWA 1IM2A 1QDEA 3ZZ0A 1S9HA 4TL7A 2VHJA 4MYUA 4HDOB 1NN3A 3BK7A 4GNKA 2QMHA 4RD4A 5DO9A 1N5JA 1K5DA 3QKRA 2XXAA 3PJRA 1NN1A 1AQUA 1VYUA 1YZTA 3NH9A 2X2FA 3BFXA 4B43A 2DBYA 4C0HA 5F9FA 1SULA 1XBTA 3MLEA 2GZHA 1IN5A 2XOKA 3LW7A 5CDFA 3RC3A 4LJAA 4V0KA 3K70C 2Q0HA 2NMVA 5AJWA 5FR2A 2JIZA 4MGYR 4B35A 3HPQA 4NBSA 2QMOA 1L4UA 1W49A 1KO1A 2FFBA 4V0NA 3HYRA 5DNYB 2WSMA 2GJ8A 1E9BA 2PX0A 3EC1A 2REOA 4Q7JB 5FL7D 1OH7A 1UKEA 3DZDA 5GJVC 4HEJA 2ZSBA 3CKLA 3A58B 3QF7A 1FMJA 1LW7A 3TK1A 4GL2A 1CP2A 3EIQA 2JLSA 2KBEA 2QTHA 1XTJA 5IDVA 4TYQA 2JJ1D 3BBPA 1O87A 5J4YA 1WBBA 221PA 1P9RA 2YZ2A 1E2IA 3U6BA 2ZUCA 4DDVA 1U99A 3IBGA 4IDHA 1DG3A 3T34A 1OXXK 3HYTA 1NG1A 5JS7A 4QHYA 4NONA 2VSXA 2B92A 4JT2A 1Q1EA 1G1MA 4R2HA 4B47A 4CDGA 4NCNA 2I1VB 3OIYA 5DI3B 4DLWA 1CXZA 5P21A 2FDCA 2GEUA 1VKJA 2A7QA 2XJ4A 4I81A 1XWIA 1CJVC 3NXSA 3LA6A 2WHXA 3R7WB 3RS0A 5FL3A 5CIQA 1PZNA 3TSWA 4DSTA 5A5GA 2YKGA 5GADl 4Q1CA 4PO9A 4EKDA 1F2UA 2IT1A 3VFDA 2WTUA 2Y8EA 1EFRA 4JVSB 4L9WA 4QKQA 1T6NA 2IYXA 4B75A 3EZ6A 4DIEA 4B3BA 4TYNA 2O8FA 4JLBA 3LXXA 1FP7A 2G1JA 1II9A 5FFMA 3TRFA 1GWNA 1II8A 2HDNB 3Q5DA 4CVNA 1NNEA 4KODA 2FEMA 2IEZA 1G17A 2JJ2D 3U2QA 1P73A 2IYVA 4CW7A 2IWRA 3BOSA 4HAZA 3QXHA 3BAFA 2P5TB 1NIJA 1JPNA 3ZDQA 4M53A 2JJ8A 4KSCA 5KDLA 3T1OA 1RYHA 2ZTSA 3VHLB 2J0UA 4IFEA 4AKIA 1KI6A 3OEED 1AM4D 4JVLA 1G4AE 1ZCBA 2IYSA 2Q9CA 2ZI9A 1A7JA 3IIJA 4MDEA 2MSDB 2BVNA 1JEEA 4BFZA 2BMDA 2BBSA 2RHMA 3EIEA 3WNCA 4AWXA 1YZLA 4TMWA 1JR3A 2AD5A 5EE3A 4LYHA 2H7VA 4HYYA 2CCKA 4HZIA 1YZQA 3HU3A 1JB1A 2I4IA 4GBMA 1VHTA 3DOFA 4HUQA 2JATA 4JKIA 5G41A 3L43A 3EZ9A 3QKTA 1FL9A 4XTCS 1G6OA 5E7MA 1S4QA 3U3RA 3L0IB 1U2RA 3LBNA 3DM5A 2OE2A 2GF9A 1GL7A 2F1HA 1JECA 1G18A 1GNPA 2QP4A 3SYLA 2VHCA 1X1SA 1FOEB 1E79D 2X19A 2FV8A 3QKRB 5LD2B 4HB4A 1YHNA 3X1YA 2XXAB 4N3NA 3H84A 3UMFA 4HSEA 1WBDA 4QL3A 1YRAA 1G3MA 2XSZA 4EPYA 1B0UA 3Q7QA 1R2QA 4DCUA 1JEDA 1SVKA 2ZJYA 2R62A 3GLGA 4BZPA 1GTVA 1H8ED 821PA 1ELOA 3A4MA 1UKZA 1I4LD 3UANA 4WIAA 4IDOA 1FQKA 1D9XA 3L8YA 2G0TA 4YDHB 3I92A 2J7PA 1T91A 4KFUA 3CM0A 1XPRA 2CMKA 4TT3D 4TQ9A 2WM9B 3TW4A 5IK2D 2GK6A 5C2JB 1MR3F 2WAYA 3N2EA 4M4SA 3GLHA 3DZ8A 4URWR 5KO2A 1CJKC 2UKDA 5F3WB 2VRWA 4LHXA 2D7CA 4G1UC 2GETA 3AQ4A 3TH5A 1E2JA 2G77B 1Q1BA 1R7RA 3BS4A 1IN8A 1L8QA 3TVDA 2QQ0A 3OIVA 5AUNB 1BMFD 3AF1A 4OQNA 3VR5A 1Z0IA 3C5HA 3CR7A 3W8NA 2GKSA 1Z22A 4BFVA 4KFRA 4BGDA 3LLUA 3CB4A 5JI2E 4EDHA 2XZLA 1Z6XA 5C18A 4HLUC 1YZNA 1AGPA 2RAPA 2YWFA 1F2UB 1OFHA 4MITA 5J4LA 4YMTA 5SZHB 5SZJA 3GEEA 3CRW1 1VYVA 1FX0A 2O8FB 2QGZA 3FMPB 4JBXA 3CF2A 4RZ3A 5BQ5A 2O8DA 5LD2C 1Z3IX 2R6CA 1II8B 1W0KD 2QRZA 2FMXA 1QG2A 3P27A 1KGDA 1RRPA 1L4YA 4Z54A 2WKQA 1KI2A 3BRWD 4EJSA 2G0NA 2J1LA 5FBQB 3CF6R 2ZRCA 1I2DA 2YJTD 2IYLD 2JDIA 4YMUA 1FTNA 1WCV1 3D7MA 4I1SA 1UKYA 2ZPTX 1RE0A 5EE1A 1OFIA 2A78A 3LDAA 2IF0A 5FPTA 1DS6A 1P5ZB 1U98A 1UDXA 4JJKA 2ZRJA 2W0SA 2J0UB 3NWJA 3QPUA 1E2PA 1IHUA 1JR3E 1KI6B 3IO3A 4FIDA 2P2LA 1PUJA 1E2QA 4OJQA 4PO8A 3SHWA 3TIFA 4JMPA 1ZRHA 2W0MA 1XD2A 5H8WA 2NO0A 2GVDC 2D06A 1LB1B 4Q9LA 1YR6A 4AG5A 4MDFA 4PPFA 5BYJA 3VR2A 3PEWA 3CH5A 2G83A 1D2NA 2BJWA 2GTPA 3VQTA 1EGAA 4P4SA 2D4HA 5JBQA 2PZFA 4C0QC 1Q12A 3EA0A 3IIKA 1FZQA 3GLFE 3AVYA 4HUQB 3QE0A 4M1MA 1W36B 1DO0A 2C8VA 4Q9KA 1E69A 2QROA 4WOPA 3TVTA 2RGCA 4XIGS 3U44A 3VMFA 4UNSA 5BN4A 2V6JA 4FCWA 1M2OB 2J87A 1UBEA 3AEZA 1BS1A 4F91B 1LV7A 2N46A 1X1RA 1X8LA 1S9DA 3CR8A 2IS2A 2QL6A 2IXEA 2AD1A 2CJWA 2ORWA 2YHSA 1R5OA 2GEDA 2P6UA 3ND9A 4OHZA 1T5LA 4JBYA 2WVJA 3SI7A 3D6TB 4Q9JA 3UG7A 2QPAA 4YQFA 1G8FA 2O52A 2QTVB 1W5TA 1Q3HA 5JRZA 3GLGB 3G0HA 4QM6A 4LBYA 2OM2A 3QXSA 3OF5A 4YDSA 2ATXA 3SQXA 3MJRA 2BBTA 3HPRA 4HB2A 3WRYC 1Y3AA 2OLJA 4NYMQ 5FTNA 2JLWA 1W1WA 4JT4A 3FVQA 4DEYA 2VP0A 1OYYA 5J47A 2ANCA 3GLHB 1IN6A 1GIAA 1WRBA 1Z8FA 2QRNA 2E9SA 3HU1A 4TSFD 3LX5A 3MGCA 2RMKA 1QHYA 5C46F 2C2HA 3W6NA 4TL8A 2VF7A 2A2ZA 1TQ2A 1LNZA 4A92A 4D81A 5L3SA 1OB2A 2PCLA 2OCAA 2HV8A 5E95A 4D80A 2WV9A 2OFWA 3KKOA 4LC1A 5FL7A 3VX3A 4O25A 4L8GA 4US2R 4N0EA 3KKPA 2XZPA 4NYMR 2EVWX 1Z47A 1F2TA 1Z29A 3SEAA 1MO5A 2ZEJA 1W36C 2JJ1A 1E1QD 5CK5A 4PX9A 4TLDA 4II7A 2B6HA 4DC9A 2EFEB 1FX0B 3LRPA 4B2IA 3NHAA 4R9UC 2BKUA 4IVRA 3UKDA 4GI7A 1ZP6A 2NOAA 421PA 2IYYA 4A6XA 4EQ6A 2O8DB 4QBHA 4YONB 1NVWQ 4ZCLA 4LJ6A 1KMQA 3AF2A 2LKCA 5BYKA 1SVMA 3CWQA 1N0VC 1E6CA 4EJSB 5FBVB 4RVCA 5KNCA 2YOFA 1DAHA 1S1MA 1PUIA 4IOMA 1XMVA 2GESA 4RSGA 1M6NA 2NTYC 3QXXA 3FMFA 2FNAA 4LJYA 1M7HA 2R2AA 1U90A 1Q57A 2Z6VA 4CEIA 1XD2B 2NZ8A 3CBQA 5GJCA 1H8HD 3R20A 3TMKA 3RS4A 5TARA 3F0TA 2JJ2A 2YOHA 2XX3A 1KSGA 4PQYA 4PZLA 3WHKA 1TU3A 4P4SB 3MJHA 2DPXA 3KKQA 1G64A 2ZJZA 3GFOA 3UWKA 3V00A 3HJNA 3X2SA 3MG9A 1QVAA 4V0LA 3LLMA 5KSPA 1B23P 2IUSA 3U44B 3OEEA 5F9HA 1K6MA 4NCHA 3T35A 1DELA 4M1SA 2GAOA 5DI9A 2IWHA 2C04A 4F92B 2G9NA 3TR5A 1SGWA 4U02A 5DISB 5KYKA 3H1TA 3QENA 