1XF9A

Structure of nbd1 from murine cftr- f508s mutant
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
281
structure length
264
Chain Sequence
TGIIMENVTAFWEEGFGELLEKSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Side chain and backbone contributions of Phe508 to CFTR folding.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 91
structure length 264
sequence length 281
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xf9A00
5FOSA 5JWOA 1XTRA 1V5WA 3QQ5A 3KUDA 2O8BA 2VHUA 4HDOB 2KWIA 2JCSA 3W5JA 4OI0A 2W6IA 4HYYA 4A0HA 4RSGA 3DOFA 1NSTA 3MGCA 3CKLA 4M9QA 1G7TA 1ESMA 4Q18A 2GXSA 5ELXA 1Q3TA 1N0UA 3EPHA 1VCMA 4PZYA 4ZCLA 4NYMQ 4BFZA 4D80A 4XVUA 3AQ4A 1SQ5A 2DFKB 3ECCA 1DELA 1G16A 3KDSE 1E96A 4LPSA 4HSEA 5FL7D 3RLFA 3IIKA 3LDAA 1G8FA 2QBYB 4GBMA 5FI1B 1P6XA 1RFLA 2QI9C 2IXFA 4ACBA 4V0ME 5G3YA 3K09A 2CVFA 1DAKA 1R5OA 3L8ZA 1UBFA 5DYIA 2OXRA 2QT0A 3QPUA 2A5GA 1W44A 1K5GA 5A0FA 2WICA 3QKSB 1KSGA 1P3JA 3UMSA 1ZC3A 5J4HA 1X1RA 1UJ2A 3TSWA 3DEFA 4BRUA 4QG7A 1SVIA 4Q9JA 4MGIR 2D2EA 4Q1CA 3U5ZB 4C0LA 1E9CA 3NH6A 4A0GA 2V54A 3WMFA 4FINA 4EQ6A 1SKYE 1IAQA 3K70D 2QEQA 1M7GA 2ZJ8A 2HV8A 1KDRA 3TUIC 1ZVQA 1IN6A 2ZR7A 3BGWA 1BKDR 3MWLA 1WDTA 2ZRPA 4QGGA 4TZ6A 2TMKA 2X19A 4JKYA 4TLBA 1XDBA 5FBRB 4E03A 2YHSA 2BBTA 1DS6A 1Z0IA 3CX8A 3QEOA 4Q47A 4TTRA 2Z4RA 4V0LA 2UZ3A 2VP4A 3BS4A 4LJ4A 1JR3D 2RH5A 1ZUNB 1G8HA 2DWQA 2HJGA 3X1DA 5BN5A 2PZFA 1M8PA 2YNMA 3H2YA 2V3CC 2VPPA 1E9FA 2P65A 1DE0A 4XJXA 2QENA 1X1SA 3LLUA 1RW4A 3GEHA 2BV3A 3OHMA 5DIFA 2RGXA 2V7QD 4LCBA 2IL1A 3I62A 2F1JA 1NVXQ 1ZCBA 2ORWA 4MRNA 1YRAA 2O0JA 1TTTA 1W36B 4M1MA 2O8CA 4MKFA 4TYPA 5FPTA 4Y0AA 1QHHA 4B47A 3DMDA 2YWHA 1NLYA 3SHFA 3MG9A 4JSYA 3S1AA 2DWPA 1SVWA 3LV8A 1CR4A 2WSSD 2GTPA 1WBBA 3IO3A 5FTNA 3Q72A 1NBMD 1OLOA 1E2LA 4FCTA 5FL7A 1Y3AA 2ZI5A 1ZW6A 3HU1A 4KFRA 3GCGA 2OCPA 1TQ4A 3IGFA 1YZKA 1NN1A 1XB2A 2AK3A 4PSVA 1PJRA 3UG7A 3OESA 3GFTA 2J0UB 3MWJA 1WBDA 4DDVA 3C15C 4DIDA 1OIWA 5GJVC 2EYUA 5KO2A 1SXJB 5EXTA 4TMXA 3RS7A 1X8LA 5FPYA 5B30A 2AN9A 2GESA 5J5CA 5DGXA 1P73A 1U99A 2G9NA 1FX0A 4GI7A 4C2TA 1L8QA 1N5LA 3HYTA 3L0SA 2ZI3A 4I99A 1KK0A 3VU9B 3GLFE 2CLCX 4FXPA 5BN4A 4HUTA 3NEYA 1NNEA 2QG6A 3HPRA 1J70A 4DLXA 4MRSA 1E2JA 4KBFA 3K09C 1KI6A 2FN4A 2WOJA 5J4KA 5C46F 2QMUA 5E3HA 5AJZA 1T9HA 3SBDA 2C5LA 4M8NE 2QORA 2BJWA 4AKHA 1QBKC 5G40A 1L4UA 1JR3A 2G0NA 4Q9KA 1GM5A 1R5NA 1AS0A 4IDHA 1N6NA 1J8MF 4C7OA 2AKAB 2G6BA 2VO1A 2YYZA 3QBTA 3I73A 4UJ5A 1IOZA 2GCOB 2QGZA 4GP7A 4ON9A 3EIHA 5DYGA 1HE1C 5KNDA 2V7QA 4LZZA 4PSKA 4RFVA 1GOTA 2DPXA 4M9ZA 1U8YA 3THWB 2ZE7A 5L3QB 1XMSA 1KMQA 2P3SA 3KKPA 5J4YA 3SDZA 3IQWA 1RJ9A 2HLDD 4K81B 4EPTA 5CB6A 1F2UA 5AJYA 421PA 1NVUQ 1A7JA 4XVQA 3T35A 4WW0A 5EQTA 3BH6A 3CM0A 4GOKA 4M53A 5CK5A 2ZJZA 2J0QA 4AK9A 3LVRE 2WSSA 3NHAA 1E1QD 4KCGA 4UNNA 4DLYA 2VP6A 4JLBA 4ZI2A 1NBMA 3EXAA 4ZKEA 2J9RA 4JLDA 1E4VA 4FN5A 4YXWD 3GLIB 4IW3B 4K8OA 3U7EB 2WJIA 1VIAA 2O8BB 3QENA 2BWJA 1Z06A 2LKDA 1Z47A 3MLEA 3A37A 2D7DA 5HTKA 1R0WA 1KDOA 2P6RA 1P2VA 4B73A 3I5XA 5KU1A 3KQNA 2GZDA 1NG9A 4IDPA 3HU2A 3R7WA 1P4SA 3HR7A 5DHFA 4BFVA 4PQFA 2BMFA 1KDPA 1E2EA 1UKZA 2GK6A 4D25A 4NCHA 5JFGA 2O0HA 4D2IA 2D06A 2ZAMA 4D4JA 3BB1A 4Q9IA 3CPHA 2ONJA 5AUOB 2ZTSA 2F7SA 3OZXA 5KPDA 2XB2A 1CKEA 3V00A 1KI9A 3GMTA 1IN8A 3DKPA 2QUZA 2GEUA 1DO0A 1U2RA 3PENA 1RKBA 1T0HB 4V0MA 2K5UA 4OK6A 2RCNA 3AP3A 4NBSA 1NVWQ 1XJ0A 1Z6YA 1OT3A 1ZC4A 2DFTA 4RKEA 4QM7A 4WZBE 2GK7A 5EP2A 3W3ZB 3GP8A 4Q4AA 1J99A 4Q1AA 3PXGA 1Z08A 3UIEA 4URZR 4TYYA 1DADA 1VYVA 1GZSA 2ERYA 5C18A 5HE9A 1P62B 3OFND 3GFPA 4RCZA 4EQ6B 4ESHA 4YMWA 2QY9A 3KKQA 5DO9A 1E9DA 2HCBA 2AL7A 1W5TA 4J0QA 1YZNA 2HLDA 4HDQB 4V0OA 2MMGA 4HAVA 4DDTA 2CL7X 2WWGA 2QRZA 2ZETA 4G0NA 5BQ5A 5EZ5A 3TW4A 3UPUA 4AI6A 4U00A 2G88A 1E98A 1E0AA 1P9WA 4BRWA 1NIJA 4B3FX 5DHAA 5LDDC 1TADA 1P9RA 4UNPA 2UKDA 1E1QA 3D6TB 3VR2A 1DVRA 3WRYC 1M7HA 3PCRB 3C14C 1XPUA 2CBZA 3EASA 2QTVB 1XXHE 5FOVA 3VHLB 1ZIPA 4IHQA 4D81A 5BW8A 2WJVA 1DAFA 1ETUA 5FTKA 1TQ2A 3IIJA 4YXWA 3WMEA 1A4RA 3U2QA 1COWD 4QNRA 1ZP6A 3T5GA 1OIVA 2QAJA 2BVNA 2G3YA 3BB3A 4KYUA 4Q03A 2R2AA 2BBOA 2IS1A 3BB4A 5TVKA 3EAQA 3TQCA 1OXXK 4DWJA 3W8NA 2XOKD 1GTVA 1QHHB 3ICEA 3PUYA 2X8AA 2IX3A 5FPSA 3CZQA 3CH5A 3CWZA 4Q4HA 1BYIA 2FSGA 4CGZA 3BBPA 1CJMA 4M9XA 2ZRJA 1GP2A 3G5UA 2ODNA 5JI2E 1E2NA 5JS8A 2EWVA 4DLRA 4XWOA 2C77A 3FPAA 3I8SA 1CULC 3U4QA 2RGEA 2WPDD 2R6AA 4GFDA 2GVZC 3REFA 3ADDA 2AK2A 1GILA 1DAIA 2BCGY 1OH7A 1NG1A 2JJ2D 5H1YA 1MT0A 4PPQA 1YZTA 1R6BX 1LTQA 1IHUA 3TSOA 5EP1A 2FGJA 1NI3A 2IYWA 5IK2A 3SBEA 1UEJA 1VCIA 3AVOA 4A92A 1KSHA 3THOA 3AGPA 1FX0B 4KV9A 1RC8A 2IS6A 5JMTA 4JYCA 4IFEA 1NN0A 4W5JA 3OFNA 2Z0MA 4HLCA 3K70B 1IBRA 4JT2A 1RVDA 1IONA 1XD2B 4HB3A 1Z3IX 3CRW1 4DB4A 1ZU5A 3C16C 3TMKA 4XWKA 4GDFA 1FNMA 2B92A 3WYAA 1X6VA 2C2HA 2HEIA 4AYXA 2YOGA 2IHBA 4FWIB 4GZLA 3B1VA 5FTLA 3LH5A 2W0MA 3RNLA 1NJGA 2BKEA 2AX4A 2ZSAA 1WF3A 4PHFA 2Q3HA 5G3ZA 2EVWX 1F48A 2JLVA 4LC1A 1UDXA 4HI0E 3HU3A 1YR6A 4EPWA 1C1YA 2GJAA 2WJHA 4C7OB 2GETA 1Q0UA 1YR7A 1LF5A 4NONA 1FPMA 4RJLA 3U3RA 5IRCD 5G41A 2GCPA 3A4NA 3X1ZA 1D9ZA 