1XF9A

Structure of nbd1 from murine cftr- f508s mutant
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
281
structure length
264
Chain Sequence
TGIIMENVTAFWEEGFGELLEKSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Side chain and backbone contributions of Phe508 to CFTR folding.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Cystic fibrosis transmembrane conductance regulator
total genus 91
structure length 264
sequence length 281
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xf9A00
2QROA 1JPJA 4KLZA 1G3RA 1FZQA 1AS0A 1OXTA 4TYNA 1I4TD 1XPOA 1EFCA 2EFCB 1ZM2A 2CE2X 4DLUA 4V03A 4D2IA 3B1ZA 1BO6A 3LDAA 4AKIA 4PC3A 1OIWA 4YMTA 1G8FA 2RGCA 3AM1A 4DC9A 4IOMA 3ZIAD 1ZAKA 1R5OA 1YQTA 4TL6A 3BE4A 1ZD9A 2P6NA 4RJLA 2QGZA 2ZRPA 1DTSA 2DR3A 2WMNB 5EJEA 2ZRJA 2NO9A 3RWMB 4PX9A 3WP0A 3TAUA 2FSHA 2XOKD 2ZSEA 2PEYA 3GLHE 4GMDA 1KO1A 4QRHA 1UKZA 1IN6A 1KI9A 2CLDX 1BH2A 2UKDA 2JATA 3BRWD 2YOHA 5FI1B 2IXFA 4FMBB 2DWOA 5EE1A 3TUIC 5CIQA 3FFBA 2Q6TA 4GRAA 3AQ4A 3GLGE 3EW9A 4IDPA 5AJZA 5H1YA 2O8DA 3U4QB 2XB4A 2PJRA 3VR3A 1E94E 3I61A 4FWIB 1W36C 1X8LA 3THOA 3FE2A 1RPZA 1EFHA 1TNDA 4GZMA 4BZPA 4K46A 5KHOC 5HCNA 1L2TA 3VQTA 4C0HA 1DAGA 3FWYA 1DG3A 4NH0A 2ZRFA 5G53C 1A82A 3B5JA 2ONKA 3WMFA 1JALA 1E4VA 1G6OA 4BLPA 1KK3A 5SZHB 1O3YA 1D2NA 5J5CA 5JI3E 4EPYA 2GAOA 2V54A 4EDHA 5IF9A 2YZ2A 4GOKA 3O8BA 3ZH9B 2JEOA 4LHWA 1IHUA 2WWXA 2O8DB 3IQWA 5E95A 4G5RA 4M9SA 1QG4A 1EFUA 5GJWC 4MYHA 3CUEF 3NDPA 1WXQA 3EIEA 1WMSA 2I4IA 2EFHB 1QHSA 1WA5A 2BV3A 1WB9A 1FP7A 3IIJA 5GJBA 4KAXA 4F93B 1XCMA 4WXPA 3TVTA 1QHHB 2XTNA 1IONA 3P4XA 1D2MA 1HE1C 4Q4HB 3MGCA 1KAGA 4OHZA 3U7HB 3ZJYA 2CE7A 1U0LA 2O5VA 2WPDD 3KKQA 4MA4A 2ZVQX 3UPUA 5G40A 3LO5A 2GXAA 5KSOA 2DHRA 3RS3A 3IIMA 4Q02A 4URWR 1ZMXA 3KB2A 3M6AA 1PLLA 2J45A 4LI0A 4D82A 2ZE6A 5E7MA 3PJRA 1W4RA 2QBYA 2PCLA 5FUWA 3MD0A 4PHHA 4FINA 5CLQA 3FMFA 3S1AB 3RSLA 5C4GB 2KE5A 1OPXA 1JAIA 3T15A 4A9AA 2O8EB 2ZJ5A 5D3MB 5EXSA 1VMAA 1W2GA 4C30A 3IPXA 1DELA 5EE3A 3TSWA 1J2JA 3CZQA 4I1UA 1DARA 1EFRA 2XSZD 2BOVA 4BRUA 4G3XA 4QM7A 2XEXA 4EQ6A 1SVSA 3L8YA 5LDDC 5KNBA 4LJ8A 2W2XA 4BWYA 4MYUA 3EC1A 5M04A 4AKHA 3KQNA 4EUNA 1GL6A 2NIPA 4D80A 1GWNA 3AF0A 1G7RA 3BK7A 2GWHA 1ZCAA 4Q1DA 4YQFA 4M4SA 1LNZA 2VL7A 5BN4A 8OHMA 3CIOA 1Z28A 5D3MA 4HLUC 2QP3A 1E1RD 4QGGA 3VX4A 1FL9A 4L9WA 1SHZA 1A7JA 1S4QA 4M1MA 5TV2A 5IT5A 1CXZA 3BB3A 3ADCA 1OXUA 1XZPA 3TJZA 3X1XA 3BXZA 3QENA 3K0AB 3QKTA 5FTNA 2CCGA 5FOVA 1ZIPA 3EZ7A 1UBFA 3K0FA 3ICQB 2O8CB 4V0ME 3CX7A 3RLFA 1WQ1R 2V1XA 3EA0A 4N0EA 3OEHD 2HT1A 1IJFA 1GZSA 4V0KA 4KJZA 3PUXA 1E9SA 1XTRA 2ZI6A 1UEIA 4HDOB 3K70B 1OJLA 4CRWB 3SNHA 4JLOA 1VHTA 3TIFA 3UKDA 4DLRA 2IF0A 2R65A 4Q4AB 4X8OA 2WAXA 2ZPTX 4Q1CA 5EQTA 3SBEA 2DFKB 5SZIA 2QY9A 2V7QD 4A6PA 3AUXA 1BMFA 4TQUS 2VO1A 5C2JB 1VECA 1QG2A 3OFND 1G64A 1RZ3A 2A5YB 1HE8B 3IHLA 4JSYA 2KBEA 5G3ZA 3VR2A 1QHHA 2ZREA 3WNCA 3NEYA 2JLZA 3KKOA 4R2HA 3K9HA 3BORA 3IBGA 1OH8A 2GEUA 1KO4A 5HTKA 3DOFA 4L15A 1UKVY 3OHMA 4WOPA 5H70A 4RFVA 4UNPA 4CT4B 2FEOA 2RGEA 4WZAE 1CKEA 2QENA 2ZSFA 5KYKA 1T9HA 3RANA 2O0JA 4UNSA 1Y63A 1E0AA 2YNMA 3IHWA 2OG2A 2UZ3A 3DO6A 3KFXA 3QY0A 3R8CA 4LHXA 5CITA 1ESNA 4PPGA 4WW0A 4CEHB 3NHAA 4R71A 3AF1A 2PZGA 4OL0A 3QF4B 4DLZA 1LFDB 2W83A 2YC2C 3C16C 4NBSA 5FBLB 2ERXA 2YWHA 4MKHA 3KQHA 3PUYA 2WVJA 2XJ9A 3PITA 1VG1A 1W44A 2ZROA 3B60A 4URUR 1LVGA 2FZ4A 3KDSE 4JJKA 5H8WA 2VP4A 1E4YA 3HWSA 2OUKA 4F92B 1T5LA 1G7TA 2XNDD 3NC1C 4WA7A 1ZYUA 4C9BA 3KKPA 5J47A 2W6JD 3FYHA 2Z4SA 1Z47A 4KI0A 3W9YA 2JJ2D 4LCBA 1MV5A 4CT5A 1WP9A 3VHLB 2A2ZA 5LBIA 2F43B 2G3YA 3DHWC 5EE0A 2FG5A 3W3ZB 4D0GA 5FL7A 4B3XA 2IX3A 3SQWA 2H1LA 1KJYA 1N6KA 1C4OA 1C1YA 1W1WA 2IXGA 4AKEA 2FN4A 2X8AA 3B8HA 5K8UA 3ICEA 4QHTA 2XZOA 1VG8A 2IYVA 3AKEA 2E87A 3LRPA 4NP6A 2P6RA 2GEDA 2IYQA 1H65A 4N3NA 3FB4A 3WMGA 4BFWA 3C8UA 1CR2A 1NVWQ 1TUIA 2RGAA 4GPTA 2ONJA 4DIEA 1QHIA 1XTKA 1Z6XA 4H9GA 2DCUA 5TARA 3MFYA 2ZRNA 4LPKA 3D3QA 1XDBA 3CR7A 2OEPA 2CEAA 1JQLB 2QSZA 3REGA 1JXMA 3CRQA 4JYCA 1U94A 4KVGA 4ESVA 1I2DA 2KBFA 4A8JC 2CHGA 3ZVMA 4DBLC 1GNPA 3UMSA 3KUCA 2EYUA 3UMFA 4B3DA 4RD4A 3K0EA 4RZUA 3CWZA 4P4TA 4IVPA 3B6EA 4Q47A 2WKQA 4BRWA 2EWVA 1F2UB 1S9DA 4S35A 3I5XA 2DB3A 4DUGD 4LK2A 5DIFA 5DHFA 2GETA 1WE2A 2ZJ8A 4M53A 3EZ9A 3AVYA 1QF9A 2G6BA 2O52A 3AF3A 4UXJA 1OKKA 1OXXK 1XEXB 1VYVA 3QXSA 3W6PA 4AG5A 4AIIA 2ZS9A 2ZEJA 1NIPA 3GPLA 4M9QA 5DO9A 4MRNA 4YXWA 2ORIA 2ODEA 2JAQA 4BEJA 4Z1MD 2ZRKA 3I32A 2CHQA 1RYHA 2HLDD 3R8FA 3OE7D 5EP1A 421PA 3OIWA 1U8ZA 5EXXA 1P7CA 3PFIA 4YMVA 4XOIA 1G4UR 3GJ8A 1Q1BA 3EC2A 1MABA 3VR6A 4I81A 5FL3A 2RGNC 2WZQA 1Z0DA 4CF7A 2FU5C 1R8QA 2EFGA 1Q1ZA 4Q66C 2QGNA 2J7PD 5EE5B 3GLFA 2AFIE 3K70C 1SHKA 1ZM3A 1G41A 3CX8A 4K8OA 1Z6TA 2KJQA 4L16A 4O2LA 2NZ8A 1L7VC 2GCPA 4OQLA 4CEIB 3QBTA 1I2MA 1CLUA 1NLYA 2UVQA 1U8AA 2V9PA 1YE8A 3PUVA 3RSOA 2W00A 3WP1B 1JXOA 3VNUA 2CJWB 4PSAA 2R6DA 3WYAA 3A4NA 1N5IA 3DMDA 2CLSA 4E5UA 4TN1A 4LJYA 1DO2A 2OESA 2YWEA 1W5TA 4BFZA 2ZRHA 1HTWA 1TQ6A 4PPNA 3KJEA 4B2IA 1HURA 5JLJA 1RC8A 1T3SA 2WSSD 4PFSA 3C15C 2ZJZA 1UKYA 3TVDA 5FUXA 5JS7A 1OIXA 3IKJA 3KXIA 3LQQA 