2FG7C

N-succinyl-l-ornithine transcarbamylase from b. fragilis complexed with carbamoyl phosphate and n-succinyl-l-norvaline
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
Knots found
sequence length
320
structure length
320
Chain Sequence
SHMKKFTCVQDIGDLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRLSTQKAALNLGMNVIVLDINQGAWKLETERGVIMDGDKPEHLLEAIPVMGCYCDIIGVRSFARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTARPKVVMTWAPHPRPLPQAVPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYDQMKAFEGADFIYAKNWAAYLGDNYGQILSTDRNWTVGDRQMAVTNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords putative ornithine carbamoyltransferase
publication title Structure and catalytic mechanism of a novel N-succinyl-L-ornithine transcarbamylase in arginine biosynthesis of Bacteroides fragilis.
pubmed doi rcsb
source organism Bacteroides fragilis
total genus 118
structure length 320
sequence length 320
chains with identical sequence D, E, X, Y, Z
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.3.-:
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
C PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 2fg7C02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 2fg7C01
1DUVG 2QGFA 2HSEA 4H31A 1RACA 3AT1A 1SKUA 1C9YA 5AT1A 1R0BA 1RABA 3M4NA 3KZOA 1XJWA 4AMUA 1F1BA 5G1NA 2H3EA 4OH7A 4EP1A 1RAAA 9ATCA 4FYXA 4A8TA 1RADA 1FVOA 3L04A 1AT1A 4KGXA 3L06A 8AT1A 4IV5A 4KH0A 4JQOA 1ZA2A 3GD5A 3KZKA 4ANFA 3L05A 4KH1A 1R0CA 1Q95A 1EKXA 5ILQA 3SDSA 3M5CA 1RAHA 4EKNB 3UPDA 1TTHA 1TU0A 1NBEA 4NF2A 5G1OA 4FYVA 3CSUA 1EZZA 1D09A 1TUGA 1PVVA 3D7SA 2A0FA 4F2GA 1FB5A 1RAGA 3KZMA 3R7FA 3E2PA 1JS1X 4A8PA 3KZNA 3NPMA 1A1SA 3GRFA 2FZGA 3Q98A 1PG5A 3TXXA 2BE9A 5G1PA 3LXMA 2G7MC 2P2GA 1ACMA 4KGZA 3TPFA 2IPOA 1AKMA 1DXHA 2FZCA 2RGWA 2BE7A 4FYWA 2YFKA 1RAIA 3M4JA 6AT1A 4F04A 4AT1A 4BJHB 8ATCA 2I6UA 1ORTA 3MPUA 3KZCA 3R7DA 4JFRA 4JHXA 1I5OA 2EF0A 2W37A 1OTHA 3D6NB 4FYYA 1VLVA 2FZKA 2AIRA 1RAFA 4AM8A 4E2FA 1ML4A 4WTOA 3R7LA 4KGVA 2FG6C 2ATCA 2FG7C 2AT1A 1ZA1A 4A8HA 7AT1A 2QG9A 4KWTA 3L02A 1RAEA 3M5DA 1EP9A 2OTCA
chains in the Genus database with same CATH superfamily
4R01A 5TJ9A 1E6UA 3HI6A 3Q6NA 4RA6A 1E2PA 1RYBA 2R79A 3JALA 4HWGA 4XKJA 4EG1A 3C3YA 2CF5A 1EDOA 3SHWA 4FGUA 5IX8A 2IF0A 3O75A 3H11B 1PVDA 4Z8XA 1CUIA 3HV0A 3VBCA 5JNSA 4FCWA 5ALPA 4IMIB 2ZREA 4N7RA 4REQB 3JTEA 2JPDA 3KZOA 3FTQA 4XQ0A 4HFRA 1VBKA 2P0EA 5HQTA 3K5PA 2BEJA 1AE1A 5FYQA 4CKXA 1ILEA 2XZTA 4I9FA 4JR1A 2WIBA 3B6ZA 2PXCA 4H08A 1VFPA 4OAPA 4J75A 1MLDA 5IVHA 1P45A 2HDOA 3AP2A 2EG5A 1L5YA 5E4YA 2FTKE 1E66A 5F1PA 3RRBA 2EZ8A 2D0DA 3S2UA 2YQZA 4RQAA 1VYHA 2VAWA 4PYLA 3T1YB 1GR0A 1BWPA 2DRIA 2A8YA 2BTQB 2NNWB 2ZTUA 4KFUA 3ICEA 4DIKA 3IVXA 2CWWA 3MTIA 4J76A 4P4UA 3S8YA 1JN0A 4ZO9A 1H8ED 1P4RA 4N8DA 3CRZA 4EGFA 1TT7A 2GJ4A 2P9EA 1FMJA 1T9ZA 3QWBA 4RFSB 3AI7A 4I50B 4ZU6X 4EQZA 4Y2YA 1WPRA 5IAJA 1U0JA 3PBKA 3DE1X 3W5IA 2DETA 1W6UA 3D7RA 3Q0TA 1E89A 4J0JA 4ZOLA 