1XF9A

Structure of nbd1 from murine cftr- f508s mutant
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
281
structure length
264
Chain Sequence
TGIIMENVTAFWEEGFGELLEKSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Side chain and backbone contributions of Phe508 to CFTR folding.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Cystic fibrosis transmembrane conductance regulator
total genus 91
structure length 264
sequence length 281
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xf9A00
2GA8A 2D2EA 3CR7A 5A0FA 5KHOC 3OHMA 2ANBA 3QENA 1OIWA 1RRFA 4Q7LA 1EWQA 4KSBA 4Q7KA 2A2ZA 1CS4C 4C2UA 1G6OA 1XXHE 1P61B 4EQ6B 3QF7A 1R5OA 4WBSA 3CF2A 3TAUA 2QQEA 2KE5A 3B6EA 4ABYA 5FTMA 4Z51A 1OYWA 3CKLA 1NMYA 3LAWA 3ZGXA 2O5VA 5KNDA 2RGAA 2O8CA 5AUOB 5FBWB 2ZS7A 2HCBA 2J7PA 3GJ3A 3KKQA 3BERA 3PUYA 4DSUA 1KMQA 1XX6A 4TL7A 4E07A 2Q9BA 1G3UA 5CIWA 5FL7A 1JQLB 5IHPA 4FD2A 4H9GA 4LHWA 2JGNA 3BIFA 3H0KA 3DO6A 1KI6B 1KMHA 2ZRPA 2PT7A 1OHHD 1JECA 1FOEB 1LF5A 2CLDX 3T35A 4US1R 5IDVA 5CK5A 4FCTA 3UG7A 5AUNB 4XJXA 1KGDA 1Q57A 4B33A 2FF7A 4PHTA 4MGKR 1TAGA 2VL7A 1P73A 4LHYA 1NG9A 2OAP1 1F2UA 1KK0A 1S4QA 1XJ0A 2AFIE 2FV8A 4OK3A 5AWFC 2ASEA 3RAPR 5EJEA 1KI9A 4URUR 3CM0A 2C2HA 1KI7A 3EA0A 2XTZA 1ANKA 1MH1A 4PTLA 1YR9A 4ARZA 1L4UA 1SKQA 1AIPA 3KQLA 1YKSA 1ZM7A 4C0AC 2D06A 5EP1A 4JVMA 3DMNA 3DKPA 4GOJA 4YQFA 5LBIA 1GKYA 1OIVA 1VKJA 1YJ5A 5TV2A 3BRWD 1E1RD 4AD8A 2ZIAA 4JBXA 2O8CB 3AUYA 3JZAA 3TNFA 1NL3A 5CB6A 3EPKA 2QUZA 1Q44A 4ZKEA 3HYTA 2ZETA 1F2TB 3IBYA 4QHSA 4ACBA 3A1VA 3VTKA 2HYDA 3TUIC 2CE2X 1PZNA 2ERYA 3RHFA 4QNMA 1MRNA 2FA9A 4DT1B 5JBQA 1RW4A 5KYKA 1E1QD 4ASUD 1OXTA 3QNUA 1I4TD 1US8A 3SS8A 1BIFA 3X2SA 4IOMA 1P2VA 4A6PA 4LPKA 5JSZA 3IEVA 2WSSA 2JJ1D 3CNOA 3EZFA 4Q1DA 2J46A 3QKRB 1R10A 4JL5A 3P4YA 2ZITA 4Q00A 5DO9A 4IVRA 4IOLA 1XTQA 2O8DB 1E2DA 3NIBA 4Q4JB 4DXAA 2FFAA 4TL8A 2WWYA 2GKSA 1ZCBA 2O8EB 2BWJA 3D8BA 2CCGA 2V55B 4IVPA 2WAXA 2P67A 4MDFA 2FE4A 1E94E 1Y63A 1LY1A 2IHBA 2XEXA 2QP9X 3P1JA 5K8UA 4V0MA 4UJ5A 4V0ME 2QQ0A 3EWAA 4L16A 4Q9LA 1COWD 1U0HC 1J90A 3W3ZB 4KITB 2HF8A 4HEJA 4A82A 4FWTA 1R0YA 1R6BX 4IEIA 4TMXA 1E0JA 1F2TA 1OFIA 3BK7A 2GBLC 1E2JA 3ECCA 1ODFA 2Q21A 4E09A 2CBZA 4NCHA 4EPXA 4FMDB 1TQDA 4DRZA 4Q4LA 1FMJA 4YMUA 3RRNA 2FEMA 4HAUA 5GJBA 2D7CA 4HI0E 4OK6A 4B44A 4BLTA 3V9PA 4JBYA 1E3MA 1US8B 4G01B 1ZD9A 2VSOA 1W1WA 3F5FA 2AHOA 1Z2CA 4TN1A 1CR2A 4LX0A 2PX3A 3VR6A 2IYRA 5L3RA 4OHXA 4EIWA 1RVDA 3FOZA 1N6NA 1QHHB 2G0NA 3PVSA 2QENA 3P4XA 5TMPA 1HE8B 2GEVA 2IA5A 1NLFA 1FP6A 2ZYUX 2Q0HA 3KL4A 2O8BA 1S1CA 5J40A 1KAOA 2VSFA 4PQFA 4Q1BA 3WMEA 3L0PA 5DIFA 1KO4A 2ZI5A 3T5DA 3TMKA 3PXGA 4Q4AA 3W6OA 2FSIA 2AKYA 3U7EB 1VPLA 3QUSA 4U02A 3CRQA 2BVNA 2CK3D 3GLFB 2YINC 3MFYA 4JLJA 4WA7A 3FTQA 2QEQA 3RS2A 3KTAB 2C78A 1PLJA 2ZSDA 4M1KA 4RZXA 3KQUA 1YVDA 3TUJC 3IO5A 4BFWA 4DDWA 5E7IA 2IYVA 2QTHA 2A5FA 5KSZA 1W4CA 2ZANA 2JLZA 2A78A 5BYJA 5HTKA 4CRWB 5F9FA 2QT0A 1OB2A 4UNPA 3EASA 3HWSA 2R8RA 1VIYA 4WAUA 2ZRFA 3QKUA 5L3SA 3K0FA 2WV9A 4FMCB 3A4MA 1KO5A 5KSYA 1JR6A 1C1YA 2EWWA 4RD0A 1LFDB 3WMFA 5H70A 3F8TA 4GOKA 4XVRA 2A5DA 5IRCD 1ZMXA 1N25A 3X1YA 3CPHA 2QAJA 4OJQA 3C7KA 2WSSD 2BMEA 4NU0A 5FPTA 2A3RA 1II9A 2C03A 3QIAA 2VEDA 1DTSA 4B3GA 2Z43A 1BS1A 4BFTA 1PLKA 1AKEA 4HSEA 2WIAA 1ESMA 1OXSC 3OEHA 2IK8A 5D3MB 2F3TA 3AVWA 3BE4A 3RABA 3SNHA 1E2LA 4C0KA 1M7HA 1U9IA 3SHWA 4K46A 4EAQA 2ERXA 4URYR 1NJFA 2NMVA 3QPUA 1G18A 3F0TA 4X8HA 5EE1A 2HF9A 3SYNA 4ITRC 1NLZA 3H1TA 3R9XA 3GJ4A 4BFXA 4W9MC 4D6PA 1N6LA 3CW2A 3DOEA 2QI9C 3JVUA 4NYIR 1GSIA 1N3BA 1VCMA 3WXMA 3I62A 1NIJA 4NCNA 1QHGA 2PL3A 2QA5A 5L3SB 3FKQA 4EKDA 3RWOA 2ZRGA 2UVQA 3NG1A 3UG6A 5HKKD 3LXXA 4XIGS 3SBDA 2X8AA 3ADDA 2ZYWX 3ZQJA 1PUJA 2REOA 3D3QA 4IDQA 1R0ZA 1RPZA 2BCJQ 4IDPA 3MD0A 3SFZA 1FTNA 2ZI7A 1OE0A 2ZRDA 2CHQA 3L8ZA 5BWMA 3I72A 1A82A 3SC3A 2DB3A 2FX3A 2IW3A 3H4MA 1MRSA 1RYHA 3AVPA 4AI6A 2GHIA 2OHFA 1W48A 4IOKA 5DNYB 3QSYA 3U4QB 3FB4A 5EZ6B 3QG1A 4JVSB 1T6NA 1UPTA 2H18A 1E0AA 2ZS8A 1X1SA 4A4DA 1G21E 4JVNA 1SVKA 2IYQA 2QY9A 1U9IC 1P62B 2E1RA 2DWQA 2DFTA 2A5JA 4HUTA 1VCOA 3T5GA 5FOSA 2O0JA 3CRW1 2KWIA 4NP6A 5FBVB 2R44A 4FN5A 4QGFA 1BYIA 2CHVA 3J81k 3FFBA 3ASYA 4BLRA 5J4HA 1D2EA 2ANCA 4LGMA 4MGZR 2YOHA 3BXZA 3RWMB 2MSDB 3MWJA 1E4YA 4D4MA 4V02A 4W5JA 1UBEA 1ZAKA 4N0DA 5FI1B 1W36D 4V0LA 1FUKA 1OH5A 3CH5A 2V54A 5F9HA 3NBYC 3W34A 2R6CA 5GJWC 3QKSB 4LDJA 1XXHB 4TZ6A 1L2TA 4XWOA 3LNCA 4JJKA 4EPRA 1ZVQA 4RCZA 2ORIA 4GDFA 2CHGA 1EFTA 3AP3A 5JWRA 3U4QA 4TQUS 1XTKA 3LXRA 4NPHA 4UNNA 3KQKA 2O8DA 1FL9A 1ONBA 1SQ5A 1YR8A 4KCGA 4YMWA 4M9XA 3KXLA 4HLUC 4Z8XA 1GWNA 3U6BA 4DDVA 5DN6A 3QXJA 4Q9HA 5C1BA 3OEHD 3PQCA 4MA4A 1U94A 2K5UA 1JI0A 2Q9AA 3EZ6A 1UKZA 4MDEA 1Z0FA 1WBBA 2GAOA 1M6NA 4ERNA 1J8YF 2AWOA 1ZUIA 4FMCF 3L2OB 5JZVA 2AN9A 1XMIA 1VIAA 2JDIA 4Q9JA 1ZJ6A 3P26A 3PEUA 1TQ2A 4Q19A 4XTCS 4YDHB 1XD9A 1NY5A 1DE0A 1GILA 1ZBDA 1BMFA 4OBEA 4OL0A 1Z2AA 4I1VA 1EESA 1NVXQ 2P6UA 1EK0A 4F91B 3QEJA 2ZYVX 1XXHA 4C0QC 5KPDA 3GLHE 4OHYA 1T8UA 1DAGA 3FHCB 4JYBA 3TLXA 2YJTD 4AC9A 2HLDA 3K09A 1IQPA 5FFMA 2IX3A 2VLIA 2VF8A 4ZDJA 4X8OA 4F92B 