3C4JA 1ZM9A 2WM9B 3IBYA 3O47A 4B47A 1KMQA 3TK1A 1R8SA 3VR5A 5UKDA 2IXEA 3WYFA 2FFHA 5JJLA 3QQ5A 1XJQA 2BEJA 4IHQA 3GLIE 2ZI3A 4QHSA 3D31A 4AK9A 2Q0HA 3HP1A 1XEWY 1E1QA 2ZUDA 1G3UA 1JECA 3AP3A 4MKIA 1G19A 3BFKA 1ZUIA 4QBGB 3ADBA 3MRSA 4A36A 2JLVA 5JHGB 1DAEA 1W5SA 2VA8A 5FTMA 1W7AA 1QBKC 2OCYC 1JJVA 4NCJA 2PLFA 1TU3A 3AKYA 2C96A 2RH5A 3MUFA 1DAMA 4KSBA 4DDVA 3SR0A 1RFLA 2W58A 1OB2A 4A1FA 2J9RA 1E79A 4V0LA 5EE9A 2ODWA 2ZU0C 3UATA 1IXSB 1US8B 3PCRB 3DPUA 4KV9A 3NXSA 1C9KA 1MO5A 5DI9A 2ZM5A 2QAGB 2IF2A 5ELXA 4A15A 2C03A 2GHIA 2QTVB 1ZU5A 5FTLA 2OXRA 3EZFA 4GT1A 2FSFA 4B3FX 4M1TA 2R6GA 1NKSA 1IY1A 5E7IA 1CBUA 5A0FA 3CPEA 4PANA 2JLXA 3ZD7A 4R9UC 4LDJA 4OJKA 1U9IC 4PSKA 4KFSA 1DAFA 2J59A 2ZRAA 2JGNA 1W4BA 5KU1A 1G5RA 3E5HA 1R0ZA 5EXPA 4DCTA 4R7ZA 1TQ4A 5AJWA 4NCNA 5CJ2A 5AJYA 4B2LA 4RD3A 2DFNA 1NBME 2OLKA 2QPTA 5E4FA 2GDJA 2QEQA 2WJVA 2O8CA 3TQCA 1G18A 2QQEA 2HCJB 5HKKD 3LA6A 3WHKA 1YKSA 4A4DA 3FMOB 3BH6A 3TAHA 2AKAB 4DLTA 2Y8EA 4TLCA 3AGPA 2KI5A 4JSTA 5DYGA 4MKGA 2F1RA 3GLGA 2GRJA 3QPWA 2V3CC 3LVQE 1HT1E 3B1YA 5FPYA 5FOTA 1TL7C 4GBMA 2ZRMA 5BQ5A 3MCAA 1AKYA 2YINC 4HB0A 3I1FA 1JR3E 1N5JA 3QOFA 4HUQA 4RVCA 1A4RA 1YVDA 1EFRD 2XSZA 4PR0A 3B7GA 3KKMA 4ITRC 1IY0A 2ODNA 1S1MA 2JJ8A 2R44A 4W5HA 1CJUC 4I1VA 4HLDA 5TMPA 4X8LA 1QHGA 4MUBA 1OYWA 1W46A 4HDQB 4JKIA 4UNNA 1TQ2A 4Q1FA 1XD9A 4C0KA 2NO6A 3LBIA 2YC4C 2Z5FA 4QL3A 1W49A 4ZIRA 4JIMA 4OI2A 2NG1A 4RY2A 1Z06A 3KTAA 4YMWA 1E2QA 4UXHA 5KSYA 1SXJD 3V9PA 3GCGA 3WY9A 3VU9A 1YR8A 2PZEA 2KB0A 3SEAA 5HCIA 4B71A 4B43A 1ZC3A 2B7CA 2PMKA 3AV0B 2Q21A 1VIAA 3HPQA 1ZU4A 1EWQA 1GL9B 4M2LA 2CCKA 2GF9A 4BFVA 3QVVA 1XMIA 2QI9C 2YHSA 2Z0MA 4NYMQ 5DSZA 1KKMA 5J4KA 4F7WA 1GNRA 5EZ5A 3O8DA 3SHFA 2IS1A 1DEKA 1KJZA 1II8A 1II9A 3FTQA 2FE4A 2ORVA 4FCTA 4H1UA 4LYAA 1T3LA 1NP6A 4NKRA 4NE2A 4O3MA 1DBSA 1K8RA 4C2TA 2F1JA 1H8ED 2WKPA 1GM5A 4XSHA 1OFUX 4TT3A 1S3SA 4HI0E 3RYTC 4F4IA 2IWHA 1FTNA 2A3RA 5AWFC 3M0EA 5DE3A 3Q5DA 5J4LA 2CL7X 3U3MA 2R62A 4DLYA 4EFLA 1N6OA 1DOAA 2BJVA 4JBWA 1Z0KA 4P32A 3X1ZA 2WOJA 4EQ6B 1L8QA 1ZM4A 4ZI2A 4D25A 1F2TB 3PENA 4WXRA 4XWOA 3VKHA 1CRQA 2BVNA 1II0A 2BMJA 1E2GA 1RVDA 1N6RA 4HYYA 1BYIA 1ETUA 3NTUA 1E32A 2LWIA 2XOKA 2QBYB 1VCOA 3Q3JB 4IEIA 3LW7A 3QNUA 1U81A 3SYKA 5EUMA 1DPFA 4P4UA 1P2SA 2DWPA 1W2HA 2QT0A 1CJVC 2D4HA 1H8HD 2DY1A 1TF2A 3SYLA 1KYIA 3AUYA 2PZFA 3I92A 2EW1A 4M1SA 4JZKA 4JVLA 4PO8A 4XJXA 3SDZA 4B34A 3AVWA 1XCPA 4DLVA 4RSGA 1RRGA 2PT7A 4FXPA 2P5TB 1VG0B 3LBHA 1KDPA 1KI2A 1E2NA 4B44A 2AKYA 2OZEA 2DFTA 5CM9C 3A4MA 3HYRA 1V5WA 5FUYA 1MABB 1WBDA 2BWJA 2EVWX 3JZAA 3PR1A 4F4JA 3EARA 3QEOA 2N1BA 1AIPA 3F3YA 3GLFB 4D4LA 3QSYA 2IW3A 1E2KA 4HZUA 1D9XA 4HB4A 1QHNA 3DM9B 1XTJA 4B6EA 3NBZC 1E69A 4B2PA 4OQMA 1PUJA 1H8EA 1DG1G 2QNRA 2ZRIA 4LJ9A 5AJVB 2VP5A 5EUQB 4ZDIA 4XWKA 4PHFA 2O8BB 5F9FA 2VSXA 3U7GA 3NH6A 4KYUA 3L8ZA 3CPJB 1S1CA 2QUZA 1GG2A 2FFQA 2QZ4A 1G7CA 4OK6A 3THWB 4LRWA 2AFHE 2QTHA 3CF6R 4FWTA 3NEJA 5FTJA 3SJBA 2GCNA 3QPVA 1G8GA 1P9RA 4N1AA 1R7RA 1XD2A 2W6ID 5JMTA 4IW3B 4MDEA 5BYKA 2QAJA 4DLSA 3LW8A 2QMEA 3Q72A 4XVRA 1KMHB 5FPSA 1N3BA 1W48A 1YR6A 2AD1A 4OI4A 4HUQB 1D6JA 3ZS9A 2XJ4A 2P0EA 2ZYTX 2ZJ2A 3QF4A 3U6BA 1DO0A 1AM4D 1FMJA 1OLOA 2BM1A 2NPIA 4NTZA 3AVXA 3HPRA 1GP2A 4KHZA 3ZVLA 5FOWA 2O0HA 1FNNA 1UBCA 1NVVQ 2R6AA 4MKFA 1JQJC 4XIGS 3VR1A 2ZUBA 1KI3A 4A2WA 4A0RA 821PA 2EQBA 4C4PA 4PAMA 1CRPA 2H7VA 2J0UA 1NIJA 3L0PA 4KODA 4B35A 1T6NA 5LD2C 1HH4A 1T91A 1G8PA 2ZYVX 2ZRBA 3CM0A 2VYFA 2Q3FA 3A1SA 3E2IA 4K81B 5KO2A 4AG6A 2PX3A 2XNSA 5P21A 1YHNA 1FP6A 1CTQA 3TMKA 1ESMA 4KLNA 4KFTA 5BWMA 5GVSA 2J7KA 5K8LA 2ANBA 3GLHB 2AX4A 3CONA 3X1DA 2ZE7A 3WRXC 1CJMA 2VTKA 2CHVA 4G5GA 3M1IA 2GVDC 3SE0A 4OHVA 1FQKA 1XB2A 1P9WA 3B9PA 4PHGA 4DHEA 5JBQA 1Z5ZA 2XXAB 1UAAA 3TE6A 3QKUA 1M7HA 5DHAA 4ZDKA 4Q9IA 3IO3A 3ZGXA 1XCGB 2CK3D 3W8NA 2I3BA 4QGFA 1GOTA 4C0JA 3SQXA 4D26A 2ZJBA 4RZ2A 4AC9A 4HSEA 5AUPB 4BFUA 3BAFA 3FPAA 4FMCF 1QDEA 2B8TA 2C78A 3FKSD 4QHYA 4LBZA 3K9GA 1XU4A 3IPYA 3K0CA 3UWOA 3QIAA 4JJZA 1AKEA 4WIAA 2ZJAA 3GLHA 2V6JA 2QN6A 2IK8A 1UM8A 2DFLA 2GBLA 1OHHA 4W7SA 2BEKA 5JZVA 2PLRA 5JWHA 1I4DD 4QGHA 2AN9A 3AF4A 2D74A 4XTCS 3ETLA 4AURA 4A8JB 1N0UA 1CR1A 3B85A 4Q9LA 3VKWA 1JI0A 2JA1A 2VHUA 5C18A 3DOEA 5FTKA 2CXXA 4Q48A 3PIRA 3ZYCA 4B3GA 5KPJA 3CR8A 4DT1B 3MWLA 4PPQA 4DT1A 4RCYA 3Q8XB 1GRRA 3BERA 5SZJA 2NTYC 3FVQA 4P31A 1N6IA 1P5ZB 3NH9A 4U02A 1MRSA 4B76A 3D6TB 2AXNA 2WJHA 4ZDJA 3T5GA 3B1XA 3KQLA 3PEYA 1E2FA 5E7JA 2ZJYA 5K8IA 5L3VA 4PC1A 2YKGA 5GJVC 1S9HA 4JLBA 4KXFB 2JIZA 1IN7A 5G3YA 1NLZA 2YWGA 2ZI7A 1XFAA 1XNJA 1E0KA 4EJSC 4JLJA 2H16A 1E9DA 3SC3A 5L3QA 1XWIA 2ZUCA 3RHFA 4L8GA 2ZS8A 2A5GA 4MGIR 2RCNA 2PCJA 3OF5A 4ACAA 4D0NA 2VF8A 4B3BA 4DWJA 2G1KA 2J46A 3BH7A 4DB4A 3I3SR 3PEVA 4C7OA 2XZPA 2WAYA 1Q12A 1NSTA 2ZVPX 1YR7A 1Q3TA 4Q4HA 2QMHA 5CK4A 3ZZTA 1VYTA 3DMNA 4P4SB 2JLYA 4QOSA 1KY2A 2CJWA 3H2YA 4U00A 3LFUA 2NPFA 4Q1BA 3QI2A 2H17A 1KY3A 1PV4A 1T3HA 1KI6B 1SKQA 5JI2E 2VIIA 4Y0AA 4JLNA 3E1SA 5KDLA 1R10A 3EWAA 3U6KA 4CEJB 4URVR 1U9IA 1W4AA 3CB4A 4MDFA 1KDOA 2OFXA 3QXXA 1OFHA 1WDTA 2V55B 3BBPA 5EP2A 4LV8B 3ECCA 5B57C 