1XF9A

Structure of nbd1 from murine cftr- f508s mutant
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
281
structure length
264
Chain Sequence
b'TGIIMENVTAFWEEGFGELLEKSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
molecule tags Transport protein
source organism Mus musculus
publication title Side chain and backbone contributions of Phe508 to CFTR folding.
pubmed doi rcsb
total genus 91
structure length 264
sequence length 281
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xf9A00
4KFTA 2O8EB 1T0HB 3BB1A 1SXJB 2EFCB 3CUEF 2ERYA 4URWR 4LJ7A 3AV0B 4BZQA 4TLCA 2JJ2D 4A4DA 4TT3D 2XOKA 3PUVA 1NG9A 2PMKA 4PPFA 1LFDB 4P4SB 2OEPA 2IXEA 2ZJAA 5EP1A 4PAMA 3CH5A 3KQHA 3WNDA 5E7MA 3RWOA 2HXYA 4G1UC 4M8NE 4OKSA 4JVMA 3IQWA 2BEKA 2GDJA 3WMFA 1R0WA 1HY3A 4W5JA 3VR3A 2DFTA 2GILA 1DAGA 4FW9A 4C0BA 4AWXA 3R8FA 2BIFA 1IN7A 2NPIA 3FPAA 3IUYA 3QKTA 4A2WA 2EWVA 3L0OA 2WOJA 4XH9B 1S3GA 1M34E 4N3NA 3PUYA 3NXSA 2PX3A 1C4OA 1GDDA 1N6IA 1ZNXA 2WKQA 1BMFD 4RY2A 3SHFA 5EJEA 3THYB 4PHFA 1XJ0A 4Q9HA 1S4QA 2IXGA 1U8ZA 4P3YA 5FOVA 2XNDA 2XEXA 3OEHD 2IA5A 3VR6A 5FBLB 5HR5A 1NVVQ 4OHWA 1I4LD 3GLFA 2FNAA 2P6UA 3EIQA 4TLEA 4JJKA 4BFWA 3FHCB 1CTQA 2CJWB 1LVGA 2FFBA 1A4RA 4FCVA 4Z8YA 4C30A 3BAFA 3LDAA 3R7WB 2AL7A 1UKEA 1C9KA 4OK3A 5EXPA 3PXGA 3IIJA 4V0OA 1RC8A 4L9SA 1MV5A 3ASZA 1W2GA 2CXXA 1E2FA 2QAGC 5KOYA 2IYRA 1US8A 3FWYA 4M22A 1SXJA 4F93B 3AB3A 4B6EA 2WJJA 4JKIA 1Z8FA 2KI5A 4AC9A 1DTSA 1YR6A 3P4YA 1T9HA 2X8AA 1IHUA 2F9MA 2A5FA 1BOFA 1MO4A 5B58C 3GLGA 3C8UA 1AS0A 2GCNA 3BRWD 4RD3A 5L3SB 3DL0A 3ZIAD 1E2EA 4A8JC 4K8OA 2ZRGA 3U3JA 4TQ9A 2IEZA 1G6HA 5FTNA 5C4MA 4B75A 4M21A 3U3KA 3THXA 1Z28A 4NBSA 4WVFA 1Z0JA 2QTHA 2ZRDA 3E2IA 2PEZA 3T1VA 2HXSA 4LJ5A 5EE0A 5C46F 1A82A 1G3QA 3OIWA 1G4AE 2O0JA 3TW4A 2L0XA 3RVBA 2Q9BA 1UEIA 3EC1A 4A9AA 2W0MA 4HUQB 3QSYA 1KI3A 4A2QA 1GL9B 2XX3A 2ATXA 4KSCA 1FMLA 2IX3A 3OIYA 4HAZA 4RZ2A 2OILA 1KZ7B 5TV2A 4IVPA 2V6JA 1MH1A 1XXHA 2OE2A 2QSZA 4I81A 1A1VA 1SVOA 3DEFA 1O87A 3W90A 1KO7A 1Q12A 2OXCA 5F9HA 1J8MF 1NKTA 4MRRA 2ZI5A 2PEYA 3FDIA 1Z0DA 3B7GA 3QG5A 3Q8XB 5B30A 2OV2A 4P4UA 1TX4B 4KJZA 1TEXA 4AK9A 2I3BA 4HDCA 4KI0A 4UNRA 1FUUA 1W48A 2OAP1 5L3SA 4DUGD 4ZCLA 2XTMA 3I3SR 2ORVA 2R6GA 5KPDA 3U4QA 5AUNB 1JR3D 3X1ZA 2WWFA 1ZVQA 1W0JD 2VSXA 3MLEA 4G5OA 1NN3A 4KLZA 3U60B 3AM1A 3RDPA 4B6FA 1FNNA 1G18A 2W2XA 4BZPA 5GADl 4I1UA 1COWA 2WAYA 3KB2A 2ZS8A 2FSGA 1XX6A 4Q7JB 1JEEA 2Q0HA 5AK0A 5DSZA 3ZVMA 4KHZA 1E1QA 3B9PA 3HDTA 2OM2A 2ZPTX 4NTZA 1VMAA 1VHLA 1P61B 4HB0A 1XB2A 4V02A 4YMSA 1SQ5A 1GNQA 2RGAA 1CJVC 2I1VB 1PUJA 4LPSA 1KK0A 1E9RA 2NG1A 1Z6GA 1W0JA 4OI1A 1ZIOA 3V9PA 5J47A 1SVIA 1XXHB 4HATA 4WW0A 3K0SA 2Q9CA 5TY0A 1EFCA 2QTFA 3A1WA 1T5IA 1X3SA 4HAXA 1E1RD 1YE8A 5DI3A 2W6JA 4QFMA 1JPNA 5HE9A 3SI7A 4NYIQ 4TL8A 1KY3A 3QKSB 4NCHA 1ETUA 4A0FA 1ZD1A 3PJRA 2IYQA 4NL4H 5KYKA 4FCWA 3A1TA 2OHFA 3QENA 3SJBA 3TVDA 4D25A 3D8BA 4W9MC 4QOSA 3CIOA 1MABB 4HB3A 3X1WA 2J3EA 4IXNA 1FUKA 4UXJA 1YKSA 4EAQA 2P0EA 1BO6A 2WPDA 1XTJA 3RANA 1DAKA 2RGEA 3CZPA 3K9GA 2IUTA 4I1VA 4HEJA 1KY2A 3K9LA 5GVSA 3I62A 1SVLA 1ZUHA 1Q3TA 4TT3A 2VYFA 3GEHA 3CX6A 2FMXA 5DN6A 2GHIA 3F3YA 3C41J 4LYHA 4B33A 1P60A 3TNFA 4I99A 1IOZA 4PTLA 4PR0A 3VNUA 3HR8A 2PLRA 3LQQA 2HJGA 3HPRA 3QI2A 4Q1AA 2PT7A 2G77B 1XF9A 3MFYA 1G6OA 2F1RA 1GKUB 1N6NA 1KK1A 5B57C 1XCPA 4YMUA 4D6PA 2ZSAA 4LBZA 1WMSA 4MITA 2VF7A 3TUIC 4JL6A 3RRZA 2EU8A 2JJ8A 1II8B 5JWRA 3U7EB 4PAOA 1UADA 3HYRA 2WIAA 4DVGA 1R10A 2IYWA 3I5XA 1YZKA 2JEOA 4L9WA 4X8OA 3WMEA 4BZXA 1E99A 5DYIA 4MQBA 3U7GA 3SU8A 1OFUX 2W00A 4GMDA 1NJFA 2B8TA 1S9HA 4OHVA 5F98A 1WDTA 4M1OA 3QQ5A 4ACAA 5DI3B 4RD0A 2H18A 1ZCAA 5IK2D 3K0CC 4PHTA 3WNBA 2BM0A 4E5UA 1ZD9A 1EK0A 2OCYC 4IRUB 1E0SA 2R6AA 2JLRA 1G8GA 2F7SA 1P4SA 2BKEA 3AKYA 4RCZA 1GIAA 1RRPA 4QBIA 3PIRA 2WJIA 3C7KA 4NKRA 1CP2A 1WE2A 3OIUA 3LFUA 4IDQA 1KI6A 4DCSA 1FL9A 1UF9A 2A9KA 3NIBA 2NZJA 1NY6A 3FHOA 4F7WA 4JBWA 2DY1A 4GBMA 4MKIA 3DZ8A 4FN5A 1NVUQ 2ORWA 3W5IA 3WBJA 3PEWA 2O8DB 2VF8A 1R2QA 2D7CA 3AVWA 2X2EA 3KJEA 2IF2A 3EZ7A 3ND8A 3QUSA 4FI3C 3ASYA 3AGQA 1EXMA 1DO0A 2YC2C 1CRQA 3ZZ0A 4L8GA 2J46A 4O25A 3E1SA 3IEUA 5GJVC 2G3YA 3FE2A 4YXWA 1VYVA 2LWIA 4IOKA 3CWQA 4PO1A 5DLQC 3T1QA 1QG2A 1E0KA 1FOEB 2BMFA 5AUPB 4TLDA 3ONWA 3CF0A 4FXPA 3B1WA 3T1OA 1QHYA 1M7GA 3CNNA 4HAUA 2O8FA 1GL6A 4XOIA 1RRGA 1NIPA 2OBMA 3OE7D 4QKQA 3NH6A 2RAPA 4TWZA 5HE8A 3TQFA 2QPTA 1KO5A 1FTNA 4Q4JA 5KHOC 1T8UA 4FMDF 2AR7A 3WP1B 4HI0E 3DKPA 4M9SA 2UZIR 1HH4A 4W7SA 1PV4A 3I32A 2ZVQX 3WMGA 2WTUA 1UKZA 1NMZA 3JVUA 1XMVA 4FINA 2CLDX 4DLYA 1U81A 1KI6B 2ZE5A 4MRPA 4JLAA 2C9CA 4LDJA 2N1BA 1GWNA 1Z0AA 1P72A 4LI0A 1QHGA 4MYTA 4D0LB 2OCPA 2PZFA 3ZLJA 2CK3A 2GRJA 1VHTA 3LD9A 4JJZA 2ZUDA 2ZITA 4HB2A 3AF2A 1W36D 3KFXA 4M4SA 4RD6A 121PA 3AUYA 4QBHA 1FX0A 1CULC 4A0GA 3U4QB 3CRVA 3V4FA 1TUIA 1W2HA 2O0HA 4TYYA 3T1TA 2BJVA 2W2TA 4DLVA 1AS2A 4Q1DA 3VU9B 4FWIB 3QXXA 2WAXA 3DM5A 2IYLD 4AYXA 1YZGA 1NL3A 4QGHA 3F5FA 4F4CA 1QHXA 2ZS9A 3K09C 4PAQA 1BH2A 2ZSFA 1PJRA 1ZM9A 1QZXA 4PZYA 3KZ1E 4FMBB 521PA 2IW3A 2OLKA 1G8FA 2ATVA 2BM1A 4QXAA 4CGZA 2ZETA 4M1KA 3K70C 