1CKEA

Cmp kinase from escherichia coli free enzyme structure
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
225
structure length
212
Chain Sequence
AIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQVKGFSVNFERLLAEIKLVPAADALVLDSTTLSIEQVIEKALQYARQKLALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
publication title Structures of escherichia coli CMP kinase alone and in complex with CDP: a new fold of the nucleoside monophosphate binding domain and insights into cytosine nucleotide specificity.
pubmed doi rcsb
source organism Escherichia coli
total genus 70
structure length 212
sequence length 225
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 1998-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ckeA00
1FUUA 1GNQA 1WE2A 3O8DA 5KPDA 2BC9A 2BBWA 1RPZA 1MT0A 1KTVA 2PZFA 4Q48A 1E79A 5LBIA 3PUVA 1NLFA 3K0FA 4LBWA 5J40A 2KWIA 2WWWA 3EG5A 5C18A 2WKQA 4KJZA 4URXR 1AZSC 4CEHB 3ZVRA 1QHNA 3C41J 2QPOA 4Q9JA 4CEJA 4NU0A 2C9OA 5HPYB 1Z63A 3IIMA 2NMVA 3ZH9B 2LCFA 2PCJA 4EFMA 3IEVA 4RVCA 4Q66C 5IK2A 3GJ8A 2GBLC 3U3OA 3B1WA 4LYHA 1OH7A 1D8TA 1IY2A 1HT2E 4KVGA 4B33A 1P5ZB 3ZJYA 3K0SA 1AKEA 3K1JA 5CYOA 5JJIA 2XNDA 1N5IA 1OXTA 2DFNA 3FFBA 1T3LA 2MSDB 2CJWA 2JJ8A 2XXAB 3GJ3A 1SXJA 1DTSA 1P3JA 4TN1A 4YONB 3X1YA 2WIAA 4CIDA 4TQUS 1OHHD 1OXXK 2OT3B 4Q9HA 1E2HA 2ODEA 4BEJA 1IY1A 2DYKA 1G7TA 2C99A 2QTFA 4KFSA 1JR6A 2WWGA 1P4SA 2ZRGA 1T3HA 4PPNA 1M34E 1OSNA 2NPIA 3E70C 3P1JA 4PO9A 4XH9B 3TJZA 5DH9A 5KDLA 2QT1A 5FOWA 1T8UA 3KKPA 6Q21A 3TSOA 1G19A 5E7IA 2W58A 4LJ4A 5KDOA 5JEDA 521PA 3F3YA 1NMZA 4URWR 4GI7A 1ZNXA 4Q7MB 1R6BX 5C46F 3OEHD 4WZBE 4CEHA 3RSOA 1IJFA 1MO3A 4C0BA 1LW7A 2A7QA 1K6MA 4D2IA 3VHLB 2KB0A 2GXSA 1XXHE 1IJEA 2NZJA 1T8TA 1TPZA 1FUKA 4C0JA 1NVUQ 5CJPA 3LD9A 1XBTA 3FKSD 3PIRA 3JVVA 4XTRA 3DDCA 4A0FA 2XGJA 3A4MA 2OM2A 4QNRA 2P5SA 3CRQA 2QN6A 2XB4A 2VRWA 4KBFA 5J4KA 1V5WA 1M7HA 1Q3HA 4QJ3A 2Z4SA 1E0JA 3EWAA 4JVSB 3RS5A 3QXXA 1Q0UA 3A4NA 2IYWA 3OAAA 3X1DA 1WBDA 1B23P 4CZ2A 2DR3A 2OFOA 1W0JA 4NMMA 1G16A 2QM8A 3HP1A 4OI4A 2PH1A 1GWNA 1XD9A 2CK3A 2IYXA 2WVJA 4HZUB 3OESA 3EX7C 4URVR 3T1VA 5FPHA 4B71A 3IPYA 1KI7A 4C4PA 1E2DA 4HSEA 4TT3D 4BZPA 3B82A 5KSPA 3ADBA 2I1QA 4O2LA 2O8DB 3K53A 3SE0A 3KXKA 5CM8B 2JIZA 3BFKA 4DLWA 4PX9A 5FOVA 4PSVA 1Z47A 2B8TA 2GZHA 5FUYA 2MSEB 3AF4A 4ZKDA 3D7MA 3GJ0A 3VR5A 3B1YA 4DCSA 4DZZA 4RKEA 1W1WA 4XTCS 1VIYA 4NP6A 2CE7A 3M6AA 1MABA 2GTPA 2ERXA 2QI9C 3MCAA 3CRVA 2Z5FA 1F5NA 1AK2A 3MRSA 4MYTA 1II9A 3ETLA 2YZ2A 4RD1A 3V00A 2JLSA 1CBUA 1X1RA 2ZRCA 3PUYA 4EPXA 4OI2A 3TW4A 1K5DA 1NI3A 1OV4A 2EFCB 3P20A 1MOZA 3KFVA 2O8BB 4CGZA 4IOJA 5TV2A 4JT4A 1DG3A 4PHHA 3J81k 2FGKA 2VTKA 1G4AE 1OHHA 3QBVA 3RDPA 4RD4A 2WWFA 1OKKD 4KFRA 3QJYA 3S1AB 2FH5B 4Q21A 4TZ0A 3DO6A 3W5IA 3KB1A 1G6OA 4GL2A 1BMFA 5AK0A 3WP1B 3QNUA 4AYTA 2F1IA 4R98A 2RB4A 3EAQA 1DVRA 3K9LA 2O8DA 5KSOA 5BYKA 2A2ZA 2QORA 4FINA 3IQXA 1GL9B 2R65A 4D0NA 4OI0A 1G8GA 2OCPA 2P6RA 3LDAA 3U44B 3BIFA 1TADA 4IEIA 3CLVA 1OYYA 3PFIA 1KJWA 4FMDF 4Q4JB 2ZETA 1KK2A 2EU8A 2GETA 3PG5A 4V0OA 2BM0A 4BECA 2WSSD 4BLPA 2RGCA 1R5NA 3U60B 4G5QA 1Z6XA 2D4HA 1HQYE 2YC4C 2GDJA 1J8MF 2D2EA 2IYZA 5FL3A 3SYKA 3X1WA 4HDCA 3QF4B 2O8BA 1G291 2NG1A 5AUOB 4QJ4A 4DLYA 2GAOA 1XEFA 4Q7KA 4RCYA 2A5YB 3QQ5A 3QG5A 3C16C 5F98A 2KJQA 4LV8B 3A1VA 1TU3A 4PHGA 3S1AA 4PHTA 3TR5A 1OFUX 2GBLA 5P21A 4DLXA 3KKQA 4LDJA 4KLNA 3T1TA 1S96A 1H8EA 4RCZA 4TYYA 3MGCA 5J4YA 2A5GA 4EPWA 3RABA 1T9HA 3KJEA 3SOPA 2WJIA 4A0GA 2Q3MA 2V55B 2GCOA 5EE1A 4NCHA 3LWNA 2D06A 3U44A 3D8BA 1CS4C 4MGYR 4M9ZA 2OLJA 5JZVA 2PMDA 3V9PA 4Q4JA 2ZRIA 2V7QA 5BN5A 3OIYA 1CJMA 1XU4A 4BZQA 4H1VA 4AG5A 2RCNA 2ZVPX 5DI3B 1EGAA 2Q21A 4P33A 3QXSA 4Y0VA 3QF4A 1E1RD 4XD7A 1UKYA 4LWZA 3W6NA 2HYIC 4F91B 2A30A 5FPSA 5L8VA 2OO7A 2ZRDA 4US1R 2JLUA 2BBTA 4I99A 4TTPA 4TMKA 2FU5C 3GLHE 5JSZB 3DVLA 4W5HA 3B13B 1YJ5A 2YV5A 4RZXA 4NCKA 4BQSA 4B34A 4IOKA 1IXSB 3EWSA 2J59A 4TWZA 4A6PA 1G21E 1AS0A 1Z6YA 2ZSAA 3HPRA 3B2EA 3RHFA 3MLEA 1S1MA 5A5GA 4K81B 4KITB 2JLRA 3UMSA 1G4UR 4KSBA 1CU1A 2Q6TA 4HLQB 1JNYA 3W3ZB 5JJLA 5H8WA 2D74A 4V0KA 2I4IA 1AGPA 3CNLA 2N46A 4UXIA 5C4MA 1J90A 4LPSA 1E32A 1CR0A 1HE1C 2XOKA 2W00A 1R0XA 3RWOA 1JEEA 2FPKA 2ZJ5A 2WSSA 1JPJA 2PX3A 4IOMA 5F3WB 2VEDA 4CDGA 1LTQA 2BMEA 3VR2A 2AD5A 4LYAA 1OH5A 1IN8A 2QT0A 4LBVA 3FB4A 1RRFA 4GOJA 3DKVA 1E9AA 4Z1MA 3RRNA 2GVDC 1TUIA 4Q9IA 3UATA 4TMZA 1QG2A 2IHYA 5AUQA 1II0A 5SZHB 2JDIA 3K8YA 3JZAA 2ZR9A 4YMTA 3MD0A 4QBHA 3ZVNA 4LJ9A 1DADA 1MH1A 1ZU4A 3QG1A 5H1YA 4DCUA 2J0SA 1N0WA 3AF2A 3RS7A 3TSWA 1FOEB 4QOSA 2J3EA 3K09C 4TYNA 1PLJA 2EFEB 4B3GA 5JHHB 3OIVA 3CONA 4Q4HA 5JMTA 4A2QA 1Y63A 5M04A 3M1IA 2IS2A 1VIAA 3CX7A 4TLCA 1SHKA 3SU8A 2WAXA 2YWHA 3AGQA 1E4YA 4AYWA 2QG6A 4EIWA 3VKHA 2C78A 1G17A 4JLVA 1OT3A 1YZGA 4IXMA 2N1BA 1G3UA 5B57C 2VH5R 2PJRA 1ZUHA 1U0JA 3CKLA 3F0TA 5HCNA 3WY9A 2WICA 1HUQA 2GNOA 1KO7A 2BMDA 2BJWA 2R6GA 1BIFA 4QHYA 5BN3A 2ZRNA 2R8RA 3ZLJA 1HV8A 3M0EA 1E1RA 4TYPA 5B64A 1QG4A 3UG6A 3OEED 2QL6A 1E9DA 4LHWA 1LS1A 2ZREA 1I4TD 2YOFA 4NONA 5CDFE 1Z2AA 4LK2A 3GEHA 1TMKA 1R2QA 3CWZA 2YYZA 4NYIR 2OBLA 1YR6A 5JCPA 2QBYA 