1CKEA

Cmp kinase from escherichia coli free enzyme structure
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
225
structure length
212
Chain Sequence
AIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQVKGFSVNFERLLAEIKLVPAADALVLDSTTLSIEQVIEKALQYARQKLALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
publication title Structures of escherichia coli CMP kinase alone and in complex with CDP: a new fold of the nucleoside monophosphate binding domain and insights into cytosine nucleotide specificity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 70
structure length 212
sequence length 225
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 1998-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ckeA00
3VNUA 3WMGA 1OHHD 5B58C 3KFXA 1Z47A 2IF0A 4DXAA 5FOUA 3QY0A 3BH7A 3MWYW 2GILA 2ZTSA 4N1AA 4QL3A 3KKOA 4HDOB 1RE0A 1A1VA 4HB2A 4OQMA 5AR1A 1VYTA 4LJ4A 3TGPA 1U0JA 4TTPA 3DEFA 4OJQA 1Q22A 2GZAA 3DM9B 2YC2C 2J5XA 4OKSA 1CR2A 3ZYCA 1G18A 1GRQA 1FNNA 3LQRA 3FTQA 1P62B 2VSFA 1IN6A 2QT1A 5BQ5A 4V0OA 4IDPA 3RVBA 2PZEA 3PQCA 1E2GA 1NIJA 1OH6A 2ZYWX 1NVUQ 2QAGC 2YWFA 4IXNA 2CHQA 3L2OB 3QOFA 2ZSAA 1AZTA 2CMKA 3G0HA 3FYHA 1OXXK 1YRAA 1E2EA 3ETLA 4NCHA 4QXAA 3NXSA 1W0JD 4LYFA 3QBTA 4GMDA 3BH6A 4NL4H 2ZRGA 1NSFA 1K5DA 2FZ4A 2KJQA 1G3RA 1S4QA 3IEUA 4C9BA 3GEEA 3RRYA 3NC0C 2F1HA 3I32A 4IFBA 3PUYA 4Q1EA 4YXWA 5H1YA 5GJWC 3NIBA 4RZXA 3U3KA 2FGJA 2W2XA 3KQHA 2WWYA 1YHNA 3H0KA 3SHFA 1G3UA 1V5WA 4BLSA 1FX0A 1HA3A 4DHEA 2XB2A 4F93B 1TQ4A 1E2PA 2GJ8A 4U7DA 1RJ9B 4AKIA 3PEUA 1X86B 4IJMA 4ON9A 4TL6A 3EZ6A 3I4LA 4H9GA 1IY1A 2ERXA 3Q72A 4MRNA 2QMOA 4K46A 1IHUA 1DE0A 1XEXB 1ZP6A 2XB4A 2C77A 1CTQA 2ANCA 2FZLA 4LBWA 4DCUA 1RW4A 3KTAA 5KOYA 1HT2E 3QJYA 5CB6A 3A37A 3TBKA 4A8JA 1T6NA 1EFHA 1C9KA 3OE7A 3EXAA 4CT4B 3A58B 1SVWA 3T15A 1CLUA 1UKZA 3HP1A 2JAQA 3HU3A 1Z3IX 1BMFD 1TUEA 1XJQA 1VIAA 4A2WA 5C18A 3EAQA 4MH0R 3I5XA 1VCMA 2WAYA 2RGNA 4X8MA 3TVTA 1GG2A 1SVIA 4II7A 4LYAA 3W8RA 4EPVA 3BWDD 1HH4A 2AR7A 4LHYA 1X8LA 2GTPA 3I8XA 1LF5A 5EP2A 4M1OA 3DM5A 4WZBE 1KHTA 1VTKA 3AM1A 1ZD1A 1JR6A 3U7GA 1WXQA 1JAHA 4V03A 5A0FA 1S3SA 1SXJE 2ZUCA 4G5GA 4LBZA 2J1LA 2VSOA 4JLKA 3WY9A 1CRPA 1W2HA 4ZCLA 4TQAA 4PANA 1UF9A 5TARA 1Z0JA 2W6JD 3OZXA 3PVSA 4M4SA 5DGXA 4QHTA 3K09A 3IKJA 1R0XA 3LW7A 1E2FA 3QVUA 3ADBA 1JECA 2HJGA 3CF6R 1IOZA 2OBNA 4JZKA 3BERA 4D25A 3MMPA 1VKJA 5EE3A 4JYBA 4JBXA 5DN6D 1ZM7A 2X8AA 4FMCB 4PHGA 4QFMA 2QMHA 1P9NA 2ZI5A 2PX0A 5G53C 1B23P 1Z5ZA 3B8HA 4IVPA 5CJPA 3MD0A 1PLKA 2QORA 2LKCA 2FOLA 4JL8A 4Q9LA 4HATA 1RZ3A 3TW4A 3EZ7A 4FMDF 3P20A 4M9ZA 2NG1A 4IOKA 1J8MF 5DO9A 4EJSC 5FPYA 1FP7A 3AKDA 2YYZA 3EZFA 3OIUA 4JLNA 1TNDA 1IQPA 4BZXA 5EXTA 5L3QA 4WZ6A 5JFGA 3TIFA 5DIFA 1DAMA 3VR4A 1DADA 1KY3A 2PX3A 2P5SA 3HR7A 4OHWA 3UG7A 4CEIA 2FNAA 5KDDA 4M21A 1OE0A 3V4FA 1KI1A 4EFLA 1I4LD 5L3SA 3LDAA 3NDBB 3TKLA 1JR3A 4OK5A 4AD8A 2P5TB 3TUZC 4JMPA 1G19A 2BWJA 4MKFA 2I4IA 5G3ZA 3C16C 2ZUDA 3W5JA 5FI1B 2BMEA 5EP4A 3GFTA 1ZU4A 2GF9A 1G5RA 4Q4HB 3I72A 4LJYA 4XTCS 3SBEA 1JPNA 4M1YA 5FR1A 4AYWA 2F43A 2CLSA 3KKNA 4Q01A 4P4TA 1R0YA 1NMZA 1NJFA 1W4CA 1YZNA 2DY1A 1G3IA 4LPKA 3AVXA 1QDEA 1XEWX 3F0TA 1G20E 1G3MA 2YJTD 3A1UA 2ZITA 3GJ8A 3R9WA 4LY6A 3QSYA 2OV2A 3UXMA 1DG1G 3D31A 2V1XA 1E1QD 2CL6X 1KDPA 2WSSD 2IXGA 2V6IA 3K0CA 2BBTA 3T1QA 3ZZTA 3C7KA 3LBNA 2IUUA 2EFHB 2CEAA 2H7VA 3GQBA 2IYLD 1KAOA 2ZREA 3DKPA 3L8ZA 3CUEF 4PXAA 4L9WA 1W5SA 1W36D 2Q21A 5HCIA 3SFVA 1FPMA 1OFTA 2FX3A 1KJYA 3NVAA 3QXSA 4HLDA 4NZYA 4RD2A 3U2QA 2NIPA 2LCFA 3A1WA 5LDDC 1N6LA 1RJ9A 1J8YF 3OIWA 4IVRA 1K6MA 2O8EA 1E9AA 3S1AA 3HR8A 4XVUA 1XXHA 1R0WA 1D2EA 1E9BA 4DT1B 4IFEA 1ONBA 4BASA 4DZZA 4CGZA 3P4XA 3THOA 4U5XA 3GJ4A 3HPQA 4B74A 5BN3A 1Z0AA 1EFUA 2J7KA 1KI6B 4ZIRB 1VIYA 5K8LA 1FTNA 3X2SA 2BKUA 4LRWA 1R8SA 2ZYUX 3KXIA 2IF2A 1DVRA 4ZPXA 1V43A 4FMDB 5AJWA 4ZCIA 2RB4A 5AK0A 5CIWA 2JATA 2QBYB 1S1CA 3CWQA 4QHYA 2EFDB 4HUTA 5K8UA 3K9HA 1JJVA 5FL7A 4C7OB 2OG2A 4QM6A 1R2QA 1AIPA 4Q18A 3PFIA 1YR8A 1T0JB 1AN0A 3CNOA 3NEJA 4NKRA 2GCPA 4Z1MA 5EZ6B 4DLXA 4U00A 3ECCA 3B2EA 2QN6A 2IW3A 3HYRA 3WNCA 4A0HA 4BLPA 4PZZA 2J0VA 3OFNA 1W5TA 3TNFA 4M9XA 3W3AA 4UJ3A 2YOFA 2ZS9A 1P2UA 1JJ7A 4JJZA 4NHOA 4LHVA 4N0DA 4CW7A 4Q9KA 4NMMA 4Q02A 2W0MA 3AVVA 2UVQA 1QHSA 3QBVA 3GLFB 4TSFA 2FJUA 2PZFA 4PSVA 1ESNA 3IHLA 2UKDA 1KY2A 4W5WA 1Y3AA 2XOKA 4TLEA 1AJEA 1RYHA 5EXPA 1BS1A 2ASEA 2ZROA 2PJZA 2ANBA 3MUFA 2HLDA 3I61A 4IDQA 1MR3F 3C5HA 4D80A 4PO9A 3IO5A 1KJWA 4NPHA 3BORA 1LB1B 4NYIR 3U3MA 4MYTA 1NF3A 5JS8A 1R5NA 1HT1E 1U98A 5L3RA 2HDNB 4Z54A 1DAGA 2XNDA 5TMPA 2I3BA 2W58A 1OW3B 1M1YE 1D8TA 1YZGA 3D7MA 2N42A 2RGBA 1X3SA 4KLNA 5DI9A 4TT3A 4DRZA 1J70A 2YZ2A 1R5OA 3VHXA 1MOZA 1E32A 1CXZA 1JQJC 1VMAA 4QHSA 3QKRB 3AKEA 5AJYA 4LYJA 5EP1A 1HEIA 2VP2A 3QKSA 1FMLA 3KKPA 2IYXA 3KFVA 2JGNA 5FUXA 2ODNA 4BEJA 1UADA 2LKDA 4Q4HA 1GITA 3REFA 3GFPA 4WAUA 3VFDA 4RCZA 4C0QC 4QM7A 3ZZUA 3C5CA 3DHWC 2NO9A 3QPUA 2QA5A 2HV8A 3WP0A 1CEEA 1KO5A 3BB1A 3RS3A 1WP9A 5HCNA 4KLZA 4FCWA 4Y0AA 3REGA 2BBSA 2IBMA 3TH5A 3UPUA 1W0JA 2C2HA 2IEZA 2GCOA 1GFIA 3CKLA 1N0VC 1PZNA 2QZ4A 2O52A 3B1XA 4ACAA 