5CYOA 4BRUA 1E4VA 3L0PA 3QXJA 4URZR 2G9NA 4D2IA 4FMCB 4QG7A 2B7BA 3GLHE 4B47A 1UKVY 2GJSA 2GEVA 2GBLC 4OJQA 1NVXQ 5G3ZA 1R4AA 3QKRB 1VPLA 1BMFA 4JS0A 4BLQA 4DDUA 3IDQA 4BFZA 1ANKA 1JR3E 1E2GA 2GBLA 2VBCA 1OXSC 4YDSA 2QP3A 3IO3A 4IFEA 4N1AA 5ANRB 3SE0A 3OEHA 3GFOA 4KBFA 4RFSB 4XWOA 3UMFA 3WHLA 5KSPA 2ASEA 1II9A 3MWLA 4DB4A 1DARA 4AG5A 3IQXA 1DEKA 2A5YB 3KDSE 3U3MA 2IBMA 1OSNA 2GCOB 1SHZA 2XXAB 1OKKA 2EFEB 4ZCIA 2O8CB 5K8LA 2ZYUX 4M1TA 5DIFA 3DZDA 2JJ1A 2DHRA 3X1YA 4QJ3A 2K5UA 1YR9A 3AH8A 2EQBA 1Z07A 4TN1A 1DAMA 5G3YA 2J45A 3NWJA 3O8CA 3IPYA 3SBDA 5ELXA 1AN0A 421PA 2ODWA 2FU5C 2YWHA 1E0AA 1XEFA 4I4LA 2V1UA 4LJ6A 3VR4A 4B2IA 3K0EA 3TMKA 2R8RA 2GTPA 1NKSA 1NVVR 5JBQA 3SYKA 2OO7A 2OCAA 2B7CA 1WBDA 2HLDD 2VHJA 4UNPA 2CVFA 3U6BA 1KNQA 2BJWA 4B2LA 4EQ6A 2F55A 1VIAA 2AXPA 2HJVA 3B82A 4DEXA 2CMKA 2ZI3A 1MR3F 3BH7A 4MDFA 2Q9AA 1G20E 4RD2A 3QXSA 3B1XA 2OSBA 1IJFA 1VECA 1R5BA 2AKYA 4CVNA 4AKIA 1OHHD 5E3HA 1M7BA 1IXRC 4AI6A 4Q48A 4JVLA 4NDZA 4KV9A 1G8YA 3CF2A 3CH4B 5F2EA 4BFTA 4FCTA 4PO9A 3KB1A 2DB3A 1Q0UA 2NQ2C 1TU4A 3BH6A 3ZDQA 3CONA 3T5GA 2X19A 3FMOB 2IYUA 4B2PA 4US0R 1T0JB 2ZJ5A 4TSFD 4DEYA 4BPBA 3MG9A 3GJXC 1Q1ZA 1ZMXA 5JHHB 4GSYA 4JL8A 4XIGS 4EKDA 2RH5A 2C98A 2ZRHA 1W5SA 4NYJQ 4LV8B 4BLPA 3VMFA 2GXQA 1K5GA 1NSTA 1U8YA 1EX7A 2ZRJA 4NU0A 1M8PA 1XDBA 1XPRA 4XTRA 1HURA 1W44A 2QUZA 2XB4A 2ERXA 4B34A 1CBUA 3UIEA 5EE9A 1OIWA 3B5JA 3OIVA 5IT5A 1FW6A 1U9IC 1W4AA 3NH9A 3OESA 1TQ2A 2O8CA 2RCNA 5FL7A 4PC6A 4B3FX 3FGNA 3AGPA 2ZXUA 2QA5A 3Q72A 5KUTA 2HYDA 1W4RA 3EPJA 5DISB 1E2IA 2Z0MA 2VA8A 1G41A 4DUGA 4ZV4A 1GSIA 4P33A 3PR1A 2ZSEA 5FUYA 3PG5A 1VCOA 1JECA 1P62B 1XJQA 3SDZA 3T34A 4EQ6B 3BS4A 1D9XA 4N0DA 4R2HA 3S1AB 1NJGA 3U44A 2EYQA 5CB6A 1K8RA 1LNZA 1E98A 2ZYVX 3AUXA 1QHNA 4DDTA 3JVVA 4F4JA 2BBSA 2VP4A 1H8ED 1LY1A 4WZBE 1E4YA 2CL0X 3B6EA 5AWFC 4A2PA 3VR5A 3FKQA 1XZQA 1KDRA 2KB0A 1EWQA 3IPXA 4A0HA 1N5JA 2FSHA 4EJSB 1UBCA 5M04A 1HYQA 2P67A 4C0SA 2QY9A 3WY9A 1ZUIA 2VRWA 4LUCA 5BYKA 2PZGA 2QGZA 1PVOA 1NMXA 3U7HB 1M74A 2BMJA 2PZEA 5KSYA 3K53A 3AEZA 1DS6A 3REGA 3NBFA 2R6CA 4TL6A 1E6CA 1OH5A 2B6HA 4M1MA 2WWYA 4M2LA 3SS8A 2YV5A 5HCNA 4ACBA 3SNHA 4AYTA 2XJ4A 3ZH9B 4Q9IA 3TR5A 4M1WA 1HE1C 1T6NA 1SKYB 2BDTA 2GJAA 3IBGA 1E69A 3FFBA 1X8LA 3O8DA 1VTKA 3RS4A 3VNVA 3GLHB 3U61B 5A5GA 3L0SA 3ECCA 3OFNA 1KOFA 1G9XA 2FGJA 3RS5A 2PT5A 4JLOA 4DLZA 4PC2A 1FMJA 3QOFA 4U00A 4XD7A 3U3OA 2UZ3A 1G8PA 2VP0A 2AD1A 5DHAA 2V4ZA 1R5NA 4DLXA 4M53A 3W8RA 5JHGB 4DIDA 4OI4A 3L43A 3RLFA 2A5GA 4URXR 3Q3JB 1D9ZA 2C04A 2SHKA 1ZM7A 3NVAA 5KNBA 4IDHA 4URUR 4RD1A 3WYFA 821PA 1WRBA 3IIKA 3O8BA 1E2JA 2QM7A 2JCSA 2F1HA 2ONJA 2HEIA 2JJ1D 4XWKA 2WV9A 5IK2A 1Q22A 1HV8A 1NLYA 3GPLA 3GJ4A 2CL7X 1T3LA 3EASA 3K0FA 4NP6A 3ZIAA 1UAAA 2BWJA 3EZ9A 3R9XA 3T06B 5HZKA 4EJSA 5KTYA 5FOSA 3MWYW 3BXZA 1KK2A 2YNMA 4TMTA 2ANBA 3AP1A 2JLUA 1SXJE 2GKSA 2HDNB 2YVUA 4EPVA 2OESA 4P32A 3VR2A 3QJYA 2ZE6A 1TUEA 1E2QA 3DPUA 2QG6A 3ZS8A 1YRAA 5JJKA 2D62A 1Z2AA 3AF3A 3L8ZA 2H92A 2FPMA 1X8KA 2O8BA 2OBNA 2V54A 2XGJA 1F2UB 3NEJA 1E32A 4Z54A 1QDEA 2J1LA 5K8TA 1Q21A 1Z5ZA 4LV6A 3T61A 2ZRIA 4I1SA 4Z1MD 2BBOA 4F92B 5DN6D 5UKDA 3FKSA 3Q85A 1G7SA 1MKYA 1Q20A 1V43A 3KQUA 1G19A 1F2TB 4B48A 4X8HA 2REXB 1IN8A 2J0QA 4XSHA 5EE5B 5L3RA 4GOXA 1Q57A 5JWOA 2KWIA 2ZU6A 1A5TA 3NG1A 2QPOA 4GI7A 4P0TA 5C18A 2CHVA 4Y0AA 4IOJA 3CNOA 4Q18A 2ZJ8A 1W4CA 3RHFA 4QGAA 1ZP6A 2ZJ2A 2ZE7A 3UANA 1WXQA 1M2OB 2QENA 2C96A 1U0HC 3EA5A 1XEWX 4DRZA 2Z6VA 1EFRD 2YYZA 4PO8A 1AJEA 1G7CA 2BCGY 4OL0A 3OZXA 3X1DA 2YC4C 1AIPA 3OEED 3REFA 2O0KA 5FBVB 2ZE8A 2ZRNA 2AWOA 2ZI4A 5LD2B 1QHSA 2UKDA 2XITA 4DZZA 1U99A 3PEYA 3EAQA 4R9UC 3ZZUA 2Z5FA 1XD9A 1QBKC 3LO5A 4ZIRB 4Q4JB 4JLVA 1G7TA 1OF1A 1WCV1 1AQYA 2WSSD 4RVCA 1JJ7A 4TMVA 4LOAA 3CZQA 4UJ5A 2GEDA 2JLXA 5KDDA 3CR7A 3BFVA 2REOA 4DLRA 3O47A 3X2SA 4BFSA 5J4VA 1Z3IX 2WOOA 4UQOA 2DPXA 3TKLA 1XD8A 2P5SA 2GAOA 1DO2A 2IUUA 2F6RA 1XWIA 4OYHA 4TMWA 3NHBA 1GAJA 2WBLC 3T15A 3FHTA 1OJLA 4ON9A 2PLFA 4KU4A 4PC7A 2Q6TA 3BFXA 2FZ4A 4MYHA 3RSOA 1JNYA 4DT1B 1P75A 2WWHA 3LBNA 3DKVA 4GMXA 2KE5A 3KXIA 1W7AA 4WAUA 2A78A 1RJ9A 2FGKA 4OHXA 1WB9A 1YU9A 3GCGA 3SFVA 4TYWA 2JLSA 2QAGB 4RKEA 3CLVA 3ZS9A 3R9WA 1R5OA 1R6BX 4YC7A 1O3YA 3K0CA 2OFXA 3VU9A 4CW7A 1D2NA 4D0GA 2GJ9A 3QKRA 4FWTA 1E79D 4QHYA 4QHSA 1N5LA 5JI3E 3H0KA 1OKKD 3TE6A 1L4UA 1YR8A 3CRMA 3THXB 1Z6AA 1DAIA 1XFAA 4OHYA 4PSKA 1EFUA 5AR1A 4IJMA 2IS2A 1I4DD 1OB5A 1DAHA 1JQJC 1GUAA 3VHLB 4V03A 2BKUA 3RS7A 1M6NA 4UXHA 4Z8XA 5GVRA 2WJGA 2MMCA 3PITA 4YXWD 4KBGA 3TIFA 2BMEA 4BLTA 4ZIRA 5D3MB 3LV8A 2EFHB 721PA 1I2DA 3NTUA 2VEDA 2Z4SA 4W5WA 5CDFA 2JLQA 3GQBA 3FOZA 1G3IA 8OHMA 2WJHA 2VHQA 1P2TA 1FP6A 1RYHA 4H1UA 1UKYA 2LCFA 3SFZA 2BBWA 3D6TB 3K9NA 5JCZA 1W47A 2AD5A 4C4PA 1CLUA 3PCRB 1IY1A 1TNDA 1YZLA 2IS4A 2NGRA 4JVNA 5AUQA 3EPKA 2NIPA 5FFMA 1NI3A 3MWJA 4XWAA 1OIVA 4QRHA 4ZKEA 4LSGA 2D74A 1KMHA 1OPXA 2NMVA 621PA 2FZLA 3KUCA 3HWSA 5HKKA 1Z22A 1ZAKA 2P6NA 3P20A 4MA4A 4BGDA 5JRZA 2JLWA 1BS1A 4A8JA 2V3CC 1EG7A 4WXPA 1W0KD 2IYZA 4PPGA 1MO3A 3EARA 1CR4A 1KAOA 3HP1A 1FFHA 4US2R 4EPWA 1WBBA 2FDCA 1RIFA 4B3CA 2A30A 