1XF9A

Structure of nbd1 from murine cftr- f508s mutant
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
281
structure length
264
Chain Sequence
b'TGIIMENVTAFWEEGFGELLEKSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Side chain and backbone contributions of Phe508 to CFTR folding.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 91
structure length 264
sequence length 281
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xf9A00
1Q3TA 4CEHA 3WNCA 1JR3A 4PZZA 2WSMA 4HB0A 4IDPA 2VP0A 4O3MA 1SXJA 5JJIA 2WV9A 1BYIA 1W5TA 1JR3D 2FPMA 2IUUA 1SXJD 1W5SA 3QVUA 2QE7A 5DSZA 4NCJA 2Q3MA 3QQ5A 2VP2A 3I1FA 2C96A 1U9IC 1VIAA 2HDNB 5A0FA 3SBEA 4ZO4A 3H0KA 4JYCA 1AM4D 4IEIA 5LB2A 5JFGA 2ZE8A 1KI6B 2Z4SA 4W5HA 3KL4A 3CRVA 1Q0UA 1W44A 1D9XA 2G6BA 3V9PA 1L2TA 2QROA 1KSGA 3DMDA 2ERXA 1EFRA 1K8RA 4FI3C 4US1R 4PC7A 4NZYA 5G41A 2QEQA 1Q12A 3ND8A 2ZI3A 2XSZD 4HUQB 1G3QA 2NZ8A 4OHXA 4TWZA 1T91A 5DN6A 3GPLA 3N2IA 4D0LB 1F2TB 4OQFA 4WIAA 4EAQA 2FSGA 4S35A 3LWNA 4H1UA 1KZ7B 4BASA 1AZSC 1VHLA 4UXHA 1KMQA 2OUKA 4QNMA 4NP6A 2YOFA 2G88A 1UAAA 4XSGA 3I8XA 5JI2E 221PA 1YZQA 3HPQA 4HATA 4XTCS 5FI0B 4DHEA 5AR1A 1AJEA 3BFKA 4B3CA 5F9HA 4CEJB 4HB4A 4A36A 1ZM7A 1WXQA 3Q7QA 1NVXQ 1BYUA 2ZETA 1XCGB 2WJIA 1A2BA 1ZU4A 3WP1B 4AD8A 1DAMA 1NBMD 1W0KA 2AN9A 3AGQA 3KJHA 3TVTA 1QG4A 1N0VC 1SKQA 5FTLA 4OI0A 1OJLA 3KKMA 3EPHA 2W6JA 2GCOA 3H2YA 3EZ9A 2FZLA 2YHSA 2FMXA 1WRBA 2CEAA 5EE5B 1PZNA 2HUPA 3B1YA 3L0PA 1P60A 2PL3A 3GEIA 1KO4A 1Q20A 2E87A 2VL7A 4P4SA 2W0SA 3MAAC 4BUJA 1LFDB 1P5ZB 4ACAA 4HAVA 4HAUA 5EUQB 1SVKA 1DPFA 1S3GA 3KFXA 5DHFA 2WWHA 1HE8B 3OZXA 2ZUCA 4WXRA 3WHLA 4DIDA 2AKAB 1DARA 2ASEA 4URZR 3UMRA 2A9KA 4TL8A 2BKEA 4C2UA 2H57A 2PZGA 5KTYA 1OXTA 3K09A 3RC3A 3RS5A 2XZLA 4AURA 1DOAA 1AS0A 5J4YA 1WMSA 3HU2A 1WDTA 2ZJOA 2JLUA 5JI3E 1OFIA 1AGRA 2CNWA 2R6DA 1BOFA 1NKTA 5HPYB 1KO8A 4LGMA 1NG9A 2BEJA 2R6CA 3R9WA 3EA0A 4RZXA 2OEPA 2WSSD 4QKQA 4FINA 1SKYB 4R2IA 3SEAA 1VCOA 2V7QA 2C9OA 2RGCA 2PX3A 5FL7D 4AG6A 2AFHE 4D4MA 1BMFA 2JJ1D 3UMFA 2CVHA 5AUNB 3EPLA 1P2UA 3EZ6A 1W46A 3SYKA 4A4DA 2RGAA 1HT2E 1YKSA 5E3HA 2MMGA 2ZE7A 3BJIC 4IDOA 5C4MA 3DKPA 2DB3A 1R5OA 2BOVA 4S2EA 5JHGB 3UWKA 2ONJA 2ODWA 3MWYW 4EPWA 1E94E 3Q3JB 4TYPA 3MUFA 2IXFA 5KSPA 3T5GA 5LD2C 3P1JA 3BB4A 2JA1A 1Z0KA 4G5GA 1AS3A 1NMZA 1OIVA 121PA 1KJYA 4JL8A 4O2RA 4QBGB 1XMSA 2ZAMA 4OQXA 4YC7A 2QSZA 4Z8XA 4GT1A 2L0XA 5BWMA 5FTMA 3F0TA 4O25A 2IT1A 3MLEA 4OKSA 2GKSA 4LJAA 3B1XA 3X1WA 1FOEB 2XB2A 1II0A 1TX4B 2R6AA 1RRFA 3ADCA 2P5TB 3G5UA 2QTVB 3KQLA 3BRWD 1IY2A 4M22A 3M0EA 2GJSA 1CIPA 2ZAOA 3L0OA 4DCSA 1RZ3A 4JVLA 1TMKA 4B32A 1SHZA 1S9HA 4M1MA 3SNHA 3SYLA 3P4XA 1HUQA 1W36C 4ZI3A 3HP1A 3QENA 4OI1A 2OZEA 1Z0FA 4ABYA 1M8PA 5L3QB 4ZCMA 2CL7X 3CRQA 4UXIA 1DBSA 2J0UB 5JBQA 4CT5A 2GDJA 3W8NA 4M0LA 4L5BA 5FUYA 2IS6A 4JLJA 2PBRA 4DKXA 2BMFA 2ZS8A 2W00A 4RZ2A 2ZE6A 2ZRAA 1A5TA 2ZYWX 3VNUA 3QXCA 1US8A 2A5DA 4TN1A 4DT1A 2FFAA 1EG7A 4M9XA 5HCIA 4JSYA 1Q44A 3QI2A 1RYFA 2A2ZA 2WWXA 3BOSA 1UBEA 3DVLA 1EFHA 3LQRA 4PANA 3LAWA 5HZKA 1JEDA 2IC5A 4G0NA 2OT3B 1J90A 2EYQA 1Z0AA 1D8TA 2ORWA 2ZRGA 3PITA 4DLTA 4XD7D 4LHZA 3WYAA 4AKEA 1OF1A 1N6NA 1A7JA 3CNNA 3K09C 1OHHD 3ZDQA 2ZTSA 2WVJA 5JWHA 4A0HA 1KJZA 2D06A 1V43A 3W8RA 5JS8A 1Z6TA 5C1BA 3IHLA 5JECA 1JR6A 3SR0A 4JLBA 4EPTA 4MRSA 1MO4A 3I32A 1TL7C 4TMXA 1TQ6A 5CYOA 1MO5A 5L3SB 3OE7A 1NY5A 4QJ5A 1E99A 4US2R 1TADA 5KHOC 5CJ2A 1TQ2A 3WYFA 2ANCA 3KUDA 4BFVA 3I4LA 3F3YA 4L4UA 1GOTA 1P9RA 1NG1A 3BGWA 2HYDA 2J9RA 4BLSA 4JZKA 3K0SA 3WRYC 1E3MA 3TQFA 1LVGA 1ZNYA 2ZEJA 2X19A 1P6XA 2QI9C 2AWNA 3ZVRA 3U7FB 3SFZA 3B5JA 4BLQA 1KI6A 2KE5A 3WXMA 2FEMA 2IYUA 3K53A 2P67A 4LBYA 4MGYR 1CJTC 3LX8A 2ZJAA 2WMOB 5E7JA 3I72A 3AF4A 4JBYA 1WCV1 1XFAA 1LTQA 1KK1A 4AI6A 1LV7A 2N46A 4HUQA 2HJVA 4PHFA 3B60A 2WKRA 3W6OA 2XNDD 1O3YA 2GXSA 5FR2A 2CHGA 1F2TA 1KY3A 5JRZA 1JNYA 1P9NA 5KNCA 3AVVA 2ZRDA 5SZKB 2O8DB 2QBYA 4MGIR 4C0HA 3KKOA 2X1VA 5JWRA 5TMPA 4JBXA 2ZSAA 5AJYA 1MV5A 2JIZD 1LF0A 3RWMB 1FFHA 1G1MA 1ESMA 4JLPA 3RWOA 2BVNA 4CEJA 4FWTA 4MUBA 4Q1BA 1N25A 2V1XA 4Q5IA 1HE1C 5CM9C 1DVRA 1ETUA 1QG2A 1Z6GA 1PLLA 2ZREA 5KO2A 5GJCA 4DJTA 5FL3A 1VG8A 2DBYA 3TUIC 3FHOA 2BWJA 1Z47A 1W48A 3THYB 1H8EA 2YV5A 1CXZA 2G83A 5TB5A 1IXZA 2C95A 5GJWC 4EPYA 4ZCIA 2Q3HA 2FPLA 5CK4A 2Q3FA 3VKHA 4V02A 2NO0A 2GZHA 4AY2A 4LJ4A 4B3BA 1M7GA 2QN6A 2YWHA 1FMLA 1ZBDA 3BH7A 4OHZA 1GP2A 1Z6XA 1SKYE 4DCUA 4JYBA 1GL6A 5G53C 5G3YA 4POAA 5HKKA 2DPXA 4M53A 3OESA 1E9CA 1CS4C 4NYMR 2KBFA 2OAP1 1Q22A 4R9UC 1FNMA 1AIPA 1XNJA 5HKKD 3PJRA 3TR5A 5DI9A 3AKCA 3ZJYA 4LRWA 2IS1A 3HU3A 4CZ2A 2YJTD 5B64A 1ZINA 1OKKD 4GI7A 3CPHA 3QEJA 3FOZA 1CJMA 1JPNA 4UNSA 1IY0A 2HF8A 5FI1B 1XCMA 3WNDA 2AFIE 1RRPA 1RKBA 1S0UA 2WTUA 5KOYA 3U60B 1EFUA 2RAPA 4MDEA 1OXXK 4YMSA 1ZC3A 1U0LA 4QGGA 2CHVA 1DG1G 3BK7A 1NP6A 3IILA 3EZ7A 3MCAA 4ARZB 4B34A 1UF9A 2BEKA 2J7KA 1OH7A 1TNDA 1N6LA 3AVXA 3FHCB 4HAXA 4QC2A 2RGGA 3RVBA 4PPQA 1IXSB 2B8WA 1OW3B 3JVUA 2FWRA 1E2GA 2OHFA 4OL0A 2C03A 1QHXA 3C41J 3FE2A 3W90A 1IJEA 3NVAA 1B0UA 1FTNA 3IEUA 3I61A 1R0XA 2VP5A 1OLOA 2ATVA 3REFA 4WXPA 1LS6A 2QUZA 