2FDCA 2YWGA 2ERYA 5H68A 4NYMQ 5KPJA 4C0SA 4KXFB 1EG7A 2DCUA 2QQEA 4LHZA 3BBPA 4GMXA 1R7RA 4DIEA 5J4HA 4E09A 2QRZA 1E4VA 3BOSA 1KDRA 3L8ZA 4IDQA 3R9XA 1N6KA 2IHBA 2QMOA 1XCMA 2X2FA 2BDTA 3TSZA 1BOFA 3ZDQA 2IXEA 3NDBB 2IYTA 2F43B 1GL7A 2KBFA 3ZS8A 4YDSA 2X8AA 1OXUA 3U7HB 2VHJA 3BERA 3AV0B 1SULA 1OB5A 4A36A 4KBGA 2EVWX 2G0TA 1VMAA 3NBZC 2ZS8A 5FOTA 1X86B 3RAPR 3PXGA 4M9SA 1W0KD 5EE0A 2Q9BA 1W5TA 2C96A 3O47A 2CNWA 2VSOA 1SKYE 1EFUA 5CM9C 1E2LA 2FSHA 4A0RA 4PPQA 1IQPA 4X8MA 4S2EA 2FV8A 1SZPA 1E2NA 1VG8A 5F9HA 2BKUA 3LW8A 3WRYC 2IS4A 2HCJB 5KYKA 4DT1B 3C8UA 4LV5B 3C14C 4DLZA 1T5IA 4YMWA 2G1JA 4NZYA 4DLTA 1X8LA 1G3IA 2FSGA 3EARA 4NH0A 4RJLA 4PFSA 1OJLA 4F4CA 3I32A 821PA 3ASZA 1E2JA 5JEEA 5FBWB 3I5YA 1CRQA 1Q22A 1E69A 4BASA 1RFLA 2ZJ8A 4PAQA 4B3CA 2Q9AA 1VPLA 3WNDA 3KX2A 3BJIC 2HT6A 3VQTA 4AD8A 3WMEA 4MDFA 3EZ7A 2B21A 4URUR 1XPRA 1QHHB 3U7EB 2QPAA 3O8BA 1M7BA 2XITA 1E2QA 4WVFA 2YINC 2OLKA 4GOKA 4TMVA 1X1SA 3K9HA 3UG7A 1NNEA 2Z83A 3P32A 1P75A 4MGZR 2WTUA 1R5OA 3JZMA 5CITA 1NF3A 2GCNA 1GTVA 1OXSC 2BBOA 3GFOA 2PZGA 3CZPA 4Q19A 221PA 4P3YA 1W36C 2ZSBA 2L0XA 1PUIA 1PZNA 1Q57A 3JVUA 3PEWA 1NIPA 2EWWA 2CEAA 5KHOC 3QEOA 2ZYWX 1Q21A 1YZTA 3LFUA 1NN0A 3SI7A 1KI4A 4NHOA 5A0FA 4TYWA 3NDPA 4TZ6A 4JLJA 2G83A 4W5JA 1OH6A 1VECA 2SHKA 1S8FA 4AKEA 4NL4H 3AUYA 3Q5DA 4YXWD 1R8SA 2ZE5A 2AWOA 3AF3A 4LX0A 2I1VB 1CR2A 5F2EA 4BE7B 2AL7A 3TUZC 3NXSA 4E07A 3AP2A 3CR8A 5FPKA 3IKJA 4RFSA 4E22A 3LA6A 1Q1QA 1HT1E 4BEBA 3ZZUA 2J0VA 3AP3A 3UXMA 2RGNA 3AP1A 4JVMA 3SN6A 4DXAA 3AVOA 4B74A 2FG5A 3DZ8A 3THXB 4AG6A 2REOA 1WXQA 2OCBA 3ND9A 4OQNA 4PO8A 4R9UC 3TMKA 3AKDA 2GCPA 3I4LA 2IF0A 3MMPA 1G8FA 2ONKA 2IYLD 2BMJA 1ZM3A 5EP3A 2FFQA 4KVAA 4PC3A 3TVTA 3T06B 1XP8A 3I1FA 1I2MA 1NBME 3EIEA 4OQLA 4U5XA 4BLTA 1LVGA 1W48A 3BS4A 2CVFA 2O0HA 2QAJA 2ZI4A 4DSNA 1EFRA 4FMCF 3PITA 4AIIA 1N6LA 3P27A 3BC1A 5DLQC 1VYVA 1FP6A 1WB9A 1U2RA 2I3BA 4KV9A 1AZTA 2ZUCA 2CL6X 3A6PC 2P2LA 4LC0A 4NYJQ 4PQYA 4ZDKA 2BKEA 4C7OB 1G64A 1I4DD 4TL6A 2HF9A 1W44A 2W83A 3K0FB 4L8GA 1KI3A 2ZRLA 1KAOA 1SHZA 3RNLA 2C77A 1FX0A 2QE7A 2HLDD 1C4OA 3EPHA 4OHYA 2KE5A 2JJ1D 1ZD8A 2BOVA 1Z6AA 4XVQA 3QPVA 3THXA 2J41A 1G5RA 3FTQA 4ASUD 2W6ID 4Q5IA 2G1KA 4MQBA 1SGWA 1ZIOA 5FBRB 4LHXA 4CW7A 1E0AA 2C95A 4D0GA 3QXCA 1C1YA 4F7WA 2ZJZA 2CLCX 3PENA 2J0QA 3BWDD 1H8HD 2CJWB 1UBFA 5L3RA 3T1OA 4QXAA 2YOHA 2ECKA 5FR2A 2VBCA 3WHKA 1JXOA 1IY0A 1TQDA 2VHUA 3GLIE 1AJEA 3R8FA 4Q47A 4Q1EA 2IS1A 1G3RA 3PUWA 2IW3A 2BBSA 2OV2A 4OBEA 1KSFX 4QGHA 2JCSA 3ZVMA 2GZDA 3CF0A 5TB5A 4JT2A 3C5HA 4A8JB 2BM1A 4TL9A 4QM7A 1S3GA 5ANRB 3U4QB 4YXWA 1QDEA 2OHFA 2QAGC 3CRRA 4C7OA 2QUZA 1EFCA 3L0SA 4PC7A 1RRPA 1QZXA 4ZDWA 3TUIC 3LNCA 4M21A 4RZ3A 4LRWA 3TQCA 4D82A 1W36B 4Z8YA 4CT5A 1MRSA 3IDQA 2WMOB 5L3SB 3MJRA 2G77B 1SVLA 1JJVA 3DOEA 3SJAA 4JLAA 5CLQA 3K70C 1V43A 3D6TB 1SVOA 1E1QA 2FN4A 3H2YA 1MO5A 1TAGA 3U7GA 4C2UA 4DCNA 2GF0A 4Q03A 3MFYA 1MRNA 4M1YA 4L5BA 4ZDIA 4NBSA 3E2IA 3T61A 1UBCA 1VCIA 1P9WA 1TEVA 3NHAA 2XZLA 4XJXA 5BQ5A 2HCBA 2DBYA 4BLRA 4UQOA 1Z8FA 1ZMXA 2YNMA 2JLYA 3R9WA 1TTTA 3WMFA 4V0MA 2DWQA 2RHMA 3ZGXA 3CWQA 1IOZA 1CR1A 2BV3A 3TGPA 4KFTA 4H1UA 1P73A 1A1VA 4LBYA 1JAHA 2PEZA 1J70A 3DHWC 4BFTA 1KHTA 1QF9A 4A8JA 3U4QA 4JMPA 1F2TA 4M1KA 1A4RA 1W47A 2LKDA 3QF7A 3GLFE 1TL7C 3H86A 2G3YA 2QA5A 3REGA 4G5SA 2WJHA 1DE0A 2E9SA 4X8HA 1IN6A 5EP2A 1NG1A 3H0KA 4EDHA 2HLDA 1OIXA 2A5FA 4H9GA 1NY5A 5L3SA 4TLAA 5HKKA 2JJ1A 1WA5A 1N6OA 1F6BA 3NTUA 1G7RA 1DAEA 4Q9KA 5BWMA 2HDNB 3PVSA 4FCWA 2R6DA 3ZS9A 4LJ8A 3GP8A 1W4AA 3FFAA 1PVOA 1XZQA 4MRNA 2YJTD 4F4JA 1MABB 1TQ2A 2XTMA 3I3SR 2XTZA 2PCLA 2AXPA 3CO5A 4DUGD 5AWFC 3QXHA 1ZD9A 5JS8A 3X2SA 1KDPA 3I61A 3MWYW 2A9KA 4GNKA 1XTIA 2CHVA 4B6EA 4NPHA 4O0MA 2FEMA 1VHLA 2GK6A 3E5HA 2ORWA 1L4YA 5IDVA 1KY3A 5JWHA 3IO5A 3VHXA 4AK9A 4IVPA 4EPVA 2QM7A 3IILA 3VR4A 2F9MA 1E94E 1F2UA 1FP7A 4LC1A 2VO1A 1JR3E 3KQKA 3QVUA 4YDHB 2KSQA 1UEJA 2ZJBA 3RS4A 1VDZA 3T15A 1WQ1R 2CL7X 3K70D 5E95A 4XWOA 4G5OA 4A1FA 3N70A 5JCZA 2R6CA 2FPMA 1XJ0A 1GUAA 4V02A 3AVUA 2BMFA 1ZW6A 4YQFA 1ZCBA 2BEKA 3BXZA 4PR0A 3IUYA 1MV5A 1I2DA 5TXGA 3HWSA 4N3NA 2QU8A 4URYR 2ZSEA 1F60A 2VYFA 4HLUC 1CKEA 1CJTC 2NOAA 1P6XA 1DG1G 4RZUA 2PZEA 3Q9LA 3L82B 4U00A 1CR4A 5SZJA 4BLQA 2EFHB 1N6PA 3LW7A 4DEYA 2ZI5A 2ZITA 2UKDA 1JPNA 1UADA 2QAGB 4MGIR 1YR7A 3QUSA 4V0LA 4AURA 3A1TA 3BB3A 1VCNA 2O8FA 4UKDA 5UKDA 1XRJA 2YOGA 5AR1A 2OUKA 3TBKA 3UWOA 2A3RA 1HURA 2ZRHA 4IHQA 3W90A 5KSZA 3ZZTA 1GG2A 4MYHA 3PEUA 5C4GB 4DDTA 3LX5A 2C04A 3W9YA 4CEIB 2ZSDA 4BFSA 4MKFA 1EFTA 1O87A 4UXJA 3ECCA 2ASEA 2GILA 5FOSA 4XSHA 3RC8A 2HJGA 4B6FA 4AY2A 1XJCA 1OW3B 1GIAA 5GJWC 3CH4B 3RRZA 3H84A 3B1VA 3QIAA 3CNOA 2QZ4A 1XWIA 3PJRA 1P61B 2NPFA 3OEHA 1U0LA 2GCOB 1ESNA 3CPEA 3QEJA 2G9NA 3U61B 4B75A 1KMHB 2PMKA 1NBMD 5AJZA 1FQJA 1KK3A 5IT5A 2EYUA 3SFVA 3TQFA 1FMJA 2WKPA 3QY0A 3HJNA 4KYIB 2FSIA 621PA 3WNBA 4OHVA 1UPTA 2ZSFA 3FKSA 4KU4A 4M1WA 4NKRA 3AGPA 4M9QA 2OESA 3KUDA 1PJRA 4QHTA 3SJZA 3SQWA 4YMSA 1VG9B 3IIKA 1YE8A 5K8IA 1CTQA 3I8SA 2H5EA 1JQJC 2QAGA 1FMLA 3OF5A 4ZCLA 3KJHA 2KBEA 2JJ2D 1AS3A 2W0SA 4WZ6A 1P62B 4XOIA 4I1OA 2WHXA 3AF0A 4JL6A 4BLSA 