4P33A 2J59A 2PBRA 4BFTA 4D25A 4QGFA 2CJWB 3TAUA 1ZNWA 2W2VA 4GMDA 2WJHA 3F3YA 721PA 1T9HA 2XNDD 3L0PA 1Z0DA 4NZYA 4ZDKA 3VHXA 2OZEA 5JEEA 2BM0A 2D2FA 4IFBA 1VMAA 3QKSA 3ZQ6A 2ZRKA 2CDNA 2TMKA 1NSTA 4Q01A 3SR0A 2WWGA 1KI9A 4HATA 4MUAA 3O8BA 3MWYW 4QC2A 3DM9B 1G7RA 5J40A 1E79A 4A0RA 1FMLA 4LC0A 1Z6AA 4EPTA 3A1TA 3NBFA 2CLDX 2BJVA 4P4TA 3X1XA 1MH1A 4KLNA 2J0SA 3AF3A 1NLZA 4LPSA 2QSYA 3U3OA 3ZYCA 1KSHA 3L0SA 3OIUA 5EP4A 4TYYA 2CBZA 4IKEA 3T1TA 2WJGA 2GEVA 1TMKA 1BIFA 3RDPA 4CEHA 1H8EA 2REBA 4A8JC 1G3RA 5L3SB 3K0AA 1KDPA 1ZM9A 4D4JA 4DDWA 1WB9A 4O0MA 2C98A 3PUZA 5E7IA 2W2XA 3ONWA 5E3HA 4TT3A 5C4GB 2NG1A 4MRNA 1U0JA 4JS0A 5HCNA 5IK2A 3MWLA 1SVWA 1F2TB 1XU4A 5G3ZA 4IOKA 3IPXA 3THOA 3THYA 1IN4A 5CB6A 1ZM4A 1Z6GA 2WICA 3I73A 4HZUA 5FOWA 5JWRA 3AVTA 1FP6A 4URZR 3QVUA 2OXCA 3BH7A 4Q1AA 5GJWC 1EX6A 1R5NA 1BMFA 1E9FA 4EQ6B 3GLIA 2ANBA 5L3QA 4JLVA 4RCYA 1V5WA 1N6HA 2FSFA 3QXCA 1NVUQ 1QG4A 2ZI5A 4PXAA 1XTIA 2RB4A 2HCJB 1SKQA 4H1UA 1Z0FA 1CLUA 5D3MA 3P4XA 5FPYA 4URVR 4WAUA 3K9LA 3DKVA 3EWSA 4MRRA 5JHHB 1SHKA 4B44A 2DFNA 1U81A 4YLGA 3TR0A 4DLRA 1R0WA 2BC9A 3LXRA 4CEIB 2KJQA 2QNRA 2RGAA 4GSYA 3ZQJA 2V1UA 2H57A 2VTKA 4I1OA 4C0JA 3O8RA 3LV8A 1W0KA 2DCUA 5L8VA 3JVUA 3W6OA 1A2KC 3SOPA 2VLIA 3KJIA 4NL4H 5DH9A 4Z1MD 1W4AA 1NKSA 2JASA 1D2EA 3CW2A 3DVLA 5HE9A 3A1VA 1SQ5A 3GMTA 3W6PA 1T3LA 4Y0VA 1XJQA 3I4LA 4JVMA 1OJLA 4HB3A 2Z4SA 4I1VA 4O3MA 3LQRA 3VR6A 3W3ZB 2KWIA 2A5JA 2QE7D 2R65A 3CPEA 6Q21A 3K9NA 5B30A 3BGWA 2R6AA 5HZHA 3GEHA 1DOAA 1KSJA 4KAXA 4IXMA 3U7EB 2ZU6A 1XEXA 2ZVPX 3I8XA 2ZRHA 3MWKA 1R0ZA 1AGRA 4W5WA 1H65A 3B1VA 2WIAA 3BFKA 1QHHA 4XSHA 2BKEA 4UNRA 2NQ2C 3QKSB 3IEVA 1BOFA 2BBOA 2QZ4A 4GFDA 2FPKA 1E9CA 5H70A 1GRNA 5FBWB 4L9SA 3VR1A 4TTRA 2V4ZA 4AG6A 3KQKA 2OEPA 1QZXA 2QP3A 1NMXA 2ZI6A 3RSOA 3KJHA 1NIPA 1UEJA 1E2MA 3CO5A 1E0SA 4BUJA 1PJRA 1NG9A 2OO7A 5CITA 4IDPA 1JI0A 4PHHA 5JEDA 3JZMA 3W90A 4CEHB 4PC7A 1U94A 3P20A 4G5GA 1NN5A 1X3SA 3K0AB 2ERYA 3Q8XB 4UNQA 2AXPA 4ESHA 2GRJA 4BASA 1GKIA 5DSZA 2XB4A 4A2PA 4US1R 1HTWA 2ZRBA 2C96A 1EFCA 5A4JA 4OYHA 1SVSA 5CJ2A 2QM7A 1IJEA 2EFGA 3CNLA 3KQLA 3UIEA 3THYB 2HF8A 4ZIRA 1HE8B 4FINA 5DGXA 4HZUB 3AVUA 1AS3A 4E07A 4OHYA 4TSFA 3IGFA 4V02A 4DZZA 1J7KA 4MGIR 1OXTA 4AKHA 3UWOA 5HZKA 3GLIB 3FKQA 5L3QB 3B1YA 3U3MA 1EK0A 1S0UA 4QNRA 1FQJA 2P3SA 1E2FA 5JFGA 1MO6A 1ETUA 4XH9B 2ZAOA 4A9AA 3GJXC 2CHGA 1XD8A 3U7HB 3AVXA 3T1QA 1G16A 3QF4A 4BFSA 1US8A 2MSCB 3M4YA 2JLXA 2ZR7A 2EFDB 5D3MB 1IAQA 3PUYA 2CNWD 1E1QA 3VR4A 2VL7A 5J5CA 3N70A 1KSFX 4RKEA 4Q1BA 2Q6TA 3KXLA 2IYZA 1KAGA 2ZE5A 2BCGY 2NPIA 4TTPA 4D0LB 2GILA 4WBSA 3FMIA 1N3BA 1CR0A 1WA5A 4A0GA 3I62A 1D8TA 1SKYB 4BEJA 1E4VA 1ZUIA 4TTQA 3K0CA 1AS0A 3BE4A 2DFTA 4BLOA 3V4RA 3AVWA 2ZYTX 2J46A 4QFMA 4AIIA 4C0BA 521PA 3EPHA 4Q7KA 2FGKA 4UJ5A 4XOIA 3QPVA 3EZFA 1E0AA 4Q00A 5JJIA 2V9PA 1AZTA 4PC3A 1G291 4MKHA 3IUYA 1H8HA 4LJ7A 2F55A 1EWRA 1K8RA 4UQOA 4A4DA 4DLUA 4Q18A 4F7WA 5DYIA 4LZZA 1IONA 1E2NA 4A1FA 1XEXB 1MT0A 4A82A 4TLBA 1IQPA 1IY2A 4JVNA 5KNDA 2RH5A 4LJ9A 4C0SA 1J70A 1QHHB 3T61A 1PLKA 2ZJ8A 2C03A 2IF2A 4U00A 1G19A 3OFND 3SJBA 2J0QA 1DAIA 1G21E 2V1XA 2ZRDA 4QGGA 2H5EA 4DLVA 3X1WA 1A5TA 2OCYC 4A0FA 5CB8A 1DTSA 2EWVA 4S35A 3RRMA 5KPDA 3QG5A 3I72A 2VP6A 3KDSE 3RABA 3UPUA 2XTNA 3GJ4A 5FOSA 1KK0A 1XCGB 4GRAA 1U9IC 4I99A 1DARA 1UEIA 1OE0A 1YQTA 2X2EA 1JPJA 2ZE8A 4DLSA 4DLTA 1OYWA 2H17A 1AIPA 1E9EA 4G5RA 4LX0A 1YR8A 4XVRA 5HPYB 2XNDA 3PEVA 1OKKD 1KYIA 1G41A 2HXSA 5KNBA 5GJBA 4R71A 2XNSA 3WP1B 1S2MA 4GZLA 4FMDF 3DMNA 3H4MA 3ZVLA 4KBFA 4C0KA 3WNBA 3TNFA 3P26A 4WA7A 2V3CC 4LI0A 2IYTA 1XEWY 2J41A 2QENA 4IDQA 1ZAKA 4EAQA 1NSFA 3E1SA 4M2LA 4OQFA 1C9KA 4EFMA 2DHRA 1A4RA 3T15A 1UM8A 2YWHA 4ZIRB 3LAWA 1X8JA 2VH5R 4TN1A 3WRXC 2ECKA 2OAP1 4JKYA 3PUVA 4LV8B 2Q9BA 4WW0A 1I4TD 2D2EA 3HR8A 1L7VC 2PEZA 4RFVA 1KI3A 1KNQA 4NDZA 1MO4A 2C77A 1NP6A 4B74A 3AGQA 2ODEA 3CPHA 4Q1EA 2WAXA 3QF4B 1TAGA 3C16C 1US8B 3FYHA 2ZE7A 1JAHA 2HF9A 4PR0A 1OH8A 2JLVA 1ONBA 1W4CA 1KKMA 1MKYA 4AY2A 1X86B 3C41J 4OKSA 5JMTA 2A5DA 4TLAA 4JYBA 5TB5A 3LD9A 2ZSEA 1ZNZA 4C4PA 1G5RA 2OLKA 3B9PA 1OFUX 2GZDA 1T5IA 2AL7A 3ETLA 4WXRA 5KDOA 4QM7A 5FR1A 1HEIA 4E03A 4BRUA 2WJVA 4FMCF 4V0ME 5EUQB 3ZS8A 5GVSA 3GLFA 4FD2A 2ZRFA 2ZS9A 1FNMA 3K09C 2IYQA 3U3JA 3FHTA 4LDJA 1KO7A 2RGXA 4ZI2A 5FTJA 4MYHA 3OIWA 1XDBA 2FEOA 2ZQ5A 4UXIA 4AYXA 2ZR0A 4ZDJA 1OB5A 4GP6A 4PPQA 3RSLA 4C9BA 3TQFA 3EPLA 3RAPR 1RPZA 2KI5A 3RRYA 2BEJA 3SQWA 1ZCAA 2YV5A 1TF2A 4BE7B 1QHXA 3ZGXA 1R10A 3CX6A 1JQLB 4IOLA 2DFKB 4MKIA 5CK4A 4Z1MA 1ZNXA 3A36A 3THWA 3O47A 2BWJA 2KSQA 4NH0A 2BMJA 5AWFC 4D0NA 4FMDB 4F93B 4QXAA 4LSGA 5J4VA 4LJ4A 4Z8XA 1RJ9A 4JLJA 5HTKA 2KE5A 2AXNA 4NCJA 3PITA 2SHKA 1KI8A 5TV2A 2P65A 1RRFA 2WOJA 3QPWA 4QNMA 1MOZA 2QE7A 1FUUA 2C9YA 1D9ZA 3PVSA 4M22A 2WPDD 1S3GA 5TDHA 1NJFA 1BO6A 4HAXA 3P4YA 5DYGA 4B73A 3EPKA 4ILEA 