4IVRA 2NOAA 5AK0A 3WMFA 3T1TA 2JLVA 3VKGA 2REBA 4LX0A 5FOSA 2F9LA 2Z6VA 3OIWA 3JVVA 1VG9B 3VMFA 1P2SA 4JMPA 3CO5A 3LW8A 4LHXA 4Z1MA 4U02A 4DB2A 4A0GA 2XGJA 1CRPA 3N2EA 4Q7KA 4GOKA 3Q72A 1MO6A 3OF5A 2QL6A 4GZMA 3TBKA 1NLZA 3RAPR 3I73A 3RSOA 3FKQA 4DVGA 3OEEA 1TUIA 1AGPA 1Z0DA 3U7EB 3UKDA 3O8RA 2R8RA 2IF2A 5DH9A 4AKIA 1FPMA 1KK3A 1D5CA 3TUZC 2G3YA 4LSGA 3RS2A 3LXRA 1DAFA 2PZEA 3VR1A 1AQYA 2IYQA 4C0JA 5FOVA 2RHDA 2FGJA 1RPZA 4I1OA 2OESA 5L3QA 3NTUA 4D26A 2KBEA 4MYHA 4Q9KA 3R7WB 1KNQA 4JJKA 1DELA 2H18A 3AKEA 2J0UA 2Z4RA 2WICA 4D81A 5C2JB 1OXVA 1ZAKA 1Z2AA 4LDJA 1R8QA 1NIPA 2FOLA 5LPNA 1T3LA 2AWOA 3NG1A 3SN6A 3HR8A 3FDIA 4DLZA 5KDDA 3CPJB 3CIOA 2QMHA 4QHSA 4XWKA 1OH6A 1G8YA 3GEEA 4DCTA 4A0FA 1IN7A 3MWKA 2V55B 3NC1C 5KUTA 2O8BA 1KI7A 3THXB 1GKIA 1C4OA 2YOHA 3RABA 1H8HA 5A5GA 4A6PA 1JJ7A 1U2RA 1G7CA 3GJ4A 3KQNA 2FJUA 2XTZA 2ZUDA 3K0CA 4KVAA 2BIFA 1H8HD 2RGEA 1L4UA 2W0MA 4YDSA 5J5CA 4IKEA 2HLDD 1XTIA 2QM7A 1E9FA 1WP9A 2R62A 4MDFA 1DAGA 3IBGA 4UQOA 1OYYA 2F3TA 1GRQA 2J41A 1OT3A 3NHBA 2ANBA 5DO9A 4BFZA 4P31A 4JT2A 3NIBA 5B2ZA 5AUPB 3PEYA 2OM2A 3Q9LA 4NCHA 2YWEA 3QXHA 3MSXA 2CJWB 5L3SA 1KO1A 4BLPA 2DYKA 1EFTA 4DWJA 1VYVA 1XRJA 2J1LA 3X1DA 1VG1A 4KYUA 1PUJA 2QGZA 3CX6A 2J0QA 3REGA 4M1WA 1E0SA 2P6NA 4F93B 1TPZA 3A1TA 4FWIB 3TW8B 3GEHA 4QHYA 2AXPA 1ZM2A 2Q9AA 1M6NA 4JKIA 1COWD 1R0WA 2QMOA 4FCVA 1N0UA 4LY6A 5KU1A 1X8JA 1YHNA 4JBWA 2ZXUA 4B43A 1TAGA 3PQCA 4N1AA 1RE0A 2IEYA 3QIAA 2Q9BA 4DSOA 1S1MA 4PO1A 1YJ5A 4XOIA 1G21E 3U6BA 2QM8A 2D74A 1K5DA 2C04A 2R2AA 2REOA 4BZPA 4D0NA 3AVQA 5EP3A 1AKYA 1KI8A 3EAQA 5J40A 2CE7A 1ELOA 2QZ4A 4ITRC 4TT3A 1IY1A 4YMTA 2F1HA 2F7SA 3C7KA 3VTKA 4MKGA 5B30A 1NKSA 2F3RA 4TYQA 1XMJA 1UFQA 4RD6A 3QG1A 3SHWA 3A1WA 2ZS7A 4QRHA 5E4FA 2O8DA 4PQFA 4N3NA 4BLRA 1VHTA 5C18A 1BKDR 1DAEA 1YR6A 4C0LA 4LJ8A 3T35A 2B6HA 5LDDC 5H8WA 2IYVA 3P32A 4GSYA 5DE3A 3TSOA 4B3XA 5BN4A 3V00A 3IQWA 4CGZA 2YINC 1YQTA 3H84A 3EC2A 3W3ZB 1HA3A 2G1JA 4Q4LA 2ZU6A 1JR3E 3TMKA 2XOKD 3QUSA 2QPTA 4ZDIA 3L8YA 4DXAA 1SXJE 1E1QD 2F43B 2IF0A 3BXZA 4AG5A 3PUZA 2GNOA 4RD0A 3THYA 1RC8A 1MABB 1FUKA 4W7SA 3IEVA 4C0AC 4JLOA 4YONB 2JGNA 3EZ2A 1Z5ZA 4L15A 3WNBA 2ZJZA 1AS2A 1KMHB 1ZC4A 3IQXA 4XJXA 1KO5A 5DHAA 2FA9A 3K0CC 4RSGA 2OCBA 2F1JA 4O2LA 4TYWA 3NXSA 4NYMQ 1XEWY 4IOMA 4DUGD 3TRFA 5HE9A 4D80A 2QTFA 2CHQA 4DSTA 4M9QA 4I81A 1KSFX 3GLGB 5FTJA 2XAUA 5SZHB 3TW4A 1G9XA 2O0KA 1X8LA 5EE0A 1JPJA 3B8HA 2FPKA 3CZPA 2VSOA 4OHWA 3GD7A 5DYIA 4W9MC 3CLVA 1OH5A 1ZIPA 2EFCB 2IYRA 1KGDA 4WZ6A 5CITA 4GFDA 721PA 3LD9A 3ZH9B 2NIPA 1R0YA 1G6OA 4DDWA 2IX3A 2J3EA 5CK5A 5AJVB 2JLWA 3A4LA 1ZD9A 3R8FA 1XBTA 5JCZA 5KDOA 5BQ5A 3CX8A 3VR6A 3A8TA 2H7VA 1RJ9B 4M1KA 3NDBB 1OIXA 2QP9X 4ARZA 2XSZA 4F4CA 4Q1DA 3RS4A 3Q8XB 1X1RA 1FZQA 1ZNWA 2CBZA 4IOKA 4JIMA 4EPRA 2YOGA 2IXGA 2D62A 2ODNA 1NI3A 1BIFA 3CX7A 3GJ7A 4EJSA 5CIWA 4KI0A 3KKQA 4PQYA 5K8LA 2OAQ1 2VBCA 1DTSA 3ND9A 1A1VA 5EXTA 5FBLB 3KKPA 2QPOA 5HE8A 3TR0A 1CJUC 1LNZA 3ECCA 2FF7A 4V0KA 3R9IA 4BGDA 4PHTA 2WMNB 5JRJA 2QTHA 1MH1A 1NJGA 4TMWA 3O8BA 2FSHA 1SHKA 1UDWA 5P21A 2PZFA 4II7A 4I1SA 4OHYA 1NBMA 5KPDA 3W5JA 1D2NA 1HYQA 1JXMA 1DO0A 3ASZA 4YMVA 3KQHA 4EUNA 3QBVA 2BJWA 1P62B 1S2MA 3K9NA 3WY9A 1IM2A 1KOFA 2PEYA 1D9ZA 621PA 1YR8A 3K9HA 1Z2CA 2DWOA 2VHTA 4OBEA 4RY2A 1N5JA 1VTKA 2V4ZA 4MUAA 1T6NA 4FMBB 4G5OA 3L0IB 4B6EA 3RRZA 1XEXB 4PAQA 4E5UA 1CKEA 2MSEB 2GXQA 2Z43A 1N2CE 3SYNA 4JL5A 3I5XA 1Z63A 4KODA 2JJ2D 3R7WA 1HURA 5E7MA 4WOPA 3K70B 2DFLA 4BFSA 1CR0A 4YMWA 4TMTA 1J8YF 3O8CA 2WAXA 4D2IA 3U3JA 3TAUA 3GLHB 2OFWA 3QOFA 4URVR 1E2NA 3IO3A 2NGRA 4RD3A 4KSBA 2BMDA 3P20A 1XJCA 1VCIA 4PZLA 4HB3A 3UXMA 4HDQB 2N1BA 1UM8A 1Z0IA 1KAOA 3QY0A 2J0SA 5BYKA 1SXJC 5F9FA 3M4YA 4MRVA 2WWWA 5GVRA 2WSSA 1G8PA 3GLFB 3CZQA 2CLSA 1ZUHA 5FL7A 2GXUA 2JJ1A 2V6IA 3FMPB 4A2PA 3VU9B 4Y0AA 5H70A 4D0GA 1W0JD 5J4LA 3Q7PA 5KNDA 3A6PC 3TK1A 2O8FB 2BKUA 1CR1A 2JCSA 1M7BA 1ZNZA 4DLUA 3ZD6A 2C99A 4XVQA 4LI0A 2FH5B 4LV5B 4UNRA 3FFAA 3AH8A 2JASA 2PMKA 3CKLA 1G41A 4GP7A 4JLKA 5LB4A 3OIYA 2CJWA 2QP4A 1QHSA 3EWSA 1GM5A 4FMDF 5GADl 3QEOA 2LWIA 5K8TA 4W5WA 2A5FA 4TMZA 1T8TA 1MT0A 1VG0B 5EZ5A 2G9NA 3EPKA 1T3SA 2WWGA 4GDFA 1VECA 1VCNA 5ELXA 5FOUA 2Q9CA 5TDHA 1OXUA 3K1JA 2O52A 4EJSC 1N5KA 3KQUA 4C30A 1T9HA 3AUYA 4NKRA 4D82A 1T0JB 3GJ0A 3C4JA 3IO5A 1E2IA 3CF6R 4R98A 4LOAA 5EJEA 4XTRA 3PUVA 1LB1B 1NN5A 3KUCA 3QKTA 4NONA 2HJGA 4B48A 2GESA 3AF2A 1Z0JA 4ZKDA 2IYTA 4PHHA 2GAAA 4NH0A 1DS6A 2AK2A 1Y63A 3TLXA 1OB5A 4D4KA 4ZV4A 2ZRBA 4TSFD 1EFCA 1I4TD 1Z28A 4JLVA 3IBYA 2B92A 1WF3A 4OK3A 4ZDJA 4F7WA 3FWYA 2VPPA 1E4YA 3WBKA 4EIWA 5EE1A 5HR5A 4MGKR 2PLRA 3DDCA 3MJHA 1NMXA 4Q47A 4ZI2A 1GAJA 2ZRIA 1E2FA 3FFBA 4FMCF 1WB9A 2OXRA 4QOSA 1Z3IX 1KKLA 4I1UA 5F2EA 3W5IA 4B33A 1KDTA 1UBCA 2F1IA 5CJPA 1XP8A 2VHQA 3LLMA 3EIHA 2IEZA 3CF2A 5DYGA 4MYUA 1W4AA 2BM1A 1L7VC 2CLCX 4TLDA 1M1YE 3U3KA 1AK2A 1IXRC 1G7RA 3IDQA 1LW7A 4CDGA 1WBDA 4RCYA 5JCPA 2RKOA 4BZQA 2GHIA 1U81A 2JLSA 5CDFE 1XX6A 4Q7LA 3E2IA 4YLGA 1QDEA 1CJKC 1E9EA 2QT0A 3QPVA 5FBWB 3UG6A 2F43A 5JSZB 3GLGE 4ACBA 3BERA 4LJYA 2FNAA 2ZYVX 1A4RA 4L9SA 4XD7A 1MABA 