4XRRA 4QFCA 3WI7A 4RTMA 5FPYA 1Q7GA 2YFQA 2XWJI 2AZTA 4F4CA 1C1XB 1NURA 4HNGA 4C4TA 2R48A 3E81A 4JASB 1G63A 3ONVA 3UB3A 8GPBA 3OJXA 4R3NA 4R9VA 5HZMA 4EI2A 4KLZA 1TEVA 3C6MA 1Y7HA 2CLKB 2OPBA 2W6ZA 3LV8A 2FX5A 2RAUA 3G2OA 1J5EB 3E7DA 2WKWA 2VJPA 3GJSA 1XRMA 4ZCSA 4DLPA 5LUAA 3HE3A 3MWEA 1RCUA 3HBAA 1EHYA 3U48A 4ALJA 2BMJA 1OD6A 3FGZA 4BNMA 4HPJB 4ESOA 3ZD6A 2CHGA 2GN2A 2QW0X 4QICA 4Z49A 1KOFA 4Z0NA 3COVA 1S2IA 4C7OA 5BUQA 4FN4A 1L5WA 3TXAA 3GC6A 3LX4A 4GR4A 3E4CA 4B73A 3BRWA 5FLKA 5C1OA 3D8HA 1V8PA 1EX9A 2GEBA 1VGQA 1M8PA 4BDSA 4BX8A 3VVBA 1JECA 2JA1A 4BVAA 1UBFA 2FQ1A 4QOGA 4CMCA 3JY6A 4R1SA 1JPVA 5IT5A 4AT1A 4GVXA 3NOVA 1FK8A 4L72A 1U5BA 4I7EA 3N59A 4BNZA 3JQCA 4RK1A 5K3AA 2EF0A 1JDSA 4QARA 3K15A 3GN2A 3KE9A 4YT8A 3BSFA 2BHSA 3ZWKA 5AK4A 3IH5A 4R0NA 5EOVA 5IZCC 1II8B 1FCJA 1D2AA 3FETA 2RK4A 2ZXUA 4ZZ2A 1Y7LA 5B3JC 2VP9A 3H17A 4UMFA 1AKQA 5D7BA 1D03A 3KHUA 1XCPA 3C5EA 3AM3A 1LK0A 2YHBA 5F33A 2XA2A 3RC9A 3RJTA 3GQBA 5BMOA 2AG8A 5BMVB 1G8HA 2DH6A 2VLIA 3K1ZA 4KIUA 4A3SA 4RMIA 1U0OC 3Q0IA 3B12A 1ZCJA 2C9OA 1JHUA 2CBXA 2I1VB 3Q3EA 2I71A 5KQSA 4GLFA 2IZZA 2BFNA 3WWEA 2G4LA 3T0GA 3FOBA 3N8HA 2JI6A 3FOCA 2C0CA 3CUYA 4CIDA 2OC4A 4QU8A 3DBRB 4DRXB 1VDZA 3WLRA 1U1GA 1KI1A 3HY3A 3UBMA 1CY6A 3VPFA 2UUCB 5BOSA 4UUMA 5KX5B 4OH7A 3FDFA 3DFKA 2QD2A 1SY7A 5CH8A 2B61A 2GT1A 4NE7A 2J0UB 2AI2A 2OQ2A 3BIWA 4NCJA 4CMEC 3G3EA 5J2UA 1YHYA 5JXGA 3WL3A 1F06A 3ABOB 1ELOA 4QU0A 3VFDA 5CXQA 1KC3A 4WZBE 1E7SA 3ONFA 1ZLYA 5T6MA 1SUSA 1YMUA 1RI5A 2WD9A 4MP8A 1PR3A 4C43A 4TS3A 5LQSA 3HJTA 4C7KA 1KA9H 1T8PA 1JYSA 3EEFA 4XR4A 4BO5A 3GT0A 3EGCA 1YJBA 1KMHA 2QZZA 4Y6PA 2H29A 2AS0A 3IDFA 1GTL1 1T0BA 3SDSA 1M2WA 3LP6A 1IN7A 4ZQHA 4RTRA 4ABTA 2VJBA 3Q7PA 2NYRA 8ADHA 1U3FA 4LOLA 1UJ6A 1N8TA 1R0SA 3NHBA 5HE8A 2FXVA 1CKEA 4KO8A 3EBOA 2Q6OA 2UYGA 3JQ8B 2Z58A 3L7OA 4W8OA 4ESEA 3NW9A 2A1UB 1YQGA 3FZEA 2WY2D 1LK5A 5K6AA 2J0EA 4PCUA 3I61A 1I8TA 1ZVVA 1FB5A 4JR0A 4MULA 4N6OA 4QEDA 3VC1A 1L8QA 3E48A 1LI7A 4YJ2F 2OCDA 3AHDA 2X3FA 4JMLA 1X1SA 3K35A 3NBXX 4CETA 3SQLA 1BH6A 3PR2B 5B2FA 1CV2A 4M7PA 3D8UA 4KV7A 2C5EA 1SUDA 2Z6VA 3ND8A 2CW5A 4OGKA 4RFLA 1KEUA 2HLPA 3UENA 1R0ZA 2FMUA 5AI6A 4D3XA 4CDRA 4UFPA 1N2SA 2QLMA 2GLXA 1BMFA 2GPJA 1L1RA 1J8QA 3GLQA 4CM5A 3AM1A 1C3LA 4ALKA 4X85A 4OVKA 5BR4A 2QE7A 4JUCA 5LQCA 1Y8RA 4I9HA 2WJYA 2RGGA 2AG5A 5P8WA 5AK6A 2VCEA 4QUJA 4BNKA 1R88A 4BNGA 1SWVA 1PR0A 5FAXA 4QFBA 4CPDA 2ZW9A 3DOCA 5KINB 1X0XA 3FMGA 4MUFA 4Z3DA 3UICA 1BE8A 1EGHA 3I52A 1EZ4A 4L2IA 4JMPA 1FXWF 1TUBA 1VL5A 2GKSA 4J3NA 3IURA 3ZGNA 4B3DA 3TUZC 3PEVA 1XAIA 3DR5A 4Q7QA 4Y1FA 4RETA 4O02B 1DRVA 2E9SA 1X1BA 2REOA 3KT0A 5GZ1A 4QOFA 2QPAA 5DH9A 3C43A 4IIXA 3FZGA 4H35A 1SK8A 4WASA 2GEKA 3H0KA 2CJWB 5TX7A 2VSOA 1CDZA 4G8BA 3SZRA 5LPNA 2PKEA 5ENDA 3BK7A 2Q1WA 3DLCA 3JWPA 4YAKA 7AT1A 1Y6GA 1DJOA 2Q7XA 4IICA 3HB4X 2VDWB 3OESA 3ZHRA 3C48A 3NEYA 1IBLB 4O3MA 2P9QA 1WZUA 3ICWA 5HJ7A 2GWRA 5TE9A 1D1QA 2A0KA 2VHYA 2RAPA 3QFHA 4QUDA 1WNTA 3UANA 2QGFA 2HSEA 4EQ6A 4JLJA 