2BJWA 2QL6A 1G7SA 2CCGA 1NL3A 3CWZA 1TAGA 5KO2A 2O0JA 3MLEA 2O8BB 3RS7A 4R7ZA 2WWHA 2R6GA 2AFIE 3L82B 3PUWA 4D4KA 1EX6A 4E07A 1NIPA 1M2OB 3O8BA 4DLTA 5TV2A 4TMWA 4MGKR 3C14C 4IOMA 4PC6A 4TQUS 1A5TA 2WOJA 3CM0A 3LXRA 3GLGE 1KK3A 2H16A 1IXZA 2O8CB 1VG0B 1GUAA 3DKVA 2YNMA 1ZRHA 4D81A 2FH5B 4UKDA 3ZH9B 1AQUA 1XB2A 4TMKA 2IYUA 2ODEA 4F7WA 4PSAA 1DAFA 1UBEA 3CLVA 4XWOA 1OXTA 2GVZC 1S9DA 2J46A 3L0PA 1RKBA 4Z8YA 2YOHA 2VF8A 4XOIA 5JWHA 1NMYA 2WMOB 4LV5B 2GBLA 2WICA 4KCGA 4M53A 2ZI3A 1KGDA 3PIRA 4C0KA 1UKEA 3M4YA 1OIXA 3CZQA 4M0LA 4F91B 2V1UA 5AUNB 2WJGA 4B47A 3I62A 1VG1A 4Q7MB 1ZU5A 4M1TA 4PQYA 4ZIRA 4US1R 4M9SA 2PCJA 1N5IA 1UPTA 4V0NA 2NPFA 4Q19A 1US8A 5EXXA 1ETUA 1XTKA 2XEXA 4UNPA 4DDWA 2WSMA 1KI9A 3T61A 3UIEA 1JAIA 1XCGB 2J9RA 3BOSA 3QPVA 1BKDR 2QBYA 4NTZA 1FL9A 1OXSC 4BWYA 2CLCX 4L4UA 1KJZA 3CX7A 4B6FA 4US2R 4JVMA 2C96A 1S96A 2XAUA 3T12A 2KBEA 2OAP1 3MG9A 4HLUC 4MRSA 1XP8A 2G0TA 1CR4A 1T0HB 4KFRA 5CJ2A 4UNRA 2GNOA 1XJ0A 1TF5A 1TADA 2AX4A 3E5HA 2P6RA 2AXPA 2BMJA 3NH9A 3N2EA 1ZW6A 1E9EA 4OQXA 1BH2A 1F48A 4PQRA 2IS2A 3BFVA 4Q4JA 5DHFA 4BFZA 5CIQA 4A2QA 2CHGA 4B2IA 4URVR 1N6HA 2F3TA 2CK3A 1E2NA 4CZ2A 3ASZA 1T9HA 1QBKC 3RYTC 2VF7A 3G82C 1Z2AA 3BC1A 1PLJA 4RY2A 4HB0A 4B71A 5AUPB 1CR0A 2N46A 4XD7A 3MWKA 1W44A 1UBGA 4Q7KA 5EE0A 3SC3A 1JNYA 3FMIA 5JHHB 1TUIA 2NZ8A 4E03A 2OCAA 4HLUA 1I4DD 1H8ED 1MH1A 4HB3A 4B32A 3NG1A 4A0FA 5TVKA 2J41A 5CDFE 2VL7A 4A92A 1U9IA 3U60B 3CX8A 1EWQA 3VKHA 1RYFA 4KJZA 2WKRA 3W9YA 2AHOA 4BQSA 1OH8A 2PLRA 1OFHA 3ZVLA 4BFSA 4DUGA 2G83A 2KB0A 3BFXA 2PMKA 1OSNA 2F1RA 3QKRA 4L9SA 5E7MA 1IN5A 3NBFA 4LSGA 1FMJA 2E87A 2GETA 3RWOA 1U0LA 4LV8B 2C9YA 2QGZA 2IUSA 1S1MA 2OFXA 4B3BA 3LXXA 4HSEA 4DLYA 1KI4A 4PAMA 3PEWA 1YR7A 3IQWA 2ZU0C 4IHQA 4KFTA 3ZZ0A 4DB2A 2VRWA 4B33A 4N3NA 1SHZA 1LTQA 4RCYA 4AC9A 3H84A 1D2NA 3EZ2A 4B3DA 5DNYB 2FA9A 3P32A 1X8KA 1Z6GA 1UKVY 1NMXA 4G5RA 1ZNZA 2WSSA 4R2HA 1HUQA 1D9ZA 3K8YA 4BLOA 1LVGA 4NDZA 4ZDJA 4PZLA 4BFYA 2ZJOA 4IEIA 4KSBA 1XTIA 2BBOA 2QEQA 1IN4A 1YZTA 2XSZA 3EASA 2VHTA 2NMVA 3ASYA 2XTNA 1UEJA 4W7SA 5KSOA 4H1VA 5F9HA 2FPKA 1P6XA 2VHJA 2XJ4A 4GZMA 4QBFA 5EE9A 2H1LA 1XFAA 1M74A 4NYMR 4DCVA 5JCPA 4BLRA 5UKDA 2DHRA 1N5JA 4DIDA 2CCJA 4DLZA 3AVPA 4P0TA 4GT1A 2EU8A 3B85A 2RAPA 4AK9A 2O8CA 1LV7A 4JLOA 3AP2A 2HXYA 4Z1MD 2RGGA 1TPZA 4JS0A 1Q20A 2YKGA 4OL0A 1G8GA 3R20A 4HAYA 3RC3A 1QHIA 1YZUA 4ACBA 4RKEA 3OFND 5KUTA 4C0HA 2FFAA 1G9XA 1FUUA 1TF7A 3LFUA 2P0EA 4UNSA 3HU1A 1WCV1 1ZD9A 4TMZA 4AIIA 3QXJA 1W7AA 2ZRJA 3GJ3A 2XX3A 3RSLA 1OFUX 1XMIA 3AKYA 1F2TB 5FTMA 4RSGA 1CBUA 1GL6A 4TSFD 1FP6A 1EXMA 5TB5A 2C03A 3QNUA 4B3CA 5J5CA 1CJVC 4OK3A 5KSPA 2XOKD 2QRZA 4HLQB 4LI0A 4MUBA 3VKWA 1X8JA 2RGXA 3CRMA 4PHFA 3BIFA 4I99A 4OI1A 1GILA 1PJRA 1SVSA 3EA5A 4X8LA 1C1YA 2GEUA 4QBHA 4TMXA 4LGMA 3B7GA 1EFRA 1UM8A 5HTKA 1SXJB 2IX3A 1E79D 4C4PA 4C0BA 2R6AA 2XNDD 2IHBA 4NONA 3ZGXA 3MFYA 1R7RA 2NPIA 4EIWA 3GJ5A 1DTSA 5EE1A 4AG5A 1AZSC 3SEAA 3A8TA 1P3JA 3QQ5A 1G7TA 4M9QA 4TT3D 2YWEA 1UKYA 2A5DA 2CNWA 2GXSA 3DMNA 3V00A 1YR9A 2EQBA 2Q0HA 4NE2A 3X1DA 5KNBA 3ZD6A 4K81B 3BJIC 1CJMA 1NVVQ 4JL6A 1NKSA 1W2GA 2XJ9A 5IK2D 1O3YA 1G1MA 2PJRA 2CLDX 4RFSA 3SN6A 2P65A 3KXKA 2ZRNA 4FMCF 3SZRA 1XBTA 2G3YA 5FTNA 4PC3A 2GXQA 4C2UA 2XXAB 1L7VC 3FB4A 3CH4B 3IGFA 3LBHA 3SJBA 3ZLJA 2JLVA 1N6IA 3JVVA 1RIFA 5HPYB 2QROA 5AJZA 4BEBA 2DFLA 2NO0A 1Y63A 1NLZA 1W0KA 1XZQA 4JBWA 3BXZA 4X8HA 3EIHA 3KJEA 4DIEA 4EQ6A 2D2FA 4NCNA 2OT3B 3SYLA 2NOAA 4Q9JA 1G5PA 4H1UA 4HUQA 1MABB 2R6FA 5E7JA 2ZI9A 4ZDWA 2HF9A 3LVQE 4HYYA 4E5UA 4ESVA 4QGFA 4TYWA 4D26A 4XWKA 3QUSA 2PH1A 3HJNA 1S9HA 3U44A 1HV8A 4TLBA 3FPAA 4FXPA 4UNQA 3F3YA 3VKGA 1NLYA 3PR1A 3U4QB 3AF3A 1DAIA 2QAGA 5IT5A 1ZC3A 3ZS8A 2HJVA 4DJTA 2BM1A 3L0OA 2FE4A 1T91A 5KPDA 1CF4A 3LV8A 1ZUIA 2ZRHA 1EFCA 3L8YA 2QGNA 3SS8A 4IOJA 2NZJA 4LBYA 2A30A 1KDOA 3THXB 5DYIA 4HZUB 2OFOA 1NG9A 3RDPA 3GLHA 4AKHA 4ZCMA 2ZAMA 4W5HA 2IYWA 2ZRDA 1Z83A 4KITB 3AUYA 1QHNA 3TMKA 1KO4A 3THYA 3OEEA 2P67A 4KBFA 2ZJ8A 3Q5DA 2H57A 3QI2A 1ZMXA 4DSOA 1XF9A 1J90A 2V4ZA 3CR7A 1CU1A 1RRGA 5L8VA 4PZYA 4OI2A 3GPLA 3EPKA 1XPUA 3QXHA 1IY2A 1KO7A 1DS6A 3LA6A 1VECA 3HWSA 4KHZA 3U3OA 4ERNA 2OXRA 3K70B 1ZVQA 2FSGA 721PA 3WYFA 1XDBA 2XTMA 3N2IA 1ZBDA 1OKKA 2IYYA 3UWOA 1E2KA 1XEWY 1BIFA 1SXJC 3IEVA 4P32A 1ZUNB 1GNPA 1WBDA 5C4GB 1Z8FA 3TR0A 2BCGY 1R10A 3KB2A 1GKIA 1P5ZB 1OB2A 1KK2A 2GRJA 1HY3A 2FFHA 2WVJA 3Q5EA 1QZXA 3QEJA 1DAEA 4DDTA 1UDXA 1JR3E 2FWRA 2GESA 1F2TA 1P60A 1F60A 1OYYA 5FBWB 2ZVQX 2CK3D 4JKYA 4EJSB 4GOKA 2BEJA 2XTZA 1X1SA 3SYNA 3TLXA 2IUTA 2ZR0A 3A1VA 2GZHA 2ZRKA 4OJKA 4XD7D 3CZPA 4EUNA 5KYKA 3PCRB 4MRVA 3L43A 4GI7A 2WTUA 1NN3A 2CDNA 1VHTA 4YC7A 8OHMA 1II8B 3DL0A 2D3WA 4MRPA 2A5JA 1X6VA 1NVXQ 4Q7LA 2G6BA 3HYTA 2H17A 4PO1A 5B30A 2ZSBA 5HR5A 3LVRE 1ZM2A 2ZEJA 1IBRA 3BD9A 4A36A 1SVLA 1XEFA 1P2TA 1DEKA 2BMFA 2Q9CA 3OAAD 1YZLA 3W6NA 3ZVNA 4P3YA 3W6OA 1UJ2A 5KNDA 4DUGD 4AKGA 5HZHA 2JLRA 1VYVA 1PUJA 3QF7A 3WYAA 1KOFA 1RRPA 3U3RA 4CF7A 2XZLA 1FQKA 3KQUA 3MCAA 4TLCA 2N1BA 3IBGA 5DH9A 2WOOA 4EJSA 1AS0A 2CJWB 3H1TA 3K9LA 4ITRC 2GJAA 1E3MA 2XXAA 1H8EA 1XTRA 2Q6TA 3AQ4A 2Z4RA 3C4JA 4A4DA 