3CNLA 8OHMA 4DCTA 2ZE5A 1COWA 3NHBA 3T12A 4TMVA 3NWJA 1W47A 3TE6A 1AQYA 3QF4A 1YZUA 2XX3A 4JVNA 4QGHA 4I1UA 1RJ9B 2RGGA 1F2UB 1E9BA 1JXOA 1QG2A 2XOKA 4CVNA 1TNDA 1S1MA 1KMHA 3ZYCA 4DCUA 3KL4A 3LWNA 4KJZA 2ORIA 3EIQA 1ZBDA 4HB0A 4F4IA 1U94A 2AXNA 2QROA 4F38A 5TV2A 2ZVPX 4YMVA 1G19A 1KK2A 1CEEA 2A5FA 1I4TD 1UKEA 2IYVA 2WM9B 1ZM7A 3BRWD 2WPDA 3ZS8A 3OF5A 2IWRA 1KY2A 1GAJA 2QMEA 2YINC 3ZZUA 1GRNA 2ZQ5A 4Q21A 5M04A 3U44B 1XX6A 3I3SR 2AWNA 4F93B 2H16A 2WIBA 2QN6A 3H4MA 3GFOA 2NO1A 2GAOA 2FA9A 1TUIA 3R7WB 2R8RA 1O3YA 4MKIA 3DMNA 2QAGA 1NN5A 2Z5FA 3SJCA 2HT1A 3F8TA 1U0LA 3CPJB 4TWZA 4XOIA 1PZNA 4HATA 4LBVA 3CPEA 5JRJA 3D7MA 1XD9A 1NLZA 3TIFA 4D82A 4A2QA 2AR7A 2KJQA 1WA5A 4BE7B 2XZPA 4MRPA 4X8HA 5KDDA 4PC6A 1XPOA 4XSGA 1XEXA 1XEFA 3SHWA 4DKXA 2GILA 3R20A 2J46A 4DVGA 1TU4A 3GJ3A 5EUQB 4C0JA 4Q4AB 2N46A 1MO4A 3F3YA 4LV8B 4ESVA 2DFLA 2RB4A 1XTKA 1GRQA 3GLGB 3ZVMA 3K0CA 2CJWB 2WMNB 3P27A 4QXAA 1N2CE 1SKYB 4A1FA 4E09A 1KI1A 1KHTA 2ERXA 2Q9BA 1XP8A 1CBUA 2VH5R 1A82A 1UPTA 4F4JA 3EPJA 1W1WA 2ZRLA 2ZANA 4JZKA 1VCNA 3SOPA 1GIAA 1Z2CA 3SU8A 2YOHA 4LJ5A 2ZS8A 1AZTA 2MSDB 3VQTA 1ZUIA 4C0KA 2P5TB 5K8TA 1GL7A 3H84A 5DI9A 1WXQA 3LA6A 5CM8B 3REGA 3RRZA 1XXHA 4JJKA 4DLTA 2GJ8A 1N6OA 2P67A 4BFYA 2X1VA 2ZEJA 4D6PA 2J3EA 1LY1A 1G8GA 1NY6A 5JSZB 3ZDQA 1N0VC 2IYYA 4MDFA 1YR8A 3SFVA 2NO7A 1CJKC 3ND8A 4ZCMA 3BFKA 5KPJA 2OM2A 1W2HA 4TQ9A 4MUBA 1PUIA 1VG9B 1AS3A 1UKVY 3FMPB 5CK4A 2WWIA 5LB2A 4EPVA 1HT1E 3PQCA 4B43A 1BYUA 3OEHD 1YHNA 4XWAA 2W6JA 3NXSA 5EXXA 5CYOA 4ZV4A 3U7GA 1NLFA 1GWNA 4NCKA 3PEWA 4Q4HB 5EE9A 4WVFA 1N6PA 5KYKA 2CCKA 1S9DA 3Q5EA 2J7KA 2A2ZA 4QJ5A 1AZSC 1DARA 5KSPA 3WNCA 3W3AA 1G6OA 1IXSB 5DLQC 3B60A 5JZVA 5AUQA 3GEIA 3QF7A 3U4QB 2H8KA 4LGMA 1JAIA 3BK7A 3PUVA 1JXMA 1WQ1R 4IJMA 1NKSA 1HUQA 1OKKD 5K8UA 4B48A 5UKDA 3A4MA 3FKQA 3Q8XB 3BAFA 4OQFA 3EC2A 2IYUA 4LHYA 3WHKA 1AGRA 3D3QA 4LV6A 3CIOA 3LW8A 3KB1A 5C4MA 2IF2A 3OE7D 4AYTA 2QAGC 1VCOA 5H8WA 3G82C 1E2GA 2NPIA 2HYDA 3UWKA 4L8GA 2FSIA 5JHHB 4LV5B 4Q7KA 2QTFA 1QHIA 2WWFA 1D2NA 3CR8A 2WZQA 2RAPA 1I4DD 1E9RA 5TARA 5CDFE 5KHOC 4DXAA 4KI0A 2PEZA 4WAUA 5JCPA 4LYFA 1CRQA 1H8ED 1CJTC 3A1WA 1R8QA 5GJCA 2FFQA 4B3DA 1HURA 4EFNA 2J45A 1PUJA 5TB5A 3RS3A 4B2IA 2WJYA 1L7VC 3LXRA 3QXSA 2YWGA 1G41A 1V43A 2GDJA 2IHYA 3AKCA 3C41J 3QKUA 2CHQA 1XZPA 1W7AA 4C2UA 1HE8B 2OFOA 4ZKDA 3GJ7A 1TF2A 5FPHA 2HF8A 2ZJYA 3K0CC 4QM6A 4ZCIA 1IXRC 1XCPA 4JLVA 3VR4A 4GRAA 4W5HA 1GNPA 1QDEA 5KOYA 1X3SA 221PA 2FEMA 4LSGA 4TYWA 3QF4B 3WBJA 2OFWA 3FVQA 2ZSEA 2ZIAA 1XNJA 2DFNA 2FJUA 2G0TA 3CNNA 3OEHA 3Q9LA 1GVNB 2ZJ2A 4JMPA 3WBKA 2XAUA 4E22A 3OIYA 1KMHB 3QKRB 2CCJA 2VHQA 1EX6A 4PPNA 4HLUC 2BMEA 2ODWA 3L43A 2G1JA 3QBVA 2FX3A 4W7SA 4HAYA 4BUJA 2OEPA 3JVVA 4TLEA 2XEXA 1Z5ZA 4PZLA 1NVVR 1CJUC 1KO8A 1QHXA 3OIUA 5CB8A 4F4CA 4QRHA 3AEZA 1OIXA 1P2TA 3MUFA 1N3BA 1OKKA 2PLRA 3ADKA 4B6EA 3G0HA 4NCJA 2F1IA 1UBCA 2ZRKA 3GLHE 1B23P 1W2GA 1Z0KA 4I4LA 4B2LA 1O87A 1TF7A 4F92B 2ZYTX 1HYQA 2ODBA 2O52A 3NTUA 4LJYA 5DE3A 4R71A 1YZGA 1Q1BA 2OCYC 3OE7A 3IQXA 5DN6D 4JJZA 1Z22A 5C2JB 5B57C 1UBGA 1Z28A 1JQLB 2B21A 3Q7PA 1G20E 4TLDA 4GL2A 2IS2A 4PAMA 3X1YA 1A2BA 2OO7A 2QAGB 1NMXA 4HB4A 121PA 2EYQA 5EZ6B 3TVTA 1XJCA 2EFDB 4XH9B 1T91A 1WMSA 3RS4A 2H17A 3RSLA 4JLMA 4LJ9A 3O47A 4QGAA 2NTYC 4IOMA 5GVSA 1G17A 1H8EA 3PUWA 3CWQA 4QJ3A 4EFLA 3CW2A 3Q3JB 2QE7D 4IOKA 1GL9B 5HCNA 1E2IA 5KUTA 1S4QA 5FUXA 4KYIB 3THYA 4B76A 2KBFA 3M0EA 3B1WA 3DZ8A 1XEXB 4AC9A 4PC3A 3T61A 2FFAA 3I92A 2QSZA 4A8JA 3ICQB 3KQHA 4BLSA 2R6DA 2H1LA 2FE4A 1OFUX 2BCJQ 1K5DA 1KK3A 2F43B 1XF9A 1D8TA 2WVJA 3FWYA 2UZIR 4M0LA 4U02A 4IOLA 1SVLA 5KDLA 2DHRA 1UF9A 4D0GA 2PEYA 4OQMA 2GKSA 5EE1A 4AY2A 3QSYA 2VF7A 4G5OA 4RZUA 2WWWA 1GUAA 4EDHA 1KI3A 4CRWB 4NCIA 3SJZA 4BFTA 1US8A 1CTQA 4MRVA 3RDPA 1Q1ZA 3KJHA 4UNQA 1Q20A 1HEIA 5SZKB 1ZM2A 4G01B 1QHYA 1UBEA 1XMJA 1RRGA 4IDQA 5JLJA 1T0JB 5FTJA 3EA5A 5AUNB 2D74A 3L0IB 5B58C 1W4BA 4A4DA 4PXAA 4CDGA 4LX0A 4URUR 4PHHA 2CHVA 4MYCA 2V4ZA 2OAP1 4TMTA 4ABYA 4KSCA 1VG1A 1VIYA 2C03A 3IHWA 1E2FA 1PLLA 2VL7A 5J4VA 1W4RA 1GG2A 1OB2A 1FNNA 1JJ7A 1M7BA 4C30A 2HT6A 4I1VA 3BFXA 2IEZA 521PA 4A36A 1BOFA 3OEED 3AUXA 2AKYA 5DN6A 4TMZA 4TT3D 4TMKA 3RC3A 4DSUA 5JJLA 3EZ7A 3IBYA 4CEIA 3PITA 4Q5IA 1E2HA 1G5RA 3NBFA 4OQXA 2JGNA 3I1FA 1G64A 1KI4A 4JLNA 3UXMA 3BD9A 3CR7A 4EAQA 4GSYA 2XTZA 4CF7A 2QQ0A 2RGDA 4OL0A 3GEEA 4Q7MB 1NN3A 3ZVNA 2WWXA 1FZQA 3K0AA 4Q1EA 2QE7A 4FMCB 3TKLA 2CNWD 1FTNA 2Q6TA 3E70C 1AS2A 3ZD7A 1NVVQ 2OCAA 3EC1A 1MO3A 1JJVA 1VYUA 4KLNA 3FFBA 1KAGA 2JIZD 2QM8A 5F98A 1E79D 2ZYUX 4C0SA 2FPLA 3TVDA 4DCNA 3W5IA 1G8PA 1G6HA 5J40A 1JEDA 5JJKA 3TSZA 2BC9A 4OHYA 3B1YA 2XITA 2VHTA 5CDFA 3VAAA 4PHTA 1OW3B 2IYXA 2GF0A 5AUPB 3LAWA 4BGDA 2YWEA 1UAAA 2ZYWX 3MJRA 1NMZA 1IY2A 3CX6A 2CE7A 4YLGA 5KSOA 1DAMA 4CEHA 1KO7A 1Z6TA 3LBHA 4P32A 2FZ4A 4LDJA 1L4YA 1N0WA 5JBQA 1KYIA 1EXMA 1IY1A 2OAQ1 4A8JC 4O0MA 3TAHA 3SC3A 4BFXA 4DB2A 4LBYA 3T1QA 2B7BA 4CT5A 5KDOA 3I5YA 4DRZA 2X77A 4URVR 2ZE8A 1U98A 1CLUA 3A1VA 1HV8A 4OHZA 4PC2A 1OHHD 4PSAA 1OFIA 1XTJA 3RRNA 2QMHA 4MITA 3LQRA 1T8TA 1HH4A 4P0TA 4MRRA 3NC1C 4LHWA 