1KO1A 4TL7A 4Q4LA 1KZGB 5FL3A 1S9DA 4LJ4A 5EXTA 1D5CA 1N5IA 5LB2A 2ZRKA 1JXOA 2QT1A 4C0HA 1AA9A 2ZAMA 3FMIA 1ZW6A 3DM9B 5BWMA 3HYTA 3W6PA 1ZYUA 4L16A 4UNSA 4NE2A 1UBGA 4HDQB 5CM9C 2AFIE 4QJ4A 1R8SA 1CIPA 1VCNA 2PJZA 4MGIR 5FOWA 4EFLA 2WJVA 3FKSD 4RZUA 1E2MA 3R20A 1TF7A 1XBTA 4YONB 2ZYTX 4DCVA 3C16C 1YZNA 1NSFA 1E79A 2GCPA 3LQRA 1TL7C 4IW3B 1JALA 5DE3A 2CJWA 3MUFA 3UATA 1N6HA 2AK3A 2REBA 2GF9A 1AKYA 3CKLA 4PZLA 3QVVA 3UPUA 5TVKA 1KKLA 1ZD8A 1E2PA 3MAAC 1IY0A 3EZ2A 4PPQA 2CLSA 2QAJA 3OF5A 4N0EA 3AVQA 1MABA 1EGAA 4ZI3A 1XD2A 4IFBA 4XVRA 4C0AC 2V7QD 4KVGA 3KQLA 1NBME 5HPYB 4KCGA 3ZD7A 4PXAA 1P6XA 3R7WA 1XTQA 2MSDB 2G83A 4MH0R 2EW1A 1N5KA 1N3BA 1Z83A 2EFGA 2XTNA 2A2ZA 3B2EA 5JFGA 3ZVNA 1XTRA 2DFNA 2ZJBA 1OHHA 3KKNA 4W5HA 2V1XA 2QM8A 1W46A 3W5JA 3DDCA 3LVQE 2G0NA 3QEOA 2GA8A 4M1YA 3TLXA 1T3HA 4MYCA 3J81k 4KLNA 2J0UA 1IN6A 1U0LA 4LHYA 1P3JA 2QSYA 1JXMA 3A36A 2GZDA 2W6IA 2YJTD 3TQCA 3I8SA 1KJYA 2GK7A 4O2RA 2HCBA 5CM8B 3ZVLA 1P9NA 2IL1A 1SXJC 3QIAA 1A7JA 1P2SA 1ZC4A 1SVMA 4TSFA 5LPNA 2FG5A 3C15C 2RHDA 4TL9A 1II8A 2QE7A 3ZQ6A 2DWPA 5KPJA 1MOZA 3AVUA 1QVAA 3DOFA 2AHOA 2YKGA 2CDNA 3BD9A 2BBTA 3Q7QA 2ODEA 2R9VA 4IDPA 3HR7A 1Z0IA 4OHZA 4ESVA 1NN1A 1QHIA 5DYGA 3AKDA 4MRSA 3EPHA 1T3SA 4DSUA 1COWD 1B0UA 3BBPA 4IDNA 3TH5A 5HKKD 3GJ6A 4S35A 1ZNYA 3AKCA 2NO9A 1RRFA 1NMYA 2W0SA 4D80A 2FFHA 1N25A 5H70A 2IS6A 3FVQA 3LLUA 1OXTA 3F0TA 1MRNA 2BHRA 2ZUBA 4OQNA 2C95A 1GRNA 1AZSC 2C8VA 4IOMA 4Q7MB 1E9SA 2LKDA 3AF1A 3TSOA 3NDPA 4BECA 4GT1A 1P7CA 4LCBA 4LWZA 4X8MA 5FUVA 1XD2B 2X1VA 3I1FA 3GLHA 3B78A 1QVRA 2RGNA 4C0JA 2OFOA 1P2UA 1J90A 2G88A 3LW7A 3CW2A 4PQRA 2O8EA 2O52A 1P5ZB 4GPTA 4TQAA 2WMOB 3PUZA 2YOGA 4ASUD 4CDGA 2HF8A 2HYIC 1F3OA 2Z4RA 1KDTA 5A4JA 1XXHE 4C7OB 4D0NA 5JS7A 2J7KA 4AYWA 2J0SA 3I61A 3EW9A 1I2MA 4C0LA 4PQYA 5DI9A 3MMPA 1J70A 4NYMQ 2FFAA 2GVZC 3OEEA 2QL6A 3BGWA 4DDVA 5AJZA 4WZ6A 3AQ4A 1JQLB 2R44A 3PUWA 3QF7A 2XZPA 4HSEA 4D4JA 3GD7A 1CXZA 4EPXA 3FYHA 3CO5A 1AQUA 2GJ8A 3N70A 3AVPA 5FBQB 5BQ5A 5JSZB 5EZ6B 4F38A 1ODFA 2EYUA 4X8LA 2CEAA 2YOFA 1G3UA 4ABYA 3DO6A 3GMTA 2P65A 1BYIA 4FMCF 3KUDA 1R8QA 1NLZA 5IRCD 5EP2A 2H17A 5JI2E 2MMGA 1S96A 1YHNA 4WIAA 3QBVA 4JLMA 3WRXC 4G01B 5CLLA 2QE7D 1CU1A 2CNWA 1U8AA 2H5EA 4EIWA 3H4MA 5FTKA 3LVRE 4FIDA 2FE4A 2VPPA 3LXRA 2IHBA 2GXSA 3GEIA 4QGFA 4B73A 2KBFA 2W6ID 1VG8A 1HT2E 2ZSDA 1KJZA 1NVWQ 3BH0A 1B23P 3KTAA 1VCMA 3IBYA 4AURA 2WHXA 4DBLC 1GILA 1E9EA 1TADA 3U44B 2QRNA 2WWIA 4ERNA 2F3RA 2P6RA 2D4HA 3I73A 2ZJZA 4B43A 1LV7A 5C2JB 4GFDA 4YQFA 4HLUC 2GEUA 4QNRA 3SZRA 1OT3A 4MDEA 2OT3B 5AUOB 2C9YA 5J4HA 2C77A 2BMDA 2HLDA 2IK8A 3RS2A 4IEEA 2WSSA 4R2IA 1IN4A 3Q7PA 4NONA 2C2HA 4AIIA 4Q9JA 4LYFA 3G82C 3SQWA 4HYYA 3P1JA 3TSWA 2JAQA 4GOJA 1G8HA 1T5LA 4QJ5A 2G6BA 2DWQA 4JL5A 1GITA 2XSZD 3NEYA 3MRSA 2GAAA 2GETA 4POAA 2JLZA 1XPUA 3SR0A 2AFHE 1UFQA 1LF5A 4LX0A 1PLKA 1HE8B 4Q7KA 3TRFA 3KJIA 1HQYE 3CM0A 4TYPA 2CE2X 2CLCX 3QF4A 3KJGA 1GKIA 1ZINA 2GZAA 1X6VA 2VP9A 3C4JA 4GRAA 4NYIR 1Y3AA 3N2IA 1AGPA 4IDOA 3CR8A 2DWOA 4JMPA 4XVQA 2QMUA 2IWHA 5B2ZA 1JI0A 1VKJA 4R71A 4BFVA 4P31A 1PZNA 4CEHA 1JPJA 3IHLA 3CB4A 3CPJB 3OE7A 1AS3A 1XCMA 4HUQA 1D2MA 1DELA 4WOPA 2NPFA 2B21A 5GJBA 2KBEA 2ZTSA 1KSFX 2GCOA 2IHYA 4KVAA 2IC5A 5J4KA 1HQCA 2IEYA 2DYKA 1N6LA 1H8HD 2IYXA 2J7PD 3A4MA 1JBKA 1FPMA 1IM2A 2IT1A 3UG7A 3EWAA 2Q3MA 3KKOA 4OBEA 4D4MA 4IXMA 2BC9A 3K1JA 1E94E 1UBFA 1N6KA 2XJ9A 2ZR0A 1W4BA 4PC1A 1A2BA 4GP6A 3CWZA 2GNOA 5BN4A 1S0UA 3H86A 4OQLA 1XTKA 2YHSA 3B1ZA 4V0NA 4DT1A 2CK3D 1OH7A 3OFND 1TPZA 1II0A 2GJKA 4NYMR 4QC2A 4B3GA 2H16A 4G5GA 1AKEA 3PEUA 2QT0A 2VTKA 5BXQC 5JJLA 4H1VA 4CYMA 4L4UA 2QMHA 1KSGA 4LBYA 4GZMA 2ZJOA 4KITB 4QBGB 2Y8EA 1KI1A 2AWNA 3TJZA 3SBEA 4A1FA 5JRJA 4XTCS 4QBFA 2HF9A 3RRNA 1LF0A 2ORIA 3AF4A 1Z0KA 1G3MA 2IYYA 5P21A 1VYUA 3BERA 4JBXA 4G0NA 4HZIA 1ZNZA 3TSZA 2CNWD 2ZR7A 4NCIA 2A5DA 2CVHA 4TMZA 4KYUA 1KO4A 4QHTA 1NN5A 2F43B 3ICEA 2ANCA 4NZYA 3ADDA 4XVUA 4WXRA 2ZRFA 4KAXA 3ADKA 3SJZA 5DNYB 1E2DA 4FD2A 1KI9A 4CZ2A 4Q01A 3CRRA 1IXSB 4U5XA 2C5LA 1YR7A 2ZU0C 3QKSA 4JLDA 4LHXA 3VFDA 1N6RA 2CE7A 1LB1B 2FOLA 3TUZC 4CEIB 2PMDA 5HTKA 1E9AA 4HLUA 1IY2A 5D3MA 4BWYA 3ZZTA 1SHKA 3ICQB 2RGXA 2FJUA 3FMPB 2ZREA 2ZRAA 1CJMA 2QGNA 2QROA 1TMKA 3A6PC 1RFLA 3KJHA 2E9SA 2KJQA 3GLGE 3K0AA 4P4TA 4HLQB 1GM5A 2I4IA 1XTSA 1N6PA 2IF0A 3S1AA 1SKYE 4C2UA 1TF2A 2ZEJA 2NO1A 3QEJA 3N2EA 1Q1QA 1VIYA 4DDWA 5EXXA 5GJWC 5JZVA 4EPRA 2OLJA 2G1JA 1ZM4A 3UG6A 1D8TA 2D3WA 1DE0A 1M7HA 4LGMA 4UXIA 1HTWA 3B60A 1ZM2A 2ZI9A 3A1SA 5H1YA 1E3MA 2RGNC 1RKBA 5FBRB 5D3QA 2AX4A 1J8YF 4R98A 3B1VA 3UXMA 4KODA 4JT2A 1NIJA 1FX0B 2BVNA 2PL3A 1RW4A 3RYTC 1UM8A 4Z51A 5CK5A 1G7RA 2OBLA 1BIFA 3BB3A 3D7MA 4Q4HA 2BCJQ 4C0KA 4TLBA 4JVSB 1KDOA 3AP2A 4MKHA 3GLGB 1HUQA 2P5TB 4D4KA 3HU1A 4CEJB 3VHXA 4JKYA 3U6KA 1PUIA 4JT4A 4Q4AA 4LC0A 1SKQA 5FPSA 5KU1A 1ELOA 1UJ2A 4WZAE 2HV8A 4F4IA 1E2KA 4M9ZA 1XCGB 1ZUNB 4RKFA 4BRWA 3THWB 3WYAA 2BV3A 2NO7A 4Q19A 3UK6A 1Z06A 3BORA 3CX8A 4TYNA 4G5QA 4NH0A 3EIHA 4PX9A 2OUKA 2G1KA 2R65A 2HT6A 3RRMA 4DSTA 2I1QA 5LD2C 3EIEA 1PLJA 1SGWA 3CNLA 2OAQ1 4BEJA 1WQ1R 4DSOA 4U02A 4F91B 