1Q21A 2J87A 2SHKA 5CB8A 3AGQA 1RC8A 2F3RA 3A4NA 3VR1A 2B7BA 2HCJB 3W8NA 1E0KA 1QRAA 4URZR 1AK2A 1P2SA 2DWQA 3FMFA 5JRJA 5CLQA 5KU1A 2FSHA 2R6CA 4KBGA 2HYDA 2QENA 1L2TA 2XSZD 1ZM4A 1P4SA 3UANA 3N5CA 3RS2A 5EZ5A 2JCSA 4CYMA 3PITA 5AJXA 1G5TA 3EG5A 5DLQC 4MITA 2B7CA 1G6HA 4TZ6A 4GSYA 1DOAA 1OXUA 3U6BA 1Q3TA 4KSCA 4XSHA 4WIAA 2JA1A 4P4UA 3L0IB 4LJ9A 5JBQA 3VMFA 3D3QA 1YKSA 2GJ9A 1E99A 2C8VA 1A7JA 1XEXA 1NBME 3LRPA 3K70C 3GJXC 4OK6A 2C78A 3FMPB 2CVHA 3CRQA 3LW8A 4O0MA 1GL9B 1KMHB 3OESA 4URYR 3NBZC 3W6PA 1E0AA 2HT6A 5P21A 1S2MA 3PEYA 4NCIA 2ZR7A 3QVVA 3AP1A 4IW3B 1A2BA 1HQCA 4Q1AA 5TDHA 3JZAA 4LDJA 1U8AA 2AK2A 2R62A 2BBWA 2O0HA 4IDHA 1GZSA 4Q1DA 1SKQA 4TYQA 5J47A 4OHXA 3THXA 4LHXA 5C4MA 4LX0A 5HKKD 1Z6AA 2ONKA 2QT0A 2JEOA 1Q44A 1WF3A 4JVNA 3GLGB 1EK0A 4JT4A 2EYQA 1TMKA 1SQ5A 4UJ5A 4WW0A 4FI3C 4MGYR 1TQ6A 1GTVA 3OIYA 4LWZA 4FWTA 1D9XA 2RGAA 4BE7B 2X77A 4EFMA 2ZRAA 4LOAA 4MKIA 2QMUA 3CPHA 1ZAKA 3EZ9A 4RVCA 1EFRD 1OJLA 3QEOA 4OYHA 1N2CE 121PA 1S3GA 4TQ9A 1AS3A 3C41J 1Z0DA 4G1UC 4AI6A 3W5IA 5SZHB 1NN1A 5GVRA 1U8YA 1F6BA 2F9LA 4OHZA 3KUCA 2JLWA 1U94A 4PSKA 3EC1A 3A1TA 4HB4A 4D6PA 2CNWD 3FHOA 5FR2A 1SHKA 1UBFA 2G1KA 1Q12A 3LD9A 4PC7A 1GP2A 3T1OA 2TMKA 2JLUA 3B1VA 2ZRLA 5FTKA 4KAXA 1G8HA 3FKSA 4NCJA 1I4TD 4ZKDA 4S2EA 2OAQ1 3QF4B 1EG7A 1TEVA 4WZAE 4Q1BA 1E9FA 1W48A 1JEDA 3RRNA 1N6PA 3LX8A 5C2JB 2IXEA 2AKAB 1JBKA 2CXXA 2EW1A 5H8WA 1C4OA 2OM2A 1E79A 3X1YA 2IT1A 2R8RA 1VCIA 4ZDIA 4F4JA 4I1OA 4XSGA 3I5YA 1AA9A 3VR2A 2PT7A 2ZQ5A 4YQFA 5K8TA 2NQ2C 1II8A 4A0GA 4GZLA 1W0KD 5KNCA 2B92A 3BE4A 4RKFA 5FBQB 5FOXA 3KKMA 4Y0VA 4BLQA 3TK1A 2QE7A 2QPAA 1KAGA 2NO7A 2AFHE 1TQ2A 1HYQA 2Z6VA 2ZRCA 3P4YA 2GK6A 4KV9A 5IF9A 5IK2A 3Q9LA 3F8TA 2B21A 1TF2A 2RMKA 2X2EA 2CL0X 2JIZD 2R65A 5JRZA 5DE3A 4ZDKA 2REXB 4KXFB 2BEKA 4G3XA 2WZQA 3TAHA 1NSTA 2D4HA 1E2LA 4DB4A 5L3VA 3GEIA 3UMFA 3AF2A 4AYXA 3JZMA 1RPZA 2G1JA 1ESMA 6Q21A 3VR5A 4BRUA 4BPBA 4PC2A 3M6AA 2UZIR 3GFOA 5JSZB 2DYKA 4HAVA 2IXFA 3UK6A 5GJCA 1G4AE 1WA5A 4KODA 2OZEA 2VHCA 1DG3A 2REBA 3CIOA 3O47A 4O2LA 4LZZA 3AKCA 1IAQA 1LS6A 2VP5A 4FCVA 3DPUA 1ELOA 3GLIE 4R98A 3F5FA 1RRFA 3SR0A 821PA 1OYWA 2BJVA 4M8NE 4FIDA 2VP0A 4NP6A 2DR3A 4AY2A 1N6KA 3SQXA 3OEED 2QM8A 1LY1A 4ZKEA 3AVQA 2GZDA 4PHHA 4JT2A 4KU4A 2H92A 3V4RA 3RNLA 5FPSA 3O8DA 4JSYA 3SYKA 3R9IA 3VR6A 1W4RA 1JPJA 4QNRA 5CM9C 5TY0A 1Q3HA 2W0SA 3NBXX 4DT1A 2IYZA 2IA5A 4LJ7A 2VHQA 1OKKD 3I73A 4CEJB 1P9RA 2AWNA 4M1MA 1TL7C 3IO3A 1KMHA 1Z28A 4A6PA 3K0EA 5CYPA 1KI6A 2V54A 3CW2A 5FOWA 3U6KA 2RGCA 5BYKA 3PEVA 2JJ2A 1T5IA 1KTVA 4BRWA 2IYVA 1Q57A 4HLCA 2D7DA 1GVNB 3QKTA 2QAJA 3VQTA 4DEXA 2JDIA 3QPWA 4Q4LA 2O8DB 2D06A 1XD2B 2PMDA 1CULC 3KJGA 1F3OA 1Q1EA 1NG1A 4C7OA 4DSTA 5A4JA 4B44A 3GLGA 2ZE6A 2ODBA 4M1KA 3ZQ6A 3BH0A 4TTQA 3CB4A 3NH6A 2A5FA 1F2UB 3AF1A 3QG5A 3VU9B 3CNLA 5GADl 2VBCA 4MKGA 2IL1A 1ZC4A 2D62A 3LLUA 1E2HA 1M7HA 2VEDA 5BYJA 2GF0A 3TVDA 2J0SA 3BRWD 3RS5A 1SXJD 1XNJA 4TYPA 4DBLC 3SU8A 3TE6A 5CM8B 2ZJYA 1G16A 3KDSE 2X19A 4G01B 1XPOA 1E2DA 2IK8A 3CPJB 4LJAA 1RFLA 2MSCB 2UZ3A 2WJJA 4L16A 3GLFA 3EW9A 1EESA 4MRRA 3AB3A 3EC2A 3AVUA 3TSZA 1G8PA 2IYTA 5FL3A 5SZJA 1IN7A 2ORIA 2ZRBA 4C30A 5DHAA 2VTKA 4IOLA 4PQFA 2OO7A 3CF0A 4HAUA 4ARZB 1NY5A 4ZI2A 3QF4A 1D2MA 5KPJA 4K8OA 1OFIA 3ADCA 3KQLA 1FFHA 4WA7A 5KTYA 2GEVA 1AM4D 2ORVA 4PO8A 3WHLA 3IIKA 3SFZA 2BM0A 4TMTA 1T8TA 2NO6A 4Z51A 4P4SB 1GL7A 2VO1A 4AKEA 1W47A 2ONJA 1CS4C 1GAJA 3MGCA 3DOFA 3OAAA 4NYJQ 4GNKA 5FBVB 1UFQA 3EX7C 3QIAA 1KI7A 1KO1A 4PPGA 1U8ZA 2GEDA 1OLOA 4BFVA 4D82A 1ZNYA 3BB3A 4B3FX 3H2YA 2K5UA 4FMBB 3DZ8A 3SJZA 2QUZA 4PFSA 4PTLA 2ZRPA 5EE5B 2PEZA 2WAXA 2Z4SA 2ZYVX 5CITA 1DO0A 3SOPA 4E22A 4PHTA 4XVRA 4U02A 4NH0A 4RZ2A 3RWMB 4CEHB 4LUCA 3N70A 2ZM5A 4V0ME 4I1UA 1T5LA 1E6CA 3LAWA 4Q1CA 3AGPA 2OESA 3E70C 2AWOA 4YDSA 2Q3FA 2DFTA 2IWRA 1YVDA 2ZETA 3MWJA 4A82A 2O8BA 2VLIA 3WHKA 2O8FB 4BFXA 3MSXA 2JLSA 3KTAB 5FBRB 4ZI3A 2XITA 3E1SA 1GRNA 4KVAA 1YU9A 1L4YA 1E1RA 2D2EA 2GKSA 3K1JA 4B34A 1QG2A 2F7SA 2ATXA 3NTUA 1K8RA 2EWVA 3R8CA 2YV5A 4DDVA 1PUIA 3EA0A 5AWFC 5JI3E 4G5OA 4TZ0A 1KSGA 5JEDA 3EPJA 1KIMA 1G7RA 1QVAA 4HZIA 4MKHA 3ZQJA 3FHTA 3ZS9A 1R4AA 5B64A 1VDZA 2OCPA 3IBYA 2CVFA 1A82A 2QP4A 3A4LA 2XNSA 3K70D 5JCZA 3FGNA 1NJGA 4ILEA 4JBYA 2ZXUA 2GHIA 1WRBA 2OEPA 1P72A 3IPYA 5JWRA 1MO5A 3NHBA 2F6RA 1P73A 1IM2A 3AVWA 1U99A 5DYGA 2ZR9A 1FZQA 2QP3A 3C8UA 4DCSA 2YINC 4YONB 5KSYA 2W83A 1EWRA 5IDVA 1KDTA 4DVGA 2PEYA 3D8BA 5HKKA 3KJIA 2FFBA 3ADKA 1KKMA 4UXJA 2CL7X 2HF8A 3B1WA 3UKDA 2ZJ5A 4QBGB 4FN5A 2VA8A 4JLVA 3FKSD 1NVVR 3FHCB 3KJHA 3V9PA 4DLWA 1Q1BA 1KI8A 3DO6A 2FDCA 4JSTA 3I92A 1U2RA 4LJ6A 1JALA 4Q4AB 4OQLA 5GVSA 5J4VA 1OPXA 2W2VA 2GAAA 4C0AC 1DAHA 1OF1A 1XJCA 5FH9A 4YMVA 2MSDB 2EFGA 4WOPA 1KK1A 5SZIA 4I81A 2PT5A 3ND8A 1GNRA 2ZANA 4LHWA 1LF0A 4B2LA 1ZINA 3E2IA 3QG1A 2QSZA 5AUQA 3LO5A 2OXCA 2IYRA 3GJ0A 1MV5A 4Q66C 3PG5A 1U90A 2C9OA 2BOVA 2D7CA 2I1VB 2Z83A 3Q7QA 2JASA 2QE7D 5BWMA 1CKEA 1JEEA 3FWYA 3Q85A 5FI0B 2MMGA 4BLTA 3RABA 4EPRA 3OF5A 1G3QA 2Y8EA 3RS4A 2JLZA 1IXRC 1U0HC 4GDFA 5L3SB 5EJEA 1DBSA 3WXMA 1KSFX 2AD1A 2R2AA 5FUVA 3FOZA 1IJEA 3I1FA 2WWFA 3QXCA 4ESHA 