2EWWA 3IUYA 2BBWA 4Z51A 1JEEA 4JL5A 4NHOA 2R2AA 5C1BA 4TMVA 1COWA 1SVKA 3A1VA 4HAZA 1T8UA 2ZI5A 1WBBA 4US2R 1HA3A 1A5TA 3HJNA 5AK0A 5C46F 1E9BA 5JHHB 1IXZA 1EK0A 2NO0A 4NDZA 2O0KA 1S8FA 5HE9A 2ODBA 2OSBA 1W0KD 4FN5A 3L0SA 3L0IB 1E6CA 1NJGA 1KDTA 1W0JA 2K5UA 3P20A 3UIEA 4DIDA 2YYZA 1M34E 1MOZA 1FUUA 4KBFA 3WMEA 4AWXA 2WWIA 4DSNA 1FNMA 3IDQA 4OBEA 4LBWA 4YC7A 4TSFD 3TRFA 1NBMA 2IYYA 4RZ3A 4Q9HA 1KK2A 1WRBA 2ANCA 2B8WA 4XWAA 3RDPA 3TLXA 4DUGA 1JJ7A 2GA8A 4PSVA 5AUOB 2QT1A 2NZJA 4G5OA 3C41J 1XEXA 2Q9BA 2WIAA 1CJTC 1Y3AA 2C77A 5FR2A 1O87A 3A37A 3PEUA 3HU1A 2RGXA 4MUAA 2O8FA 3BFVA 2WWWA 3RABA 4YMUA 1Q21A 1M8PA 4V0OA 3TH5A 4EAQA 4EFNA 3THWA 3NG1A 1HQYE 3R9IA 3TUJC 4Y0VA 1JR3A 2AR7A 1ZNZA 2BBOA 1PLJA 4A2PA 221PA 2F9LA 2WWGA 5J4HA 2HV8A 1U90A 4L4UA 2J0QA 5A5GA 4HZUB 2Q9CA 2GBLC 3QBVA 4G01B 2ZJOA 1E1QD 4LGMA 4QXAA 4LJAA 1EX7A 2QTFA 1N0VC 1FUKA 3W34A 2OO7A 1E3MA 2JLSA 5IDVA 1W4CA 2HJVA 4FMCB 4OQNA 4I99A 4AY2A 1G3IA 1OW3B 4F91B 2XTZA 3QPUA 4GNKA 1SZPA 3QEJA 1R0WA 2VHJA 4NU0A 2TMKA 3Q5EA 1KK1A 3WBKA 3N70A 3MG9A 2IYXA 3QKRB 5TB5A 4BLQA 3AEZA 3KTAB 1FFHA 2LKCA 2WWFA 3GD7A 4Q4AA 5FBWB 1YZLA 1P9NA 3KKNA 2KSQA 2IC5A 2GF0A 4O0MA 4V0NA 3KL4A 3SBDA 2OT3B 1ZNXA 621PA 4EFMA 1S0UA 1EG7A 3T34A 1OV4A 3MWJA 2QORA 4M1OA 4LV5B 3QVUA 1V43A 1WF3A 4NYIR 1ZJ6A 3GP8A 1XPRA 2H18A 3PQCA 1FW6A 2J87A 4KYIB 3B13B 1XXHB 3TSOA 4UNQA 4HLQB 1XRJA 1XMSA 3KXKA 3T1TA 1A2KC 2JCSA 1OF1A 2DBYA 1AZSC 2AL7A 4B48A 4H1VA 2PT5A 3NBFA 2BMEA 3DM5A 3OEED 4M22A 1N6PA 4DZZA 3TUZC 1XPUA 2P65A 3LD9A 4Q01A 1G7SA 3AVUA 1FX0B 2QP9X 4AD8A 3K8YA 1HYQA 1IOZA 1J7KA 1NRJB 3K70D 2J7PA 2Z6VA 2E1RA 3SJZA 4YDSA 1AS3A 1NJFA 1CU1A 1XP8A 3A8TA 3H1TA 2AHOA 2GKSA 1GNQA 4CVNA 2ZTSA 1E96A 2YJTD 3TKLA 3DEFA 2HDNB 1OFTA 1BIFA 1ZW6A 2H5EA 2HLDA 4B6FA 2IYSA 5J4YA 1SKYB 5FBQB 2OM2A 5JJKA 1GVNB 1X1SA 1XMJA 2ZE5A 3L82B 1F6BA 2VLIA 3K9NA 2PBRA 1N5KA 4JKYA 2GJKA 2H92A 4IXNA 2HUPA 1G5TA 3IIKA 4UKDA 4YLGA 1FX0A 5CDFA 4RD6A 3EX7C 1Z2AA 4GI7A 4P4SA 1E9CA 4PC7A 4JLPA 5KTYA 1X3SA 1VCMA 1ZBDA 4WZ6A 4M21A 1M74A 2OFWA 2OCPA 3FFAA 3VTKA 1OSNA 1ELOA 1KOFA 1Z6GA 4FW9A 4U5XA 5DYIA 2HXSA 3KJHA 4Q7MB 5FOUA 1W36D 1W0JD 1ZM7A 3U3JA 1F3OA 3PUWA 4OYHA 3SJAA 1UKEA 2OV2A 1A2BA 2GAAA 3A4LA 4QM6A 1ZNWA 2G9NA 2ZI9A 2C95A 4JYBA 5F2EA 5FFMA 1KHTA 2MMGA 2RKOA 4IOJA 4MRRA 1LTQA 5EXTA 2ZR0A 4TYYA 1N5LA 3B82A 1LF0A 1JBKA 1Z0FA 4OKSA 5C4MA 2VQSA 4P0TA 2NGRA 2RGNA 1W47A 4PPFA 5FOSA 1GDDA 1U2RA 4MYTA 5JEDA 4FMDF 1UFQA 4JVNA 4DVGA 4JLDA 5K8TA 3C5CA 1J8MF 1MH1A 4GOXA 1FQJA 3GQBA 3GEEA 3GMTA 2BJWA 2GCOA 2XAUA 2G1JA 4LHYA 1OE0A 5EP4A 2ATXA 3TGPA 2GJAA 1IM2A 1N6NA 1XTQA 3DZ8A 3QXJA 3NC0C 4HAVA 3CNOA 3L2OB 4JVSB 4AYXA 1NMZA 3MAAC 4EPWA 1QHXA 4PO1A 2A9KA 2C99A 2FPLA 4QFMA 5DISB 1E99A 3EASA 3THXB 4GDFA 3T1OA 1Z0IA 2FMXA 4HUTA 3VX3A 2RB4A 2OBNA 5DGXA 3NWJA 4HB3A 5H68A 4BEBA 1DVRA 4LJ6A 2ZYUX 3AVPA 3GJ0A 3UMRA 5JSZB 2J0VA 1M7GA 1HEIA 1QVAA 1EGAA 4EJSB 3L0OA 3HR8A 2OBLA 4EJSA 3U5ZB 2REOA 1Z0JA 3C7KA 2O8FB 4ZIRB 1M1YE 1GITA 2H8KA 2WJGA 2YWFA 2RHMA 2AD5A 4BQSA 3FKQA 2I1VB 2FSGA 4ZKEA 2FWRA 1KJWA 1XD2B 1VDZA 1AJEA 2Z83A 1VYUA 3U60B 2OXCA 1IBRA 2JIZD 1XBTA 2Z4RA 4PZYA 2BC9A 3PG5A 2BIFA 4OI1A 3OESA 3RRMA 1IJEA 2ASEA 2B6HA 1NN0A 5FBVB 1N0WA 4TMTA 4J0QA 1IXRC 5FUVA 3I72A 1XXHE 4C7OB 3SI7A 3A58B 1AGRA 1E2EA 3BC1A 4A92A 4W9MC 4GP7A 1JR3D 2Q9AA 1P62B 1TTTA 1Z0AA 2FNAA 2BKUA 1E0SA 4CDGA 3X1YA 1JEDA 2HF8A 2J3EA 4QBIA 3VAAA 3REFA 3CKLA 1TU4A 1NF3A 3T1VA 1AK2A 2VRWA 2XITA 1RIFA 4WBSA 2AWNA 1G21E 3DZDA 1ODFA 3M4YA 2GZDA 4TL9A 1J99A 2QP4A 1U0JA 4TYPA 1XD8A 3OFNA 4NYMR 4TQAA 1YZKA 1NNEA 2OCBA 1PUIA 1P72A 2MSEB 2V7QA 4FD2A 1SXJE 1MO4A 1UADA 2KWIA 1KKLA 2IYUA 3ZQJA 4JVMA 4BFYA 2C04A 1HQCA 3FHCB 1CIPA 3BIFA 3JVUA 4ZCMA 3BWDD 1TMKA 2PMDA 5L8VA 3NIBA 2HEIA 2A5FA 4JT4A 4DEYA 3R20A 2VHTA 3QXHA 4TLAA 2GZAA 2IUSA 1YRAA 1D8TA 2QAGC 3H0KA 1YZNA 3W3AA 3R9XA 1HT2E 2IUUA 3WBJA 4NPHA 3FGNA 2RGGA 1W0KA 2P5SA 1NVXQ 2VHQA 1HV8A 3OAAD 3K53A 4FMDB 1P2VA 1Q0UA 4A82A 4TL7A 5KNCA 2CNWD 2L0XA 1U99A 4ZKDA 1KO8A 2CMKA 1JNYA 5JRZA 3ADKA 2BMFA 3K09A 2CDNA 1RYFA 2ZI4A 4N0DA 3LLMA 2D2EA 2IL1A 1COWD 1XTSA 2W0MA 3ZZUA 3UK6A 1NMXA 2GZHA 4B33A 2FDCA 2FV8A 4XSGA 4TMZA 3N2IA 3GFOA 3T06B 4ASUD 4G5SA 2CBZA 4JL6A 4NYIQ 3ZIAA 1AZTA 3KXLA 4A2QA 4BLRA 3B1WA 3EZ2A 3I8XA 3UWKA 2JJ1A 2GXQA 1G20E 2FGKA 2OCAA 4XVQA 1QVRA 4DLWA 1AQUA 5EZ6B 1XEFA 5BN5A 1NN3A 1OYYA 1SVMA 3BGWA 3CNLA 1KSGA 5JCZA 2EU8A 3GJXC 5CYPA 3D8BA 1Q3HA 3SS8A 5FPTA 2REBA 1KI1A 3QKRA 3ASZA 1PZNA 3CW2A 1Z2CA 1Z29A 4TZ6A 3ZD6A 1UBEA 4US1R 4URXR 1GKIA 4ZCIA 2OE2A 4KO8A 3UXMA 4UXIA 2WKRA 3P1JA 2C98A 2ORWA 2W2VA 4M0LA 3AVQA 4BPBA 1BS1A 1ONBA 2MMCA 3OAAA 3EIHA 4QJ5A 1G3QA 5BN3A 1M6NA 1KO7A 1G3MA 4G5QA 1E2IA 4G0NA 4JBYA 1EFTA 4JL8A 3AKCA 2O8BA 3PV0A 2QRNA 3VMFA 2N46A 4QKQA 2AXPA 1JR6A 2CVFA 3TQFA 2QE7D 3VKGA 1GIAA 2BCGY 2Z43A 1SULA 4DEXA 2W0SA 2OILA 4ACBA 5DN6D 1XTIA 2A78A 2NMVA 4GZLA 3T35A 3AH8A 2WWYA 5CIWA 3GJ3A 4TT3D 4YMSA 3WRYC 1LS1A 4ABYA 2F55A 1NI3A 1XF9A 3K1JA 3LY5A 1G8HA 4CEHA 3L43A 2O8EA 1XZQA 4GFDA 4Q03A 3P4YA 2ZRGA 4C0QC 1B23P 2JASA 4L5BA 3TW4A 4US0R 1UDWA 