1NBMD 1NN0A 3WXMA 1XMSA 1N2CE 1FZQA 5L3QB 1E0JA 1J2JA 4JYCA 1YZQA 5FL7D 4MUBA 5JMTA 4MGKR 1CJUC 1IN5A 1RJ9B 2DFKB 2VHUA 1YZUA 4JLJA 3H1TA 3T5DA 4ARZB 1Q1BA 3D3QA 4RZ3A 2QP9X 3A1UA 2QMEA 1OXUA 1TQ6A 4LY6A 2C03A 1OW3B 2CCJA 4URVR 5FI0B 2NO0A 2QORA 4K46A 2PX0A 3ZYCA 2WWXA 3ZQJA 2Q21A 1ZM3A 4UJ3A 5BYJA 4RZXA 3CBQA 1EX6A 4I1OA 4C3ZA 1KYIA 4Q66C 3MD0A 5AJWA 2YINC 3SYLA 1U94A 4BLOA 1E1RA 1NF3A 3GJ0A 5FOTA 5J4YA 2GXUA 4MYUA 4KSBA 2QAGA 1Z47A 3X1XA 1OFIA 4L5BA 4OK5A 3ZVRA 1AZTA 2J5XA 4HDOB 1TF5A 1DBSA 4DJTA 2OXRA 4TTPA 3I92A 4II7A 1OFHA 2F9LA 3LW8A 3Q5EA 4V0MA 1V5WA 1A2KC 2H7VA 5C1BA 3UMRA 3EPLA 2O8FB 3RC3A 3QPWA 1XP8A 2O8BB 3IO5A 4IVRA 2B8WA 3U3RA 4LZZA 2WPDD 4ILEA 5EUQB 1D2EA 1OB2A 2QNRA 4M0LA 4L15A 3AVTA 3CPHA 1S8FA 2VH5R 2JATA 2C9OA 1GZSA 1N0UA 1UDXA 1NLFA 1L4YA 3KXKA 1CEEA 5AJVB 4IOLA 2WKPA 1KK3A 3LNCA 2VL7A 2FWRA 4IKEA 2XOKD 4EFNA 1F2TA 1FNMA 2F1IA 1P2VA 1KSHA 1QHHB 1VG9B 3E5HA 3TAUA 3VAAA 4A82A 2F1JA 1TAGA 2R62A 4ZDIA 1XPOA 4O2LA 2Q3FA 3GP8A 1Y63A 3NC1C 4ARZA 3CRQA 1W49A 3ETLA 4LJAA 3I4LA 2XB2A 1F48A 2EFDB 2F3TA 5JJIA 4U7DA 1MO5A 3PFIA 5E7JA 1U0JA 3RRYA 2OFWA 1OIXA 1P73A 5JCPA 1ONBA 5FPTA 3A58B 3BK7A 4TMKA 4UNQA 1G3RA 4DCNA 1X8JA 3UWOA 2OZEA 4LK2A 4UNNA 3GLFB 2VP2A 3U7FB 4D4LA 3A4NA 2PJRA 3IIMA 2RGCA 1XTIA 3OAAA 5J4LA 2NZ8A 4D81A 1G291 2ZAOA 3PUXA 1JR6A 5IHPA 1G5RA 1ZBDA 5FPYA 4ASUA 2XTZA 1KTVA 3EWSA 1W36C 1KGDA 1P9WA 5FPHA 3C5HA 2JJ2A 3PV0A 4LYAA 1VG1A 5G53C 2RB4A 5CB8A 4DLSA 2FF7A 3ADCA 1NY5A 1YJ5A 1QF9A 1ZJ6A 1GVNB 1ZC3A 2ZI6A 1Z6XA 4XD7D 1Z6TA 1AGRA 1VYTA 3GJ7A 2PBRA 1E9FA 3FMFA 2E1RA 1RPZA 2ZYWX 4UKDA 3DVLA 2DCUA 1DVRA 3L2OB 3QG1A 5JSZA 2E87A 2B92A 5JEEA 2TMKA 3BB4A 3LBIA 4BQSA 3K70D 3ADBA 2NO6A 4GNKA 4R7ZA 3B85A 1DAEA 1Q44A 2XXAA 5DO9A 1TEVA 3T35A 3PENA 2ZRBA 3L8YA 3P4XA 5CIQA 5SZJA 3UMSA 3GLIB 1CRPA 4DKXA 1SULA 2QEQA 1DG3A 1KMQA 4A6PA 2D2FA 2Z83A 3NBXX 1R0ZA 5FOUA 5EP4A 1GKYA 2JA1A 3CX7A 3FFAA 5TMPA 1CR2A 1T8TA 1K5DA 1T4GA 1QHHA 4G3XA 4LV5B 1C1YA 4E07A 4DB2A 4DWJA 1GTVA 1H8EA 1TU3A 3LBHA 4Q7LA 5AJYA 1Z08A 4KO8A 4US1R 2A5JA 2QTVB 3GJ3A 4TTRA 221PA 3RABA 5CK4A 2XZLA 4RCYA 3KFVA 1XEWY 4ZDWA 4GP7A 1UEJA 3BE4A 4A6XA 2FPLA 1TTTA 2JLVA 3GFTA 3EZ6A 2QMOA 1OFTA 1CKEA 3F8TA 3W3AA 5BW8A 3NBYC 1Z0FA 1ZRHA 3GLFE 2BEJA 2ZUCA 2QI9C 2QP4A 2BOVA 3ND9A 1G16A 2WICA 2IS1A 1MT0A 4DIEA 2J9RA 5F3WB 5EE1A 4Q1BA 4TQUS 3WP0A 3TVTA 5G40A 2XZOA 2N42A 3KXLA 4XJXA 1XJCA 4KXFB 4Q00A 4YDHB 3VTKA 5EZ5A 1CJKC 3RWMB 3WRYC 4Q9LA 2H57A 5GJCA 3SYNA 1GFIA 4TMXA 3TW8B 3RS0A 2ZVPX 2J41A 2WWWA 4BASA 3IHWA 3QF4B 4Y0VA 1RVDA 3A1VA 1RE0A 3TK1A 1E2NA 2ZM5A 4CEHB 5L3QA 3AVXA 2GF0A 3GJ5A 1HEIA 1F6BA 3EG5A 1RYFA 3C14C 3IKJA 3G0HA 1E9DA 4B76A 2EVWX 5EP3A 4PPNA 4Q47A 2ZANA 4B3BA 4JLNA 4V0LA 4HZUA 1U2RA 4LRWA 1ESMA 4A36A 1YRBA 1E1QD 1RZ3A 3UKDA 2R2AA 2RKOA 1KHTA 1XZPA 3EC2A 5FTJA 3LLMA 3GJ8A 3B8HA 3AVOA 3HJNA 3M0EA 1FP7A 4OQMA 1KAGA 1N0WA 5IDVA 2YWEA 3EX7C 1US8B 5K8UA 1IAQA 2WJYA 3QE0A 3WBKA 2JIZD 2VHCA 1S2MA 4DCTA 2R6FA 4DLWA 4GDFA 4CT4B 4LC1A 3BOSA 4MKGA 3BJIC 3QKUA 4C7OA 2QPAA 2FA9A 3K8YA 5KSOA 1KNXA 4A15A 4E03A 1HA3A 4ESHA 4HAVA 3QBTA 3BWDD 2A3RA 1CR1A 3AF0A 3D31A 1GG2A 5H68A 1CS4C 1KIMA 3QVUA 4B3DA 1J7KA 4RJLA 3P27A 2WVJA 4B35A 4JLPA 1SZPA 3GLIE 4LBVA 3L0IB 4YLGA 4GL2A 1OXVA 1G17A 5FPKA 1N0VC 4OQXA 4LHWA 4B32A 5G41A 5FTLA 4QL3A 3FTQA 3I5YA 4HLDA 4NCNA 4G5RA 4RFSA 1NNEA 2OCBA 1GRQA 1MRSA 1JJVA 5L8VA 5SZHB 2JDID 4B3XA 1Z2CA 3ZD6A 3KTAB 1FQKA 4C2TA 4GZLA 1Z29A 1F60A 5F9FA 2ZS7A 5FUXA 1U90A 3DMDA 2MSEB 2GWHA 2ODNA 1H8HA 2J7PA 1XRJA 3QXCA 4Q02A 4Q03A 5KNCA 2FEMA 3OAAD 4C0QC 1WF3A 2ZJYA 3R8CA 4NPHA 4NCKA 2XAUA 3JZAA 4MKFA 3LH5A 4TZ0A 1EFTA 4EPYA 4CF7A 2FFQA 4BFXA 5CITA 5FH9A 4P4SA 1ZIPA 4JZKA 4PHHA 2P3SA 2VP6A 4LBWA 1P9RA 3Q5DA 4JSYA 5FBWB 2JLYA 1ZU5A 4LHVA 3A8TA 1VCIA 3TBKA 4BLRA 3LX8A 4ZI2A 4CRWB 5E95A 3RS3A 2ZROA 1L2TA 1UDWA 5DHFA 2PH1A 3K09A 4QGGA 4AD8A 4EPTA 3MCAA 3MJRA 4LJ9A 4PSVA 1R0XA 4ZKDA 3L82B 2HUPA 4NYJR 5KDOA 2Z43A 3WHKA 1X86B 2PCLA 3CPEA 2ZR9A 1G1MA 3PQCA 4OI2A 4ZPXA 1AM4D 4AY2A 4Q1EA 2C78A 2FSFA 4WA7A 3GLIA 5JS8A 3THWA 5BN5A 3K70B 4LPKA 1DG1G 4WBSA 4HLCA 1Q3HA 3MSXA 3W3ZB 3QPVA 3I8XA 3KKPA 4BEBA 4IVQA 2CHQA 2VO1A 1KMHB 3W34A 5JEDA 3KX2A 2IWRA 2ZI7A 5EQTA 3LA6A 2EWWA 1FTSA 2J0VA 4LHZA 4XSGA 2IUSA 1NP6A 2D2EA 3DMNA 3VR1A 5CJ2A 1MO6A 2IYTA 4YMTA 2WIBA 4TZ6A 3RSLA 4Q1FA 3IGFA 1GRRA 2YZ2A 3HPQA 5LB4A 2VIIA 2C99A 2ZRMA 3AP3A 4ZO4A 3U5ZB 2N46A 3SQXA 4H9GA 4MUAA 4EUNA 1KJWA 2ECKA 2X2FA 5LBIA 5SZIA 4AG6A 3Q9LA 4QM7A 2WKRA 3SN6A 3AVYA 2GZHA 4BE7B 3PVSA 5H8WA 4QNMA 1OH8A 3QNUA 4A0RA 1CF4A 4JIMA 2YOHA 3B1YA 5LDDC 1SVKA 5EUMA 1KI7A 3M4YA 4YMWA 1H65A 3SOPA 3SC3A 4NHOA 3M6AA 2V55B 2IXFA 2XSZA 1GL7A 2QU8A 4EFMA 1CR0A 1JAHA 3SJCA 4ZDKA 1XEXA 2A7QA 5CYPA 4YMVA 4M1SA 1E9CA 2WZQA 1OYWA 3LAWA 3NKVA 3AKEA 2ODBA 4HB4A 3JZMA 4AKHA 2AK2A 1ZU4A 5C4GB 3P32A 4OI0A 3B9QA 4HAYA 4D82A 4CEIA 1UPTA 4CT5A 4TYQA 1X1SA 1OH6A 2QN6A 1S1MA 4IEIA 5J5CA 5E4FA 5FR2A 3A4LA 3IEVA 4G5SA 4LJYA 3LWNA 1OLOA 4RFVA 2ZRPA 4MRNA 3N5CA 2X77A 4EJSC 3H84A 2HCJB 2RHMA 2NTYC 3KKMA 5HZHA 2DFLA 3TUJC 1R0YA 3V4RA 1X1RA 1JEDA 