4EFLA 2ZAMA 2HYIC 4ACBA 2R6DA 2Z43A 5AUOB 2AKAB 4RZ2A 1XB2A 1KO8A 1F60A 1GL6A 2RGDA 2HCBA 4KSBA 5K8IA 3EC2A 4WVFA 2X8AA 2CL0X 5BXQC 4AKGA 1CJMA 5DHFA 1IBRA 5FTMA 1IXSB 4RD6A 3TAHA 3SU8A 1CS4C 1JNYA 2YVUA 1BH2A 3N5CA 4B2PA 1P2VA 2HJVA 3BERA 5K8UA 3NDPA 4NMMA 2CEAA 2XTMA 1Z28A 4XWKA 2VP2A 4B6EA 5AUPB 2QM8A 4OK3A 2ZVQX 3PEUA 4LYFA 3LO5A 4BFYA 3K53A 3M6AA 1Z07A 4DB4A 1IY0A 1NVXQ 2ZSFA 2OG2A 1JBKA 1S1CA 3UG6A 3W5JA 1ZU4A 4FMCB 2BV3A 2LCFA 4A2QA 4JBWA 1G6HA 1SHZA 4XJXA 5EXXA 1RRCA 4ZDIA 3EIHA 3QY0A 2WWXA 1G7TA 3CUEF 1VIYA 1DAKA 3B6EA 4PSAA 1XP8A 3C8UA 3AVQA 4LHYA 3MFYA 4XWAA 4DB2A 2KB0A 4IHQA 1PVOA 2F7SA 2V6IA 2PH1A 2PEYA 4TLCA 1FW6A 3FB4A 2W83A 3ECCA 1GOTA 4XVUA 2ONJA 4OQXA 2GBLA 4HAVA 5B58C 5KU1A 4ERNA 2P6RA 1P9WA 2CLCX 4OL0A 3SJAA 2YWEA 3A8TA 1ODFA 4KLZA 2H16A 3GJ8A 1MRSA 3GLFB 4TL6A 2FA9A 4ZKEA 5KDDA 4X8MA 4IOJA 3AVVA 2CNWA 2QU8A 3RS5A 1XTRA 3RS2A 4BRWA 1N6PA 1MRNA 4B6FA 4D82A 2ZM5A 4LWZA 1P2UA 2QSZA 3NEYA 4PQRA 3RVBA 4M9ZA 3IQXA 2CE7A 4NYJQ 4MKFA 2REXB 3KQNA 2V55B 2IYRA 5FPHA 4P31A 5JLJA 4M1KA 1SXJE 2OILA 3RNLA 4RJLA 1GDDA 2J45A 1EFHA 1GKYA 5CLLA 3THWB 5H68A 2XEXA 1HY3A 1ANKA 1NLYA 1RJ9B 3CWZA 1EFTA 3Q5EA 2JLRA 1P6XA 3NEJA 2IUTA 1F48A 2FSGA 5HR5A 2GCPA 4GOXA 4ARZA 3K9GA 3WYAA 2WWYA 4NYIQ 1QRAA 3GCGA 2C99A 3X1ZA 3U3KA 2DFLA 3SJCA 3EXAA 3TLXA 4JLKA 1RFLA 4Q4HA 5IF9A 2OCBA 2IYWA 3OEHD 2OHFA 1KO4A 3PENA 1NMZA 1XCMA 3B13B 5CIWA 5FTKA 2C95A 1Q1QA 1ZUHA 2WIBA 3PUWA 1E9AA 1S8FA 3QQ5A 4QHSA 4F38A 2VF8A 1UBGA 1KK3A 4PAOA 3E2IA 1YKSA 2GWHA 1A82A 2Z83A 4UXJA 3K0SA 1CF4A 4HLQB 1HT2E 1LS6A 2ZSAA 5JWOA 3KQUA 1VCNA 4NYIR 1D6JA 2ZJAA 1KI1A 4O2RA 3GEIA 1AQYA 2C78A 1VCOA 1E2GA 1OHHD 3QEJA 4PAQA 1BYUA 3GD7A 3PG5A 3G5UA 1AKEA 1YR9A 1YR7A 2EW1A 2V7QD 2ZRGA 1U0LA 2JLYA 4BZQA 1A2BA 5KSZA 4WZ6A 2OESA 2ZR9A 2HXYA 3KTAA 4Q48A 1RKBA 2W2TA 5JCZA 3NVAA 1CBUA 1LY1A 1OKKA 4A0HA 4QBIA 1W5SA 1TTTA 2GXAA 2FJUA 2FFAA 3SN6A 1VIAA 2AK2A 4TMVA 3S1AA 3T5DA 3ZZUA 4GZMA 3PFIA 4PZZA 1LF5A 1M7GA 3TUIC 2RHDA 4G01B 1CU1A 1N25A 3L82B 4PZYA 4TWZA 4F4IA 1CR1A 4UJ3A 1AZSC 1Z2CA 1VCMA 2LWIA 5D3QA 2P0EA 3GFTA 4MQBA 4GP7A 2O8BA 2GZAA 2IYUA 2VBCA 3B60A 3R9IA 4TZ0A 5JJKA 4L5BA 1GAJA 3FGNA 4JZKA 5FOTA 1CKEA 3RWOA 3AH8A 3H0KA 2CE2X 1OXUA 2V8OA 4Q21A 4C7OA 2FOLA 3SDZA 3D3QA 4GDFA 2PZEA 5KTYA 2ERXA 2IC5A 5JHGB 2R9VA 2NO6A 2HJGA 4NPHA 3EARA 3Q9LA 4Q5IA 3MAAC 1RZ3A 3QJYA 3IHWA 3TBKA 5AR1A 4HLCA 5DLQC 4A6PA 1W7AA 2QBYA 4CF7A 4Q4JA 2HUPA 3ZH9B 3CZPA 1TEXA 2AKYA 1F3OA 1OXVA 4US0R 2X1VA 1RYFA 4YMSA 2AHOA 1VG1A 3I32A 4RCZA 1LVGA 3Q7PA 3I61A 1W47A 4RD0A 3OZXA 4MYTA 3QNUA 3HU2A 1KJZA 2O0HA 4EJSC 2IL1A 4IRUB 2MMCA 3U5ZB 3MD0A 1E3MA 4OHWA 3R8CA 4PTLA 4B34A 3REGA 5FUWA 1CIPA 4CT4B 2ZRLA 1ESMA 2FWRA 3KX2A 5AJVB 1G3UA 4ARZB 1KDTA 2C5LA 4PC1A 4AYTA 1WMSA 3B8HA 4R7ZA 1Z0AA 4Q4HB 1UPTA 2X77A 3VNUA 3CONA 5FTLA 4OI0A 5EZ6B 1QHGA 1QVRA 3A1UA 4PSKA 2JLUA 4JLAA 4FXPA 1OH5A 4FN5A 4HDCA 1NBMD 4H1VA 2Q21A 3CH4B 3ASZA 3IO5A 5F2EA 4YMVA 2ZXUA 2GBLC 4WZAE 1ZMXA 3KJGA 4EPRA 4QOSA 2F6RA 1N5LA 1J99A 4CRWB 2D74A 3REFA 3IDQA 5EE0A 4RD3A 5FOVA 2O5VA 3NBXX 1HE1C 4DUGD 2OV2A 2WPDA 3TGPA 5HE8A 2PL3A 2WJIA 2AR7A 1VG8A 1NJGA 4WXPA 2GHIA 4AD8A 5J4HA 2GVZC 1OV4A 2DR3A 2F3TA 3FMOB 4UKDA 4B71A 4TMXA 2YYZA 2KBFA 4K8OA 5EP1A 2BBWA 1N0WA 4LYJA 2QORA 1XNJA 3BD9A 3KTAB 3GJ3A 1OF1A 1OW3B 5IT5A 1JXOA 2GJKA 1J90A 4JLDA 4L16A 4EPWA 2C9CA 3AKDA 4M21A 1G3IA 3QXJA 2HEIA 4URYR 3S1AB 2XZOA 2FGJA 5AJZA 2VIIA 3IQWA 4AC9A 4NCKA 2G6BA 1Q1ZA 1DAMA 3EAQA 3AKEA 1NI3A 4LGMA 4AURA 1ZIPA 3PV0A 1NLFA 3VKWA 1JJVA 2VSOA 5CYPA 1G4UR 2QEQA 5FOXA 2F9LA 4KJZA 5KOYA 1E1RD 3B82A 1DG1G 3GPLA 4U5XA 1XJCA 4PC6A 4D4MA 2O8BB 4JLPA 4HB0A 4IXNA 3W3AA 1W0JD 1XZQA 2GCOA 3K0FA 1SXJD 1YZGA 3A1WA 4LBVA 4PSVA 3WY9A 1G3QA 1GNRA 3EWAA 4KHZA 4BZXA 1T8UA 4DVGA 4BQSA 1UADA 4C7OB 4HAWA 1MABA 2GF0A 3MCAA 5DE3A 4TYPA 1WE2A 3CNOA 1KZ7B 1Q3TA 1TQ4A 1N6IA 3LX8A 1W48A 4FWIB 4ZV4A 3HR7A 4LBZA 1TX4B 3UMSA 1N2CE 5FBRB 5LB4A 1NY5A 1XTSA 1DVRA 3FFAA 2ZSDA 3SE0A 1DE0A 4JLNA 4EPXA 2QBYB 3AM1A 4Q4JB 4PFSA 4W9MC 2ZETA 4P3YA 4H9GA 1VPLA 1RW4A 3B1WA 4BFXA 3ICEA 4UXHA 1CRPA 4B48A 1FTSA 1XF9A 3QOFA 3ADBA 1E2DA 2BIFA 1I4DD 2HT1A 1NRJB 3U61B 2A30A 2OAQ1 5E7JA 4URXR 1WXQA 1KAOA 3W5IA 1KI4A 2PX3A 1TEVA 4OHVA 2QI9C 4KFTA 2ZITA 1KY3A 3VU9A 5GVRA 2XITA 4IEIA 1E2HA 4DSNA 1ZM7A 2CXXA 4Q4AA 3JZAA 4TMZA 2BOVA 4JIMA 4M1TA 4JL8A 2ZI7A 4G5OA 1SVLA 4DLYA 1P2SA 1AA9A 1HUQA 4Q7LA 4MA4A 4N1AA 2IS4A 3CX7A 5J4KA 2DWQA 1FFHA 1N6NA 2WMOB 1AN0A 2G88A 2A5YB 3T1VA 2J9RA 3CRVA 2FZLA 4N0DA 1F6BA 4ZCIA 2GXQA 1WF3A 3ZD6A 1UAAA 2ZRNA 3HWSA 1WQ1R 3AGPA 3NDBB 2CVFA 1VDZA 2CL7X 1C4OA 3IKJA 2QGNA 3ND8A 1RIFA 2H1LA 1E2KA 3A4LA 2OT3B 3QUSA 1GL9B 2QG6A 3BFVA 4E09A 1PV4A 1NF3A 1KDRA 1KJYA 3V4FA 5KSYA 2G1KA 2QPTA 5C1BA 4OQLA 2MSEB 1COWD 2QMEA 1QF9A 2VP9A 2OUKA 3SNHA 2ZREA 3LWNA 2NZJA 5EUMA 3OEHA 