2KSQA 4F93B 4JLPA 5EXXA 1FFHA 2EFCB 3DDCA 5FTLA 2BM0A 3OIVA 2OE2A 1G7RA 3TJZA 1Z6AA 1H8EA 2G88A 4AKIA 1MT0A 1F48A 2ZSAA 2WSMA 3C5HA 3NXSA 3EIEA 1KI8A 4JLKA 2XZOA 1KSGA 4M53A 3K1JA 4A8JC 1S1MA 1GRNA 3RVBA 3GLFA 1Y3AA 3GLFE 5JHHB 4TYNA 4PHGA 5B58C 1NN5A 3NC1C 5J4YA 1CXZA 1Z63A 3QBTA 1TUIA 1YHNA 1NBME 4L8GA 2ZQ5A 3ADKA 2IXFA 3B60A 1CBUA 1TPZA 2G77B 4B2IA 2JATA 2CCKA 4MH0R 1NI3A 2EW1A 2QMUA 1VG9B 4Q4HA 4HB0A 3MG9A 4DCSA 1ZM3A 4P4TA 3ZS8A 2IUUA 3BH0A 2N1BA 1CEEA 1OJLA 3IIKA 5B64A 4CW7A 2QRZA 2PJRA 1S3SA 2J45A 3GEIA 5G41A 4HUQB 2CDNA 3VNVA 1CULC 2NPIA 4OI2A 4EPWA 1G16A 2FGJA 3EPHA 5AUPB 2YZ2A 3KDSE 3R8FA 4TYYA 221PA 2GCPA 1CR4A 2VP6A 3AKYA 2NO7A 1E6CA 1V43A 3KFXA 5B57C 3CF6R 1COWA 3ZS9A 1GRQA 5FH9A 3QE0A 2QP3A 2XZPA 1ETUA 4DSNA 1SVMA 2Q9CA 2EQBA 2B8WA 5FPYA 1HEIA 3VKWA 4ACAA 2IEZA 1P75A 4BFUA 1U8ZA 2KBFA 5EXPA 3EARA 2HDNB 3K70D 4Q02A 2R6DA 3WNDA 2I3BA 1SHZA 3QKTA 3VMFA 1UKVY 2P6RA 3EG5A 4H1VA 2LKDA 2LWIA 3PCRB 2MMGA 4M2LA 4PC2A 1YZGA 2HT1A 2NO9A 3FMIA 3TE6A 1F5NA 3QY0A 1GUAA 2WKPA 1VDZA 1G20E 3IPXA 5CYOA 4LJ8A 2GCOB 3H2YA 3A1UA 3IUYA 1E9DA 3TAHA 1UDWA 2XOKA 4KV9A 1C9KA 2MSEB 4TTRA 3TSWA 1G3MA 3PEWA 1G3IA 3B85A 4C0LA 1QHNA 2ECKA 5EUMA 2Q3FA 2ZUCA 3NHAA 1EFHA 4LV6A 2ZAOA 1I4LD 4XVUA 5L3QA 2QM7A 4RFVA 3ZVLA 2V1XA 5LB2A 3UMRA 4AKGA 4P33A 4TYPA 5GVRA 3BJIC 3REGA 4PSAA 5B2ZA 3T1VA 2P3SA 3IO3A 2E87A 1Q22A 3ZVRA 4G5GA 4BLPA 2WWXA 4KODA 3B9QA 3TH5A 2C04A 3A4NA 3HP1A 2X19A 3PENA 5EE5B 3U3OA 5BN3A 3N5CA 1HURA 2XAUA 5BN4A 1DG1G 1OIXA 3K0EA 1D9ZA 1WF3A 2QPAA 3GLGA 4PC7A 1E2GA 1AGPA 2I1QA 4HB3A 5KSPA 4V03A 2NOAA 1IJFA 4QBFA 2Z0MA 2PCJA 2WIBA 3DL0A 2BIFA 3X1ZA 2OCPA 2QE7A 1SKYE 2G6BA 2HEIA 3DHWC 3C14C 1AJEA 1XNJA 3K9GA 3MLEA 4DUGD 1G8FA 4WXRA 2W58A 5H8WA 1BO6A 1X8JA 2KB0A 3K0AA 4M1MA 4Q03A 4RCYA 3THOA 3RC8A 1XBTA 1JAHA 3QG5A 5EP3A 4DBLC 4OHVA 3O8CA 4MKHA 2YOGA 1D6JA 3OAAD 2NG1A 1CJKC 2WMOB 5FBLB 1Z47A 3KFVA 4A15A 2AK2A 1WB9A 3QXSA 4AK9A 3K9HA 3RRZA 5GJCA 5F3WB 1Q1BA 3WHKA 4JZKA 5BN5A 4CIDA 3KB2A 2PMDA 3RC3A 1VTKA 2J0SA 2ZJOA 3DZ8A 3KUDA 5F98A 2P0EA 3IILA 3VKHA 1XWIA 2X2EA 1KI4A 4LYAA 3GLGB 1W4RA 3U7FB 2J0UB 1IY1A 1C4OA 3GLIB 5EXTA 4O2RA 3BGWA 3OFND 3I73A 4CDGA 3HPRA 2J3EA 1Z5ZA 3PUVA 4MKIA 4TT3A 3I61A 1NN0A 2XNDA 3CRRA 2F9LA 2QSZA 1GP2A 3N2EA 3VX3A 1ZNWA 5DSZA 4FINA 1D8TA 4TQAA 3U60B 1FQKA 3ZJYA 4U7DA 3K0SA 1M7GA 3EIHA 4ESHA 2IS4A 1NBMD 5CJ2A 5A4JA 4I99A 3GJ0A 3O8DA 1EFUA 2AD5A 4B34A 4ZI3A 1AZSC 1XDBA 4TTPA 4A0FA 4GZMA 3H86A 3TRFA 2FSGA 4YDSA 1OXXK 1R5NA 4CF7A 3VKGA 4LHZA 3THYA 1KO7A 2ZVPX 4FIDA 1E2KA 4L5BA 1IBRA 1W36B 4YXWD 1DAKA 2DFKB 4YC7A 1SHKA 2GDJA 3D7MA 3SQXA 3AF3A 1N6RA 4MRPA 3QXCA 4LBZA 5H1YA 4ZCMA 2QGNA 3CIOA 1E32A 3AF4A 4NHOA 3MWYW 1MKYA 5ANRB 3RLFA 1AS3A 4YMVA 3ICQB 1G8YA 3BAFA 4Z1MA 4B73A 2HLDD 3EPJA 4QG7A 1XTIA 1ZC4A 2RGXA 4DCUA 2OFOA 2O0KA 3GCGA 4LUCA 3AGQA 3SE0A 1VYUA 1JXMA 2G83A 1T9HA 2V6JA 3U5ZB 2ZI3A 4ILEA 1KSHA 1PV4A 2FH5B 3DM9B 2O8FA 3HU2A 1N6OA 1KO8A 1E2QA 4LJ9A 3B1VA 2NGRA 2V8OA 3U7GA 2D74A 2ZR7A 2FOLA 2IS2A 4OQFA 1OXUA 1ZNYA 4QM6A 4CGZA 1F60A 2QRNA 3FHOA 1O3YA 4QM7A 4TLDA 1KYIA 2OESA 1U99A 3LV8A 3THYB 3X1DA 2W00A 4B2LA 1IXRC 3K0CC 3U3JA 3CX6A 3AVUA 4P32A 2J5XA 1RRGA 1GKIA 4QJ4A 3VR1A 1YQTA 3CNNA 1Z6XA 1P2SA 2IUTA 2WKQA 4NYJQ 4DSOA 5JFGA 4UQOA 4AG5A 4CEHB 1S8FA 3V4RA 4W5HA 2X1VA 2V3CC 4E22A 1OXVA 2IT1A 2J59A 3CR8A 1P60A 1ELOA 1KHTA 4TLCA 3D31A 1OH8A 1FMLA 1LNZA 4FCVA 2Z4RA 4ZI2A 4TTQA 4A6XA 1W0KA 4GRAA 3Q8XB 5JJKA 2GETA 2FZ4A 4RFSA 1EFRD 1EWRA 1G64A 1E0KA 3KKNA 2IL1A 2YC4C 1OH7A 1U0JA 3B1ZA 1V5WA 1WQ1R 3DZDA 4ESVA 2J41A 3U3RA 1E1RA 3B7GA 2I4IA 4JSYA 1JR3D 4JJZA 2O8FB 3I3SR 4ARZB 2A30A 2G1JA 3AP2A 1ZUNB 3OEED 2ONJA 3T61A 2EU8A 2F7SA 2OLJA 1JXOA 1YZTA 1SXJB 4TMWA 2AX4A 1BYUA 1XTSA 1NRJB 1N6PA 2XNDD 3I8SA 3PR1A 2ZJ5A 3Q5DA 4HZIA 4JMPA 4RY2A 3RYTC 2XXAB 3OIUA 2SHKA 3NBZC 4EPVA 5DGXA 4OHWA 1KK1A 1TQ4A 1TU4A 2ZROA 2ZVQX 3KXKA 3LY5A 2QP4A 2V1UA 1HUQA 4BFSA 5KDOA 2GJAA 4AG6A 4AIIA 5FTJA 3KZ1E 4A2QA 4B48A 1S3GA 1GNRA 1G6HA 2C96A 2OCYC 1U8AA 2WJHA 3VR4A 3NDPA 3FMOB 5C46F 3CH4B 5L3QB 3FDIA 2VP0A 4N0EA 1XF9A 3CWZA 1MO6A 4UNQA 2QZ4A 2ZU6A 4TLEA 4DLWA 5LB4A 1SGWA 3L0OA 1XPOA 1OH6A 3B1YA 3KJEA 1Q20A 3I8XA 2IXEA 2EFDB 1FNMA 3GJXC 4QGAA 2B7BA 4B76A 5TVKA 1XFAA 4JBWA 4JS0A 4KAXA 2H7VA 1N0VC 1PVOA 1XZPA 3RS5A 1KZ7B 2JLUA 4Q66C 1XCGB 2PT5A 1GVNB 2EYUA 3K0CA 1ZIPA 1HT2E 4CEIA 1S9DA 3IGFA 1VCIA 3I92A 5SZKB 4QGGA 4QJ3A 4IJMA 2ODBA 1SXJA 4RD2A 3T1OA 1NN1A 4PPFA 2ZI6A 2DFNA 5DN6D 5JLJA 3BH6A 3MGCA 1NVVQ 4M4SA 5KU1A 1RYFA 4QGHA 4V0NA 4QOSA 3UANA 1SKYB 1HQCA 3LA6A 3WMGA 1ZU4A 2VO1A 1G5TA 4PQYA 3TQFA 2UZ3A 2GEUA 1E9SA 3QI2A 4NYMR 4DSTA 2GILA 4RSGA 4NCKA 4EJSC 3EZ2A 3W8RA 1Z29A 2FJUA 4PPQA 2NO1A 5C4MA 1HTWA 3U44A 3RNLA 2RKOA 421PA 2IYLD 3PJRA 3IHLA 1TQ6A 4ZCLA 4DLSA 4XD7D 3EXAA 5DI3B 1X1RA 3B9PA 4K8OA 1U81A 2DHRA 4MRSA 2C99A 1XEWY 1FP7A 3ONWA 1CR1A 4CEIB 2F1IA 1XEXA 4QJ5A 3QXXA 4KU4A 1ZU5A 2VHUA 1E96A 2NO0A 2QAGA 3AKCA 3QEOA 1FTSA 4UXIA 3BS4A 3TK1A 1KY2A 1QVAA 3GLIE 3DEFA 3CZPA 1JJ7A 3IDQA 2RHDA 1G41A 2WKRA 3LWNA 3UWKA 5GJVC 2GZAA 4US0R 5JCZA 4RKFA 1XB2A 4BLSA 