3BC1A 4LJ8A 5HCIA 5KDLA 5FUWA 4Z1MA 1XMIA 2FEOA 4MGZR 3NC0C 2QQ0A 4BUJA 3CF6R 4ZCMA 2KSQA 4Q4AB 4O3MA 4AKGA 1KO8A 2ZQ5A 1E9BA 3T12A 2CBZA 5A0FA 5KO2A 1GP2A 2J0UB 1W36B 1EFHA 2RGBA 3THYA 3VQTA 4Q4HB 3HU2A 3LRPA 1G5PA 3BFKA 2YWFA 4PQFA 2CCGA 3DOEA 4JSTA 1NG1A 1KDPA 3K0FB 4NCJA 2ZRCA 4K81B 1TQ4A 4DSNA 3RAPR 5CIWA 1XMJA 2CL6X 2QZ4A 4S2EA 1OE0A 1F5NA 2JGNA 3WYGA 5SZKB 3VKWA 4AKEA 3SJAA 2GESA 5B64A 2GK6A 2VSFA 4J0QA 1IONA 1Z6YA 2NOAA 3W6OA 4DXAA 4A92A 3LXXA 1JB1A 3B13B 5DGXA 1IQPA 1E2HA 1YZTA 2RMKA 2WSMA 3KL4A 1U98A 4JYBA 1EESA 3CRW1 5TXGA 4PC3A 4PZZA 1XNJA 4HAWA 2O5VA 3OHMA 2H1LA 3KQNA 5IF9A 1Z63A 3EXAA 3TAHA 1TQDA 3VX4A 4M9QA 4A8JB 1G21E 4RSGA 3RNLA 2IYVA 2ZSBA 2W83A 1FQJA 4B71A 4V0ME 3SHWA 2YWGA 5L3VA 3KQKA 4GOKA 5K8IA 1CJTC 1D6JA 5TDHA 4D26A 1DAFA 1GOTA 3UWKA 1YVDA 1BKDR 2W58A 3V00A 2VQSA 2F43A 4DCUA 3DHWC 2VHTA 3MGCA 5EE3A 1GNRA 3E70C 5AJXA 4E22A 1N6OA 2AKAB 5JLJA 4ITRC 2RGGA 2IYSA 1BYUA 1S3SA 3NBZC 1KI8A 2QBYA 1J99A 4V0KA 5FI1B 1YQTA 3NDBB 4MRVA 2H8KA 2GXAA 4DC9A 2V6IA 5JECA 5FTMA 4OJKA 4LYJA 1SVWA 4KYIB 4BFUA 3FB4A 2WWGA 3VKGA 3W9YA 3W8NA 1JR3A 3QY0A 4KFUA 4IHQA 1LW7A 5KSZA 2VP5A 4O0MA 4B74A 1OXXK 2P2LA 1DPFA 1UBEA 1VDZA 3NHAA 1DADA 4TTQA 1L7VC 1OYYA 3THOA 1L8QA 3HU3A 1HT1E 3U2QA 1KI4A 3LX5A 4ZDJA 1U9IA 3BIFA 1IJEA 3I72A 2DBYA 2FH5B 2RGDA 5CDFE 1IBRA 3K0AB 4JLKA 5E7IA 6Q21A 3W6NA 2D06A 1ZCBA 1WP9A 1JAIA 1IXZA 1G64A 1G5TA 3QXHA 4URYR 1KSJA 2XNSA 5FR1A 1SVSA 1G4UR 5CJPA 3C5CA 2LKCA 2CCKA 4OQFA 3M1IA 4PHGA 2G0TA 3TGPA 1W5TA 1S1CA 1I4TD 3VX3A 2QQEA 2ZIAA 4CIDA 4PFSA 4HZUB 2FV8A 4FMDB 2QRZA 1GNPA 2MSCB 2W6JD 2FX3A 5BN3A 2FSIA 2JIZA 1RRCA 2AN9A 1K6MA 1SXJD 2VLIA 1NRJB 1QRAA 4NMMA 2UVQA 2Q3HA 1NBMA 2JASA 2J87A 2QBYB 1EFRA 3SEAA 3MWKA 4KFRA 4PANA 4Q5IA 3KKQA 3H2YA 1PLLA 1M1YE 4CEJA 3GEEA 1KKMA 2GVDC 4C9BA 1E2LA 4HUTA 1XU4A 2O8DA 4E09A 5FOXA 1AK2A 1T91A 4QM6A 1R7RA 2ONKA 3G5UA 2FN4A 4DLUA 3LY5A 1LS1A 4PSAA 2R6DA 3PEVA 2ZRLA 4JLBA 2WMNB 3K9HA 3TR0A 3WNCA 2FPKA 5DH9A 2D7DA 3AVVA 3RC8A 1EWRA 5TB5A 3P26A 2AXNA 2VSOA 2OG2A 4M9XA 3QPUA 1LS6A 3A37A 3GFPA 4OK6A 2V7QA 1WA5A 3MJHA 4Q9KA 5J40A 2PCJA 1LTQA 4KFSA 4BFYA 2J59A 1W1WA 2JDIA 3R9IA 4EDHA 1E96A 5CLQA 5TARA 4DHEA 5EXSA 4BLSA 1ESNA 2HT1A 1DOAA 4JBYA 4DLTA 3EZFA 3VKHA 1XEXB 4Q21A 1W0KA 5KNDA 1F2UA 1ZNWA 4MGYR 2W2VA 4RD4A 1OV4A 4Q1CA 3ZJYA 3EA0A 1QG4A 2CHGA 2V8OA 1Q1EA 1VG0B 2DR3A 4TLAA 4B44A 3O8RA 3IILA 5JWHA 2V9PA 3ZGXA 2WM9B 1KI2A 2XNDD
chains in the Genus database with same CATH superfamily
4KFTA 1T0HB 5AIAA 2EW2A 2EFCB 1TMYA 1VBKA 2PKQO 1CP3A 2YHBA 4URWR 4FJ2A 4B7ZA 4G63A 1GADO 2N3ZA 4OA8A 3V8QA 1U0TA 4A4DA 1TW2A 2ASVA 2X7XA 2XOKA 1GZ5A 3R0IA 4XOUA 3UMVA 1Q0RA 4PPFA 1LFDB 3AC0A 5AKLA 4FCCA 4QUDA 3OQOA 4I0WB 2ZUUA 2FQ1A 4JASB 2REQB 2ZJAA 4O02B 1NQUA 5EP1A 1FSZA 4D3FA 4ZEVA 1QFMA 2DUWA 4O1IA 3NVKI 1RYDA 3FI0A 1E6MA 5HGXA 3E4DA 4EKGA 4G1UC 4LZWA 3VGJA 1UEXC 4JVMA 1OLUB 3OI7A 4WH0A 1L5FA 2DULA 5AVQA 4B4WA 4OGFA 4W5JA 3T3GA 1Y1RA 2DFTA 2QX7A 3K5WA 4XGIA 5BSGA 4I9NA 3C6BA 4C0BA 1JTEA 3QKTA 3FYSA 1V8ZA 3UEOA 3QOXA 4BQIA 4YS6A 4YAIA 4Z4EA 4ICIA 2VDWB 4A2WA 1DRJA 3DDHA 2QL9A 4EY4A 3FCXA 1XNRB 2OMKA 1EFLA 3DHNA 1KFKB 1F4LA 3L0OA 1R4ZA 3VKUA 3GA5A 2BEWB 1X38A 3S6JA 4N65A 1NNLA 3PFCA 4ZVQA 1HGXA 3NXSA 5C4IA 2Y05A 2EIHA 1KVQA 2DPMA 1VGRA 2QR5A 3O21A 4AJ1A 4AL4A 3WLIA 3ZXUB 1Y9ZA 3BX1A 5EJEA 3P0FA 1XJ0A 4B46A 4EHNA 5KVVA 3LKDA 5FOVA 1FP2A 2VWGA 3LY8A 3RT1A 1CUWA 3HY6A 3NPMA 2XVMA 1V6AA 2IA5A 5I7AA 3UHJA 1L3CA 2QVCA 1YF3A 1X1DA 1NVVQ 4JJKA 1W73A 5ALMA 3DXFA 1A4RA 4MMZB 3GR6A 3AFNA 3LDAA 1PNRA 4OK3A 2Z95A 4FFDA 3TXAA 3IIJA 4V0OA 5HM6A 1F8XA 3NU1A 1RC8A 4L9SA 5T4HA 1AD2A 3ASZA 4ERXA 1UBTS 2NPOA 4DYHA 3ZWKA 5EHZA 1O5OA 2V4MA 2WD7B 3BD6A 4LKOA 1Z38A 4AVYA 1KS9A 2P3LA 2X9VA 3SZGA 3FWYA 3INRA 4BU1A 1IQUA 1Y6ZA 4G0YA 4F93B 4WBNB 4B6EA 5ADVA 1BE6A 4JKIA 4UU0A 3A6LA 4ISBA 4BQNA 1ZZEA 4LZJA 3UJNA 3ET4A 1HNWB 4G89A 3OBBA 1QH8A 3INGA 5LDGA 5C37A 1AV6A 3I0ZA 3EXHC 3O8QA 1V95A 3DNFA 1KMCA 4PWYA 3GLGA 3C5EA 3C8UA 3GRAA 2XYGA 3KSMA 4GXNA 5AM1A 1UCFA 3QRWA 2YRXA 1UPAA 4MWCA 4X63A 1AUPA 3T38A 2H51A 1BFUA 3WMXA 4CF4A 4EF4A 5J2UA 2VDRB 1XVUA 2X5OA 3OPMA 4LF6B 1E2EA 3DOCA 1JFSA 1TJ5A 4H6VA 3U3JA 2BY4A 4B75A 1M9NA 1Z28A 1KJ8A 3FYTA 4NBSA 4BV3A 2QVGA 2GHQA 3BMOA 4F1WA 4YMIA 3E2IA 1H93A 3K31A 1X19A 2V5UA 3FIJA 3E61A 3R24A 4MVJF 4O29A 4ZAVA 3QMVA 3UTCA 5C46F 1QUFA 4KRFA 1A82A 4EL5A 1G3QA 1RADA 2C5AA 1FRFS 3OIDA 5ALKA 2O0JA 2E4ZA 1TO1E 3OKAA 4E5DA 2WE8A 1YJ8A 2YJ5A 3EC1A 4A9AA 3QSYA 1KRXA 4HWTA 1AO0A 3G8DA 1K0UA 3ANNA 3STXA 3AOGA 5DNUA 1JJAA 5C7LO 2NACA 3C43A 4LXYA 4LSWA 2AA3A 1KZ7B 3ILXA 4H1TA 4HLNA 4ZOLF 5CVEA 3GGGA 2QSZA 4G2NA 4AJKA 3T3PB 4I81A 3DEFA 2PT9A 1CNEA 1Z7EA 2FLKA 3IRUA 3U39A 1ULUA 4RULA 1JXAA 5JYEA 3I5UA 1W94A 1L1RA 2RC6A 4LRYA 4K6OA 2IOFA 4IIEA 2NP6A 1L5QA 2AT1A 3QG5A 2F4NA 4PR3A 3QX9A 5JSQA 3GG9A 4ZCQA 3ZE7A 2X0JA 4L51A 5B1SA 5KTSA 1TX4B 3KQQA 4A6DA 4X24A 3GMIA 3IUBA 1JA9A 3RUEA 1H66A 4AK9A 4KI0A 3BULA 4FFVA 4RVHA 5FPPA 4UNRA 3JAMA 4WECA 4DJJA 1WMBA 2W2NA 3LF1A 3NWEA 2H1RA 2O1EA 3P94A 2C7GA 1CUFA 2CW5A 2QG4A 1PG2A 