4G5RA 3T1OA 4G01B 3HYTA 1SGWA 4QBIA 1OHHA 3P4YA 3SU8A 2RCNA 3TQCA 3QPWA 1JQJC 3PV0A 2F55A 1KMHA 1QVRA 1XCPA 1Q1EA 2EVWX 2ZJ5A 1FTSA 2BMJA 3B1VA 4GBMA 4QHTA 4DRZA 5KNBA 2O8CB 1MR3F 3PEWA 2VHUA 3UG7A 4DDUA 1J7KA 2PX0A 2GTPA 4F4IA 2GJ8A 1IONA 2ZROA 3FB4A 4XVUA 3N5CA 1YVDA 2GETA 2FSIA 4WZBE 2I3BA 3IIJA 3KXKA 2YVUA 2BDTA 3CM0A 4WZAE 5CDFA 3U7HB 1PVOA 2CL0X 2JDID 3U61B 2C2HA 1E79A 3GLGA 1G18A 4PSAA 2KB0A 5H1YA 2V6JA 3NDPA 4LK2A 2FEOA 1X6VA 2ZE5A 3AUXA 3AVYA 4V0LA 1E79D 1Z07A 2BBSA 2W2XA 4FN5A 3GP8A 4AWXA 2IYWA 2G0TA 3CWQA 4FW9A 3CRRA 4PZYA 5IK2A 3MWLA 3U3OA 4EFLA 1R0ZA 4A2WA 1SVOA 3KQKA 4C0BA 1F5NA 5IK2D 4M1OA 5JJLA 2IYXA 5ANRB 1GWNA 4D4LA 5JEEA 2CE2X 2XX3A 4TYYA 1IAQA 2C9YA 1DEKA 1G16A 2OILA 2C8VA 4EQ6B 4DB4A 5TARA 4A15A 1J8MF 1T4GA 2NO1A 3RS3A 1KSHA 2J7PA 2VH5R 2XNDA 1U98A 5FFMA 2H17A 2A3RA 4PPFA 1CJVC 3B1WA 1E98A 2VSXA 4YMUA 2J7PD 1KI2A 4MYCA 2IW3A 4HDOB 2IK8A 2Q6TA 2UKDA 4NYJR 3EASA 5K8IA 4MRRA 1NF3A 2EQBA 5KPJA 1JQLB 3L82B 2JIZA 2HCJB 4A8JB 2HXYA 4IDNA 4HAYA 1S8FA 1N6IA 2OFXA 2OCPA 3QKSB 1G64A 1U94A 3CH5A 5HZHA 2VSFA 3VHLB 4Q4JB 3UMSA 2ZM5A 1T0HB 1YZTA 2A5YB 2DFKB 3D6TB 3DOFA 3TGPA 1IN5A 4CW7A 1I2DA 4JLDA 1RIFA 3GLHE 1S3SA 2AD5A 5TV2A 3AP2A 4LBZA 3KXIA 2WJHA 2C78A 5IHPA 3L2OB 3EWAA 3OAAD 3J81k 4B35A 1Q1BA 3F8TA 3GJXC 4PXAA 4QM6A 4PFSA 4Q9LA 4GZLA 4Q01A 3BB3A 3C16C 1MKYA 3KTAB 1SVIA 3PEUA 3DM5A 2OBLA 3RANA 3NHAA 2B7BA 2O0JA 4WVFA 4PSKA 4IFBA 3SZRA 3AQ4A 4RZ3A 2KJQA 1YRBA 1JJVA 1YU9A 2HEIA 4LHVA 1YZNA 4C2TA 1XEXA 3LLUA 4KJZA 1KI4A 2W2VA 2WPDA 1ZMXA 4G1UC 4F92B 3MJRA 5TXGA 5BW8A 5JHHB 5D3MB 3T12A 1K6MA 2EWWA 2GBLA 4TL7A 2WPDD 1TU4A 2FGKA 5FPKA 2XJ4A 3LX5A 4PO9A 2VP6A 3K70D 3GLHA 1PJRA 1OKKA 3U3RA 4C0SA 1GITA 4BFXA 1G8GA 4Q19A 2V9PA 4OJQA 2PT5A 4E22A 1CU1A 2QA5A 1E2HA 2FX3A 2G1KA 4IXMA 4JL6A 5G3ZA 2E1RA 1IN6A 3N70A 4PAOA 1E0JA 3B13B 4MKHA 2WZQA 1R2QA 1XZQA 2EU8A 4NPHA 2OLJA 3HDTA 4JJZA 2WIBA 3BAFA 2OE2A 1ESNA 3GLIB 4CEHB 2ONKA 1QHNA 1XTQA 2XJ9A 4A1FA 5B58C 3ADDA 3NWJA 3VU9A 2QGNA 2PJRA 5FBQB 2GAOA 1W1WA 1GRRA 1RFLA 4B76A 4BQSA 2O8FA 1FQJA 2R65A 3AKYA 3C15C 3P26A 3AVUA 2WAYA 1E1RD 4G3XA 4PC3A 2JLXA 1XTJA 1HH4A 2RGNA 3R8CA 2IUTA 3T06B 1WE2A 5FTKA 8OHMA 2P5SA 1C1YA 2LCFA 1VMAA 3TVDA 4C7OA 3L0SA 1OE0A 4MRNA 4NL4H 3W34A 3LH5A 1B23P 1IN4A 4HLUA 4OI4A 3FMIA 5TY0A 2NG1A 3NEYA 2WJVA 4LYHA 2NO6A 2D2FA 3U44B 1QRAA 2PMDA 2YZ2A 3SOPA 3KB2A 3GFOA 4P4TA 2VEDA 1R8SA 1G7TA 3EW9A 3QKRB 4PPGA 4DC9A 4H1VA 1KAGA 1KNXA 4U5XA 1G8HA 2GCNA 4TZ0A 2Z5FA 5BN5A 3AVPA 1A82A 3KZ1E 1F2UB 1H65A 1Q57A 2QENA 3QJYA 4HLDA 3PFIA 2YKGA 4DLWA 4Q7MB 4D4JA 2HT6A 1TF2A 2NPIA 2KWIA 3QXXA 4MYTA 4PX9A 1FUUA 3AV0B 4NMMA 1XPOA 3I62A 4HAWA 1YZUA 5EE3A 3W3AA 2A5JA 4PC6A 4MRPA 3D8BA 2QAGB 3L8ZA 3B2EA 1E2JA 1E9DA 3X2SA 2ODBA 2P65A 1DADA 1G4UR 3LBNA 4IDQA 3VQTA 3X1YA 4HB2A 3EG5A 1T3HA 3A36A 3X1XA 3IKJA 3ZVLA 4LZZA 1M2OB 4Q00A 2FFHA 4XIGS 4ESHA 4U7DA 1XPRA 1I4DD 5FUVA 3RRMA 5G40A 2H16A 1ZD8A 1I2MA 1YZKA 1N6HA 3AP3A 4NCIA 4RFVA 2FN4A 3HJNA 1KJWA 3AM1A 4JVSB 1X3SA 4U00A 2W6ID 4PAMA 5JSZA 1VDZA 4Q03A 5CLLA 2C98A 1X1SA 2EFDB 1GRNA 1OB2A 1R10A 5SZIA 1NSTA 4BE7B 2LKDA 3AB3A 1IOZA 3NBYC 1FW6A 1KSJA 2P6UA 3NBZC 4NDZA 1HT1E 2BCJQ 2IYZA 3VX4A 2WWIA 3BS4A 3PENA 4NTZA 4TLEA 3I3SR 2HLDA 3A58B 1RRGA 2MMCA 4K8OA 521PA 1JI0A 1XTKA 4KHZA 4BZXA 1JBKA 2KI5A 4PC1A 4EPVA 4Q02A 3ZZTA 1OPXA 1KK0A 1OV4A 2GVZC 4B2LA 1Z8FA 2O8CA 2CCGA 3KJIA 4LYAA 1N5IA 4KCGA 4KXFB 3P27A 2JAQA 3A4NA 3QG5A 3K0FB 3IHWA 2DFTA 3EARA 4KVGA 821PA 4TLBA 3Q5EA 4B71A 4PSVA 4Q1EA 2ZSBA 5UKDA 2OV2A 1KDOA 5HTKA 1KDRA 2ZI9A 4LBVA 4C0KA 1XD8A 2IWHA 2RGNC 2YC4C 4MA4A 2GA8A 2B21A 1COWA 4NCNA 4BRWA 3K0AB 4TLCA 2ZRFA 3T1QA 4X8MA 2GZAA 4CVNA 3WHKA 3CONA 3D31A 2FU5C 3D7MA 3A1VA 3PEVA 2REXB 2DWQA 4HLUC 1P73A 1FX0B 4TYNA 5JS7A 4L8GA 2VP9A 3NBFA 4M4SA 1BS1A 3KXLA 3HU1A 1VCMA 4BFUA 4M9SA 2D3WA 2WKPA 3NKVA 2JLRA 1DO2A 2PCLA 4F38A 1KIMA 2NMVA 4TQUS 1ZU5A 2QMUA 4EQ6A 4YXWA 2BBOA 5IDVA 3HYRA 4WW0A 5JWOA 2BMEA 1CTQA 4LJ6A 5GVSA 1D2MA 3LNCA 1EX6A 2D4HA 1U8AA 2ZJBA 2GK7A 2VF7A 4YXWD 2MSDB 2VTKA 2BHRA 1TEVA 3GJ3A 2OXCA 4ZDKA 1N5LA 1TQ4A 2QQ0A 4NYJQ 1R5NA 2RGBA 3FVQA 1NNEA 1HY3A 1FL9A 4YQFA 3NH6A 4G5QA 1W47A 1E96A 2Y8EA 4QG7A 3VR5A 1UKEA 4A8JA 1G7SA 2XZPA 4CEIB 1KI9A 1U0HC 4P3YA 1GG2A 2XOKA 4HI0E 2DY1A 4Q4JA 3SS8A 1E1QA 4DSNA 1XD9A 4MQBA 2C5LA 4A92A 5FR1A 3I5YA 3KX2A 4HDCA 2X8AA 1KDPA 2BJVA 1XDBA 3VR3A 4BPBA 4DDVA 5FH9A 1PV4A 1GUAA 3CWZA 3QPUA 3FMFA 1NL3A 3C14C 4B2IA 3SJBA 4DCVA 1Z06A 3KTAA 1FP6A 5CLQA 1WQ1R 4UJ3A 3T5DA 2IS2A 2ZVPX 5CIQA 4ASUD 4B3DA 4QGAA 1JAIA 4TZ6A 1G19A 3HWSA 1XTRA 2Q0HA 3K9LA 1OXSC 3PUXA 2CL6X 4US0R 1CEEA 3LO5A 2FV8A 2XTMA 4HUTA 5IRCD 4MITA 4PC2A 1R7RA 4DUGA 5J47A 1ZJ6A 2D7DA 2ZRLA 5D3MA 3U5ZB 1NLYA 1UPTA 2FZ4A 4IFEA 5K8UA 5KSOA 3TSWA 5DNYB 3FKSA 3L43A 4LUCA 1FMJA 1R6BX 2HCBA 3D3QA 4QGHA 2QT1A 1DAHA 4MGZR 4QBFA 4C9BA 4UJ5A 2DR3A 2RGDA 3UK6A 1N6PA 3FKSD 3PXGA 2CMKA 3W6PA 1YR7A 2ZJ2A 3NBXX 1NLFA 3OHMA 4JKYA 5FOTA 3TUJC 4HZUB 3GJ6A 1NY6A 2WBLC 1G17A 5CM8B 4P33A 1E9RA 2X2EA 3OEHD 1I4LD 1P9WA 2ZQ5A 1Q3HA 4R7ZA 2CCKA 4JVMA 1OSNA 2CK3A 4B47A 5J4HA 