4G5SA 2ZRFA 4HAWA 2ORWA 4D2IA 3BB4A 5DISB 4ARZA 1ZIPA 5F3WB 1JQLB 4TL7A 1SVKA 3T34A 1ANKA 3I8SA 4J0QA 3WRYC 2F43B 5JHGB 2FV8A 2Z5FA 4PAOA 1DAKA 1N25A 1TQDA 5GJBA 3WYGA 2FSIA 4EPTA 3GEHA 5FUWA 4P4SA 4HDQB 3PXGA 2IS1A 4B6EA 1M34E 3RC8A 1Q0UA 4OI4A 5J4LA 3FMOB 4MYUA 1E9SA 2JLQA 2P2LA 4QJ5A 4QNMA 4BGDA 3ZJYA 3VR3A 2Z43A 2JIZA 4FWIB 2ZIAA 4I4LA 4A8JC 4YDHB 4RD4A 1E2MA 2HXSA 2NGRA 2OSBA 1WE2A 1NVWQ 2HEIA 2ERYA 3GLHE 5F9FA 2IEYA 3B13B 4BFUA 5J4HA 3CO5A 3NBYC 1G41A 4IXMA 4JLDA 1P61B 2EFEB 2VQSA 1AS2A 3FDIA 3K0FB 2C95A 3CPEA 4QC2A 5EP3A 5IHPA 1TU4A 2YOGA 2CHVA 2QNRA 1GIAA 2RGNC 4CEHA 4O25A 4BUJA 4ZO4A 1W4AA 4C2TA 2J7PA 3I3SR 1KI2A 3FFBA 4URUR 4F38A 2CE2X 2X2FA 1IN8A 4D4MA 421PA 1JI0A 4PC1A 2GK7A 5KDLA 5LB2A 2JLXA 3A36A 5BN4A 1R8QA 3S1AB 2O8EB 2E1RA 1N6OA 1XX6A 1XXHB 4GPTA 3Q8XB 2KI5A 3U61B 1GOTA 1IONA 1E9CA 3U7EB 2FFQA 1DARA 1N5LA 2LWIA 4BECA 1G8YA 3L0SA 2JJ2D 2OE2A 2R9VA 4MYHA 2O8FA 1G7CA 2P6NA 1J7KA 2XZPA 3FE2A 3K09C 2JDID 2EVWX 4M22A 4MYCA 5B57C 1N0UA 1A2KC 3ZVMA 4BFWA 3BGWA 3TJZA 3SJCA 1I2MA 2JLYA 3ZIAA 5FPTA 4AWXA 2WV9A 1Z07A 3U7FB 4CT5A 3IHWA 3IQXA 5E7IA 2C5LA 4GBMA 1PLLA 2ZRIA 1QHYA 3AV0B 4W5JA 3DOEA 3UG6A 2P3SA 3B60A 4MGZR 5DSZA 2OCBA 2GJSA 4JIMA 4BFTA 1KKLA 3D6TB 1Z0FA 1IXSB 1CRQA 2OCYC 4DLRA 2WJVA 3IIMA 1LW7A 1ZM9A 4I1VA 1OH7A 1Q1ZA 4LC1A 1W4BA 1PV4A 3NC1C 5DI3B 4URWR 2GXAA 1UBCA 2CBZA 4OQFA 1Z6XA 1LNZA 1FTSA 5EXSA 4R2IA 2QQ0A 4EAQA 1N0WA 3U5ZB 3RS0A 5BXQC 1XD8A 3KZ1E 2BCJQ 3W90A 4D4LA 4NU0A 1OT3A 4GP7A 3AVTA 4KI0A 4IDNA 4GOJA 3CONA 1FNMA 2JJ1A 2QRNA 2D74A 2WM9B 1JB1A 3VHLB 3WBJA 5H68A 2VP6A 5G41A 2H18A 5JEEA 1P9WA 1ZJ6A 1AKYA 3EARA 1A4RA 1KSHA 4YLGA 4Q4AA 4B43A 2ZS8A 2YWHA 2XZOA 4WXRA 3CH5A 1YRBA 3PUXA 5JS7A 1JXMA 4NCKA 2VYFA 4IDOA 4PPFA 2WPDA 1SXJA 2ZI4A 2O5VA 1G64A 3VAAA 1Z2CA 5JJKA 2ZJ2A 3K9GA 4B73A 3ONWA 1GNQA 4RJLA 3AVYA 1MKYA 4DSUA 2MMCA 3LH5A 1BYIA 4LHZA 1N6RA 3CRVA 1B0UA 4Q5IA 2FF7A 2O0KA 5FPHA 1TU3A 3WMFA 5FUYA 1P2VA 4OBEA 2A7QA 1OV4A 2QQEA 1QG4A 3EIEA 3LX5A 3RRZA 1SVOA 3Q7PA 1RRCA 2J45A 3LBIA 4HDCA 1COWA 2WWWA 3K0CC 3GP8A 2B6HA 3CRRA 3FKQA 1CIPA 3OEHD 3QKSB 3AH8A 2FU5C 3RHFA 1YR6A 2QM7A 3AEZA 2V7QA 5FTJA 3B1YA 2RCNA 3SNHA 1G21E 3NDPA 3TQCA 4D0NA 3BBPA 3W34A 1NN5A 1BYUA 2YWGA 4JVLA 2ZE8A 4A0RA 1XXHE 4XVQA 2KSQA 1QHHB 1QVRA 2DWOA 2R44A 3R7WB 1E2JA 4IEEA 1BOFA 3WMEA 4ZV4A 4QGGA 5EUMA 1GKUB 4QJ4A 3IIJA 2YC4C 3WRXC 2IC5A 4CDGA 5K8IA 1E9RA 3LLMA 4YMSA 1MABA 2GCOB 1GSIA 2F1IA 1Z22A 2ATVA 1EX7A 3UWKA 1ZNXA 1T8UA 2C04A 4L5BA 4WBSA 1ZNWA 1K5GA 1E1RD 4EPYA 3NKVA 4D0LB 3A1SA 4S35A 5E95A 2FEMA 3ADDA 2G88A 3VX3A 3RAPR 4ABYA 3SDZA 2ZJZA 4UXIA 5KSZA 4V02A 2OUKA 4PAQA 3U4QA 3K0SA 4DSNA 521PA 5JI2E 1II9A 1E69A 3K0FA 5E3HA 3MAAC 1ZCBA 4AYTA 4AURA 1M7GA 3U3JA 3M0EA 2BVNA 3HDTA 2BDTA 2L0XA 1T3LA 1XCMA 1AGRA 1X1RA 4HZUA 3TAUA 3GMTA 2W6IA 5BN5A 3LY5A 3CF2A 4TLDA 4QKQA 1WB9A 3QXXA 3GLIB 2J0QA 3IPXA 2OBLA 4D0GA 1UDWA 5BW8A 5C1BA 4QGHA 3RSOA 2IS4A 4R71A 1P7CA 2ZJBA 4ASUA 2ZE5A 4GL2A 1XU4A 2VP4A 4BZPA 3SE0A 4GP6A 2IYQA 4GOXA 3P27A 1KNXA 1US8B 4IKEA 1KNQA 4JYCA 2VPPA 4KYIB 1Z06A 2QP9X 5GJVC 4EDHA 4UXHA 5J4YA 3DVLA 1TX4B 5LD2B 1E96A 4GFDA 3IILA 4KFUA 1YJ5A 1NLFA 1Z08A 2WMNB 1NBMA 3K9NA 3WP1B 2QPOA 1LS1A 1GM5A 3GJ6A 5D3QA 2BHRA 5DI3A 1YZKA 3X1WA 3SBDA 4JLMA 4PPNA 3TQFA 2VH5R 4GMXA 4F92B 3KQKA 4CVNA 1R5BA 1OXVA 4MGIR 1J99A 4XIGS 1S8FA 1SGWA 4GRAA 2F9MA 4F4IA 3FFAA 3MWLA 3AF4A 2VIIA 621PA 4LK2A 3UMRA 4C0JA 4LCBA 3X1ZA 4AG6A 4L8GA 2AN9A 2PBRA 2BC9A 3CR8A 2RGDA 2QTHA 2QSYA 1HE1C 3B6EA 4TN1A 1MO3A 4DLVA 4B3GA 3A4MA 2FGKA 4Q4JB 2VP9A 2FSFA 3BK7A 3PENA 1E9DA 2H8KA 3FVQA 1CR1A 3PUZA 5HE9A 4B3XA 5ELXA 3W3ZB 2JJ8A 2KBFA 4QJ3A 1HTWA 1WQ1R 2GVDC 1E0SA 2ZSDA 3DZDA 2IWHA 2HYIC 5FOSA 1Z0KA 4WVFA 1Z0IA 4RD6A 1OIVA 4TMVA 1SVMA 1G4UR 1N6NA 5EQTA 1H8HA 1G291 4M1WA 4QBIA 3TR5A 4OHVA 2RHDA 1EGAA 2A5GA 2ZRMA 2RGEA 1XMVA 3WBKA 5FPKA 2A2ZA 3AF0A 4O2RA 3T1TA 4TYNA 3O8CA 5ANRB 4BZQA 1KMQA 4G0NA 4WXPA 2A78A 1Q1QA 2WJHA 1OHHA 3CRW1 4Q47A 3AP3A 1VCOA 2QG6A 4DCTA 4DDUA 1XRJA 3R9XA 2WHXA 1VG8A 2QI9C 4UQOA 1IY0A 5D3MB 1XCPA 1I2DA 2W00A 1XMJA 4RD0A 4HI0E 1NP6A 3EWAA 5G3YA 3TSWA 3M1IA 2CJWA 2WKQA 4FD2A 4POAA 4XWAA 2EYUA 4KYUA 4FINA 4B75A 4YXWD 2AK3A 1U81A 3K0AB 2NTYC 3MJHA 5JZVA 5JMTA 1ZD8A 1XTJA 1WDTA 2BKEA 2J7PD 1HQYE 1KK0A 1XZPA 5KHOC 4LYHA 3LQQA 4NYIQ 5TXGA 3R7WA 1QHHA 4JKIA 4EFNA 2J0UB 1AQYA 1VCNA 4TL8A 5F98A 3C15C 4KVGA 4CIDA 3QKUA 2DPXA 5AJVB 3SHWA 3KX2A 1XPRA 5CK5A 3OHMA 2ZSFA 4B2PA 1QHXA 2WWIA 1NI3A 1W49A 3PV0A 4HEJA 1KDRA 1ZYUA 2VHUA 4XTRA 3SJAA 1W46A 3DDCA 2DWPA 2GBLC 1II0A 1VPLA 1XWIA 3QENA 3SQWA 2AXNA 3OE7D 2P6UA 2V8OA 5HE8A 2GCNA 3ZIAD 3CNNA 2FPLA 3RLFA 2F1JA 4C3ZA 1G8FA 4JLAA 1CP2A 1W36B 4B48A 2HT1A 4QOSA 4FW9A 4DWJA 2ZU6A 1TTTA 4MDEA 3LNCA 3GCGA 3EPLA 2DB3A 3T5GA 3TW8B 2QTFA 1VG9B 2MSEB 4QGAA 5CYOA 3OIVA 1ZM3A 4IVQA 4LJ5A 1NY6A 5LD2C 1SKYB 3THWB 3KQNA 4JJKA 4V0KA 2BIFA 3AVOA 4OI0A 1IJFA 3H86A 2ECKA 2B8TA 2ZUBA 1KI3A 4X8OA 1NNEA 1KYIA 2X1VA 3KKQA 1MO4A 5CLLA 2J3EA 4PPQA 4RZ3A 5FTLA 3AUXA 2G0NA 4HAXA 4JVSB 2GAOA 1XTQA 5JJIA 1RVDA 2W2TA 4KFSA 1GWNA 2Z0MA 4TL9A 1GRRA 4JLBA 4A2PA 2A5YB 4JLJA 