1M1YE 3T06B 1F5NA 3VAAA 4CIDA 1W2GA 1N5KA 3HDTA 1BKDR 3IEUA 3RS3A 4Q4LA 4X8LA 3KUCA 4Q66C 2AK3A 4OK5A 4DIDA 1YRBA 2IW3A 1G5PA 1Z83A 2OXRA 3BORA 1EESA 1LTQA 3C5CA 3M0EA 2XB2A 2IUUA 1KTVA 2YINC 4HDQB 4RKFA 3IHLA 4G5SA 2QTFA 2W58A 4EUNA 1ZNYA 3MSXA 4YXWD 5JECA 2E87A 1OHHA 4PANA 3TSZA 1KK2A 2AWOA 4PHGA 2V7QA 3UATA 4QGAA 5HKKD 4M9XA 3M1IA 1IOZA 2AWNA 1OXSC 2WWFA 4DT1A 1N6RA 2GCOB 3K0FB 5HCIA 3D8BA 4KBGA 1EWQA 1JAIA 2IHYA 3EZ2A 2ODWA 2WWHA 4HLUA 1MABB 4JSYA 4V0MA 4LHZA 5LBIA 4DWJA 4QJ3A 5FH9A 1A1VA 4ZDWA 1E2LA 4DJTA 1P9NA 3I5YA 3BXZA 1YU9A 4RZUA 4Q9HA 3GJ6A 1ZBDA 3BB1A 2RCNA 1R6BX 3VX4A 4D4KA 3K8YA 3CX8A 5TMPA 3U60B 2AFHE 2DB3A 3RRNA 2VSFA 5CJPA 1JALA 4OI4A 2ATVA 1VYTA 4D2IA 1E94E 3VKGA 2XGJA 1J8YF 3QI2A 5JCPA 3SFZA 4M1OA 1GP2A 3DL0A 3KFVA 1UJ2A 2QP9X 4AYWA 4MRVA 2A5GA 2N1BA 1E9DA 2F1IA 3EX7C 1Q20A 1YZUA 2L0XA 3ZZTA 2ZI4A 1R0YA 5DIFA 1HA3A 4MUBA 2WKRA 1E2EA 3VU9B 4YMWA 3LVQE 4LCBA 2J7KA 2GJ9A 3JVVA 4Q1FA 4Q4AB 2CLSA 4POAA 2VEDA 4QBGB 5EXPA 1YJ5A 3GQBA 2PLFA 1FNNA 2GXSA 3KKMA 4DEXA 4B3XA 2UVQA 4Q02A 3X1DA 2EYUA 5DN6D 3NC0C 3AV0B 2XTZA 1AK2A 3VTKA 2HT6A 1IJFA 2BCJQ 2RGNA 2DWOA 3R9XA 3QVVA 1QHSA 2R8RA 4BPBA 1Q44A 5FPSA 2ONKA 3A37A 3GJ5A 4TL9A 2VHUA 3B7GA 3CRRA 1EXMA 4D0GA 2GA8A 2YNMA 5H1YA 4AKEA 2IA5A 4G0NA 4M1YA 4LPKA 5FPKA 4M1WA 5FI0B 2WSSD 2W6ID 5JJLA 2F9MA 5EJEA 2ZRAA 3PR1A 5K8TA 3WMEA 1XFAA 3IPYA 4CZ2A 3A6PC 4KCGA 3SBEA 3TJZA 2JLZA 4LY6A 2EYQA 4X8OA 4DXAA 1GRRA 2JCSA 3RS7A 1P72A 1VECA 1R0XA 3KQHA 1Z6TA 4RD2A 1TL7C 3F5FA 1T3HA 5EQTA 4KV9A 1ZM2A 2PJZA 3SBDA 5ANRB 2FSIA 1EG7A 1YZKA 2O8CA 1QBKC 2H18A 5EP3A 3NIBA 3AP2A 4MH0R 2IHBA 4TYWA 1NBMA 3RLFA 1YVDA 3OHMA 5KUTA 3IBYA 4DSUA 3AF4A 3G82C 2JAQA 5TVKA 3AP3A 3EW9A 3LBIA 1GUAA 4P4UA 1M8PA 5FOUA 4DRZA 3FFBA 1P2TA 1Q21A 3BJIC 1L2TA 4L15A 4M9QA 2VPPA 4DUGA 1XMIA 3I5XA 3K1JA 2D62A 3C14C 3F8TA 2GXUA 1XEWX 2QQEA 3AVOA 3NTUA 1HQCA 1UF9A 1KJWA 4Q7MB 5DHAA 3VKHA 1M34E 5EXTA 1G8PA 2IEYA 1LFDB 3ADDA 4RFSA 2O8EA 3SHFA 5CM9C 3I1FA 4DT1B 4OQMA 5EZ5A 3ASYA 3CRQA 1IN7A 3B78A 3H86A 4R98A 3FKSD 3TQCA 3W9YA 2ZRMA 2VQSA 4KU4A 2BEKA 1QHIA 3NC1C 1R8SA 2PT7A 1U8AA 4K46A 2HYDA 1ZD9A 4KVAA 3OESA 1W46A 3OE7D 1GRQA 1KDOA 2GNOA 3DKPA 1PLJA 3WXMA 2QAJA 3SZRA 1OT3A 5CDFE 2CK3D 2EFCB 1R5BA 2EFHB 3LW8A 1E1RA 4Q9IA 4XD7D 3UXMA 4E22A 4E5UA 1JXMA 1T8TA 3UMRA 4JSTA 4TMTA 2JLQA 1CJUC 1W0JA 2AX4A 2QT0A 1TU4A 1SXJA 2XJ9A 1K5GA 3ADKA 3AP1A 1VCIA 4HUTA 2CCJA 4RD1A 3GFPA 4PAMA 3O8CA 3AUXA 3R9WA 1ZJ6A 5KPJA 5A0FA 2BHRA 2Q3HA 4B32A 4NHOA 3V9PA 4FCTA 2ZS8A 5G40A 2PMKA 3K70D 3LFUA 2YWGA 2YOGA 2BDTA 3Q85A 3GP8A 1XX6A 2ZJ2A 4R2IA 3ZIAD 1GVNB 4RZXA 1KK1A 4KI0A 1FPMA 1YE8A 2F43A 1J8MF 4XVQA 4Z51A 2Z0MA 4IDNA 4EFNA 2D7DA 4XSGA 3ADCA 4O2LA 3QEOA 3KB1A 4TQAA 1T3SA 2V54A 1N6LA 3FDIA 4DLXA 2ODNA 2RGEA 4KVGA 2IK8A 3K0CC 2N42A 1IY1A 1WP9A 1II0A 1DAGA 2FH5B 1GKUB 1XCPA 3Q3JB 3HP1A 5SZKB 4C2TA 1M74A 2OFXA 2WMNB 4DBLC 1HQYE 4P0TA 1EX7A 2W6JD 3GJ0A 3KL4A 2H8KA 2J0VA 1X8KA 5UKDA 2ZANA 3B9QA 1NL3A 1NBME 4IW3B 5LPNA 3AUYA 2OFOA 2IS1A 2ODBA 4KYUA 3TSOA 3W8RA 2FE4A 3UK6A 3OAAD 3CRMA 3GJ7A 1N6KA 1KKLA 1OIVA 4ZKDA 3NKVA 2O8CB 2CHVA 2FFQA 3T5GA 5JZVA 5K8LA 2QN6A 1ZC3A 2AFIE 4W5JA 5JSZA 1ESNA 3IILA 4URUR 3LQQA 121PA 2ASEA 1E0JA 4F4CA 3ZD7A 4UNPA 4U7DA 2GDJA 3SS8A 3B2EA 2NPFA 1O3YA 4MGZR 2ORIA 4LUCA 4BEBA 1E4YA 2JA1A 1DPFA 1HH4A 3FHCB 3LVRE 4JLOA 4KXFB 5EXSA 4XTRA 1COWA 1E32A 2FSHA 4PPNA 2P67A 2IXGA 2CHQA 2HLDD 4A8JA 4V03A 4ASUD 4RFSB 2O8EB 4K81B 4ESVA 3W34A 3KZ1E 3I3SR 4BFWA 3SYNA 2FPMA 4QG7A 1Z06A 4PPGA 3DHWC 1Z6YA 4GOJA 4DDTA 1HURA 4JL5A 3LNCA 4TQUS 3FTQA 2RGNC 1TNDA 4B3FX 3TW8B 3RRZA 5L3RA 2WJJA 4OBEA 4LHVA 1KOFA 4PHTA 2B21A 4LV6A 1KHTA 1Z2AA 4TMKA 3VR3A 4YXWA 1T4GA 2ZE6A 4B3CA 2F3RA 5B64A 1XJ0A 4BLPA 5BN3A 2CCGA 2ZUBA 1ZC4A 2VP4A 3E5HA 2JEOA 5JWHA 5HKKA 3GLGE 1C1YA 3ZJYA 2ZYVX 2OSBA 2J3EA 1DEKA 4NE2A 1VG0B 1SXJB 1P4SA 4TZ6A 4ZPXA 2WBLC 1U8ZA 1MO3A 4J0QA 4WZBE 3SFVA 4PHFA 2QY9A 4I4LA 3L2OB 3H2YA 4DSOA 4NYJR 5BWMA 1I2MA 8OHMA 1G7SA 1G5TA 2PT5A 1IXRC 2GAAA 3GLHE 1DAEA 3N2IA 4PO1A 5LB2A 5IRCD 4D26A 1E99A 2NO9A 1W44A 4ON9A 2W00A 4B76A 4ZCMA 3U4QA 1CJTC 3K9HA 2FFHA 3QG1A 3WMFA 2UZIR 1GZSA 1Q22A 4OI1A 1E98A 4CYMA 2ZJBA 1ZUNB 2F43B 1TQDA 2F1JA 3OFNA 1S3SA 1QHNA 4IEEA 2PLRA 1UBFA 2GJSA 1TPZA 5JS8A 3TUZC 1SVIA 3KJEA 1Z5ZA 1G20E 4LYAA 3WYFA 3MMPA 2ZYWX 4OK6A 1X6VA 3O8DA 621PA 5F98A 3SYKA 1OLOA 1TQ6A 1T0HB 4FCVA 5AJXA 4C30A 2WZQA 1NMYA 4HLDA 3QIAA 1P3JA 1OFTA 3B1ZA 1BYIA 4I1UA 1CR2A 3AF0A 2NGRA 5DN6A 4ZO4A 2VHQA 3VNVA 3P1JA 2Q3FA 4V0OA 1E0KA 2FN4A 2VYFA 4W7SA 3RYTC 4P32A 2WWIA 3LH5A 3ICQB 3KXIA 2ZRPA 4LJ8A 2FF7A 2ZRIA 2Z4RA 3A4NA 3ZVNA 4LJ5A 3NBZC 1E96A 1SXJC 2C9OA 5JSZB 4B33A 3CF0A 2WSSA 2W6IA 4JJZA 1DAFA 1GSIA 4CT5A 3U6KA 3RC8A 4AI6A 2A9KA 2ORVA 1AJEA 1W4RA 4FI3C 1TUEA 2PCJA 4M8NE 2XOKD 4LOAA 4Q1DA 1GM5A 2QAGA 3PCRB 1TADA 2JIZD 