1W7AA 2QMEA 1NSFA 5JLJA 1GDDA 3B6EA 3GLIA 3GQBA 5D3QA 1P4SA 3AVOA 3SDZA 1HQCA 3DL0A 2CK3D 3T15A 2PEZA 3TH5A 4R71A 3FHTA 2CCJA 4Q1CA 1ZUIA 2XNSA 4GNKA 2WJYA 3DMNA 4UXJA 1NBME 3NC0C 3HR7A 1EX7A 1NVUQ 3ZQ6A 4Q4AB 5LBIA 3DPUA 5AUOB 1QF9A 1ZNXA 3ICQB 4HZIA 3AF0A 3UATA 2QE7D 4OQNA 1W2GA 4EKDA 2AR7A 3X1ZA 3VX3A 4TMKA 3B7GA 4G5SA 2ATXA 3KJGA 1TF7A 4QGFA 4I4LA 5B57C 3OIVA 1UKZA 3M6AA 3THOA 1U8ZA 2QNRA 2JLYA 3U44A 3LVRE 2UZIR 1VKJA 4CRWB 1KY2A 3K9GA 1OFHA 2J59A 2GEDA 3QKRA 4UKDA 3BH6A 1KO7A 2VHCA 1P7CA 3ZYCA 5L3VA 1AZTA 1G3MA 2I4IA 1ZYUA 1QHHB 3SC3A 4A8JC 4X8OA 3JZMA 2P6RA 3CR7A 1EFRD 1FP7A 2GWHA 4KFRA 4UNPA 3C5HA 1TUEA 3RRYA 3VHXA 2ZUBA 4L16A 1F2UA 2QP3A 3Q5DA 2WOJA 3EX7C 2AD1A 1SVSA 2CDNA 4KLNA 4K81B 4ZCLA 5DN6D 1U0JA 3LDAA 2WJGA 1RYHA 2QBYB 1U8YA 2F9MA 1U99A 2LKCA 1HTWA 1NRJB 1NVWQ 1E0KA 3Q85A 4N0DA 1UEJA 2C9CA 2QAGA 4A2QA 4DCNA 4TTRA 4DZZA 3ZVNA 2IL1A 1AKEA 4A6XA 2JJ2A 1E2MA 5DISB 1Z29A 1OFUX 1YZLA 4R2HA 4GMDA 1L8QA 1UJ2A 2OG2A 2P2LA 3PVSA 4DLYA 3CRW1 1HEIA 1S4QA 4LJ7A 2CVFA 1N6KA 5EXSA 1MRSA 4M1TA 2NO9A 3SI7A 1F6BA 5JZVA 1E2QA 2ZSFA 2NTYC 3THWB 1W0KD 1F60A 5JJKA 1K5GA 2O8EB 1W36D 1GL7A 2ZRNA 4LCBA 4KU4A 4RFSB 2W6JD 4HAZA 2OBMA 2XB4A 4OHVA 5CB6A 2IUSA 2EWVA 3DHWC 4V03A 4CT4B 3THXA 2PJZA 4HYYA 3QSYA 2OBNA 1P2VA 2P3SA 2QRZA 1W0JA 1T8UA 2CLDX 2QSYA 2HXSA 2VP4A 3ZD7A 1CF4A 4KFSA 1G6HA 1EGAA 4GOJA 3VKWA 2PLFA 1UBGA 4AYWA 1FQKA 4DLXA 1G20E 4DBLC 1OFTA 2E9SA 3V4FA 3B78A 3K0FA 2O8BB 4JLMA 1GNQA 1JEEA 4K46A 4Q66C 3CRMA 1E9SA 2ZI4A 1P75A 5CB8A 4QFMA 3BE4A 2GXAA 5EE9A 2H92A 2HV8A 3QXSA 3ZLJA 1MOZA 2CNWD 1N6OA 5GJVC 2ZVQX 1II8B 5HCNA 4Z51A 3K0AA 5C46F 1A2KC 4DEXA 2GJ9A 1KI3A 4Q9JA 3TKLA 4E07A 5FBVB 1GFIA 1UBFA 1CR2A 1G3UA 1Z22A 2GZDA 2V7QD 2AHOA 4I1VA 1W4CA 1BMFD 1FX0A 2ORIA 1E9BA 4Q4HB 4TSFA 2ZI5A 2X77A 3C8UA 3DZ8A 4FCTA 4QNRA 2O5VA 1DG3A 1KK2A 5FOWA 3ADKA 1J99A 4KAXA 1NVVR 1XB2A 2EYUA 4W5JA 1DAKA 3RC8A 1GZSA 4UNNA 2N42A 1XF9A 3O47A 1IJFA 3BIFA 3AEZA 2AL7A 2FDCA 4E09A 4F4JA 3LXXA 1SQ5A 2A78A 5H68A 1J2JA 3SHFA 3I8SA 4OQLA 1QHYA 421PA 4BRUA 2QAGC 2W2TA 5FPSA 3PIRA 1J70A 3QE0A 4CEIA 3OFNA 1KTVA 3WBJA 2IYYA 2ZYUX 3QBTA 5BYJA 1RRCA 1O87A 4MH0R 2V54A 4ILEA 1UADA 1XWIA 3OFND 4RVCA 4Z54A 2PT7A 1G5RA 2GJAA 2DWPA 3O8DA 1GILA 1XEWX 4PTLA 4PPNA 5IF9A 4B75A 1W4RA 4PO8A 2Q21A 2ZRCA 2ZITA 1N3BA 1ZRHA 4TTQA 2BBWA 3E70C 5DGXA 3CNOA 3S1AB 4Q1AA 4TQ9A 1IQPA 3E5HA 4JLAA 2OLKA 1W2HA 1M7HA 2Z83A 3U4QB 1TTTA 1XPUA 2WKQA 4M9ZA 3AVTA 1N0WA 2FFQA 2AK3A 4IRUB 2GILA 1ZM3A 4A82A 1YZGA 3NEJA 3SQWA 2W58A 3KKNA 3U7GA 4TL6A 1AQUA 2QAJA 2RGXA 2QY9A 4AC9A 4WBSA 3BORA 2JDIA 2QRNA 2WM9B 2ZR9A 5JEDA 2CXXA 3LA6A 4GPTA 3PUYA 4F91B 2JATA 5FTNA 3ICEA 5L8VA 1NJFA 4NYIR 1Z83A 3QVVA 4LV8B 1ZCBA 3AVWA 2V3CC 2GEVA 3TAHA 5KYKA 1D2EA 1XD2B 3T61A 4PQRA 2Z0MA 2ZYTX 4GP6A 4HZUA 4AKHA 4URXR 4P0TA 3JZAA 2BM0A 2ZI6A 4Q1FA 4PR0A 4B74A 1JB1A 4AKGA 3B85A 4I99A 1Q1QA 4IVQA 4LJ9A 3IUYA 5KSYA 4HLQB 4KBFA 4C0QC 1TQDA 1JALA 3ZGXA 2ZPTX 2J46A 3GFTA 1W4BA 3GMTA 4IEEA 2WOOA 3BBPA 1VPLA 4ESVA 1E6CA 1FNNA 4XVRA 1Z08A 3BD9A 2TMKA 3ONWA 4IDHA 1OYWA 2B7CA 1KYIA 2WJJA 2WIAA 4AK9A 4ZPXA 5FPTA 1RJ9A 3OE7D 1GVNB 4Q4AA 3ZIAA 4D25A 1ZM4A 1E2EA 1II9A 2IYLD 4KYIB 1ANKA 3QF4B 4ON9A 5E95A 2ZSDA 3B9PA 4GL2A 3ZIAD 1U90A 2RB4A 4E03A 3VNVA 3TJZA 4AYTA 3CPEA 5E7IA 2H5EA 1OIWA 2GCPA 3WMGA 5AWFC 1QHIA 4Q9IA 2H1LA 3WYGA 1SVMA 2PCJA 3A1UA 1XMVA 4A9AA 3KFVA 3BB1A 1E69A 2QU8A 2FE4A 1M34E 2J0VA 1GNRA 1PLKA 1E2LA 2DHRA 2FG5A 2ORVA 4DSUA 3SBDA 3CNLA 3CW2A 3NH9A 2R6GA 4FXPA 4LPSA 5F3WB 2XXAB 2V8OA 1NIJA 2ZRKA 3B82A 4RKFA 4BFTA 2I1VB 4Q18A 4DLSA 5DLQC 2V1UA 5DI3B 3OAAA 3DEFA 1QHHA 3W6NA 5F98A 4QJ4A 2IHYA 3AGPA 3K0EA 1AA9A 4LBWA 3PG5A 3EC1A 2FFBA 3I92A 3LW7A 4BWYA 4DLVA 1N6RA 2DFNA 2DCUA 4RD2A 3RRNA 2IBMA 4CIDA 3AF1A 1Z6YA 4KBGA 1V5WA 2ZJYA 2R9VA 4V0ME 4XWOA 2NZJA 3SQXA 1TU3A 4M8NE 3V4RA 3GLFE 4Q48A 1GNPA 1G8FA 2YYZA 2NQ2C 4IXNA 3ZS8A 4BFWA 4BEBA 4EPXA 5FBRB 3FMOB 1GKYA 3LV8A 5DIFA 4HLCA 5EP1A 2C77A 2YWFA 3EPJA 4LHYA 2AKYA 1XZPA 2ZSEA 4OJKA 2IYSA 4J0QA 5FOXA 4LYJA 4RZUA 2WHXA 1SVLA 3RDPA 3RLFA 2WWYA 1DAIA 4B44A 1ZIOA 3THWA 2XITA 1H8ED 2ZRHA 3RSLA 4ZIRB 3SJAA 4EFNA 4A0RA 2O8EA 1ZP6A 2H8KA 4RFSA 1JXOA 3ADBA 3EIEA 1E4VA 1AN0A 3GJ8A 4RD1A 3VAAA 1M74A 4V0MA 1UKYA 4IOLA 1EXMA 1XXHB 4OQMA 3GFPA 5L3RA 1LS1A 1MRNA 1Z6AA 4N0EA 3MG9A 4Q7JB 3MRSA 1EWQA 3GLFA 1L4YA 4WAUA 1XEFA 4WA7A 3ZZUA 2J45A 2JJ8A 1SZPA 5AJZA 1Q1ZA 3SJCA 4JSTA 1SXJB 3VFDA 1ZD1A 1E1RA 2O0HA 1HQYE 4Q21A 4M21A 3FPAA 4GOXA 4LV6A 4M2LA 5EXXA 2VLIA 3UWOA 1CRQA 2BBTA 2ZR7A 3RS7A 4YDHB 3U6KA 2QORA 1QHGA 4JS0A 1QVAA 4OYHA 4RCZA 5J4KA 2UZ3A 4LPKA 1NMYA 3SE0A 4DLRA 1W49A 2BCGY 4DIEA 4URUR 1CULC 1SVWA 1P72A 3WP0A 3CR8A 1E9AA 1D6JA 2ZRPA 3TNFA 2VHJA 2XEXA 2IHBA 4OI2A 3ZVMA 3MGCA 4GMXA 2ZRMA 3F5FA 4FIDA 1VYUA 3PCRB 4KV9A 1II8A 2JLZA 4KFUA 4LC0A 2OCYC 4HSEA 4O0MA 2J87A 2GF9A 3G82C 4NE2A 1EWRA 5IT5A 1ZM9A 2B8TA 3ZQJA 2GJKA 2MSCB 1QBKC 4CYMA 1E0AA 2IS4A 4XH9B 5AJXA 4Q4HA 2ZIAA 4L9WA 1S1CA 2EFHB 6Q21A 4EJSB 1XJQA 1JAHA 5LD2B 4QM7A 1S96A 4EFMA 2QG6A 1NVVQ 4BFYA 3PR1A 4FCWA 2VO1A 1Y3AA 4IVPA 2YNMA 1F48A 