1M7BA 2KE5A 4DCNA 1YZQA 3GLIA 3IUYA 3J81k 1BMFA 2JJ1D 1ZCAA 2ZI7A 4C0SA 2IS6A 2GWHA 2Q3HA 3GLFE 1R6BX 2HUPA 5E4FA 5FBLB 5IRCD 3UMSA 4Q9HA 1CJUC 4D4JA 4A1FA 3B82A 4EPXA 5HZKA 2AD5A 4IRUB 2B8WA 3T06B 2QPTA 1N5KA 4Q9IA 2EWWA 3BAFA 2VSXA 3SI7A 2QMEA 1M6NA 4W9MC 2WPDD 3R8FA 5C46F 2BMDA 1YE8A 4XJXA 5G40A 2HCBA 1NRJB 3BFKA 2V55B 3CBQA 1YQTA 2FN4A 2CE7A 2OFWA 5AUOB 3KXLA 4RZUA 2ZSEA 2W6JA 2ZJAA 4NYJR 1J2JA 4EPWA 5F2EA 3B9PA 2E9SA 2ZVPX 1E2QA 4UNNA 1U9IC 2REOA 2ZYTX 4FCTA 5FFMA 4M2LA 2XGJA 2V6JA 3EIQA 4C0LA 1E4VA 4N0EA 2PLFA 2PZGA 1COWD 4M1SA 1JR3D 2QY9A 5DN6A 1WBBA 4LPSA 3X1XA 1S0UA 3ICQB 2PCLA 4P31A 2V7QD 4XH9B 1AKEA 3CX6A 1QHGA 3NWJA 4RFSB 2NO1A 4DKXA 5JJLA 2OLJA 5JECA 4QG7A 3TRFA 5KDOA 2V3CC 4LJ8A 1D6JA 1L8QA 5H70A 1Z63A 1Z6TA 1SULA 1XMSA 4RD1A 1G6OA 1MT0A 3P26A 2OBMA 1FW6A 5LPNA 2RKOA 4LV6A 1DELA 3A6PC 4A15A 1DO2A 3WNDA 2Q9BA 2R6DA 4MA4A 5B2ZA 1HURA 1T4GA 3QE0A 5M04A 1F5NA 4Q48A 4URXR 3MRSA 4EQ6B 4A9AA 2FG5A 1XD9A 2G77B 3KUDA 2ZPTX 4HUQB 3OEHA 4DC9A 1AGPA 4EKDA 1QF9A 4RFVA 1HE8B 5EUQB 2I1QA 5D3MA 1D5CA 3RRMA 1W36C 4QRHA 2YVUA 3IDQA 3KB1A 1FX0B 2IHYA 3B9QA 3U44B 2QU8A 1XTSA 1SKYE 4YMUA 2DBYA 2ODWA 2FEOA 2IYSA 3EPHA 2WWXA 1VYUA 3ZDQA 5FOTA 4LBVA 3WNBA 1ZUHA 1H65A 1T3SA 5JSZA 3K0AA 5JLJA 3TUJC 4B76A 4Q1FA 4RD3A 2QAGB 1VHLA 4CRWB 4A6XA 2FMXA 2DCUA 4DLUA 5CDFA 1PVOA 1GDDA 1LFDB 3TSOA 2J0UA 4Q7JB 5FOVA 1M8PA 4A8JB 1T3HA 1Z6YA 3KL4A 2Q9AA 2ZAOA 5CK4A 2W6ID 1O87A 1GKYA 1E94E 3B78A 1Z29A 4OHYA 4E09A 1MRSA 1E1QA 2WIAA 1NN0A 1UAAA 3PJRA 1CJTC 3P1JA 4P33A 4B35A 2C9CA 5SZKB 2OILA 4O3MA 3GLHB 3B5JA 4US0R 4ASUD 5J4KA 2F55A 1UEIA 1WMSA 2CCKA 4Q21A 2A9KA 4MUAA 3VX4A 2J59A 2KWIA 1KO8A 1OIWA 4F4CA 1ZIOA 3MJRA 3THYB 3B1ZA 2BV3A 1OH5A 3VNVA 1L4UA 3LWNA 4LC0A 4Z8XA 1NKTA 3ZD7A 3UATA 1E98A 1KSJA 4DEYA 4Q03A 5LB4A 2WJIA 3T5DA 4V0MA 2WIBA 1E4YA 4V0LA 3NEYA 4CEJA 2ZI6A 3GD7A 3G5UA 1FOEB 1SZPA 2GDJA 5FL7D 3T35A 3U7HB 3THWA 4TTRA 3PUVA 4MDFA 1MO6A 1NBMD 2FPMA 2RH5A 3JVUA 4HAZA 3RANA 3BS4A 1BO6A 2WWGA 4OQNA 3K53A 3VTKA 2ZE7A 3DMDA 1DPFA 1JXOA 3T1VA 1KZGB 4DLSA 3Q3JB 2QTVB 2YHSA 4I1SA 2V9PA 4JL5A 5LBIA 4YMTA 2H5EA 4TYYA 2O8DA 1N3BA 4KO8A 3GJ7A 1XD2A 3TUIC 3O8RA 1R0ZA 2OLKA 1FQJA 4PR0A 2G9NA 2OHFA 3HU2A 2C98A 4TWZA 4NYMQ 1W1WA 1G17A 1E0JA 1F2UA 3NHAA 1EFTA 3VU9A 2DFNA 2PL3A 5J40A 4G5QA 2WBLC 5JWOA 4Q00A 4PX9A 4YMWA 2AKYA 3ICEA 3ZVRA 1P75A 2GXUA 3ND9A 2GJKA 2GA8A 1E2IA 2A3RA 2DFKB 1H8HD 2HLDD 2ZS7A 5A5GA 2C99A 1CJKC 5L3QB 221PA 2RHMA 2WKPA 1KZ7B 1ODFA 2AL7A 4NBSA 2Q3MA 4TLAA 3H4MA 1MRNA 4L15A 1TEXA 4R9UC 4CEIB 1FUKA 4MQBA 1OB5A 3EWSA 2WJYA 2EFCB 3HPRA 4JLPA
chains in the Genus database with same CATH superfamily
2BTQB 2RHLA 2VG8A 5JPIA 4F72A 1IG0A 3NATA 3KFXA 2IF0A 2VNAA 3NBKA 4NDAA 5E6UA 5FOUA 4FT4A 2GQ0A 3R6GA 2ZTSA 4QL3A 3TNYA 4AP6A 4PLWA 4HDOB 3EY4A 1TYDE 1JJIA 1MIHA 3TEJA 3JQQA 3ICWA 4RPIA 5C0OE 2ORED 3PF8A 3B2QA 3CLSC 4OVKA 1G8KA 2FDRA 2GRAA 4HVCA 3TGPA 4R2JA 4KNVA 5IDYA 3HJHA 5CT5A 2WJ3A 2BFEA 2J5XA 4ZOLB 1PQUA 2Z8YM 4KRFA 4HO1X 4E5NA 3CVUA 1GNLA 5IM4A 3C3YA 3OZGA 2R66A 1SR8A 3IAM6 4M7RA 1NVUQ 2W8BA 1R4MA 2YWFA 1XAHA 2NNWB 3K05A 3O92A 3QOFA 5TGZA 3F74A 2ZSAA 1QUFA 4M0KA 1G9TA 1QNLA 2IGBA 2QKYA 2YJNA 4QO7A 1EIWA 2WNSA 3DUFB 2OCGA 1UDBA 1ULUA 4QXAA 4R3WA 4WRRA 3BK2A 2A9JA 3TM4A 4G4SP 4A5SA 1C30B 1W0JD 3LHSA 1ILWA 2Q46A 3QBTA 3BH6A 4GMDA 4ZEVA 4YP1A 2FX5A 4L76A 3Q1LA 4YY3B 3IEUA 4D97A 2YBEA 4K9RA 1GPH1 1E5LA 2HD4A 2J9ZB 2QW0X 2ZSHA 3OI7A 4IFBA 1M8GA 3PUYA 2YWBA 2VDMB 4N8EA 1OOEA 5GJWC 4IWXA 3AUFA 2GHRA 2P2YA 1XV5A 3LVBA 4AM8A 3WIEA 1J5XA 2W2XA 4KJXA 2C94A 3ZE6A 5JYDA 3L92A 5GV7A 4L75A 4WBNA 4BLSA 2XB2A 4DXDA 3I9LA 2QG9A 1EBUA 2C5FA 1A27A 1U7PA 2IQ5A 4Y30A 5F7JA 4DCCA 1NQVA 3O90A 4GXRA 1X86B 2YHUA 4Q37A 4AKIA 3QXGA 1BW9A 2JFUA 2O1XA 3O2JA 2OHOA 4QOIA 2FQQA 4IGIA 4ZJPA 1DE0A 3DW1X 1FDIA 3EGEA 2XB4A 2BEWA 3I09A 3PZRA 2C77A 4WK2B 3TB6A 3ZWKA 4UW9A 1Z0ZA 1JXAA 1OZHA 2FZLA 2X5XA 3DBLA 4P3PA 5CVVA 3O1LA 4DR4B 1TGYA 5KOYA 3TQRA 4OB7A 4BV3A 1RPNA 1T6NA 1EFHA 1J0CA 1XCLA 3HRHA 1GTG1 3EXAA 3D81A 3V8NA 1R88A 1D0IA 3T15A 1U9ZA 2XUGA 3NC4A 3AY3A 1BMFD 3SZOA 4LXHA 5ITZA 5JADA 1KEKA 1YJXA 4FSHA 1J2EA 1EXWA 1GARA 1VIAA 1WVMA 3HVHA 4A2WA 1ORVA 3K2QA 4CDNA 2XKAA 3EAQA 4MH0R 5E9WA 1EM6A 1RHUA 4OAQA 1VCMA 2PAAA 1U1DA 4X8MA 4FBMA 3U7RA 4C4SA 3BE8A 1EUCA 3CNEA 3BWDD 1HH4A 5TJ9A 3CFYA 4GI1A 4MUNA 5B1HA 4Y2XA 4WHMA 1YRHA 2HBQA 3DM5A 1SQGA 3ZGLA 1C0PA 2HNBA 2JFYA 3MK31 3AM1A 3DT6A 3RK0A 4F4UA 1SUCA 3TZHA 2V7UA 5A0FA 2QRLA 3O8NA 1MENA 1S3SA 3DBVO 1C8BA 1QGDA 1W2HA 4IDEA 1I24A 1X2BA 4M4SA 2W6JD 4AG6A 3PVSA 5D3ZA 4FFNA 1QUEA 4QHTA 4AXXA 1E2FA 2ZAGA 3QVUA 1F7UA 1L7MA 4E70A 2QVBA 5IJ0A 5TEVA 3AHDA 5GV8A 4TV9A 1VKRA 5GPBA 1Y9JA 3EBLA 2FRVA 5LMCA 1TM3E 1EFDN 1KQNA 3HDVA 1VKJA 4MS1A 3DS8A 1ADCA 4M36A 1RZRA 1BE8A 1XCBA 4N5HX 4WFKA 3CJRA 4WKCA 4UVGA 4CQMD 2X8AA 4FHCA 3L79A 4HEQA 1O1YA 2PX0A 4DV3B 1YASA 3IOMA 3K9CA 3MD0A 1PLKA 2V74B 4Q9LA 1P4RA 1ZSVA 3HDGA 4UCXA 3TW4A 2G72A 2HJWA 3UHPA 3IPRA 4AJEA 3ZTWA 1SU6A 3H3FA 4FMDF 4TN5A 1QE0A 2NG1A 4X60A 4IOKA 1LBEA 2Z5VA 4X84A 2VUTA 1FP7A 3AKDA 3BSWA 1P45A 1T9ZA 3E4CA 2DHEA 