3C7KA 3U7GA 4A8JB 2I3BA 3B1XA 1GG2A 4NP6A 1KY2A 3I8SA 1OIXA 2RKOA 2VO1A 4DCSA 5JI3E 4FWTA 4Q19A 3FWYA 1CRQA 4Q47A 3WP0A 1Z08A 4M9SA 3B85A 3D31A 4CGZA 1KZGB 4G3XA 1XMJA 2OCPA 4G5QA 3IIMA 3TUJC 1XEFA 2RGBA 1NN0A 5LDDC 4OHXA 4W5HA 1FUKA 2B7CA 3BH6A 5TY0A 4IVQA 1V43A 2OBLA 2QA5A 4DCVA 2WJYA 2FU5C 2PJRA 2QMUA 5AK0A 5FBLB 1KNXA 3B5JA 1UFQA 2WKPA 1DO2A 4DHEA 4C2UA 4NTZA 4AK9A 2VA8A 3DEFA 4OJKA 3ZS9A 2ZYUX 5ELXA 1RC8A 1RRGA 3FKSA 3J81k 2RGGA 4LV5B 3WMGA 1HV8A 3C15C 3CIOA 3WHLA 1UBCA 1EFRD 1VG9B 1JQJC 3OE7A 4ITRC 2BM1A 2YC2C 2VP5A 3EASA 3AKCA 1G8YA 1GILA 2O0KA 2ZJOA 4Q03A 2CK3A 4EIWA 2DYKA 3U4QB 4BWYA 2EU8A 5EE9A 5EE5B 4XD7A 4GMXA 4ABYA 4CEJA 5FUYA 4DLZA 4IVPA 5B57C 1NY6A 4X8HA 4JL6A 1M7BA 3L0OA 3AVPA 4KO8A 3NG1A 1KMHA 3P32A 2BMEA 4C0AC 2EQBA 3THXA 1DBSA 4EPVA 2QUZA 3DO6A 4C0LA 4NKRA 2NIPA 2ZS7A 1JJ7A 1Z0KA 4Y0AA 2EWWA 1D5CA 2B8WA 4ZI3A 3BB3A 1NKTA 2A5FA 3FHOA 4BLTA 3CPJB 1XPOA 3RWMB 4D4LA 2D3WA 3T12A 2DWPA 3R8FA 1DADA 1NVVQ 3ZIAA 1EFUA 4L4UA 1JR3D 1Y63A 2PZGA 2I1QA 3FOZA 4KYIB 3CNNA 3NH6A 1PLLA 3U7FB 1ZVQA 3DDCA 4MRSA 1W36D 1XXHA 3WBJA 4GOKA 1W4BA 3CLVA 4C3ZA 2QT1A 5KSOA 3FE2A 4HAYA 3LBHA 3PEYA 4UNNA 1MV5A 3BB4A 4QHTA 4TLEA 1KI7A 3L8ZA 4F4JA 1CULC 1NVVR 4HI0E 1IXZA 3WNDA 2W6JA 3ZLJA 5AJYA 1KO5A 3QBVA 1U9IA 3AB3A 4LK2A 5CYOA 2XSZD 1Z63A 3DMDA 1ZD1A 1Q0UA 1HYQA 4BECA 5M04A 2ZROA 5B2ZA 3A1SA 2A3RA 1TUIA 2R6FA 5IHPA 1G8HA 1W2HA 1AS2A 3OAAA 4JYCA 3KB2A 3EG5A 2QAGB 1E9RA 3MRSA 1ZYUA 2ZU0C
chains in the Genus database with same CATH superfamily
3C3EA 3HFGA 3L0BA 3LQ1A 4PFKA 3EPRA 1CE8B 1LBIA 3TFQA 3GRZA 5LNK6 3OZWA 3M3DA 3DOEA 2W42A 3O38A 3TXXA 3HV2A 4L5YA 5LSAA 2WSBA 1LF0A 2LW7A 3QVSA 4O3FA 4BB9A 4E13A 5C4MA 2GB4A 1GNLA 2I1LA 2VRCD 1QFMA 3RT7A 4DR3B 1ZM3A 2AJCA 1DU4A 2X5XA 4LQ4A 4X1YA 4ZOLA 5IEBA 3NBYC 2ZSKA 3L84A 2YWDA 3IT3A 5AI4A 3IAM6 3AESB 4ECAA 2UYHA 4ZVRA 2AFHA 3RGWS 2P7HA 3MJVA 3TKAA 1AKYA 1BHSA 2RH8A 3AO0B 3ELWA 3QX9A 1HT1E 1MPXA 2LIPA 3DXZA 2HLDA 2C5EA 4RIGA 4QGHA 2JBAA 2I6FA 5CGQB 5SYMA 3GP3A 5COBA 4BFUA 3I9FA 4M98A 1B15A 4FWBA 2Q3EA 1CUHA 5FO0A 3SJZA 5LQMA 4K05A 2X7HA 3ABIA 1ZRNA 3WQRA 4G89A 5KVCA 1GYPA 5SZIA 5EP2A 1XQ1A 3F73A 1W6UA 4EA9A 1UR5A 2AN9A 1H2FA 4LZWA 4OMCA 4WCFA 4CMIA 5A4FS 1VLMA 2ORYA 2R6GA 3ELDA 1X13A 3PSAA 1P61B 1KTIA 3MQFA 3QFRA 4BVJA 4XGIA 1OPXA 1T1EA 1AA6A 4PQFA 1Z13A 2JGNA 3M2PA 3T5CA 4K3UA 1OH6A 2ISQA 1EA7A 4JOSA 1K8QA 4P93A 4XRGA 5JYCA 5KVAA 2OYCA 2HADA 3SC3A 3LC2O 4W1QA 1TEZA 5EJFA 2G3YA 3NAGA 4D8YA 3FYCA 1HNZB 2IHJA 1UINA 1XZEA 1TF7A 4B4KA 4IY1A 1AE1A 5AUQA 3K5HA 4A1OA 4U3JB 1PL7A 3AKYA 4EBBA 5BUZA 3H4TA 5J2UA 5L3VA 4QTTB 4CKWB 2JDID 1WCXA 3DB2A 3FGPA 2OBMA 3H5VA 4QLOA 5A03A 2WYWA 4MQFA 3T9FA 2QAGC 5IAAA 5BR7A 1NAHA 2NSJA 4J90A 4Q05A 5JARA 5L4LA 4ACAA 3S8EA 5FDFA 2NP6A 1GAEO 2ACKA 2O6LA 2I1WA 4ND6A 1TIBA 1W52X 1Z88A 3JQFC 5E4YA 4MKGA 1SOUA 3DGFC 3G17A 3K70B 3QUAA 2ZIAA 4CM8B 1JYFA 1NC1A 1VTKA 2BMFA 3TSYA 3H18A 5M5BA 3TE6A 4KIJA 2Z9DA 4E14A 3KV3O 2XQIA 2I4NA 2RKBA 1KQGA 1T0JB 4A36A 4NCIA 1XZIA 5GOZA 1LS1A 1FTYA 1PF7E 1S01A 2GM5A 1P1IA 4P84A 1TYDE 2Q3BA 4PIMA 1FRQA 3TDMA 4DJEC 4B3GA 2ONCA 3A05A 4OKIA 4WSOA 1UWLA 1T9GS 2PY6A 2X5NA 3DEIA 4B87A 3BK2A 3MTBA 4MWDA 1XD9A 4Z8YA 4A2WA 1QIDA 4MVJP 3VO9A 3PQCA 2GF2A 5LMCA 1NJ5A 2CL6X 1T4MA 4UM8B 5K3BA 1XT6A 2OBNA 2WAOA 3Q72A 1DXYA 3EZ7A 4C1NA 3HP7A 1SKYE 1GKKA 1XAHA 4C3UA 1AKUA 1W30A 4FGLA 4HAUA 4MB0A 3RFXA 3RS8A 3W4JA 5DBOA 2D2XA 4GPTA 1WABA 4WXEA 5JRJA 2DBZA 1ZH8A 2FZ4A 2HU5A 1Y1LA 2EKBA 4E5DA 3CCFA 1K0UA 2CDAA 3GT7A 3KUDA 5LU8A 3I39X 1IM2A 1DZ3A 2JCGA 5LCXA 3ZZ0A 4UOQA 2INGX 4Y30A 1QH0A 4BMZA 1P6QA 1NN3A 1V71A 5TSDA 1YQGA 4NHEA 4RD4A 1HX7A 4D4GA 2I3AA 3EEQA 2XXAA 3PJRA 3FMVA 1AQUA 4X1YB 3NJRA 4I5DA 4ZOLB 3NI2A 4CKYA 3UGKA 2QRUA 1KQNA 1ODJA 3G7NA 4B43A 1T24A 2GZSA 5K0NA 5F9FA 1UDBA 2OL4A 4EITA 4HQNA 1IN5A 4E5MA 2AFHB 4LJAA 1RFGE 1MGPA 2Q0HA 2GPWA 1XEAA 2JBAB 5SICE 5FJIA 4ISCA 2FFBA 4QEDA 3HYRA 1Q1NA 3S4YA 5CDGA 2CZCA 1QCZA 2GJ8A 2ZJ0A 1YQWA 4B45A 5A7FA 3DA8A 5IC5A 2A9RA 5GJVC 1FMJA 4MW2A 3TM5A 2C58A 1CP2A 1I6WA 5J2TF 4WCFB 4CMIB 1X0XA 5DNDA 4MIOA 4TYQA 5IDVA 4PYIA 2O1SA 4P08A 1R1DA 1E2IA 4HQRA 3VO8A 1HDZA 4DDVA 1ZL2A 4BMYA 4YS6A 3HYTA 2XT9A 3RYIA 4IJKA 2NSHA 2WYVA 4NONA 2VSXA 4JT2A 3ITEA 5KYGA 1PBNA 3WGVA 1RXUA 2ILTA 1NW8A 3OIYA 3IB6A 4NQZA 1QGAA 1WBJB 1PL8A 3GI1A 3IBTA 1EFAA 2A7QA 1WDMA 2E18A 4I81A 1CJVC 3KT3A 3NXSA 2RAUA 4RBNA 5FO1A 2CUZA 1DSSG 2VG8A 2WHXA 3RS0A 3V8MA 2RI6A 4L8YA 3UMBA 3G49A 1WXHA 3GHHA 3ECAA 4UVIA 1JLSA 4Z49A 4MQFB 5GADl 2VYVA 1LW6E 4FX2A 4A7PA 3VFDA 3DHNA 1WMDA 4L9WA 4Z99A 5T64A 1PR0A 1ECBA 3QVLA 5BSWA 3KYBA 4TYNA 1ZCFA 2G9RA 2WT4A 1FP7A 1QYXA 1E7WA 2E6UX 4L7VA 1V9LA 3OA0A 5FFMA 4IG4A 1ZI8A 4MKZA 3TRFA 3I53A 3Q5DA 2Q5JA 4M88A 1DBRA 5LA6A 3PFCA 2JJ2D 4CW7A 2IYVA 4B0OA 3O9MA 3BOSA 3K5IA 4HAZA 4YIKA 1X7GA 2P5YA 