1FSPA 3V6LA 2PUWA 3AESA 1JQDA 5LZ2A 3OQMA 2JLVA 1RABA 2Y1FA 1Q83A 4PBTA 4UMVA 2R47A 1EFKA 3GCXA 3WO1A 2HMSA 3ZS9A 5K3EA 4C76A 3NNDA 3A6PC 3OIWA 3JVUA 1BO6A 1H66A 2H06A 1RZRA 4JEIA 3F2VA 4A23A 2YWBA 3JD0A 5HZGA 5CJPA 4OQMA 2X0NA 5DYGA 5I51A 1JTVA 3LVFO 4D8TA 1B23P 3FIUA 1KEKA 3KB6A 2DGDA 2DZDA 3EEQA 2JJ2A 3LC0A 1J8DA 1MUUA 1VSUA 4NMXB 3WK6A 1HKHA 3WBJA 1H2HA 4HLUA 1U4SA 1AKYA 2R1UA 1LA2A 3PUXA 4DHWA 3Q3HA 4PN7A 2YV3A 1U3VA 3FUWA 3ST7A 4B3FX 3P26A 5JS8A 2XCUA 4BMYA 4TT8A 2CXRA 5JFGA 3D43A 1A5BB 2AOTA 4NU5A 5IM4F 1FFXA 1XKLA 2QK4A 2H8GA 5BN5B 1J0XO 4B74A 4AKGA 3I6YA 4WZBB 5GPBA 3SDBA 3KKZA 5F7ZA 2AJTA 2Z9CA 5BT9A 4FMCF 3S2SA 1EZZA 3M9WA 4FMPA 4RNDB 4CIAA 4GSKA 1CYDA 2C0PA 3PL1A 1A27A 2LDBA 3WLEA 2B1QA 3K2QA 1JDNA 1H4TA 3QI2A 4NZYA 2EERA 4EJ6A 4F45A 1IPHA 4AJ2A 5D00A 2PFGA 2BEVA 4MWSA 3GA5A 2ATEA 2ZI5A 1YA6A 2CMHA 1WHSA 2HPVA 3DLTA 3LPAA 4RF5A 2GVNA 4R2LA 5F9FA 5EMKA 3WOHA 1ZMTA 4DNQA 2XBUA 3INTA 3DTYA 3W5AA 1GKLA 5CA1A 4L27A 4E4RA 3IUPA 2C5SA 3I9KA 2X86A 1Q50A 2PSSA 3B6JA 4GXTA 4JKYA 2F1RA 3RYIB 2FE1A 1PBNA 1UM9A 4NZNA 4E32A 2FDRA 1AOXA 3HWX1 1LSJA 2YWGA 1Z37A 3ENVA 3LCCA 3ZWOA 2BFCB 4K9LA 1IZ9A 1H1LB 1WWKA 2OXTA 1K63A 1WVMA 3MM4A 3OCYA 5JSQA 5IDQA 3FCYA 1ISHA 2A86A 4N1AA 3BXXA 4OGWA 2ONJA 3TTYA 1F60A 4ENRA 4K81B 1U2RA 3GFVA 1SC9A 2JVJA 1FP4B 2RC6A 1JBEA 3SFTA 5I4CA 5L3QB 1ZM2A 3DBIA 2AA3A 4H1UA 1DRKA 3E9CA 3O4RA 3ZS8A 4ZCRA 2PVCA 2JVIA 2PZLA 3OTWA 4PC7A 1ZGJA 1X2EA 1YZHA 3H1AA 1KAGA 1U28A 4X6LA 3WGZA 2VDKB 4E2XA 4ZGGA 1KPIA 5LXTA 4IIJB 3VU9A 2OB1A 4ARIA 4E2FA 1RHJA 3MTGA 4W5RA 3MNFA 4YQFA 4EY8A 1N9GA 4TKZA 1YNOA 1M1UA 2QLLA 1X1EA 2TMKA 1MB4A 2WWGA 3NTUA 3QTBA 4PYOA 5C8YA 1DLIA 1C8KA 4M9ZA 4MHSA 1KZ7B 3L18A 4HS9A 4TRMA 2DH5A 1H8EA 1TVKB 1HTWA 2PUTA 3CIFA 1FLAA 1S8NA 1SXHA 3HC7A 4KRXA 1UAGA 4OHWA 1WULS 3F1KA 1EK1A 3A04A 1CUUA 3I5AA 4P35A 3OZUA 4CG1A 4FDTA 3DDZX 2NACA 2XZPA 3WL8A 3JQEA 3A3PA 1O9HA 2H7CA 1YMQA 1I3KA 2P69A 1GT91 3BRSA 1Q11A 3P0IA 4FONA 4OXYA 5BVGA 4U8HA 4J3JA 1NRWA 4YJGB 5KWVA 1Y1KE 2JRLA 3OO1A 4IILA 5A0FA 2YHIA 4E4TA 3O2SB 4X7PA 4W6QA 2DBQA 1XA4A 5CXXA 3SK0A 3N7AA 4EABA 2QUJA 3WWOA 3I4FA 3TG2A 3TZHA 3D2AA 3L7AA 4U2BA 3PC8C 1PJZA 4JZYA 1V7ZA 1AGYA 3KPWA 4KE8A 2MOKA 3G1WA 2IYOA 4NPHA 2HA5A 3B1VA 5ALXA 5ITZA 5JNTA 3OZIA 2VDUE 2N75A 2C2MA 2WINI 4NCKA 4XFKA 3T3DA 5BSEA 3U16A 1WD7A 1E7YA 2D4AA 2IXDA 4PGAA 5JOQA 2FSVA 3K96A 3Q0EA 5IW8A 4WOPA 4G4GA 3RYCB 3K73O 1IWPB 1IHDA 3TW6A 1ZJ6A 1P3DA 1YL5A 1OMOA 3BJMA 1TK2A 2XCRB 1W6RA 2XLBA 1T9AA 1FXUA 1I32A 5CDGA 3ZUPA 3VDQA 4QM7A 2YW9A 1ORVA 1YIAA 2VF5X 1I2MA 2RKWA 3WWPA 1CC1S 1RKVA 3BBPA 3FPHA 3OFKA 4JUFA 1TE2A 3ZHSA 1FE8A 4S35A 2G0NA 3ILXA 4ZVMA 2GZ3A 4DIEA 5AJHA 1TUGA 2O5RA 1N7JA 3R7AA 1NVEA 1GLGA 3VZRA 3HI4A 1PWEA 2E55A 1H69A 5L40A 3RSOA 2QMYA 1OHHA 4Y1RB 1WCXA 1GPBA 3R0XA 4IQ8A 3WFZA 4X93A 4YREA 2C03A 1NI4B 2PZEA 3IAM6 5KHAA 4FI3C 13PKA 3NP7A 4P2GA 4OLBA 5FWAA 2JLRA 1Y6RA 4BNVA 4TYQA 2ZU0C 1FDRA 2B0CA 2OY0A 4HN9A 1UMBA 1XR3A 2FWNA 1L7BA 3JQAD 4PZCA 3Q9LA 