3PUZA 4ZPXA 1W0JA 1X8LA 3WBJA 4OI1A 2RHMA 2XX3A 1U98A 3CRVA 2OT3B 3R20A 1Z6TA 2ODNA 4KFSA 4IFBA 1EGAA 4P4UA 2ZM5A 4NCJA 4F38A 2PMKA 2WPDA 2BBSA 5KDDA 5C18A 1Z0DA 3AF0A 3A8TA 2J7PD 1EX6A 4NYJR 1G9XA 3MSXA 4FI3C 4HZUA 4RKEA 2CNWA 1A1VA 4G0NA 2GVZC 5TB5A 2NO6A 1N6HA 1UEIA 2ZRAA 5CDFA 2OO7A 3QOFA 4N3NA 5A5GA 5IT5A 3D6TB 1KMHB 1UFQA 3F3YA 2R65A 3E70C 5AJXA 4D4JA 3FMFA 3K70C 3RS7A 4V0OA 3NDBB 2BEKA 2XITA 5FOXA 3QXHA 2WOJA 4BEBA 6Q21A 2FWRA 3QJYA 2ZI9A 4LPSA 4R2IA 3W5IA 5CIQA 3ZZUA 1AZTA 2ZJ2A 1WP9A 2BBWA 4EFMA 4HB2A 4W5WA 5D3MA 3K70B 2QMHA 5JEEA 3P20A 1E2EA 3SJCA 4KO8A 5KO2A 4QBHA 4PO1A 1GITA 2R2AA 3GFOA 3UWOA 3KXIA 2FNAA 1N5LA 2E9SA 3MUFA 3Q3JB 4KFRA 1XPUA 2I1VB 4URXR 2GEDA 3QVUA 4TSFA 1KJYA 1Z8FA 2QROA 2YHSA 4QNRA 1XJQA 3E1SA 3I5YA 1MR3F 2ZRKA 4LCBA 4B3CA 2C9OA 3OF5A 4JKYA 3CBQA 3W8NA 1G3QA 1XCPA 4JSTA 3GLGE 4X8LA 1KI1A 1Z0JA 2FZLA 5TXGA 2ZE7A 4R7ZA 2ZRLA 3AH8A 5JS8A 3TUZC 2CL7X 3CUEF 1KK3A 4G1UC 3LVQE 4JLAA 4CVNA 3WNCA 3EC1A 1P7CA 2AWNA 5SZIA 5JEDA 2J0VA 1NP6A 1SXJC 4BLOA 4LBWA 1IJEA 2CXXA 1AKYA 2JJ1A 3QPWA 1A2KC 2H17A 1GG2A 2HT6A 2WM9B 3CF0A 3NTUA 1E9RA 5BXQC 4BASA 4RFSB 1BKDR 1P4SA 3T12A 3LRPA 1M8PA 4Q1FA 4HDQB 2BCGY 4PO8A 3GJ8A 4KJZA 4PQRA 4XTRA 5SZJA 3O8RA 1E69A 2XJ4A 2NTYC 2W6ID 1ZP6A 1E4VA 4QBGB 5DH9A 3AVTA 2ZRBA 3EWSA 4IDNA 4M21A 3IQWA 1FX0B 2GNOA 2FN4A 3PIRA 3NH6A 4KI0A 2MMCA 4RJLA 2JLYA 3TSZA 4M8NE 2O8EA 2FSFA 5LDDC 3WYAA 3FGNA 1G8HA 1DEKA 2VF7A 2ZUBA 1OLOA 3SJBA 4ZDIA 3GD7A 2QN6A 1GDDA 1P72A 3PG5A 1DARA 3HJNA 4OQXA 1JPNA 1TEXA 4NYMQ 2YOFA 4EFNA 2AXPA 3QPVA 4L9SA 2XJ9A 2A7QA 3IPYA 1E2NA 1DAIA 2DY1A 4R71A 3AV0B 3UPUA 1W47A 4D26A 1G17A 3BFXA 4LJ7A 2F3RA 4LJ5A 5EZ5A 1DAEA 2ZR9A 1DOAA 2ZR0A 1J2JA 3SR0A 1ZD1A 4R98A 1UJ2A 2OILA 4F7WA 4DLVA 4DB2A 4AKHA 2D4HA 1KDPA 3LBIA 3B1WA 2F43B 2QTVB 4LJ4A 1RIFA 2PJZA 2ODWA 3CONA 3GLHA 4I1OA 5FOVA 2TMKA 4OK5A 4DUGA 1XMVA 2ZRJA 4Q7MB 4URVR 1I2MA 2BJVA 3X1XA 1P9RA 3M4YA 1G3RA 3PUXA 4QBIA 1WDTA 2BC9A 1R8SA 4M1OA 2QNRA 1RRPA 2ZE5A 4PX9A 4QHYA 8OHMA 5HPYB 1W5TA 2GTPA 4MGYR 3AP1A 2IYUA 4LHVA 3Q7QA 3K9NA 4B75A 3EZ9A 2J7KA 3DMDA 2IS6A 1OV4A 2IC5A 5AK0A 4DCTA 3OFNA 2W6IA 4OJKA 4BQSA 1AQYA 5IF9A 1QF9A 4YONB 5IK2A 3TR5A 4GP7A 2KJQA 3UXMA 1JQJC 2D62A 3FWYA 2KBEA 4E5UA 5HCNA 4Q18A 1KZGB 4F4JA 1W49A 1IN8A 1ZNZA 3KTAA 4XVQA 2MSCB 3ZZ0A 5K8TA 1NBMA 2ATXA 1U8YA 3TVDA 1T5IA 521PA 1HA3A 1SVLA 1T5LA 5FBRB 1SVOA 3MMPA 1KNQA 3U44B 2JIZA 3KJIA 3BH7A 3MJHA 2ZE8A 2J9RA 2XTNA 1K6MA 2F43A 4XOIA 3MRSA 4EUNA 3GLHB 2UKDA 5DI9A 1IM2A 3GJ5A 1Q3HA 3DPUA 1H8ED 1XZQA 5CK4A 2ZJZA 2RH5A 3QVVA 1F6BA 1MO4A 2ATVA 3LQQA 4WVFA 2LKCA 1S0UA 4HAZA 1T8TA 3NBFA 4A2WA 2ZJAA 2REBA 4XD7A 2VSXA 4GPTA 4C0JA 2XB2A 1VECA 2ZS9A 4MUBA 2A5GA 2Z5FA 1M74A 4LJAA 2HYIC 1TADA 2QAGB 3NKVA 3SOPA 4B2PA 3LX8A 4EPTA 3WNBA 2VIIA 3L0IB 4HYYA 4NYIQ 4MKFA 4ZV4A 3LQRA 1P3JA 2W2XA 1R4AA 3C41J 2FU5C 3HR7A 5J4VA 4TZ0A 1W7AA 2QMOA 2W2TA 1AS0A 3HU1A 1ZM4A 3A1SA 5J47A 3THWB 3AVYA 1TX4B 1T91A 4S2EA 2JJ2D 5FOUA 3GFTA 5JRZA 3G5UA 3ZIAD 1IOZA 2ZUDA 4NH0A 4Q01A 1MV5A 1G291 1NMZA 1GM5A 2ZSFA 1HV8A 4GNKA 4MRNA 2GZDA 2W0SA 1G7CA 3NHBA 4YLGA 1WMSA 3E2IA 3LW7A 2O0HA 3BD9A 5C4GB 1RRCA 4KLZA 4MRRA 4RD3A 4BFVA 4HZUB 5DHFA 3RS0A 4GSYA 1E99A 4A0HA 1M2OB 1PUIA 1M34E 1XRJA 4DIDA 4DKXA 3KQNA 5FOWA 3GEHA 3R8CA 4ZKDA 4PC6A 3KKOA 4HUQA 4M9SA 1W44A 2G1KA 4B71A 5JHGB 1AN0A 4BFZA 5L8VA 4BZPA 3LFUA 1KNXA 2XGJA 4TQ9A 1E9BA 2P5SA 5B30A 3ICEA 3I1FA 3DM5A 2ZEJA 5DHAA 2JEOA 1Z3IX 3LBHA 4I4LA 5CM9C 1X8KA 1E9CA 4NONA 2L0XA 1CLUA 3IQXA 4TYQA 2VQSA 3PEVA 1E2MA 4XWKA 4P0TA 3THWA 3U7HB 5DE3A 4B6EA 1KAGA 4CZ2A 5K8LA 1HT1E 2PH1A 2ZU0C 5KOYA 5TDHA 2WTUA 4A36A 4A92A 1M7BA 2H57A 4IVQA 4PXAA 4KBGA 3DKVA 1BH2A 2HJGA 4Q47A 1ZNXA 2AK3A 1ZYUA 4FCWA 1WXQA 1N5KA 2C77A 5FTKA 1KKLA 4MYTA 4US2R 2FFQA 1MABB 1CU1A 1X6VA 4DCNA 2QTFA 3V4FA 4QRHA 4TYWA 2JLXA 1IN5A 2GWHA 2RGBA 1W4BA 3T15A 1G7SA 5FI0B 2IWHA 1G19A 2OBLA 4A2PA 2J87A 4AY2A 1ZM2A 4N1AA 3O8BA 5CB8A 1A5TA 4LV5B 5JI3E 1WCV1 3I32A 2QORA 1EFRA 4C2TA 1KI2A 4NMMA 1LB1B 2ZYTX 4WW0A 4OKSA 1SVIA 3GFPA 3FKSD 3QKSA 1KDRA 2XNSA 3ZZTA 4Y0AA 4JL8A 1OT3A 5KSOA 4L9WA 2OBNA 1OF1A 1RC8A 3S1AB 4GP6A 2YKGA 3OEEA 1JAIA 4KVGA 1D2NA 2ZRNA 3WY9A 3HDTA 1P2UA 4LBVA 2BMDA 1UBCA 4HLQB 3U3KA 2VP2A 3THXA 2RGGA 3FPAA 2F9MA 2OFXA 2OM2A 3Q7PA 1E79A 2JLQA 5EE9A 4DLTA 4F4CA 1MABA 3QQ5A 2JDID 4NE2A 1KI3A 4YMTA 1JEDA 1Q1ZA 2GBLA 3NWJA 4JL6A 4PZZA 3VR3A 3L0SA 1S96A 2ZSBA 4GT1A 2CEAA 4IFEA 1TU3A 2AFHE 3BFVA 3N2IA 4LZZA 4DHEA 1GNPA 1QDEA 4WXPA 1NLYA 4BRWA 3TQCA 5AUQA 2IYXA 4UKDA 3ADBA 1CRQA 4RD4A 4B3FX 2BHRA 3GMTA 1T0JB 2CJWA 5TY0A 1DBSA 2IS1A 1AGRA 1QVRA 3KKMA 2GJKA 4R9UC 3LLMA 1OKKD 4O0MA 4CT5A 3UMFA 4B74A 4DLXA 1E9AA 1W2HA 2Q3MA 3NEJA 2DBYA 3KX2A 4XSHA 4MGIR 2WVJA 4A1FA 5P21A 5JCPA 3PUWA 2NPFA 3GLIA 1OYYA 1P2TA 4M22A 2YWFA 4HLUA 2BBOA 1W36C 3ZDQA 2IYSA 1RJ9A 3VAAA 1YR6A 4MUAA 4S35A 2P6NA 5FL7D 4GMDA 1IY2A 1N2CE 3WYFA 2FGKA 2ONKA 3RRMA 2AL7A 1K8RA 1HY3A 4BUJA 4LJ6A 4JKIA 2GESA 4IKEA 2F55A 1XCMA 4BZXA 4CEJB 4LYFA 2ORWA 3GPLA 2B7CA 2PEZA 4M9QA 3ND8A 1JB1A 1G5PA 4RD1A 3ND9A 4RZUA 3ZYCA 4AURA 1E2HA 1EX7A 4HLDA 