2GJ9A 2W2XA 2OE2A 4BZXA 1QHGA 1XMVA 1HQCA 1WCV1 4NE2A 3SR0A 2OEPA 4CEIA 1DBSA 2GVZC 4FXPA 4HUTA 3TAHA 5FTKA 1NVXQ 3OHMA 1M74A 4PPFA 3MUFA 4ZCMA 1KJZA 2ZRAA 3BD9A 1R10A 2CBZA 4JLMA 4G0NA 3RRYA 3TW8B 4FCVA 4R2HA 4LJYA 3V4RA 1G1MA 4TT3A 3TKLA 3AVQA 1RRGA 3KB2A 3ADDA 2WOJA 3EXAA 2WPDD 4BFVA 3GLGB 1SQ5A 2CL0X 1GOTA 2OFXA 2J45A 4B3DA 4WAUA 2EQBA 4WZAE 3AUXA 3SYLA 2ZU6A 4TLEA 4ZO4A 2JGNA 3RWMB 3Q8XB 5DSZA 1AQUA 1G41A 4DVGA 1KMHA 1EFHA 3QKSB 1YZUA 4HZIA 2DWOA 3PUXA 4K46A 1HYQA 3N5CA 1ZJ6A 4TYQA 5DE3A 4IFBA 1RJ9B 4ITRC 3EZFA 5IHPA 2JAQA 3Q72A 4P4UA 3Q5EA 3WYGA 4Q9LA 1JI0A 1XD2A 2IXFA 5H70A 1RC8A 2PX0A 3VKGA 2BCJQ 2ZM5A 3SJBA 3I92A 2OG2A 2O5VA 1DAKA 4KI0A 1R8QA 3WRXC 4B43A 4A4DA 4XWKA 1OKKA 3WYAA 3AVYA 3TLXA 5CK5A 4PC6A 2ZYVX 4B3BA 1JEDA 4C2TA 5FTNA 2GKSA 3A1UA 3AKEA 4TL8A 1KY2A 2WJGA 3HDTA 1GKIA 2F3TA 4PPGA 1W7AA 1GITA 3DEFA 3I72A 3GJ5A 2GJ8A 1AQYA 3GLGA 3BH6A 2R6FA 3QPUA 1TNDA 3GJ4A 2VF8A 5CYPA 3WBKA 1W46A 3MWKA 1RE0A 4Q18A 4Q7JB 3QKSA 4M1OA 1HY3A 4Q4HB 1OE0A 5JJKA 2ZAOA 1Z6TA 4FW9A 3W8NA 3T5GA 2HT1A 1NLYA 5FOUA 2FX3A 1KZ7B 1E9EA 1RJ9A 2OCYC 1J2JA 1K5GA 421PA 4EFLA 3N2IA 4YLGA 4Q1FA 3GJ6A 3RRMA 2QTVB 3PQCA 3QOFA 1MR3F 1U8YA 4LUCA 2AK2A 4DJTA 3HR8A 1FTSA 2ODNA 1DAHA 4IW3B 5E7MA 3RC3A 2ZROA 2G6BA 1NKSA 4TLBA 3VX4A 3EIHA 1GSIA 1Z0JA 2HXYA 1J8YF 1EWQA 4WA7A 4JJZA 4G3XA 1JB1A 3CR7A 1SXJE 2ZQ5A 1ONBA 4LI0A 2F1RA 1NJFA 1N5KA 5EUQB 1OH8A 1OPXA 4HB0A 2QBYB 2GRJA 3PV0A 4HLUA 4JKIA 4LYFA 5BN4A 2D7DA 1FZQA 1G3QA 1XMIA 2IBMA 4RD2A 2GJAA 4UJ3A 2HYDA 4YC7A 1XEWX 4Y0AA 4EKDA 2WPDA 2W2TA 4DIDA 2P0EA 4L16A 4FN5A 1UM8A 3LQRA 3SNHA 4BWYA 5LD2C 2C03A 1UAAA 3GD7A 2VP6A 5G40A 3KQLA 2FF7A 4QHSA 3T1QA 4JLPA 5AJXA 3U3KA 4R71A 4HUQB 2V9PA 4I1VA 3U3MA 3IPXA 3UANA 4ZI2A 1QBKC 5B58C 3ASYA 2BCGY 4Q1AA 2RGGA 2XX3A 3B7GA 4EFNA 5ELXA 3L0IB 4MRPA 4B47A 2VHQA 2ZI6A 2QP4A 4A2PA 4GZLA 3D3QA 1DAIA 1JAIA 1Q1BA 3AKCA 2DFTA 2IYQA 3K0CC 4MKHA 4PSAA 4B35A 1C9KA 2RAPA 2CLDX 2W2VA 2RGXA 1AS2A 1XXHB 1GRRA 4POAA 4DDUA 5GJBA 2H17A 3W34A 2VPPA 4I1SA 3HYTA 3THYB 5TARA 2RKOA 4MRSA 3VR1A 4Q4LA 1G7SA 3HU1A 3RYTC 4PC2A 3GEIA 2RGBA 5FUWA 3WMGA 4RD3A 2NO1A 4M2LA 2ZYUX 1L8QA 2BVNA 3KQHA 1MO4A 2VL7A 1H65A 1Z83A 5FH9A 3VAAA 2AKYA 4BFZA 3U3RA 5FPTA 3CW2A 2R6AA 4GSYA 2QP9X 1ZM4A 4LJ6A 1D2NA 1W2GA 2HUPA 2OXRA 4P32A 4HUQA 3VNUA 1FFHA 4OJQA 2P6NA 1P7CA 4OQFA 4Q4AA 2FE4A 3WHLA 1TQ6A 5DHFA 4B3FX 1YR9A 4EPRA 2H92A 5GJCA 1Q1ZA 3T35A 5KTYA 2H57A 4GBMA 1L2TA 1EX7A 5FTMA 5FTLA 1RYFA 1XEWY 1IN4A 2NIPA 3TK1A 2IEZA 2RGDA 2FOLA 2GESA 4DCTA 1X8JA 5L3VA 3F5FA 5CJ2A 4MYUA 1ZM2A 2NO7A 3UPUA 3B9QA 1X6VA 4M0LA 1M1YE 3NH6A 4G1UC 2DFLA 4XVRA 1N6HA 4IFEA 3I62A 3ICEA 1D2MA 4F4IA 1UKEA 4I4LA 3DPUA 4PAMA 1G5TA 4V0NA 1XXHA 1M6NA 3SQXA 4C0LA 1T5LA 4QBFA 1VYUA 3NIBA 4IVRA 5DYIA 3THYA 3A1SA 1AM4D 2C5LA 4ZKEA 3C4JA 5LB2A 2F1JA 2KI5A 1XTSA 2H16A 3NG1A 2ZE8A 3EC1A 2WV9A 4JKYA 2ZS7A 3EC2A 4GDFA 1BYIA 1Z0IA 1BO6A 2D7CA 3L0OA 1DARA 5FR1A 5CB8A 4AKGA 2H1LA 2HXSA 2IA5A 3P4XA 4CVNA 3IQWA 2HF8A 1QHYA 1KSGA 4D25A 2IS6A 5KNDA 3VNVA 3B5JA 4B44A 2WAYA 3TUJC 3EPKA 4RFSB 4WOPA 1W2HA 2B8WA 2WMNB 2B92A 1Z0FA 3B78A 4MH0R 4OYHA 1NVVQ 3KKNA 4F92B 4M1SA 1DS6A 3CPJB 5EP1A 5JECA 3B1ZA 2J0UB 2VP4A 4MRRA 1SVKA 3PEVA 4N1AA 5DIFA 1M7GA 5EZ5A 1NJGA 1L7VC 2G0NA 3U2QA 1D9ZA 3NHBA 3OE7D 2ZJYA 4FWIB 3OEEA 3U3JA 4I81A 3AQ4A 5D3MA 4ABYA 4OQXA 5L3QA 4HLDA 3SHWA 4EPYA 4B2LA 5KSYA 3VMFA 1UKVY 1AKYA 1W5SA 2EFDB 2VP9A 2WWIA 1CLUA 2P65A 2FPLA 4DSUA 3DOFA 3GMTA 3I73A 1KIMA 2GAAA 3MAAC 2J7KA 2OAP1 3UK6A 4V03A 4M9XA 4TSFD 5FPYA 2WJJA 5DO9A 1WRBA 1ZM9A 4M22A 1VYTA 3SYNA 2ZI7A 2CHQA 3KZ1E 1YQTA 2ZE7A 4M53A 1NG9A 3CX8A 2O0JA 4GZMA 1VCOA 4PZZA 2Q9CA 1EXMA 4PZYA 2A5DA 2WOOA 5EXTA 1FX0B 1VCMA 3ND8A 2XSZD 3IBGA 1ZM7A 2YWEA 3N2EA 3ZQJA 4TMWA 1W0KA 3O8RA 4EUNA 4LPKA 2J0UA 3TE6A 4RD6A 4NYMR 4X8LA 3CB4A 4UNQA 1HEIA 3L0PA 3SZRA 1B0UA 3WYFA 1YZNA 3K09A 4ARZA 1S2MA 5DN6D 2IXGA 3U6KA 1IM2A 1Q3TA 1E79D 1XDBA 5JI3E 4JBWA 4LJ5A 5JRJA 3H1TA 4D80A 4OI1A 1J99A 4MGKR 1KO4A 3K9GA 4XVUA 1EWRA 4ZIRA 2GEVA 3T12A 1Z0KA 1KNXA 1XFAA 4HEJA 1E0SA 1LFDB 1NVWQ 3MSXA 1Y3AA 1NL3A 2IF2A 3G0HA 2C2HA 1YU9A 4YMVA 1NN5A 5IK2D 1G6HA 2J5XA 3FHCB 4L15A 5HZKA 3K0AB 2JLZA 4ZCIA 1ZUNB 3CH5A 1NLZA 3GFPA 3ZVLA 1YHNA 2J7PD 4LHVA 5G3ZA 1KO8A 3RS3A 1M8PA 1PV4A 4JLBA 4LY6A 3QKRA 1Z06A 4TMTA 3K0CA 1XJQA 5AJVB 3CNNA 5IRCD 3ONWA 1SXJD 2ZRMA 3FDIA 1HH4A 1S0UA 1A5TA 4FCTA 4P4SB 2R2AA 3F8TA 3VKWA 3GLHB 4AWXA 2IK8A 2WJVA 3FGNA 2GEDA 4GFDA 4CT4B 2DHRA 2ZYTX 4ESHA 4U7DA 2QY9A 3IHWA 3I5XA 5CB6A 5A4JA 4OK5A 2A5JA 1ZYUA 2IUUA 3AM1A 4IDPA 3OE7A 4LZZA 1D5CA 2ZPTX 2J46A 5DI9A 1XX6A 4N0DA 5GVSA 3THWB 1YR8A 5FOXA 5HE8A 5B2ZA 5JLJA 1Z6GA 4OKSA 1IAQA 3IHLA 2W6JD 1G9XA 1FNMA 1T4GA 5JWOA 1N6IA 3HU2A 4AI6A 2ZJAA 1GL6A 2DPXA 3Q7QA 1RYHA 4X8OA 5EZ6B 5FL7D 3SBDA 2ZUDA 3THOA 2IUSA 3OIWA 4XWAA 4Q1DA 1KKMA 4LOAA 1XEXB 1G3MA 1SKQA 5JFGA 4XSGA 3NBYC 1QVAA 3DKPA 3K0AA 3QXJA 1XF9A 4TSFA 3FWYA 2DB3A 2WWYA 2R44A 4TTQA 3O8CA 5BYJA 3B1XA 1DO2A 4PO1A 3A36A 1F2TB 4EAQA 2CXXA 3AVWA 2IYRA 3C15C 1GNRA 1CJKC 1OF1A 2FFBA 1BH2A 1XMSA 4P4SA 2ZRFA 1RIFA 3GLHA 4ACBA 1W0JD 1OIVA 5EJEA 4IDOA 