4JKOA 4RHYA 1T6ZA 5AUNB 2DY0A 4WX2B 1P29A 3X1ZA 1GCUA 1ZVQA 2WWFA 1NN3A 5HMLA 3LT1A 4BVHA 2CSUA 3OFKA 2PX8A 1OY1A 1RR6A 3QKIA 1G18A 5TNXA 3RDPA 5LNK6 1T1IA 4I1UA 3FLMA 1PZGA 3P0JA 2L82A 4EGSA 3TBFA 1S2IA 2UUAB 1JEEA 2EBUA 1C7ZA 3HP4A 2QN3A 3VC3A 3B9PA 2X9LA 3HDTA 3V55A 4OHYA 4E1VA 3L8EA 4R2XA 4V02A 4BVFA 2WQ7A 1SG9A 1SQ5A 2RHHA 3LWBA 2VYCA 1CJVC 2I1VB 3H1BA 3BXPA 4LCJA 2KHZA 4BP3A 2LXNA 3ZTTA 2ZZMA 2FZGA 1ZH2A 1E1NA 2ZTMA 3H5VA 1K27A 2H0RA 1SQGA 3HBLA 2B6NA 3V9PA 4DLBA 5JJBA 2OBFA 3LF2A 4CLXA 3HWX1 4X62B 1EFCA 2PL9A 1B1CA 1T5IA 5THXA 3SEFA 4HAXA 1L6IA 4YP5A 4BCCA 5DI3A 5HVNA 4M8SA 2ODQA 2W6JA 3M6UA 1JPNA 3SI7A 2CXUA 3LZ6A 1Q11A 4DR6B 4MYRA 1P33A 3FZYA 3ZG6A 3BHJA 5KYKA 2O48X 3DO5A 1JHRA 5F64A 4EVIA 4J3JA 3CIOA 4RJTA 1MABB 3G6KA 3O9ZA 5EJFA 4HB3A 4DIOA 1QG0A 3DMFA 2P0EA 2YQZA 1BO6A 3ER6A 3HUEA 4IMIB 3RANA 2XOXA 2RGEA 3S40A 3OZCA 4I1VA 3UJHA 3K9LA 1QNFA 3O0TA 3UPDA 5T6MA 4BCBA 4KHPB 2A14A 5K0LA 4QTYA 4OAQA 4G0UA 3KS9A 4PZEA 1F9AA 1H3NA 4MUKA 3P5SA 5FWXA 1H5UA 2VYFA 4YUZA 4ZEWA 4O8ZA 4F1JA 1NYQA 2FMXA 2YCLA 4B33A 1PFWA 1IOZA 1I2CA 4QOFA 1VGVA 2H63A 4BUCA 3NANA 2ONZA 3ILHA 3LGSA 4LGVA 5L95A 4EEXA 3R3UA 1NM5A 3CSUA 4RJIA 3WMRA 3I6MA 1EWKA 3ABQB 3E1KA 2QRVB 5AQ1A 2BFAA 5CAEA 1E63A 1OYOA 5ESXA 1YIAA 3LQQA 4LZLA 2XUPA 2ZXFA 3PQ6A 4DMLA 1L5OA 3NUZA 3AIMA 3I3OA 4NU5A 1XF9A 3MFYA 4IJKA 5C9ZA 1GKUB 4MLCA 5F51A 4ZQFA 4MX8A 2CC2A 5F7JA 4CM4A 3KQMA 1Z88A 3QH4A 4JX8A 4AX4A 3CUSA 1XCPA 3VA7A 1U0BB 4LF5B 3CXUA 2ECQA 3RRZA 2EU8A 2JJ8A 5JWRA 3GT3A 5JROA 1NBWB 3DBVO 4LXQA 2YYSA 4DVGA 5K3FB 2BZ1A 1VMIA 1ZJWA 1YZKA 2AJBA 1LBTA 3PFFA 2ZULA 4IDDA 4BQFA 1Z4MA 4PCUA 5MFPA 1CJCA 3ACCA 3HCBA 5EHNA 3ASUA 1LI7A 1YT5A 1OFUX 4C01A 2W00A 2FPIA 1A72A 2Q1YA 1HK7A 3QTLA 2HTFA 1WDTA 2XNCA 1JU4A 3FOAA 3DVQX 4QPPA 5BYBA 2C4KA 3K0CC 1QQ7A 1CUAA 3WNBA 4ZYTA 3X2FA 3RIEA 3MWEA 1LK7A 4E5UA 1BHSA 1KVUA 3BUSA 3CE6A 1NW6A 2AI2A 2J5QA 4IRUB 1E0SA 3WJ2A 5JXWA 1TEZA 1U4SA 5LUAA 1Q1AA 3VZSA 3H75A 4DC1A 2V7VA 1HLFA 4RCZA 5DB4A 4EB8A 2AYYA 2PH3A 4QBIA 3FF4A 4WFQA 5IVIA 4NKRA 2VDMB 3OIUA 1KTIA 2VPZA 3LFUA 2Q1XA 4DCSA 1EJBA 3ESQA 4C4SA 4X7PA 1FL9A 1UF9A 1UPXA 2P2SA 1YI1A 2PRSA 2Y1DA 3DDOA 3NIBA 4C6HA 3FHOA 5M5BA 1EUCB 3AFGA 3GUYA 3KT8A 1CUEA 4GD3Q 1EDZA 2ORWA 3I53A 1AG9A 1E3JA 1H4SA 2H1CA 4DIFA 5IAOA 4XQCA 4O4LA 2XQVA 4R8VA 1AZWA 2PH5A 3KR2A 3HEBA 1KYZA 1GHTA 1AKRA 1RWVA 2CZGA 1Z4LA 3ASYA 3ZKWB 4D3XA 4R2KA 2FMUA 1MAVA 4KWEA 4E94A 4O25A 1JQAA 3SBXA 5GJVC 1D1QA 2BTOA 2G3YA 4X91A 3WICA 3K5HA 4Z9YA 3GAAA 1WDWB 1QG2A 3V1NA 2FPWA 5AUPB 1XAGA 4HADA 4TLDA 4FLEA 1R50A 2DRIA 2OFFA 1QHYA 1M7GA 3CNNA 4HAUA 4AF6A 3AU9A 2O8FA 1GL6A 2C0CA 4BX2A 4XOIA 3CUWA 5EKDA 1NXPA 5CDHA 1RRGA 4UUPA 2B30A 2YVQA 1RI4A 2OBMA 3OE7D 3NH6A 2PUEA 2GWRA 4HWOA 1TYBE 2IZ0A 2RAPA 2B78A 2AJLI 2GR9A 1RJDA 4DR3B 1T8UA 2EZ8A 3WIDA 5CLFA 3KWJA 3ODGA 4TS1A 5JSYA 5H80A 3L1HA 4N8SA 2PWYA 4W7SA 3WG9A 4YJFB 1B43A 4BP9A 1BGXT 1UKZA 1H2XA 5IULC 2CLDX 4DLYA 3ORYA 2ZE5A 1GTL1 2N9UA 1ZN8A 3AUTA 4XEHA 1IVNA 1GWNA 1EDBA 3LZDA 3MTEA 4LI0A 3FMGA 1KRWA 4PV7A 2W7TA 3ROPA 4D0LB 2PZFA 2VS1A 4RA9B 2AG8A 1K3TA 2IZ5A 3LD9A 4DV3B 3CVOA 3KWLA 4L4XA 1UMKA 1XRMA 2EAUA 4M4SA 1S8AA 3AUYA 3G2KA 2D1SA 3EXIA 3ZGVA 1WL8A 3WWDA 1OGIA 1VP3A 1M0TA 4QU9A 1WSDA 4FJ1A 1TUIA 3TPFA 3V4FA 3GLTA 3WJ1A 4TYYA 4DLVA 1AS2A 5ITZA 2GZ3A 4Q1DA 4BP1A 4J76A 1HZZC 5K2MA 2IYLD 2AJTA 1IRIA 1YZGA 4TYNA 4QGHA 8ABPA 3F5FA 4TKZA 4F4CA 1GLVA 1OUMA 2R8XA 1NUAA 1Y1LA 5JVDB 3W8EA 4DAEA 1QHXA 5I7FA 1T3GA 2V7TA 5EERA 1L7BA 4NEQA 4NPCA 3KEQA 4AMVA 1QZXA 2H2FA 3KZ1E 521PA 3C4QA 3RFXA 3X43A 1Q2UA 3ZKWA 2ATVA 1QQ5A 1G98A 2ZETA 3I01M 1YKFA 4BV8A 2QL5A 1WY5A 3LUPA 1N2OA 3L0PA 1CEXA 2MDTA 3USCS 4BRUA 4D2IA 2B5VA 4FMCB 5BWOA 3IE1A 1GR0A 4LTNA 2OZLB 5IDWA 5K0FA 4AG3A 2XB8A 1E7QA 2JCXA 4ED9A 2GBLC 3TNJA 5LU9A 1HT0A 1V8OA 3MS2A 4JS0A 2XE8A 4BLQA 1BROA 1BNCA 3E7DA 3IEPA 3DNMA 1ANKA 1C0KA 1UPUA 2GBLA 4RESA 5CT8A 3SSMA 3I2YX 3IO3A 3Q87B 3GFOA 4RFSB 4CHGA 1YJQA 4KDFA 2V45A 2ASEA 3OT1A 1DARA 3EXFB 3GP3A 1LDEA 2A5YB 1DEKA 2QX8A 3KDSE 3GLIE 1FIUA 4BLVA 4QXRA 4UEQA 4ZAZA 3N0XA 2E4UA 4M1TA 1IK4A 2BFCA 4RX1A 5DIFA 5JO0A 2MU1A 5EWJA 4OH7A 4JITA 4RGQA 2BMVA 3PICA 2HU5A 1DAMA 1RCTE 4EO4A 4EKYA 5KQMA 4HYQA 4H0FA 4BAUA 2Q6IA 3DBRA 2LDBA 3PDJA 1DC8A 4DCJA 3O8CA 1TCCA 1IXYA 4KO3S 4PBTA 2ODWA 1FJGB 3HVIA 1E0AA 4AY6A 5A03A 2A1TS 3A6JA 3TMKA 2HIAA 2FUEA 2COUA 1XHLA 2GCGA 4GSLA 1NVVR 1CS0B 2VXOA 5ICEA 1S01A 2B7CA 4UUBA 3O6VA 5A06A 4HAIA 5FPQA 4IRXA 1WBDA 2HLDD 5AHKA 4YALA 2CVFA 2YWJA 2IH2A 2JIRA 1QM5A 1BZYA 2PMEA 2BJWA 4WBNA 3W9BA 2CMKA 1QOPB 2YIJA 4DNXA 4MDFA 4Y7CA 4Y1RB 3E9EA 2MIIA 1IJFA 2H85A 4CVNA 5LA6A 2DH5A 3PXEA 2J48A 4V39A 1J1UA 1OHHD 4H31A 5ADHA 2G72A 5CJJA 4YIKA 3DL2A 4JVLA 1SBTA 3K2IA 2EARA 2D5IA 4BMNA 5A6VA 4P80A 2ON6A 1T10A 5A2QA 3OWHA 4YMLA 4EYQA 4KV9A 3IXMA 4K0KB 2R00A 4Q3AA 4FCTA 4PO9A 1D8AA 1Z5GA 2WFLB 4FFWA 4OFZA 1TU4A 2PS1A 5COQA 5DGCA 3CONA 4TMYA 5GAJA 3MERA 3E8MA 4RGVA 2HC9A 3OICA 1Q7BA 1GYRA 1Z82A 4FYWA 4BPBA 1EFPB 2I7TA 3ZDYB 4GSYA 4JL8A 3WQRA 3IUNA 4M0CA 1JSZA 2C98A 4BLPA 4NYJQ 1QIGA 3VMFA 3B20A 5L9AA 