3UK6A 4TSFD 4IW3B 2RCNA 2PZFA 2OLKA 3CB4A 3WRYC 3AVXA 2IYTA 2C5LA 3AKEA 2CJWB 5J4KA 3KB1A 4LY6A 4DEXA 2D7DA 2GVDC 1IXZA 3SHFA 3AVQA 3SFVA 4ON9A 3EZ7A 4BEJA 2CNWD 4C0BA 1UKYA 2UZIR 1II0A 4IDOA 1X86B 5HCIA 2JAQA 4LJYA 3TSOA 1R0WA 2GK6A 1YZKA 1M1YE 3A1WA 2WJGA 1FNNA 2PLRA 3BBPA 3FKSA 2O8BB 1QBKC 4OHZA 721PA 3FHTA 2QT1A 2IYZA 1N6KA 1QZXA 1RJ9B 3G82C 3B13B 4QL3A 2OXCA 2QM8A 1NSTA 2VHTA 2QGZA 1QG4A 1XTJA 2ODEA 4LYJA 2R6FA 5E95A 1OPXA 5AJWA 2DWOA 4D25A 2GZHA 2HXSA 4CEJA 2QU8A 4G5OA 2B21A 4EQ6A 4L4UA 1ZRHA 2HJVA 3HPQA 4Z54A 1GL9B 2PZEA 4MYCA 4BFYA 1JJVA 2OBMA 4JLDA 5E7MA 4FMDF 1CKEA 4Z8YA 2GF9A 1DADA 1E2PA 4Q5IA 2GJ8A 1QG2A 3CO5A 2Z4SA 3W3AA 2NZ8A 1ZCAA 1Z0AA 1XJCA 2ZTSA 2VYFA 4PAOA 1TTTA 4LRWA 1J99A 2WWWA 4MYHA 1KIMA 1KJZA 2EFEB 1QRAA 2VPPA 3BFKA 3OESA 5H68A 2ZI4A 4P3YA 3UKDA 3LX5A 1KO1A 1IY0A 1H8HA 1P9WA 4LC1A 1J7KA 5JMTA 1DVRA 3PEYA 4PSVA 3C4JA 1E9FA 3LD9A 1CR0A 1DG3A 1OKKA 1Z28A 2RMKA 4FXPA 4UJ3A 1DS6A 1G4AE 2P65A 4DVGA 1KDOA 4DLZA 1PJRA 4G5SA 2J0QA 3ZQ6A 1T4GA 3RSOA 2BEJA 3VHXA 1JALA 1YE8A 5JI2E 4Q1CA 3EA5A 3M1IA 4TWZA 1CJUC 5JWOA 4C0SA 5FUVA 1HE1C 5CITA 3CRMA 3CZQA 3BB3A 5FBQB 1NIPA 1UDXA 2VP4A 1HQYE 2QE7D 5AR1A 4Q7JB 5SZHB 1P5ZB 5IK2D 1VG8A 3P27A 5BW8A 2DYKA 3B78A 4QFMA 4M1SA 4TLBA 5TARA 1UEJA 1E9EA 1T3LA 3OAAA 4KLNA 4YXWA 1ZW6A 4EFLA 3OZXA 5G3ZA 4PFSA 2H5EA 1OFHA 5DYIA 4K81B 5BQ5A 5CLQA 3IIMA 1R0XA 1N0UA 1G7TA 2BBTA 4I1UA 2VHQA 3AVOA 4QC2A 1W5SA 2ZRCA 3LVRE 3BORA 2JLSA 4PPNA 2HXYA 1TF5A 3GJ6A 2DR3A 5JSZB 4CYMA 3BWDD 3T1TA 2VP9A 3QKRA 2JJ2A 5G40A 1CJVC 1IXSB 1JR3A 1II8B 2WWIA 4GOXA 4P4SB 5AJZA 1HH4A 3S1AA 1E1QA 3Q9LA 4ASUA 2VP5A 3FFAA 4B6FA 5E4FA 4Q4JA 4WZBE 5FUWA 2AR7A 2CVFA 3L8YA 4TT3D 2P2LA 2J0UA 4TMVA 3THXB 3A6PC 4B3XA 1U90A 3CX7A 2RGEA 3KQHA 4KYIB 5E3HA 1WE2A 1UKEA 1H65A 4P31A 3FYHA 2B8TA 2FFHA 3TIFA 3R9WA 5ELXA 5KTYA 4RZ2A 1QHIA 2OV2A 4D0GA 1U2RA 3OE7A 4H1UA 3W9YA 3ZIAA 2WMNB 3CPEA 1TF7A 1NNEA 1R7RA 1QHYA 2FFBA 1CRPA 3PFIA 4NBSA 2HV8A 3GJ7A 1LS6A 2IBMA 3SYKA 3EC2A 1YRBA 3AB3A 5LPNA 3CPJB 4GI7A 2GJ9A 4C9BA 1CJTC 1VYVA 2C95A 3SBEA 5HZHA 4D4LA 1Q12A 2YVUA 4A9AA 5LD2B 4EJSA 1NSFA 4DJTA 5CDFE 2PBRA 2QMEA 4PC3A 1QHHA 3VU9A 1LW7A 2OEPA 1GNQA 3DVLA 3NBXX 5C2JB 4UXJA 4QXAA 2ZJ8A 1R2QA 3SN6A 4V0KA 1RKBA 1XEWX 5UKDA 4GZLA 2OG2A 2ZJYA 3NC0C 3Q5EA 5FPSA 4A8JA 4KHZA 2QL6A 4BRUA 5DYGA 2WJYA 2VH5R 2WZQA 4IXMA 2ZRMA 2NQ2C 3SZRA 4IHQA 3P32A 5EXSA 1S9HA 1TMKA 2Y8EA 1N0WA 4OQNA 3ZVMA 1HYQA 4URZR 5FUYA 1GZSA 3SU8A 1G1MA 3KKPA 1CP2A 1U0LA 1RZ3A 1ZIOA 1ZD8A 4NKRA 5FPKA 4C4PA 2XSZA 2G9NA 2GXUA 1NMXA 2YWGA 1SXJD 4LBYA 4BPBA 1NN3A 2BMFA 3VR5A 3UATA 1CJMA 1D9XA 1SZPA 2EYQA 4PZYA 1BMFD 1FUUA 4KBFA 4ZDWA 3U2QA 3B2EA 3W6PA 4EJSB 3AVVA 4CEHA 1XD2A 1UBFA 3PITA 5FR2A 4ZIRB 3K0FB 3RRYA 2Z83A 5EE0A 2BMJA 1L4YA 1AQUA 1XMSA 3LDAA 4MRVA 4C3ZA 1EXMA 1X3SA 3VNUA 3AEZA 3X1WA 3A36A 1FQJA 3SJAA 3B1XA 5EE3A 3K09C 3TW8B 4PPGA 1G8GA 3UIEA 2W0MA 1GOTA 4LOAA 4HATA 1Z6GA 1OB5A 4XH9B 2ZJBA 2QBYA 1P9NA 2IWRA 4B35A 4G3XA 5EUQB 4LC0A 1WRBA 2FSHA 2IF0A 3CNLA 3EPLA 2V9PA 1Q21A 3JVVA 4NCIA 5EQTA 4BECA 3MCAA 4IXNA 4JLOA 1GL6A 2V7QA 1EFCA 3B8HA 2VHCA 2ZRIA 4M9ZA 2XTMA 2FPLA 2DWPA 2JASA 3ETLA 1GIAA 1ESNA 4Q1EA 3U61B 1XD8A 1I2DA 1FZQA 2CE7A 4FWIB 3T34A 5AJVB 1D2MA 1XTRA 3TBKA 4II7A 3R9IA 4GFDA 2B92A 2RGCA 2WWHA 4Q4HB 4LYHA 2LCFA 3I4LA 3MAAC 1AK2A 3VQTA 1KSJA 4GBMA 5CLLA 1YU9A 3C15C 1Z6YA 1AA9A 1S2MA 3LBNA 2OZEA 1LS1A 5FUXA 2CMKA 3TVTA 4D80A 1UF9A 3A4LA 3M0EA 3NVAA 1SULA 3C5CA 3IHWA 4OI0A 4ZO4A 1GAJA 3A37A 4D4KA 4DWJA 4Q9KA 3WP0A 4PZLA 5GVSA 5AJYA 1ZUHA 4DLUA 1KKMA 3BB4A 4ZDKA 2H92A 3T1QA 5HKKA 2QBYB 3W90A 4AWXA 4DB4A 2WWGA 1E98A 4OQLA 2G3YA 1JR3E 2H8KA 4GMXA 1A2BA 1FX0A 2V6IA 2EVWX 4B43A 1RE0A 4PHHA 2WWFA 2CCJA 2DFLA 4BZQA 3HR8A 5HZKA 1KDTA 4PO9A 1SVWA 1W0JD 3M6AA 3WRXC 1I4DD 2RB4A 2IUSA 3TKLA 2ORVA 5EP2A 4AKEA 1W46A 3HYRA 2GCOA 2F1HA 1DO0A 5JS7A 4JT2A 2WBLC 2DCUA 4DEYA 4TMKA 3IEUA 1GRRA 5KNCA 2JLWA 3SI7A 1NF3A 3VFDA 3CX8A 4PANA 4DC9A 3I5XA 4OYHA 3ADCA 4A0GA 1JNYA 1PLLA 1T3HA 1AS2A 2C98A 3A1TA 3H84A 4HAWA 3WBKA 4D2IA 1G5RA 4R2HA 1DPFA 3ZH9B 2ZXUA 3C16C 1MOZA 4U00A 2IYWA 4RD6A 1OW3B 4X8MA 3KUCA 1N5IA 1J8MF 2WJIA 3MJRA 4C0HA 1T0HB 1LF0A 3N70A 2OCAA 4AYTA 4CT4B 4Z1MD 3AGPA 2VBCA 3REFA 3ZD7A 4HDOB 1VG1A 4AYXA 1II8A 4P4SA 1UADA 3OIWA 1IHUA 1CTQA 1VHLA 4HB4A 4D82A 3ASZA 3TW4A 1OHHA 1P6XA 2EFGA 2YC2C 3C8UA 3K8YA 3SJZA 3RDPA 2JLVA 1KOFA 1J70A 4HAYA 4JLVA 1Z22A 2EWVA 4DZZA 1LTQA 2O52A 4Y0VA 4PC1A 4EPYA 4J0QA 2JCSA 5L3VA 2JIZD 2GCNA 2QPTA 3IKJA 4Q9IA 3ZD6A 1MO5A 4UXHA 2F6RA 1A4RA 2VTKA 2FPMA 2CK3A 3RANA 4XSGA 4OI4A 1Z07A 4IDHA 4I81A 3B82A 4HAXA 4TL9A 1T3SA 1YZUA 2RAPA 3LLUA 3RS3A 3SYLA 121PA 2EFHB 3W5JA 4KVAA 2IEYA 1YRAA 2YWEA 4QKQA 3EW9A 4HDCA 4OQMA 1XPRA 1OSNA 1Z0IA 1VHTA 2FDCA 5FTNA 1RFLA 2R62A 2GXSA 2B6HA 4DIEA 2RGNA 2XZLA 2GRJA 2G0TA 3AKDA 1DAMA 4UNRA 2H1LA 2CVHA 1GTVA 1K5GA 1W2GA 2V4ZA 3R7WA 3W6NA 4A0RA 1OFUX 2NIPA 5CYPA 1CIPA 1SVSA 3SDZA 3VU9B 1VYTA 3NEYA 2F1RA 3TR0A 5DISB 3U6KA 1H8HD 4D0NA 1ZC3A 1IONA 4C30A 2RGDA 5D3QA 5CJPA 1NY6A 2X77A 4A8JB 5E7JA 5KPJA 4NDZA 2GXQA 2OAQ1 1ZM9A 2BM1A 