2GGSA 5CBKA 1WOYA 3E9RA 4K0RA 4JLNA 1IQPA 1ZBQA 2XMGA 3HDQA 3HZZA 3Q7SA 5JFGA 2QZJA 2FB9A 4ZI7F 2ROQA 4AKTA 3STUA 3LUBA 4OHWA 4CEIA 1DP4A 2ZYSA 1OREA 4JUFA 1KKUA 3V4FA 4AS1A 1YZ3A 4QVGA 4HFRA 3IOYA 4YP0A 1SC3A 3TUZC 5MGBA 1MF7A 4WOCA 1QQ6A 2II6A 3PHBE 2BWJA 1O08A 3C3WA 4JODA 4TT8A 3SS7X 5KNDH 3FLAA 1TVMA 2FHSA 4B6PA 3M9WA 3VGPA 1G60A 4C14A 3L06A 2CF5A 1OZ0A 4LJYA 4UHCA 1JPNA 3MTAA 5FR1A 4P4LA 2CLSA 2I0FA 4FUQA 2AEFA 2HLHA 1ZVJA 2PSFA 3CZ4A 3F6SA 3I58A 4Y6GB 4ZRDA 1QE5A 4BNDA 3FOWA 3D6VA 3FM9A 5LOVA 1NMZA 4GYYA 2O2XA 3PC8C 5TF4A 1G3IA 4LPKA 2P91A 5HA5A 3DSRA 3ZLBA 1QDEA 1XEWX 1G66A 3M70A 5GP1A 2GSWA 2ZITA 2ZWOA 4NU8X 5SV2A 2AXEA 2H29A 1TKCA 3QV1A 3EDRA 3MCZA 4HR7A 1SWVA 3MMSA 1ZHFA 4BPBA 1K68A 5CA0A 4AY4A 3ZDBA 1RI5A 3R0XA 4D0RA 4QD3A 4NPAA 5IVHA 2AN3A 1JDBC 1XU7A 2IU4A 3O95A 4IKOA 2X7HA 3KOXA 1P1CA 1DDGA 4WLUA 3PQDA 1AZWA 3RE1A 5BY2A 1TE2A 3C7KA 1V3VA 4NZNA 4PWYA 5ALPA 4P36A 3GQBA 3JQGA 3RCBA 1K66A 3DKPA 1M6EX 1SBNE 2HRRA 3EDQA 3IBFA 4PXAA 4U7PB 1WEHA 3RYHA 4CF4A 1A95A 5EWJA 1BMQA 2PKQP 5BXYA 2HK8A 1R0KA 4QTYA 4LRXA 1OFTA 3PGKA 4QQRA 1KJYA 2F1KA 3HGQA 4FLMA 2I9PA 1XK6A 3B6ZA 3GNQA 3HFGA 5LDDC 5DSTA 2DH5A 1RJ9A 3OIWA 4IVRA 1K6MA 3S1AA 2AXQA 1NNUA 1R18A 1A98A 2PA3A 3DMYA 4I36A 1PR6A 3WRXA 3QFCA 1DRWA 1XXHA 3GVIA 3PPWA 3T9DA 3WK4A 4E4YA 1YVUA 1D2EA 1E1MA 1E9BA 3IHKA 3HO8A 3IQIX 4OA8A 2FWNA 4PYRA 5F1YA 2YICA 1EE1A 2JLCA 4R1MA 5D6OA 4M87A 1D2HA 5IAGA 4B74A 1E89A 3ND7A 1OLSA 2KM1A 1D1SA 2J7KA 4Z9AA 1KI6B 4PPYA 1NULA 5K8LA 3P9YA 5FQNA 3M82A 1YO6A 1M8KA 4PBSA 5F1KA 3V3KA 4Q7QA 2GNPA 3RKUA 4BBAA 5CFLA 1V43A 3TTUA 5KWVA 3G9UA 4MXDA 3CLRC 5CIWA 1CB0A 4WX2B 2UU9B 2QBYB 3LQKA 5HKBA 1D7OA 1U7UA 5K8UA 4GEKA 4E1AA 4PO3X 3CW9A 3K9HA 2B34A 2GZRA 2VH1A 1DQNA 3LLSA 1PWZA 5AM1A 5T4HA 1WO8A 1M6HA 4RDXA 3PFIA 4Z1MA 5IUJC 1JIVA 1G2PA 3PRJA 3FOBA 1UBSB 2OSVA 2VXOA 4ZAVA 3B2EA 4AULA 3WLAA 4HWSA 4LXGA 1JU4A 3NONA 4KEAA 4A0HA 1JKIA 1FYVA 4ID9A 2ARKA 5E9AA 1X74A 5KYTA 1V16B 3P2JA 4KRXA 1CUBA 2ZJ3A 2ZS9A 4NXNB 4IIUA 3IEMA 2OXTA 4RFSA 2ADOA 3WGYA 4XLLA 4CW7A 3EF3A 2XVMA 4NESA 4U39A 4Q9KA 2W0MA 4M37A 5BQPA 3AVVA 1T1SA 4PIPA 1V1RB 4FEEA 4RIGA 4TSFA 3ZX5A 3NVDA 2FJUA 3IAHA 2OY0A 4O2BA 3FLMA 3LY7A 2XT9A 4DGQA 3ET5A 3U3DA 1K89A 1NW8A 2NN3C 1ESNA 4PSVA 4W5WA 1GYQA 3DHVA 1AU9A 4WI1A 3M1YA 1RYHA 3I83A 2BR3A 5J2TF 4BMVA 4ED9A 2YRXA 2Y1LA 4MAAA 2ZROA 3AI3A 4XB2A 3MUFA 3UWDA 3I61A 3CVYA 3LGSA 2C4TA 1H2YA 2B20A 3C5HA 1TAQA 3RT1A 4D80A 4UM9B 4BQQA 2XMBA 4NPHA 1U0GA 3O73A 3ROGA 2V7WA 4MYTA 2FWIA 5JS8A 1R5NA 1HT1E 3GJQA 4FYIA 1Z82A 2XNHA 1PZHA 3UV3A 3WGLA 4XJSA 5FWYB 3CJTA 1NV9A 2V7PA 2EXXA 1ORDA 2I3BA 1D0SA 1KJIA 16PKA 2EHJA 3H3JA 4HGRA 2A4MA 1OW3B 1UANA 2VCHA 4PRLA 5DI9A 4FQ8A 4KLNA 1X3SA 4NMHA 3B8EA 3M83A 4DRZA 2DRIA 3EGXA 1J70A 1R5OA 3VHXA 1KMIY 1PGPA 4HQLA 2RK3A 3JSAA 5M5BA 5K3SA 1CXZA 1GLGA 4H18A 3A6GA 5AJYA 3U7QB 2CL5A 4LYJA 4LN1A 4OG2A 3H1BA 3PA6A 5HK8A 5JBNA 3MRTA 2IOFK 4N3BA 2O2ZA 3AM4A 3BAZA 3O0TA 4GUAA 4UULA 2QLTA 3CW8X 2I1WA 4FSXA 3TRDA 4DBZA 2LKDA 1E7MA 3C6YA 1UKBA 4P54A 4GPEA 5K05A 4IGAA 2QV7A 1WL8A 2CV2A 3S29A 4EUHA 1PGJA 3UC5A 2MCFA 3C5CA 3DHWC 4ZVTA 4OGKA 4EARA 2NO9A 3G9QA 5AW6A 3EMVA 2HV8A 2ALJA 1CEEA 1OA0A 2EDAA 3LRXA 3DP7A 3CCBA 1L4MA 1L5RA 2IBMA 2R79A 4JAVC 1O95A 1XZAA 3DLTA 3M3DA 3TH5A 4D5GA 3BPSA 3T4UA 4LF7B 2Y05A 2XZTA 3UKOA 2ZPUA 2XVZA 3GR6A 2QZ4A 4ACAA 3NAGA 4BO3A 4U8HA 2CCGA 4XGRA 3VR0A 5AQEA 4FGUA 1VRVA 1GAQA 5KO2A 2O0JA 3HVRA 2F00A 3MLEA 3M1LA 2WTNA 3HWX1 3K92A 3K1AA 5AJUA 5CFQA 4D4KA 1JL3A 4E07A 2XWBF 1NIPA 1ZA1A 3ZUPA 2VYQA 3GH1A 1A9RA 1L4HA 3Q15C 4IOMA 1CCWA 1JHRA 4GVLA 1PT7A 4TQUS 3GDFA 4YJFB 5FV7A 4UHHA 3GLGE 3EOZA 4P1ZA 1SKMA 3JQEA 3WBFA 2DHDA 1JDVA 1KK3A 1ZRSA 2EX1A 4TYMA 2D5CA 4DR7B 1IXZA 2O8CB 2BKXA 2NU8B 2B5VA 3DKVA 1KYWA 4OLFA 1ZRHA 3B52X 3G0IA 1QHEA 1ZH2A 2WTEA 3RQSA 3DQQA 2Q4BA 3S7ZA 1Q6YA 1UJMA 3VC2A 3ZH9B 5C8DA 1JHDA 2O2JA 5HF8A 5EVCA 3U40A 1AQUA 5HOEA 1FYXA 1IB0A 1GA1A 2DUMA 3G3EA 2Y4OA 3NWBA 5CFOA 4OLAA 5E4JA 3V48A 3HB4X 4YRCA 3INTA 4CR6A 3M6XA 2DF8A 4NBWA 3TG2A 1WJGA 4E14A 2GVZC 1UZMA 1E77A 3DEHA 3HKEA 5EIFA 3NIDB 1FFWA 4PCAA 1V39A 3LHKA 3MMZA 3UO8B 2LR0A 3KP1A 2JFVA 4XOIA 2PKCA 1RXSA 1NMYA 4WGGA 5JWHA 4MK4A 2GBLA 4JN6B 4M53A 3HB9A 4C0KA 1Q15A 1OIXA 2V1UA 2AT1A 1LPBB 1SOAA 3DOIA 1PS0A 3VYUB 4Q7MB 3ZK9A 1B8VA 3W5CA 3WS7A 2PCJA 3HZHA 1P2BA 3J7TA 1RJEA 1WXHA 3P9CA 3DTVB 1WU7A 3R23A 4MRMA 3DCYA 3BZBA 4Q19A 3TXYA 1MDBA 3TECE 2XEXA 4JJ7A 5HKAA 4OQZA 1KI9A 1D4ZA 1U2DA 2PL1A 3QI7A 4GM0A 2J9RA 1W94A 2QLLA 1BKDR 5E6RB 2XEDA 4FC7A 2YMPA 1IHYA 1OXSC 4BWYA 3DTYA 4HNGA 1ZLYA 3SHOA 4B7UA 2FQYA 5JALA 5CTAA 2WB4A 2G04A 5AM4A 1IBKB 3T12A 2KBEA 2OAP1 4HLUC 1XP8A 4GU5A 2BHTA 3HJUA 3RVNA 3PCTA 4JBNA 2PSJA 2EGHA 4K6CA 4LZJA 2B4QA 2VT6A 2FZWA 3VPDA 4I50F 2FP4B 4YEDA 4MR9A 2AX4A 5M3BA 4AUNA 2IXTA 2BMJA 5J1SB 3DUWA 1PG5A 3K6JA 5IKOA 5HS6A 3DYIA 1SNYA 1T3GA 5IAOA 2EDCA 3GBVA 1EPUA 2NQTA 5J3JA 1C9MA 3WZMA 1RCTE 1NFQA 1GD1O 1VLVA 1X7YB 1F48A 2NU7B 1O8CA 1YK0A 3NIGB 1RWWA 4HPWA 4OKNA 5DHFA 2PX8A 5CIQA 3AOEA 3BWBA 1L7QA 3HDYA 1N6HA 1JDZA 1FK8A 1YB1A 3NI2A 3D6HA 4DIUA 2O2GA 3EMKA 