2ZVJA 3ACCA 1S7GA 2P5TB 3ROMA 5BW5A 5FA6A 3FSGA 4HGQA 1O0CA 1RPJA 3TPFA 5KDLA 1QE0A 3T1OA 4RZHA 3C6MA 3UMVA 3EOZA 2I67A 3QWBA 3FVWA 4BP1A 2ZTSA 1FX1A 2NM0A 3JYQA 4TOIA 3RBXA 1KI6A 3OEED 3P2MA 2EG9A 1AM4D 1AF4A 4JVLA 2KLBA 5IM4A 3BBLA 2IYSA 1EDZA 2MSDB 4JMLA 3KUUA 1UXJA 4TTIA 3PD1A 4DRYA 3IDSA 1CUEA 1P0PA 3NUZA 5IG2A 2P4QA 1PZFA 3NP7A 4JXKA 3NKFA 3URMA 2AD5A 4RY0A 5C9ZA 3LUFA 3DGEC 5EE3A 3FWNA 1ST3A 1ZR4A 1WY7A 4DQDA 4RHCA 1JB1A 1BW9A 2GKOA 1VHTA 2I4IA 3CTMA 3EGEA 4X45A 2RIRA 4HUQA 4BVLA 5G41A 1D4FA 5E7MA 2EZ4A 3ZCTA 2VBIA 2FZGA 4HEA6 5DBIA 2GF9A 1L8OA 2F17A 2F1HA 5EQDA 4XM1A 1PK9A 3JWJA 4D96A 4Y2GA 1X1SA 2E49A 1FOEB 2WU4A 1P4RA 1E79D 1WMAA 1LX6A 1V7ZA 2ZT8A 2VFAA 1I13A 4FHGA 3ICVA 1XUOA 1BA3A 4HB4A 1YHNA 1FMTA 3AHFA 4UUMA 2WIDA 5ILQA 4QAJA 3X1YA 2XXAB 2UYGA 2HTEA 3BHNA 2A0XA 1QV9A 2IELA 2Y1CA 1WBDA 4TSKA 2C0QA 2GBPA 9LDBA 3BE5A 1B0UA 1ZD5A 4KR9A 3QX3A 2GFIA 4G41A 1R2QA 4DDKA 1JEDA 3BFPA 5DX1A 3WWCA 1SCBA 2P2SA 2O7RA 3RU2A 2QTVA 3I2GA 3SQNA 3TFOA 3W4IA 4E5PA 1H8ED 2Y0PA 2EGUA 1PR4A 3A4MA 3S70A 4D3FA 3OQJA 3V8NA 4M8SA 3CTPA 1FQKA 3RRJA 4N5DA 4M8IA 4Y67A 4XR4A 3TTVA 2ZXFA 4YDHB 4XXHA 5JYBA 2ZBEA 1A9QA 3RC7A 2JVJA 3CM0A 3NHUA 4TQ9A 4EHFA 13PKA 3GEDA 2BFPA 2WM9B 4KEAA 4M0MA 5EI5A 4YV7A 2FR8A 5IK2D 5CDHA 1C7RA 4MQLA 1MR3F 1J56A 1J9EA 1U02A 2O2SA 5CDYA 4FYWA 4MGEA 3KB8A 5KO2A 1AT1A 4C06A 1W59A 3ZWWA 3DBVO 4B40A 2VRWA 5F78A 4ERXA 4RTJA 4OBXA 3M6FA 2GETA 3IPLA 1FDUA 1E2JA 1ZK3A 4CF4A 1IN8A 3TVDA 3RYIB 4PV7A 1J6UA 5T57A 5FWNA 1ZQ9A 1SG0A 5CW2A 5CXUA 4N9QA 1QMPA 1Z0IA 3D7NA 1RAAA 3IERA 5B1HA 4AS2A 3VR6H 2AR0A 5TF4A 3FCEA 5JI2E 2WF6A 2Z1NA 1ND5A 1Z4QA 2AG1A 4XVHA 5CUQA 3R0XA 1X0VA 4EDHA 5J58A 2XZLA 1HFKA 2GM9A 4AJ1A 4DQ0A 1YZNA 2M6KA 4EMSA 2YWFA 1RTKA 2Q07A 1OFHA 3CS3A 3O7MA 2EERA 2R5WA 2O2YA 3Q3IA 5SZHB 4YMTA 1UOEA 1VJCA 4JK3A 5SZJA 2O1WA 2P90A 3L7CA 5BSVA 4R3WA 2WM8A 3I3OA 4IV0A 3I9OA 3OLXA 4O4HA 3R3HA 2WLTA 2R6ZA 1SK9A 2R6CA 4WKNA 2QRZA 4J49A 2OVFA 5KJ6A 5IZCA 4Z4GA 5LP1A 1QG2A 5LA6B 1VL1A 1L4YA 4QQ8A 3VM6A 2OGTA 2Q5QA 4Z54A 3COJA 5FBQB 4DTIA 1QFSA 1I2DA 1B8UA 2BUAA 1CJSA 1K27A 4YMUA 1UKYA 1RE0A 4C78A 2A78A 5BRJA 3SKVA 2IITA 1XROA 1P5ZB 3E5NA 4JJKA 4G9GA 1YDEA 1E2PA 4I0WB 4EELA 3IO3A 1KI6B 4FIDA 1PUJA 3VR6D 5K05A 3IQGX 4F2HA 2QJWA 3HA7A 2GH1A 5DLPA 2GVDC 2EJWA 3INTA 4PEVA 4YAUA 4MDFA 4PPFA 4V0RA 5BYJA 1K66A 3PEWA 3CH5A 1YS7A 3HYLA 3KO8A 3NM6B 1XWFA 2NTEA 3WAJA 3TIIA 1MB3A 4PRZA 1EGAA 3EYWA 2OYRA 1JKJA 3A3OA 5IVIA 1ZA2A 2D4HA 5AI0A 2G5PA 3HKDA 1BW9B 2PZFA 3IIKA 4UZEA 5JBQA 3P45A 3AVYA 4HUQB 3ZXSA 3GJZA 3ZWBA 3QE0A 4HL6A 3NHYA 4D6YA 3I8OA 1G2IA 4FFBA 4Q9KA 1E69A 3JQAD 2YXDA 4ND2A 2J9FA 5ADHA 1H66A 3DHYA 4GOOD 1YRYE 3BUSA 1G1AA 4F5DA 1WMBA 4N0PA 5BN4A 2XD4A 3AZQA 3C48A 2J87A 4KN5A 2AI3A 1JG4A 3IP3A 1DIRA 2EWMA 4F3YA 1PJTA 4V2UA 1DRVA 4IMIB 3FTFA 4MWCA 2IXEA 4H1HA 4EHKA 4NDNE 3LY7A 2AD1A 5K5EA 4N0MA 2CJWA 2ORWA 4XRRA 5EC8A 5FLYA 3F98A 3ND9A 2D2IA 3T9BA 3K94A 1V4NA 4NMHA 1PYOA 1Y9DA 2O52A 1C29B 2QTVB 1TVKA 1PGQA 5JRZA 1R6DA 4K87A 1GZUA 4W8HA 2PMFA 4R1OA 3F67A 1FU4A 5KTPA 2C9DA 4LBYA 1XPJA 1P1RA 3FCOA 3FYUC 2ATXA 2FOIA 2ZIEA 3IQEA 4JGGA 2H65A 2WU1A 1MG0A 4LZLA 4YI5A 4HB2A 2X13A 2E55A 1AKVA 2FB9A 5LQCA 3ZZ1A 2HZ7A 3ABQB 1LA2A 5AW8A 5FTNA 5FLXA 1UK6A 3HCCA 4G0UA 5KWJA 2VJKA 1X80A 2FCAA 2ZYIA 3IAS6 1OYYA 4K9QA 2G7MC 2J3MA 3VOAA 3WV5A 3F7MA 2ANCA 4GPBA 4W5NA 1Y6FA 4CV1A 1SD1A 5ALTA 3KQYA 4BJ6A 2E9SA 3TCNA 3MGCA 3G9TA 1FYWA 2RMKA 1RM0A 4KXQA 4E5KA 1KJ8A 4LTDA 1NNUA 3G5MA 3W6NA 1T1SA 2VF7A 4OBWA 1KMNA 1TQ2A 4A5OA 1T0PA 5TGZA 2I71A 1YQEA 2HV8A 1DDOA 2XUGA 5E95A 4RZSA 3WYNA 1NQTA 2GHTA 4D80A 5FL7A 3VX3A 4O25A 4L8GA 1M72A 1B8PA 3H19A 1GZ6A 3BHMA 3KEQA 2EVWX 3VUFA 3SEAA 1MO5A 2ZEJA 1O97D 4KSYA 4Q3CA 4YP6A 3LCJA 1XV5A 2Y67A 3RJ9A 5A9TA 2PIAA 3DZFA 3QMWA 4PX9A 1FSPA 4MB6A 1NQWA 4DC9A 5KIAA 1YDMA 3LRPA 1HM5A 3WGZA 1LZLA 1SM4A 3DT6A 4R9UC 3UKDA 4CMCA 5TIIA 4EKEA 1NWHA 3L9XA 1KZYC 421PA 4A6XA 2OBXA 3LT4A 3MFQA 4O4HB 3ND7A 2R8YA 3WQBA 3G6WA 3AHJA 1UJBA 3CUSA 3NHZA 4YRBA 2HR1A 1KMQA 3WK7A 1TPYA 2LKCA 4JJIA 1RXSA 3GA5A 3AUTA 4E15A 4KXXA 3SXUA 4C6TA 4NXMB 5FBVB 4RVCA 4IHJF 5IDXA 3L18A 1DAHA 4POOA 5LMZA 1CQIA 1PUIA 2YVKA 4DSAA 1NXSA 1YF3A 2GESA 4K28A 1M6NA 4GLLA 4JUBA 4K9KA 1G66A 2FNAA 4W9RA 1JDJA 2FJ0A 3CC8A 4LJYA 3VZCA 2WJ6A 1PWXA 1UPCA 1KEEA 2Z6VA 4I9UA 1J2RA 4HVAA 2PNFA 3C0KA 3JZDA 3OZEA 2IEBA 3P0EA 4R7ZA 2EX1A 5DTRA 5ESXA 1BROA 4K6CA 5E7QA 2I55A 1FNSA 5K6AA 1P7YA 1UC4B 4B5LA 4CKZA 1ZOPA 3HG7A 5DGHA 5CVVA 1NOJA 2YXBA 3TMKA 1KGSA 5A04A 1YRLA 5ITZA 2JFZA 5KNBH 5BOVA 4G23A 1X77A 3TINA 3JQ9A 5I7VA 5K0BA 3UK0A 1V3QE 4YRTA 4PZLA 1SBQA 4IICA 3WHKA 4CQNA 1JKJB 1RWXA 2DPXA 3MJHA 4IZOA 3H9JA 3HKDB 4H0CA 1EX1A 1GCUA 3MG9A 1N8TA 4FFBB 1QVAA 1A9YA 4TM7A 3LLMA 3LK6A 3Q0TA 2DY0A 2IUSA 4IWXA 2J9FB 2QI9F 2XTAA 1K6MA 5F9HA 5EIEA 4X85A 