3GEIA 3ZZ0A 1OH6A 3BH0A 3GEHA 2IYTA 4TYWA 3B78A 5IHPA 4LSGA 4DLXA 2VHCA 3T61A 4MGKR 1XEWX 4B75A 2JLWA 2G0NA 3F5FA 2C2HA 3NVAA 1Z08A 3LXRA 2FF7A 3FMIA 3I4LA 4JLKA 3RC3A 1CF4A 3W6OA 4CGZA 3VR4A 5JEEA 2X77A 3MSXA 2QE7A 2F43A 4Q7KA 3SJCA 5BYJA 2XXAA 4QBFA 4KSCA 4QNMA 3V00A 4DJTA 2XTMA 3EIQA 1IAQA 2ZSAA 2RMKA 5KSPA 3RS5A 3ZVRA 2FH5B 2FZLA 3P32A 1MT0A 4PC2A 4Q9KA 5TY0A 4M1KA 4IOLA 1OFIA 4XD7D 5AUQA 3ASYA 1LY1A 3FKSA 3AVTA 4HDCA 1KTVA 4C0SA 4WZBE 3RC8A 2NO1A 4ZCLA 3H4MA 4QBHA 4MITA 3SFVA 1S2MA 4Q7LA 2WSMA 4DDTA 3QG5A 2YOFA 1CS4C 1NSFA 5AUNB 1FMLA 5CM8B 3CH5A 4Q4LA 1P4SA 2D3WA 4E03A 4EPTA 1QRAA 1IN4A 2PH1A 1EXMA 3RNLA 3CX6A 1IQPA 3EZ6A 3ADDA 1MR3F 2DWQA 2WHXA 2ZITA 2ZRDA 1E98A 1GL7A 4Q18A 2G88A 3W90A 1Z22A 2HT6A 2BM0A 2G0TA 1E2LA 4OHWA 2VF7A 4AKGA 2B92A 1FTSA 2JJ1D 2MSDB 3K09C 4LBVA 4JT2A 2JDID 2OAQ1 3TW8B 1T8TA 2GVZC 2QL6A 4LHZA 3OIYA 5JJIA 5FR1A 4Z8XA 1PVOA 4XD7A 2AK2A 2QRZA 1P2UA 1VKJA 4EPRA 1ZUHA 3QE0A 3Q7QA 3U44A 4XTRA 4LJ4A 5B64A 4URYR 1XMVA 2FEMA 2A30A 5HKKA 2VP0A 3KB1A 5ANRB 5CB6A 3J81k 2WMOB 4HLUA 5IK2A 3LLUA 1CP2A 1JPNA 4V0MA 2CNWA 4EPXA 3I62A 2GILA 1F48A 4PO9A 3RAPR 6Q21A 4OK3A 2REXB 2NO7A 1Q57A 2ECKA 4Q9JA 4PQFA 4IDNA 2F1IA 1T0JB 4ON9A 1G1MA 4TTRA 2D7DA 2IWRA 1Q1QA 1DAKA 4B74A 5JFGA 4GP6A 3VU9B 1GUAA 4DCVA 4EPVA 2ZXUA 5CJPA 1E9EA 5HZHA 3EG5A 4ILEA 4Q00A 4D0LB 1P61B 1MO6A 4M1YA 2FFBA 1ANKA 1KI7A 4WVFA 1R0YA 3DKVA 4LUCA 5JSZA 2EFDB 2GNOA 3QUSA 3RRNA 4CW7A 4ZPXA 2I1QA 1XJ0A 1RW4A 1DADA 1A1VA 3AKDA 2ZU6A 1Q20A 4UJ5A 3IO5A 3QKSA 3H84A 1ZD1A 4IDOA 3FHTA 4W5WA 4IVRA 5L3SB 1SVWA 3BB4A 5J40A 3EPLA 1GKUB 3LNCA 4X8MA 4P33A 4QJ3A 3AVVA 3ZLJA 4O2RA 3TR0A 1RE0A 3RWOA 1P3JA 3FDIA 4IDQA 1PLKA 1ZNYA 2GJ9A 1LS6A 1ZINA 2F9MA 3SFZA 1Z6AA 1GSIA 2RGDA 5F98A 3Q7PA 4BFSA 3BD9A 4RFSA 2IYRA 2UZIR 2QSYA 3T1QA 1P2TA 3KQKA 4OI0A 1SVIA 2H57A 5GJCA 4DKXA 3OEEA 5FPKA 3LXXA 4KU4A 2IUTA 2P6UA 4UNRA 3AVOA 3PXGA 4LWZA 2P3SA 1G8YA 5JECA 1KO5A 2VSFA 3OIUA 1SXJC 3Q85A 2FFAA 4BUJA 1QZXA 4BZXA 3QXCA 4QGAA 4BECA 3KQUA 2FX3A 4I1OA 5EP3A 3EXAA 1KI6A 2X1VA 5FBRB 2WSSA 3T5DA 3WHLA 4G1UC 1VPLA 2WJIA 4HZIA 4JLVA 1IN8A 3VNVA 4BZQA 3C5HA 4IFEA 5LB2A 2F3TA 2ZANA 4HAWA 4DCSA 3B9QA 2LKDA 4FCWA 3U44B 4ASUA 2ZRLA 4TQ9A 1H8HA 2CL6X 1WCV1 4FIDA 2FJUA 5TXGA 3A1UA 2ZIAA 3U3RA 4CIDA 2C9OA 1MO3A 1TF5A 3WNDA 1YRBA 2D62A 2EFEB 5CLLA 3X1WA 1KGDA 4C0LA 3U2QA 1RRPA 1OXVA 2HJGA 2QPAA 3EWSA 3BB1A 1BOFA 4O25A 2ZRCA 2WJJA 4D4KA 2V4ZA 4YONB 1SVLA 2BCJQ 1LW7A 3I73A 4JMPA 1L4YA 4Q1EA 3U4QA 5KPDA 1D5CA 2WOOA 4E09A 4WAUA 4A0GA 5CK5A 1PJRA 3QG1A 1B0UA 2F7SA 3ND9A 1UPTA 3OE7A 1R2QA 1XX6A 1Z63A 1IY2A 3OIVA 1NY6A 2GK6A 1VCNA 2FSIA 4M9XA 3SYNA 2QAGA 4M1WA 4CEIA 1N2CE 4DB2A 2ERYA 2N42A 3K0AA 3ZQ6A 4CZ2A 2OHFA 2X19A 2WJYA 4LY6A 4C0AC 1OKKD 4ARZB 1S96A 2JLQA 2IBMA 1N25A 2YOGA 3GJ7A 4TSFA 2FPMA 2Q3HA 2W2TA 1G6HA 4LJ5A 2J41A 3F8TA 1GRNA 1X8KA 2GXSA 4A8JA 1L4UA 2YVUA 1E2HA 5KOYA 2CLCX 4TWZA 2GXUA 1E2MA 4DCNA 2ZSBA 3O8CA 3H86A 2BDTA 3NDBB 1KMHA 1ZVQA 2IEYA 2QU8A 2XGJA 2IS2A 4II7A 4BASA 3VFDA 3V4FA 4NCHA 1YJ5A 4RFSB 3T12A 2OBMA 1YZGA 4OHYA 4ESHA 1U8YA 3CO5A 3AP1A 2IS4A 1J90A 1NG1A 2BHRA 3I5YA 3G82C 2B7BA 4EKDA 5J4VA 2ZE8A 2G77B 3BFXA 1QHYA 4M8NE 2X2EA 4C3ZA 1Q22A 1DE0A 3MJHA 3B2EA 2NOAA 3LH5A 2WICA 3JZMA 4R98A 4CYMA 2IYLD 5AJXA 4MYCA 1RRFA 3IEUA 4IKEA 2WV9A 2D06A 3U7EB 4MRVA 2ZSDA 2R6FA 5GVRA 1ZP6A 1GRQA 5BW8A 2R9VA 4PHTA 1UDXA 2ZAOA 3DL0A 3S1AA 3IQXA 2QQ0A 3V4RA 3GJ4A 3CH4B 2ZR7A 5FL7D 3CLVA 5KSZA 4URZR 3GJ5A 1Q44A 4OQXA 3HR7A 1XXHA 1G17A 4HLCA 2JJ2A 2RAPA 4LYHA 4ZI3A 1ZD8A 3ONWA 2AK3A 5KDOA 4JLAA 2J0SA 4C2UA 4S2EA 1AS2A 1NMYA 5A4JA 4D81A 2D2FA 3U3OA 4AI6A 4B3CA 1TX4B 1II8B 3D7MA 3IEVA 1FOEB 2NQ2C 4BGDA 3K0SA 2V6IA 5HE8A 4IJMA 1OB5A 5HPYB 1YU9A 3FHOA 2R6CA 2QG6A 3P26A 3U3KA 2F1HA 5JWRA 1E2PA 3W5IA 1DAHA 4Z1MA 3CWQA 1TUEA 2DPXA 5SZKB 5HR5A 2VSOA 4UQOA 1OH5A 1Q1EA 3G0HA 4JBXA 3BJIC 3TSZA 4BLOA 3NBXX 3B1VA 3GLIB 5E3HA 5B2ZA 2HXYA 4LBYA 2VP9A 4RKEA 4TLBA 4LJ7A 3ZDQA 5JWOA 1TF7A 4IVQA 1T4GA 1UBGA 1DAIA 2GJ8A 4Q21A 3X2SA 3KJGA 3RRZA 4UJ3A 3EA5A 4A0FA 1BMFD 1G9XA 1KZGB 3FMPB 2J5XA 4CEJA 4OQFA 3KFVA 1Z83A 2ZS7A 3DVLA 3HYTA 1CR0A 2XX3A 2C9CA 5B58C 1E79D 2CL0X 3THXA 1KI4A 4RZXA 1NBMD 3VHXA 1K6MA 1Z3IX 3OEHA 3EPKA 1NN1A 2Q3MA 1HY3A 4B73A 4TTQA 5FH9A 4OK5A 2PJZA 1KI8A 4QJ4A 1NN5A 3K0CC 4LPSA 1U0HC 4TZ0A 721PA 4LZZA 4Q7JB 4KVAA 4MGZR 1NY5A 4D4MA 4NCIA 1SQ5A 3MWYW 4MRPA 3CF2A 2ZYWX 1KZ7B 4IFBA 2G83A 4LYJA 5L3SA 4BFTA 2A5DA 1LB1B 2RGBA 4I1SA 4TYQA 3HDTA 5TVKA 5KDDA 1CJKC 3CRVA 1YZUA 3RS0A 1KSJA 1MRNA 4DRZA 2JLUA 2C5LA 1E2JA 2GK7A 1TQDA 2MSCB 4RCZA 4TMKA 1VCIA 2BBSA 1T5IA 3LV8A 4HAUA 1CR4A 1NG9A 4GSYA 1TPZA 4L9SA 3A1TA 2B21A 3CZPA 1R0XA 3DKPA 4LOAA 5F9HA 3AGQA 2QMUA 4NCKA 3PUZA 4XH9B 1X1RA 121PA 2XNDA 2ZR9A 3ND8A 4POAA 4DSUA 3A36A 5JCPA 1E0JA 3R7WB 2GTPA 3R7WA 5DNYB 1F60A 3EAQA 4PQRA 1G4AE 4GL2A 3HU2A 4B32A 1G5PA 1K5GA 1P60A 2HYIC 2E9SA 4IOKA 1Z6YA 4DXAA 1G291 4AYTA 3THYA 5L3QB 3R9WA 3N5CA 2RHDA 3THYB 5CYOA 4U7DA 1JB1A 5JRJA 3LVRE 1MKYA 2C9YA 1Z07A 2C8VA 4RD2A 3LX5A 1ZUNB 3CRMA 1ZC4A 2DYKA 1SKYE 1RRCA 1NKTA 2WPDA 5KNDA 4PZZA 