3RLFA 4PXAA 4LV6A 3EPJA 2RHDA 1CXZA 2ZUBA 3A1WA 3W3AA 4GP7A 2CK3D 5EE5B 4RD0A 3BH0A 4MUAA 5C1BA 1G5PA 1NIJA 2Q3HA 1DAGA 5CIQA 1CP2A 2ZJOA 1OFTA 1VTKA 1WP9A 5DN6A 2BHRA 1KO1A 2JATA 5KOYA 3THWA 4YMUA 4UNRA 1XCPA 3QVVA 3CF6R 1CF4A 2JIZD 2WM9B 1LB1B 1GKUB 3B6EA 1XD8A 4XIGS 4FMBB 4IOLA 1GILA 1N5JA 3FPAA 2REXB 4P4TA 4DLVA 3KQNA 4LYJA 3T5DA 2QMUA 2XZPA 3DM9B 2AXNA 1F2UB 1P72A 2D2FA 2DWPA 1XEXA 2GF9A 4W9MC 4RY2A 3GJXC 3G5UA 2QP3A 4R2IA 1KDOA 2BWJA 4DDWA 2ATXA 1GRNA 1TF2A 4GPTA 2J7PA 3LQQA 1AIPA 4IEEA 1KZGB 3MG9A 2IYUA 1X8KA 5J4LA 1SVWA 1KK1A 1LNZA 2AFHE 3QKTA 3QKUA 2F7SA 4EQ6B 1JQLB 3I8XA 5KU1A 1D2EA 2ZRKA 3LLMA 1KSJA 1T3SA 1VKJA 2ZRJA 1ZNYA 1OFHA 3BB1A 3SBEA 3UKDA 5KDDA 4Q01A 4WIAA 3IGFA 4ILEA 1T91A 4CYMA 1R5BA 2GJKA 1E99A 1BMFD 2VSFA 4ASUA 2W6IA 1YVDA 4FMDB 1CRPA 3TAUA 3ZD6A 1E0KA 1KDTA 2XZOA 4JSTA 1D9XA 3OFND 4DHEA 2F55A 4DB2A 4ZV4A 4QG7A 4QFMA 1NN1A 3SS8A 3DMNA 1KKLA 1H8HA 4GP6A 4OQMA 2QMHA 4BUJA 2F6RA 1CEEA 2X1VA 3KUCA 2OSBA 2O8FB 1US8B 4NYJR 5E7JA 4D0LB 1W4CA 2W6JA 2PT5A 3EZ6A 5FL7A 3QBTA 2VHTA 5HCIA 4KYUA 1X3SA 1SVMA 4DWJA 4K8OA 4A6XA 1UF9A 4JIMA 3VTKA 4BLOA 5IF9A 3B85A 4HI0E 1A2KC 2X2EA 2OBMA 3EW9A 1KO5A 5F9FA 2NQ2C 3TRFA 1SKYB 4ZI3A 3H4MA 1E2MA 2OFWA 1E2PA 3X1XA 4E03A 4EQ6A 2XXAA 2NGRA 4WXPA 4Q1BA 1BKDR 1KJYA 1ZC4A 2EWVA 3EA5A 3LBHA 2PL3A 2C9CA 2ZRPA 3FVQA 4PANA 1P2SA 2ZJ2A 3ZQ6A 4JLOA 3WNCA 2PBRA 2REBA 3FOZA 1N2CE 3OIUA 5JI2E 1GVNB 3QE0A 4QC2A 2QGNA 2IEYA 3GPLA 1W49A 2F1HA 1GP2A 3VX3A 1GZSA 5HR5A 4NCIA 2XEXA 1FL9A 5JBQA 2QQ0A 1BS1A 2VSXA 3HYRA 4B2IA 1H8ED 4D4JA 2TMKA 1HA3A 4OJKA 1QHXA 1Z07A 3CIOA 3AVVA 1NMYA 2C8VA 2GXAA 721PA 3DZDA 2NO0A 3A58B 2WJYA 2NO6A 3L8YA 2ZTSA 4D4LA 2GZAA 1US8A 3LV8A 2DFKB 1LV7A 4LJ7A 2N42A 4IXNA 1TEXA 2FJUA 2R62A 1S9DA 2CDNA 1UDXA 1GM5A 4TL7A 3W6OA 4B76A 2V7QD 3U5ZB 1XPOA 1KI6B 5TDHA 1Z2CA 3K70B 1P2UA 1Z28A 2ZAMA 1KI8A 4ZPXA 2FFHA 3R8CA 3AH8A 1U8AA 4B32A 4MKIA 1HE8B 2OZEA 2V6JA 4A15A 3AEZA 4S35A 2P5TB 2O0KA 2V4ZA 4I1UA 4XD7D 1KAGA 2QRNA 4LBZA 4KSCA 5E4FA 2OAQ1 2H8KA 4D81A 5K8UA 4A9AA 4B48A 5J4VA 4JLDA 1GAJA 2CCKA 3SJCA 4FIDA 4HB2A 1ELOA 1TQ4A 1TU4A 4HAWA 1P9NA 4HLCA 1P2VA 2FZLA 4MKGA 4HZUA 1ZVQA 4OHXA 4PSKA 5C2JB 2AX4A 3LVQE 2B7CA 3QI2A 2XNSA 5EXSA 4DDVA 2HEIA 2VLIA 4LSGA 3A4LA 2H18A 1ZP6A 4FWTA 1KNQA 5KNCA 1SVSA 3OFNA 4DUGA 1E2EA 1XD2B 1XZPA 2FNAA 1W4RA 4KAXA 4RZ2A 1YRBA 2UZ3A 2RGEA 3DL0A 2PJZA 1KMQA 2ZI9A 5HZHA 3A8TA 4C30A 1RVDA 2FWRA 3PR1A 2AKAB 4QRHA 4JJKA 3AB3A 1HTWA 5JS7A 1Z0DA 1E96A 3ADKA 1W4BA 1Q12A 2XOKD 3V4FA 2D62A 2FGJA 1U94A 1TUEA 1KI6A 1LS6A 4D6PA 3CUEF 3GQBA 3P4YA 2O52A 4TQ9A 1YRAA 1UJ2A 2QENA 5J5CA 4QGAA 2JLVA 1FW6A 1QVRA 4Z1MD 3IO3A 4N0EA 2GJSA 3P26A 1Z3IX 4PTLA 2Y8EA 3NEJA 4ACAA 3C5CA 4B73A 1WBBA 1D6JA 2IYVA 2JDID 3TNFA 2IYYA 3EASA 2DY1A 4OL0A 1G8YA 4US0R 3TH5A 2WBLC 3DMDA 1DAFA 3LVRE 2GXUA 2V6IA 1WMSA 1U9IC 1U90A 4KFUA 1KI1A 1ZU5A 1OYWA 3KKOA 4JZKA 4PQFA 4IVQA 4CF7A 5JHGB 4TQAA 1E9BA 2AR7A 2X77A 3A37A 4HAVA 1TF7A 1G8HA 1U81A 3BAFA 3BK7A 4HB4A 3SC3A 3CRMA 4NYIQ 4HAYA 1NY6A 3ZZ0A 1OFIA 1IN7A 2VA8A 4PQRA 4TMXA 2IWHA 3LO5A 1XCGB 3SEAA 1I4LD 1E2KA 1TX4B 3GCGA 5FI0B 1BYUA 2ZEJA 2CCJA 3PEYA 1ZD1A 4QKQA 4QM6A 2OILA 2ODWA 5G41A 5KNBA 1CJUC 4IJMA 2IYSA 2QSZA 3VR3A 2ODBA 5EP4A 4CRWB 1E2FA 4B3XA 2ZXUA 1JECA 2ZVQX 4G01B 1FQKA 3CPHA 2ANBA 4HDOB 1UFQA 5DYGA 3BRWD 4FI3C 3LBIA 2GK7A 1S1CA 1KYIA 4WW0A 5EE3A 4LCBA 1ETUA 3ZD7A 3NBXX 1DPFA 5K8TA 5EE9A 5SZIA 1T6NA 2BEJA 2AN9A 2V8OA 5AUPB 1RW4A 1NBMA 4WBSA 2Z6VA 2ONJA 4HYYA 5FUVA 5JWRA 1E9SA 4ESVA 3FHTA 3GLIB 4BGDA 4L9WA 1OXVA 2Q3FA 3IIJA 1Z5ZA 5DISB 3AVTA 3FMPB 1KK0A 4GOXA 1ODFA 2PEYA 3FKQA 4EJSC 3HR7A 3LY5A 1F48A 4RKFA 1DELA 2RH5A 5CLLA 1F3OA 1P2TA 3AVPA 1DAMA 2JJ2A 3U6BA 1KI9A 1ANKA 2IWRA 1NKTA 2YWFA 1L4UA 3LBNA 1Q44A 2V3CC 5GADl 1CIPA 4A2WA 5K8LA 4KLZA 3UMFA 4C3ZA 4OK3A 3SFZA 4BRWA 4L9SA 3NKVA 4QJ5A 1E2GA 2H7VA 1NRJB 1XNJA 4V0ME 2ANCA 5EQTA 1UDWA 1E9FA 5TVKA 1WDTA 1J7KA 2Z4RA 2XJ4A 1K8RA 1CJVC 3KFXA 3ADCA 1MKYA 5DI3A 3TIFA 2OXCA 4Q1CA 1Q20A 5BW8A 4A0HA 4IDHA 2D3WA 3CX6A 1QHIA 2CNWD 1S3SA 2IUTA 1Z29A 3B8HA 1AN0A 2NO9A 2W0MA 1S4QA 4JVLA 3FMOB 4W7SA 2O8EB 1E3MA 1IHUA 3MWLA 4LGMA 4P31A 1MO6A 1OIWA 2FFAA 2MSCB 4F93B 3KQUA 5JSZA 4A82A 4M4SA 4OK6A 1G8PA 3VFDA 3GEEA 2CVHA 3RSLA 3GLIA 3AKYA 2HV8A 3KL4A 1JR3D 2RGNC 4GRAA 1Z22A 1WF3A 4Q4AB 4HATA 4RSGA 2VQSA 1JBKA 1PLKA 1S9HA 2WWXA 3HU3A 1Z08A 3W6PA 4JVNA 1XTJA 4M1TA 4Q02A 5E3HA 1E9CA 3GLFB 5FBQB 1CULC 1N6NA 5G53C 4D4KA 2B7BA 5KO2A 3R20A 3EPLA 3D31A 5SZKB 5LPNA 1G7CA 2CHGA 2GEUA 2AWNA 4HB3A 1NN3A 4IKEA 3NBFA 1FPMA 2LWIA 4MRVA 2BJVA 5G3YA 2E87A 2X19A 3UWKA 4MA4A 1GRQA 1ZRHA 3LXRA 1COWD 5GJVC 3M4YA 1ZNZA 4BRUA 2AHOA 3FMFA 2FZ4A 1E2IA 3TVDA 2O8EA 1VG1A 5B30A 1UEIA 3BFXA 1JALA 4LHYA 1XTQA 5FUXA 1UKZA 3KKMA 2CLSA 4QBGB 2QGZA 1A7JA 1GKYA 2ATVA 3PCRB 1O3YA 5DGXA 4DSOA 4PZLA 3AF1A 4GMDA 3R9IA 4KCGA 1Q1EA 2Z0MA 1N0VC 1TF5A 5LB4A 4U02A 1U98A 2UZIR 3DM5A 3W5JA 1E9RA 2UVQA 3VR6A 2BIFA 2ORVA 3KDSE 1R0ZA 1XPUA 1JJ7A 2GXQA 2YHSA 3GLFA 4MDEA 1VG0B 1ZIPA 3REFA 1N3BA 2F3RA 1IXZA 3WBJA 2O8CB 2JASA 4KO8A 2PT7A 5FTJA 3R7WB 2WKRA 1IONA 2K5UA 5D3MB 1JXMA 3K0EA 