4HLCA 4HAVA 3BOSA 2OCBA 5G53C 2GJSA 2WJJA 4KXFB 1EG7A 2BJWA 4MYUA 1LV7A 3G0HA 1KY3A 2ZSEA 3RS4A 1GKUB 2IHYA 3KJGA 1Q0UA 2P5TB 1NG1A 1YZQA 4WZAE 5EP4A 4KSCA 4JLMA 1DO2A 4W7SA 4ZCIA 1F3OA 2C9CA 1QHSA 2XB4A 3PV0A 2PCLA 5J5CA 1FPMA 1G8PA 1XU4A 2GF0A 4DCVA 3U3MA 2XOKD 2QG6A 3AUXA 1BOFA 1TNDA 4G5QA 4PR0A 1XD2B 2R6GA 3V00A 2WICA 4B47A 5JJIA 2YNMA 4URWR 4LK2A 4ZIRA 3AQ4A 4KFTA 3FMPB 2W2VA 4DLRA 1CF4A 2PZGA 2CL6X 2ZAMA 3NH9A 3Q85A 3VR2A 1B23P 1JPJA 2OXRA 5FPHA 4NL4H 2QSYA 3ZLJA 2BKEA 3LO5A 3QBVA 2OUKA 1NVWQ 3KJHA 3TGPA 3ZVNA 1B0UA 1KK2A 5FL3A 5M04A 4LI0A 1IAQA 1F2UB 1XMJA 3WHLA 5G3YA 3BC1A 4PSKA 2YV5A 5J4LA 2C9YA 2VHJA 3VHLB 2N46A 3EX7C 2KI5A 2RGNC 3IBGA 2Z6VA 2FMXA 3L43A 1K5DA 3IIJA 4C7OA 3B5JA 5FR1A 2ZPTX 4JLNA 4WIAA 2GXAA 1D5CA 2J1LA 5FOTA 2CLCX 1IN7A 621PA 2D2FA 5KUTA 1AM4D 4I1SA 2WJVA 1TL7C 2GAAA 1TEVA 2Q3HA 4M1YA 1DELA 1UM8A 2AXNA 5JRJA 1NKTA 4B3BA 4UNSA 4JVLA 2A5YB 3GEEA 1KJWA 1VG0B 1Z0KA 2VA8A 4JYCA 3GP8A 2PLFA 5HR5A 5KDLA 1Z83A 2WPDD 3QF4A 3SEAA 4BLQA 5JECA 4U5XA 1JEEA 2PEYA 2YWHA 3OE7D 4DT1A 2BOVA 1IN4A 4GL2A 3WYGA 2IYYA 3K53A 4FMBB 5HE8A 2HCJB 2N42A 4E03A 3OIYA 4D81A 4F4IA 4AYWA 2OSBA 1YZLA 4LV8B 3WP1B 4D0LB 1QHXA 4B32A 821PA 4G5RA 1NVUQ 3E5HA 4DDUA 3UMSA 4C7OB 4KFUA 1UAAA 1DAFA 2CL0X 2JLRA 3MWLA 4MITA 4BGDA 2ZRHA 2JJ8A 2XXAA 2OFWA 1E0SA 3FE2A 5JJLA 2BDTA 2HUPA 2AD1A 1E2IA 2IF2A 3FVQA 4O3MA 2IXGA 2BKUA 3A58B 1NJGA 3LH5A 5CM8B 3QF4B 2W6JD 3EIQA 4PAQA 3LW8A 3K0AB 1IN6A 2R9VA 4Q48A 5GADl 2FEOA 5F2EA 1GL7A 1XP8A 2QAGC 4PAMA 1N5JA 2QPOA 2REXB 4RVCA 4TLAA 4LHXA 4NZYA 2A9KA 1WBDA 2XSZD 1YZNA 4RZ3A 4WZ6A 4BE7B 1NKSA 5BYKA 1R5BA 5KNBA 1KTVA 2WOOA 4Q1AA 3T06B 4M1WA 1E2FA 4POAA 4M1TA 4TL6A 4L15A 1UBGA 1Z06A 4TMZA 3AF1A 1Q3TA 1Z08A 4PHFA 1R8QA 4M0LA 5K8IA 4EDHA 4YMSA 3VX4A 1G4UR 4DLYA 2PX0A 4DDTA 1MO3A 4IRUB 3EAQA 2CLSA 2W83A 4FW9A 4Q4AB 4IEEA 5LD2C 1Q1EA 3O47A 4LSGA 3GQBA 1DAHA 4B3DA 4JT4A 2FPKA 3DOFA 3BB1A 2AKAB 4JLBA 4QHTA 1L8QA 3SQWA 4NTZA 2VRWA 4TMTA 1YR7A 2H16A 2BV3A 4O25A 1OFTA 2YYZA 4JIMA 5HE9A 1N6IA 1W0KD 2ZE6A 2V7QD 3K9LA 1E79D 1JBKA 3RSLA 2W6JA 2C8VA 3AF2A 2D3WA 3AM1A 5DI3A 2DPXA 2NZJA 3JZMA 1SXJE 4MQBA 1A7JA 1NVVR 5JWHA 4LWZA 4XWAA 4BWYA 3R7WB 2Q6TA 2JA1A 3Q72A 4WOPA 3L82B 2WAYA 4Q21A 1XEXB 4IOJA 3CWQA 5DLQC 1ZINA 1KI6A 1L7VC 1Q1QA 4MKGA 1LVGA 1VMAA 2WHXA 1W4AA 1KSFX 2FG5A 2X2FA 2ZREA 2GK7A 4O2LA 1FW6A 1GFIA 1O87A 1TUEA 2F1JA 3CLVA 1XEFA 1TF2A 3HU3A 1VCNA 2R6AA 1WA5A 3MWKA 4KYUA
chains in the Genus database with same CATH superfamily
3BX1A 3TM5A 3CR7A 1UWVA 2ANBA 2VCEA 3QENA 1OIWA 1RRFA 4Q7LA 1ATZA 4G65A 2B78A 5GONF 4AT1A 2ZYSA 5CNJA 1G6OA 4EQ6B 4EZEA 1NVTA 2Y6VA 2JHPA 1ZJWA 1I7QB 1RABA 3B6EA 1GXSA 3KEOA 2RJ3A 2ZB7A 2QG9A 3IELA 4M76B 1N2BA 2PA3A 3CKLA 3WBFA 1MX1A 2H7CA 5HOQA 5IJZA 2PWPA 2Q3CA 3LAWA 5KNDA 2OM6A 2X1HA 2XWQA 4O1IA 4OGKA 1MA0A 2A14A 4I7EA 5AUOB 2ZS7A 2HCBA 2J7PA 3GJ3A 1Z4JA 2VKQA 2Q4EA 4WKOA 5LUAA 4ER6A 1G60A 3BERA 3KKQA 2G5TA 1G3UA 5CIWA 2X9VA 5FL7A 4J76A 2GM3A 1ZX1A 3K92A 2B5VA 3GVCA 4LHWA 5CHEA 1ZN7A 2FPWA 1KI6B 1KMHA 1WU7A 1D07A 3I9V1 3B7PA 3C3AA 3IJPA 2CLDX 1PV1A 1FOEB 2PS1A 1R0KA 3UMJA 5DBGA 5CK5A 4FCTA 2A33A 1P7WA 1Q57A 1S7GA 1Y37A 2IGBA 3WGJA 5BNZA 3HVKA 1KRHA 5IT4A 2FF7A 2W6MA 4J1NA 4MGKR 1TAGA 3CUSA 4E11A 3KPVA 4U5QA 5BSTA 3IOBA 3D4LA 1F2UA 5FQNA 1ST3A 2CLKB 5GM2A 1ZSNA 3KCNA 4G67A 3CV3A 5ALDA 1CY4A 1DOHA 2AFVA 2EGHA 2FEXA 1R0RE 4HP8A 1OGYA 2HRZA 1MH1A 2O3TA 3EBOA 1YR9A 4C4YA 3N76A 3O2QB 4RDCA 1SKQA 4YWJA 4C2BA 3KQLA 3DMTC 3R44A 5JSYA 3RC7A 2BTEA 1OBOA 4C0AC 3DMNA 1N5OX 3DKPA 1M66A 2HBQA 3T3DA 4YQFA 1GKYA 1OIVA 1O9HA 4Y2JA 3MBOA 1OXKB 3RRBA 5F7OA 2E5LB 1ZONA 2VATA 2ZIAA 1C1HA 2NU7A 4JBXA 4NLLA 4BV9A 4YT8A 1WW2A 1L1FA 1CUSA 1ZK3A 4S1VA 5CB6A 1MAUA 3DP9A 3KDPA 5ESRA 2A7XA 4UM5A 3SIRA 4ZKEA 4DYVA 2IOQA 4H7EA 1E1CA 4FONA 2QJOA 4FIZA 4ACBA 3P2IA 4RDIA 3VTKA 5ADUS 2HYDA 4FKBA 1MTZA 1OVGA 1CYEA 2WVAA 1ZL2A 3S29A 4K2AA 5KYKA 1BCSB 4B7CA 1FSPA 2H5JA 2FB9A 4EAAA 4C4XA 2CKDA 2P2YA 3QYPA 5TQ0B 5B7QA 2B7LA 4Q3DA 1P2VA 2I6XA 3DLAA 2QMYA 1N2JA 4OLHA 4QSHA 1NVBA 1U2EA 3CNOA 1DINA 1C1DA 2ORYA 1R10A 1WWKA 1KE1A 4QLOA 2X40A 2ZITA 4K1XA 4HPXB 4Q00A 5DO9A 1PL6A 3LXMA 4IOLA 2O8DB 2Q6OA 4GZ6A 3TCXB 4BWFB 4CIXA 4Q4JB 4C04A 5BRAA 2I6FA 2QL5A 3F9CA 4AB1A 3EMBA 1EDOA 4HNSA 3MS4A 2A58A 4N65A 5EJAA 2V55B 3T7SA 2WUWE 2PQMA 4HVLA 1GGNA 1Y63A 2Z1MA 4JCOA 2XEXA 2PLWA 4CU2A 2EERA 5B6PA 4JI0B 2J9XB 3LTEA 1WHSB 1S7CA 4RJ2A 4DV2B 2H00A 4S3MA 4F5DA 2HWYA 4JBGA 2DJ5A 4MVJE 3W3ZB 4HEJA 4A82A 2Q1SA 1TM2A 1KERA 1E1CB 2AI3A 1E0JA 3QVSA 3VNSA 1KAHA 2GBLC 4CODB 1WW8A 2MYPA 1NQTA 2C31A 3ZWOA 3IUSA 4W8HA 1PJZA 2YJGA 3R9KA 1YE5A 3D3JA 1XC7A 4EG4A 4QYMA 2Q1UA 4WCFB 1M0TA 1Z7WA 3LP5A 4NFHA 2JVIA 3V9PA 3U4CA 4AKSA 1KYVA 1P39A 2V96A 3HBAA 3IXLA 3SLGA 3T4EA 4V1CA 5FWYA 1R6UA 4XPZA 3R5FA 5AVTA 3FBTA 1A7AA 1RBMA 5I8ZA 1V7ZA 2FYTA 5GGYA 1KEWA 3OZ7A 4LX0A 4N5HX 4KP7A 3HP4A 2BRUA 2IYRA 5L3RA 4OHXA 4W1QA 1RVDA 2FE1A 1N6NA 1QHHB 2G0NA 3ILYA 1LI4A 2VT7A 3B6JA 4ZT3A 5CFPA 2GEVA 5BSRA 1Q92A 1Q7RA 1SBIA 4BL5A 2ZYUX 4MW9A 4NWIA 1L5OA 4P4NA 1EGVB 3IYLW 1S1CA 5J40A 1KAOA 2VSFA 