3FOAA 1T9HA 4UU8A 2DWCA 1JSZA 2VF7A 4O4JB 2QAIA 4XFJA 1PVDA 3FFWA 4H7JA 4NULA 4ZV7A 5AUPB 1CR0A 1X13A 5IXSA 1VHQA 2BTOA 4JROA 4F85A 4MW1A 1SB8A 1USUA 2BDUA 4CLOB 1EGQA 4EI2A 2OCAA 3SC6A 1MH1A 1H8ED 2XRMA 3VAZA 3QX3A 3ZU3A 3NG1A 1K08A 4RVSA 2YS6A 1T25A 4MWCA 4O2AB 4O4IA 4QOFA 5BW4A 4RV5A 4A92A 4BX2A 2J85A 1FLVA 1WUTA 3CX8A 4EMBA 1EWQA 1HDXA 2ZUWA 1G6Q1 2WKRA 1VM6A 4BQSA 3W2IA 2CV0A 1OFHA 3HWWA 3FH0A 3ZVLA 4G2TA 1EUYA 1UPFA 1DFGA 1BDIA 1UWKA 4LSWA 3UBTA 3QKRA 1CUEA 4LSGA 4UTXA 1FMJA 1U0LA 1UJNA 1Z7BA 1C4KA 1BZYA 4PG6A 4FHEA 3M6WA 3O2QB 4JX8A 2JHPA 1CERA 3OQ1A 3LXXA 3KOZA 3ZHQA 4P5DA 1DKOA 3GF4A 2WDZA 4M7PA 4NBNA 3FWKA 3SE7A 1SCUA 2FY8A 2QN1A 4K7JA 4RSMA 4DB2A 2VRWA 4B33A 3TMAA 4N3NA 3GRVA 3OOHA 4XPIA 5JARA 1Y8QB 4PTYA 3ZKAA 4S1PA 5LLDA 2A9VA 3OPQA 1D2NA 4ND5A 1A4XA 1SJ9A 4G65A 1X8KA 3PNKA 1B0ZA 4FHDA 2GR9A 4PLTA 3UH1A 4PLPA 1SKAA 5BN4B 5D87A 3OD1A 1GU0A 1LVGA 1ZY2A 4F21A 4NDZA 4ZDJA 4PZLA 3SM3A 4G24A 2OZLA 2HBYA 3IERA 1MRZA 2O7QA 1XTIA 2XSZA 2OP0A 3BGSA 2WHQA 4B9EA 2VHTA 4X62B 3IAS6 3TI9A 4BJHB 1O0SA 2XTNA 4B4VA 1UEJA 4FFBA 4L28A 3BSYA 4EA9A 1U4NA 1TQ8A 4PF1A 4H1VA 1C7FA 1M2OA 1MXHA 1NAIA 2B2XA 4UZEA 4D02A 4GZMA 2NVWA 4RS3A 3ZY6A 5HS4A 1H1LB 2H1LA 1M74A 4IDFA 4DCVA 5JCPA 4CV1A 5FP0A 2QM0A 4RQBA 1TJ3A 4XUGB 5G02A 3VTFA 5K99A 1SBHA 2FN9A 3ESZA 3I9V1 5I7AA 3GHYA 5CT8A 2RAPA 2OK8A 5ED4A 2F4VB 1LV7A 2HXYA 1J21A 3E22A 4YO8A 4JGIA 3N2GA 4FDUA 4BWVA 5DOZA 4IV0A 3IKTA 4AJOA 3W5UA 1UJ5A 1XJ5A 1G8GA 1L4NA 4YPVA 2KQUA 3HKCA 4H35A 1PT6A 4FR2A 1UK9A 3UAVA 5HHTA 4FZ5A 1YAJA 4ACBA 1I5OA 1X77A 3KQWA 2FFAA 2Q2WA 3L7AA 4ALJA 5KUTA 5LWHA 4WV3A 5TSDA 4EP1A 1QOZA 5FQOA 3LFUA 3HU1A 4QIHA 1QGUA 1WCV1 1ZD9A 4TMZA 3SC4A 2CLFB 3IOCA 2XB9A 2CFCA 3EGWA 3QXJA 1W7AA 3NOXA 2REQB 3ZY3A 1OFUX 4FDTA 2VBGA 4LYDA 1F3LA 2ZVDA 1PFQA 3SF8A 3WQQA 2GPWA 3D6AA 1VI2A 2R1TB 3OF3A 1EXMA 3A04A 5IBQA 5T8KC 4JJFA 5EGNA 4FB5A 1EX1A 4B3CA 1CJVC 3CLRD 3QK7A 1YRLA 4OU5A 4HLQB 4LI0A 2RGXA 3DOUA 3NNDA 1FNCA 1H3EA 4WPGA 1ZZEA 3KQQA 3ZHUA 5BSVA 2I29A 1PJRA 4YROA 1QDLB 2PRJA 4ND1A 2CSXA 3KYCB 5LQMA 4LGMA 4QELA 4PNEA 2ADFA 4S0ZA 4J43A 1VZ2A 4ZYTA 1EFRA 3B2NA 3DL4A 4EB6B 5YASA 3UJ8A 3OM9A 3HA2A 1DAOA 2XNDD 4QRDA 1I6MA 2IHBA 4C0BA 4NONA 4RA6B 4UPVA 5L6LB 2NPIA 4R01A 1U63A 4AG5A 2PA0A 2Q4OA 3CX3A 1AZSC 3UM9A 1T8PA 4TT3D 1ID1A 3AJRA 2CWWA 3DVAB 2YWEA 3ITDA 3OTGA 3AOGA 3PU6A 4X6LA 3UUEA 4R2WA 2QVZX 2R25B 2K4MA 4MWTA 2BF4A 2GXSA 2QQFA 3DMNA 1NW6A 1QGYA 2EQBA 3WE7A 4EI9A 4YRGA 3W5AA 1WKVA 1FJXA 4M1EA 3WLSA 3ZE0B 2JFXA 3BJIC 1XN4A 4MCIA 1W2GA 2XJ9A 1O3YA 1G1MA 3N74A 4PZEA 3MJ4A 3VV3A 2PJRA 3TI7A 4FNOA 1E3JA 3O82A 5EN4A 2Y9MB 4PC3A 5CIYA 2G76A 2GXQA 3VAYA 1J56A 3E35A 2HSWA 3GHHA 2NSJA 3H4TA 1IM8A 1H4VB 2ILVA 1L7VC 2Y1GA 3D3WA 3CH4B 3L7YA 5ARBA 1P3DA 4UVIA 3SJBA 3O1HB 5ECDA 3UF0A 4B5KA 1N6IA 1QOQB 1UQUA 1NHGA 3SPXA 5IKMA 1RIFA 3A9CA 1RAFA 4QDTA 1SC1A 4A73A 4WASA 4RAOA 4FDMA 2B4RO 2J3HA 2EZUA 1Q19A 1Y63A 5ALMA 1MHPA 1T3ZA 2O9JA 1W0KA 1VE7A 3B9RA 1TM1E 3FVVA 3BXZA 3QVLA 1M33A 3W7AA 5C1DA 4TKMA 3EIHA 3KJEA 4DIEA 4EQ6A 2C97A 1I6LA 2D2FA 3EXHC 3PQ4A 5IBRA 3P97A 4QXQA 2CC2A 3D7SA 1LWOA 4WVLA 3W78A 1EQ2A 2HF9A 1SRRA 2OLEA 1X80A 3HCOA 3LVQE 4FDAA 4MULA 1VJ1A 1KMMA 3BWMA 3THRA 5CDYA 1NFRA 5DHQA 3FPKA 1R37A 3QUSA 3GY0A 1L3CA 2XYQA 4ZO7A 1CUGA 3KWJA 1H1TA 3FPAA 3KEOA 1E1DA 1M76A 2HHLA 2OGTA 3O4VA 3UC9A 1MAAA 3K73O 1RQLA 2YNMD 1X94A 2EF0A 3D1JA 4DMUB 1KL7A 4KQXA 2JCBA 2OM6A 2HLPA 3U4QB 1IBMB 3AF3A 1KFJB 2C4VA 2PJUA 3RIGA 4EHDA 2QAGA 1KA9H 3BXOA 1ZC3A 2RHJA 3ZS8A 2BM1A 4RMGA 1B7GO 5FWNA 3QX9A 1QHFA 3I53A 3O0DA 4MCHA 5KPDA 2QTWB 1ZUIA 1QP7A 1J0DA 3EF1A 3AUJB 3NHSA 4OHPA 4CLRB 2GAJA 3NVKI 1PK8A 3A7DA 4TX1A 2WT9A 3E7PA 4AJPA 3ZCVA 4BDSA 1EMDA 1MIOA 2BAGA 2QN9A 4MLZA 1N1DA 4LBYA 4C21A 2IV3A 2Z09A 2B99A 3AF6A 4HZUB 1NG9A 4RVUA 3C45A 2JCVA 2ICAA 1U04A 3F6EX 2ZRDA 3LDGA 1YOVB 2IV7A 1Y7IA 3IELA 2OHXA 5D00A 5JXHA 4RORA 5TX7A 3T3OA 2H2DA 2ZJ8A 3D4OA 3Q5DA 4KTVE 2H57A 4WH0A 4B81A 5AW4A 4DJJA 2V4ZA 1J90A 4OOFA 2ZTHA 1F20A 3Q8KA 5B1IA 4E7PA 4PZYA 4OI2A 3EPKA 1XPUA 3QXHA 4QU8A 2Y0PA 3LA6A 4KHZA 3GH3A 1ICEA 4RVDA 4LGVA 3U3OA 3WAGA 2MINB 1R8YA 3DH0A 4HDNA 2G80A 1Q7TA 1ZVQA 2WF6A 3H2JA 4I14A 1EUDA 3TCXB 4XDGA 3WYFA 721PA 3ZD8A 5JAPA 1ZBDA 4DV1B 1OKKA 2C7BA 3UWOA 3VOTA 1I51A 3JD4A 4UZSA 3WGVA 4OLJA 1BIFA 1SXJC 2ISSD 3IEVA 2QTVA 3BDIA 2B1QA 1IWOA 4IH1A 4W6QA 1RKVA 1XPJA 1MB4A 1QO0D 1CUXA 2Q4RA 3ENNA 2VDUE 5LN1A 5CFNA 2OAGA 4NS1A 3CH6A 2GRJA 1T9DA 3JZFA 4Q9DA 4WOBA 1W6RA 2OOKA 3NU1A 4HGYA 1QIKA 5DKFA 4JNKA 5JDIA 4PLZA 1J0EA 3ZXUB 1JG6A 2N0SA 4JWKA 4L0CA 4IIHA 1SIWA 4AZTA 5C5DA 4AZ3B 3ZV3A 1F2TA 1SC4A 3COPA 1Y1QA 3COSA 4BE4A 1D7AA 1GPUA 1N3YA 2Z1MA 1T35A 3FNFA 4CKBB 2E18A 2O0LA 2BEJA 2XTZA 1X1SA 3Q0EA 4RYDA 3PI7A 1NAHA 1FYWA 4ISBA 5A5EA 1I6KA 4OJKA 4XD7D 4ZVNA 3TZBA 4WLVA 3WHPA 4HYTA 1R4ZA 2JVKA 4RDHA 1VHTA 3QVGB 4GRIA 1II8B 3DL0A 4YC7A 2PRIA 1E7RA 1MQSA 3GP5A 5ER6A 1UBHS 3A31A 1FE8A 2H17A 1U4SA 2FZ5A 2ZIVB 2Y1KA 3I2KA 1I32A 3H3XA 4QTTB 4UVHA 3LVRE 4Y2TA 1G2OA 1CQXA 1VKOA 3BD9A 3ACDA 5A7GA 5FBHA 2A1UA 4A36A 5HW0A 1XEFA 5B6PA 1P2TA 2Q9CA 3OAAD 3VR4H 1F8UA 