5L3QB 5AJYA 4IRUB 3KTAB 3BORA 2FA9A 4GT1A 121PA 4Q7LA 4MYCA 3K9NA 3ICQB 1UBGA 1KOFA 1IN5A 1U9IA 3OZXA 2ZANA 2FMXA 3ZIAD 3NC1C 1XB2A 1YZQA 5EUMA 5EXPA 3HPQA 2A78A 5FFMA 3MJHA 2G88A 1RKBA 3UIEA 4II7A 4EJSB 2XB2A 2XJ9A 4FMCB 3CBQA 3G82C 4DLUA 3BFVA 3KXLA 3CZQA 1XMJA 2YKGA 3SHFA 4EPTA 4ERNA 2P6UA 1ZCAA 3FYHA 1LY1A 2QPTA 1RRCA 2CMKA 3E1SA 1SVIA 1NSTA 4JL8A 2J1LA 1GFIA 2J87A 2IL1A 2AFIE 4AKIA 5TY0A 1T0HB 1A2BA 1EX6A 2EW1A 4Q00A 1GDDA 3EZ2A 1JR3A 4UNNA 4BPBA 1DO0A 3QPWA 3KJGA 4G5RA 4Z54A 1T0JB 4O25A 1FTNA 1DOAA 1EFRD 4M8NE 2QSYA 1M2OB 2Z43A 2RGAA 1ZBDA 2IX3A 2F43A 4C0AC 2ZR7A 2FEOA 2ZS9A 1G20E 2VP2A 2O8CA 4L4UA 5J47A 4ARZB 1R0YA 3R7WA 4G5GA 1R0WA 4PHFA 3IBYA 4PC1A 5LD2B 1OLOA 2J9RA 1SXJC 4UJ5A 3KTAA 4DKXA 4ON9A 4JLKA 3UMRA 1E6CA 2AK3A 2NZ8A 2VF7A 4OHWA 4KODA 2QE7D 3GJ7A 4ZIRB 2GA8A 1PLLA 2FSFA 2VP5A 3SDZA 5AUNB 4HAZA 4P0TA 3LAWA 1EK0A 2VP0A 4EJSA 3T34A 2OCAA 1FNNA 5CK4A 1COWA 4D26A 2CE2X 2AD1A 2V54A 1LF0A 4NCNA 3LXXA 5HTKA 4A8JC 3MWJA 4DLSA 2V1XA 3ZYCA 4HDQB 4C9BA 1NSFA 2E1RA 4JSYA 1YZKA 1IBRA 3NH9A 4MUBA 3LLUA 4Z51A 3TR0A 4WXRA 2XAUA 2ZI3A 2NTYC 3QKRB 4R7ZA 4C0HA 4C0KA 8OHMA 4QNMA 3WP0A 2V1UA 1XTKA 3RANA 2VHCA 3EIQA 4DT1A 2ZU0C 5CIWA 2C98A 5KUTA 4KHZA 4OHZA 5DHAA 1A82A 3X1ZA 5FBLB 3NWJA 2CCGA 3KXIA 2Q0HA 1IXRC 2GHIA 1N5LA 2QTHA 3EA0A 3Q85A 5JRZA 5LDDC 3AVXA 4UNPA 4TLDA 4BFXA 2F9LA 1ESMA 1QRAA 2MMGA 2QMEA 4BFWA 4C0QC 4US2R 3B60A 5DNYB 3QSYA 1ZAKA 4JL5A 4URZR 1II8B 5CDFA 2C9YA 4JYCA 4A92A 2YC2C 3RS0A 3FHOA 3BB4A 5HE9A 1DEKA 2YVUA 4DLRA 3ZIAA 1QHHA 3IEUA 2ZIAA 1N0UA 3EZ9A 4IDNA 4J0QA 1YKSA 4O3MA 1E1QD 3LX8A 2PLFA 4PAOA 4E5UA 2ORIA 2OBNA 3LH5A 4JYBA 3GLGE 3BGWA 2XNDD 4DRZA 1UBEA 3Q7PA 4JBXA 4NTZA 1YZLA 3PUZA 2IC5A 2LKCA 2RMKA 4TTRA 2PLRA 4UNSA 4DBLC 1XTRA 4O2RA 3CM0A 1AA9A 1LF5A 4FD2A 2P67A 2VIIA 3B9PA 2JLXA 2JA1A 3U7FB 2JEOA 2EFGA 1U8ZA 4RFVA 2ZR0A 1ZUIA 3QENA 2WSMA 3C7KA 5EXXA 3VU9B 4W5WA 1KSHA 1U0HC 4BFUA 4AC9A 4NDZA 1G18A 4DEXA 1AGRA 3CF2A 1NMXA 4LJAA 3FE2A 2HJVA 3BE4A 3Q3JB 2EYQA 3WXMA 1OB2A 3W8RA 1EESA 2QNRA 4ZDJA 5FBVB 1GNPA 2WIBA 1RZ3A 4JLNA 1N6RA 2P3SA 2ZE6A 1II8A 4M1MA 1Z0AA 1ZNWA 1W36D 4JBYA 4JS0A 2QEQA 4Z8XA 4DC9A 5D3QA 3L2OB 4CEJB 4AKHA 1KGDA 1VHTA 5HKKD 4D4MA 1ZC3A 1P60A 5TMPA 1PUJA 4DCVA 4QGFA 2WZQA 1KI2A 4NCJA 3LRPA 3RVBA 5GVRA 1R4AA 1N25A 2R9VA 5AJWA 4MITA 4BFYA 3GFTA 2MMCA 3KJIA 3NVAA 3NEYA 4QBIA 5BXQC 2GWHA 2XTNA 1NVVR 3RS2A 3L43A 3BH7A 1NP6A 2JLQA 5FI1B 3CRW1 4HAUA 1U99A 1ZINA 1SXJB 4HAXA 3OAAD 4QGGA 4F38A 4UXHA 3NC0C 2JLWA 4B2PA 3VU9A 2WWHA 3FMIA 2XSZA 1P9RA 4DB4A 2ZRBA 2IT1A 4AYXA 1QHSA 2QROA 2B6HA 4DSTA 1E98A 4QL3A
chains in the Genus database with same CATH superfamily
1FUUA 3C98A 4AX4A 5BW5A 1WE2A 1TYZA 2BBWA 3ONNA 3N3AC 1RRCA 3WMRA 3O9ZA 1AXGA 1Q74A 2AE1A 3D2LA 5JC1A 3LCRA 3TYXA 1Y9EA 3FPCA 2XVYA 3UOGA 4IQ4A 2YIDA 3K0FA 4LSZA 3WISA 5K01A 1WW8A 3ISJA 1QVZA 5IKPA 4LHSA 5C18A 2VYVD 1AZSC 1H6AA 3BGVA 2QPOA 2XGMA 4Q9JA 1GU1A 4CEJA 1Z63A 4Z9BA 5JAHA 4M8IA 4UNIA 5LP6B 4MKXA 2QK4A 1Z62A 1W96A 2A1UA 2OZVA 2QRQA 2PFKA 1RSZA 3IEVA 4RVCA 5JYEA 2Z6UA 1JB9A 4N7JA 3IVAA 1B15A 1BE6A 1QC5A 1N4DA 1XKLA 3PCTA 3OQIB 3F97A 4WDRA 2OXIA 5M29A 4BTVA 1YDMA 3OZGA 1RQRA 4W9NA 5LQJA 4YDQA 3BXXA 2DBRA 2CBGA 1NV9A 5DT9A 3OP4A 2JJ8A 1PS8A 4EM6A 4QGSA 1SXJA 1P3JA 1UXHA 4TN1A 1XTVA 2HK7A 4EYGA 1ZKMA 1SB9A 3MN1A 3X1YA 3RJZA 4XRGA 1V4VA 2WIAA 4QUHA 3U62A 1FP1D 3ESQA 1OXXK 3RYFA 2OT3B 4Q9HA 1E2HA 2OVFA 1G7TA 3P8ZA 4BX2A 1MX9A 2C99A 2JCXA 2KM1A 2DLCX 1AKMA 3MNFA 4IIEA 1P4SA 1QVWA 4PPNA 3KWJA 1M34E 3A2NA 2RH8A 1M10A 1AF4A 3HXTA 4PO9A 3TJZA 2B2XA 1TJYA 2QT1A 4I66A 4DA4A 3ABRB 3TDMA 5E7IA 3S5JA 2O48X 1FU8A 3GYBA 1IWBB 2J3LA 5KOHB 2B5VA 1B8PA 4B3JA 4BGEA 3WAJA 3FW1A 4GI7A 4Q7MB 5C46F 1ABFA 4WZBE 1NE2A 2HCTA 3LE8A 1MO3A 4C0BA 3P9IA 2N1MA 1XAGA 2H5JA 3TLMA 3PC7A 3ZY2A 4D2IA 5HZGA 3G2JA 3GLIA 3KEMA 1PWHA 1UBMS 4C0JA 1QYVA 3L9WA 4FJ0A 4CM8A 5CJPA 3IV9A 3LD9A 1E7QA 1ZN9A 3FPFA 4I8XA 4ZT3A 4WE3A 4R05A 4Q6WA 4FQ7A 3A3KA 3DDCA 4A0FA 5BMVB 2XGJA 1ITZA 2NV6A 1RCUA 2QN6A 4PM4A 3IBSA 5JVDA 1Q3HA 4AP5A 2QTBA 2PGJA 3NUQA 2JFVA 2Z4SA 1E0JA 3EWAA 4JVSB 2HIMA 1SG6A 4ZC8A 1FFDA 3EQ8A 5T4BA 3A4NA 1WBDA 4WCVA 3X1DA 1KAMA 1Q0ZA 2YN4A 3QX3A 4GLBA 1AKWA 1KR5A 4G0PA 2ZSKA 1VBMA 4WKOA 4Z7QB 1J9ZA 4Y1GA 1QMPA 3A1NA 1U8CB 3P9ZA 5AM1A 2PH1A 5F2OA 4G0VA 1T5HX 4HZUB 1D6SA 5A7FA 4CLOA 3OESA 3EX7C 4OHBA 1UFKA 4URVR 5FPHA 4TT3D 1DQZA 1G55A 1LPSA 4HXYA 3SEFA 2ZZMA 3B82A 1HORA 1R3UA 3QOYA 2VJBA 5KSPA 4BC0A 4BNDA 1UZLA 3H04A 3CIFA 4O2LA 5DYTA 5CM8B 1HL7A 3DJYA 4RIGA 6REQA 1V71A 4PSVA 3LUBA 1ORTA 1K97A 4FEEA 2GZHA 3KE8A 1AKUA 2GKGA 3KNZA 5IP5A 3WLEA 2QSJA 3VR5A 4JQYA 4Y3UA 7MHTA 4EX6A 4X1YB 3RU2A 1MH9A 2EP5A 2B0CA 2R3SA 4P80A 3H16A 2AF3C 2CE7A 4QUBA 3BGDA 5B3LA 4BQFA 1T4CA 3GQBB 2NXNA 4RYDA 3CRVA 4JU9A 3MRSA 3NT5A 1II9A 1Z73A 2YZ2A 4O4HB 3UK2A 1XRLA 4E51A 3PUYA 4EPXA 2Q1WA 1ORRA 1K5DA 1F38A 2EFCB 1EVIA 3OKAA 3P20A 1MOZA 2ZSJA 2YJ3A 4K6CA 3SF8A 2O8BB 5FIUA 1UOQA 3KQOA 1U2SA 2PGNA 2V7PA 4JT4A 5C32A 3H3JA 5ISMA 3WSWA 4RTSA 4G67A 4RFLA 3GPCA 4YJFA 2IU6A 4BJ3A 1LLUA 3DVSX 3ST7A 2XOEA 4B7XA 1EIWA 1V2GA 3IP5A 3CCBA 4X00A 