1UEJA 1RKBA 4TL8A 2IS6A 2OAP1 1E9RA 2VEDA 3KUDA 5KUTA 1F2TA 4NL4H 1GAJA 2HF9A 1LF5A 2IYZA 3MMPA 5D3QA 1D2EA 2BMDA 5DH9A 3NKVA 5LD2B 4F4CA 4XVUA 4ZO4A 1GKYA 3BOSA 3GFPA 4M9ZA 1TADA 4ZV4A 1S3GA 2EYQA 4JLMA 4YXWD 3A6PC 3E70C 3W8RA 1AN0A 3JVVA 3MWKA 1F2UA 2WIBA 5BXQC 1DS6A 2GESA 4TMXA 2JLRA 1FPMA 4Q19A 3KZ1E 3WNBA 3NHBA 2QM8A 3LX8A 5AR1A 1KIMA 2ATVA 5LB4A 3WXMA 4A6XA 3NBYC 4MQBA 3BS4A 3A1WA 1OXSC 1R5BA 4V02A 4PXAA 5B30A 1US8A 1R4AA 4LX0A 1D9ZA 3CBQA 2CCJA 1EESA 4KFUA 2FGJA 4PAOA 4X8HA 1XJCA 1EWRA 5CDFE 521PA 5FI0B 1ZIOA 1OT3A 3UG7A 3IILA 2F3RA 4QG7A 4BLSA 4LV6A 3AF2A 4TMWA 4NYJQ 3CRRA 1M2OB 3QF7A 1YZQA 1E1RA 1R5NA 1KK0A 2YV5A 4I4LA 4LC0A 4LHVA 4DCUA 1OHHD 2WWHA 1VHLA 1N6HA 1E9FA 2J1LA 4FCVA 4MH0R 3SN6A 4PAQA 4EIWA 4MGYR 5IRCD 5L3RA 2R8RA 2ZETA 3CPHA 1NVVR 2LCFA 3F0TA 1KNQA 5DI3A 4DSOA 4IDHA 3GJ6A 5DI3B 4E22A 4DDUA 2WTUA 2FOLA 4HB2A 4P3YA 4KCGA 4D4JA 1K5DA 2WBLC 4ZDWA 5TDHA 3MJRA 3LWNA 1UF9A 4TLDA 1KSHA 2JDIA 3ZS8A 1AGPA 3P27A 2CVHA 2CK3A 4Q4JA 2VPPA 1Z8FA 2X2FA 4PC6A 2IHYA 1KDRA 1W36B 2PL3A 4DSTA 4ARZA 1G16A 3KX2A 2SHKA 3Q9LA 3RS4A 1J70A 3ZVNA 1P73A 1KAOA 4BE7B 4JS0A 2XZLA 5CB8A 5JS8A 4RD0A 2QM7A 2A7QA 3RS2A 2P67A 3RRYA 4IEEA 4C0BA 3SU8A 1LV7A 4ERNA 3G5UA 3GLGB 1NLFA 1BYUA 1NVUQ 2ZQ5A 4MRSA 4QNRA 3UG6A 2OFOA 3LAWA 1SVOA 3LBNA 4LYFA 1J8YF 5FPHA 2W6JA 1VTKA 3N2EA 3OZXA 2V1UA 4TLEA 1GILA 2IHBA 1M7BA 3KJIA 4QC2A 5LPNA 4KFRA 2VP2A 4TTPA 3SOPA 3GLFE 1X6VA 2FPKA 4FI3C 1P75A 1OIVA 2FA9A 2IEZA 2VBCA 3I8SA 3O8RA 3K0FB 1ZRHA 2A5JA 2HCBA 1SGWA 4AYWA 4YDHB 3QJYA 1TEXA 1CEEA 1OH7A 3UANA 1KSFX 4BFXA 2J0UB 4IRUB 4IXMA 4Z8YA 1JAHA 2PEZA 3CRW1 3QKSB 4PZLA 2IYWA 2GCOB 1EX6A 4D6PA 1NL3A 3TNFA 2D7CA 3GFTA 3W5JA 3C14C 2P2LA 4Q5IA 3RS7A 1VIYA 4NZYA 1SXJB 4F38A 1R6BX 1AQYA 2V8OA 5G41A 5GADl 1VG9B 4RD1A 2F6RA 3AP2A 4HATA 2GEVA 4HAXA 2IT1A 1BKDR 2IA5A 5DLQC 1X8JA 1KNXA 2BBTA 3TBKA 5F3WB 1E2DA 2QA5A 1I4LD 1UJ2A 2HYDA 4PQYA 1F5NA 1T0HB 3GLIA 2W6IA 3WYGA 4A0HA 4E07A 3CNNA 5DN6A 1YR9A 4PTLA 1CULC 1RJ9B 4RKFA 3EPJA 2GJSA 1U98A 3IGFA 5FOXA 3U61B 1X86B 4Z54A 1GFIA 4KBGA 1E9AA 4NMMA 3U7FB 1N6LA 3TR5A 4DDWA 2XB2A 1SXJA 3DDCA 4BLTA 4KITB 4HAYA 2ZAMA 1TAGA 1HUQA 1AA9A 1YZTA 2VP6A 2OLJA 4GMXA 2VH5R 4W5JA 3AB3A 2QMOA 4LC1A 3EPHA 1GTVA 3RVBA 3W6NA 5HZKA 3PVSA 3SHWA 3MLEA 2PX0A 4Q1AA 4Q4JB 4GOJA 3LQRA 4NONA 3PEWA 1IN5A 5IK2D 3K9LA 3FOZA 4R2IA 1P6XA 3CF0A 4OHXA 4OJQA 1RJ9A 3SZRA 1TEVA 4NYJR 2AWOA 1ZCBA 3HU3A 2QPOA 2BKEA 4HEJA
chains in the Genus database with same CATH superfamily
2QROA 1MHPA 1G3RA 1CZNA 2IOFK 3V8NA 2EFCB 1YBMA 1OXKB 1ZM2A 3RKRA 4DLUA 4D3YA 4LY0A 5BVHB 1JFFB 1JG7A 4J9VA 1NYLA 1PWEA 2YX1A 4Y6LA 2WQ6A 4AKIA 4Y1GA 1ONOA 4PC3A 4KOAA 4YRSA 1IY9A 1QKIA 4YMTA 4Z3OA 3GY0A 2RGCA 3R76A 2WF6A 3AX6A 4AB1A 1ZAKA 2GM4A 2FPSA 1F0NA 4TL6A 2P6NA 5D51S 4RJLA 4D3FA 4EDFA 3MQ2A 2ZRPA 3TNLA 1V1JA 5GZ6A 1QCCA 3AUSA 2JIRA 4TS3A 4BYMA 4NNPA 4E2WA 2PN1A 3L6OO 2X7JA 1G20B 1FMTA 2P9GA 4HTFA 3RIEA 3WHIA 4DR2B 2R4UA 5EIHA 2PUDA 2QMQA 2XGMA 1K4MA 1KI9A 1BH2A 1P0MA 4O33A 2ZJ0A 4IMPA 3IELA 1J4AA 5EE1A 4IQ0A 4J1QA 5CIQA 1RJDA 2VATA 3BHJA 2Q6TA 3BN3A 4XQGA 3ZWQA 4E11A 1H9CA 2KLBA 5H1YA 4G4GA 4B7CA 1FDSA 3NT2A 3U4QB 2XB4A 1T15A 4AF7A 4FWIB 1QTQA 4BZPA 3TLEA 3HB0A 3B6MA 1CB7A 4BMPB 3CT4A 5AKEA 1KGSA 1BTOA 1L2TA 2XYRA 4JB3A 2BISA 3T7EA 3FWYA 4RLSA 3TOVA 3B70A 1ZDMA 1A82A 4JWTA 2WP8J 4F4HA 1JALA 4QYMA 1ILEA 1G6OA 2FQYA 2WHRA 5DU2A 5JNRA 1KFJB 3QVTA 1GPWB 1QH9A 3EGEA 4AJJA 1KK3A 4FYMA 4G85A 4BLPA 1CUUA 1D2NA 2CFSA 4EGFA 3SC2A 4J43A 2V54A 3KG2A 4HXFB 5HVNA 1QE0A 3OQBA 2YZ2A 3LGSA 2XI4A 1DUVG 3EXIA 4LDQA 3O8BA 4L3WA 3NM4A 4QRIA 3ZH9B 1AA6A 1DHRA 1Y6QA 2PZMA 1RRKA 1DC3A 3L41A 4LHWA 4WKPA 2I9KA 2VZEA 2FR8A 3C87A 1W5AA 1F6DA 3IQWA 5U4QA 3QIVA 1XVIA 4FJ2A 1ZWKA 1C30B 1EFUA 4FYYA 2JLCA 3GUUA 4JKOA 5GJWC 3NDPA 3A2MA 3FR8A 1JNXX 2QD4A 3EIEA 3VYRB 4DMRA 4V1CA 4NS1A 1QHSA 2QUJA 4IIJB 1SY7A 4WOJA 5IXSA 4FXOA 1WB9A 2QRVB 1NBHA 5C1IA 1E7SA 1C9DB 1RAFA 1FP7A 1T2NA 3IIJA 5DKFA 1P6UA 1WDKA 1TI7A 3UQYS 5JQGF 1S4MA 3LQFA 4HBGA 2PMWB 5EWMB 4PZ0A 3SZGA 4CM5A 3K72B 1IONA 3EVFA 1H05A 2DKNA 3EMDA 1D2MA 1DC6A 4KGZA 5HUQA 5AW2A 1A4XA 3JQ9A 4FIZA 1DCKA 4FE7A 4KGVA 4MR9B 2VYVD 3EVTA 3WDSA 5FUBA 4NICA 2DUWA 2ADOA 4NAVA 4YCDA 4EENA 4BGVA 4RL4A 3M5DA 5CD9A 2XUPA 4RC9A 2QYOA 5KSOA 5FWYB 4KK4A 4UHEA 3UK2A 3HSSA 3V8MA 2DHRA 3RS3A 1PZMA 2NVUA 3FWPA 4NENA 4AS2A 4DNFA 3CF4A 2QN8A 2WTAA 1X77A 3Q11A 4QOJA 4LGYA 5E7MA 5DCLA 3V8PA 4H4DA 3A6ZA 3BE5A 5CLQA 1ZY2A 2IPNA 1H6CA 1LPPA 2HCTA 3FNGA 2FRDC 4XYGA 3RSLA 4N12A 3S1AB 1WLYA 5CCBA 2QIOA 2O8EB 3T15A 4A9AA 4FPXA 5D3MB 3UA4A 2C7GA 4EA6A 1RYNA 1VMAA 1W2GA 5ED4A 3JU3A 5EE3A 3TSWA 1J2JA 1PR3A 3CZQA 2XAAA 2RJNA 2BOVA 2XSZD 1CVLA 4K2AA 3CW9A 4G3XA 2P62A 1EEHA 4HTFB 4MRMB 3BXPA 4GUDA 4I5GA 4BMYA 4EQ6A 3D6FA 1W2WB 3L8YA 2FSVC 4ZHSA 3BILA 5A05A 2XNKA 5LDDC 4LVOA 1V1RB 3A11A 4ENRA 5AFSA 5BQXA 1DGQA 5CB4F 2CKDA 4D9EA 3R9XA 4LJ8A 4MKXA 3QBEA 1WD7A 2PBFA 3ULKA 1AURA 3N07A 1F5SA 4L73A 1YI0A 4MYUA 4NOJA 3UT5A 3ZK9A 4BQFA 1H4QA 4H3VA 4EUNA 2YZNA 4D80A 1O8CA 3BK7A 3KB6A 1DJLA 4KE9A 1NXVA 1OZAA 4Q7EA 4BO8A 1ZCAA 