1YZLA 3QY9A 2GPAA 5ES4B 1UAGA 1UJ2A 5ALEA 4FQ5A 1TYAE 3TZQA 4AKGA 5GY7A 4FYHA 4W1PA 4CM9A 1VYVA 4RADA 3AHEA 3E8SA 4HLNA 1KOFA 4IIGA 2CNLA 2OYRA 3EGIA 4CF7A 1P7PA 4KQ9A 3OT1A 1FQKA 3BCSA 5DRTA 3Q3GE 2X8JB 2EJVA 4TLCA 3D3KA 2N1BA 5HDQA 5KQGA 4GBED 2VDNB 5CEFA 2DGDA 3OQBA 4ZVOA 3WJ2A 2O07A 5BQ3A 5K4GA 3ZV4A 1ECCA 1OAAA 4WY2A 2GTIA 3KZMA 1HDRA 4G67A 3ZDXB 3FNBA 1RYZA 3JX9A 4KWIA 3BMNB 4O29A 1MN6A 1Q21A 4LXUA 4ATNA 4KI7A 3HB5X 2F3RA 1MTZA 1C0EA 2HIGA 3VR1A 3KLBA 1F9AA 5C5EA 1EK1A 3HABA 5KU1A 3DXFA 2HGSA 2FSHA 3CZ5A 2HYDA 5AH0A 1EJ2A 1L2TA 3H9QA 4DC0A 4PRYA 2DLDA 3VYSB 3UANA 3N5CA 4M98A 2ZWIA 3UMCA 1E3WB 3MTEA 4CYMA 3EXFA 3KT3A 4UAJA 4E51A 1L5ZA 3VVCA 1T0UA 1X38A 1VJCA 3DEJA 3JASA 3FETA 4QYIB 1YQGA 4WEOA 1A5AB 1HZZA 3JU3A 3PC6A 4HFJA 2IU3A 4IS3A 2WINI 1AQNA 1Q3TA 2Q8PA 2F8TA 2VN8A 3B1JA 1MA3A 4XSHA 4N7JA 4ZZ2A 1DC3A 2C2KA 2XUIA 3ELBA 3KT0A 1B26A 1U3UA 3QKWA 1B76A 5AVJA 4L7VA 3L8EA 3D3QA 2JGLA 2GJ9A 4J0CA 1E99A 3FD8A 4LZLA 5IZCA 2C8VA 1A7JA 2V5AA 2VAXA 1I0IA 5CHYA 2GEJA 2C78A 3MS4A 3BWCA 5EC8A 5DGDA 1WQ4A 1WLYA 1LPNA 2ATIA 2WM2A 3OESA 1PF7E 1U8EA 4ZK6A 1NUTA 2YZMA 3WNQA 1T2CA 5F5LA 1G20A 3T9CA 5FT9A 3PEYA 3FROA 1TFUA 1FRFS 4IW3B 1A2BA 1HQCA 5TDHA 3A3YA 3L7OA 2O0HA 4HVLA 2IOYA 1Q1AA 5SICE 1GDTA 5E7QA 4OHXA 5LIPA 2WQZA 2UUAB 3UUFA 3P0FA 4CCYB 4I55F 4NOMA 1Z6AA 3ESXA 4K3VA 5TQVA 4MWDA 2JEOA 2P2NA 4DMLA 2VAPA 3GLGB 1EK0A 1T8WA 3ORQA 3PPYA 4J90A 1LRLA 2HSEA 4CHGA 1TMKA 4UJ5A 2NVUA 4ALLA 1WV0A 4F9EA 3UGQA 2A9RA 2ZW9A 5EIOA 3OIYA 3KL2A 1J2UA 4PYOA 2VYNA 1LSUA 2RGAA 4BE7B 3HVJA 2ZRAA 4KDCA 4WESB 3Q3IA 4WFIA 3Q98A 3KWMA 4TTAA 1FSZA 2IYAA 4UU1A 3U62A 2VJCA 5K5EA 5CCBA 1DGQA 1OJLA 2JW5A 4H0CA 1G5HA 1N2CE 3AUSA 3BKXA 2QTAA 4O4HF 2PIAA 4TQ9A 3C41J 2H08A 1LQUA 1VIMA 1Z0DA 3L0ZA 4GE3A 3SFTA 1ZKDA 4XASA 3MB8A 3FTFA 5GVRA 4RYLA 3VMMA 4OHZA 3AR6A 1XLVA 2J3JA 3HDJA 4HB4A 5HF5A 4G09A 1OGJA 2CNWD 5AYVA 2YFQA 1XU9A 4W4TA 2G1KA 2CB9A 3DL7A 4V0RA 5IMSA 2WTBA 3Q7EA 2GMWA 3GPIA 5FTKA 1G8HA 3A9UA 4C01A 1JJBA 5JAHA 4ZKDA 1TI7A 2F67A 2J8ZA 2OAQ1 5SYNA 1KERA 2VFAA 1CT9A 3CSSA 1GQQA 4ZQCB 4Q1BA 4DV0B 4R5MA 1N6PA 1VL2A 2PFGA 3LX8A 5HK9A 2QPLA 3E03A 5TC4A 2CXXA 4Y18A 5H8WA 4DCPA 3PNQA 1C4OA 2OO3A 1E79A 4Y7CA 4JOSA 4ZPJA 4WK0B 3H2ZA 1YTLA 4I1OA 3D02A 4XSGA 4BO6A 1VDMA 3M34A 2QLJA 3KS9A 3L07A 3P2EA 2NQ2C 4I08A 4YQFA 3G49A 4A0GA 4GZLA 3CKYA 3FG9A 3EF0A 4FYVA 5KNCA 3GLQA 1CJSA 4D9KA 3VPBA 4RKFA 2J9YB 5FBQB 1PFKA 2ZTLA 5AKZA 2FZCA 2HA2A 4Y0VA 4JCCA 3HNOA 2QE7A 3IEIA 3F1KA 4KOAA 1RWQA 4N3GA 4DHWA 2J0EA 2ZRCA 3R7FA 3VC1A 1XVIA 1HGXA 2EP8A 3SX2A 2GK6A 1Y1RA 2WLTA 2VUHB 3H11A 3OJXA 4WD3A 3RARA 2RMKA 1SK9A 3SEZA 5FBZA 1Z34A 2JIDA 2B8NA 2R00C 1OX4A 3OFKA 2PUFA 4LHEA 5H83A 3VU8A 4G56A 2XQVA 2P9JA 1YS4A 4NZPA 3HYCA 3QOWA 1E2LA 4Y0NA 5LQKA 3I12A 4GKAA 1TTQB 1CK4A 1BWPA 2P35A 3GEIA 3HSKA 4ZEOA 2P2DA 1KVQA 2XA2A 3AF2A 2W6QA 4U2CA 4AYXA 2G1JA 1RPZA 1ESMA 2Y3IA 4R2MA 4Y9UA 3TSCA 4BRUA 1WXIA 3BGVA 3HKDB 4FE3A 4PX2A 3DCIA 1KFKB 1R6UA 1Y80A 2DYKA 2VSNA 4G0OA 2OHVA 4F5EA 2DFPA 1M54A 1NU8A 3M6UA 2LIVA 5GJCA 2HW8A 4KODA 3UJPA 4DWVA 5KSWB 1X9GA 2HU2A 2QUHA 2GEBA 3GN2A 1D8AA 1X14A 5DEIA 1DG3A 3SYRA 4P6VF 3O47A 1WY5A 4KAAA 4LZZA 4DG8A 2Q8QA 4J16C 5BRAA 3KSZO 5JNWA 1U8UA 3H16A 5JPDA 2VP5A 5DP2A 3DPUA 4AECA 5BWLA 2G71A 3GVCA 3ZWBA 4R98A 1U5BA 3WFJA 3WKDA 5KS2A 5HIMA 2EKBA 2WHEA 3O21A 4M8NE 1JI3A 2DR3A 4DQXA 1KHHA 4RMIA 1W4LA 4QUJA 1RXIA 2NU9B 3AVQA 2PAFA 1P5FA 2GZDA 4J2TA 5IAKA 4AJ1A 4CG1A 4IQ4A 2AUTA 3EH1A 3JQFA 4IR7A 2GFHA 4JT2A 1NM5C 3O91A 1TIPA 3B3GA 3ILHA 5ALRA 3V34A 1QWSA 3S55A 1F8FA 4DNFA 2CXHA 3HJRA 4YAGA 3VR6A 1HDGO 3GJTA 4EEKA 3A6ZA 4LI3X 2IA5A 3QYPA 1ZOPA 4KWTA 2VHQA 3ONFA 3QLUA 3I73A 4W5NA 1JT2A 3T1HB 1NA5A 1P9RA 2ZBEA 2N75A 3BL8A 4D6XA 1TL7C 1XI2A 3IO3A 4JT8A 1SIBE 5KX5F 5DCWA 1DU4A 3RUPA 3SBXA 1N75A 2V54A 4G26A 4GLFA 1RYMA 3CV3A 3CW2A 4WXYB 1A9YA 2DWUA 2WIFA 5DPMA 1OAOC 2JJ2A 1T5IA 3JPYA 1K4YA 2YIDA 4OEHA 2CSUA 1NT2A 4BRWA 3MOSA 1KJ9A 4HFNA 2D7DA 1GVNB 2QAJA 4YJ2A 3DQPA 2JDIA 5FD8A 4CFSA 2OPHA 3RSGA 3QPWA 3EVBA 4FR0A 2B83A 4I4NA 5HZMA 5HSGA 1ML4A 1MJHA 1XD2B 3B48A 1VKNA 5I7OA 2CMGA 3D4NA 2E82A 3KJGA 4GHWA 1Q1EA 2VHXA 3KV1A 3MQ4A 3WLLA 4QSHA 1E1YA 1FLAA 1GZHB 2BI4A 3A2KA 4MV9A 2ODBA 4M1KA 3WGMA 4TTQA 5CB4A 2J6HA 1T5HX 1ZXLA 4HTFA 3RYCA 1Z5UA 1DEHA 3AFHA 5CLHA 3CNLA 4JYZA 3QYAA 3SQDA 5F5XA 4C7JA 3ZCRA 5ERXA 1MC4A 4MKGA 3NO4A 3UJBA 2XECA 4C08A 2R47A 3KZOA 4KN5A 4TZTA 1BWQA 3AY6A 3MJEA 3RS5A 1HWYA 1SXJD 1PT8A 5BVHB 5GIOE 1E3QA 4J0JA 4P38A 5JIBA 1K7YA 3K5HA 3GVXA 4HEA1 2WWRA 2AW3A 2AEMA 2PX4A 3NBMA 4CMBA 1XAIA 4OY3A 1JDJA 1UFOA 1Z15A 2P1ZA 1RFLA 3BMXA 3H9CA 4BNVA 4F6CA 1W8DA 1UQTA 2UZ3A 3TS1A 1SG6A 3EW9A 3K1ZA 4QDZA 3WLKX 4YYZA 1YCDA 2HLNA 2OV3A 3DLHA 2JVJA 1DLIA 4G6ZA 5E6UB 4AJIA 3TSZA 1QYIA 5FL3A 5SZJA 2ZRBA 1MFZA 2CHEA 4FFOA 1YDHA 3P0RA 3U80A 1N32B 4N40A 4PQFA 1MZVA 2PNJA 1R27A 4ARZB 1YUBA 2HPZA 3QF4A 1OU4A 4IS2A 4K8OA 3H42B 4P3OA 4Q15A 3S8MA 3MILA 3QEBZ 4GR9A 2CJFA 1PQPA 3L9WA 3ME5A 4ER7A 5I51A 2P5UA 4HXEB 3RHTA 2V7TA 1A3CA 3JQAD 4BBZA 4YUYA 3SFZA 4G0UA 3UAGA 3X2FA 5JO0A 2VYCA 4EEXA 1WUHS 4TMTA 3UJCA 1T8TA