4Q21A 1IL0A 3IIIA 3NHWA 1YBFA 3NC4A 4CU2A 4M38A 2O8NA 1ZLXA 1G6OA 2HF2A 5AK0A 1OTYA 3QNUA 4AYTA 2ATCA 1KY4A 2WTBA 4RLQA 2O19A 3KKLA 2YFKA 1KAEA 2EBUA 3DMPA 3EODA 3LUGA 3E1GA 4H7IA 3JVDA 3ETNA 2A2ZA 5HILA 3ZVNA 2H1WA 2DXIA 2R65A 1PL0A 3F46A 4D0NA 4L6AA 3AY6A 3I53A 4OA8A 4W6QA 3LDAA 4ZANA 2FQ1A 1GZUA 2PLAA 3BIFA 1J0XO 4S0XA 4Z6KA 2PU7A 1V7CA 5EJ5A 1CS0A 1YI1A 2YL2A 4B46A 5LQKA 1OYYA 3I2GA 1KJWA 4Y6LA 1JI3A 3FNIA 4Q4JB 5REQA 5TE9A 5JD4A 1GU0A 4LWQA 3NJRA 3V4VB 4NQRA 3ZW8A 4HQKA 4U6QA 2BM0A 3GIDA 4HXFB 1E7WA 1U3CA 2R66A 4BECA 2WIDA 1PQYA 1P74A 2OCGA 4NS4A 1J8MF 4QWWA 4BNHA 1K4MA 1E3WB 1U4NA 1CP3A 4OSOA 5E0OA 3HCPA 2ZCJA 1RD4A 5J59A 4D8WA 3IMEA 1G291 4LWOA 5AVRA 5KHLB 3IL2A 1JU9A 3P7MA 1NBEA 1PDWA 1CHNA 4O0LA 2P9TA 1OZAA 2O23A 4IUBS 2ZTUA 3VO9A 5BSTA 5FYDA 3CNEA 4BVAA 5I48A 2O2ZA 1FIUA 3DEYX 4PHGA 3LC1O 3AR8A 3G1TA 2BMWA 1Z2OX 1OFUX 2HWWA 3SEQA 1XELA 2X1MA 3QJGA 3KKQA 4KIJA 4RF5A 3OX1A 1V48A 1H8EA 1KZ4A 3STXA 3EFEA 2A5GA 1KU6A 2X76A 4IGKA 1FDSA 3KJEA 2AJBA 2D2IA 3MTBA 2WJIA 4A5SA 2ZT7A 3IQDB 2I6QA 3PRHA 4Q12A 4BXOA 3DL2A 4KWEA 1A5ZA 1SC1A 5AKJA 3ZVKA 3QPBA 3VDMA 5CPFA 3W5CA 1UBUS 3HVUA 1Y3IA 3GJZA 1RBQA 2YRWA 2OLJA 4JB8A 1TTHA 1YZFA 3UKOA 2VYND 1NI4A 3NBUA 4L07A 3RVRA 3WDMA 2ZRIA 4ALMA 4LE2A 1UZAA 2NXJA 3O75A 2SKCA 1TVCA 2V3WA 3A14A 3OIYA 4QREA 1Q2XA 5CRIA 5G0VA 2H9AA 4CMIB 1Z17A 2RCNA 3CXRA 4YO7A 2DUJA 4DV0B 4HNHA 2ZW9A 1IOLA 1E6KA 4X93A 1EFAA 4EUFA 3C3AA 3CKMA 4CM4A 4ZTZB 3MHTA 2XUHA 3LC7O 4OJTA 2YIJA 4XFDA 3QF4A 4GVXA 2HJRA 2VT3A 3BMCB 3QLTA 3SHVA 4XD7A 4WLFA 1SURA 1NW4A 3A6FA 1F51E 3BVPA 3LHKA 3R5XA 2CV0A 1Z4QA 4P0PB 1TVEA 3D6JA 3R7FA 3TEMA 3F74A 5AD1A 2HNAA 1PVVA 1UMBB 5DHTA 2BBTA 3JWIA 1IZZA 4QYIA 4TTPA 3A25A 1RTKA 5JSZB 3G8AA 3A1EA 4TRJA 2ZWPA 4YMLA 2X5JO 4W5HA 1AU9A 1TJNA 2MDTA 3ANXA 3RCBA 3IDSA 3OOJA 1KJJA 4G24A 3VU8A 4NCKA 13PKA 1XDWA 2XB6A 1IXSB 2XDAA 5JFTA 1G21E 1JX6A 2Q7OE 1AS0A 3I04A 4LK3A 2NVBA 3H4VA 4HVAA 3MC1A 1YBAA 2YV4A 1BCSA 3DLPX 3NKLA 1RCTE 1JHUA 1NDHA 3I76A 4MUFA 4KSBA 2CF5A 4YJ3B 4HLQB 5E2BA 4HEHA 3ZBTA 2Z8YA 3EVCA 4QUDA 3GGCA 4EARA 2D74A 4YQZA 1C9NA 4V0KA 4UXIA 5C4MA 4KR7A 3DCIA 4LPSA 3UGJA 1E32A 3VTZA 1HE1C 4N5MA 1R0XA 1R9JA 1RWWA 1U5BB 3OZEA 2OXFA 4ZREA 3AESA 3RWOA 3S2SA 4NXMB 2FPKA 2Q2WA 4O63O 2P35A 1QCYA 5D87A 1JPJA 2PX3A 2Q8NA 2BTOA 5C81A 5JO0A 1UWLA 2YBDA 1CRPA 1SCAA 2AD5A 4DC1A 3FYTA 5KI6A 4IDDA 1BNCA 3WYCA 4GOJA 4PCUA 1U7UA 4UBJA 1H85A 2REQA 1YBMA 3E4DA 4AF7A 2GVDC 2JBWA 2RHRA 3ELWA 3V8RA 2UUBB 1TUGA 3HHPA 2CGEA 1Z4LA 5KYGA 4AVYA 2X13A 3GZJA 1NUTA 2IHYA 4LXUA 5ELMA 2PBZA 4MVWA 3K8YA 1JAXA 3KPWA 3G23A 3WC4A 2VJNA 1PP4A 4YMTA 3MD0A 4X7BA 4C14A 4QBHA 3TEFA 2QGFA 2QYTA 1D2AA 3L7BA 4LJ9A 3TIIA 3R5KA 3QG1A 1BHO1 2HWUA 2ZWAA 1S01A 4E3ZA 4O2BB 1JFFB 2W4MA 4QT0A 5ITZA 1KQFA 4B2YA 1THMA 4XGNA 3F7TA 3KVNA 4NABA 2C2OA 3K09C 3VSEA 3U19A 2H1OA 4WKGA 3G2OA 3ZXXA 3D9QX 2D1SA 4EG6A 5JHHB 2AFHB 2JKYA 2J67A 3H5TA 2FP3A 1DWOA 1SC3A 5AVSA 1Y63A 3CRZA 3M1IA 2MWMA 3WJ7A 4TLCA 5KNDD 3AI1A 3SU8A 1PT6A 2O2GA 1E4YA 1EB8A 4XPZA 4B81A 5H9WA 2IELA 3ZXSA 2FE1A 3HVIA 2DMRA 2N1BA 1IVYA 3EXFB 3JASA 5B57C 4QG3A 2PJRA 3TRHA 2XUOA 1KARA 4PY2A 1KO7A 1SQ0A 2BJWA 3PVCA 4JHLA 4PXSA 1GTJ1 3IDZA 5AXCA 1J5XA 4YMIA 4R40A 4DA9A 3BRWA 2XI4A 1Z4PX 2R8RA 1P4RA 4DILA 2O3QA 3L5OA 3UG6A 1W2WB 3OEED 3FYDA 3PA8A 5TQVA 5LP1A 2TYSB 1LS1A 3JYQA 1MVLA 2NXCA 1I4TD 3KE9A 3O1LA 2GZ2A 3GN1A 1EGQA 4GLFA 1GZVA 4M1TA 1LSJA 3E7PA 4PVDA 4HGQA 5CDFE 1PNRA 3GEHA 1ONOA 2DLDA 5BSMA 1JHXA 4IKOA 4NYIR 4WJKB 3PHBE 3U13A 1YR6A 2B99A 5J5AA 1CUYA 4P58A 5A7HA 3ROPA 2BFCB 3IP8A 1QS0B 2WEKA 3CUTA 4KXFB 3C1UA 3MS7A 1NVGA 2G6TA 1HG0A 2QQEA 1C2YA 3FVRA 4RY0A 4X61A 2VWQA 3G88A 4TSRA 5DBIA 3ROZA 2I3DA 2Q5CA 4GYKA 4DIEA 5EIBD 1E4VA 4WNAA 1KDRA 3L8ZA 3U26A 4EDFA 3BTOA 2PS9A 1SUPA 2QRKA 4D3YA 1XMXA 1QIKA 1DFIA 2MYNA 4B4KA 1BOFA 2OG1A 3NDBB 2O06A 1OGYA 1HK7A 2HRCA 5CGQB 1V1RB 2F43B 2KBFA 4U2BA 1YULA 4YDSA 1T6ZA 4AJOA 4BO4A 3BGIA 4EJFA 3U7HB 3B6MA 1MJGA 1V7ZA 2FPPB 1IB6A 4HRAA 4MRMB 1X7WB 4TXJA 1WY7A 5FO0A 1JKIA 1KYVA 1NDQA 1UOOA 4JYZA 1JG6A 4Q82A 4OH1A 4C0XA 3A26A 5IJ0A 2EVWX 1TQHA 3TCKA 5AM4A 5K0GA 1VMAA 1NAHA 1NVDA 2FVYA 1PR3A 3FKJA 4K2HA 3NM5A 4P22A 4RV4A 1QK5A 4UFNA 4UZSA 1KZ6A 2AUTA 2BL4A 1IQUA 4NRDA 3WX0A 3OJ0A 4IJKA 4ZGGA 3BFPA 3BJRA 4R2XA 5T6MA 5G1OA 4MB0A 2G9QA 4DV2B 3AFHA 5BNFA 1UH5A 3RI3A 2VSOA 1SKYE 1EFUA 2PJDA 1Y5RA 4MWEA 4LISA 5ADHA 2BKXA 1WVMA 3IT0A 1ODCA 2FSHA 4PPQA 1QO0D 3VHQA 1IQPA 2D5AA 2VBFA 3OIDA 2E85A 3K9WA 3LCJA 3JAWB 4P81A 2FMHA 3ZWXA 3N8KA 2CUZA 1E2NA 5CHYA 2Q6VA 1CY4A 2EGUA 2Q99A 1VG8A 2XKBA 2JD1A 4Z1OA 5AVQA 2AZXA 1A69A 1OBFO 1R0SA 3LW8A 2CWDA 1NW8A 3Q7IA 4WNYA 3Q3CA 3U1TA 4DLZA 2GF2A 1T5IA 1RWKA 3R0QA 4DG9A 3NIWA 2G1JA 1O97C 4NZYA 4DLTA 1V8DA 4UMVA 3WTCA 4A7PA 5B55A 5JYCA 3CZAA 3H9BA 2ACKA 3VRHA 3WE7A 1G3IA 5TEWA 3D64A 4NH0A 1IK4A 4HNQA 2Z6AA 1OJLA 3UJCA 4G65A 3ASZA 5HFNA 4DA6A 1TGYA 3INRA 5FBWB 5GIOE 3DUFB 1IQRA 2LR0A 5DX1A 3I5YA 1T3TA 3AUUA 1CRQA 2W48A 2F1OA 4IJQA 1E69A 4OM7A 4BASA 1BEUB 2YNMC 4B3CA 1TAQA 2ZBRA 3SQNA 3KX2A 4MQLA 2JGKA 3X1KA 4IIHA 5A03A 4W1RA 2JVJA 5HS6A 3WMEA 3NALA 