1T5IA 2OFOA 2VRWA 4TLAA 1ZCAA 3VR2A 4JVNA 4BEJA 2ECKA 3E1SA 3EXAA 2VIIA 2FSFA 1G5PA 1WA5A 2PH1A 3AP1A 3DOEA 3CBQA 4NCKA 5FPYA 5KDLA 4ZKEA 5A4JA 3C5CA 1E2KA 3BWDD 4UNQA 4URYR 2JEOA 1TEXA 4D6PA 1LF5A 2AX4A 4CF7A 3A1SA 2OCAA 2G0NA 4FD2A 5BN3A 1R4AA 2I1QA 3LVQE 3BC1A 3DKVA 3R20A 4QXAA 2VYFA 3R9XA 4EDHA 1GSIA 4Z1MD 2OSBA 4Y0VA 1YR9A 3TIFA 2BV3A 4ERNA 3H4MA 1HV8A 1W36B 2IA5A 2OO7A 2W6IA 3RNLA 2GF0A 1NN0A 3IGFA 2GCOB 4LHWA 3RHFA 3ETLA 3OEED 5FUWA 3K70C 3TE6A 2GBLC 1E2PA 2ZR0A 1OH8A 2ZS9A 1MO3A 1RW4A 3H1TA 1G5TA 2VQSA 4X8HA 4FMDB 4KSCA 3FYHA 3H86A 2NPFA 3TSZA 1CP2A 3RS0A 4P4SB 4QL3A 2GVDC 1PLJA 1G3RA 3S1AA 1X8KA 1NN3A 1UKVY 1GTVA 4LJ5A 3T1VA 5EQTA 2A7QA 3DZDA 4TQAA 3DM9B 3U4QA 2W83A 2EFEB 2R44A 2A30A 1P3JA 2BC9A 2ZANA 1WBBA 5EZ6B 5FUXA 2IWRA 2QQEA 1IHUA 2G77B 5EUMA 4Q9HA 3KB1A 4BECA 3QKUA 2D7CA 2ZJ8A 2GRJA 4DDTA 5EP4A 2VF8A 3FGNA 1XMIA 3QXJA 5TVKA 3EZFA 1Q21A 3BH0A 4P32A 4IHQA 3SFVA 3SJZA 1G4AE 4NYIQ 3K8YA 3U2QA 1IN8A 3LFUA 2X2FA 5BXQC 1E2DA 3M1IA 3GJ5A 1XD2A 4B6FA 4AIIA 3ZS9A 1G3IA 1TF5A 4URWR 1CR4A 1BO6A 4FMCB 4NBSA 4KLZA 5AJWA 3U3MA 3W9YA 3MD0A 4IW3B 4NU0A 1ZW6A 1NN1A 3IIKA 3UPUA 4OK5A 2IXEA 2YC2C 3T34A 4B3FX 4RD4A 4QJ3A 3LBIA 3LY5A 4RKEA 3PUWA 2GEUA 3HPRA 4QBHA 4C3ZA 3KJEA 4B73A 2RH5A 2RMKA 4XWAA 2WWFA 1U9IA 1ZUNB 2F1RA 4XSHA 3A37A 3FTQA 2A5GA 4LWZA 1SULA 4BLOA 4B3GA 3AKDA 4X8LA 4KO8A 3LRPA 2SHKA 3QF4A 2EFGA 3QNUA 3EIQA 2GK6A 4DEYA 4LC1A 1F3OA 1GIAA 3VR4A 4P4UA 3OIUA 5AUQA 4LYFA 3CB4A 1X86B 3DO6A 2P0EA 4TL9A 3WRXC 5C4GB 4OK6A 5J4VA 2ERYA 1RVDA 4H9GA 1BH2A 1JECA 2F6RA 1XJ0A 2K5UA 3ZZ0A 4BLTA 1UEIA 1KZGB 5EP2A 3QKSA 4C4PA 2XXAA 3EA5A 3IPXA 1DE0A 1LY1A 1ODFA 1ZVQA 2EW1A 4V0OA 3BFXA 2JLQA 3CH4B 5DI3A 2XTNA 3B9QA 5CYPA 2XZOA 1E32A 4M1SA 3BFVA 3MWJA 2RHMA 4HEJA 2HF9A 4TT3D 2ZU0C 3KDSE 3MMPA 1UDXA 1R5BA 2AXNA 4ASUA 2J5XA 1KKMA 1CBUA 3QF7A 3WMEA 2NO7A 3MFYA 2UVQA 2R6FA 1VIYA 3ASYA 3LBHA 1XXHE 5JMTA 3B1ZA 1P2TA 3UANA 2ODEA 1KI1A 3GCGA 4PHGA 4ZDWA 4AYXA 5KSZA 3GLIE 2HYIC 4GRAA 5M04A 2HT1A 4MKIA 2VA8A 4IJMA 5EXPA 4IOJA 1US8B 5GJBA 4DT1B 1ONBA 3IPYA 1G291 4M1YA 4MKFA 1EESA 1T5LA 3CUEF 3AF3A 1EK0A 4C7OB 3UIEA 4V0NA 3IIMA 1PUIA 1IBRA 2QPAA 1C9KA 1XU4A 1YRAA 1QZXA 3CF0A 1S9DA 5SZJA 1GKUB 4ZIRA 4KFTA 4Z8YA 2YWGA 3OEHA 4B2PA 3RYTC 2ZRJA 4TMVA 1YE8A 4JT4A 3LQQA 4KITB 4RJLA 1GL9B 2ZI7A 4NHOA 5FPHA 1XTSA 1XXHA 3G0HA 1KHTA 1P61B 2D2EA 1VYTA 4JLNA 3A4MA 1CLUA 4TTPA 2KSQA
chains in the Genus database with same CATH superfamily
4CEHA 1ISFA 5B1IA 1FUEA 3MWEA 4ONEA 4CMIB 4O3MA 1T5SA 1UOPA 4RQBA 3TEJA 5IKXA 4INOA 2WV9A 1W5TA 3PC7A 4YMIA 2FPMA 3KWLA 5BYAA 1MJNA 1OWLA 3G1TA 3HDGA 5LQKA 3MUOA 3QVUA 2QE7A 5FWDA 1NBHA 1RZRA 2DKFA 4LMRA 2PXCA 3S2ZA 2BT4A 4N12A 1HT3A 3LUKA 4OCZA 1KZHA 2B3DA 3DE4X 3UVEA 1XZKA 4KVFA 1MO2A 3FYUA 4P4GA 5H4HA 1C7QA 2R1ZA 1MBZA 5JS1A 2ONCA 4DRXB 1QAOA 2P2SA 5HW0A 1F3LA 1M1XB 5ESRA 3H99A 4R9NA 3ZV5A 1JJBA 1UC5B 4B3TB 2Z4SA 1VE6A 4IGIA 3ZK7A 2I8LA 3CRVA 2BFDA 1D9XA 3B1FA 5HNKA 2QYTA 1SU6A 3FA2A 3AM3A 1RTTA 1TCBA 1U6JA 2F2TA 4MRMA 4RH0A 3LUFA 3Q10A 2ERXA 4HS4A 4I3GA 4US1R 3VR6D 4DJEC 4EHLA 4EUHA 5G41A 2QD1A 2QTBA 3Q3IA 5D6NA 4ALKA 3KAKA 2XSZD 3KAJA 4HUQB 4KIUA 3C3JA 4WLEA 3AFOA 1KIFA 1T91A 5DN6A 3N2IA 1PNQA 3EVDA 4JVOA 2ECQA 4R1PA 4BATA 3WLJA 4J6FA 4WIAA 2I4RA 4BO0A 2I3AA 1ETHA 3R24A 4KIJA 1N1EA 4H1UA 2Y1WA 4CF3A 3HH8A 4WESA 4ITVA 1AZSC 3VSBA 4DA0A 1K8YB 2QTRA 4NP6A 4QNMA 5CVDA 4KQHA 4RTKA 1T0BA 3N7AA 3UH1A 3GPIA 1WV1A 1XAHA 3EH2A 4WERA 4XSGA 1KC3A 3M1LA 3TSYA 3G13A 3B7PA 2A1UB 1TD9A 2Y1DA 1RYYA 1RM3A 3BQ9A 4DHEA 4Y2JA 1DZIA 3BFKA 2GB4A 4XKJA 4YJGB 2YZGA 1KZ4A 4ZT6A 3QVTA 1JDBC 1ZM7A 1WXQA 2G7MC 2W9XA 3P9SA 2N75A 4KN8A 4O1MA 5LDGA 1BYUA 4Z4EA 4EELA 1JX6A 4LCEA 1XCGB 1I6LA 4OLFA 3KRTA 4J1TC 3DGFC 1OC4A 2PWYA 4GM0A 4K9MA 2HPZA 5F1OA 1NBMD 3EWNA 1QIJA 5BQXA 1O6CA 4PZ9A 3S0JA 3BZBA 4OI0A 3KKMA 5A3RA 3PUHA 2VDWA 4DCPA 2GCOA 2YRFA 4BNVA 4V2UA 1KJQA 2HRRA 1D6MA 2YHSA 1WRBA 3PNVA 3TLCA 3KEMA 2NTEA 3LGXA 2GN8A 4W4TA 3EZYA 4NFLA 1UT8A 1DI0A 4EGFA 5LZ9A 4L73A 2BTQA 2VTBA 5HM8A 3DBIA 3OZSA 4P4SA 1NJ5A 2EKDA 2W0SA 3H2HA 3MAAC 2VT3A 3TLKA 4YJ3A 1V4BA 1N2IA 4LDRA 3BHNA 3AU8A 3BULA 4HAUA 4NZMA 3KSBC 3SEFA 2R6HA 5KTOA 1DPFA 1S3GA 3T4XA 4BPRA 1YVPA 5LWQA 1X1TA 3B89A 2HTFA 1PT7A 1U3GA 2P4HX 4AJLA 4HKTA 3OLVA 3OMWA 2PRKA 3G2NA 4PRYA 4WXRA 3ZCRA 4PG6A 5DU2A 2DUMA 1MLDA 1AGNA 1F0KA 4I50A 3IMKA 1DARA 4KWCA 1Y1KE 1DC4A 2ASEA 3QU2A 4QUDA 4DQVA 3RVRA 4GXRA 2DPGA 3BWXA 2I9KA 2J3KA 1SD2A 2EXXA 4PVDA 3OG9A 3I9OA 3HI6A 1CWUA 1E6UA 4PX5A 1EHYA 4RSMA 5U4XA 3GN1A 1DOAA 1GU0A 1AS0A 1CY8A 2DUWA 2PG3A 2GF2A 4AURA 1M2HA 1E5LA 2O20A 2QJRA 1GQSA 1MW8X 5T3YA 1XYVA 3CCCA 1EVZA 3C45A 1Q91A 3FPBA 4EF4A 4LC9A 2PZKA 3WYNA 1KO8A 3VDQA 4C4TA 2ID7A 1Z34A 3GT7A 3PD0A 1PE0A 1JQEA 2BEJA 2GMWA 1VC2A 2OEPA 2R6CA 3EA0A 3L01A 4R1TA 1SBYA 1OY1A 2HRZA 5H59A 5CYGA 1S2NA 4G1BA 4D4MA 3UMFA 5KTMA 3KWMA 2WILA 3DLTA 1JDPA 3PJFA 3RASA 1JKJA 2C4NA 1P2UA 2QVBA 4PZUA 4FS3A 1QK5A 4LXTA 4YIKA 5EESA 4AU1A 2FWJA 5JXJA 3RC3A 1AKTA 3H5OA 4ZT5A 2JFXA 4UEOA 2HQOA 3ICWA 1PT5A 4RPCA 1PV2A 2WAMA 3CEAA 4IDOA 5JAHA 