1VJ0A 2J33A 3AESB 1U8YA 4RDXA 4WXHA 1EX7A 4NU0A 4CFYA 4YMHA 1IZ8A 1PJLA 4ZYZA 4IIGA 2B34A 1XPRA 5AVXA 3CLUC 3MFQA 2PWAA 3WLOA 3B5JA 2C4NA 5CT5A 1DXQA 3NH9A 1TQ2A 1BD3A 4JUAA 1BU8A 5BW4A 3HTXA 1BWSA 1ZESA 2C4HA 4BO3A 3W1WA 1IBCA 3OO0A 1OXBB 5D5PA 1D6SA 3Q72A 3B7PA 4XWWA 2XCIA 4AWAA 2HYDA 3KK0A 5KUTA 5LM3A 1W4RA 3HDHA 3EPJA 2G63A 2W6PA 2BHTA 1X80B 5DISB 3OBIA 3PFBA 4P33A 4GMKA 4W7HA 3W2IA 1C8LA 1PR6A 4J6FA 4EEKA 3QNMA 2PXXA 2C59A 1P62B 1A9YA 1XJQA 1FXWA 3C2QA 4WESA 3GHHA 3D6NB 2IPOA 3OMLA 3SDZA 3T34A 4MOWA 2EJBA 3DF7A 5F12A 4N0DA 4BTVA 7MDHA 3U44A 9GPBA 4GMFA 1X13A 2D0OB 3DBLB 1ML4A 5B36A 2A0WA 3E9DA 1E98A 3ESAA 2ZYVX 1KZ6A 3GAFA 1X15A 1QHNA 3CCCA 3QPDA 3K8ZA 2WV7A 3AR5A 2X0NA 1QANA 2DPLA 3JVVA 1FYEA 1ZEMA 1AKUA 3NW9A 3O9VA 3RUFA 4F4JA 2I4MA 4RNDB 3VR5A 1N92A 2OHOA 3EE6A 3KJZA 4LSZA 3PFKA 4B40A 3M3HA 5ITVA 4CUZA 4A0HA 3KPWA 2JRLA 4G97A 4WINA 1NFRA 1O9GA 1HYQA 1SHTX 1O95D 2P67A 4C0SA 3A14A 4DLNA 5FUMA 4LUCA 3PHGA 1WWKA 5BYKA 4W1SA 3OZTA 4GBED 1F4VA 1NBHA 1IATA 2QGZA 3GRCA 3IV6A 1NMXA 2GK4A 1M74A 2A7XA 5EZYA 1LDMA 1CC1S 2QKYA 4FYIA 5ALRA 4OY3A 3D7RA 3FI9A 1OH5A 4OHRA 3PQ2A 4M1MA 1PEDA 2P1RA 3M6FA 3SS8A 3IIIA 2LDXA 2YV5A 3ZWOA 3ZY2A 4QODA 5DU2A 3ZH9B 1PR9A 1FYDA 4R5MA 4N9WA 2GYWA 1SKYB 5JH7F 3PT9A 3OTHA 4UAVA 3RVNA 3USZA 2GJAA 4YRAA 2QRHA 4I1PA 1XRRA 5A4FS 1XZEA 4F2GA 1QONA 1VTKA 3A9UA 5A5GA 3KE9A 3RODA 3VPDA 4RGYA 4N76A 3ECCA 3OFNA 1N5OX 3EXIB 4ZEOA 3R09A 3MMZA 1KOFA 3VI4B 5ABPA 5JADA 2AZXA 2OG1A 2PT5A 3O2QB 4PC2A 3L07A 4DNQA 2R84A 3SM3A 2BGLA 2ID8A 4C1BA 5CFOA 2E0IA 4GW3A 3PC2A 3I9JA 5FHQA 3JTMA 5JLAA 2V4ZA 4RETA 3HYSA 1CK4A 1Y7LA 2YVLA 4GSKA 4M53A 4YCDA 3GEGA 2CJXA 3L43A 2GMWA 5AO9A 4ENWA 4PG5A 4IJ5A 2SHKA 3R76A 4AECA 1KQOA 4OSOA 4URUR 4R8SA 2JIBA 4ND2A 4RK4A 3OY7A 3IIKA 3O8BA 3P5BA 4MJ3A 5ES3A 4YYEA 1PGNA 1ZSYA 4DMGA 1EIWA 3R5SA 4V3CA 4FUQA 4MK4A 5K3FA 3A9VA 2ONJA 3ZLTA 2ESRA 2JJ1D 3CH7A 4BDSA 4WKBA 5CG1A 4CTMA 7YASA 1NLYA 3GPLA 1EWVA 1NHGA 2CL7X 4QFBA 4G85A 1JG2A 4NP6A 2QW0X 4IO1A 1C5KA 2CXHA 3BMNB 3RJZA 2PWPA 3HJFA 4LOLA 5JAIA 5HZKA 4S2UA 3KCNA 2QS9A 4J2HA 3BMXA 4D8XA 3PNYA 3OVMA 2YNMA 1A8UA 1QHEA 1IHOA 2FN7A 4CM7A 1LKZA 2B4YA 1YVEI 3FWPA 4Z3KA 1ORDA 2TMYA 1A7AA 3VR2A 2CBXA 5CT4A 4DKXA 5K9ZA 3QLJA 3AHHA 1CUCA 1YRAA 3UQYS 3L8ZA 2WABA 4Z0NA 3IT1A 4N6GA 5EVJA 2O1WA 4UPEA 4A8PA 1VI6A 2UVPB 4Y9UA 1M2JA 1MJFA 4V1CB 1XPOA 2OBNA 4P1ZA 1QPBA 5KI6A 3QUQA 4F11A 3EEBA 1ATIA 3DFZA 1NONA 1WV1A 3IDFA 4Z54A 1ZSNA 1HG1A 1Z5NA 2V59A 3D3WB 2V4UA 2C54A 1C14A 2ZIXB 3H5LA 1PE0A 4M0KA 2J08A 1DOHA 3FLEA 2BBOA 3BGOS 5HDBB 1T5HX 4JD5A 5DCLA 4EA7A 1NATA 1UBSB 2P6MA 3KUXA 1PHRA 2WYUA 3QGMA 5UKDA 3VZCA 5AM2A 1MKYA 4EJ6A 2PUGA 3KQUA 2DGDA 2OK8A 1F2TB 2C9DA 4YRRA 4Q3EA 3RV4A 3SIPA 2P9HA 2ID7A 1N2BA 4EABA 1RC1A 3ORRA 5KKCA 1EJ6A 4XSHA 3DCNA 1CDDA 1X7HA 2XHZA 3HS3A 3I9FA 2HZBA 5ELMA 1IB6A 2YUTA 2ZU6A 4JAVC 1BJTA 2I3GA 4P0TA 1X7YB 2R7MA 3A6ZA 4IFTA 3CNOA 5J2TB 2ZJ8A 4O4HB 5JD3A 1UBOS 2ZUVA 2NXEA 4QGAA 1FPQA 2WY2D 4ZOCA 2ZE7A 1LWOA 3ANLA 4XSVA 4JP8A 3UANA 4QQRA 1NFQA 2C96A 1PIWA 2GUGA 1S3IA 2Q5QA 3EA5A 5J63A 2Z6VA 1SXHA 1U2PA 4JA0A 1AHNA 3JQBA 4DARA 4X1KB 1GPWB 1N3YA 2XZTA 1JJFA 3BRWA 1YAHA 1EXNA 2BKVA 3MB5A 2BCGY 3DTNA 4R6XA 4Y6GB 5TIIA 3V97A 3CGGA 1S2OA 2R1TA 5TJHA 3OEED 1JR4A 3REFA 1KY5A 1FYFA 5EC8A 5FBVB 4XD2A 4YRLA 5G4KA 3EOAI 4FQ8A 3CCFA 5IKMA 4GPBA 2A1UB 3SR4A 5CEFA 3BN3A 2P4HX 1HDGO 2AFRA 2FWMX 4GI1A 1H9CA 4XGQA 1XD9A 3BCSA 1BVYF 3D43A 4S12A 3NR2A 3QELA 4Q4JB 1ZCZA 3KYDB 1NW3A 1OF1A 4WKPA 5E0OA 4X66B 3FYUB 3DOJA 1J1IA 2IFTA 2QHXA 1Z6QA 3MZ0A 3DDSA 1R0KA 2GEDA 2AFIB 3BMCA 2JLXA 3BFVA 3IPAA 2PWBA 3M6WA 1FC0A 3O7WA 4BFSA 2R7KA 1ENOA 4LNAA 5CEJA 1CX9B 4EHIA 5J4VA 1RPJA 4HH3C 3IULA 2R4QA 2CSXA 3DAPA 3I34X 2W4MA 2JCBA 1XZNA 1J39A 2F6RA 4CTOA 2ZKLA 4TMWA 1KZ4A 2JKVA 2O05A 4WFJA 4NENA 5K3AA 1I0ZA 3ETGA 5IC5A 2A9FA 3IAS6 3DG9A 1N9ZA 3WLQA 4HS4A 1KP3A 1P1HA 1KYQA 2FKNA 4XX0B 4WT7A 3BFXA 3FDZA 4MYHA 5AW7A 3RSOA 4DT1B 1P75A 4FBMA 4KXQA 4BIMA 4C7XA 3CBGA 4GMXA 4OLAA 3DMTA 4MCJA 3L8HA 2OV1A 3CY6A 2A78A 1RJ9A 2IPNA 1YU9A 3EFHA 1PR5A 2QAGB 1Q0PA 5BT8A 3VC1A 3CLVA 5JASA 3ZS9A 3H87A 3WVNA 3QUBA 4B5LA 2F64A 1WW3A 2FW9A 2HNKA 2I9PA 2PGJA 3NT4A 5A0VA 4C3OB 1O9HA 5JI3E 1RYYA 2IPAB 2V6BA 3CRMA 3NJRA 3VOAA 3W06A 4UCFA 3THXB 1XFAA 3UXEA 1C8VB 3DTVD 1QHFA 1OWNA 1W1UA 3I6YA 1I32A 1JDPA 1XMQB 1MMFB 4IJMA 4G9EA 3L0CA 3QYAA 5C5CA 4Y2HA 1XSEA 1DAHA 3OLWA 2CD7A 4YK7A 3VHLB 2A9RA 4KJXA 3QZUA 4G1BA 4FS3A 1Q91A 2OZLA 4PG4A 4UXHA 2F1OA 3LUKA 1TIBA 1N7JA 4JQZA 1NR7A 5GVRA 1MX1A 2O07A 4E5VA 4CIYA 6REQA 1TT5B 1QIHA 3PTZA 4II3A 5AYVA 4ZIRA 1QVVA 1RE1A 2C1EA 5D3MB 3GLSA 2J3DA 3VO2A 5DM70 1HE5A 2XGOA 5TGDA 3GGJA 1WAMA 3P9ZA 2Q7OE 4RENA 1M2FA 2PUCA 2I65A 1NR5A 2WJHA 4D56A 2ZYRA 3EYWA 1X1CA 3WK7A 4L4RA 3ZBPA 4BU0A 1EP1B 2LCFA 4X20B 5D2CA 2ZIZA 1TC1A 3WQSB 4E51A 2AD5A 4XCQA 1X14A 3O5AA 1Z2EA 4KGZA 1R66A 3I6ZA 2GCEA 3EPKA 1XRNA 1GGVA 1MAWA 1XTZA 1RVV1 3FVVA 2FXVA 4KXYA 4XWAA 3FR8A 1BXZA 4JBHA 4P58A 3CVYA 4RSHA 5B2EA 1OIVA 3FFTA 4FDMA 3DE7X 5JVDF 3FCCA 2O2GA 4L0MA 1JQBA 4EDFA 1WXIA 3V34A 1KFCB 4Q05A 1CV2A 