4GBJA 1Q7GA 4Z4EA 4R1PA 3VPHA 5JRDS 1Z38A 2O3JA 2QPAA 4LX8A 3ZGVA 1OGJA 1YTLA 4D41A 2XMPA 4WVFA 4L5IA 2D0DA 4FX5A 5C8DA 1VXRA 2VDWB 1X1SA 2CW5A 1IIRA 3K9HA 3UG7A 5C8YA 5JXHA 1QUEA 3AR7A 2Z83A 4MV0A 1P75A 5FEMA 1NNEA 1G98A 4IV8A 2IUEA 1NP7A 2HSWA 1GTVA 3LF2A 4YUXA 4MVXA 3GG2A 4N0PA 3HGQA 1DC6A 1E1CA 1VBKA 1XV5A 3V1LA 1P17A 3E9ZA 3R7SA 3CT4A 1HFEL 1K1EA 3TM4A 1NIPA 2EWWA 1HE4A 2D1TA 3GA5A 3TF5A 5WRFA 2ZYWX 4MW2A 3EH1A 2UZ1A 5JNVA 1YZTA 5KYUB 4PZCA 2VRCD 2CJYA 2GS9A 5B3JC 3LFUA 3ME5A 3Q0TA 5ERYA 5HRAA 4JI4B 3AR3A 3JWGA 5JXGA 4GMFA 1NQXA 3BQ9A 3OT1A 4L0CA 4IGAA 4HDNA 3NVDA 1QX4A 4W5JA 1VECA 2PLWA 2X9QA 1ECBA 1EM8B 1TRKA 1ZISA 2VNKA 3PQEA 4NL4H 2ENWA 1BE1A 2F17A 3AUYA 2AYYA 3C3MA 4FEGA 5T4EA 1ECJA 5C0OE 5EIWA 3LPMA 2D5BA 2I1VB 4L8YA 3ORRA 4LXHA 4KO3S 5JXJA 2JI7A 3BJMA 3P2EA 5AW1A 3WIDA 2DR2A 3QOWA 3K1AB 3SICE 3PQFA 1GRCA 4CMHA 4DFDA 5EHZA 2WHRA 1SQFA 1AXEA 3BMOA 3UXMA 4BEBA 5CW2A 5DRTA 1GYQA 1OLUB 1MQ9A 3I01A 3SHOA 4DWOA 4BVHA 2EBWA 3ED5A 2VRNA 1YB6A 3UAOA 1RWBA 4C7MA 3ZEAA 1U2DC 4R9UC 3S99A 1UKCA 3IAM6 1YJ8A 3I4LA 2IF0A 3LDFA 4K87A 1G66A 5MN6A 4ARCA 1VKZA 1O4WA 1QUFA 4FXOA 2ICAA 3S1LA 1ZM3A 1MEOA 5EP3A 2BONA 5GGYA 1IXYA 2VUUA 3S8MA 4DLLA 3TVTA 5HOQA 1ZMOA 4UM9D 5SYNA 2BE9A 3I1FA 4M0PA 4ENWA 1LVGA 4QPJC 3BS4A 4IZ6A 2O2YA 3TLEA 2FQXA 2QAJA 1U02A 1TA9A 1CV2A 2H29A 2PZBA 2Z2XA 2ZI4A 3ECSA 1RHRA 4DSNA 3UT5A 4CMGA 3P27A 4ZOEA 2FZWA 4GS5A 1VYVA 4YRMA 4EKIA 1WB9A 2I3BA 4IF6A 2ZUCA 1NQWA 1PBTA 2GUGA 1QQ5A 5JCJA 4DMUB 2QTLA 2P2LA 4LC0A 4XUEA 2WUWE 1H93A 1CUXA 5DNWA 4E1BA 2Q8QA 4OP2A 4RETA 1T9AA 4KUHA 4FZRA 3UTCA 4FQ8A 3ZIUA 5JCXA 2C7VA 2HF9A 4H59A 3DKIA 3K0FB 1RP1A 3VDQA 1KI3A 2RK6A 1R0CA 4FZVA 3SQDA 3O3MB 4NMWA 4DMGA 1TO6A 2C77A 1H5QA 2BI8A 2QE7A 4H4DA 1N2SA 3UJBA 1I6WA 3LQYA 2JJ1D 3PD0A 3HA3A 1IHDA 2A1UB 3HGTA 2CXUA 2JGJA 3LU1A 4JOCA 1ZMRA 4IH1A 4UPDA 1G5RA 4FFDA 4ASUD 3KPVA 4TVSA 5CFRA 4IRXA 2G1KA 2F3UA 4MQBA 3GGDA 2OD7A 1SGWA 4JJ6A 1YQ9A 3VHRA 3VJKA 3MJCA 1X7YA 3KHUA 5LR6A 4KR6A 1E0AA 2XPCA 2JW5A 2O2XA 3JPWA 4IYRA 4BBPA 2CJXA 1KZ9A 5CLHA 4ENTA 1EDZA 2J32A 2HWKA 3ASVA 3F98A 2PZJA 4H6PA 2XRFA 3I6YA 5AVYA 2IHUA 2EHJA 5L3RA 3T1OA 1N9GB 1XJ5A 3OSZA 3Q7EA 4IINA 4ZPJA 3WHKA 1U1CA 1JXOA 1IY0A 5JC8A 4OO3A 2OGUA 2HQOA 3R8FA 2VDNB 3ABZA 3PWTA 4Q47A 4R1NA 3RYFB 4F6LA 3FX2A 5T8KA 1RMTA 2IS1A 1G0OA 5IH3A 4ZOQI 3PUWA 5EVCA 1PNOA 2BBSA 2OV2A 3FLBA 3MJFA 3SF0A 5KAPA 2JCSA 2H1CA 4KHPB 1DINA 4MI6A 3C5HA 4A8JB 5JTTA 1M0WA 2V9ZA 5C80A 2VUIB 4C7OA 2QUZA 3L0SA 3ZE2B 5LXTB 4PEVA 4JX8A 4LJLA 4Q24A 3HNPA 4M21A 4F3TA 3R3UA 5HA5A 1NSYA 3GNQA 2PYDA 2PKRA 4Z2YA 3GRZA 4Z8YA 1KR2A 2W90A 2Z3ZA 4XZ3A 5DM1A 5EHGA 1P81A 5LKRA 3WRYA 3GBPA 4W8HA 1M3SA 2WMOB 1WD5A 2PIAA 1XCBA 5AI5A 5F5NA 5K09A 4IRMA 5E6UA 1BXRA 1AKTA 4JLAA 1D4ZA 1E1NA 5CLQA 5L7YA 1V43A 3D6TB 3WQRA 4IQGA 5J5VA 3KKKA 3OM8A 1I10A 2ECQA 2FN4A 4I8IA 4NX2A 3T4UA 2IQIA 2WWRA 2CLFB 4JCOA 5AIAA 1W8IA 4YCCA 1MRNA 4XUDA 2J5BA 1V45E 3Q9SA 4I19A 4L5BA 3LI2A 1MOPA 1V3TA 4IDGA 5JVDB 5TX7A 2J0EA 3PFHA 1TCUA 5DYWA 4EG4A 3T3NA 2I91A 4CF5A 1XROA 4W82A 4BLRA 1Z8FA 4P08A 3KR2A 2P9ZA 1LEHA 3VNAA 1Z5NA 2ORYA 4JWTA 5CBKA 2O9JA 1GNSA 3PKJA 3PYLA 3WMFA 1VL0A 1BJRE 4OFZA 4V0MA 3UUWA 2Z3WA 3HP4A 5HBRA 5KTPA 1B8NA 4BO0A 5IS2A 1ABEA 5GZ6A 1SKMA 2BR3A 1FMFA 4E70A 3MWDA 1PNTA 2Q2QA 1ZD4A 4IIJF 4MVJG 3TGPA 1O1YA 3GA7A 3KC2A 1WHSB 4BFTA 1GY8A 1KHTA 1QF9A 3IXLA 1T13A 1W5EA 3U4QA 4JMPA 1A4RA 4OJNA 2BR5A 4PG8A 1W47A 1SH7A 3NUZA 2V45A 3T38A 5K8CA 4BNDB 5BUQA 1TL7C 3H86A 4KZPA 4XX0A 4KREA 2G3YA 1WF6A 2CMGA 2DPMA 3PX3A 4G5SA 4K1LA 5DXFA 2O5EA 3E5RA 1SVUA 1GZ7A 2FZVA 3K0BA 3JZFA 1HMPA 5T67A 2HLDA 4MX8A 4H9GA 4WLUA 1ZD5A 3D6VA 3WSTA 4EHKA 3QELA 1M0SA 3Q8KA 3A9WA 1TI7A 5BWMA 1WSBA 1AZWA 2HDNB 4I7EA 1GJRA 4YAOA 5CTJA 4PN3A 3AY7A 3GP8A 1XN4A 2O14A 4LJ8A 3SIWA 4DJAA 1AUOA 3K15A 4NHEA 5DCWA 2YJTD 4F4JA 1TQ2A 4P5PA 2IY7A 5JJ5A 1QKJA 5I9TA 3SVLA 4DUGD 2WK1A 3QVOA 4AJHA 4UOZA 1ZD9A 5JS8A 3D1VA 3X2SA 2NADA 2PUEA 3MWYW 1DC8A 2A9KA 1V1MA 1BD4A 4NFYA 1RACA 4Y2HA 1AN9A 3WHPA 1L4YA 2WF8A 1KY3A 3SF8B 3T9FA 1ZHFA 3HFRA 4UMEA 3SFTA 3OC6A 3VR4A 4EPVA 2F9MA 2OFPA 2X9VA 1F2UA 3EQ9A 4ITUA 2YUIA 5DCUA 1UBHS 3WAKA 5KWEA 3PJDA 1H6BA 1WVGA 2ZSIA 2A8YA 1LJLA 5IAAA 1NKVA 2CL7X 3NTRA 2Q1SA 1ULAA 2I55A 5JPCA 4HRXA 3TRDA 2X4LA 1EE2A 3QX9A 1SPBS 4IIVA 4JXXA 1B8UA 1IK6A 2PRYA 3H18A 2VHZA 3DTVA 2FPMA 3WK8A 2DC1A 2FUCA 1GUAA 2VQFB 2C4VA 3HJBA 4V02A 4F4DA 3P2MA 1R16A 2G9UA 5AI0A 1J09A 1YUBA 3MCWA 4FHCA 2HIHA 1C7RA 2BMFA 2I03A 5T6BA 3MILA 3AVUA 1ZW6A 2JHGA 3QFHA 4JD5A 3QU5A 4FC7A 1MV5A 4OQQA 1I2DA 1TCAA 4F9GA 3L06A 3UUEA 1HFWA 1FUIA 4N3NA 2QU8A 3GF4A 4LNHA 2VYFA 3G5AA 4HLUC 1UZMA 1CJTC 4YJHA 2NOAA 5JZ9A 4NWIA 1LZKA 3ZV7A 5REQB 1A76A 4J7AA 1M6VA 2IPOA 1JLKA 3AJRA 4MEJA 4MHTA 1CQXA 3Q9LA 5SZJA 2AJDA 4DEYA 1N6PA 2HK9A 4QEKA 4ZD6A 2O7VA 1Z4OA 2PBLA 2ZITA 5IFKA 4RTRA 4I1YA 5B6IA 1JJBA 1T0BA 5EIXA 1S7CA 3TNLA 3ZNQA 4V0LA 3BB3A 1YDGA 5FWXB 2GCIA 3WZMA 2ATEA 5UKDA 2DX7A 1JIQA 3QVMA 4IHQA 3OICA 2P3QA 5FJIA 2BEWB 4YWHA 2PAAA 1CUFA 4F5DA 1GG2A 1PDVA 2I8AA 5C4GB 3DMYA 1UWCA 4DREA 4DDTA 1HC7A 3N8GA 5EYPA 3MGGA 1A9QA 2NU8A 