4UUAA 4EGCB 2AMVA 3CVUA 1WB6A 3KCNA 4V2IA 1LLUA 3DKPA 3WRYA 4PN3A 3RSFA 4S2EA 2ONJA 3IEXA 4B6QA 2J08A 1ZN8A 3F7MA 1T9GS 3AESB 1PR0A 4TYPA 1KDYA 1T9DA 3EGXB 4IMIB 5I4KA 2J3JA 2ZUVA 2JA1A 1GCAA 3TLJA 2GUWA 4WN9A 2OHIA 4W7HA 3WISA 1NMZA 4RMNA 121PA 1KJYA 1OI4A 1ZBQA 2RAUA 1I6WA 1OX4A 4QBGB 4Z8XA 4ZVMA 3DP7A 1JIKA 2EJBA 5IULC 3S40A 3W4IA 2FW9A 2QN9A 5FF9A 1VBNA 2EL7A 2QVZX 1PJSA 3F0TA 4JSRA 5BRAA 4DKJA 1JFFA 3IELA 4N48A 2IT1A 5EKUA 2GKSA 3B1XA 1QO9A 3ILSA 3SIRA 5HMMA 1II0A 2R6AA 4S04A 3ADCA 3LTNC 2P5TB 1U0RA 3ESBA 4RS3A 4AQDA 2FX5A 3MQ4A 2IXTA 4M22A 4DCSA 2CYBA 1EUYA 1P1IA 1QF7A 3ED1A 2O5RA 3L0OA 2PRIA 1KBOA 4A3SA 1RBQA 4J3JA 4BJ3A 4EJ2A 1RZ3A 4JVLA 1QP4A 1TMYA 4B32A 4YRNA 4PIMA 4BO5A 1PVVA 2YX1A 1HUQA 2XBMA 1OTHA 1MN6A 1M8PA 4ZCMA 2CL7X 4B4KA 1O94A 2NQ8A 1DHRA 3C3EA 1NW3A 1DKOA 2YIJA 5JSQA 4EQZA 1YK1A 3WE7A 2NV2B 3W8NA 2VJLA 3NYIA 1DL5A 3LQYA 1JKIA 3H11A 1T4DA 5EIEA 3AI3A 3C87A 2PBRA 3VJMA 3WDKA 2ZS8A 1YV9A 2W00A 3CLSC 1T5DX 3GDWA 1QAMA 2ZE6A 4RZ2A 2PWZA 1W4LA 4KPFC 1ZOPA 4LNAA 2WF8A 3GJYA 1US8A 2O7SA 2W8BA 3N74A 3NEAA 4TN1A 3ZN2A 4DMUB 2ZFUA 1IQ0A 4DT1A 1EUQA 2FFAA 4PONA 5DW0A 1KRHA 4WEQA 3BD8A 3P45A 4M9XA 3WKAA 1GHTA 4QU8A 4JSYA 2O8BB 2FPWA 1RCUA 4NFHA 1YS7A 3G7UA 1BWQA 3HVUA 1JEDA 1H2HA 2VJCA 4KWTA 5CEJA 3KHSA 1YKGA 1LVUA 1KQ3A 1Z0AA 2ZRGA 4ARAA 3AUTA 2AEMA 4XD7D 5TMEA 1XQXA 2H08A 1XDGA 2XDYA 3IULA 1T3ZA 4IQ8A 4HEQA 3DWGA 1P6QA 9GPBA 4LISA 1ENYA 4IIEA 3EVGA 1OHHD 4A8PA 1JN0A 1T26A 2WVJA 3FGOA 4AP9A 3D3JA 3VI3B 4YP1A 3W8RA 2HHAA 2FPXA 4FUTA 1QDUA 4MS1B 3DV2A 1C3JA 4BKUA 3IHLA 2AOUA 1SC1A 2QTGA 1XTTA 3K71B 3C8DA 1SKAA 4QBKA 3VV3A 1M83A 3KL2A 4WNIA 4TMXA 5T67A 1R0RE 4ZEMA 3GUUA 3ZTWA 4BQOA 3ZDBA 1NW8A 4CMIA 1NY5A 1JDNA 5K0BA 1V48A 2HR1A 1NF9A 1IHXA 2NYUA 1NM5C 3QKWA 4IFTA 3LC2O 5KQRA 3DLIA 2I2FA 3KUDA 3BCRA 3F7OA 3I4LA 4BFVA 5DBGA 3L3BA 5IJAA 4L4UA 1GOTA 2NZ2A 3IUJA 3JTMA 3OY7A 4U3JB 3CHYA 3VNRA 5IDWA 1QCDA 1EHIA 1P9RA 1Q11A 1EZ1A 3I9MA 1R9GA 4TKMA 3WRYC 3TJRA 2W6PA 3TQFA 5C35A 3INYA 5CLJA 3ZJTA 3P2EA 2ZEJA 1C9DB 1DX4A 1C3LA 2QI9C 2JKYA 3HFSA 1ZWLA 4DRXA 1N0IA 2QD4A 1H1DA 5GOTA 1H2WA 1GPH1 1GCOA 3B5JA 3SFZA 3U7FB 3B3JA 2PUBA 1F5SA 3C3BA 1TJNA 4XVHA 3UAWA 2FEMA 2IYUA 2VQ6A 3K53A 2P67A 3MTDA 1CJTC 1HDZA 1NVEA 1I1OA 3DSRA 4GLFA 1M76A 3S8YA 4BHTA 1EDZA 2K2WA 3I72A 4JBYA 5C32A 1WCV1 1VZ3A 1XFAA 2PKQO 1Y6ZA 3UAGA 2IODA 1MQSA 1QE0A 4HUQA 2V0CA 3DDNA 5E0KB 1B0AA 4PS1A 1AHIA 1BC5A 1GTJ1 2XNDD 1O3YA 3C48A 2BEVB 4JA0A 2CHGA 3DAYA 3KPWA 2DBQA 2Z95A 2MDTA 5LL6P 2IH4A 1P9NA 1CEQA 4QPDA 4C43A 5BW4A 1GQ2A 2FN7A 3EVFA 4CBVA 2NT3A 2QLJA 2ZRDA 2O8DB 2G07A 3GLSA 3GZNB 2PH3A 4G8DA 4MGIR 4QTZA 3E2PA 5KU7A 2GZ1A 2X1VA 5JWRA 3I39X 4GI3A 2HWYA 3R0XA 1X2EA 2JFBA 2L19A 2A1UA 4K8RB 5K4GA 1LF0A 3FR8A 3ZKWB 4KMMA 1I4WA 3QVJA 1JL3A 3KQYA 4GD3Q 1F2DA 4YJGA 1O94C 4EUSA 3OOSA 4FWTA 3OMLA 4LTMA 4BO9A 1QIMA 2VDVE 3G17A 3IVCA 3MXOA 3QYAA 2J9GA 4M60A 2PSSA 1ETUA 4JJAA 3EGCA 1PLLA 4LMAA 3R5XA 4R8VA 5CM9C 3E05A 4IF4A 5KREA 4CQNA 1KYVA 1GGNA 4GR4A 2BWJA 4NOLA 1W48A 1L7OA 3H6KA 1XZEA 4Z9AA 5TB5A 2YXNA 3S2UA 4E2FA 5LYJF 1J2EA 3NWPA 3OZBA 1UT5A 2Q3HA 3VYWA 4CLEA 4EPYA 1T2VA 3H4VA 4PYLA 1C41A 1VL2A 2Q62A 4RMIA 4OREX 5DHSA 3ZWKA 2GZHA 5T4HA 5JPDA 2ZZMA 4AY2A 4LJ4A 4B3BA 1T0UA 1XKXA 3FTNA 3K0BA 4JB2A 2F59A 2JRCA 2AW5A 2ISQA 1WY7A 4FKZA 5DNCA 2H1WA 2YICA 6YASA 2BMVA 1Z6XA 2H1HA 4PBTA 4U0KA 1SKYE 1ZUD1 5DFAA 4DCUA 2AOXA 2WABA 3RVMA 3GY0A 4POAA 3TLAA 3ZJ5A 5KIAA 4PGMA 3OE5A 4UU8A 1FFWA 4G63A 2IOQA 1QYXA 4L95C 4YP9A 2HJHA 5KWIA 4NYMR 1Q22A 4R9UC 5LQRA 1AIPA 3IE2A 1IZ0A 5B1SA 4BAGA 5AKEA 4M8LA 4DG5A 5GP1A 1GQOA 1I01A 2ETXA 2QTLA 4LRWA 1N75A 1ZICA 3HU3A 2G82A 1FS5A 3I2HA 3NBQA 5L53A 4ZALA 3I37X 4JENA 1UJBA 3QNMA 2FUKA 3MUNA 1G2IA 2R97A 3OPNA 2Q5IA 1ZHHA 1ZI9A 2QOEA 4JR2A 4QQKA 1GO2A 7MDHA 2HF8A 1R16A 2VC2B 3QXGA 2JIQA 3Q8KA 1PR5A 1Z2DA 5EJAA 5JH7F 1S0UA 1WMEA 4G1MB 2QJOA 1R0KA 5KOYA 2G80A 3IMEA 1EFUA 3GO4A 4TV8B 1XDWA 2RAPA 2E6KA 1GV0A 1OXXK 4JI8B 2NO5A 4MDEA 1U7TA 1ZC3A 4B85A 3OCZA 4QGGA 7MHTA 4C06A 4ER5A 2QRGA 2I6XA 2QB5A 1QLJA 3TQOA 1LV8A 3SP1A 1G9SA 1PZFA 3G9ZA 4B34A 4ZI7B 3DD1A 3F5DA 2HV9A 2J7KA 1OH7A 4IZHA 1N6LA 3ZX5A 4UAJA 4BTEA 3FHCB 5KC9A 4HAXA 4K03A 2M98A 4RPLA 5FA8A 2B8WA 1J7JA 3E5RA 4CM5A 1OW3B 4DV6B 4XB2A 5JAUA 3FOFC 4FFVA 3SS9X 4NPCA 1Z5PA 5A5VA 1IBMB 1VLVA 4M9CA 1QHXA 1NYQA 3AESA 3RUEA 3KCQA 4FTWA 4LFCB 3W90A 4RTSA 1IJEA 2X5NA 3A3NA 3EGXA 4Y1GA 3SQDA 3TW0A 1WOYA 2INGX 2HU8A 2IITA 1OLOA 2ATVA 2R87A 3OETA 3REFA 4BP9A 4Z7NB 1RABA 2P9JA 3TRJA 4BU0A 4UDOA 4UBLA 1R4ZA 2PBFA 2CB9A 4O4JB 3HKDB 4WNCA 4QSHA 2COEA 1GEEA 3CO5A 1SQ6A 4LHXA 4LY9A 1GDHA 3A25A 4QPJC 5DYYA 4IZOA 5IJZA 4GOKA 3Q72A 1PFVA 4ZRMA 2Z3WA 2JHGA 3OF5A 1EAYA 1JG4A 1FFYA 2QL6A 4GZMA 5L40A 2DHQA 1ZEJA 3I73A 3RSOA 3JWPA 2PR2A 1ADBA 1FY2A 2Z5VA 3AI2A 4MPPA 4B3IA 1X2BA 4MV4A 2P9TA 1Y4UA 4RQUA 1WZCA 4G4GA 3TUZC 3E5NA 2BDEA 5EIFA 4BUCA 5JASA 3I5AA 2PZEA 3LXRA 1YR3A 4MVWA 1IH8A 5LP6A 3AIMA 3L1IA 1YTLA 4P3PA 2FGJA 2A0UA 1QWOA 2CY0A 1OXMA 2GUGA 1LNQA 2OESA 2AEFA 3ET4A 3K1ZA 3QBDA 4JP3A 3SC2B 1TW2A 2KBEA 2WD7B 5AH0A 3X3HA 