3T35A 4M1SA 2CLEB 5BN4B 2C31A 2P4EA 2C04A 3VNSA 3ZHRA 4CCAA 2G9NA 4NBVA 1WCIA 1JJIA 1SGWA 3BIJA 1CY2A 4CETA 2UZ4A 2VKTA 1KFBB 3K8OE 4L5IA 4U39A 3PNMA 3PQDA 3HC7A 3EWIA 1WOMA 3L8FA 9ABPA 2H29A 5DHUA 1QTRA 5K0ZA 1K2WA 2CJWB 1SQGA 2QLTA 3TAUA 3Q8LA 4GI3A 4GMDA 1P1JA 1IVYA 4EUKA 3DL7A 3L79A 4KR7A 2X8JA 2XKJE 1XVUA 721PA 1HZJA 1C0KA 2B2CA 2XNDD 4NZYA 5ER9A 1TVKB 3UENA 3L1KA 1RWVA 3L1VA 1T8SA 3QKSA 5JEEA 1RJWA 2ZRKA 2A67A 2CDNA 1NSTA 2TMKA 3ZZNA 5KNBD 2VJDA 3VISA 5B6PA 1JE1A 1R6AA 4LJSA 2X8WA 3THSA 4WL0A 4WHMA 5B1YA 1ZWKA 2FFRA 2XNKA 3NZEA 4J1SA 3RS9A 5BSUA 4Y98A 4IP0A 4YR7A 1Z6AA 4RTRA 1Q11A 1UK9A 4U5QA 2PAFA 3ETEA 1X80B 1KKUA 2BJVA 3KDAA 3M6LA 3NBFA 4P4TA 3TJRA 4KLNA 1NLZA 1N2GA 2PRJA 1KSHA 4FQ8A 4FCCA 3DS8A 4IKEA 1NUHA 2GN9A 1EJBA 2WWRA 5BORA 1K06A 3OZAA 2GEVA 4RHUA 4JLWA 3SEQA 3W9BA 2VZ8A 1AKWA 1TMKA 3G0CA 1BIFA 1PW5A 1PKEA 5H82A 3MUNA 3RDPA 3RSSA 5K8VA 1WR8A 3A6DA 4CEHA 4A8JC 2C9ZA 3H2SA 3MLBA 2H85A 3INRA 4K03A 1A7AA 1G4HA 2G07A 3BIOA 2H06A 1ZM9A 3AI2A 4ZJYA 5JV5A 3KOWA 3O2SB 4FHZA 2QUAA 1VJ5A 4GXNA 4YRLA 1RQXA 2WD9A 3G1WA 1L7BA 5E7IA 1SEVA 2JIOA 4HADA 5FV7A 3GVPA 1SUCA 1P7VA 1SVWA 3MWLA 3NTQA 4HWRA 1BJRE 4IDEA 1DQNA 1UFKA 3THOA 3THYA 3S1LA 5ADWA 2CYBA 2GJ4A 4W9NC 4HZUA 1GFZA 4OQDA 5KTMA 2C1EA 3QVUA 1UT8A 1WQ4A 1ZY2A 3QU2A 5EKXA 2XRYA 1RXYA 3KYIB 3ROQA 2AQHA 5LNK1 1FIUA 2VQEB 2UVDA 2G9UA 3ILSA 3OF2A 5EGSA 5D01A 1B1AA 1NVUQ 2YJ5A 1R3DA 2OLEA 3HGTA 4H2DA 5B58T 4MVCA 1IC6A 2ZI5A 3G5AA 2ADFA 4PXAA 3S27A 3SXUB 1SKQA 4C6TB 4KI7A 2BHTA 1GYRA 1QFZA 1E7RA 1CQIB 3KT8A 3NTLA 4URVR 3X1KA 1Y1QA 2WDZA 3IAM1 5ES4B 4XWWA 1UAYA 1XA0A 2AT1A 4B1FA 1TM5E 4M89A 2I2CA 3DKVA 5BN1A 2F3QA 1VRWA 3EWSA 2VTDA 4ZPJA 2Z6QA 3MS2A 1YQUA 1JIIA 3KPVA 1U81A 4YLGA 1KEEB 2P2DA 4DLRA 5IFKA 5JH7F 3LXRA 2GZ3A 3GJSA 3UWDA 3H8SA 2QNRA 2RGAA 4GSYA 4CMHA 3TL3A 5CFOA 3OWOA 1TIKA 2Q4OA 3Q7SA 4QOFA 3UB3A 1OBCA 1E1KA 5IMBA 3O8RA 4P80A 5ITZB 1YD7A 2DCUA 3PYXA 1QP0A 1OCEA 1NJ2A 3H3JA 1DWQA 4IGAA 4YECA 3SX4A 3W6OA 2FQ1A 4DIUA 3P9SA 4TTSA 3E8SA 4NL4H 4HBGA 3NTOA 1W4AA 1O0BA 5A3JA 2ZQYA 2X3UA 5HE9A 3ZU4A 1NXQA 1T3LA 4FLEA 2NUPA 1XJQA 3H7AA 3BDIA 5HG0A 5IDWA 5P8WA 5EKSA 3VBCA 1VMIA 3PR2B 3UJBA 2ASVA 2Z4SA 2JLAA 3NAZA 1Q7GA 3L8CA 1LTKA 3OUZA 3W3ZB 2X14A 5AVKA 2PG3A 2KWIA 3EXHC 3PQ4A 2A5JA 2R65A 2WR8A 3CPEA 4OLHA 6Q21A 1WCIB 3X44A 1ULZA 2CXTA 2HWYA 3NRJA 2C9BA 3CVVA 3IAUA 2R6AA 5FBHA 2LPMA 1A96A 1IATA 1C3EA 2J9GA 1SU8A 4KE9A 3VVMA 4EZIA 5HZHA 2CWWA 3IL2A 3A6KA 3EY4A 3FNRA 4EGJA 1QQTA 2ZU6A 3C24A 2ZVPX 3JU3A 2ZRHA 2YBEA 5DW0A 3SOZA 1G5QA 3W9SA 3WNZA 1XTZA 2DAPA 2NZYA 2P9YA 2X8JB 3BFKA 3MZ0A 4NBWA 1JLRA 1QHHA 1WWKA 3SP1A 2HDWA 3MWGA 3QKSB 4GR5A 4ITUA 5CNIA 2FR0A 2EAUA 2HK8A 3HLTA 2BBOA 5HVNA 3TR6A 4XA8A 5AKLA 2B1QA 3IUJA 5ICCA 4AN4A 1QAOA 3OEWA 1XWWA 5DTEA 4BMXA 3W1EA 5KTNA 4Z7QB 1UBRS 3VR1A 2G1PA 2PYIA 2V4ZA 1BCSA 1W4ZA 4YP7A 2VDNB 2OEPA 1QZXA 2BHLA 3A3NA 4LA4A 4PR3A 4Y6SA 2Y9PB 4Y2TA 3RSOA 1EQAA 2P6PA 4HP8A 5BQOA 1CNMA 1E2MA 1CP3A 3DZJA 2PO5A 1E0SA 3D6FA 4H15A 4J2TA 5FAKA 3AFNA 1IBLB 4D9KA 5GTDA 1JI0A 4BO4A 1KYWA 4GMKA 3JZMA 1TM7E 4MV7A 1BE1A 1HG0A 3L49A 1OWPA 5DCLA 1A0OA 5DBFA 3DMHA 4CEHB 4CT0A 2FR1A 2PQ6A 1HDRA 1RWPA 2CJPA 3KJZA 2ERYA 3OKPA 1HE4A 3Q8XB 3QPBA 4GBJA 4OXRA 3ZCVA 3DNMA 5LD2C 2B1RA 3NHPA 4PYLA 3PK0A 4BRSA 4P6VF 1XQXA 1Q14A 2VSQA 1B74A 2CXPA 2XB4A 4US1R 2BPOA 5B2FA 2C96A 1EFCA 1NATA 2FQYA 1E5LA 1W4LA 4OYHA 1FS4A 2GYVA 3LHSA 4HFNA 3CNLA 5EIXA 3UIEA 2Z8YA 2HF8A 3QTLA 4QUBA 3THYB 2A86A 4K0KB 4OG2A 4FINA 4G56A 1P39A 2ETXA 4HK4A 1HFEL 3HUTA 4HZUB 2PUBA 4UUBA 4ZT5A 4V02A 5EIWA 4DZZA 1J7KA 1EJ6A 1QNLA 5EZQA 5CCEA 2P2GA 3FKQA 3SR3A 3WTBA 3P2KA 1JH8A 1F8YA 3VPCA 3IELA 5ALSA 2DBQA 3R5JA 4FT2A 1E2FA 5E4TA 4I50F 3TQTA 5JFGA 1GRCA 1MO6A 1ETUA 5I4BA 2PR2A 2ZAOA 1OYVA 1U9YA 3I6MA 1AMNA 1QIIA 5D6NA 2X0EA 1JHRA 2XH8A 3T1QA 1US8A 2QJRA 4IIJF 4JUCA 4ZD6A 2EFDB 3PHGA 2E4AA 1NF9A 1QQAA 4BKPA 1E1QA 2X22A 3AINA 1VE1A 4P81A 4NH4A 5BSHA 2R4TA 3ISTA 4RKEA 2A58A 3E2MA 3JRNA 3VTFA 2A0YA 5AVYA 3I34X 1A71A 1KAGA 1XZMA 2YVLA 2ZE5A 3HM2A 2NPIA 1ZISA 3JVEA 1TVMA 2GILA 4DCGA 3ILXA 4WBSA 1ZKMA 2YJGA 3FMIA 3O91A 4YRGA 1JDNA 4P5PA 1GQRA 1SXIA 1D8TA 4MKRA 1NXOA 3F3MA 3FTNA 4BEJA 1G8MA 2Z2IA 3OJLA 2IOYA 1KMCA 1ZGGA 2UXDB 1MCZA 4TTQA 8LDHA 2LGJA 3LPAA 1AS0A 4GAEA 4BE4A 4BLOA 2DH6A 4MV0A 2H48A 4PAGA 5JAIA 2G1AA 3DAOA 1JDUA 3L4BC 2NUPB 1AC5A 3R3YA 4IHAA 4QFMA 2EJUA 3HBLA 4OLFA 4JASB 1VMKA 1NT4A 2BR5A 3C7AA 3RIXA 4AO6A 2RGYA 2EHDA 2FGKA 5GMOA 5SYNA 4UJ5A 1EVEA 1GL3A 3V7FA 4IXWA 4K9MA 1Q7TA 2VUHB 3LF2A 5JJIA 1AZTA 4MYRA 4KHPB 3NORA 4MKHA 2UVPA 3Q15C 1SC1A 3WLFA 4C22A 1TC2A 4EL0A 2V5VA 4TMYA 1EWRA 1HDEA 3OOWA 4G1VA 4M60A 2GR9A 1BGXT 1JSXA 2PFKA 4KRXA 1Z68A 2LDBA 3CLSC 4UZFA 4PYMA 5AK4A 3MEQA 5FNZA 4AN0A 3N7UA 4MCIA 2O9JA 1IQPA 2QN1A 3BDVA 2GBGA 4EHLA 1I3OA 2RH5A 2JZNA 2FKNA 