1QP4A 3WMEA 3L0PA 5DIFA 2ZI5A 2BMAA 1OYOA 2ECPA 3T5DA 3VPBA 5D00A 4HV4A 2C84A 1NYQA 2EQ5A 2WM2A 4JP5A 2ZYHA 2NW6A 2QXYA 4P3XA 4QFDA 1QPGA 1SG9A 1XEAA 2FSIA 4RS4A 4OM8A 4W4TA 3VPCA 5BOSA 3E53A 3LDFA 4DJJA 2B0JA 1SZDA 3GRPA 3O95A 3OIFA 3I0ZA 3VR5D 4WA7A 2XKKA 3QSGA 1H5UA 2O7RA 2QEQA 3JAKB 1O94C 1PLJA 2NZYA 3DSRA 1WCWA 3PFHA 2IVZA 1YVDA 3I42A 3T1NA 4LE0A 3TUJC 3KQUA 4MR9A 5E7IA 4NZMA 4Y67A 2WZDA 1NUPA 2GFQA 5KSZA 1BE1A 2NTJA 2Q3BA 5L7YA 2OD2A 4YRZA 1NE2A 4YFVA 4DNOA 1FMCA 3RWBA 1FCJA 2Z98A 1N7IA 2V7BA 1LDGA 1F4PA 1RRMA 3SXPA 2V59A 4ID9A 1Z6QA 4ZHSA 1OB2A 3ANLA 2ZOSA 3K0KA 3NUZA 3HWSA 4UNPA 1BDJA 3EBPA 3PDCA 4HS4A 4WAUA 2AW5A 2ZRFA 4OF4A 4YLYA 2EOAA 3QKUA 2OYRA 4WNYA 3W1VA 5KSYA 6CHYA 2NSYA 2V6BA 3G0OA 1U8XX 5H70A 4PWYA 3DDSA 5H80A 1N77A 4GOKA 1JDZA 2A5DA 1ZMXA 3BDIA 2OCLA 2XUFA 3WLOA 2JBAB 1CJCA 4OJQA 2C5BA 2WSSD 4NU0A 2W9XA 3W5DA 2PT6A 1NRXA 2G08A 3KR2A 3OZFA 2QW0X 1II9A 4MLPA 4UDNA 4UEWA 2C5FA 5IABA 2YIMA 2VEDA 1SKAA 4CKBB 2Z43A 5IS2A 1BS1A 2C4VA 2PXXA 3RI3A 1VL1A 1PBTA 1PLKA 2GNAA 1WCYA 4HSEA 4EFDA 5EMLA 3OEHA 1WBJB 2V5VA 2AC2A 5J9FA 3EVBA 2Z8XA 3KSDO 1D3AA 2PYZA 3M6XA 2HCFA 3MGBA 1EQUA 1E2LA 3SNHA 3NWBA 5ALTA 4C0KA 4EAQA 2CWWA 4MR9B 1NJFA 2QTTA 1S89A 2AX3A 5E9JA 3EVNA 5AVXA 4F6RA 4UU0A 2W2KB 2BP7A 5GIOE 4C06A 1PCXA 3SSNA 1XO1A 4XDHA 3L7KA 1YMVA 3D02A 3LGXA 3RO7A 4E1VA 4YACA 5KMGB 2RAVA 1CZNA 3CW2A 5LBUA 3JVUA 2Q8PA 4NJOA 1NE7A 1NTOA 2Y93A 5H4HA 4XZ3A 4Z99A 3ZI4A 1BN6A 2HTFA 4PYJA 2QA5A 4FFBA 2H5IA 5TS2A 4EKDA 2ZRGA 3AFHA 3L4SO 4XI9A 3NG1A 3UG6A 3ZX4A 1XU9A 4AIRA 3RVKA 3ADDA 4AZ0A 3CLSC 3I39X 2REOA 3ZQJA 4KREA 1OTYA 3DXFA 2VQ6A 1RPZA 1RLMA 2BCJQ 1F6WA 2X13A 1J07A 5IJ9A 5K3FB 4P0QB 5C53B 1PGJA 4CKCA 4DDHA 1UINA 2FR8C 3FNHA 2VYVD 1B2LA 2JFZA 4AJLA 5KTNA 5BWMA 2NUPB 2JFFA 5G0WA 2W6NA 1B3RA 1LFAA 2FX3A 2Q0XA 1T5TA 1ODJA 2ES4A 2IPAB 3DWGA 2YHIB 4WWHA 2AE1A 1P8JA 3LSYA 4Q16A 3N8HA 5DNWA 2AJBA 3ITDA 1ZGJA 1D2HA 4N7BA 3KAKA 2VTEA 4G4IA 4MAFA 5E0KB 3FB4A 5DNYB 4CGYA 4B9AA 3EBLA 3OFSA 5KQGA 5AHXA 3ZWWA 8GPBA 5FOQA 4IL5A 1MMFB 1MNAA 1Z18A 2CJYA 1M2GA 1E0AA 2XYPA 2ZS8A 4CKWA 1I2CA 3PRHA 4R16A 3HWRA 2AQ8A 3E7XA 4JVNA 4ZZ1A 4LYYA 2C7GA 5EY5B 3UICA 2E1RA 2QYHA 2FQYA 2GOYA 2DWQA 3HP7A 4AJ4A 4HUTA 3N74A 3CRW1 5F21A 1G5HA 1UBRS 2R44A 3O4GA 4NCXA 5DHUA 1ECLA 2I76A 3F67A 2CHVA 2X0EA 3UKJA 3ZNOA 1EGQA 1CUEA 3AOEA 2ANCA 4LGMA 3JQDA 4RETA 3RWMB 1ZW1A 2HMVA 3ET4A 3NALA 4V02A 5BSGA 1NQVA 3DPIA 3I2JA 4EF6A 1YIOA 4W5JA 2ODPA 3JATA 4FR2A 2NACA 5E4YA 1W36D 3DV9A 1XU7A 2WHRA 4IKPA 3F49S 1FNDA 2Y76A 2V54A 3ASUA 3CTPA 3W34A 4LGYA 4Y0NA 4QDTA 3GA5A 3QKSB 4ALJA 1K4YA 1SHUX 4TZ6A 4RLFA 4HKTA 3LYLA 2N9UA 3LNCA 4RLSA 5JMOA 1P4RA 2E5FA 4EPRA 5HIIA 3AZQA 4RCZA 1EUCB 5F76A 1J8DA 2GZMA 5AKYA 2VDMB 2OB1A 3KFLA 5JWRA 2VJOA 3JD1A 4TQUS 3O4VA 3HKCB 4NPHA 2XDAA 4OJYA 5BNWA 3OY7A 3KQKA 2Z6AA 1ONBA 1V48A 1C5KA 4CMGA 3H5RA 2OK7A 3I04M 1LQTA 1A5AB 4RJIA 3NJ8A 4R3UC 1SPBS 2RBKA 3SIWA 3H7IA 4BQIA 5DN6A 3QXJA 4PLZA 1Y5MA 2JFVA 3ENVA 3PQCA 9LDTA 3ZQUA 4P92A 1XTUA 2AXQA 4MUNA 1NF2A 2IU6A 1BVRA 1A9RA 3IVRA 2OBFA 4FYYA 2YXLA 5ALXA 2GAOA 4WGGA 1BHO1 1ISSA 1M75A 1RQ7A 1M6NA 3E9DA 3NBKA 4ZT4A 4ZYVA 5EHIA 3RUFA 1WO8A 3L4EA 1SOUA 1J0XO 2OMEA 1VIAA 1B74A 2JDIA 4ZRNA 4U0KA 4YXFA 2IH4A 3GF4A 4IM7A 3IXQA 1TQ2A 3GLVA 4NEHB 4CKZA 1YO6A 4WBNA 4JGBA 2I9KA 1MOSA 5CVTA 3AG6A 4KH0A 3WTBA 4XGRA 3ZD9A 3D4IA 1EESA 1GPWB 3HUFA 2VPQA 3PU6A 1XZKA 1G0NA 4F91B 5HGXA 2JIDA 4LXQA 1GTSA 1ZEJA 1UANA 1QCDA 3DLIA 5CD9A 1SA0B 1L4FA 4B7ZA 4JYBA 5J2TA 3GAFA 4FT4A 3ZOKA 2YJTD 3A05A 2HLDA 3GDFA 2SNIE 4AC9A 4E0BA 4EB0A 5B55A 5I7OA 1NV8A 4KOAA 4X8OA 4F92B 3PYMA 1WSWA 4F93B 4B3IA 1AQIA 2EFCB 3K31A 4QOGA 5AXBA 5FTLA 5WRFA 4HX5A 1JN0A 3TJZA 3IEPA 5HZGA 3V8QA 5TT0A 2G80A 2LDBA 2G88A 3G02A 4Z9XA 4AKIA 3F9RA 4ARBA 1BE0A 1JU3A 2ZSAA 3FSRA 3HA2A 3HLTA 3U4HA 4R6XA 1K97A 4QPZA 3UUWA 5BMOA 3H1GA 3JZFA 3MIZA 2VDNB 2OQVA 2PPLA 4MQMA 4YRJA 1ZGBA 2FQXA 3RVBA 1D2AA 2B6NA 1RD4A 1Y3AA 4MUMA 1N34B 1PTJC 1D6NA 3KPWA 1F9AA 2ZJ6A 3FR7A 5B58C 1JB9A 1IG0A 5DK6A 5E3JA 1H3EA 1VC2A 4C6HA 2ZBRA 1V1MB 1B14A 3L4BA 2GUWA 4X92A 5EKXA 4IJKA 4CFZA 5J4YA 5HS6A 3JQ8A 3FLEA 4PLYA 1PFWA 3U61B 2V0GA 4JBIA 5AKXA 1PGNA 3OJEA 3ADKA 2Y0DA 2IXFA 1A95A 1DQRA 3FYTA 1BW9A 3NKLA 4K1LA 4K3VA 4NJEB 4U8GA 2FPSA 2GM9A 4RIHA 3UAGA 1NJ8A 3HSSA 1FFXB 1UIRA 1GSAA 4L8VA 4BOYA 1BRTA 3QX8A 3DVSX 1ZQ1A 2J6HA 4ZQBA 2VSNA 2QMUA 4GPIB 1FP4B 2C83A 4F0JA 4HB0A 3HJBA 3FI9A 4QPJC 5C7OO 4EYSA 3ZWNA 4P4TA 3ZS8A 1VKNA 4C7MA 1I94B 1CEEA 3EH1A 4EHNA 3WK8A 2J6CA 5B36A 5D01A 4UQLA 1QE0A 1S3SA 1TDJA 1K63A 1J2YA 2CDNA 4HUQB 3NORA 1CULC 2C4HA 2NPIA 7REQA 1JU4A 5J2UA 1R00A 1HKUA 5AUPB 1ZN2A 1SVNA 2VDUE 2YZ2A 3HHPA 221PA 2GCPA 4XYEA 5JNLA 3B1KA 2B69A 3JPWA 2VP6A 3O4HA 3SC2B 4F5ZA 1TJNA 5JJCA 2BGRA 5GZ6A 1UR5A 1PQWA 2NU6A 3OKAA 3V97A 2CXUA 4D56A 1I3MA 3UFXB 2R5NA 3IAM1 2QTRA 3L5OA 4AJ9A 1P75A 4EHJA 4BFUA 1U3VA 5JH7A 5K0GA 1C7IA 1H2AS 3FTCA 1V1MA 2AEMA 2J33A 3GGPA 3TBFA 3PC4A 3WNDA 1OXMA 5A6SA 1DJNA 1NW3A 3EG5A 3MUNA 3ZZ1A 3SXUB 4Y2TA 3PCRB 4M2LA 3BD7A 3CLKA 1GCOA 3QY0A 2QRPA 1O96A 1VKHA 3MCUA 3FNIA 5CYOA 