4Q9KA 3DZIA 4JJKA 3WGMA 4EFDA 2VPXA 2H18A 3H8VA 2FETA 2PDAA 3EGVA 5EJ2A 2Z4RA 4CODB 5KJ6A 3W6ZA 2JVKA 1Z2AA 3V48A 4LDJA 3WGHA 5IVHA 2F17A 4J0FA 1PHRA 3OF3A 5LPNA 4KE7A 4O63O 5IZCA 3C3AA 2C5HA 4MW4A 4H77A 1AKRA 4TVKA 4DPLA 3VVBA 1SJ9A 3CIOA 2QMHA 5KDDA 1OH6A 1F4LA 3I28A 4A0FA 1IN7A 3MWKA 3S2EA 3AYXB 3FYCA 5JZBA 5KUTA 2O8BA 1MB2A 3FZNA 1MG5A 2OZVA 3IUEA 5ESDA 2EJWA 4H2DA 1MJHA 4J9VA 3Q3GE 1U2RA 1EVKA 2J5QA 4S12A 5C53B 2XTZA 3FTDA 1FLAA 2PUEA 3MBOA 1G9TA 1QZTA 4DQLA 2BIFA 3K31A 1TEZA 1L4UA 3JXEA 1JT9A 2W0MA 1KP2A 5ALOA 2O19A 4EGQA 5T3UA 3A2NA 4PLGA 2RKBA 1XTIA 1WP9A 2ABWA 2QVLA 4MS1A 2F3TA 3AR4A 1Y7IA 5HFAA 4IILA 5FXMA 1U2TA 4PSUA 5B2ZA 3NIBA 1T43A 2NZXA 3HKBB 1AA6A 3DD5A 2QTCA 4LQCA 2YWEA 3MSXA 4O08A 3FIJA 3WYFA 4B8YA 1TZJA 3I45A 2DYKA 4R5MA 4WT7A 3C3DA 4AJNA 2WTMA 1RR6A 4KYUA 1PUJA 1NLUA 2QGZA 4P6VF 4M1WA 4H6XA 4Y9UA 1U2EA 3CW8X 3D6FA 3OX4A 4FWIB 2WJPA 4U3JA 5FOQA 1QRTA 4K9KA 1JLHA 1ZM2A 1XK6A 2AXPA 2E2WA 4B81A 3ERCA 1HK7A 1COWD 3RE1A 4TPKA 4TZTA 4BVHA 4NVRA 4PM4A 4FGJA 3P52A 2ZXUA 4N1AA 4MPJA 1RE0A 1ZJZA 4EO9A 2PFKA 3P5SA 3QIAA 2Q9BA 4P5PA 5HGJA 1GAXA 5C3MA 1WTAA 3GNSA 1YJ5A 3DNFA 4FYHA 2FXIA 5ALLA 3LVFO 3R3SA 5EZYF 3MJVA 4E0BA 2H48A 4UMDA 3CO0S 1K5DA 2REOA 3DMHA 2C2ZA 3TAXA 3UKJA 4BO1A 1ZR4A 4BZPA 2PPLA 1HDIA 2YZMA 4NE7A 1KAMA 2H51A 3EAQA 4KIWA 1XZHA 5EP3A 3ZXYA 4TT3A 2GBPA 2PXAA 4CU2A 2J6BA 5K6RA 5IYZB 2RCYA 1FMCA 1GTMA 3ETGA 3AK4A 2EIHA 1QYVA 2JHCA 1PWHA 2BEVA 3QFCA 5E4JA 3WYEA 4XRGA 4Q9AA 1B6SA 5I51A 4JP5A 3QG1A 2FLVA 2FXVA 4GKVA 1JT2A 1UWCA 4N82A 5FKJA 4QRHA 2O8DA 3GZNA 4N3NA 1SCDA 5C18A 3CEMA 5BSWA 3I2GA 6GPBA 1CK4A 1FS6A 1E1LA 5DE3A 4YDRA 3TSOA 5LP6C 4B3XA 3A2LA 3OM8A 1VL8A 4UCFA 2NV0A 3V00A 3ZKWA 4DLKA 1RP7A 3VTZA 3F6BX 3NOXA 3H84A 5SY9A 3W3ZB 4D8UA 1YL7A 2HPHA 1G6KA 2G1JA 3F47A 3OC0A 1IUOA 3P0FA 3P0JA 3TMKA 1IM5A 3QUSA 4FUQA 5JC8A 4INPA 4DXAA 2F3QA 1VE3A 1E1QD 1M6VB 2IF0A 2V45A 3BXZA 4M7PA 4RK1A 4F2PA 4BV8A 4G4SP 4RMJA 2QL9A 5FBHA 5IZCC 3LSTA 1JIVA 1TIBA 2DGDA 2JGNA 2AE1A 4FI3F 2IOFK 1Z8HA 5AVXA 3ROXA 2B30A 1VJRA 1AMNA 2IOYA 5AFSA 1CW2B 4ZMRA 3ZBTA 1H22A 2JFOA 3DV9A 4FT2A 4G36A 3IQXA 3TRDA 1RZVA 2FA9A 4YRZA 3DR3A 4GGPA 3PFFA 1Z0UA 5EIXA 1HEYA 4YMGA 1JQBA 1LW6E 4BKOA 3C39A 4ZQGA 2F1JA 2B8EA 3UJ7A 2XUKA 4KQEA 1UPBA 1HDGO 4IHJF 1QKJA 2N0SA 3TRFA 4JV5B 4OX9B 4IH4A 1NOJA 2ZWPA 5HE9A 1THMA 1B74A 1XZLA 4DSTA 3NAZA 2WT9A 3C4VA 4FGSA 4M9QA 2JEYA 4E2XA 1NT4A 1KSFX 1PWXA 3PCTA 3LDUA 5SZHB 3MMSA 1H6CA 4KXLA 1ISGA 1G60A 3O4VA 5EE0A 6PFKA 5DYIA 1E3WB 3CZPA 5TEWA 5C8YF 2WE7A 3GD7A 4J2HA 3ILXA 2GHTA 1ZIPA 3D0RA 1KGDA 3KM0A 4FFNA 4OF4A 4WZ6A 5ALXA 5HBRA 2QK4A 4ZJYA 1FCJA 1DZ3A 3JQ8B 3RUIA 4GFDA 1MOPA 3JQ7B 4TXMA 1KQPA 1RJGA 2NIPA 5FA5A 3ZH9B 4CM3A 3JQBA 4L9AA 1WW8A 3OBBA 4YAJA 4F45A 4TV8A 4DDWA 3IT3A 4RACA 1EK2A 4S1WA 4YA6A 1XQ6A 5MGBA 2IX3A 3NOOA 4IG4A 5ILGA 1RRKA 4RHEA 1EIWA 4IF6A 3D6JA 5DHRA 5K0CA 1PP4A 5JZOA 1CUFA 3R7NA 2Z30A 1ST3A 2HSZA 3A8TA 4M1KA 3NDBB 1KIAA 4PW0A 4WZAB 3T5BA 1UJ5A 4JP1A 4H1WA 2A14A 4ZI7A 1DNPA 4JU8A 3RUFA 2ZIXB 2BHNA 3M6IA 4NAUA 2AVDA 1VMKA 3LLVA 5JBNA 1NI3A 3G8CA 1M2NA 1J0DA 4Z2YA 4HH3C 4I5IA 5J1SB 3L7MA 4PQYA 5K8LA 2OAQ1 3T0IA 2OENG 4N6NA 3TZHA 4M3NA 2HO4A 2OQ2A 1IXKA 1YGPA 2PKRA 3H8JA 4LZNA 1EH5A 3ECCA 2DKNA 3FZEA 4TQGA 4DABA 2NZWA 3KUKA 3A32A 1FXSA 1X9IA 1SCKA 1X1BA 1XI2A 4PHTA 3OTQA 2QTHA 4QUIA 3PYMA 4O4JA 1NJGA 3HKDA 1NAHA 1R18A 2NUBA 3KPVA 1SHKA 3O8BA 4Y9RA 1C7FA 1J0CA 2ZBDA 3NBMA 1QO0D 2PZFA 3GARA 3L77A 4II7A 1RAAA 3HUEA 5P21A 2KS6A 5JVDB 1XQYA 2BDUA 3DCIA 1JXMA 1DO0A 1JPUA 1OU4A 3I6MA 3CLHA 2XGMA 2VRCD 4GZ3A 1RWNA 5K4AA 3BRCA 3B36A 4EB6B 5KQPA 1ZMBA 3P9NA 1NJSA 4RH1A 3ZVKA 1D9ZA 1M1ZA 2AN4A 1MVLA 2XOEA 3FTPA 1Z2CA 2GDZA 2VHTA 1KEWA 2WM3A 3DHVA 2CNKA 1VTKA 3KD3A 4OBEA 8MHTA 1KEKA 4WE3A 4OHUA 5CT9A 1T6NA 3L0IB 5L4SA 1DLJA 1DJQA 2BFBB 1MNQA 3SC2A 2GXQA 2ZUUA 2NSLA 3FNFA 4KWEA 4EB0A 4DSZA 3IMGA 2WD7A 4NEHB 3OLQA 3I5XA 4ZJZA 1Z63A 2DERA 3GVCA 4WOPA 4NU5A 1JRLA 3V2HA 4ZYWA 5ENDA 3UJNA 2PNFA 1CR0A 4YMWA 4KR9A 3O8CA 3ZWYA 5J2TF 2CGEA 2DU8A 4FKMA 4X1YB 4F85A 4JEIA 4EGAA 4URVR 4R9SA 3RPEA 5HEKA 3IO3A 4X92A 1R5JA 1H93A 1YJCA 1YL6A 1Z68A 4KSBA 4RD3A 5HIKA 1YA4A 1XJCA 3T9AA 2UUBB 4UTOA 1U5AA 1MAHA 2I4NA 5BMVB 2WFAA 2D0DA 1UM8A 1U9ZA 4FZ5A 3QY0A 1QVZA 3CH7A 4IO0A 4NU6A 4RV5A 4UAUA 4GKBA 3M4YA 2N1MA 1Y1TA 3N8NA 1Z6ZA 3CNQS 1BROA 2SKEA 3OOHA 3PRJA 3RROA 3PSAA 2PD3A 1VHDA 3EEIA 3H2GA 4G07A 3WK4A 5HM6A 3NGLA 1P29A 5FL7A 4RJIA 4O1IA 2RC5A 4GLBA 1Z3CA 2IV7A 2PRZA 1ULTA 3VU9B 3C6MA 2UV8A 3ILHA 1R4MB 4Y0AA 1GA4A 1W0JD 1W8DA 5J4LA 2VDOB 4QASA 5CX1B 3Q7PA 4UNIA 1T8RA 1FDUA 4G89A 3TO5A 3V32A 3JQBC 3JVDA 3A6PC 2JCSA 2XQVA 1E6LA 3IUPA 2I91A 4A2CA 2AN1A 4I55B 4XVQA 4RA9B 4LI0A 2BI4A 2FH5B 1SPBS 3FFAA 3GEBA 4KDCA 3HKBA 2R7KA 1ORDA 4JLKA 3DL2A 3OIYA 3OWXA 3RVQA 4C2BA 1Y98A 4F8YA 4Z99A 3EWSA 1OQAA 4ZPJA 3LDFA 4FMDF 4I2VA 3UUWA 5GADl 4A1OA 2VRBA 3OCWA 2ZDQA 2A5FA 3CFYA 1T8TA 3GZJA 2PMCA 5EZ5A 4WFJA 3R7SA 4WSOA 2W93A 1DV2A 1VECA 1ZJ4A 2V8BA 2XKAA 4UMEA 4UULA 2Q9CA 2ZUTA 2RFLA 3SR4A 5JT1A 3U7IA 3KD2A 4MX8A 2O52A 1VJDA 3KQUA 3AUYA 