1GLGA 1QHHB 4U00A 2V58A 3C45A 1WY5A 3QGMA 1BHJA 2VCEA 3ESRA 3SJBA 5M3BA 3LPNA 1QO9A 3LUKA 4IUDS 3KL2A 3UKJA 4ZHQB 2Y1FA 3KAPA 3X1WA 1C3JA 2D5BA 2QR5A 3L1UA 4OFBA 2OCYC 2XBMA 4PYRA 1BCSB 1XVVA 4Z9XA 1KH2A 2JEZA 3PPIA 3RRMA 2VP6A 1GEEA 3UPUA 5FOSA 2G9ZA 4GRAA 4QPCA 4XYBA 4F71A 1TK9A 1V2HE 1YQTA 1OE0A 3JD3A 3D3NA 1JPJA 3AWIA 5ARDA 4B8ZA 2ZBUA 3LKBA 3VZSA 4B31A 4DLTA 2H17A 1YR8A 3H8VA 3V2UA 4BMCA 2QM0A 5TEVA 4NAVA 3HR4A 4JI5B 4CG3A 5EG5A 2HXSA 1JXAA 1XZDA 1S2MA 3H3XA 3IJPA 4GZLA 3DMNA 4CUKA 4NX2A 5AXDA 1H9AA 1J8QA 4RDCA 4ARCA 4KBFA 3WNBA 4YT5A 3P26A 4LI0A 2IXAA 1U6KA 2QENA 1UPBA 2OGZA 1F9EA 5FLKA 1GPAA 1S2LA 3K71B 1IOVA 3OSZA 3E1SA 2CFCA 1NW4A 5HIMA 4EAQA 2DHRA 4EFMA 5H16A 4GQAA 1UM8A 3O03A 1LJ8A 4QXQA 3LAWA 1Y6JA 2VH5R 4TN1A 3EYAA 3N59A 3EFBA 3COVA 3TWOA 1OBFO 4WTOA 1E18A 2ECKA 2YFKA 1X7WA 1ZN2A 2QM3A 3PUVA 4HEA1 3MM4A 4RC9A 4W7HA 3UJCA 1CEXA 1RE1A 3A1NA 3ZHUA 5A4DA 2VCYA 3E9ZA 2Q9BA 4DV3B 3ZY6A 1SXGA 3DOOA 5ALKA 5IWCA 1F6DA 1O6BA 4MV8A 2HMVA 4RFVA 5F2OA 4JU9A 2IZZA 1MO4A 3QRWA 5LBTA 4C7MA 1JDTA 1EVIA 1MB0A 4KDRA 1BFKA 3C16C 1US8B 4UREA 3FFXA 1E8NA 4WCFC 5E8RA 3RVLA 3GVCA 4FBLA 5IKEA 4U7JA 5HIAA 4K88A 1KPGA 4MNTA 3WKEA 3PUJA 4FONA 1UP6A 2QD3A 3LQ4A 5JMTA 5TB5A 2ERCA 1P19A 5LZ7A 1XJWA 1MB2A 2XPCA 4CKBA 4Y2VA 2GZDA 3QFFA 2AL7A 3C6QA 3KVNA 5K51A 3UJ9A 3ZU2A 1T6XA 2DZDA 4C2BA 5KDOA 4HNQA 2QTGA 3C5VA 3O73A 4BRUA 3HCDA 3GLFA 3SLKA 5CXQA 5EMLA 1QOPB 4PXSA 5LJLA 4ZZ3A 3PXXA 1I1OA 5I7SA 4RQUA 1VP3A 4LDJA 3TOZA 2J4FA 2XV1A 3D0KA 3UQYS 3TO5A 2FEOA 4UXIA 3SBOA 5EJ8A 4I55A 3DEZA 3GWGA 3G9XA 4QPZA 1B16A 3B6ZA 4X54A 4PPQA 1VE6A 3AHCA 1NUUA 3RSLA 3TQFA 4C9BA 2ZT7A 3DFKA 3I0NA 3GFSA 4UTXA 5KTSA 3EN0A 2I22A 2IP4A 2TRSB 2UVPB 3D3KA 2WJPA 4D44A 2GS9A 3HJRA 3ENVA 3N2YA 2VAVA 2JAWA 1R8YA 1CQPA 1KFKB 4X6LA 4D43A 3SVTA 3M82A 4AP9A 1JQLB 1UC8A 4G2NA 5AP9A 4Z1MA 2FRVA 1DEXA 2BWJA 2PZ8A 3CX4A 3ETDA 5DBHX 3TBHA 4LSGA 2PM8A 3KC2A 2NU9A 3BWEA 3GRKA 4RGQA 2KE5A 4FT4A 3BHJA 3ZD8A 1U4SA 1XDDA 2SHKA 3M4ZA 3NVDA 2XMBA 1KI8A 1DKRA 5TV2A 3I5UA 3QPWA 3EEIA 4WLEA 1FUUA 1Z12A 2C9YA 4R8SA 4WA8A 4FOPA 3PJEA 2WPDD 3WJ1A 1S3GA 1R4NA 1SUPA 2VCHA 2WSIA 1UODA 3FLAA 3GA0A 4ZVUA 5A5FA 4YVFA 5IUNC 4DUYB 1Q0QA 3T7SA 4EFLA 2HYIC 2WF8A 3FIUA 5DT9A 4DQUA 2XVZA 4RZ2A 4PS0A 1XB2A 1N2JA 1FZTA 4KV7A 5BY2A 1HLGA 4B7AA 5JANA 1F60A 2P91A 2QLLA 2DLCX 3I01A 2O54A 1KQ3A 1Q91A 1TD9A 3DWEX 4OQEA 3H9UA 5FORA 3TLAA 1LBEA 1XMQB 4QYIA 1E77A 2LP4Y 5K8IA 2COKA 4FGUA 1U1DA 2VJMA 1T2UA 2CL0X 4FSDA 2E89A 5BXQC 5JAMA 4QDXA 5DHFA 5TGDA 1IBRA 3PNPA 2HA7A 1WD5A 2QUBA 2P8JA 1XN1A 4FDVA 2BUBA 1GADO 3CX3A 2WNHA 1U7OA 4BO3A 3N5CA 4HNRA 4B2PA 2XQFA 1YK0A 2ONYA 3OU6A 2P8SA 3B5IA 2JD1A 3HVHA 3JVIA 4FBMA 4ZTBA 1UKBA 5IWAB 3AVXA 2OV4A 3GLKA 3M83A 2PWYA 1HBJA 2QSJA 3M6AA 4F3RA 3ITDA 3E3MA 4Y2QA 2W6OA 1TZMA 1NVXQ 2R7LA 5KTTA 1X7WB 4EYEA 3NCHA 4KIWA 3W5JA 1LU9A 1ZU4A 2BV3A 4FMCB 1WV0A 1J06A 3KU1A 1CZRA 2EL7A 1C2YA 4XIFA 1PR3A 3EIHA 1D2HA 1G7TA 5C53B 3JD1A 3BJRA 2CNNA 4EG6A 1L1RA 2GNAA 3A4VA 4QECA 3W2EA 3C8UA 4TWIA 1M6VA 4EVQA 2HJWA 4BNZA 1K7XB 3MFYA 3QBDA 4XWAA 2WUFA 3AVUA 2DQKA 1M5RA 3OQOA 1N1DA 5BNWA 4MV4A 1T2CA 2F7SA 3TW0A 1YR2A 3DLBA 3LPCA 2PEYA 2AJTA 3ECCA 5BUQA 3COYA 4BJ3A 1QF6A 1IUOA 3QE2A 1Y7TA 3GGOA 4UQPA 2ZJ7A 1TDJA 2A3NA 4CKBB 5FFFA 3SHVA 4ERNA 1JNXX 1P9WA 2VDPB 3F5SA 4UDXX 4PSCA 3E27A 1DUIA 2IEAA 2A8YA 2BDUA 5TQJA 1L5SA 3GLFB 3GHYA 4TL6A 1FUIA 1RYNA 1K7FB 1Y42X 3IAS1 2EW8A 4HDKA 4X3PA 5KDDA 3LFTA 1NFQA 3F97A 5IJWA 1NW3A 2XXJA 3HE3A 2CNWA 4EZBA 1T5OA 2OZPA 1X42A 4I55B 1MRNA 1UMKA 2VYND 3A4YA 5ADUS 4KN9S 2QSZA 4NQRA 2VJLA 3LP8A 4PQRA 2HQSA 2XUAA 4HLNA 4M9ZA 4S24A 3ZQUA 5BV2P 2HK9A 4NYJQ 4Y7CA 3MWDA 3N3AC 2Y77A 1HFJA 1MZVA 3PUIA 1GU0A 2IYRA 4YT8A 5FPHA 4AU1A 4DREA 6NULA 5DYTA 3KSBC 1AHIA 3UUWA 3SKYA 1H4TA 3RNLA 4AQDA 2QX7A 3MTDA 4R2JA 1N5DA 4YJ2F 1OT5A 2ZJ1A 2J45A 1HL3A 3DDZX 5EA2A 3AEQA 3UN1A 4F5YA 1U1GA 4TT8A 5H68A 1CUBA 2VDWA 1HY3A 1HNXB 4MICA 5CURA 5KAMA 2NU9B 4KK4A 3KD3A 1MQ8B 1UANA 3L5OA 2IUTA 3IOCA 5HR5A 3S99A 1ACMA 2GRAA 4XQGA 2XCLA 3BTVA 1QRAA 4GIBA 3F6CA 2XNJA 1DINA 2AUTA 2FPRA 1BDMA 2AN5A 2PX4A 3GEMA 3U3KA 5M34A 2DFLA 1R4NB 2H1WA 3R5SA 1TIPA 1BXGA 5KEIA 1A8SA 4FNMA 3OEHD 1J0CA 3EVDA 1OZHA 2CB0A 1F6WA 2Q8QA 5K20A 4IQGA 3PDUA 1ORDA 5CIWA 5FTKA 3WYEA 4BNYA 4J91A 4I6JA 2DFVA 3G5TA 3DDNA 3QQ5A 4V3BA 4TVBA 4RHEA 3CVOA 2D1SA 3P4UA 4XJTA 4QYIB 3ETCA 3VSBA 4R8KA 3DZIA 1A82A 1CUSA 2VJMB 3ZNNA 4HLQB 5K8JB 2ZTVA 2ZSAA 5CVDA 4JGIA 5JWOA 4WPGA 4WBNA 5KX5F 1ISMA 1Y5MA 2EEZA 2JHGA 2WP8J 2ZJAA 5B1DA 3N0RA 1NNLA 4O2RA 1R0RE 1KYQA 2C78A 5L9AA 3Q8KA 5I3CA 3OY7A 2VYCA 4DMHA 1BYUA 1MX9A 3DL4A 3LL7A 1VHDA 2PRZA 3E61A 2V7QD 4KDFA 4QLAA 4AAYA 4AULA 4BN0A 3QI7A 3ESZA 1A2BA 1M5TA 3DZGA 2FUCA 6REQA 1K1EA 2ZR9A 3TLYA 2HREA 3KTAA 4CTKA 2ZG6A 3HXKA 5CBPA 4U7PB 2DT8A 1W5SA 3STHA 3A9WA 2IV3A 3C3JA