3MWDB 4MR8B 4TYYA 3SJAA 1KYVA 2VXBA 2ZWMA 3HUFA 1WR8A 1UQUA 3HHEA 2G8NA 4GS5A 3SN6A 2RK3A 4KR2A 2EGGA 4RZUA 4N3NA 1QIFA 4RVOA 5EHNA 3QFCA 4GYKA 2C4NA 4HB3A 3W7VA 2QOEA 3U3KA 1EM6A 1N2ZA 3MRTA 4QPPA 5CEEA 2OOSA 1RRMA 4MMXB 4YCCA 1F20A 3OF2A 2WAXA 4UEOA 3RU7A 3GZNA 3IAXA 3SYLA 2CVQA 1H05A 1POXA 4TTJA 2XDWA 4FJ0A 2HO4A 3Q7EA 1N6IA 2C2YA 3N0WA 1LBHA 2H6EA 3F8WA 4H1TA 1E2BA 4KHZA 3AL3A 3VMFA 3JWJA 3IE1A 4AULA 3D3KA 3T3OA 5DHQA 2QIOA 2VATA 4MWGA 2FJUA 2ZULA 3JQFA 1N32B 2QTMA 3ICQB 3ZVMA 3D4PA 4X54A 5JCPA 4X7BA 1DEKA 2QM0A 3FHCB 1IM5A 2E5WA 2QSUA 4P7FA 5HUHA 1XE3A 1NJ8A 1QR2A 3HNPA 4FYPA 4MK4A 1WB9A 3TRKA 4LY6A 1LPSA 1Q7BA 4OQDA 5P21A 3NKFA 3RAEC 3HJHA 1N7HA 1NPYA 4QG3A 4F91B 3T9DA 4NENA 4QUHA 1HL3A 2H1SA 3NWEA 4DLXA 4YWJA 4FWIB 1MGOA 2OYRA 4AAYA 3H2YA 2XKBA 1ISFA 2XNKA 4MPPA 4W5TA 1QGYA 1WY7A 4KNYA 3FG9A 5HRAA 4YT2A 1CERA 1W36C 5A3SA 4BLQA 5KVVA 4M7WA 2IDZA 1UKZA 2O7VA 2WHQA 1D5WA 3PGXA 2ZUSA 5EJMA 5CA0A 1G7SA 4HEQA 4CIXA 2PD3A 3T06B 1A7AA 1O89A 3GF4A 2P6OA 4Q7LA 4QRIA 5K0LA 3CVVA 1TM7E 3FF1A 2WJPA 1B42A 1D7OA 2IYPA 1T9DA 1E3JA 1DTWB 2QP3A 2DKFA 1TFRA 1YB6A 1R5JA 4KXMA 3CLTC 4B47A 2NTVA 4FEAA 3FMOB 1VSQA 4WA7A 2G76A 3ZG6A 2B4TO 1XK6A 4ND7A 5K3DA 3DONA 4MCHA 3SBOA 3BFXA 2OMEA 4ZMBA 2PGXA 2J5BA 1TMGE 2TMDA 1EJBA 4ITUA 4WXYB 4ZU3A 1H8HD 2OECA 2CE2X 2IOHA 1S2OA 1NXTA 2P5SA 3VTFA 2WHXA 4C0QC 1CDEA 1PWHA 1CQIA 1GO2A 3KR0A 3RB8A 1DHTA 1VG0B 3S8EA 4JI1B 4YMIA 3UATA 3NHMA 4O2BA 4OJNA 3H1TA 1FYDA 4P83A 1MF7A 1XPOA 1AX9A 3IAUA 2P9GA 1ODFA 2HMTA 1WTAA 2JAXA 2V6GA 4J3FA 4DNXA 2AK2A 3AU8A 3L4BC 3P0JA 2ATIA 4UM9D 3U4CA 3UGKA 4BMZA 4RMNA 5A5FA 1CF9A 2WG1A 5ILGA 4ZI7A 4KTTE 3TZ6A 3DD5A 3V1LA 3R0QA 3HXQA 1ID1A 2VAXA 3THWB 4BJ5A 4H3HB 1PNQA 3RNLA 1VHJA 3WMFA 2YMLA 2GZDA 4M1QA 4E2YA 4IOKA 4DV2B 4D42A 3TTVA 1CUSA 4JC0A 4KWHA 4ESVA 4GLLA 2FQYA 3R3YA 2D8MA 2UYHA 3JW8A 1QCCA 4OOEA 5F64A 4GVPA 2RJOA 4N5MA 1K5PA 4BO0A 1R50A 4ZXPA 4D9BA 2F17A 2FP3A 4V0LA 1U7XA 1W59A 2QI9F 1FPQA 1A82A 2FOXA 4Z54A 4OLFA 1GNSA 3WISA 4M9XA 1SA0A 2B9VA 1TM4E 5BVHB 1QTQA 9MHTA 3F74A 3VMMA 2FWJA 1ZL0A 1E96A 1OFUA 4IG4A 1VPWA 1M9NA 1GNLA 4AECA 4HDOB 2PDAA 1O0CA 3USCS 4LXTA 5TARA 1E60A 1M2VB 1CNMA 4EPWA 3TSOA 1RRPA 1LZKA 1G20A 2PQMA 3DEZA 2AD5A 3L8CA 1OI3A 4HYEA 5B1HA 2JI7A 4MYSA 1OYYA 1FYEA 1ZM3A 2VZLA 4JYMA 3BJZA 1D4AA 1B7GO 3LKZA 2JLUA 1O4WA 4O0LA 2Y1LA 3OZCA 2FW1A 1QZUA 3GIWA 3L8DA 1LDGA 1ISRA 3CPJB 3KB8A 4PSKA 2ZIVB 2DFKB 5GGYA 3WDLA 1E4VA 1QIEA 1E9CA 4UC0A 2NU7B 3DCIA 4WKGA 4OK5A 3URMA 5DLEA 3UY4A 2AFIE 2G5CA 2VL7A 3O21A 4XOUA 5JCOA 1P5RA 5BUZA 5KYWA 4B3TB 2J46A 4D2IA 2FN4A 4EMBA 2ZRCA 1MVNA 4V1CB 2BKEA 3IAAA 3ETDA 1XCJA 3NYQA 2RGRA 1ODLA 1Y48E 2BFBA 3AJEA 3F6EX 3MUOA 1XKTA 3TLAA 3ER9A 2VRBA 4DMHA 3AZOA 3NOXA 1CEEA 5L4NA 1WRBA 4K9PA 1QK4A 3VYSB 3DXFA 1R0BA 1E2EA 3LC1O 4JBGA 4L3WA 4MKHA 4B2LA 4BTEA 2EWWA 1ZXLA 4KQMA 1REQA 3HJGA 1ILWA 4UARA 3WL4A 4YYZA 3K72B 1IY1A 1OLSB 1SU6A 1W34A 1YQQA 2C9YA 2FR0A 2WAYA 3CRVA 1KI3A 3KC2A 3ERCA 4IF6A 1DEHA 4CM1A 2Z6AA 