1M6VB 2C8KA 3SDBA 5HMMA 2KM1A 1YB6A 1JFTA 4BEVA 2H3HA 3M9WA 3T3OA 3O8NA 1NDQA 4X3CA 5HTOA 1EG7A 2WDPA 1SUEA 2FDRA 1MJGM 1KAOA 1FFHA 1S2DA 2O4UX 2JF0A 2Z3VA 3QITA 4EPWA 1RIFA 2GCIA 1ENYA 4QU8A 1KF0A 4RJKA 4ZRDA 4B3CA 1VL6A 3HFJA 3LWDA 3HRHA 5CM2Z 3ZDXB 2DWCA 5FKJA 4ECEA 4P0QB 1KZGB 2R3SA 5LB2A 4ND8A 1KYYA 2CY0A 1BGVA 1N4AA 1JXOA 3FMIA 3FVTA 5B4UA 2JZOA 1JZTA 3G0CA 3SZMA 4TSKA 2ZWPA 2R8YA 5J5VA 3DP7A 5LZ2A 4DJAA 5DMXA 3W5AA 1ZD5A 4FEGA 4NH4A 1YBVA 5FOWA 5CDTA 3E0XA 4KL8S 3TQIA 4YONB 2IEAA 2ZBRA 2NX2A 1F8GA 2GOYA 1E79A 4D3YA 3QNWA 5JFOA 4INOA 3G9TA 4RZIA 2XZDA 4PZDA 3PHBE 1T9CA 3M70A 5TQ0B 1XNQB 1PW7A 1RJEA 2CJWA 2PL5A 5IBCA 4JI2B 3N75A 5LQNA 4A7PA 2AEMA 3DJFA 1YBAA 5TVKA 3C87A 3MAAC 3NASA 3U4HA 4PN3A 4LYDA 2XYRA 2CLSA 3LQ1A 2H7CA 5E6UA 1MABA 5FJJA 1EGAA 1UFRA 4ZI3A 1XD2A 3LP6A 3MCWA 4IFBA 4FB4A 4C0AC 4EA9A 2VXCA 5CW1A 2V7QD 3TOVA 1WXFA 4HDNA 1OWPA 5HPYB 3ZDRA 1XNGA 4DBVO 4NX2A 4G36A 3RD5A 4PXAA 1P6XA 3WRXA 4PX2A 2MSDB 3PUKA 2C4VA 2B20A 2EW1A 1Z83A 2XTNA 2YN2A 4MH0R 2ADMA 1GFSA 3H5AA 3ZVNA 2DFNA 1T8RA 1OV6A 2V1XA 3EZXA 3PIDA 4H77A 5IYZF 2N1MA 3HZZA 3W5JA 3WQBA 4CV1A 3ZGLA 2HRDA 3GEDA 2OV8A 4KLNA 3S8EA 2J0UA 1U0LA 3HLKA 1QOQB 3JYHA 2PH7A 3N9IA 4GVLA 4KEAA 5TMDA 3W0LB 1NTRA 2GZDA 1Z75A 3TQCA 2JGJA 1BDHA 2P4SA 4G1FA 4AUNA 4ND7A 5M7EA 2HRZA 2WA2A 3QIAA 1K9VF 1P2SA 4Y67A 3F6EX 1QMPA 3TECE 1SVMA 4TSFA 4GS5A 5LPNA 2JFOA 5KTMA 3OURA 4FHCA 3T7EA 4M8KA 1IZZA 2C1XA 2QE7A 4FE7A 4LQDA 4MI9A 5CVCA 5HXAA 3IKTA 3AXSA 3ZQ6A 1BOOA 1ZN7A 2DWPA 4XGRA 4HNVA 5KPJA 3LM8A 1B6SA 3CZ9A 1UJ4A 4FFLA 2CDNA 2BBTA 2WQ6A 5T8KC 1VL5A 3E3AA 1LDYA 1W5EA 5KQRA 5DIZA 1Z0IA 1ZGGA 3K8QA 1OZ0A 3C97A 1JQEA 2GN8A 3CU5A 5H59A 3MEQA 4G1MB 5DYGA 4MRSA 3EPHA 4OKIA 1VLLA 1CY7A 5E2AA 4CDMA 4MI6A 3U62A 3S70A 3ZY4A 1ZOPA 4OMUA 2TRSB 3AIIA 1VFPA 2W0SA 3T5CA 4UM5A 1WNFA 1Y42X 3RJMA 3FPFA 4MRAA 3F0TA 1MRNA 3CC8A 4OQNA 3EHDA 1MPXA 1GRNA 2C95A 4YWJA 3HXMA 3EXEA 1U5BA 4EA6A 3HM2A 3V8BA 1ZICA 1QRSA 4GT1A 3L1UA 4LCBA 4LWZA 3UT6A 2J5KA 3VZRA 4BNIA 1F5SA 1QVRA 4C0JA 2BHLA 3E35A 3SQDA 1XLWA 1J90A 1Y98A 4EHKA 3TPZA 3CW2A 4PQRA 1P5ZB 2X5JO 4E4YA 4ETMA 5FJIA 3HUDA 3G9UA 4Z3DA 3CLHA 3PYMA 4ASUD 3LUGA 3P9CA 4BX0A 3EQ7A 3ISJA 2Z4RA 5KYXB 4MP3A 4BNDA 3VKVA 3D4IA 1BTOA 4KZKA 2G76A 3VDQA 4YP6A 2GN0A 1J24A 2J7KA 3VU3A 3R0XA 3NNNA 4C4YA 3WWPA 2DZDA 2DM6A 2J0SA 2COKA 4UEOA 1KQ3A 1FZTA 3AL2A 3ID6C 3I28A 5BNTA 3ECSA 5JH7A 2WYHA 4PQYA 3NRCA 1PDVA 1DIGA 4Z4GA 1Y4UA 3A2MA 4CT0A 1HDZA 3GA7A 5JDIC 4E5KA 4O4IF 4CQJA 3ZE8A 4A3SA 5B1DA 5CG2A 1V2HE 3AQ4A 3ROKA 2GJ4A 2YBEA 1CXZA 1M1ZA 2HU7A 1NVBA 4U8HA 4F3YA 4P0PB 3FYHA 3K5IA 3DLPX 5CXUA 2GJ8A 4EX6A 1EDEA 5FBQB 1H2ZA 1A97A 2QVBA 1HBJA 1U6IA 4UTXA 1KR5A 2C7VA 3DEAA 4BN0A 4EZIA 2M98A 2YOFA 1C9YA 1G3UA 2BEWA 2VAXA 4GICA 4IMRA 4MYSA 3WO1A 4MP8A 2ERCA 2AN3A 2BEUB 3T3EA 3VGPA 3R5HA 5BNZA 1O8CA 1OXKB 3TKAA 3ZHBA 5BWNA 5JI2E 1XRQA 4Z3OA 1P4JA 3QPAA 1YHNA 4RHFA 3RKUA 4JJ7A 4EB3A 5LXTB 4G01B 2EATA 1HOTA 4A16A 1U8AA 2MHCA 2DUMA 3NTRA 4EIWA 1YK1A 1F6WA 1GAQA 3OA2A 5FTKA 3K0HA 4FIDA 4AW9A 4X90A 4BMSA 4Q9AA 2JEZA 4ZPJA 5AW4A 5I3ZA 2FP4A 2IHBA 1XZKA 4L08A 4B73A 1P1RA 2KBFA 3K73O 1VG8A 1D7OA 2IGBA 1PK7A 2ZSDA 3VJMA 3O31A 2E18A 3DE0X 4TRJA 1VCMA 2C2KA 3ZHRA 3ZU4A 1CJSA 1GILA 1J5PA 3K4PA 1WUKS 2QRNA 4UUOA 2FFRA 1EAYA 1ECFA 3C6XA 2ZBVA 3I73A 1LV7A 4MCIA 1SG0A 1ZGZA 1GV1A 2M9MA 3ESCA 3SZRA 3OLXA 4JLUA 1NVGA 1Y6QA 2C9YA 4Z7QB 1U4OA 2CXQA 3N8IA 2C77A 2OAGA 4KW7A 1K2VN 4WZBA 2HLDA 2INGX 2HA6A 4DIMA 1G6KA 4IEEA 5TPWA 1IN4A 1XR3A 2H1FA 2JAUA 2FAXA 4UCQA 4JYAB 3ZIDA 2V97A 4Q9JA 2IDJA 3Q3IA 1I3CA 2CVOA 3KC2A 3KEFA 2GO7A 3AX6A 3P1JA 3O0DA 2JAQA 2MYPA 4X60A 4ZANA 5IZCA 4K9PA 1ZUWA 3VZPA 1SU4A 5B4VA 1GITA 1L7QA 1VJRA 2XSZD 2GETA 2RHCA 3NEYA 4POAA 2YDYA 3IOMA 4KPUB 4U7PB 1BHO1 2GN4A 5IEBA 2EBWA 1UFQA 1LF5A 3BMOB 1X92A 2Q4RA 4LX0A 4Q7KA 2IX9A 1HQYE 3B2NA 3SXUA 1KR2A 3S27A 2AIRA 5EEHA 5C32A 3KJGA 1SUSA 2GZAA 4GRAA 1X6VA 4PSUA 5BWMA 5JQGB 2UXDB 1AGPA 4QGBA 1YCDA 3CR8A 3IB6A 1GSOA 2QMUA 4OLFA 1V16B 4Y2UA 2PSHA 2IWHA 3ZNPA 2YZNA 3G5LA 4BQOA 5IPFA 3QBDA 5NLLA 3EGIA 1JPJA 3IHLA 3ONNA 4CMAA 4YCCA 1AS3A 4HUQA 5KQGA 1D2MA 5LA6F 2B21A 3N3AC 4I19A 1PRYA 4KVAA 5AVKA 2G8LA 3W7AA 5J4KA 1FB5A 2Q6OA 5GM2A 2IYXA 2QJRA 3TI7A 3LCCA 2Z1NA 3HCWA 4WBNF 2IT1A 1J2UA 2FB9A 1TDJA 2Q3MA 5HS6A 4D4MA 4IXMA 5I9MA 3GRRA 1NZDA 3A31A 2XJ9A 4WUTA 5ICMA 2W93A 1O94D 1DDGA 1EZ4A 2C3OA 1OD6A 2H2AA 4GP6A 2QTMA 4O1MA 4O4JF 3H86A 1J6UA 1U9JA 2I8LA 4DIKA 1K88A 4V0NA 4J3FA 1JFVA 1YASA 2FW6A 1TKCA 4DT1A 4P92A 5ALXA 4FFOA 5AW8A 3OTOB 1II0A 2ZB8A 1XYGA 4NYMR 4DILA 4S1TA 2FSVC 3B1KA 3FNHA 1AMOA 1VKZA 3AR3A 2HO5A 5EZQA 4UCXA 4C4XA 5BXQC 2ZG6A 1LK0A 3F7OA 5AW9A 4CYMA 1QF6A 4JK3A 3EDOA 1KSGA 3DUFB 2JG3A 3O26A 4QBGB 1XZAA 3BXGA 3T4XA 1BEUB 3NBQA 2WLTA 4JX9A 2AWNA 4CLOB 1P74A 4KPUA 1TJ3A 3SBEA 4A1FA 1GV0A 1WS6A 2W2KB 3TD2A 1WUIS 1YS4A 3DKRA 4QBFA 2HF9A 1J06A 1Z0KA 5P21A 2B36A 4G0NA 3ZW8A 3R4CA 3JVEA 1ZNZA 3UOWA 4Q7QA 1NVKA 2CNWD 1USKA 3JWJA 4NCIA 2A5DA 5LLDA 3GHYA 4QHTA 3KVRA 1OPRA 2UXCB 1CUYA 2HNAA 4KRXA 3U4AA 1RXCA 4KUGA 2VZEA 1DZ3A 1A2QA 3DEIA 1I4OA