4AURA 3UMRA 3SR0A 4DT1A 3IPXA 1E2DA 4RZXA 1Z6AA 3K8YA 3OEEA 1EWRA 3PIRA 4TT3A 4C0BA 3HJNA 3GD7A 4D0NA 1JPJA 3NKVA 3L2OB 2FPMA 2Q9AA 3BJIC 4DCVA 3R9WA 1VKJA 1QHSA 1LFDB 4ARZA 1T3SA 3DVLA 4BLTA 4RD4A 4CEHB 5CYPA 4YMSA 4NCNA 3KXLA 2CHGA 4C9BA 4DC9A 3VTKA 1W4AA 2W83A 2FPKA 4ZDWA 1N6LA 2A7QA 3Q7QA 3AKDA 1J7KA 4QGFA 4LWZA 3HR8A 2BDTA 2GNOA 1J8YF 1LVGA 2O0KA 3IILA 2JLWA 1VDZA 3CF2A 3M1IA 4BPBA 4B2PA 1AKEA 1G7RA 2CNWA 2CLSA 4MQBA 3GLHA 2CLDX 1AIPA 3QJYA 3ASYA 4DDWA 4ASUD 4YC7A 3C4JA 4KBGA 1LS6A 4JBXA 1ZM3A 2JIZA 5JCZA 1HQCA 5IK2D 2ZSBA 5F2EA 1E79A 3KFXA 4IXNA 2R62A 4KAXA 5L8VA 2NPFA 3SYLA 4IDOA 3I4LA 2GXAA 3FYHA 2YC4C 2N1BA 3LXXA 4ZDJA 1MOZA 4LJ7A 2ZSDA 4PPGA 2ZI9A 3RVBA 4Z54A 3ZJYA 2ANCA 2RGNC 1ONBA 4PFSA 4YDSA 4PC1A 1E2KA 3TK1A 4O25A 1M1YE 3U60B 2A5JA 4BEJA 3KQUA 1GNQA 4DCSA 1P2SA 4Z1MD 3OIVA 1ZYUA 2EW1A 3FKSD 4OI4A 4QC2A 3FFAA 4RZ2A 1JALA 2JLXA 3THYB 1UKYA 2DBYA 3K9HA 1EFRD 3THXA 4A8JB 3VNVA 3VX3A 1E2MA 2GZAA 1MV5A 3LBNA 3MCAA 1P61B 4TTPA 1FQJA 2J59A 2ZRDA 2QP4A 4Q00A 1OHHA 1RIFA 4DIEA 3WNBA 2ODEA 3PR1A 3DL0A 3CF6R 3AP2A 2WWHA 2F6RA 4C4PA 3ZH9B 1YZQA 2BMJA 4KFTA 1KI7A 2DWOA 3B9QA 2O8CB 2D4HA 4PC7A 2ZS9A 3D31A 4II7A 3I72A 4Q1BA 2F55A 3DOEA 3U3OA 2JASA 3A58B 3WRXC 3S1AB 4UNRA 2F1HA 2HXSA 3EIEA 3EZ2A 4UNSA 5GJWC 3KJEA 3SN6A 2F3RA 2Y8EA 3M6AA 1M34E 1CF4A 3C5HA 4EFMA 1CS4C 1XTIA 2KB0A 3QVUA 3AVXA 5A4JA 3AKYA 1SXJE 1OPXA 4NU0A 5BXQC 4MGZR 5FPKA 1IN5A 1IN4A 1EFUA 1G8YA 2GCNA 5ANRB 1H8HD 2ATXA 3KQKA 721PA 3BXZA 1F60A 1R2QA 3VMFA 3RRYA 3IEUA 5J47A 2JLYA 5G53C 2OSBA 2ZRMA 4LPKA 4ILEA 4ASUA 2FV8A 4JLOA 4NH0A 3CUEF 3NVAA 2NO6A 4N0EA 5LBIA 4JLAA 4OHXA 4UKDA 5KTYA 4BLPA 3JZAA 2PJZA 1NRJB 3EZ9A 4CEIB 1AN0A 1KI8A 3TLXA 1EK0A 3FMFA 2PT5A 4DJTA 4AWXA 1S3GA 2ZJOA 2FWRA 4B6FA 5H68A 1NIPA 1M2OB 3P26A 3MWYW 4P4UA 3VKWA 3GLFA 3K0SA 4LRWA 4LUCA 3A36A 1ZD9A 3TR0A 1IJEA 3J81k 2X2FA 1MABA 4KFUA 1B0UA 1OYWA 5H70A 3V4FA 3MMPA 2QU8A 1G5PA 3IIMA 4M1KA 5TXGA 1KKMA 3ZZ0A 1KI6B 1T5IA 3K0AB 4Z1MA 3NBYC 4BEBA 1K6MA 1JAHA 3LQQA 2ZVQX 3FKSA 2R65A 4QJ4A 1R4AA 1W46A 1CR0A 3KJGA 1TX4B 1ESNA 1AKYA 3BE4A 4Q01A 1VG8A 1EFRA 4JLKA 4U5XA 3HYRA 4H1VA 3TAUA 4G5SA 3ZQ6A 4R7ZA 2GZHA 4L9WA 4LY6A 1F5NA 5CIWA 2H57A 4AKEA 3KJIA 1DPFA 2VRWA 1JPNA 3B1XA 3BC1A 4NMMA 3VHXA 1EFTA 1YKSA 4P4SA 4GMXA 3W6PA 4XTCS 4NYJR 3V9PA 1XBTA 2OUKA 3AB3A 3F0TA 4KVGA 4BLOA 4L4UA 2HXYA 3GJ8A 4HAWA 1HTWA 1E32A 3TGPA 4I81A 4JT4A 3QKTA 4A2WA 2QPOA 2XJ9A 4YDHB 1SZPA 5EE3A 5K8LA 4R98A 3V4RA 2PBRA 2IBMA 2WHXA 3L8YA 4UQOA 2JLSA 1MKYA 4YMUA 1I2MA 1GRRA 3P4XA 4FIDA 1Q57A 3B2EA 4LYHA 4TLCA 4WXRA 2GVDC 4URYR 3KUCA 2ZRCA 3GLIE 2B8WA 1LV7A 4OK5A 3U3KA 1H65A 3U3MA 1VHTA 4Q48A 2Q3FA 1ZU4A 5EE5B 1OH5A 4LJAA 3SZRA 2H92A 2XTNA 1KNQA 1X8KA 4NE2A 3VKHA 3FDIA 1W36D 3LD9A 2DCUA 3ZS9A 4L16A 4DUGD 4IKEA 1EX7A 1M74A 3W34A 1H8HA 2DY1A 3AP1A 1Q3HA 4QFMA 3VNUA 1E2PA 2NO9A 3RAPR 1MH1A 2IC5A 3A1TA 3CF0A 1C4OA 4EJSA 3IKJA 4JIMA 2FG5A 2VEDA 2J41A 4JYBA 1QVAA 2YZ2A 4DT1B 1Z8FA 3IPYA 1VMAA 3GPLA 2W6JD 3VX4A 2PZGA 3RRMA 5HR5A 3UWOA 1GL6A 3WY9A 4FCWA 4YMTA 5HKKD 1Q12A 2VSOA 3M4YA 2OILA 2V9PA 1FW6A 4EPRA 3P20A 2FU5C 3SYKA 3VR5A 4ARZB 2QSYA 2D2FA 3T06B 3WNDA 1SHZA 4L5BA 1ZNXA 2HJVA 3SJAA 4B74A 3EX7C 4B3CA 4NYIR 1SXJD 5BYJA 4DLWA 4DEYA 4LYJA 5HE8A 3QY0A 4IVPA 4C0AC 4QHTA 1RRPA 3QVVA 1S96A 5JWHA 1PV4A 4ERNA 3GLHB 4OKSA 2NO0A 4Q4LA 1CR2A 4AG6A 3T1TA 1Z6XA 4UJ3A 1E99A 3IEVA 3QNUA 4TL8A 2VIIA 3KXKA 2IUTA 3AVQA 4UXJA 2D3WA 4OHWA 1YVDA 4MYUA 2VF8A 2GEVA 1S8FA 2QMOA 4FCVA 4O2RA 5SZIA 3OIWA 2IUUA 4NKRA 3IDQA 4WZAE 3EARA 3EPLA 2PCJA 4OK3A 1Z0DA 3LW7A 4GOJA 1OE0A 4XVRA 1FQKA 1OXVA 1PLKA 2OFXA 3QOFA 1WP9A 2WV9A 4G5GA 3K9NA 2YV5A 2FF7A 5TMPA 3GQBA 4DHEA 1TU3A 4L9SA 3P1JA 4G3XA 2LWIA 3QE0A 4TL7A 1DTSA 4FMDF 5HCIA 4HLUA 3ONWA 5E4FA 4DSOA 2ZPTX 4S35A 3BOSA 3W6OA 4OYHA 4MKGA 2REBA 1A5TA 4Q02A 4DUGA 2Q21A 1KAOA 2I1VB 4POAA 4S2EA 4RVCA 5L3VA 2WTUA 2G1KA 2ZR9A 5TY0A 2IYTA 4WA7A 5KSYA 3I61A 1FL9A 3AH8A 2JJ8A 3X1XA 1W49A 2QQEA 5C4GB 5EXPA 1E9SA 1G4UR 5JHGB 1DAGA 3EA0A 3CH4B 4A0RA 1T3LA 2QPTA 3PUZA 4KU4A 2WBLC 4HUQA 4NYJQ 5HKKA 1RYHA 4M4SA 3MSXA 2H7VA 3TRFA 5J4LA 1I2DA 1G4AE 2XXAA 1IY0A 4A82A 3K0EA 3KKOA 3O8BA 4DLVA 2ATVA 2BEKA 2Q3MA 1NP6A 1T4GA 1HY3A 5P21A 2DB3A 1WCV1 1SXJA 3ZVRA 5HZKA 3VR6A 3TQFA 1Q22A 4EJSC 2C9CA 2V55B 1GNRA 3ZIAD 4G5RA 2OHFA 1F2TA 4HZIA 4HZUA 1LS1A 2V6JA 3MRSA 3KZ1E 3CRRA 3MWKA 3ADCA 2QL6A 1E69A 3AVYA 3LX5A 2P6NA 2ZRNA 2IXEA 4BFUA 2XZLA 2O8DA 4AKGA 4WBSA 1E2QA 3CB4A 2J5XA 3SS8A 1J90A 3W6NA 1DG1G 4O2LA 1OJLA 2PCLA 1XEWY 4NDZA 2I3BA 3PV0A 4I1OA 2QPAA 4BFWA 2N42A 2A5DA 1JECA 1X86B 2PH1A 4W9MC 4OJKA 3K1JA 1W48A 3DHWC 2NIPA 4LBZA 3GLFB 3GJ0A 3H86A 4LOAA 2WJJA 2XNDD 1YJ5A 1MABB 4QBHA 4V02A 3U7FB 4LHXA 1U0JA 2A9KA 2AHOA 4OQNA 1KGDA 1ZRHA 1JEEA 2E9SA 5CIQA 4DLSA 1Z63A 4M1YA 4ITRC 4ZO4A 2NZ8A 1S0UA 1T6NA 2GCOA 4B75A 5D3QA 1TUEA 4JBYA 2VP5A 1ZMXA 2WAYA 3UG6A 4OBEA 4NYIQ 3WXMA 4BLRA 2RGAA 3IUYA 3K9GA 2ZRHA 3NBZC 2J0SA 1G291 2C9OA 1K8RA 3SQXA 4D4MA 1LW7A 5FR2A 3U6KA 3ASZA 3TW8B 2BM1A 1EWQA 4G5QA 1G18A 4JVSB 1R0YA 4P4SB 3FB4A 4RY2A 3A1SA 1U81A 3Q85A 3AVVA 