4OFXA 1SUWA 5ETJA 4BVLA 3K9QO 4P3KA 4AX4A 1M7BA 3G7SA 2J48A 3UYKA 3S7TA 2IYUA 2PQ6A 4IVRA 1NQOA 3QXJA 1QZZA 3ZQUA 5FLEX 1E2IA 1P1FA 1V3QE 1VOTA 3HCEA 2VWHA 5A03A 3SU8A 4M1SA 3C5HA 1JDPA 3E5HA 4P32A 3OMXA 2YZGA 3BX1A 1YFJA 1DRWA 2RHTA 1QKJA 4HMOA 1Z6ZA 2C54A 3BZBA 4R1QA 1ZJWA 1I9CA 3RROA 1CB7A 4XJXA 4TTRA 2P90A 2VT7A 4HWTA 3V5NA 4CRWB 3V1NA 2ZGVA 4UHHA 4KO1S 4DUPA 1GFIA 1YRWA 4O1MA 5CDFE 5FWYA 3FCSB 1WCYA 5BSFA 3O8OB 4KIGA 4O2AF 4OI1A 1RC8A 4F9FA 3L82B 2P67A 4XE5A 5ALEA 3FOWA 2BELA 5B58C 5ES4B 2Q1SA 4XQEA 2WZBA 3OPMA 4FFMA 2FXIA 4MRNA 1JFRA 1BU5A 1GU7A 1J20A 4GBJA 1G60A 4LBZA 2IV3A 1P0MA 2OBMA 2VZ0A 3I2GA 3GK3A 2ZWAA 1H2ZA 3VJKA 1PZEA 1IN6A 2O6HA 4UFOA 4ZIRB 2M32A 2A0XA 2WU8A 5U4QA 1BVYF 3UG7A 3VOTA 5TLSA 1JS1X 4LF9B 4PCLA 4GUAA 2Z0MA 4MVWA 1NN3A 2HADA 4Y9UA 3NPMA 1P4SA 1Q3HA 1N33B 3A9CA 1FL9A 5G3YA 1HG0A 4RTNA 1CF4A 2FCRA 2WYUA 2YHAA 2YNMD 3TLYA 4BX0A 3EDQA 1NXSA 4C0KA 2XLCA 4EO7A 3WSVA 1JB1A 4TMYA 2XMDA 3WHIA 3T61A 2BEWB 2H0QA 2DMRA 3C3PA 3KUKA 3HCRA 1ACMA 1TDJA 3O9VA 3TSZA 4EHHA 1LBQA 1DLJA 2XADA 2AJ8A 3EUEA 3VU1A 3H5LA 3R9XB 2Y93A 2PX4A 4NHOA 3TQQA 5JEEA 1SG9A 3VZCA 2B83A 4RYDA 3UWDA 1PS9A 1XU7A 2EHDA 1PFKA 1P9RA 3BWYA 1Z07A 3K6JA 3NVDA 8ATCA 5I6DA 1NW5A 2VWQA 5AXDA 3GEMA 2R65A 5BUSA 2C29D 3M9LA 4GZ3A 1U4NA 4CUKA 4GE3A 4UNPA 5B37A 2PKRA 4XGIA 4TLBA 4CKEA 2O4UX 3C8DA 1HEYA 4MEBA 1GV1A 2ZIWB 3T5MA 2E0IA 5IS2A 3ZD9A 3R7LA 4OIFA 4MGEA 2VYQA 2P62A 5D8DA 3MGGA 3A2KA 1LCIA 4HAYA 3UT5B 1SUPA 2IOFA 4CWAA 2RH8A 3BL5A 1MB9A 1SKQA 5ED4A 1XVVA 2ID4A 1ORWA 5IJAA 4RKYA 2WMOB 2VWGA 2AN5A 3PHHA 3I4LA 4RGVA 9ATCA 1DUVG 4GSLA 4TL7A 2G5TA 2BHNA 2ASVA 4O5AA 1UKBA 3PE3A 4DLKA 3FWZA 5EE5B 2D5CA 4YCSA 3KIPA 2VP2A 1M1YB 3K9GA 4KPUB 3GROA 1QG6A 3UJHA 1V7CA 3OWXA 5HK9A 5K8IA 4JBXA 2R2GA 3UO8B 2QR2A 1FDOA 2R8PA 3CVJA 3F5MA 3NGXA 4JD5A 3LZCA 5BOVA 4KQKA 4F5ZA 5JR3A 2F55A 1Z36A 3DMTA 1CVRA 5EFZA 2Q3MA 1E62A 4X71A 5KYXB 8MHTA 2GYWA 4QNNA 3QLEA 4TMFA 5MN5A 3CVWA 5JC1A 1O95D 4PO3X 3H9UA 3EY4A 5FUVA 3EIUA 1HUQA 2WYOA 2JIOA 2WSYB 3JQAA 1GD1O 1KMNA 1EA5A 2PJRA 4L5CA 1SIWA 4LYGA 4A82A 3S2YA 2BEUA 3BE4A 1KSHA 2GJSA 5DNAA 3BILA 4JI5B 3VBEA 3GJTA 2VHWA 4PSUA 4G8JA 2MYNA 5DHUA 1ST2A 4RJTA 2WUWE 2M2IA 1T2CA 4AG3A 4DV4B 1TTHA 1YZTA 2XIQA 2GHQA 3JQPA 3T4UA 4WAUA 4XSVA 5FCDA 2BSQA 3R0JA 4X62B 1Y1QA 2EFEB 3L84A 5JSYA 3UK7A 3V4RA 4FP9A 1EFPB 1RYNA 1UP7A 2OBBA 4Q1BA 1RPAA 1H0HA 3D31A 2JAUA 4QXPA 1W8DA 821PA 3CX3A 4GC5A 2RIPA 5SYMA 4UJ3A 1DUIA 1RAGA 1NRXA 1XJCA 1PT6A 2VOEA 1NYRA 4FYKA 3N2GB 1J2EA 3BSYA 2V96A 1TEHA 1QFZA 2EZ9A 2BBWA 4HQKA 2Y9PB 2GJAA 1KH3A 1CRPA 1YAHA 4DGQA 2XPCA 2HHLA 3VZQA 3QW2A 4IJVA 3AVQA 1UJNA 4YO7A 4B0OA 2EEPA 1Z26A 2W71A 1YSCA 2G88A 4PGMA 3AF0A 4G5OA 4HAWA 4OATA 1UBMS 4OJQA 3P71T 1C9NA 5H3LA 1AKMA 2JZCA 3LQYA 4LNUB 3CZ4A 2DWQA 3CG0A 4WV3A 5AH0A 4CMAA 4MHTA 1YULA 1OFUX 4BZZA 1HFEL 2ENUA 1I4LD 4UATA 3RTDA 5HSGA 4YRRA 1CP2A 3Q7IA 2Q3BA 4L7VA 4KR7A 2WAMA 5LUBA 2ORED 5AVVA 4D82A 2BN4A 3THOA 5KX5F 1UDWA 2YJ5A 1WUKS 2FZLA 3HJRA 4MNTA 