4BIIA 4LJ8A 4ARAA 2GCOB 4XUCA 3A1UA 1W1IA 3H1FA 1DC5A 4BDTA 5L51A 4AAYA 2Q2VA 3PNMA 1UDWA 1RC0A 1IQUA 4KV9A 4TTRA 3TSWA 4LSMA 2XCIA 2XUPA 1BXZA 3F3SA 3NFYA 5AOCA 1G3IA 4H2DA 2NXCA 4POOA 1Z6PA 4KXQA 3ZJVA 2Q3FA 3NHAA 1EFHA 3OLZA 4L5IA 2ZAOA 1I4LD 4XFDA 4XLTA 4ID3A 3TMAA 4ES6A 4XVUA 3QUAA 1PYOA 5TQJA 1LPPA 1T35A 2XYRA 5C1OA 3HABA 2OHXA 4AKGA 2IV2X 3L07A 3ZCPA 4Y2XA 5GVRA 4F21A 3BJIC 3QGMA 5C32A 1EIWA 4KQMA 3WYNA 1AF7A 1EJBA 3UJ9A 4C4ZA 1TYDE 1KYXA 3GT4A 4RL4A 5IVDA 3T95A 3NGMA 4IUBS 1LNSA 3A6EA 3HN6A 4G5GA 3Q9UA 2XLCA 5EXSA 1E6MA 1EYZA 1RAHA 1SEVA 1M76A 2WWXA 2I80A 3AHGA 4RMHA 4UNIA 4D9JA 2C04A 3K6JA 1ECFA 2X19A 1MAWA 4GQBA 1ESDA 3D2CA 3A28A 2XAUA 2Q3DA 3BEOA 1QZTA 3SZGA 1UP4A 3GOQA 3K0EA 1D9ZA 2QPAA 3EIWA 4C0WA 4MHTA 1O5OA 1E2GA 4LDAA 3RFFA 3P8ZA 3FFWA 5JAUA 1IJFA 2O20A 2PZBA 1OAOA 1XZ8A 2PCJA 1SBHA 4NATA 4B87A 5JCJA 4ETMA 2MDTA 3PLNA 4XRGA 2PRSA 4BX9A 1RQXA 5LU8A 5MN5A 2EQAA 2QE7A 4C3OB 1Q0QA 3KHTA 5IVKA 4KPYA 3CXRA 4L5JA 3K9GA 3R7DA 3ZCTA 4DUGD 4WXRA 2W58A 4OXRA 1NWHA 1H2HA 2RHGB 3DBLB 1DL5A 4FI3F 2AV6A 1QH1A 1X8JA 2ZW9A 4Q03A 3GEPA 4BPRA 1DEOA 2PNFA 2ZYIA 4QWMA 4OHVA 2QJTA 1SR8A 2CBXA 4QELA 2NG1A 3OJLA 1Z47A 3KFVA 3IR5A 1CDDA 4NVRA 4NV1A 1HE3A 1Q6ZA 2AK2A 1L7PA 4URFA 3BWXA 3RRZA 5I45A 1V16A 3L18A 4HL6A 4X7BA 1RXSA 3M33A 3S2GA 2OFPA 5BN5A 4HDKB 3KB2A 3CNQS 1EFKA 3TNYA 4PYLA 3U4GA 2IXBA 2J0SA 2ZJOA 1KGSA 1ZPDA 4ZC1A 2H2WA 2P0EA 2PSHA 2WE8A 1AKMA 2X2EA 1KI4A 3CHYA 3D6UA 4IX1A 1Y8AA 3U7JA 3QKWA 3BL8A 1FFEA 3G5TA 4L2IB 3VH3A 3E7PA 1OBFO 2J0UB 1U3CA 2HC9A 3K94A 5JG7A 3E6AA 5EXTA 3IERA 3D5QA 3OFND 1L5FA 3UFBA 1FTYA 2CF6A 1BAPA 1E5DA 1NMEA 3V2HA 4KLCA 3JW8A 3IMFA 5DT9A 5TF4A 4NFLA 1SUSA 3EZNA 3X1KA 1QYRA 3NUGA 2A88A 1X7XA 4D3ZA 2B30A 2PWZA 1QOQB 2QSZA 1X7YB 3WGYA 4FINA 2B1QA 3ZWXA 2FLVA 2WVHA 4KNVA 3ZJYA 3P19A 4EHKA 1JWAB 2OHHA 3P0FA 4CN9A 1M7GA 2HU2A 3EIHA 1NRWA 4GF5A 5DHQA 4LXTA 1HPLA 3GJ0A 3ODPA 3SC2A 1EFUA 4LWQA 3WSVA 4ONEA 5HRCA 3WLAA 4TTPA 5EL0A 1QFMA 1FFWA 3H86A 4KTTE 2HPHA 3QU5A 3TRFA 2R84A 1VJ1A 4M60A 2BFEB 3AZPA 5COQA 4I55F 4G63A 4FYIA 4G2NA 5BRNA 4EHDA 4FIDA 4ZTZB 1E2KA 4L5BA 2JVJA 4B7UA 1IBRA 1S02A 3GJQA 2DFKB 4HDKA 4YC7A 1FS5A 1FJHA 4REMA 3RK0A 3D7MA 2XUAA 3KE8A 3LYUA 3VU3A 1A5BB 1PWEA 1SOMA 3QXCA 4RSHA 2QGNA 3CIOA 4YX9A 2WTMA 4YRQA 4XOUA 1IVSA 1X80B 3Q2OA 1U3TA 3DNFA 4NBTA 1YC5A 2FSVC 1FSGA 2WVGA 3ESAA 4YMVA 1O95D 1ORRA 3BAFA 1KRWA 5LQJA 4DCUA 3MWEA 2O0KA 5T3YA 3UT0A 1QV9A 4PHCA 3QU4A 3C1OA 1C7FA 2GYVA 5AQ1A 1GPNA 3GCGA 3SE0A 3PPYA 3H4TA 3UUFA 5KQPA 5JYBA 3OO1A 4CLXA 1NNUA 1NC3A 1N1DA 2IU4A 1U5AA 2G83A 1W5EA 1N33B 1GQYA 2CUKA 4FHGA 5EWLB 4X94A 5C3MA 2VQDA 4A8TA 4EGAA 2XQGA 4C01A 4AMUA 1FVOA 2O8FA 1XQWA 1H3NA 4R2KA 1R4NA 2D74A 2ZR7A 4J1SA 2IS2A 2OV6A 4DLNA 4Q6WA 3A3KA 2BFCB 4OQFA 5F5LA 1JDSA 2UYOA 1JAYA 3FHOA 5KYYB 5MHTA 3OI7A 1U3WA 2WG1A 3DMPA 2VJAA 4HDSA 2OESA 1U99A 4J49A 3SYTA 3X1DA 4EGJA 3THYB 1OVMA 2M6RA 3HDYA 4QDXA 4OCZA 3CX6A 3I12A 1ADGA 4XWTA 4A7PA 4B3RB 1JBEA 2I3DA 3A10A 1JLLB 5JUWA 4CQMD 4AJEA 4OKNA 4F2DA 1JMKC 3M6MD 2WKQA 4CEHB 2XAAA 4IQ8A 2QW1A 3V4RA 4YAWA 2V3CC 2DC1A 1OXVA 1VZ2A 1BX0A 5IWCA 1TT7A 3CR8A 1P19A 4TLCA 2WU3A 1MQ8B 4NCBA 1YA6A 2FP4B 3BE5A 4MS1B 3OX1A 4A6XA 4OFBA 3D6JA 4KQEA 1OT5A 3Q8XB 4KKXB 5JJKA 3IR7A 3B52X 2BEVA 2CHUA 1G64A 2JI6A 2YC4C 1K86A 2D2XA 4AW9A 1BVYF 1WQ1R 1Z16A 1I1QB 3DZDA 4ZO7A 5FWXA 1LW6E 1E1RA 2AF3C 2OC9A 2I4IA 2WE7A 2C54A 3E27A 2IXDA 4JSYA 4O5OA 3NATA 3DS8A 3ZCUA 5G4LA 1VLMA 3I3SR 5DNDA 4DRXB 3AP2A 1ZUNB 1LRKA 2VA9A 3OLQA 4KV7A 1TUBB 4CG2A 1ULAA 4EDFA 2F7SA 3BYZA 2P35A 5CW1A 3OWXA 5KNCH 1DWUA 2DKNA 3L6RA 1N6PA 2IH5A 1K6JA 4JMPA 4RLHA 1HDXA 2XXAB 3E15A 2HA4A 2PRIA 3OIUA 4HWKA 4JODA 2YJ5A 5CB0A 3JQCA 2FMFA 2GSWA 1KK1A 4Z3DA 2ZVQX 5F4ZA 3LY5A 5KTMA 3SM9A 3H2IA 2AS0A 1QTNA 2BGUA 3RAJA 2V1UA 4I8DA 4AIIA 2ZZMA 4EG8A 3KZ1E 2P6OA 3DE6X 3H8JA 4GLOA 5I51A 2FUG1 1KJNA 1S3GA 4BNFA 5I9SA 2OCYC 3VR4A 1P5JA 1EM6A 1T13A 3OUUA 3NDPA 1J97A 4G36A 3N7UA 3QYFA 4QX6A 3FOFC 1XF9A 4PSCA 2X8LA 4UNQA 3AM5A 3LHKA 4OIFA 3UTDA 4TLEA 1DKLA 1VMDA 3NZEA 3PKZA 1SGWA 4DLWA 1MGPA 4ADSG 3ZU2A 1GN9A 3JARA 3B1YA 4YRRA 1Q20A 2WRZA 2ZP1A 4REQB 2IXEA 2RIPA 1YVEI 1QWSA 2O2IA 3EXHC 4G85A 3EUAA 3ISVA 4TRMA 3GJXC 2X86A 4B76A 5CPBA 5J2UF 3URKA 2NXNA 3HCEA 1KDYA 4Q66C 1XCGB 2PT5A 3G2IA 2EYUA 1T36B 3W5UA 1ZIPA 5AIAA 3GW8A 3AHIA 4D97A 2AJCA 3DAHA 1TM3E 2CNNA 4PO3X 3GOHA 4GUDA 3WKDA 5CA1F 1ODTC 3AWDA 5SZKB 2ODBA 2WYIA 3UMBA 3RT9A 1G2PA 2Y1DA 1NN1A 3F3KA 4O4IB 4OQPA 4EKNB 4RJTA 2XMPA 5K4HA 4HHEA 1AXRA 3BZWA 2ZI6A 2NSHA 1QRSA 2DFNA 4OHPA 1V6AA 3WL5A 3MGCA 4DIKA 3HB5X 1NVVQ 2G7ZA 3W79A 3FWPA 4QT4A 5KU1A 1QG0A 2ABWA 2M6SA 2N3ZA 1Q1NA 2XVAA 5B3AA 2Q6IA 2VO1A 5LL6P 3IT1A 2AVDA 1ECCA 1E92A 2GEUA 3QKIA 1RLIA 1Z34A 3LT0A 1RTTA 5J5AA 4DSTA 2JI4A 3FJOA 5FAXA 3ROQA 1IXYA 4ABTA 4RSGA 3QMWA 5ITVA 1F5SA 1RS0A 1L7XA 3DOJA 3LOPA 4I5EA 3WHIA 2GAJA 2ZWMA 1HTWA 4OH1A 1UFRA 1Z5WA 1ZKMA 1G66A 3CLUD 2RKOA 3TL6A 3PJRA 4MV4A 2BFPA 4J4HA 1Y9ZA 3MJCA 4NBLA 4DLTA 4ZVLA 5IT0A 1EINA 4DLLA 5HKOA 2XYQA 1GQRA 2WHQA 1UJ5A 5CT5A 2EKZA 4O4JB 4EBBA 1Y7IA 2PZAA 4KQGA 5TE9A 