1OXSC 4LI0A 5E7IA 2ZAOA 2X2EA 4PX9A 5CITA 2C9YA 1EGAA 1F6BA 1CP2A 5DNYB 1Z0JA 2OCBA 3AKEA 4O3MA 2QA5A 2V8OA 3AF3A 2EFCB 1E4YA 3RANA 1OH6A 4QBFA 1W5SA 1FUKA 2YOFA 1U8ZA 3L82B 2GF9A 2E1RA 4TLAA 4QNMA 3AF1A 4MDEA 5JECA 4P3YA 4PTLA 2AWOA 2ECKA 3QG1A 4V03A 3GLIA 1JR6A 4PZZA 1GITA 3TBKA 821PA 2OV2A 1W36C 4I1SA 1T3HA 1ANKA 3RS2A 4TZ0A 4Q66C 1II8A 1HQYE 1IM2A 2BHRA 2C98A 5FI0B 5KNBA 1E1RD 2BOVA 3ZIAA 4RD0A 3CONA 3K53A 4XSHA 5IT5A 3GJXC 4EJSB 2OLJA 4F7WA 5LPNA 4B33A 3T15A 3DM9B 1QHGA 2GEDA 1P2UA 2AFHE 4LBWA 2W58A 5D3MA 2SHKA 1ZM9A 2MMCA 3X1WA 1XD8A 3LY5A 2EQBA 4BFSA 4B32A 4B71A 1R8SA 3QXJA 3O8CA 2HUPA 5FR1A 5IDVA 2VP9A 4A15A 2HDNB 2PLFA 2KSQA 3RWOA 2DR3A 2EFEB 2ZSFA 5JWRA 2NMVA 2C78A 2I4IA 3T5DA 5B64A 1TF5A 3L0PA 3IO5A 4C0HA 1UADA 2XNDA 2ASEA 5TDHA 4ZDKA 1SXJC 3LX8A 1C9KA 1TL7C 4R2HA 3VFDA 4IEEA 4MGKR 1SKQA 1Z2AA 3H0KA 4PR0A 2IUSA 4RZ3A 4HAXA 2IEYA 2GJKA 1DG3A 1RPZA 2QTHA 1JI0A 2KE5A 1II9A 2P6UA 3MFYA 1G5TA 2ZRIA 1GKIA 4Y0VA 1LB1B 1S9HA 4FI3C 2FFHA 4G1UC 3NDBB 2C96A 3GLGE 1GDDA 1R0ZA 3FMOB 4Q7LA 4V0NA 2VHJA 3AVUA 4IEIA 3SJBA 1DAEA 3KTAA 4HDCA 1PLJA 2ZU0C 2CMKA 1W4CA 5E7MA 2PMDA 3CLVA 1CIPA 3AF0A 4BZPA 2CL0X 4Z51A 4A6PA 1ODFA 5L3RA 1YZLA 1QZXA 3U3JA 1JB1A 1IQPA 2Z4SA 4URWR 2CL6X 4PQYA 2ZYVX 1JNYA 2C95A 1G3MA 3FMIA 4BLQA 2FEOA 4DZZA 4Q1FA 4BZQA 4US0R 3SI7A 3UK6A 3NDPA 4LHZA 2FH5B 2W2TA 3LLMA 4L15A 2IA5A 4M22A 4EPXA 4V0KA 3DZDA 1QRAA 4QKQA 4UXIA 3E1SA 4MA4A 2XB4A 3HP1A 1KI2A 2R6GA 4N3NA 2WKRA 3AUYA 1XXHB 4M1SA 2OT3B 3X2SA 2VA8A 2J0VA 4P33A 5EP4A 2W2VA 1Z0AA 4PQRA 2EU8A 3PEVA 1Q44A 1E1RA 4R9UC 5GADl 1KK1A 4IFBA 4D26A 3E2IA 2PJRA 4CT4B 2I1QA 4NPHA 2WMOB 1LNZA 5E95A 3JVUA 4Q1DA 2HCJB 3DO6A 4HUQB 1ELOA 2VSXA 2FOLA 2BKUA 2XXAB 2ZXUA 2F9MA 3KQLA 1R10A 2XGJA 4CZ2A 2WKQA 3EZFA 2YWFA 1NJFA 1OFHA 4UXHA 4BASA 1UFQA 4PPFA 5AJVB 2PT7A 1KO1A 2RGNA 1EG7A 4RD1A 5EJEA 2IYSA 4CYMA 1E6CA 1DO2A 4LYAA 4ZIRA 1F2TB 4HZUB 1QHNA 4CIDA 4X8MA 3DKVA 1DAHA 1EFCA 5L3SA 2O8DB 2IK8A 1XD2A 5JEDA 5JJIA 3LO5A 4TL9A 3N5CA 2G83A 4RKFA 2V1XA 3L0OA 3TJZA 2Q0HA 4EUNA 5FOTA 2A5YB 1SVMA 1TAGA 3NBXX 1D5CA 2W2XA 2ZM5A 2ZJBA 621PA 3A8TA 4MYHA 3SFZA 4Q4JA 4AD8A 1M6NA 3EZ6A 4LJ8A 1TQ6A 3A1UA 5JI3E 2AD5A 3B7GA 1AK2A 1KNXA 2W0SA 4JS0A 2KBEA 1SGWA 2AD1A 5FUVA 1Z07A 5BWMA 3I32A 2O8FA 4K46A 3LRPA 1TEVA 2E87A 2GJSA 4MYTA 4KVAA 4JL8A 4EIWA 3U6BA 4P4TA 1TMKA 1OV4A 3OAAD 5DI3A 5LD2C 4JLPA 3N70A 1IXZA 1U9IA 4DEXA 1IN7A 3CRQA 1U8AA 2XJ4A 2EFGA 1N5KA 4B3XA 2WKPA 1S1CA 3KB2A 3AVPA 2L0XA 3LVQE 4TTQA 4JVMA 3DPUA 4DSNA 1Z0FA 1TPZA 2PMKA 1A1VA 5FOWA 1I4LD 2R6FA 1OH8A 1CU1A 3PUXA 2J87A 4GNKA 1CJVC 2GBLA 1BH2A 3MD0A 2C04A 3QEJA 3SYNA 3FE2A 4X8LA 5KNCA 3TUZC 3U44A 1FFHA 3O8DA 2BJVA 4BQSA 1N25A 2GWHA 2ONKA 1II8B 3AVTA 5FTMA 1P7CA 5EP3A 5AR1A 5FUYA 3RYTC 5JRZA 1MR3F 3NG1A 2QGNA 3R9IA 3RSOA 2JEOA 3R9XA 3ADBA 1N6HA 2BEJA 3DDCA 1YQTA 3BFVA 2PX0A 2ZITA 4QBIA 2ZREA 5GJBA 2D62A 1XMVA 4FD2A 2FGKA 1JQJC 1N6KA 1KO5A 5D3MB 4B35A 4Q7JB 4TSFD 1KKLA 2FSHA 4QHYA 4C0QC 4N1AA 4KXFB 3A4LA 1VHLA 3AF4A 1KJZA 3WHLA 1FP6A 2P2LA 2ZUCA 2LKCA 4TL6A 4F91B 2CDNA 3B9PA 3BH0A 5KSZA 1ZNZA 3C7KA 3FGNA 4H1UA 4YQFA 2O8EA 2JA1A 4RFSA 2A3RA 4P31A 2QZ4A 1W0JD 4XD7D 5FBLB 4B3GA 2IYZA 4KODA 2W00A 5CLQA 5SZHB 3ZLJA 3W90A 2FSFA 1OYYA 2O5VA 4IXMA 3VR3A 5C1BA 1BS1A 3NEJA 1NL3A 2KI5A 2BMDA 4PO9A 4D0LB 3U7HB 2ZRBA 1MO5A 3K70C 3TNFA 1XEWX 3GLGA 4NL4H 3PVSA 2CJWA 3K0FA 3PJRA 1OFTA 2GHIA 2VP2A 4WXPA 3Q5DA 3UANA 3AF2A 2ANBA 1Y63A 3KTAB 1AQUA 1F3OA 3OAAA 4E5UA 3R8FA 4H9GA 1AGPA 4GOXA 5FH9A 4FMDB 3N2IA 2R6CA 2ZI7A 5A5GA 4DLZA 1P60A 3TH5A 4A2PA 2VBCA 1U0HC 5LD2B 1OB5A 4BWYA 1ZINA 2ZRGA 3D8BA 4URXR 2OBMA 1II0A 1NF3A 4BECA 1ZNWA 4PAOA 2OG2A 1US8B 2OESA 4US1R 2YC2C 1XU4A 4JVLA 4LJ6A 2CXXA 2F9LA 2R9VA 4PAQA 3PEYA 4HAUA 3T34A 1P9NA 2J7PD 2ZJAA 5JSZA 4EPYA 2JLUA 2IYLD 3NC0C 2JLZA 5K8IA 4MH0R 1UM8A 2REOA 3QXCA 3EPKA 3LBIA 1SVKA 5CLLA 1YU9A 3W8RA 3HPQA 2F1RA 4Q19A 1DEKA 1VYTA 3RHFA 1U9IC 5CM9C 4CEJA 3HDTA 1E94E 4AYWA 3QXHA 4M1OA 3QIAA 3QPWA 2WJGA 2WOOA 3SNHA 1KZ7B 2RMKA 3QG5A 3BH7A 2HYIC 3AV0B 5IF9A 3U61B 1XRJA 2D7CA 1DBSA 1BMFD 1R7RA 5JEEA 1G7CA 2QRNA 1WE2A 1D2EA 2GXUA 2V6IA 2EFHB 4NP6A 4BZXA 4DSTA 5FOXA 4TSFA 2V1UA 4KFSA 1OSNA 1OXUA 2JLQA 1FTSA 1TQDA 2GBLC 1S2MA 2NZJA 3FHOA 4R2IA 3E5HA 1ZD8A 3MAAC 4JLJA 2CE2X 3VR1A 1R0XA 1VECA 2HF9A 1KO4A 3B5JA 1YR9A 3SE0A 2BBWA 1QVRA 3B85A 5B2ZA 5HPYB 2QM7A 1RE0A 1RRCA 1N5IA 2A30A 4QOSA 1W0JA 4XD7A 4A6XA 4ZDIA 5CJPA 1IJFA 5AJXA 5EXSA 1ZAKA 1OXTA 2XSZD 3CO5A 3B82A 2P0EA 1T8UA 4RD3A 1AJEA 1FMLA 1VPLA 4ZIRB 3AM1A 2R44A 1FUUA 3EW9A 2ZJ5A 1X8JA 2ZU6A 2LCFA 5L3SB 1L2TA 2YJTD 4HAZA 4GZMA 3I8XA 4FMCF 3QXXA 1FP7A 4IOJA 3AVWA 3SQWA 2VTKA 3B6EA 4KITB 1DOAA 1ZIOA 1EESA 3EWAA 2G77B 2MSEB 3O8RA 3AGQA 1TEXA 1UDWA 2CK3D 3MJHA 4TQUS 3GJ6A 4LC0A 1SULA 1ZJ6A 3NH9A 3EG5A 4TN1A 3LFUA 3RC8A 4Q4JB 4WIAA 2JAQA 1XWIA 4LK2A 1NSFA 1RYFA 1W0KD 3QI2A 2JDID 4IDNA 1KJWA 2ORVA 5HZHA 5GVRA 1U90A 2OBLA 3A6PC 2J7PA 4AKIA 1E9AA 4AG5A 2O8FB 3KKNA 3N2EA 5FUWA 3B1ZA 5BYKA 1MRNA 1NKTA 5AK0A 2H18A 5F9FA 2B7CA 1CRPA 1J2JA 2GJ9A 2IW3A 2QT1A 5DI3B 1Q21A 4FWTA 2MSCB 4NZYA 