1AKVA 1XU9A 1OFGA 3I6IA 2ZYSA 4KBYA 4QREA 4ENQA 5F5NA 3WZLA 4WKOA 3MGBA 1B93A 2WE8A 2DJ5A 3H8SA 5AKZA 5JSUA 1FUIA 2ZAMA 1E8NA 3DGEC 4I4CA 3UMYA 3D8BA 2PQ2A 3IKVA 2Q1UA 3GCWA 4AU1A 3VR5A 4E7OA 3CPEA 2Q62A 3GNSA 5H0IA 3DFUA 2FWIA 4YP5A 1H8HA 1SCJA 1LRLA 3Q1KA 4XYBA 2X6TA 5G3ZA 2NAPA 2CUTA 1UPCA 4DY4A 5EHXA 2J3LA 2YICA 4P3YA 1Y37A 4K88A 2C3MA 4W82A 1L1EA 3F9RA 2NAFA 4JHLA 1P1CA 4L75A 3PUVA 4M89A 4MQ4A 5CJJA 5HG0A 1NVGA 4AURA 1II0A 4K9RA 5BV2P 5CDTA 4I55B 5KJ6A 3MILA 4ND1A 4LQLA 1W44A 2R11A 1M76A 1VZ3A 4CM4B 4UBKA 4Y2TA 1W36D 5BYBA 3KT8A 2UZ3A 4I5EA 3ZE8A 3ZQ6A 2GSWA 1IQUA 5LZ5A 4AP9A 4FYXA 5C8VA 3ICCA 1T8SA 3VPHA 3D02A 2EBUA 4CNBA 3Q2KA 2Q9BA 1CY2A 4L73A 5DK4A 1H1DA 4NJMB 1W0JD 2XAUA 5AJYA 3HKDA 2MT9A 4DR4B 1FYFA 2EYUA 4RZSA 4XWKA 3CLTD 1OV4A 1QOPB 4EA7A 1AZLA 2XH8A 3K0SA 1C9JA 4BQEA 2GDJA 4CR6A 3P4XA 3UWKA 5BSWA 3ELWA 2BOVA 4G5GA 1SVUA 2CVOA 4M87A 4GR9A 4B4KA 4Q4HB 1MQAA 1X7ZB 3H13A 4UCQA 3R5SA 1T0IA 2ISSD 5CGQB 2OHGA 2PXAA 1QG4A 2JIQA 3D7MA 3R76A 5I9BA 4MVXA 1N2BA 4L4YA 2YBEA 2FLWA 4BV9A 3V4FA 2WBLC 3D7SA 3A6LA 3P96A 4LJ5A 4Y9RA 5HILA 4Z9XA 3RW9A 3UHOA 4P84A 3CJTA 4MA4A 1R4NA 4WNYA 4LXXA 4R9UC 4F8JA 2ZVPX 1XMIA 2PBRA 3JQBA 3LLVA 3NJ4A 4YRFA 5ECWA 4AJEA 4CZ2A 1T4BA 4FWBA 1DAHA 1NYQA 1R0RE 1SUIA 4QAJA 1A69A 1ZHHA 3RWBA 5I45A 1IJEA 4C89A 4RSMA 4KOAA 1I2CA 2FPGB 3KCQA 1N6KA 4LK2A 4RVCA 4W8GA 3UCEA 3P45A 4XZ3A 3UMJA 3HDTA 4F4FA 3WKDA 1F8XA 4YRGA 3GUVA 4MQMA 2J3KA 1M34E 1GZ6A 5J63A 1UEXC 1XD2A 4C6TA 3FVVA 1S8FA 1SXQA 1VBFA 1NKVA 4FQ7A 1Q92A 5G02A 4BFUA 3EXG2 1F3OA 1T5BA 4KB5A 2ECKA 4IDQA 4A91A 5ICEA 3PUYA 2GFQA 3DYIA 3KR1A 1RBMA 3LXXA 5DBIA 5FTLA 3BGWA 3LCMA 2WZQA 4JBWA 1LPBB 4IZIA 2Y6UA 1BYIA 4G9EA 5HGJA 3OIDA 3QENA 4TLDA 5HKOA 4PC1A 3PNSA 3IFSA 2P8JA 1C7EA 4F9TA 1SBQA 1OT3A 2H9IA 1CX9B 3C7CB 1JR2A 2B4AA 4G4IA 3PQ3A 4KPGA 3RREA 2O8EA 2O2HA 3KEFA 4FFLA 2GF2A 1FJGB 4BMVA 2XAAA 3HP4A 1DIHA 3UM9A 3PP8A 1ZESA 1QIJA 3VPGA 3CZCA 5G4KB 4UTNA 2OESA 4CG2A 1P9OA 5A9SA 1A7KA 3W5VA 1TD9A 1G21A 2RFLA 2IEDA 2REQB 2ZBUA 2IE0A 2W6OA 3KD2A 3KS9A 4BVBA 5IPFA 3N8IA 3MJSA 4UUAA 2XOKD 1PEDA 3AUAA 4GP7A 5TS3A 4YC7A 2KE5A 4P0TA 5J3JA 4HQ6A 3ZDYB 3VR3D 4ZDJA 1NQTA 4EG8A 3FCUB 4PAQA 1M66A 5EIHA 1TEXA 3GT7A 4HOYA 4ARCA 4FNAA 5KZMB 4GWKA 2PSDA 4H15A 3NCTA 1CUFA 1C7FA 4DLZA 1TKCA 1JXOA 2QRJA 2QYSA 2VDPB 3GNQA 3LG2A 4WERA 5IARA 3VX4A 3KTDA 4URUR 4DG5A 4NR0A 3W5DA 2PUEA 3FDJA 5H82A 3N1UA 4DBZA 4WSOA 2P4UA 4OQEA 4BRWA 1VGVA 2JCVA 1JKMA 2O14A 3BH7A 1VL1A 3EZ7A 5FTJA 3TLXA 4YUXA 2IH4A 5FOQA 1CUWA 2XNSA 3R7WB 1IWOA 4BE4A 4S05A 1CJUC 1E32A 1AO3A 2Z1MA 4IV5A 4EQ6B 3R7NA 4LOAA 4TSKA 4OHYA 3L93A 4LFBB 5KCMA 2LW7A 3KJQA 2YNMA 1PNOA 4UHJA 1O94D 1B8PA 1NBMD 4XLTA 3SXUB 3LC7O 1NJGA 5THQA 4WFKA 3RS5A 1TMYA 4KQ2A 3I1IA 3PC6A 4YASA 3UMBA 4G0UA 2XYGA 2VAPA 2B30A 2G25A 5EJ8A 5LZ8A 3UA3A 4C7BA 4HNAB 1FLDA 5DT2A 3N58A 1UBTS 4MUXA 4V38A 3AFOA 5FUXA 3KVRA 1C7QA 2ONYA 3DA8A 4KXYA 4RTKA 4OXQA 1BH2A 1H22A 4YJ2A 4XRGA 1EUCB 4JI0B 4JXKA 4M83A 4B76A 4W5QA 1IZ7A 