1X8XA 1GPLA 1CR1A 4JCCA 4CEIB 3PLAE 2QW8A 1M2HA 4M7RA 4CM8B 1G59A 2QHXA 3A70A 1Y8QB 4KGZA 2YWDA 2DFVA 4N7RA 4NFSA 3AKCA 4R1LA 4X60A 5CUQA 4P6VF 2QX8A 3LOQA 3ZC3A 1KY2A 4YCJA 3ZE7A 5IXSA 3GLIE 1J2RA 2F3UA 3DEFA 1T3TA 2G8NA 1CQZA 1JJ7A 3CZPA 4RO0A 2RHDA 1G41A 1OZGA 2OD7A 3GGCA 1XI2A 1KJ8A 2BRUC 3CLRC 1QB8A 5JCZA 4XXHA 3ZHCA 3BMOA 5FFFA 2VWHA 3WKAA 3N0XA 5IVIA 4KRYA 4YRDA 1W0JA 1X8LA 1P7ZA 3WHPA 4M0DA 5ALZA 2OT3B 4XCXA 1TVKB 1VLZA 2NTNA 2ODNA 3FRHA 5F1OA 1MTOA 3O3MB 1YUMA 2BY4A 4GQIA 4KFSA 4EG0A 2VH1A 1DZ3A 3DEZA 3OEYA 4P4UA 2X6QA 4F38A 1YDMA 3R4CA 4MICA 1A76A 5L7WA 2E21A 1ID1A 4ZVUA 3FUCA 2VNJA 1N2GA 2BKAA 3A8TA 1EX6A 4I19A 1LBQA 1LZLA 1G9XA 4NYJR 4WBXC 4F3TA 3DZKA 2GVNA 4HEA1 4UBJA 1FDSA 4LDZA 5AP9A 1GM5A 2FKNA 4Q3AA 1Q7CA 1GUYA 2NO6A 3D2AA 1K8XB 1DQZA 4GPZA 3KL2A 4MA0A 1UEIA 3A32A 5A5GA 5GOTA 2E6UX 2C58A 2POCA 3KSMA 4IUDS 2YTZA 3L04A 1GPUA 4KQJA 1HRDA 2O8NA 4JI8B 1F7VA 2R65A 1SCIA 4D4JA 3FMFA 5LSAA 5GAJA 3RS7A 2BEKA 1UMBA 3H6HA 3UH1A 3ZD8A 5A4MS 3UQZA 5T57A 1DT5A 4GPAA 3EFEA 4BC0A 2BHTA 2PKQP 2RH8A 1JLMA 1K7YA 3LF1A 1E7QA 1MD9A 2ZI9A 3MTDA 4LPSA 4TTJA 3W5IA 4CKBA 4JB8A 3M6LA 3ZZUA 3LPNA 3ND5A 3BGIA 2BBWA 5CYGA 3TIGA 4HB2A 2QMHA 1UZLA 2HDOA 2VJYA 3HUUA 5TPZD 4HVTA 4OAPA 4UCWA 4QBHA 3EXG1 4YHBA 5JD4A 2XCTB 1GITA 3GFRA 1ADCA 3UWOA 4B6JA 1J22A 2AR0A 5IH7A 1N5LA 3T1HB 1ABFA 1E6KA 2PV0A 5AW5A 1X1TA 3LA8A 3QVUA 1FYEA 4ENTA 4RM3A 1SUFA 1T9CA 3G13A 4AXBA 1OAKA 4B4VA 2IYOA 4H1HA 1GQQA 3OF5A 5LIPA 4GE0A 5ENDA 1XCPA 3CKYA 4EVQA 5IFLA 1BS2A 3UH0A 2HFJA 3MJEA 5TXGA 5A5EA 2IRWA 1M34A 1OLSA 5EVCA 4R7ZA 5JS8A 2OFFA 1N78A 3ZDAA 2CL7X 1Y9DA 2ILTA 3W9UA 3CUEF 1KK3A 2PR2A 3LVQE 1HLGA 3F96A 2AOTB 1GZHB 3EC1A 3CW8X 4G0PA 1NX6A 1V6SA 1HQKA 2R96A 4BNLA 1PDWA 4O2BF 5JY1A 2NYUA 1AKYA 4FHZA 3T6KA 3M83A 4H59A 5K2MA 4ZOAA 3CF0A 1XZJA 3B1FA 3P71T 1EIZA 1EUQA 5BUCA 4ENPA 5FX2A 2XYHA 4FXOA 1EQAA 1M8PA 3U81A 3ECAA 1JKMA 4IIBA 4KJZA 4QYWA 5DXAA 4J9UE 4Y6PA 5J59A 2IW1A 2XJ4A 2X7XA 1FB5A 3WMRA 2VC2B 4QBGB 3WLRA 4X20B 3EWSA 5LXTB 3GRUA 4IDNA 4M21A 3TW4A 4W82A 4XR9A 4YP5A 5ENVA 5C1IA 3NH6A 1ZHOA 2PH5A 2MMCA 4HR7A 3RC9A 2OK8A 2ZKLA 3L6EA 5G02A 1SCJA 1Z8HA 2FSFA 4O4IF 4WUVA 5TPWB 3TG2A 3T99A 3BXXA 1G8HA 3CB2A 2VF7A 1OLOA 4DYHA 1EFPA 3M9LA 1T1EA 2A4MA 4BV3A 1P72A 1YBVA 1DARA 1FDOA 1R27A 2X3FA 1ACLA 2HJSA 4F06A 5EXEA 5C1PA 3AT1A 4MI9A 2VXBA 4OQXA 4HXFB 5HP4A 5E6SA 2FWPA 1JPNA 2R2GA 2EZTA 2J5KA 1PVVA 4X63A 5I8WA 3IP3A 2CXHA 5KVCA 1USIA 1ZK2A 3S8YA 1NBWB 2XJ9A 4HEQA 4KN6A 2PG3A 2XWPA 3FDFA 3OPXA 5EWJA 2X4LA 3EDYA 5KVAA 3OQNA 1E2NA 3FWKA 1DAIA 1MENA 1RBYA 1DQSA 2OGWA 3RR2A 1PDOA 1O6GA 3BWCA 3M5PA 3I52A 4YVFA 4F7WA 3KEMA 1J2JA 4AKHA 2OILA 4DLVA 2D4HA 1JIKA 2ZB8A 4WESB 4J7AA 2VLBA 2VK4A 1G5QA 1NI4A 3DR5A 4I1OA 4IGKA 4L9AA 4OK5A 1QO0A 3U7FB 3I04A 4MIEA 4Q7MB 5KJEA 3G9TA 3R09A 3T3PB 4NQZA 4P83A 1I2MA 3LFTA 1INLA 2H9YA 2REQA 3VPAA 5BRJA 3H83A 3VBCA 3PUXA 4MW2A 5AYVA 4B8WA 4G9GA 3UOAB 4BP3A 4ARCA 3VUEA 1MNQA 4DOMA 5ED4A 4JHXA 4E15A 1RRPA 2RHRA 4YUAA 2YMLA 4QHYA 8OHMA 5HPYB 3K8OE 5ER6A 5D8DA 2IYUA 3K9NA 1ZI8A 4WE3A 4X24A 3DMDA 1T2VA 1QK3A 3K0HA 3OQIA 5IK2A 4O4JF 3B5EA 2VYVA 3TR5A 1SU7A 4GP7A 3V5NA 4UATA 3STVA 2HHHB 3T5AA 3C6MA 1YKGA 3SMVA 3HJTA 4RKWA 4L4SA 1KZGB 3MNFA 1SURA 2W2LA 1Z39A 1DU4A 1U0SY 1UXJA 3DEHA 4IJ6A 4ND5A 4EYGA 1BNCA 3I09A 5EJ8A 5KQRA 2NT3A 3OU2A 3OY2A 3ZZ0A 4RENA 3CN7A 3ESZA 1NBMA 4MS4B 4LHSA 1U8YA 1T5IA 2GBCA 1HA3A 3JTEA 3A6LA 1T5LA 4AQDA 1U1GA 5FBRB 1I3LA 1W8DA 1AUXA 4EG6A 2HDWA 2JK0A 4DMGA 3D3NA 2BISA 1QPBA 3MRSA 2V58A 4EUNA 3GLHB 2JIRA 2YRXA 2Z3ZA 3K72B 4KR0A 3GJ5A 1Q3HA 2JGDA 3JYPA 1XZQA 4IFIA 5CK4A 3VVCA 3QVVA 2PA0A 1MO4A 1YD7A 4ND3A 1K7XB 2LKCA 3JRXA 1LKZA 1T8TA 3E22B 4Z53A 1V8PA 3GFVA 2VWQA 4EMSA 5CBPB 3ZZMA 2REBA 2XB2A 2VR1A 1FSZA 4C0JA 2ZS9A 1HKHA 2A5GA 4QG3A 4B8YA 1VI2A 3OZEA 1TADA 3NKVA 1NVDA 2YFYA 2H59A 1MDBA 2FOIA 3BMXA 1U8EA 2WSYB 3FCSB 4WDQA 4ZK2A 5CCEA 4GMGA 1H5QA 2PL5A 4D0RA 3IFSA 1D7AA 5J4VA 2FU5C 3HR7A 1TI7A 2FFRA 1E3TA 2W37A 3A9UA 3OURA 4IYJA 1JFSA 4WY2A 2DX7A 1O7JA 2KLBA 2W2TA 1SUDA 1ACJA 4JI1B 4EHAA 1ISMA 1BMQA 1P1CA 3EXFA 5AM5A 4FK8A 2HJWA 2HHCA 2VAXA 4YJ2A 3HXQA 3NHWA 2QD1A 1Z3CA 3KWMA 1VI6A 1KYQA 3OJXA 3MGGA 4NBWA 3VTAA 5FP0A 1BEZA 1OBCA 4RKQA 1SWVA 1DT3A 1MV5A 2PLAA 1NWCA 2CNOA 4J0EA 1NMZA 4ND2A 1VLHA 4L78A 1OTXA 4ZI7F 1HV8A 3HFGA 4KB5A 1VJDA 1KZ1A 1PDVA 3P2JA 3V4SA 4YLGA 4BYMA 4WOJA 1U4SA 1IJBA 1QNFA 2O0HA 5C4GB 4IDCA 1RRCA 1Z7EA 4ZXPA 3EXEB 3I6BA 4TTIA 1T4CA 4GSYA 4BC1A 4ME6A 3W3AH 2HF7A 1E99A 1A96A 3T41A 1XRJA 4DIDA 4DKXA 3B89A 2EARA 3Q40A 4G81A 1VL8A 1TO1E 4ER0A 4KGDA 1A8SA 3PYLA 4PC6A 1Q0TA 4HUQA 4QQKA 3SD7A 3OPYB 4PTYA 4B71A 4UE6A 3TQOA 1EJ0A 7YASA 1QQAA 1WSBA 1EHIA 3Q9NA 1PL7A 3FOEC 2DERA 3H18A 3UUEA 1DXHA 3D81A 4LQLA 2ZCJA 4BX8A 2P5SA 3DDUA 3FUWA 5B30A 1CY1A 3I1FA 4H77A 2ZEJA 1V5FA 2PUFA 1QU2A 2BEWB 2ZRQA 3C48A 4RQAA 3LBHA 1QGED 4OIMA 2BAGA 5CM9C 5D6NA 3E9NA 3MHTA 1E9CA 4NONA 2L0XA 4TYQA 2BM9A 2CC2A 3N2GB 1UZNA 2H4WA 3EXIB 2GPAA 5HXAA 1DCTA 1B1AA 2R1TB 5DLPA 3U7HB 2TRSB 3UCFA 3KSAC 5K8LA 1UBHS 2PH1A 2FRDC 3F7NA 3VC2A 3T3NA 3DOHA 3OC0A