2IYRA 2ZRFA 3QKRA 2RGBA 3CRVA 2C99A 2J1LA 3NIBA 2YVUA 5LB4A 4DDUA 2IF0A 4M1WA 3ND9A 1BMFA 4US2R 4PO8A 5FBQB 4X8OA 4A0FA 4XIGS 1YRBA 2JLRA 1Z29A 2GRJA 2RKOA 1RZ3A 3C8UA 3B78A 1Z6GA 1G3QA 2QBYA 4M21A 2ZS7A 2VQSA 1OF1A 4PHGA 5FL3A 3WP1B 4Q9LA 1AM4D 5SZJA 1SHKA 1QG4A 1XTSA 1D2MA 1XZQA 4A9AA 1ZM4A 2CVHA 2JJ2A 2C8VA 5JS7A 4FW9A 2Z83A 1KOFA 2WIAA 3WYFA 1XPRA 3QKSA 2XSZA 2A78A 1VG0B 2NQ2C 1KIMA 1P5ZB 4QBGB 2PZEA 2P5SA 1KDTA 3P32A 4JBWA 5DH9A 4N0DA 2AFIE 1VTKA 4RCYA 1BO6A 2QNRA 5IHPA 1FOEB 4M1TA 1CR1A 4IVQA 4MGYR 4ZI3A 3ZD6A 3IHLA 3RS5A 4EKDA 1D9XA 1KY3A 4B34A 4B44A 1MO6A 1G3RA 5AJWA 1RRFA 3K9LA 4ACAA 2CK3A 2WWYA 3VKGA 2QP9X 3R8CA 5DISB 2ZE6A 5AWFC 2ZUDA 3RABA 3WYGA 2REXB 2O8EB 4RFSB 1UEIA 1R5BA 3JZMA 3WP0A 4D4KA 1HA3A 4Q9HA 3FTQA 1W0KA 1XJQA 2OLKA 2JDIA 4B3BA 4HB2A 4M2LA 3UMFA 4Z8XA 3ZZTA 1Z83A 2ZR0A 2F43A 3C5CA 2OZEA 2IXGA 3RWMB 3EWSA 1EFHA 1GKUB 4IVRA 3IBGA 4OI2A 2ZRAA 3RS0A 4GMDA 3THXB 4OJQA 1GFIA 1SVOA 3K0FB 3PEUA 1E9EA 4NTZA 3TR5A 1CXZA 4OI1A 4NYMR 2PX3A 2CCGA 4KLZA 2BIFA 1G7SA 2GAAA 4FMBB 4C3ZA 4JSTA 2BM0A 5E7JA 1Q1EA 2AXPA 4HEJA 3GJ4A 3PG5A 4QHSA 1N6RA 2CEAA 2Q9CA 3B8HA 4RD2A 4E07A 2JJ1D 4DBLC 1KTVA 3BERA 2OBNA 4PANA 3ZVLA 2FFBA 4IRUB 5FFMA 4AIIA 3BWDD 4OQLA 3HWSA 5BN3A 1E0JA 1E0SA 5F9HA 1XMIA 4DLUA 5CJ2A 2XTMA 3UKDA 4WZ6A 4JKIA 2EWWA 1BIFA 4CW7A 1MRSA 1A2KC 2J0UA 4KSBA 4W5WA 2RHMA 2WSMA 1WB9A 2W6ID 3BORA 2JATA 4M9SA 4CEJB 1NY5A 4KO8A 2RHDA 3DM5A 2QP3A 3GJ5A 5DSZA 3FHTA 1G3UA 2OXCA 2UVQA 4Z8YA 1T5LA 3WMGA 1QF9A 2ZI6A 2XZOA 1KSFX 2IWHA 4WOPA 1G9XA 4LHVA 2FDCA 1ZUHA 1D6JA 1G21E 3VU9A 1LF0A 3CNOA 4XTRA 3LNCA 2NOAA 2B6HA 3KX2A 4TMWA 1GKYA 4YONB 3P4YA 2ZUBA 1ZCAA 2PL3A 1AA9A 4JL6A 5FBWB 3TUJC 1KSJA 2XNSA 1KJYA 1SVSA 2F3TA 4PO1A 2VYFA 3PFIA 5EE0A 3FOZA 2H5EA 4GT1A 1ZNYA 1E3MA 1N6IA 4TYQA 3T1VA 2VSFA 4MKHA 1GSIA 2NG1A 4HLDA 3ZQJA 4HLQB 1G3IA 1JR3E 1E0KA 2FZLA 2OE2A 1G1MA 1ZD1A 3B13B 2ZROA 2BBSA 2YKGA 5FOUA 2GXQA 1WRBA 1XCMA 2IT1A 3QUSA 4KHZA 3THWA 4RD6A 3UATA 2IS4A 1XTQA 4OHVA 5L3QA 2B8TA 2FNAA 3FHCB 3CRMA 6Q21A 1YE8A 2NGRA 4TYNA 2VLIA 2Z43A 1HT2E 3KFVA 1P72A 2DYKA 3T1OA 3QPVA 3CZPA 2GA8A 1Q1QA 2VHCA 1XFAA 2RGCA 1NMYA 3ETLA 3KXIA 2FMXA 2WAXA 3H1TA 1P75A 3F5FA 3ZGXA 1FMJA 1PVOA 1JBKA 5FBVB 1KZGB 3SEAA 2JJ1A 4JL5A 3KKMA 1N5JA 3CBQA 1NBME 1S3SA 4NHOA 4ZPXA 4MUAA 2ZI4A 4GPTA 1XCGB 3W9YA 2IYQA 4U7DA 4TQAA 5F3WB 2VP0A 3CX7A 5EUMA 4GP6A 4D4LA 3BIFA 2Z6VA 4QL3A
chains in the Genus database with same CATH superfamily
1FFDA 4OBWA 5FOSA 1V5WA 5H82A 4CTNA 3UAXA 3KUDA 1F20A 3F3SA 3RAJA 2O8BA 1QTNA 1ZVJA 4K1XA 4LG1A 4PLWA 4YT8A 5AESA 1V11A 3DE6X 3MTGA 1EVIA 2W22A 3IDOA 1F4LA 1NJ6A 2W6IA 1C9MA 1HRKA 2WVHA 4OI0A 4RSGA 1WVMA 4RHYA 3I6BA 2D5LA 2H2GA 2ZBRA 1RXUA 2PX6A 3MTEA 3KR1A 5CT8A 5IM4A 1RPTA 4Q18A 4D1YA 1QKKA 2GXSA 4U3JB 1Q3TA 4WK6A 1N0UA 3G8BA 3TLEA 1UIRA 3OPQA 1VCMA 3VU1A 3LT1A 1JEOA 5DBGA 4BMOB 2O1XA 4F4HA 3A9SA 4BFZA 4YAFA 1U28C 5H3CA 1DELA 1G16A 1Y7LA 2NNLD 5E6SA 1ZUD1 4HSEA 2XKBA 2AT1A 5B37A 5J58A 1G8FA 1NT2A 1NUQA 1SHJA 4MI3A 4RLQA 3O93A 5FI1B 5IULC 4D5GA 4EEXA 2WTMA 3MT8A 4K9LA 3ZYZA 5LMNB 4GE0A 3L8ZA 1A97A 1R5OA 2R85A 4XUDA 1BDMA 1MEJA 2J9FA 2PGIA 4UBMA 1J5XA 4ZT5A 3Q0TA 2A5GA 4IH4A 2JJYA 1DRVA 3U26A 2UXBB 1JJFA 1ZC3A 4Z2AA 5J4HA 1X1RA 1K8XB 4N0QA 3MIZA 4YCAA 3WGQA 5AP9A 3RF6A 1E7RA 2AKEA 2PKRA 2AFIA 1KAEA 5T4BA 1BCSA 2V54A 3BUSA 4FGSA 2Q5FA 3E2PA 3L46A 1TM2A 4FFMA 1XQ6A 2SKDA 3PIDA 3K0KA 1LLUA 4KXYA 3L1KA 3OPYI 2ZJ8A 2UYHA 3TUIC 3WR5A 1TKBA 4LCEA 1JEJA 2B8EA 2HNKA 1IN6A 2IUFA 2P2ZA 2A8YA 2VNKA 3G68A 4OLHA 1BKDR 1V7CA 5EJIA 4OMDA 4UCWA 3WYCA 1ECBA 1WDTA 1YI1A 2ZRPA 4P3KA 2P41A 3ONVA 1KFJB 4TLBA 4RYDA 1DS6A 1YASA 3QEOA 2JLBA 2C0PA 5ICGA 2UZ3A 4BV3A 3BS4A 4DQDA 1NUPA 3E7FA 5C34B 4N41A 2BUCA 4RAQA 3K94A 2QTVA 3EAFA 3X1DA 2R1TB 3IHKA 4P3PA 3K5PA 3PXDA 1M8PA 2HIMA 2YNMA 4CMEA 2VPPA 4MB0A 4RF2A 1DE0A 5A62A 2V3CC 1X1SA 1U65A 4UC0A 4R2XA 1CK4A 3FX2A 2YY5A 3GEHA 3KQWA 5B7PA 5KNDD 5DIFA 3W5AA 2V7QD 2WUEA 3IB3A 3OQBA 2GO7A 4KMMA 1NVXQ 2ORWA 2PNFA 1Y4SA 1NI4B 2HK8A 1MGOA 4F5YA 4ND8A 5JNTA 1TTTA 3OECA 4M1MA 2O8CA 7YASA 1QV9A 3HEBA 4TYPA 3QM1A 3T5BA 4FKMA 4H27A 3H42B 3KHUA 4Y0AA 3EQ7A 3VDNB 3CLTD 1P0CA 4R6XA 4NABA 2D2IA 3HJRA 5ES4B 4HWSA 3S1AA 2DWPA 1B6SA 3ZE2B 1ZOIA 2JK0A 3GRRA 3TSAA 3VDXA 2WSSD 3OTGA 1ZQ9A 3DGEC 1VLZA 2DU8A 2YIVX 3IIEA 4ZANA 5E3IA 4WCDA 1D09A 1OLOA 2OMKA 4RKWA 2WI8A 5FTNA 1UBHS 1IHYA 1Y3AA 2PS3A 2C7PA 1ZW6A 3HU1A 4FW8A 4KFRA 1Q1NA 4MZXA 4B0PA 5JPCA 1E5DA 4RA9B 1QIHA 2R6R1 5CVUA 2WIGA 5BSKA 1WPQA 2V59A 1J7JA 2I29A 3F5MA 3GNQA 2JLAA 3MC1A 4K7JA 1KMCA 3BMXA 1ODJA 3OESA 5DNDA 2HFJA 1JHAA 3MWJA 1WBDA 4Z9FA 4DDVA 2O7SA 4K28A 4TWIA 5AOVA 2PKQP 5BSEA 2EYUA 1KYQA 5KOHA 5KO2A 3NI2A 2CFSA 4P08A 1J09A 1T36B 4ROTA 3ERCA 4TMXA 3RS7A 1X8LA 2Z8YA 1P81A 2AN9A 1XRSB 2GUWA 3F3KA 1QS0B 3OIDA 4YP0A 2DSTA 3FTCA 1OBVA 1P73A 3GGSA 5J5CA 2G9NA 1O4WA 3ZU5A 4GI7A 1GY8A 1AH2A 4EYSA 1L8QA 1C9YA 2HGSA 1N5LA 1P0MA 2FRXA 4D9JA 2PGDA 4F6CA 4H17A 4I99A 1FP4A 2CLKB 1NM5A 2CMGA 1PFGA 1B0ZA 2H1RA 2QG6A 3KALA 4F6RA 4C05A 2B37A 3TLBA 1J8FA 4MRSA 1NNUA 3VTFA 1E2JA 3HV0A 