4Q3AA 1SQSA 1KP9A 1NOIA 1RWQA 4JJ7A 3UJDA 4DMFA 4DQXA 5LJLA 2OHHA 1U3DA 3EUEA 4UXJA 2FN9A 4YP0A 3UFXA 3MOSA 4DV1B 1EUQA 2HJGA 4B6FA 4B31A 1XJCA 1HLPA 4AY2A 1GIAA 1T15A 1U31A 3D81A 3FCEA 3MJEA 4JFAA 4WCDA 5GJWC 5IBQA 4AM8A 4B6OA 3NV9A 2AI1A 3MUEA 2VXOA 3DBRB 4U8HA 3TQHA 2PUCA 1D09A 4D9BA 3M81A 2NPFA 1H5UA 3H2HA 1U0LA 2AFIA 4ZRMA 3KQQA 3ZWAA 5E8JA 2QY6A 3QEJA 2VG8A 2PMKA 3NHPA 1NBMD 1KK3A 2FY8A 5IT5A 2IZ1A 3SFVA 4HCJA 2PYIA 1FMJA 3MT7A 4KYIB 1MX1A 4BNYA 2HUNA 1JKMA 3D1JA 2COUA 4OHVA 4K8RB 3QHQA 1BW9B 2HM7A 2OESA 3A6EA 3O3NB 1QZZA 4G6ZA 1JDSA 4ID3A 4F3NA 1XRQA 2H2DA 3IIKA 1YHZA 4Y6PA 3TSCA 2J09A 1CTQA 2A0WA 4EUEA 3FGOA 4AT1A 1G20A 1JQJC 3OF5A 3V1KA 4KB5A 1BEZA 2W2QA 3Q2IA 2WYHA 2PX6A 1AS3A 2AOVA 2OO5A 4WZ6A 3R3VA 2WHXA 2XODA 4JL6A 3F8SA 2NNLD 3LMKA 3EOBI 4MMXB 4BLSA 4UTRA 2JG3A 3SIRA 2RHTA 3NWOA 2ABWA 2GM3A 1HYGA 3O3CA 2FW9A 5HDQA 3M1YA 2OEPA 1N5MA 4CEIA 1UPBA 2W11A 4QYIB 1E9VA 2N3ZA 3SKXA 4UFOA 4HG2A 4BVLA 1KJZA 3BD9A 1P9OA 1R10A 1RI3A 4GNRA 3RRYA 3QVTA 2OBFA 3TW8B 4F06A 5MGBA 1S8OA 4R2HA 4MWTA 4NESA 1QJ4A 4ALKA 1QAMA 3C6MA 3DXZA 4JXJA 1UP6A 4LTMA 1IULA 2WOJA 3V2HA 3WAGA 1XP5A 3C74A 1JWLA 1Y9ZA 2J45A 4WAUA 1M0EA 4BQOA 3LWDA 1NW7A 4TLEA 3JVEA 1KMHA 1EFHA 1YZUA 4JR2A 1WLSA 4K46A 2B98A 2ADOA 1VRWA 2CUTA 4OU4A 2AG6A 1QYDA 4R2MA 4EYSA 5AI4A 1RLMA 3DYVA 1SK8A 1RJ9B 4LSMA 4NU5A 3EZFA 4JP5A 1M8KA 3I4CA 5H82A 2AHRA 2LIVA 1EXNA 2A1TR 4KPFC 3ZE1B 4RFSA 3F3SA 3NETA 4WXHA 4BTEA 3PPYA 4C6HA 3KK0A 3RAFC 4HX2A 2IXFA 5DEOA 2GERA 1CJBA 1ULUA 4KL8S 2BFPA 3IQGX 4G26A 1TZCA 4EHNA 3PTLA 3R6DA 1RM0A 4POOA 3BHJA 4WFQA 3BXPA 4QBTA 3PDCA 4MR8A 2EL9A 1R8QA 3U17A 1FSZA 2WLTA 5AQEA 6AT1A 2GYWA 1ILEA 3DH0A 3C7TA 1T1SA 2D2XA 2QV7A 4CLRB 1OKKA 1JYEA 3WYAA 4XWKA 5CEFA 4J2HA 4PC6A 3PUJA 4B3BA 3ENZA 2YZKA 4OUDA 5AKZA 4A16A 2EFYA 1BKYA 4GYJA 1GKIA 2F3TA 4NV1A 2CHUA 2EKZA 1S6YA 4PPGA 1GITA 4PYRA 1OUMA 1MOQA 2XYVA 4Z9FA 4O1MA 5IUKC 2GJ8A 5JE8A 1AQYA 3GLGA 1FEZA 1L3BA 2WF5A 3GJ4A 4BVBA 3OFJA 1CC1S 4FUTA 2VF8A 5CYPA 1GPAA 3HKEA 5IM5A 1MB3A 3R5SA 3RFUA 5DT2A 1CFJA 4M1OA 1HY3A 4HQOA 1OE0A 2P5YA 2ZAOA 4FW9A 3K94A 2B2NA 4ZZ0A 5TC4A 4EHDA 3RG8A 1KTIA 2HT1A 1TDJA 1WSWA 1XZGA 3D8TA 2VS1A 4FHZA 4NJOA 3ZHVA 3VR4H 1IUPA 4K88A 4LZAA 1I7PA 1X7XB 3E61A 3N2IA 2WYVA 1AA6A 1EUDB 3A32A 3PE4A 1HTBA 4M55A 1A71A 5EIBC 2WZDA 3RH0A 3CH6A 3RRMA 3UMMA 3STVA 4G37A 2EZ9A 2RK3A 1MR3F 3QOFA 1U8YA 3ZJVA 4LUCA 1MGOA 4NJMA 3OEYA 1YZYA 3CEJA 3HR8A 3KG2A 2ODNA 4IW3B 4OHPA 3RC3A 1FTGA 1NKSA 1VSBA 3UK7A 4DV5B 4JUFA 1Z0JA 3L02A 3RTGA 2IVFA 4D9CA 2PA3A 2J9ZB 4JJZA 3RJ9A 4RIFA 1SU8A 3VNRA 1Z18A 4R2JA 1YMUA 4X44A 3AO0B 3A9UA 1ZOOA 5JS6A 3P9SA 3SZOA 1OPXA 4HB0A 3T41A 4EZBA 3C3DA 1RP7A 3G89A 4R9SA 5F1OA 9GPBA 4JKIA 3UO8B 2KYRA 1YB1A 1E4EA 4GM0A 1UJ4A 2QT9A 2PD3A 3U7IA 2IBMA 4RPIA 1NYRA 4YC7A 4Z9AA 4FYXA 3NIGB 3QRWA 5BV0A 4EKDA 4YRLA 2CNNA 2WPDA 4ECAA 3RQIA 5AW3A 2YS7A 4NARA 4L16A 3SNHA 3MTDA 1BWQA 1LU9A 1P5JA 1P3DA 4I3HA 3CY6A 2C03A 2VAPA 1UAAA 2I6TA 1QM5A 2Z1NA 5KOJA 1JJFA 1CERA 2XW6A 3UJ9A 1PX0A 3H5AA 4ZTUB 4ETMA 2GPTA 1L4HA 4GPD1 3KLMX 1DHTA 3GRPA 1NVMB 3K6JA 4WXEA 1CF9A 3FBGA 3GEPA 3MLBA 3E9MA 4OXYA 4QELA 1H22A 1GFZA 1TA4A 5CR9A 2E37A 4IHAA 4UM5A 2BFDA 2HJSA 1M34B 2RGGA 1NOJA 4J49A 5ELXA 4H0CA 4JYAB 4CKEA 3ELDA 4MRPA 3VAZA 4QTTB 4K40A 1IE3A 4WECA 2EGHA 4V3BA 1JAIA 3ACDA 1SUDA 1D0SA 3JRXA 3BMQB 5IH7A 4PSAA 1B0ZA 4DLBA 2RAPA 2G82A 1RYBA 4WX2B 5GJBA 1EUCA 2WWVD 4B6GA 2Q2NA 3B9BA 4KK4A 4LOIA 2G08A 2RKOA 5AOBA 5FKJA 5TARA 3ZK9A 3VR1A 2GBGA 4DA8A 1S3IA 3QX8A 2JAUA 4JT9A 3UHPA 3C0KA 3MBIA 4PC2A 4A6DA 3PDUA 3KUXA 3PI6A 4L5YA 4YY3B 2NO1A 2QMYA 3N39C 4GLOA 4C4AA 4J9VA 1NUPA 1L5SA 4RV9A 1YCHA 4C20A 1YFLA 4EG5A 1H65A 1S4MA 1Z83A 3M6UA 3PD1A 3VAAA 2XCRB 1N92A 2WFLA 1C50A 1JKJA 2ILTA 1U0FA 3CW2A 2R6AA 1V6SA 4GSYA 5B58T 4LJ6A 4RVHA 1FQWA 5ES3A 4FNGA 3W5AA 4HUQA 3F96A 4RSRA 5L4SA 2ZXEA 3LIIA 1UBSB 2H1SA 2P6NA 2FE4A 1ZBQA 1ZIDA 1H4VB 1WZUA 2I78A 3TLGA 5GOTA 4B3FX 2O5CA 3A31A 5GJCA 3SXUB 3T35A 5I7VA 5KTYA 3N58A 2HJ9A 1L2TA 2H2FA 1EX7A 2A67A 2DTXA 2Y1FA 1OAAA 1NXWA 2YYAA 3QOXA 3S40A 4DC0A 5FTLA 4UEKA 4HDAA 4KTTE 2VDLB 3L9XA 2R6ZA 3LT1A 2OKCA 5TF4A 4F0JA 4RDHA 1DAOA 5LKAA 2FOLA 3TMYA 1X8JA 3NATA 3E9NA 4M0KA 4MYUA 2GSWA 2NO7A 5CJ2A 5E9AA 1G8MA 1NTOA 3U3DA 4BV8A 5A4DA 4TWRA 4YCJA 1DKOA 1M1YE 5IJWA 3I62A 1N6HA 4P1ZA 1RYEA 1D2MA 1BGXT 2BTEA 3ROEA 3HXOA 3LO8A 3OT5A 4JGBA 1Z74A 2C4WA 2QG9A 4WLVA 3RTBA 1K3UB 3SNKA 1C2TA 3THYA 4JUCA 3UKDA 1Q7RA 2P90A 2C5LA 4Q9NA 1CJCA 3VZRA 5EGSA 2IY9A 2KI5A 1XTSA 1C30A 2H07A 1GKLA 2Q1XA 2QX7A 3HFGA 3OT1B 4YCBA 4D56A 1AHNA 5BWBA 2D7CA 3IJRA 1DARA 3L6CA 4ENQA 5CB8A 3N7AA 1GNLA 2IXDA 2QD1A 3FYUB 4PZEA 5KX5A 2Z4TA 1QIFA 1DHRA 3OE4A 3P4XA 2YIMA 3OLQA 4HNGA 3A2KA 2A1IA 1UAGA 2IS6A 4LDPA 1XQ6A 4B3HA 1E6LA 4OLJA 4U6NA 5ALPA 1D1PA 3E9RA 5KWIA 2XXBA 3EPKA 4HQ6A 4WOPA 4UVEA 2B8EA 2LRHA 2QM0A 2IE8A 2B92A 3WLPA 3B78A 4YJ2A 3EF3A 3BMOB 1ACJA 1NYLA 3NTOA 3ZGYA 4M1SA 4I50F 5C9ZA 1PZFA 3O84A 4K3VA 3VU3A 3BK2A 2ZIEA 2VP4A 1UC9A 1ECPA 1GPBA 3DP7A 5DIFA 5EZ5A 1M7GA 4GUAA 4GQBA 3TD2A 3UJ7A 4EX7A 4YRQA 3W5HA 3SVTA 2BZ1A 1PGNA 1J39A 1C7QA 2JAXA