1BJTA 4GRAA 3ZGYA 3LVQE 1MDFA 5LDGA 4RHXA 4DC0A 3AMVA 3QNWA 4ITVA 3B20A 2HLHA 3MCAA 5EIOA 3P2OA 2G6TA 5DM2A 4OD0A 4FGKA 1VG1A 5F73A 1YR1A 3NIFB 4P8RA 2V6IA 4B80A 1TI7A 5CBPA 1TT5A 3SY8A 4JEMA 5ENZA 4DPLA 3PCXA 3UHAA 2P1RA 4C87A 2Z6UA 3EVEA 3TMAA 1T3SA 1DUSA 2XCLA 4S1TA 3NVKI 4F5DA 4OXRA 4F2DA 3TTWA 5C35A 2Q2NA 1EM8A 4K6CA 2BI4A 4KQ6A 4BEVA 3B5IA 1K7FB 3GCDA 1PSWA 4IEEA 1KETA 3DV0A 4HFMA 2XRYA 3GRUA 5ALFA 4BGDA 4TQUS 2H2FA 1FXWA 2GWHA 2ISCA 3CB4A 2I4NA 3DMHA 5A4IS 5I9NA 1AU9A 1X80B 3PGVA 4MR7B 1NUQA 4WDQA 1NAIA 1SOWA 4AXXA 5DVZA 2O8FB 4K9KA 2C82A 4L0MA 2DR0A 2ODEA 4PWYA 4X00A 2BP7A 3UJ7A 1ULHA 3MPOA 4L9WA 2OLJA 5E7MA 1X2BA 3AEUB 1GL9B 4JLSA 4RV5A 1R3DA 3OQ1A 4YCAA 3MEQA 2WYIA 3FVQA 4HKTA 1GNPA 2RHRA 3S44A 4EYSA 4HAVA 1X8JA 5IF9A 1JQEA 1O95A 3KT6A 3M6LA 2O2IA 3ZY3A 2CY0A 2QSYA 4NTZA 3TECE 2WR8A 4FYHA 5AVOA 3X1KA 1EU1A 3PC2A 2JEYA 3FB1A 2FWBA 4H7KA 5CK4A 3C45A 3FUTA 5F78A 1KEPA 1NU8A 4PC2A 1H6BA 3TRFA 1J07A 2GK4A 4Q4JA 5ARBA 4GEKA 4RVDA 2D7JA 2J6BA 1UJ2A 1ZVMA 2BFEA 4F4HA 4YDQA 1VQ1A 4EBFA 2JGIA 2NZUG 2DY1A 1DC5A 1Z6AA 3CF4A 4RVUA 4UDXX 5EGSA 1Q1BA 1GRVA 1GGJA 4HD8A 4NFLA 2HA7A 4MI9A 3MTAA 3LX5A 4XH9B 3WL7A 4BNLA 3OT1B 1P60A 2JFXA 3FRJA 2FWAA 3DG9A 2YV1A 3DPIA 3MJ4A 1CUDA 3DYVA 3ISJA 3PD0A 4JP3A 2CJYA 4RIFA 3SQDA 2H51A 3COPA 3EA4A 4JROA 4WNAA 5AI8A 3EZGA 5HF6A 4CG0A 4TTSA 3RV3A 4AZ0A 4Q19A 3DL7A 2UXBB 3I92A 4MIEA 1D6JA 1GGFA 4DCGA 1KZ6A 4A0SA 1UP4A 2G9VA 1JTFA 4I2NA 4YONB 2QS9A 1I33A 1ZJ5A 1KJNA 2FN8A 3L01A 4TVKA 4ANFA 4FKBA 3SBEA 3OU7A 3QLVA 1H2YA 4UAGA 2H4ZA 3V80A 4JY7A 4F85A 3VR4H 3QUSA 3I8XA 3IUQA 2J3MA 1A71A 4ROSA 5C5IA 1U7PA 1ZD5A 2WFLA 3VM6A 3GGSA 5FNVB 4ZHQB 3TQRA 3RYFB 3CMCO 1NXXA 3E70C 1ECFA 1RKUA 5ESRA 4BN0A 3E6AA 4C5CA 3HCBA 2QUZA 3HN2A 3WGQA 2OV1A 2PSFA 2BKXA 3LIIA 4TMZA 1K6IA 4ATNA 2H1HA 2HHCA 2ZT5A 1RBYA 5DM60 4RKEA 4DYVA 2PKCA 1PJCA 4MHOA 4QJ4A 2GBGA 3T1TA 2QL6A 3GFFA 4PZEA 4JQZA 1WPXA 1P2BA 2YVLA 3ZV6A 5D5PA 1Q12A 1YBVA 1ZUNA 2C2HA 3IJ5A 1IYZA 1GNTA 1Z15A 3D3EA 4X64B 3AVXA 5B55A 3LOUA 3W5HA 3CW2A 1YE3A 3GZTB 1QJCA 4M1ZA 4PSVA 5C7OO 1OZHA 3C41J 4FJ1A 4K87A 3QEOA 5JZMA 5KQGA 2FZVA 2BM0A 5AQ1A 1JDBC 2JGDB 1E4OA 3QQ5A 3EBPA 4QGAA 4QYIB 3ABRB 5JQWA 4G0NA 4L3OA 1QHYA 1XWFA 3AEQB 1E20A 4PU0A 1FOEB 1CQJB 4O8ZA 2C98A 4HDRA 1LFAA 3RFCA 2IYSA 1AXEA 4UZEA 3MD0A 4MR9A 2I80A 1E1YA 1HRDA 4ZRNA 5B6JA 1BXKA 2VF8A 4F11A 621PA 1L5MA 1KBZA 4FOLA 5L7TA 5KYVA 4I2VA 4Z9YA 4WUTA 1UPTA 1PX0A 1I0IA 4W9MC 1GZHB 2QJRA 3D4NA 3W77A 1K06A 5FUWA 2XDAA 2RCYA 5A04A 5ALKA 4JVOA 3DQZA 5AXBA 1G3QA 4V1CI 4D4JA 4C3OB 3E58A 5IRCD 1Z4MA 2OXIA 1T9CA 3GLGE 4E1AA 4DDUA 2J9RA 4PSAA 1Q22A 5H02A 4WT7A 3WMWA 2PUDA 3I6ZA 4CV3A 4B84A 5KYYB 4RULA 2H1OA 3DVSX 4DTIA 3H9CA 2NG1A 1DT5A 2QWXA 1Q6ZA 1KKMA 1E64A 3AVOA 4RSGA 3RRZA 5K8VA 1W0JA 3A6KA 3GRKA 5KYUB 2X7JA 3C5WP 3Q2OA 2BMFA 1G16A 3CEHA 3OOYA 4LVOA 2XUIA 3SJZA 5JFOA 2FDCA 5CH5A 1JXQA 2G67A 2PT7A 2YXLA 2WHRA 2ZTSA 3ONDA 1BHQ1 1MB0A 2QKYA 4YCLA 3IKJA 4A1OA 5FI0B 3TZLA 4PQYA 4XPIA 2ZUDA 3JARA 