2QX9A 2I54A 4GRIA 4Q1DA 1AGYA 1IPFA 5JY6A 1LNZA 2OR3A 4DKXA 2PKQO 3RPEA 5BN4A 3PQ5A 1CS0B 2JBAA 3MHPA 1E0DA 1JDJA 4HLUC 1C4XA 1ZA2A 2HI0A 5D3MA 5LLDA 2AN4A 2H2IA 3MJCA 1XTZA 4TTIA 3RUHA 4X1OA 3KQTA 1GTG1 1SHZA 1JS1X 1Z4JA 3KJFA 4YS6A 1SKBA 1U3UA 2PSDA 1NVMB 4DR5B 3ADCA 2B0JA 4E08A 1IUPA 4D8YA 1EU1A 1J8QA 1WZNA 1VL1A 3U1VA 1JLKA 5DHRA 3QKTA 2C2BA 1DQRA 3K5WA 3UN1A 1YKGA 1G2PA 1UBFA 1F7VA 1DFHA 4UM8B 4QVIA 4FZ3A 4FKZA 1DIGA 4PBSA 4RHUA 3KSUA 4V0ME 4PM4A 1WQ1R 1O97D 3EA0A 3G0OA 1GZSA 1IJFA 2C3UA 1EVIA 2O23A 1N9ZA 1XXLA 4BVFA 4IF4A 4HDOB 4D99A 1RWMA 1XNHA 2QB5A 4GLJA 2XIQA 5CDHA 3RRFA 3U3XA 1VHTA 1Y33E 2I7DA 4UZSA 4Q4AB 3PPVA 5SZIA 5K45A 1L5WA 2VT2A 3UH0A 3LHKA 1ZPDA 3WRWA 4AS1A 1OBFO 3I9NA 1GAWA 1YO6A 3D6VA 5EIAA 1XNQB 1WPGA 4QPDA 5JPIA 3FXAA 3EPPA 1HE8B 3IHLA 2AE1A 3OWXA 3KD2A 5I7RA 1VQ1A 5BP7A 3IAS1 4PR3A 2ZREA 1NWHA 5KQGA 4XPIB 1AD2A 2DG2A 1VC2A 3KXDA 4R2HA 1W59A 4ZVOA 3K9HA 1Q1GA 1Y5IA 2ONYA 3BORA 1B73A 2GEUA 2ZDQA 1KO4A 3IBGA 3QW4B 4Q3AA 1OH8A 1TAHA 3WB2A 4L15A 3OHMA 3O8QA 4WOPA 3GRFA 2H85A 4RFVA 1MG5A 2X3UA 2QD5A 1YB1A 2IBTA 1BQ3A 3H2KA 3OTWA 1OQAA 2DF8A 4EG7A 2E2WA 4D8VA 2OGZA 1Z34A 2AFHA 2ZSFA 3EH1A 3OPQA 1PJ3A 3DW1X 4OJNA 2P5UA 2C7RA 1Y63A 4CGYA 5CPFA 2JI4A 3KFXA 4ZODA 4G24A 4PPGA 4RW0A 1Z2PX 4R71A 3AF1A 3OZRA 5BXYA 3TGLA 3QF4B 1NFQA 1EXDA 1WMAA 2YC2C 2VF4X 4F1JA 3USZA 3KZVA 1CQJB 2ERXA 2E21A 2N47A 4MKHA 2ODQA 4OUDA 1JJIA 3UUWA 3KQHA 5LZ2A 1RBMA 3NATA 4ZHQB 1W44A 3IMEA 1PR9A 2ZROA 3HBNA 3N8GA 4QG3A 1WPXA 1LVGA 4URUR 5H8WA 5HJ7A 3HWSA 2Y1XA 1G7TA 2XNDD 3NC1C 4JQOA 4QOGA 4B82A 4C9BA 5J47A 3EGDA 1FJHA 4KI0A 3W9YA 3JWIA 3NYWA 2JJ2D 2Q0QA 3LZCA 4RTMA 3H05A 2WP0A 4X3CA 1X7XB 2WFMA 1V4VA 2NQ8A 5BR4A 1MV5A 2EL7A 2ZVJA 4WFJA 1SQGA 4P4NA 4CT5A 4R8MA 3EJ6A 1QRSA 2PKYX 3F8WA 1ONPA 2FG5A 2NU6B 3BSYA 4LMBA 1JMKC 4LYEA 4TROA 3W3ZB 4JI1B 3QXGA 5HA5A 4O59O 3VH2A 2RAVA 1N6KA 5CBPA 2IXGA 2JGAA 5JZMA 2X8AA 2VTBB 3GT7A 2ZWOA 1VG8A 4DPLA 1R50A 4EX6A 2E87A 4YJDA 3HO6A 4NP6A 5DP1A 4IAOA 2IYQA 5D85A 1E4OA 3WMGA 3QLJA 4FFVA 2RAFA 2AI1A 3OJFA 5KREA 3GIWA 2X8JA 1KVUA 2MWMA 1QHIA 1XTKA 2ZKIA 2DCUA 3RSFA 4QODA 1XKLA 3AR4A 3ES9A 3CR7A 4KSYA 4RMIA 3HLTA 1JQLB 4RXUA 3Q4GA 3RK4A 4WLEA 1V7PC 1PR6A 1R6DA 4OXXA 1TCBA 4ESVA 1RQ2A 4WKCA 5HBRA 2CHGA 3GF4A 1V39A 3KUCA 1UMKA 3RVQA 4NXMB 3KQQA 1V1MA 4LSZA 1MO2A 3LRTA 2NSYA 3UMFA 4B3DA 3CVWA 3K0EA 1ZA1A 3D3EA 2QXTA 4KZKA 2FZGA 3D8HA 4P4TA 4U9HS 2P4UA 1U9YA 4IIBA 3PXUA 5JFOA 5MFPA 4TKUA 2XYVA 1A5ZA 3QVJA 1TYBE 1E63A 1JXQA 4H15A 4HVTA 4Z99A 4D98A 3QNMA 3ZCUA 4DUGD 1NC1A 2AQIA 2X14A 4P34A 1IBKB 3AF3A 3H9JA 4X93A 5LOVA 4MB0A 1ISHA 1VYVA 1QS0B 2RK3A 4OTZA 3PGMA 4D3XA 1AQNA 1VGRA 4AIIA 2ZS9A 1R15A 1P45A 1UFVA 3U7QB 1ILWA 1BZYA 4YXWA 1VL2A 2ODEA 2JAQA 4Z1MD 1VHDA 1WS6A 2FPUA 1SPBS 5CT9A 4R9RA 1HBJA 1JSLA 1RYHA 3OH8A 3AFHA 3CEMA 1A9QA 1R64A 3OE7D 4HHEA 4DIFA 4DG9A 2HA2A 1I30A 4C88A 4ITUA 4ZEXA 1QKJA 4H31A 3KO8A 1N7HA 4Y2XA 3EC2A 3MTJA 1MABA 2CVPA 3LA8A 3X0DA 4OYRA 4YRFA 5HMMA 1FU4A 1G6Q1 3IMFA 3GJTA 2JRLA 1Z0DA 1CVRA 3L4SO 4ZVNA 3TQRA 1MHTA 1R8QA 2PY6A 4G0OA 2QGNA 2J7PD 4OHBA 3J81A 1TT5A 3CXUA 1F4VA 2JIPA 4E46A 4EO9A 3MERA 4EKNB 5BNFA 1XQYA 4I7EA 1ZM3A 4J0EA 2CLKB 4G65A 2AVNA 1DFGA 4JYAB 5IWCA 4GPAA 1L7VC 2DHDA 4OQLA 4DANA 4CEIB 4D4IA 1I2MA 1ZO8A 4MQFB 4IXTA 4HDSB 3FNEA 3VBEA 5GP1A 1XKTA 5BNIA 2CJWB 3MTGA 4QAQA 3G6KA 1NW6A 2CLSA 4CMGA 4E5UA 4E5MA 1KPGA 3TG2A 1NQOA 4IWNA 2GN8A 4MGHA 1UC8A 2OOKA 2CFIA 4ZU3A 5E3JA 2CN1A 3DUWA 4HH1A 1TQ6A 2XYGA 4BNYA 2GYUA 1BEZA 2FWBA 4PPNA 4PYQA 3KJEA 1A98A 2JFBA 3ABOB 3PDUA 4BNGA 4TWJA 3HDGA 3A28A 1GG5A 1HURA 4BKUA 1HKUA 4ZJYA 1EFPA 3HXOA 2BFCB 1QDLB 3MMSA 5K8VA 1U1FA 3DC2A 1XLTC 1OIXA 3KXIA 3O21A 3QI7A 3ZDEA 5E8RA 3ZCTA 4YLYA 2ODPA 4GWGA 2WD8A 2WM9B 3IBYA 2VA9A 2VJPA 2WNIA 4BDSA 3PSHA 3H5OA 3G1WA 3KVOA 2IXEA 3DOCA 1VE6A 1P5RA 1XJQA 1J39A 2DBQA 3DBRB 5TQJA 4C04A 1O94A 4YCLA 2YNMD 3VPHA 3O3OB 3W9UA 1U2PA 4WI1A 1N77A 1XEWY 4YAWA 4OXQA 2UAGA 2ZUDA 2E1PA 1B1CA 1JECA 2XHEA 2Z1NA 4U8HA 1ZUIA 4ZU6X 2ZT7A 2FW7A 3LLSA 3N8KA 3NWPA 2B61A 3HFRA 5I8WA 1LZKA 4CCYB 4V39A 1DAEA 3DKIA 4WN9A 5FTMA 1F6WA 4CNBA 2WJ4A 1Z75A 2P30A 4MCJA 2BDUA 3AR6A 2HRDA 4OYLA 2PLFA 5TT0A 2O1SA 3UXYA 4JOQA 3C7AA 5JPDA 1SXPA 1I9CA 2C96A 2RH5A 1DAMA 4KSBA 3ZV3A 4DDVA 1N92A 1UBUS 4PFQA 3SR0A 4Z4HA 1R6UA 4DM4A 3KQMA 4M7PA 1QO0A 1U8UA 1JLMA 4E2XA 4IJ6A 1O0CA 4JV5B 1PHPA 4UARA 1QIHA 2UVPB 3F4LA 3IUEA 3JQFA 3T4PA 3PCRB 2C00A 4LCJA 1MZVA 1W6UA 3NXSA 2GYWA 3D0OA 1NVFA 2QAGB 3ZD8A 5KTNA 5TJHA 2YMPA 3P19A 1DRVA 2GK3A 5FLKA 2XCSB 1MVOA 3M1LA 2GHIA 3D4LA 4F86A 4KZPA 5T41A 4EJ6A 1C2TA 2FSFA 2VBIA 1E5QA 4FGWA 3TW0A 4NEGA 1NKSA 2JLXA 1N3LA 5H4GA 3CPEA 4PANA 1YFLA 2CZCA 4Z9YA 4LDJA 3TXXA 5I4CA 1U9IC 3QE2A 4IHJB 2J59A 2OHXA 1ZK4A 3PNQA 4YJ2A 1VP9A 4RKYA 1J56A 4CIYA 4HYEA 4CKZA 1WF6A 1TUGA 2C7VA 4DCTA 1EYZA 1CHDA 4ND8B 4L7QA 3MOSA 3QY9A 3RUFA 4R7ZA 5AJWA 3DGFC 1XNRB 1RZUA 4P84A 3ZE2B 1R16A 1KYQA 5H0IA 1DQNA 2Z08A 3BRWA 2G9QA 2GDJA 4AY5A 2QEQA 2WJVA 4DG5A 2RHWA 5JZOA 3P2OA 1N7GA 2EKLA 4KPGA 2ROQA 4R40A 1BXGA 2C5AA 1I3KA 4M7OA 3CRZA 4N54A 1AUVA 3UTDA 3OCUA 