4BQOA 2ZWOA 3K09C 2WIKA 3D0QA 3OQ1A 4RTJA 2WOJA 3LS2A 5JCOC 1X7WA 3OY7A 1JZTA 2GCEA 2YVAA 1ODKA 3KTDA 5AJZA 4B81A 2X3FA 2W7TA 1QVWA 2C4MA 4RUKA 1GXSA 4RZHA 3K73O 1L4UA 4FZRA 4Q9KA 1R5NA 5L40A 4Z0HO 2I9KA 1LBHA 1Z74A 1WSAA 2QVLA 2ZT6A 2YYZA 2G28A 5JMPA 3LBAA 4ZAXA 1Z56C 3WGNA 5KNDA 3D6FA 4HEQA 2V7QA 3FHLA 1JIKA 4LZZA 2EBUA 2J4FA 1GOTA 1L3BA 4LGCA 1BU8A 2ZE7A 4CTJA 1UJMA 3EY4A 1YJCA 3RYHB 2G67A 2VT3A 5KX5B 2A1UA 2M32A 3SDZA 1U8FO 5A6SA 1UWVA 4TWRA 3KETA 1RJ9A 4G0MA 2IZ5A 421PA 4PYKA 3P9RA 3T35A 1UJ6A 4HX2A 3B1KA 3DG9A 1WW8A 1Z7BA 1V3VA 4WCFA 4C87A 3GGJA 2WSSA 4UNNA 4DLYA 3KVYA 2BZ0A 4ZI2A 3SKYA 1QLHA 1MENA 4ZKEA 4I55B 2O2XA 4HH3C 5EC8A 1E4VA 1J0BA 4BEVA 1SUFA 1KZ4A 2Y68A 1Z7WA 3H1PA 3JD3A 4C06A 3GPCA 3U7EB 1E8NA 2H59A 5DW0A 2PL1A 1K6JA 3E4CA 4XGNA 1B16A 1AVTA 4OH1A 1GLVA 5IMBA 3QFFA 1LGYA 3PU6A 2D1YA 2EZ8A 1P2VA 2V4UA 1PI3A 5KU1A 2L69A 4GU5A 3HU2A 1YKGA 2Y4OA 1T2FA 3IURA 1E6KA 2AW3A 2BMFA 2VFAA 3WICA 1ISHA 3PYXA 1KDPA 4J2OA 1C9EA 5FPPA 4BKUA 2RBKA 5JFGA 5KIAA 4GMKA 1KJJA 2QTNA 2MR6A 4I5FA 3G13A 4YRAA 2ONJA 2ZTSA 2EBWA 3OZXA 2Y27A 3PB3A 4OQQA 2WZBA 4ZCRA 1WB5A 1WUHS 1TZBA 2WU4A 3EF0A 2ZTMA 1JEQB 1UJ5A 1ABBA 3A9RA 3TLKA 3A0RB 4GPZA 1DO0A 4RH3A 3I45A 4XJSA 1XWWA 3M70A 5FJJA 4DLPA 4J1NA 2HNBA 4EX7A 1SUEA 5IF3A 2PUEA 4M36A 4ED9A 4MS1B 3KQMA 3GIDA 2GJ4A 1NVWQ 2K7FA 1EZ4A 1OT3A 1ZC4A 2EL9A 3K16A 3W3ZB 1SRQA 3GP8A 5EKSA 4M98A 1W88A 1Y8QB 4Q1AA 3PXGA 1YAHA 3UIEA 2JARA 4AS1A 2WLSA 3DXZA 4WLVA 4D9NA 1G2IA 1NXSA 5E9QA 4INPA 1GZSA 2PFKA 2H1IA 2HPZA 3ACDA 2UYQA 2FZKA 4CM8A 3AJDA 5HIKA 4NXMB 3KQSA 3EXHB 5G0TA 3GFPA 4X9XA 4ZAYA 4CN9A 3Q3EA 1EG2A 1XAIA 5A9TA 2BSQA 1X87A 2JZCA 3FBGA 4LW8A 1JMYA 1QYIA 5DO9A 1YOVB 4U0KA 4TZKA 1W5TA 1RS0A 2OENG 4MQLA 5CHYA 3OF3A 4KO3S 4J75A 3SZ3A 4BU0A 2MMGA 1RLOA 4XIYA 3VHRA 1UOOA 2WWGA 2QRZA 2ZETA 1MU0A 4G0NA 4I2NA 5EZ5A 4DN6A 1DBQA 3W5BA 1PG5A 4P98A 4WZAB 3RI3A 3T4PA 3VVCA 4AY6A 3GBSA 4FYHA 1E0AA 4GBED 1NR1A 1M2VA 2XUPA 4R0NA 3W05A 3ZNNA 1KR2A 2C07A 2VT2A 3EAGA 2Q4TA 1E1DA 1M7HA 4OJYA 1KE1A 3VSAA 2OZKA 4Y2JA 3WBBA 2H2IA 1D7AA 1XP5A 2VZEA 3UHAA 3TLCA 5BN5B 1NQXA 4IHQA 1PT8A 4D81A 3G9XA 4DDKA 1QE3A 1BVUA 2WJVA 3TZQA 2XYRA 5KBYA 2G4LA 4RV4A 2PGAA 3OT1A 3WMEA 2UAGA 1A4RA 3U2QA 3PKJA 4LNUB 2OYSA 1FE8A 1IUOA 1XTBA 4MJLA 4R68A 2VTBA 3DJYA 3RUDA 5KNBH 1Q6YA 3BK1A 3EQ9A 2XUQA 2BBOA 4ZJYA 3BB4A 1C7JA 5F3RA 3H5WA 4PGAA 2I7TA 5K0CA 1GTVA 1QHHB 5CT6A 4BO4A 4XUCA 1ZESA 3C3CA 4EA8A 4EB3A 4Q4HA 2FSGA 3P9QA 3QELB 4CGZA 1DTWA 3BBPA 1T10A 1CJMA 2Q6LA 3VPXA 4BMXA 5IKXA 4M9XA 4DCMA 3KFLA 4KZPA 4XFKA 3G5MA 2WYVA 2XADA 3RWBA 3DXYA 2D2VA 1E2NA 4YHHB 5AQ1A 3DAYA 4CKEB 1JFVA 3R0JA 1J39A 1HTBA 2OVFA 3O74A 4TV8F 3OZBA 4GLJA 3VZSA 4BO3A 1MHPA 3K72B 3VH4A 4GFDA 3REFA 3TDKA 4H1HA 3SJ7A 3ADDA 3DE5X 3DBVO 2GHTA 1DAIA 4RELA 4B3HA 1JH9A 1OH7A 1XPJA 3W5UA 3KXPA 4IY1A 3BD7A 1FYEA 5U4XA 4RIEA 3WXBA 4F1KA 2QYTA 3WGMA 4JBHA 1YZTA 3BXHA 4ZT3A 3WLPA 3LPLA 1DJPA 1LTQA 2AI1A 3AHJA 3TSOA 2OXIA 3VNAA 3F96A 2IYWA 5IK2A 3WQRA 3SBEA 3ZNQA 3PC4A 1V35A 1TT7A 3AVOA 4MAMA 1O2DA 3ANTA 4A92A 4CLRA 4U5QA 5E4TA 1SBYA 4ESOA 4JYCA 4MIYA 4W5JA 4CNQA 3BXFA 1VLLA 2VPIA 2RHTA 3DONA 3A6GA 1X0VA 1V1RA 3O95A 3KOYA 1FRVA 2P9TA 2A35A 2VAPA 3DYBA 4JT8A 1KEKA 5K7SA 1C3OB 2JF0A 1O9BA 1CZLA 2UUPA 3LBYA 4KKVA 3F6PA 1O6BA 3C16C 1FNMA 1Y89A 3UCXA 4Z5XA 4QDOA 2HEIA 1PDVA 4TS4A 4AYXA 2EJTA 2YOGA 4I5IA 4OU5A 3BRQA 2B25A 4FWIB 3K4QA 4GZLA 5FTLA 4M89A 3LH5A 1MC1A 3DB2A 2PUAA 1NJGA 2BKEA 4G97A 4AY5A 2Q3HA 4BNIA 1OYVA 3CNBA 1NQOA 3I37X 4LC1A 2ADFA 2W90A 2ZVDA 1A9QA 4GUDA 2PQ2A 1C1YA 1XNHA 2WJHA 2ZLBA 4N3CA 2FZWA 2GETA 3E5RA 3SNKA 4NONA 2H9IA 3ZZMA 4CBVA 1N1EA 1J24A 4BBPA 5G41A 2GCPA 4O4HB 1D9ZA 4KK3A 4B5KA 1LI5A 2HDWA 8OHMA 2O19A 3GZJA 4HTFB 1AQYA 3O0TA 1XOIA 5BPFA 3QF4A 3UHPA 5LUAA 3KEQA 1JDBB 1OFGA 3MJCA 4QGHA 5F51A 4X94A 5ITVA 5GONB 3GVXA 5EINA 4ARVA 1AF7A 4PHCA 1F2UB 4C07A 3FPEA 4BNKA 3HZRA 1XEAA 5AQEA 5EVJA 3C1OA 1DKLA 4G09A 1T1RA 3UHOA 4C2AA 2JKZA 1A9TA 2ORIA 2QTLA 3SD7A 3EIQA 2GCIA 1I1NA 2PS0A 3AEUB 3TB4A 2AXNA 3TPFA 3NHMA 3YASA 4ENVA 3HNPA 2P7IA 4IWYA 3S8MA 4YMVA 1TM3E 2HSWA 4TPKA 1I4TD 3DKKA 5FQOA 2IYVA 1B3BA 2R4UA 1GYPA 3NALA 2NVUA 2DHCA 2ZUFA 5DRYA 2ORYA 3GEPA 1KY2A 2QMEA 1UJCA 1E7QA 3BJRA 3BBLA 1TO6A 2ZQ5A 3NRCA 4HO1X 5BRJA 5JAIA 2CHUA 1RPAA 2B4TO 3GLSA 4XQGA 2FZVA 1XX6A 4HAOA 3I3SR 1ZRNA 4WN3A 2AWNA 4H16A 4RTOA 2WIBA 4NU6A 3H4MA 4NICA 3TRIA 3OIGA 4QYXA 5LC1A 3R7WB 3IPRA 3PGKA 1NN5A 4KX3A 4GP9A 4M7WA 3H0EA 5JDIC 2AFHB 4LTDA 1H93A 2W9XA 1LCIA 2Z2JA 4MQFA 4F8EA 1DJMA 3W2GA 4HT3B 4PU0A 3CPEA 1NVKA 4DFDA 3UUGA 5JZOA 1MB9A 4IQ0A 4IRMA 1EA5A 1CHNA 1XD9A 5JT1A 1VL2A 1QK3A 2Q99A 1Q77A 3JQ7A 3L1HA 1WHSB 6GPBA 2LCIA 5AT1A 4MWDA 4BE7B 5FV4A 5FEMA 3GG2A 3GOHA 2B8JA 2XZPA 5CPFA 2CXOA 1Q2XA 5CLFA 1GT91 4GE3A 5KDDA 1P3DA 2RHGB 4ZOBA 5AXDA 4DC1A 4DV5B 2FR0A 4DVGA 1FVOA 4DKXA 2J46A 4P86A 4CIYA 4MW1A 2FXIA 3JQ8A 3CEPB 3PPYA 2N46A 1MO4A 3F3YA 4E08A 4IDBA 4LV8B 3SKXA 4ZQFA 3KZVA 1C80A 4F1WA 3CLUC 4B3TB 3OPMA 2HB6A 1XVUA 4KO4S 4C76A 3QKWA 1RNLA 3ABOB 3CN9A 1X74A 4Z7NB 4H4CA 3KZXA 3ESAA 3NJRA 2JIRA 1R9GA 