4NKRA 1T0JB 4N18A 3IQDB 3MPOA 1DQRA 3V55A 4XTRA 5DM4A 3UJPA 1JR4A 1LB1B 1TM3E 3UF0A 1EE1A 1NN5A 5T4FA 5AKLA 3BIJA 5HX7A 3AF2A 4OUKX 2PU5A 4PHHA 2GAAA 1OWMA 2NVOA 3HLYA 4E5NA 3PWSA 4GMFA 3Q8LA 1QIKA 3LFTA 2Q5FA 4D4KA 4Z0PA 1EFCA 5DLYA 2UXDB 1DWUA 2YIDA 2FK7A 3IBYA 4OK3A 1WF3A 4RQTA 3U7RA 4J7CA 1NVBA 3ZBPA 4F7WA 3FWYA 3WBKA 4EIWA 3AM1A 5EE1A 1BEUB 3P7MA 3I1JA 3NUGA 1CC1S 5HMLA 3DDCA 3MJHA 3TD6A 5IYZA 1VE9A 9ABPA 1Y6GA 2HBRA 4ZI2A 1P4RA 2WD8A 3K4PA 2A1IA 4BBJA 1IQRA 4AO8A 3LCVB 4QTXA 3A06A 5DOZA 4LF7B 1J09A 3WMXA 1CEXA 4I1UA 5F2EA 1KDTA 3NHSA 2X86A 4HMOA 1BVRA 1O6FA 3WDLA 5LFAA 2C9MA 3UOWA 3QUTA 3FMVA 2BM1A 4B3JA 4X71A 4KDEA 3U3KA 4CDGA 5K09A 3BHMA 4DIFA 4TVBA 1XCLA 3GGPA 1X1CA 3OI7A 1U81A 1NT2A 2JLSA 2XQGA 4AX4A 3RRFA 3ZK8A 4E7PA 3WWYA 4U2BA 1AKVA 4YLGA 4ZHQF 3GMSA 1A7UA 1CJKC 2O07A 2QT0A 1DDGA 1XXLA 1M6VA 2QR3A 4ACBA 4QVKA 2EP7A 2FNAA 1QPGA 1P91A 4L9SA 1LDBA 2FDRA 3R40A 3L92A 3OPMA 1JEQB 3T1OA 3N07A 5J59A 1SGWA 2XCUA 3P4YA 4RL6A 3RQSA 3O8QA 2ERCA 3QPWA 3AG6A 3KSDO 1J5EB 1F12A 5IS2A 1WKVA 1XCPA 3DA8A 3NFYA 4OSPA 3S3TA 4GBMA 2ZJ5A 1CUVA 1T35A 1L4KA 1V4NA 1ZJ5A 1ZSYA 3KLNA 4FHGA 5JMWA 5KNBA 3FFTA 2DUNA 1ZW1A 1N2HA 2VHUA 3NXKA 4F4IA 2GTPA 4HQNA 2EKLA 4PRLA 9LDBA 1IONA 1HXHA 4YJ2F 1FNCA 1Q2XA 1WUTA 3FBTA 5IMBA 3L6EA 4BBZA 5A3QA 1L8OA 3X2EA 5KNBD 5BW5A 1D4FA 5CDFA 4CNBA 4N7BA 3GA5A 4Q9DA 4BJHB 3P0EA 4HWKA 4OOFA 5LMNB 1PVOA 2GARA 4I3FA 4NBVA 1I2AA 2CL0X 3CT6A 2C82A 1C8VB 4KPUB 4ZYYA 2FFJA 4HGQA 4RXMA 5L3ZA 1KMMA 3G02A 4IQFA 4TN5A 1L5NA 1ZVMA 2QLMA 3ORRA 4M54A 4DMRA 1E3WA 1X6VA 3AUXA 3DGEC 4A26A 2EKPA 4YNBA 4F2HA 1T0PA 3AVYA 3GV0A 2IKQA 1D2CA 2DPMA 3JQ8A 1AUXA 5LN1A 3DF9A 3JQ7A 3HUTA 3RHZA 2MCFA 1WLSA 2BFFA 4WY5A 1D7AA 4YACA 1P6UA 4TKUB 3VHXB 5JJLA 4MQ5A 3FNQA 1GWNA 1R6VA 3SWWA 3HA7A 3V6MA 4H15A 5JEEA 1U6IA 1O9GA 2XX3A 4TYYA 3W2GA 3RF6A 4BNGA 1FFCA 3RSGA 2OILA 4DB4A 4EQ6B 1VRCA 2ZSUA 2RAFA 3P9PA 4WZAA 4IQ4A 4OIFA 4BB6A 3BIWA 3RS3A 4UAVA 3WWDA 2ZIXA 2VH5R 1U98A 3D6UA 4X90A 3S8EA 5DLPA 2CLKB 4NBTA 4CDRA 4ENVA 4BNFA 3B1WA 1OU0A 1WHSB 1WZEA 2HCRA 1GGFA 2O2IA 5ALKA 3WHPA 4YMUA 4DCGA 4MIOA 4LN1A 1OA1A 3KOZA 4HDOB 2Q6TA 2UKDA 4CUJA 3EASA 5K8IA 3P5BA 2Q0SA 1E1NA 2M6RA 5EQJB 1MB3A 1JQLB 3L82B 1EGHA 2B3TA 1XN1A 2P5YA 4REOA 1Q7CA 4IDNA 4D57A 5KOJB 4JI4B 1DWOA 4C4YA 3QKSB 1G64A 3BYZA 4JASB 3AQIA 4R8SA 2NN3C 3E81A 3E3LA 4N65A 2ZM5A 3G7SA 1FW8A 2I2BA 1RWWA 1QKIA 4NZPA 5DBHX 2AD5A 2VHWA 3CNBA 4B84A 4JK3A 5JVDA 2WJHA 2C78A 3OAAD 4POOA 4B35A 2FWBA 1KWKA 1R1DA 3GJXC 3LY9A 2B4RO 4ETWA 4GZLA 5AKZA 4EB6A 2CKDA 4B7CA 2A9QA 3RANA 2A9JA 5CGZA 3FGPA 3NHAA 3VPHA 3UXYA 2Y2VA 1A8IA 2C92A 2KJQA 1YRBA 1YU9A 2HEIA 2IU4A 4LHVA 1K6EA 3EOAI 4LOKA 5GM2A 4L7QA 4WUVA 5JG7A 1MH9A 1FXUA 1INLA 4PFKA 3EGEA 2PIDA 2BFBA 5CLFA 3HE3A 4HWRA 4EFKA 2QX7A 3MLAA 3SE7A 4EYQA 2I2CA 3UB4A 4F2DA 2VNAA 4F92B 1QQ7A 4LNHA 5CIYA 2XUFA 4EYSA 1A72A 3NIDB 3FUCA 5D3MB 2EWWA 2XKJE 1Z2OX 3KAPA 4Z4QA 4N3AA 3O8NA 1BJTA 1BS2A 3I04M 1YJQA 3KOXA 3I9JA 4PPYA 5DTJA 4X1YA 5LU9A 3U3RA 2WP8J 2N9UA 2JD2A 2W22A 4Q19A 4RUKA 3TZLA 4AP5A 1O9BA 4IXMA 1E2HA 4FYVA 5I7WA 1XTBA 2F8MA 5BMVA 1PBNA 3N70A 3EQ8A 3OQIB 3PNBA 4YCBA 3GFVA 4PAOA 4C6RA 1E58A 1DFIA 1R2QA 1UIRA 1PFWA 2GBCA 2ODAA 3EGWA 4LDPA 1FYEA 3UBMA 5C7LO 3OE1A 4B8ZA 4GPZA 4JJZA 4DV0B 2YCBA 1PZHA 1ESNA 2ZSJA 4IDFA 5CPBA 4ENTA 4MUKA 3I6IA 3ADDA 1QHNA 3NZEA 1KL7A 1CR6A 3KYJB 1PQ4A 3VU9A 3OU7A 1R4MA 3OZAA 3RO7A 2VJMB 4YYEA 4U2DA 5CX1A 1W1WA 1PJ8A 1RFLA 1ZI8A 1R6XA 4E1BA 5A4AA 1FQJA 1K27A 1PL6A 3P26A 5GIPE 3PZBA 1EUZA 5A0VA 3UHAA 2G28A 1UFRA 2JI4A 4I55A 4RA9A 5IBCA 3ICPA 1XTJA 1HH4A 2FF5A 5DBFA 5CBPB 1PD1A 3HV0A 2I5PO 5JNUA 2G36A 2P5SA 2R7AA 3TVDA 1I3MA 1NBAA 2EEPA 3L0SA 1C7RA 4KBYA 1YWGO 4UU1A 3FJOA 4I6JA 1TOAA 3IIIA 4JBGA 4TTVA 4ZANA 2EJUA 1T29A 5TT1A 2QJWA 3M33A 4HLUA 4OI4A 3VDMA 4D9EA 2D4AA 2XE7A 5EHIA 4UZSA 1W0CA 4DIOA 3EGIA 3C3CA 4Z9XA 2NO6A 4EITA 2D2FA 4BVGA 5LZ4A 2YZ2A 4C1NA 2XADA 3TLEA 3A0RB 2XZDA 5ALSA 1FSZA 4PPGA 4DC9A 1VSBA 1KNXA 1Q7GA 3KV3O 2HPAA 4U5XA 2VK1A 2V7BA 2XE8A 3AVPA 4AZ0B 3U13A 4HADA 2WSLA 3L9WA 1YUMA 1ONOA 3CZRA 3DBOB 2PS0A 2ZIUB 1SUCA 1ZK3A 1E7MA 3FNIA 1R4NB 1WHTB 1DBVO 2NPIA 1E77A 3QXXA 2HH9A 1FUUA 3AV0B 3JCZA 1EWYA 5EE3A 2A5JA 4PC6A 5G2OA 2OD2A 1UEXC 4DCCA 3L8ZA 2GCIA 3B2EA 1E9DA 3J81A 3X2SA 2IPNA 2O3TA 3VO2A 1WABA 1NW6A 4FDTA 4IDQA 5FLXA 3RK0A 3NNNA 1JF8A 4HB2A 4I19A 1DCFA 1IRIA 3IKJA 4PG5A 2Y1OA 3O26A 1M2OB 4XIGS 2FFHA 4LVOA 3HLTA 2YIMA 4XE5A 5IT0A 1I4DD 1U1IA 2YXBA 1NJ6A 4NC9A 2P4EA 4DCMA 2D1TA 1SUEA 1V16B 1YCGA 2ZB3A 3NETA 1U2ZA 4CCWA 1ECBA 3AP3A 5AM5A 3O0DA 4H7HA 4RFVA 4QJBA 2FN4A 3RBVA 3ABSB 1KJWA 2V7UA 2CXPA 1SNYA 3G8YA 3HJNA 1C4KA 1TYBE 3FPSA 1A9RA 2W6ID 3NM4A 1KF0A 3GEGA 2A94A 4PAMA 4Q03A 4Y67A 4KQIA 5L51A 3IDZA 4DIBA 1KHHA 4ZAGA 5KKCA 2C98A 2QV0A 2WJWA 3H8WA 1F4PA 1LTKA 1EEXB 5CMLA 1JEQA 2A3NA 4IJQA 1YC2A 4PLHA 1NQXA 3D7RA 5TQJA 3SNKA 2FYTA 1NUQA 4GDFA 3CZ4A 3GZTB 1AB5A 3I4FA 2W43A 4G09A 2B1IA 1ECJA 4AWBA 1RRGA 2MMCA 2LXNA 4LRQA 1BN6A 1XTKA 4KHZA 4C05A 2P3LA 2KI5A 1TMOA 4KX5A 3BCHA 4JUBA 3F78A 1GR0A 2NO4A 3ZZTA 4YRAA 1AXGA 1QORA