1BRMA 2HCJB 4H1WA 3ORQA 1SBCA 2DBZA 2BKVA 3O8QB 4RTLA 4HMQA 1YKSA 4A4DA 5AMXA 4WNCA 2BGTA 3BH6A 1I6MA 1GAQA 2AKAB 3EXFA 4LMPA 4HGQA 4TLCA 4JSTA 5DYGA 5CGQB 3K6SA 5K4HA 3N75A 5ES3A 4JI2B 1CEQA 1HT1E 2BGNA 2HSGA 3B1YA 3IAAA 2YZMA 2ZRMA 2R97A 2A8YA 5FNVA 4REQA 1WHSA 1L5HA 1ZSVA 3G2MA 3ZVKA 2DKFA 4H7FA 2CLLB 3KOWA 1N5JA 1X94A 1C81A 4KRXA 2G1PA 3ZWCA 1A4RA 3R7AA 1V5FA 3SEZA 4PXSA 3KYJB 2H29A 3DZGA 3OFKA 3FYSA 4RJTA 1GUYA 1YJXA 4BJ5A 1IY0A 3M89A 2ODNA 4NEHB 1HO3A 3P0JA 3UC5A 3VGJA 2OB1A 4G1CA 1KE1A 1R27A 2ZBVA 4RABA 1EVLA 4PW0A 3SKYA 4IJKA 5KC8A 1R9JA 4F3TA 3DXFA 3R3ZA 2GHTA 4HDQB 1XD9A 1BEUB 3T7TA 2NO6A 4DC1A 4ZOAA 3IUJA 4HWOA 2IY9A 3WLJA 4CIWA 1OBVA 2FWIA 3AEYA 3JQ8B 1I7NA 1QIDA 1IZ7A 8AT1A 4LZLA 4WK2B 2P9JA 3VXKA 3WK8A 4BP1A 3ER8A 2ZBQA 2DHCA 1JHOA 2RHOA 3C1AA 3HMKA 2UYQA 1SXJD 1H5NA 3GCGA 2PZEA 2KB0A 3SEAA 5HCIA 3ZLUA 3E2MA 4GPD1 1X7GA 2P0YA 4RPCA 3S40A 3L1HA 2DETA 5I5GA 1T9KA 1W9MA 2GN4A 2XZTA 4TTAA 3O9VA 4QNNA 3C3AA 1L4FA 1ZU4A 1S3FA 4L76A 4F6CA 1VIDA 3FOCA 4M2LA 4ZHQA 1PDVA 4CU5A 4FFLA 2XT9A 3DAGA 5IC6A 3Q98A 2WM3A 5BRAA 3GNQA 2DX7A 5CAEA 4XYBA 3VC7A 1UWVA 1FU8A 4RYLA 3ST7A 4NYMQ 3OLVA 1SD1A 2WU0A 1GQFA 5DSZA 3P96A 4JC8A 1WW2A 4ALMA 1Y1KE 3ONDA 5C7LO 3O8DA 4OFXA 3SHFA 4JQCA 2FEKA 4CL0A 1KJZA 4GD3Q 2OHGA 1BDIA 2PX5A 1WBJB 3G49A 4YP0A 5LWHA 2JB9A 2JKZA 3WKEA 5B6IA 4FUQA 1T3LA 2GNAA 1EP3B 3F96A 1M0WA 3KUUA 1NP6A 3PJEA 1UAAA 4QBKA 1K8RA 3S2IA 1EZ4A 2J9ZB 4WTOA 2F1JA 1H8ED 1F1JA 2WKPA 3UEOA 4XSHA 3QMVA 2BF4A 2LP4Y 5FWXB 1S3SA 5DHSA 2LE0A 1KAQA 4FGUA 3FVRA 3RYTC 4YYZA 1YHZA 1VGQA 4XDYA 1P0PA 3Q9NA 4K6OA 1XTBA 3DL7A 4DR4B 4CFSA 2Q4EA 2BP7B 4JBWA 1Z0KA 4P08A 3W5VA 4HT3B 5FQOA 5DYTA 1ACLA 2PNJA 1T25A 4D25A 1F2TB 1U2DC 2YY5A 4WXRA 1SU8A 1XKQA 5G0UA 4PAGA 2WYVA 5DRYA 5H59A 2WJAA 4N5DA 3LUCA 4EW6A 1HNNA 1T0PA 4ETNA 2KHZA 2RBEA 3A2LA 1GPUA 2BMJA 1VBKA 2R6JA 4GVXA 4W5QA 3ACDA 1Q74A 3CLTD 1ZGCA 1BYIA 4HYYA 1ETUA 2P69A 1IJBA 2PA0A 4GBED 1Y9ZA 1HZZA 4M1QA 1HT0A 3R0JA 4REMA 4G67A 3QNWA 2C3PA 1SZDA 2BGIA 3JCZA 2NXEA 4IEIA 5EL0A 3DFZA 2EJWA 2IU3A 1DPFA 1BX3A 3DE7X 4LA4A 1CJVC 2HQ1A 4AM8A 4N82A 5ALXA 4JVOA 1P1CA 4G0PA 3S2UA 5GM2A 2Z58A 3E2PA 3PC7A 4OQPA 4S1WA 1YVUA 3O73A 1B6SA 1X14A 4PO3X 3ZWKA 3I92A 2EW1A 4M1SA 3GB9A 4B34A 5A2GA 3HI6A 1B8PA 4G07A 2WKWA 1WU7A 4PZCA 2BHNA 1JB9A 2Q5EA 3RVPA 2IE8A 1HK7A 3WL8A 1N2SA 2CFTA 1OX6A 2PT7A 4FXPA 5DMHA 2B2CA 5CT6A 1J49A 1B8NA 2WT8A 3LBHA 5DM70 1KI2A 1FQOA 4HWGA 4RY8A 4W9RA 4WINA 4B44A 1K27A 3HUFA 4DM7A 4TXJA 2YTZA 2EBFX 5CM9C 3A4MA 3EOBI 3HYRA 3BCSA 1VIVA 3UAVA 1R8JA 3INTA 2BWJA 1M1NB 1QB7A 1VA4A 1XDSA 2GSDA 3PR1A 1LBTA 4QTZA 3QEOA 4OB6A 2N1BA 1AIPA 2WHQA 5HS6A 3GLFB 1KZ1A 4P3XA 4RPKA 3S0JA 1XTJA 4QPZA 5J5VA 1BGVA 2YJ4A 4ENSA 2V6BA 2QI9F 2YMLA 4YPFA 2XMPA 4K05A 2Q5HA 5TE9A 1L8XA 1Q84A 4ZDIA 3A25A 3UOGA 4XWKA 5F9FA 3HKEA 1YAJA 4PHFA 1S6YA 1KVTA 3UW1A 2D1RA 1RLIA 1BMTA 3NH6A 2O14A 3G5TA 3L8ZA 1JTEA 5AHKA 2OYRA 4ZEVA 1EWTA 1JEOA 2GM9A 1DRWA 2FFQA 2PNFA 1G7CA 2QUZA 3THWB 4LRWA 1B4DA 2AFHE 5JBIA 4FWTA 3OJWA 1M72A 1P2BA 2B35A 5AXDA 1D07A 2XCQA 2GNPA 4PZPA 1H1TA 1XD2A 1EJ2A 2W6ID 3KLOA 4AUEA 4OHFA 2UUPA 1Z88A 4IW3B 4A23A 1H1LB 5BYKA 1NDQA 5EHNA 4DLSA 1OLUA 3LW8A 3Q72A 4XVRA 4TRNA 1JDNA 4UCQA 5FPSA 1W48A 2CLFB 4OI4A 1D6JA 4YAKA 2B2XA 2J30A 2LNDA 2XJ4A 3KELA 3QF4A 1Y82A 1Z4IA 3FPHA 4LJKA 3NWBA 4YRCA 3EF0A 4JHXA 3AVXA 2NPIA 1USIA 2H4HA 3HPRA 1MJ5A 2JZCA 4WCDA 5GZ1A 4KHZA 1ND6A 2W2LA 5FOWA 1Z74A 2PFSA 1IOLA 1FNNA 2R6AA 4NZZA 1JQJC 4H1TA 2CMFA 4A2WA 1UMBB 1SCKA 3LU1A 4UMDA 3RU9A 4JDUA 2YV1A 4PAMA 1KOLA 2OZVA 3H4TA 2H7VA 2J0UA 3GCDA 1QFMA 1QX3A 2JLBA 2ZT8A 1M2VA 3L1JA 1A27A 3AZOA 5D86A 4KODA 4HY3A 1I0ZA 5JAOA 1Q7BA 1HH4A 3NRCA 5BUQA 5IAOA 4ARBA 4J0DA 1NF9A 1SCAA 1MA3A 2XODA 2ZYVX 3FM9A 1LX7A 1IUKA 1P7YA 3FSGA 4WN3A 1DQYA 1GNTA 3LK7A 3TL6A 1QIEA 3ORFA 2CT8A 1XVLA 2XUZA 2RBKA 4JP1A 1RM0A 4FOTA 4JX8A 3ROKA 4K81B 4XASA 4MUHA 3T3EA 3TXAA 4Z1OA 1XLUA 2PX3A 5KYGA 3TTVA 2QAIA 3IT0A 1KAMA 5JQGB 5KYUB 2FP4A 5ALPA 2FW6A 3JYNA 4V0QA 1WXGA 5HKOA 4KLNA 4KFTA 3KJQA 1NW9B 1UMBA 2CLIB 3FLMA 1EZ1A 2ANBA 5HFAA 3GN1A 4CWAA 5J1SB 2XECA 1RI3A 1DX6A 3CONA 3L93A 2C1EA 4IIDA 3ZLBA 3X1DA 2WAAA 1CJMA 2D1FA 3K2EA 3TECE 4G5GA 2GERA 2C4VA 5BW4A 3ZHOA 3CSDA 1GPMA 4OHVA 1P9WA 4OSOA 1MUUA 5IM4F 4DHEA 2FFRA 3AOGA 3NOXA 1PFVA 2FF5A 2RK6A 3BKWA 3M8KA 3PXXA 5BN4B 3URMA 5FRDA 4ES6A 4YRZA 2RHBA 5T6MA 4X41A 3LX6A 2CF6A 5DBHX 1FDOA 2GOYA 2AEJA 2EGUA 2RKWA 4Y18A 1YD7A 2PO7A 1NVBA 3FKSD 4GC9A 5ERYA 1E2BA 1UANA 3TVYA 5L7YA 3O1JC 3LWZA 3I01A 1SHUX 2GBGA 3QIAA 2CNOA 2DJIA 3KU1A 1XCBA 3AILA 2ZJAA 4JJZA 1L7MA 2WWTA 3ILHA 4LOLA 4MW6A 4WIAA 1DI0A 3CZ9A 2IYPA 3ZV5A 4BQRA 4CMAA 1G20A 1X19A 4RVDA 4U2GA 1LVHA 4D9NA 1SVNA 3AETB 5JZVA 1H5UA 1B8OA 3GHYA 3IALA 5DNAA 4ZV7A 2HNKA 4MHOA 2G70A 3PVCA 3ZHSA 2CXOA 1ML4A 3ETLA 3KYBA 3AEUB 3KKZA 4G36A 4HS9A 4XEUA 4KV7A 5IKOA 2DWUA 1JG4A 4JC4A 4BB5A 4HPJB 1R8YA 3O8NA 2H2HA 2XE6A 4BX9A 1TT7A 1XTPA 4C4RA 4ARVA 1KQOA 5C18A 3OKPA 1C3VA 2VKQA 1SUFA 4Q48A 1A3CA 1MLDA 1NQTA 4I6GA 4MULA 4Y6QA 3CQ9A 3CR8A 2JIQA 1BROA 4DT1A 5L95A 4RCYA 3PGLA 3TZ6A 4S12A 