4KIJA 4WV3A 4X65B 2CJWB 3ZVMA 3NJ8A 1SKYB 5IABA 3INYA 3GXBA 1N1DA 4HDMB 4XI9A 5E8RA 3HKCB 3S2SA 1KHTA 2P40A 3ETCA 3NAQA 2JI6A 4DIUA 2NUAB 2WD8A 1Y0BA 1UPTA 1WMBA 1YL6A 2R8BA 2X23A 1EVJA 4PWZA 4JZKA 5F78A 3H8WA 1Z13A 4UM9B 5JY6A 3ML1A 3WTBA 1PS0A 2YOHA 4LJ5A 1QDLB 3KQKA 4LDAA 2OAEA 4CKWA 3AHEA 3IUNA 1NP3A 1COZA 3LUPA 3QX7A 3SLGA 5B1HA 3NOQA 4F9GA 2VYCA 1A7KA 1TD9A 4C08A 3G0CA 4L0MA 2ATIA 1WXQA 5CM8B 5BSMA 2K7ZA 2GJ8A 3U81A 4EHLA 3PI7A 2XLCA 1B3RA 2ZEJA 2J3EA 1CUBA 3D0RA 2YJ4A 4N39A 2OPBA 3E23A 2IYYA 5GV7A 3VR4D 2YFKA 5CEEA 1CJKC 2DH6A 2BF4A 3ND8A 5A3RA 1HLDA 2OM2A 3W1WA 2Q2WA 2W5UA 4ZYYA 5BOSB 3MHTA 3CT6A 3M5CA 4TV8A 2CF5A 3SG0A 4QFDA 3T95A 1PSWA 4GZ5A 1Z2PX 4XWAA 1WZ2A 2IJGX 2IEGA 2OWDA 3TLJA 3L8FA 3PEWA 2YJNA 1BNCA 1UBJS 4FVTA 1PJAA 1WWKA 2CCKA 3Q5EA 3R1IA 2J7KA 1L5RA 1TI7A 3BKXA 1CB7A 4NV3A 1EVEA 1OD6A 4KQIA 1IXSB 2VDLB 3DQZA 2M6LA 3DDWA 4DLNA 2H6EA 3PA6A 5DEOA 5JZVA 3T3NA 1QR2A 3LQFA 1JAIA 4LGMA 1R8YA 4Y1EA 2GBFA 1WQ1R 1X7HA 2VHXA 4TV9B 1RADA 5AICA 1NKSA 1RM3A 1H5NA 4LNAA 1T9GR 1I13A 1OKKD 5CCDA 5JANA 5K8UA 2G1PA 5UKDA 3RTBA 4KWHA 3WL7A 3A4MA 3FKQA 4BJ5A 4YCNA 3W6UA 2ILVA 3EC2A 2IYUA 1QOZA 3HCRA 1GUDA 5AVOA 3D3QA 4LV6A 5CB4B 4NS4A 3LW8A 3QOXA 4FQ8A 4TWAA 4NE7A 4AYTA 5KWSA 3FPSA 1MG5A 2QAGC 1VCOA 1Q0RA 1UK7A 3DVRX 3T99A 3V2HA 3DHVA 2NPIA 1TCVA 1IK4A 3FG9A 3IJRA 4RK5A 1SZJG 2WY2D 3IVGA 4RY0A 2QD3A 4O3FA 3KAPA 3AY0A 5B2EA 1PL6A 3GGDA 4PRLA 1D2NA 1QFJA 1ZOSA 4S1TA 3KYCB 2OC9A 4Q16A 5HUHA 1Y1LA 3ILSA 4WNYA 1FF9A 3FTPA 2ZUUA 5LQKA 1JL3A 4MQMA 4MTLA 1L4GA 2PEZA 2Z4TA 4AB1A 4ROSA 4TUYB 4LYFA 2GPSA 3WKBA 1JQEA 2QW0X 3A1WA 3QITA 4HDNB 4WQMA 5BV2P 5H59A 1VB5A 3PQFA 4UU1A 4UTZA 1PUJA 4TLLB 4ND1A 1LLFA 4QYTA 2VPTA 4B2IA 1H2HA 2WJYA 4PN7A 1TU0A 1ZLYA 2IHYA 2OP1A 2Y1EA 3C41J 4LXHA 4PW0A 1W7AA 4PIVA 4L8LA 4YAUA 1PEAA 1RHUA 5F1YA 3F7TA 2N47A 4JI8B 4JC0A 4LKRA 4NK4A 1GFWA 1XA0A 2KLHA 4PVCA 4ZTBA 4BVEA 3PWSA 4LZLA 2GT1A 3VR4A 3F4LA 4GRAA 4W5HA 3B6ZA 1QDEA 1WCIB 5KOYA 221PA 4UEJA 5JBIA 4GWKA 1AB5A 5HYVA 3DTYA 3U62A 2VCHA 1BXGB 4N4AA 2OFWA 3OZIA 1UMKA 3Q9LA 2G0TA 3CNNA 4RO0A 3T7TA 3BM5A 5KKNB 2PKXA 4L08A 4E22A 4MI6A 1QG0A 3OIYA 4KXVA 5BQOA 4BP9A 2CSUA 3PJDA 1Z15A 3C6ZA 4CKZA 2CCJA 3A27A 1HM5A 3AZOA 4LJRA 2HJRA 2BMEA 3W2TA 4OHKA 4D3XA 2XI4A 2G1JA 4YRMA 1EFLA 3RYIA 4W7SA 4AZ0B 1VOTA 2XGMA 3C4VA 3TX6A 3LZ6A 3OUTA 2Q4RA 5L7WA 3D7RA 1TUGA 5TQ0A 1RRVA 4BWGA 4EYOA 2V6FA 4P22A 1Q11A 4QRHA 1YR2A 4CKCB 1P2TA 1ORDA 1OKKA 4QGSA 2ZAIA 3ADKA 2XUHA 3G0HA 3VAZA 2YZKA 3LXUX 4RLFA 4BHTA 5JMWA 4MULA 3GLHE 1B23P 1Z0KA 4F56A 4IUYA 4B2LA 1TA4A 1X14A 5JCOA 2DTDA 1JGTA 3RIYA 1Y3DE 3NTUA 4BUZA 3RW9A 6AT1A 4R5MA 4X90A 2OLEA 4R71A 1YZGA 5DN6D 2X5NA 3W9BA 1DOHA 1Z22A 3NVKI 1T0UA 1PZXA 2ZVJA 3D4BA 1UBGA 1L1EA 4UUBA 3GA5A 1KQFA 1G20E 1I2CA 1B76A 2XUOA 4OSPA 2IS2A 2OO7A 3CKKA 1POXA 3ORSA 4HB4A 4RHEA 1Z25A 2HGZA 121PA 4IS3A 2N3ZA 3TVTA 3ENWA 4YAIA 4S05A 3ZIDA 1HI9A 1TEHA 1AHNA 1RQXA 4QGAA 1VGRA 2NTYC 1UWKA 4IHJB 4ND5A 3NNSA 4IOMA 1N0IA 1GHTA 3ICCA 3CWQA 2PAFA 1C9JA 3H9EO 4GAEA 4IYRA 5JH7F 3X2EA 2FW9A 3Q3JB 2NQ8A 2QE7D 4KLAA 1GG5A 2DOKA 4QU9A 1FJ2A 3OZUA 1LSUA 4C4ZA 1ZKMA 3HDHA 1GTMA 2Z3WA 4LZOA 3M0EA 2CNNA 2DR2A 5ED4A 4UZFA 2OWEA 3N9IA 3IKMB 2FFAA 1AGNA 1J0AA 1G60A 2QSZA 5EA2A 3GDOA 5E8JA 1ZJZA 1O57A 1OWLA 2FPUA 3WYEA 3NHYA 5G1PA 5DVZA 3KUKA 2H1LA 1KK3A 3H04A 3FSEA 2I4MA 2C4WA 3FWYA 4M0LA 4NBNA 4UDNA 5LP6C 3WKAA 1SVLA 1ZH6A 5ER6A 3HV2A 4TSRA 2WIFA 4BUCA 5ITSA 4AY2A 4Q12A 1MVNA 2JAHA 1SIOA 4DJAA 3VZDA 4KQGA 5KTSA 1UPAA 4G5OA 1MXFA 3ZWQA 1U0TA 3FJOA 5HKOA 1GUAA 4RSHA 4Y2YA 5K0EA 4EDHA 2GQ0A 3CLRC 4EF6A 5LQUA 2JANA 4TKLA 3UPTA 4MRVA 4IBOA 2NSJA 1Q1ZA 2PRSA 3JQQA 4X7MA 3RDPA 2WAMA 4UNQA 3WKCA 1Z39A 5JDCA 4FX2A 1UBOS 4LWOA 5LLSA 1ZM2A 4G01B 4QQNA 1QHYA 4YIHA 1ZHOA 1UBEA 3Q9SA 1ZK2A 1T0JB 5FTJA 1T6ZA 2OOKA 1L7QA 3BGVA 3WGHA 2PKWA 5KHLB 1VBNA 1RRKA 1AV6A 4IZIA 2X7JA 4PXAA 3TOXA 4URUR 3MS2A 3FFTA 2D1TA 1O5IA 1Y5NA 3G85A 4O4JF 4QYSA 5ALDA 1TYCA 4C7XA 5EZYB 2AUTA 3DE2X 4QD3A 1I0ZA 3ZHBA 4BAGA 4EHHA 5AFSA 4G5FA 5EHQA 1T0PA 4ZVUA 4AQDA 2C03A 5FUBA 1XRMA 2HRCA 2VL7A 1DXYA 5F7ZA 1ISMA 1CERA 5HOQA 1FNCA 1OBOA 1W4RA 2Y1KA 3H1AA 4FFLA 4NBKA 3G7NA 1OB2A 4FOPA 1JJ7A 3AM3A 3DP9A 1GTL1 4ENSA 2YXEA 5E1DA 2DBQA 2IEZA 4A36A 3OEED 1T5OA 5DN6A 4G0WA 1QHEA 4BO7A 2R87A 3EG9A 3M83A 4H6XA 3A1NA 2VVTA 1C4XA 2LRHA 1PFQA 3LIIA 4OGGA 1EX1A 1G5RA 3NBFA 5T41A 5CXQA 4DCPA 1YDEA 4F3TA 3RBAA 4DJJA 2PKQO 1GTZA 5MFZA 1RI2A 1J4AA 4H3KB 3BD9A 3HACA 1CUXA 3JTEA 5A4MS 2PZ8A 3R3VA 4GSYA 2XTZA 2O5EA 2DTXA 2QQ0A 2Q50A 1NT4A 2SKEA 2ZYHA 1M10A 4ITUA 3V8NA 3ESXA 4MMYB 1FZQA 4Q1EA 2LGJA 2QE7A 3D5EA 4IG4A 1UFRA 2GHRA 2ZOSA 4FMCB 4JCOA 3TJMA 2VSYA 1YQXA 1D2AA 3OZ7A 4IGIA 3HBNA 1U7XA 4BMDA 1MO3A 2C2BA 4UREA 4W63A 2ZDQA 5E2AA 3WDKA 3I6MA 5B12A 1KAGA 4QX6A 1RVV1 1OJ7A 2NZYA 4OBXA 3FUWA 1E79D 2WDPA 2FPLA 4J0IA 4QDXA 3W5IA 1O0SA 4KN8A 4GQBA 1QCCA 2VT6A 3BE6A 1JEDA 3KSUA 2NSYA 1QIIA 3SX2A 2FPGB 1UKAA 4V2IA 1QH1A 2BC9A 5C31A 3FTDA 3B1YA 2G17A 4IP0A 1WL8A 2X1LA 3VAAA 4PS0A 4PHTA 2OYCA 2IYXA 3TTTA 1QH9A 3LAWA 4HPWA 4K88A 3T0IA 2OL4A 5TJHA 1Z8NA 2R1VA 3C39A 4BFYA 1QRUA 5KSOA 3C0KA 4XGRA 1ZMRA 2XWSA 1PU2A 3E3MA 3E6AA 3PNKA 1EB9A 2RGWA 4J07A 4AU1A 2FLVA 2RBEA 3OURA 3FYDA 1QZ3A 2OAQ1 4A8JC 4C7KA 4WKBA 3WRXA 3SC3A 4RXUA 1K4KA 1L6IA 5AJTA 3T1QA 3I5YA 2AOTA 2WB4A 2XBUA 4MI1A 3WKEA 3A1VA 3AUSA 2FFRA 4PC2A 3HXTA 4L76A 3M4ZA 4X63A 2OXTA 3PTZA 1OFIA 2IX9A 3RRNA 1W1UA 2QMHA 5ILGA 4LRYA 4UTRA 1IBMB 1SAYA 1HH4A 5JLAA 2G40A 4N76A 4ND7A 1AHHA 3VPHA 3NC1C 3GARA 4PNEA 3VA7A 4AURA 1YZ3A 4XGKA 2VF4X 3UMRA 4EG1A 3J7AC 5CVEA 4I2VA 1DZ3A 1KY4A 3HY4A 5DYTA 4DT1A 3DXXA 1EVQA 3QVTA 3SIPA 3OEEA 3MNFA 1A7UA 1F9EA 1GTJ1 3PIRA 4LXQA 4C0BA 5CBPB 4FOTA 4HFNA 4MK4A 4D0NA 1JPJA 3DKIA 2I22A 1WV1A 2PLAA 1KFKB 4X41A 4EKIA 2FPMA 5JD6A 1JDVA 4DCVA 1VKJA 4JP1A 1O9GA 1FUYB 4XDHA 3LQ2A 1T3SA 3DVLA 5BRAA 3OIFA 3G1TA 3UPDA 2WD7A 3L7BA 4FB4A 2J09A 1WVIA 1V3QE 4GKAA 5E1OA 1H4SA 4WHMA 4OHRA 3B36A 3VTKA 1R4NB 2HJSA 2OBXA 4J0CA 5BNIA 1EVYA 4PXYA 3AI1A 2A7QA 1JHUA 3F78A 1J7KA 4QGFA 2YV2A 4PZAA 3U7JA 4CUZA 4MP3A 1L5MA 1F14A 3L7NA 1W94A 1ORVA 4E5SA 4V24A 2AJTA 4WNAA 3CF2A 5AK5A 1Z45A 1UDAA 3SYRA 5BNWA 2C2WA 4ODIA 5DM0A 5IC5A 3S2FA 2O05A 3GLHA 2CLDX 2WF8A 3QJYA 5LYJB 1Q3KA 3ZY5A 3ASYA 1E3WA 1ODCA 5JH7A 4KLRA 4TQGA 5JCZA 1HQCA 3WI7A 3LZCA 1E79A 3BL5A 3RU2A 3KFXA 4CQLB 1E3SA 1G20A 2B6NA 3PVCA 2W2NA 2G08A 1K92A 1V95A 4YX9A 1WXWA 2P4EA 3ACCA 4ZZIA 1I51A 2YC4C 2N1BA 3DPIA 1NFFA 3LXXA 4U9HS 1F0PA 1GD1O 1MOZA 3OY2A 1RTKA 4HBZA 3HA7A 2YUTA 1T9BA 3HCWA 2HLNA 2ANCA 1JLSA 2CJXA 2KM1A 4PFSA 4IWXA 4U1RA 3RS9A 4NENA 1AUQA 2A5JA 4BEJA 4QTYA 2JH8A 5HJEA 2Z8XA 4IMRA 5A4FS 1ZYUA 1PN3A 2JC3A 1XZEA 2FEXA 1AKQA 2VHVA 5CM2Z 5ILQA 2BHLA 4N5DA 2FX2A 2IHZA 3FFAA 4IIFA 1RP1A 2C00A 2HF7A 2DBYA 3H7IA 3EQ2A 1TPYA 3VH1A 1BHO1 3A32A 5K4AA 3ZXYA 3ZHRA 2FP3A 1I1OA 2WM8A 1S5PA 1XDDA 2ONYA 5DNWA 3HFSA 4FS8A 3T9AA 1VLMA 4AZSA 4EUFA 1MH9A 2QP4A 1ABEA 2J5QA 4K5QA 4UMDA 3MS7A 3MFQA 1RIFA 2AYYA 4N8DA 4QLAA 4DIEA 3PR1A 3DL0A 3P5BA 1BA2A 5SYAA 2R8OA 3WLMA 4CQMB 4OLBA 3KKEA 1N2CB 4AXXA 2BMJA 4O4JA 1I3NA 1B0PA 1I80A 1KPIA 1K06A 3KIPA 4FK8A 4BNDA 7ABPA 2MDTA 2D4HA 2HBZA 4PC7A 2ZS9A 4UTOA 3NVDA 2F55A 2E0IA 4TXHA 1U0BB 4FFDA 4TTVA 3WLSA 5AM3A 1L5FA 1MQSA 2VJYA 2X0KA 4KGZA 4O1MA 3TW6A 2HXSA 2PUCA 1H42A 1MCZA 3EZ2A 1QFYA 4UNSA 3BSSA 5T67A 1N4DA 2Y8EA 1DP4A 4IIEA 4Q3AA 3UMMA 2VDRB 5ITZB 4JXXA 3LJKA 1KL7A 5AK6A 5JRDS 1CS4C 3TKYA 5C3MA 3D7SA 4OTZA 1CLEA 4Y2RA 1QX4A 2JFQA 2NYUA 2XMBA 4MGZR 1RYBA 2HQSA 4FEGA 2GCNA 4MCAA 4Z4GA 1X1TA 3BXZA 4EHBA 4JBLA 3NEPX 3KR0A 3R5HA 3URMA 5KQPA 3RRYA 1CIVA 5C5EA 2VQ3A 3R4CA 4LEIA 4C3UA 2IW1A 4LPKA 4ILEA 2YXNA 4OQZA 2E5LB 1T26A 2Y4NA 1B6RA 3JQ9A 2PUWA 3H5IA 5CUQA 5LBIA 4AJ9A 1FS5A 3QMMA 4OHXA 4QXPA 4ZXFA 4LF4B 4DR6B 1EJ0A 1NRJB 1SCBA 3EZ9A 4JHLA 5BSVA 2VTEA 4CEIB 3TLXA 4TYMA 2PRKA 3FMFA 1GZUA 2A4KA 2PT5A 2XVXA 3W5VA 2FWRA 3RT7A 3VR5D 5H68A 3VI3B 4B85A 4J4BA 1KJ8A 4XLTA 3RUAA 1M2OB 3NHUA 3R2JA 2B4KA 3OETA 4HSGA 3GLFA 1JEYA 1Q0ZA 4LUCA 2PXCA 3S2ZA 3A36A 3TR0A 5L6MB 4EA9A 1QFSA 3J81k 1CY8A 3OZRA 4KFUA 1VZ2A 5DT9A 3V4FA 4M1KA 5TXGA 1VRCA 1KKMA 3C70A 4FI3F 2C5FA 2VCEA 3K0AB 1XU7A 1SUAA 3MTIA 1O8CA 1CS0B 4QJ4A 1LWOA 3IX7A 1Q7BA 4GI3A 4QVKA 5GOZA 2PU5A 5E6RA 1HBJA 4Q01A 4HMPA 1DX9A 1KAHA 3VJMA 4BGUA 4H1VA 4KFCA 1ZK3A 4X66B 4JLSA 2BGNA 1KKUA 2J5BA 4AN1A 4D3FA 3IXQA 4MUEA 3RODA 1J0XO 2H57A 2Y92A 3ONDA 1IQUA 5GP1A 3SZLA 2XYQA 4NMMA 3E5NA 1MN6A 4I4TB 4HL6A 4L27A 4DIMA 1JKXA 2QK4A 5JFOA 4REMA 4L4UA 1UT8A 3AR4A 4HAWA 4GMGA 1BCRB 1D1QA 3H75A 4H6VA 3MWGA 4NC9A 2BEUB 1JFSA 2PBRA 4GKKB 2WHXA 5MGNA 3K9WA 2JLSA 4PR3A 4YAJA 3O3NB 4FIDA 4WJKB 1RXSA 3P2YA 4CM7A 5KX5F 2GVDC 4TRRA 1SEPA 2ZXFA 1UQTA 3OU7A 3ZHZA 5DBIA 1LBSA 2JFPA 4OLJA 2RHBA 3RVDA 2OVBA 1ZMOA 1GEGA 3U3KA 1VHTA 4Q48A 4UM5A 2Q3FA 1ZU4A 2R8ZA 1RWKA 3BXXA 3NOOA 4LJAA 4RJKA 5HSGA 3NT2A 1GUBA 2XTNA 3Q0EA 3DZIA 3P2OA 3F8WA 3IPCA 2W4IA 3LCRA 2WLTA 4L16A 3V42A 4EYEA 1X8XA 3CF4A 2FSVA 1X1QA 2JFBA 2IYPA 4QFMA 3UYKA 1EJ6A 3KSZO 4J2TA 1Z4NA 4RMGA 3ZD9A 4C6RA 4U3JA 3EPPA 2IC5A 3CF0A 2P7HA 3AHCA 4KO1S 5C1DA 4CTMA 9ABPA 2VEDA 2GZMA 4JYBA 2FOIA 3UXYA 1SG6A 2YZ2A 2ZUTA 1Z8FA 4B6RA 2MR5A 1JN0A 3S0JA 5BWBA 2AJLI 1BTOA 2WU3A 3RRMA 1K88A 4PF1A 3VPSA 3WY9A 3IKTA 1FW8A 3TNYA 2OILA 1HMYA 2UZ1B 4U2EA 4YR7A 3G23A 3PFHA 3QPBA 1J33A 3ILVA 3RK4A 2I4NA 3VR5A 3DJFA 2DTEA 3T9BA 1U3TA 3UZUA 3TLMA 3D6HA 1JQBA 3EFOB 3GA0A 3R4VA 5K01A 3B12A 1OREA 4GRDA 4BNZA 4KXUA 2YVLA 4B3CA 5KZMB 2NV0A 4GC5A 5FWXA 1SCKA 2HMTA 4LYJA 2QUHA 3VR6D 2GR9A 1GRVA 1I3LA 4YV0A 2D0OB 1QGOA 3GD5A 1FP1D 3PZRA 4ER6A 2Q1WA 4A1OA 1PV4A 3DT6A 4DMUB 4FU0A 4OKSA 2NXNA 1ULUA 4Q93A 1Y6GA 4AG6A 4FX5A 4AVYA 5T57A 1REQA 1U2DC 4UJ3A 4TL8A 3ZDEA 5A3QA 2IUTA 3TEMA 4CL8A 4DA4A 2FQQA 1YK0A 2VRNA 5I47A 1AN9A 4G25A 2BKLA 2QMOA 3FCCA 5L4SA 1PJZA 4O2RA 1GU7A 2DQZA 3I83A 3PQ2A 4IO0A 4WZAE 3V1UA 5AI0A 2PCJA 2C2OA 3G2NA 1L7OA 1YS9A 3LW7A 3NTOA 4GOJA 4I8DA 5DHUA 5FTWA 3TGLA 5CDTA 3S1LA 1PLKA 2WV9A 1QR6A 1O0BA 3PF8A 3HXOA 1T34A 3CLRD 1ZD5A 4N47A 4MWZA 1Y9JA 4JASB 1DTSA 4YBZA 4FMDF 5HCIA 5JCJA 2W6QA 2CW5A 4ZVKA 4DSOA 3NAMA 1TVCA 4EG0A 4NCAA 1EHYA 2ZBUA 3UFXB 3W6OA 4BLUA 1NI4A