3PFKA 2NTYC 1OJ7A 1Q1NA 2YWRA 4P31A 4N0QA 2Z57A 1P80A 5TJ9A 1U7OA 5A4FS 1SCUA 3B1KA 1MRSA 2FEXA 2HK7A 3IRVA 2AXNA 4NOKA 4ZOEA 3NOOA 4FFRA 4G5FA 4NBTA 4O08A 4ZDJA 3KQLA 3PEYA 1FRNA 1QZZA 3HFJA 4B7XA 1U7XA 2LV8A 4BGIA 7ADHA 2FX5A 4L8YA 1QGAA 4XRGA 1M2VB 2ZUEA 3PR3A 3DL4A 3KEFA 2DHQA 2YKGA 1G59A 5FI5A 1IRIA 1NQ5A 3AR5A 2VK1A 5K3BA 4JLBA 4KXFB 2JIZA 4F9TA 1JDBC 3G9QA 1G9TA 1U7HA 4UFOA 1D6NA 4YTEA 5G3YA 2FUEA 4KH1A 4NBKA 1XNJA 3ANSA 1U1CA 4JLJA 5M34A 3OPXA 3SC3A 4C76A 1Z5OA 4PRLA 3RHFA 4I5EA 4L22A 2AQ8A 3I2GA 3NTVA 1C0PA 2A5GA 5BSMA 3OZFA 4C4ZA 1JUDA 2RCNA 3N53A 1IWPB 5CVJA 3WMRA 4D0NA 5D7NA 4B3BA 2OXEA 3T5AA 2J46A 3BH7A 4WL0A 1DUSA 1MF7A 3PEVA 3VI3B 1RHKA 5EUBA 4JUDX 3SNKA 4N5NA 4ZMSA 1J5PA 3JARA 2VJNA 2X23A 3LUPA 1TM1E 4Q4HA 5FO0A 3ZZTA 1VYTA 2WUDA 4DTIA 4P4SB 4E6PA 5AM3A 3UJNA 2JLYA 4OBBA 3LX4A 4U00A 3CG0A 3LFUA 3H1GA 3O92A 3P2JA 3SE7A 3DJFA 2EG9A 3BMOA 1FPQA 5C80A 3TCNA 1XDDA 2CNNA 2IXAA 4KTTE 1N8NA 5D84A 5KDLA 4ZCTA 3EWAA 2IZ6A 3FVVA 4MHSA 5FF9A 4URVR 1AKMA 2M9MA 3QX8A 4ID3A 1DX9A 2MOKA 2NUPB 2R1UA 3L04A 4IV0A 1PS8A 1Z7BA 4NAUA 3PIDA 4EGJA 3QXXA 1OFHA 5C7IO 2V55B 2K7ZA 1IHOA 2J9GA 2XRYA 3BBPA 2J5KA 5BYBA 3RUAA 4EK9A 1O6BA 1ZH4A 3EJWA 2BSQA 1XL1A 3HZOA 3IUYA 3MCZA 1ESCA 4JL5A 3C4VA 4NHOA 4EHBA 2FN9A 5C1BA 1R1DA 2HREA 4TMVA 1NJ5A 5B7QA 3LCMA 2VXCA 1COWA 3ZR4B 2Q3LA 3UWMA 4ZMRA 3GGGA 1HA3A 4IICA 4X60A 1FRZA 2QTTA 3B3FA 1PSZA 1RABA 2MT9A 5HJEA 2V5UA 4G4IA 1EK0A 1IZ9A 4YXFA 2HWWA 4NDZA 1FTYA 2O0KA 4Z2AA 2TSYB 1FYWA 3N3BC 2ZPUA 2QXUA 1W0KD 3Q6NA 2Q2OA 4FN5A 3KTOA 4UU7A 3L0SA 1M2HA 4LCEA 4WESA 4WN9B 1E6CA 1NJGA 4AX8A 2OPHA 5T6BA 1MOZA 1Z7WA 2QJOA 4Y2VA 2WWIA 3NT4A 3ZXUB 2RGYA 4NJEB 1EM8B 3UT0A 1JAXA 1QE3A 2PRJA 1YCHA 4L8VA 2QUKA 1L7BA 2Q7OE 1NBMA 2IYYA 1PG0A 1KPIA 5LUAA 1KK2A 2ANCA 1V16B 2B8WA 2W2QA 3B36A 3RDPA 1JJ7A 5BSGA 2FEPA 4O2AF 1NNI1 4QARA 1AZWA 2A14A 1HRDA 4G5OA 4IQFA 4AJHA 5B12A 2C2KA 1LQ2A 3RYFA 2VC2B 1PK9A 1B43A 2WTXA 2C77A 5HF9A 1L5NA 1Z62A 3PR2B 2NNWB 3BMQB 2BONA 3PEUA 1H69A 1RHRA 1RYBA 1EE2A 2RGXA 3BL8A 3HU1A 3JSAA 4GKAA 4IH4A 3FWKA 4KQFA 2F3UA 4M37A 4RJJA 4Y1RB 5TQ2B 4NMLA 1BD4A 1Q21A 1M8PA 1O08A 5DIZA 3D0KA 5DGDA 1ST2A 4TLMB 4EAQA 1L4LA 1NRWA 3R3UA 3VGPA 3WA7A 3LXUX 1HQYE 3GIDA 1CQIB 3PFCA 3IB3A 2VK2A 2QYSA 3O84A 2BBOA 1ZNZA 3D6UA 2EP5A 2JFHA 4FOSA 5TGTA 1OILA 3TN7A 3ZNOA 2V96A 4A2PA 5EQFA 2NZYA 3EEQA 2WWGA 3L7IA 4MJ3A 5KCMA 2JZOA 4D9KA 1RHUA 3D3KA 4L4XA 3UWSA 1A7AA 5CXQA 2FTKE 2ZB8A 2J0QA 1QC5B 5IVHA 3TZKA 3H4IA 3NEPX 4QXAA 5HDBB 3PYLA 1TDJA 3MTIA 2QTFA 3OQNA 1FUKA 5JYBA 4UE6A 4F5WA 3ZNNA 2GD6A 3WXBA 3E5NA 2JLSA 2ZAIA 4HDMB 1C5KA 4DV7B 4HQRA 5K0CA 2NTJA 1W4CA 2HJVA 3FFXA 4B7ZA 5DNUA 5LNK1 3RADC 3TR6A 1FLNA 4EI8A 3OUUA 1F14A 2Y9MB 1QGZA 3T7CA 2IYXA 1UBTS 3BK2A 4FNOA 5F64A 3QVWA 3FFTA 1XQ9A 3G8DA 5HF6A 2PGJA 2YVLA 4R3WA 1RTTA 1JWBB 3RSZA 2GF0A 1T6ZA 4CM8B 2GZ1A 4DW8A 1ZFNA 2IXBA 5CVCA 1OV4A 1T8YA 3MWJA 4RGYA 3MOIA 4AROA 1NW8A 3CVYA 1ZJ6A 1RNLA 1PU2A 1XPRA 3PQCA 4C4YA 2O8VA 3QSGA 2XMRA 3QTLA 5KYWB 1DTWB 1EQAA 1RWKA 3TSOA 1TD9A 4OQQA 1L5YA 4GYWA 1E7RA 2JCSA 3AFMA 1DDIA 3V32A 1AZSC 3L5KA 3AONB 4DQKA 1MC5A 1L4HA 1AUOA 3NBFA 4CM7A 2BMEA 5JATA 1GV0A 3WHPA 1XPUA 2J3QA 2A0XA 2I2XB 3LF2A 4MJXA 3D4IA 4AY6A 2OL4A 1G7SA 2QP9X 4KH0A 4F5DA 5C8YA 2P2CA 6REQB 3NHRA 1RBQA 3KYDB 2Z6VA 4LZNA 3VPGA 5K7SA 1K3UB 4AW9A 4DG8A 3L7YA 1NJFA 4PONA 4BX2A 2CYBA 2NM0A 2JARA 1Q11A 2XQKA 3AYXB 3H1TA 2XDWA 2AHOA 3GGOA 5T57A 1L3BA 1MP0A 3SPXA 3WK6A 1RACA 1CFZA 1SU4A 4EY8A 1CYDA 2NSHA 3DDWA 1JG2A 1GEGA 2YJTD 2GPYA 3P9PA 4I6JA 4MIYA 5K0GA 1M5RA 1A7UA 2VRCA 2ZIZA 4UDNA 1PEDA 5D5PA 2BFPA 1CETA 1V7ZA 3U7IA 5M5BA 4KLRA 4DR3B 5B58T 3OEWA 3UQZA 3K9CA 2OD2A 2VLIA 1F17A 3K9NA 1C7EA 2PBRA 3NRBA 3FCXA 1EE9A 4IQ8A 4YLGA 2RFLA 2OQIA 4J16C 3NJ8A 5ALJA 1PFGA 4CIAA 4BVLA 3UFXA 4KWIA 3ZDFA 4Z4QA 2ZTUA 1SM4A 4QLAA 4JLPA 2D1TA 1MV8A 5KTYA 1T4MA 4Q05A 3IP8A 4MR8A 4Z4FA 3TLGB 2OFWA 1YQQA 4BAGA 3E0QA 1OSNA 2NVOA 5JVDB 2HRZA 2IPMA 1KOFA 3IQZA 4M9CA 4U5XA 1LDGA 5HIIA 4F84A 1W0JD 1USVA 1ZM7A 1WHSB 1F3OA 3A4VA 3NKLA 1CUAA 3PUWA 2VHZA 4IX9A 1QSGA 4OYHA 1A2BA 3PGKA 2F8SA 1K5PA 4HQ6A 5DJ5A 3HG7A 2JLAA 1UJ5A 2Q99A 3IOCA 4HR7A 2C95A 2G9NA 3KHTA 1RJFA 3M5WA 3DNMA 3OQOA 2W71A 3PQ7A 1LBQA 5ITWA 3PK0A 4TYYA 1ENPA 2PXHA 7MHTA 1JBKA 1T3GA 2A7XA 3FSRA 1FFEA 1OWPA 5EFOA 4BIIA 1M76A 1X1DA 2VQSA 2PXAA 3UV7A 5HQ3B 3ISVA 4GHWA 4N9QA 2GBCA 3LC1O 1OU0A 4B8YA 1FZTA 3NRJA 3BKXA 2E4ZA 4MYTA 4N3BA 5JEDA 3PL1A 3FDJA 2Q1UA 4QOHA 2ZB3A 4DVGA 3EOZA 5K8TA 3C5CA 3FNQA 1MH1A 2PRIA 3MT0A 2RI6A 3UWDA 4OLHA 2BJWA 4IIFA 4LHYA 3K05A 5AKXA 4DLPA 2GJAA 1UBKS 2X3YA 1PZXA 3DZ8A 1KVSA 4PNPA 2BEWB 2AOUB 3L2OB 5DASA 1M83A 2EGHA 4JVSB 1NMZA 2CMDA 4EPWA 5A02A 5JIBA 4G8DA 4UBLA 2D8AA 3BEOA 4B17A 3EASA 2I2AA 4EUKA 5IAGA 1E3DA 5E6RA 4GDFA 5C5DA 3QYFA 4L0CA 4R4JA 2DPHA 3ZE0B 1QAOA 4C6SA 2OBNA 4Y9DA 3NWJA 3L92A 1UT6A 4J0KA 5KOHA 4HB3A 5H68A 1ZJ4A 1DVRA 1HWYA 3AVPA 3SXJA 3TPFA 5JSZB 3F6EX 2PUWA 2HA3A 3OCYA 3U9LA 1N57A 4G0YA 1Y80A 3HSYA 3KC2A 4IKOA 4EJSA 5CFLA 5IUJC 3U5ZB 1TMYA 1Z0JA 2OK7A 3QOXA 2ID9A 4Y1RA 4ZT2A 2H8KA 5E7QA 2ZSUA 2OQVA