1TYCA 1B74A 4Z2YA 2RHWA 5SZIA 1G8SA 1W2HA 1QS0A 1UBHS 4F72A 4YXWD 1G59A 1ZH6A 3GA7A 2PH3A 2P0YA 1LBIA 1P3JA 4MIOA 4RPJA 3AQIA 4S1WA 3EQ2A 4LRQA 3QFRA 3JQ7B 4B35A 4MVJM 4K86A 1X14A 3ZXYA 4WNCA 5AUQA 1C3OB 4QD3A 3G59A 3ZDXB 4F1WA 4U00A 2P3SA 1C29B 1I4DD 3B60A 3LW8A 3I5XA 1QP0A 1OLUB 3H9JA 2CXSA 3A2NA 3GLHE 5TC4A 2XBLA 4DIBA 4GL2A 4BVFA 3ZOZA 4XGQA 4M8NE 1U0EA 4BO6A 1GYPA 2OC9A 1E2KA 1MPXA 5A9RA 2Q3DA 1PL8A 2OORC 1HYEA 2VXYA 4C2UA 1MO3A 2MU1A 2AYZA 3TDKA 5L53A 3GRVA 4E1BA 3FMPB 4QODA 3VHRA 3QXGA 1OIVA 1OXMA 3F97A 2BM1A 1O96A 7GPBA 2HIMA 1TW3A 1VJGA 3AR6A 5KOHA 3DLAA 3PFKA 3QKRA 3WLOA 5F3WB 3W90A 2Q3JA 2I91A 5HYVA 4EGSA 3ZCVA 3UJDA 5EJIA 3T95A 5BQ5A 1A4XA 1COZA 1SOAA 3OZEA 4PTZA 5FV4A 4M0MA 5IDXA 3K9NA 3PXXA 2PYDA 2XUJA 4UDNA 1R2QA 2AEFA 2OHHA 2IGTA 2C7QA 1IY8A 4FSHA 1W4LA 5LLSA 3T1VA 4RTLA 1TNDA 1WETA 2AFHE 1GL7A 4Z7NB 1EXDA 4HEHA 1Y1LA 2WWIA 4HYYA 3GJZA 3NJ8A 1V4VA 4RHYA 2FAXA 2P9CA 2PY6A 1W46A 5JZVA 2AJDA 1GGHA 3IA2A 1Z62A 1ISPA 1VI2A 4AI6A 1GCGA 1JALA 1HDEA 2POCA 2IPXA 3CKYA 4PGGA 2ADFA 3MWFA 1LY1A 1NL3A 2P4HX 3FJYA 3ZTTA 4ZK2A 1ZHFA 2JAOA 4J7AA 2QF7A 3TBFA 2XT0A 1FNMA 4R2WA 4KV9A 3QPDA 3C7KA 5E9AA 3RVKA 3VR3A 1S4MA 1JFFA 3DL4A 5BNWA 1M2OB 4AJ4A 1Z7BA 5ANRB 4B09A 1V8FA 1K0FA 2OAEA 4MYHA 3RRXA 4HDSA 3M3PA 4N0PA 4B0PA 5CD1A 1Z4JA 2PBLA 1Z4QA 4N9QA 4PFKA 2QRVA 4V0KA 2IYWA 3TWOA 4KYIB 6AT1A 3KELA 1LTQA 1K5HA 3OQIA 3C1UA 1HEUA 2Q46A 5H9WA 3MW8A 4GPAA 4BFLA 1PJQA 1WDLA 2JI4A 3BBLA 4LYHA 3SQMA 2LIPA 1EBBA 1W96A 1Q7EA 1G4HA 2AI1A 1EVEA 1Q84A 1GZ3A 1Z8DA 2Q9AA 5TS2A 3U7EB 4DY6A 1RC0A 3LCRA 4IJ6A 2DFTA 4HYTA 2VA9A 4ILKA 1JDJA 5BY2A 1RQ2A 1PK7A 4O4LB 1AF7A 1O94A 1CTQA 1NBMA 4DV3B 1WUTA 2J9FA 1KO4A 1P1RA 3HGTA 3G82C 1N1GA 4R1NA 5NLLA 3O8NA 2NU8B 3DE4X 1T5DX 1FFGA 1H0KA 2R3SA 4EAQA 1M73E 1YKFA 1OTYA 1WEKA 2OCLA 3A8TA 3B2NA 3D6HA 5TV2A 1ESNA 3T3EA 4EL0A 1NC1A 4LRUA 4I3GA 4L16A 2A7XA 3CZAA 4XFJA 4K9SA 5JY1A 1SQ0A 2P9HA 2DCMA 1ZKDA 2DQZA 2GUWA 1TYAE 1T1SA 1VJDA 2QZ4A 1JFLA 3M3HA 4IDOA 4TXMA 4XR9A 3IMGA 4V0RA 2XGSA 3DEHA 2O1XA 4TYMA 4I46A 4DYHA 4JVNA 1HDOA 5AICA 3O3CA 5IAGA 5JMPA 1XEWY 3OURA 1PFQA 3I6MA 3VR6H 4B6JA 2WJVA 1U2DC 1EYZA 4YDRA 4Z9BA 2QAGB 4QGGA 4IYRA 1S0UA 4WCFC 3A1DA 2XVYA 3FSGA 4K9MA 4MS4A 4OLJA 4BZWA 4O5OA 2P2LA 5DPMA 2TMYA 4BUCA 3C4QA 3T5AA 3PKJA 4UZSA 1UJBA 4X7RA 1Z29A 3U09A 4RSRA 1N8SA 3L04A 4N0QA 3VYRB 1KI9A 2EKZA 1LDYA 1H2RS 2ZUFA 2LP4Y 2H17A 3ZW9A 1XJ0A 3FI9A 3H18A 1GN8A 1P2FA 1VG9B 3IMFA 3KXDA 3PFWO 4QSMA 3SZGA 4CIWA 1ZD8A 3PEYA 4CEIA 2PX5A 2L82A 4CR7A 5AKGA 2HJRA 1WM1A 1PJ3A 3TR0A 3HS3A 4BASA 1H5QA 2GX6A 1XG5A 3LOQA 4KAFA 2QJOA 4GM0A 5TQ2B 1KY3A 3C6ZA 3R0ZA 4QVGA 1C30B 5FBLB 1D7AA 3U0BA 2JJYA 1M72A 1A9SA 1ONBA 3GHYA 3O6VA 4CKCA 1XNGA 1M5TA 1QWSA 1X6VA 1XTPA 3KAPA 3W5JA 3L1KA 3TGWA 4YA6A 2GETA 1Z5VA 2AWNA 1T1EA 2H0AA 2YQ5A 2H5LA 3UOWA 4BFWA 4BQOA 5K6RA 4ISBA 5DGTA 3EXFB 5AVZA 1RWOA 3S1SA 4NCIA 3HU1A 4NULA 4R41A 4Q4LA 1EFTA 1NV8A 2AF4C 3AJDA 4LDNA 3QLTA 4UE2A 1OT5A 1XV5A 5CFOA 1B4DA 4KREA 2ZBPA 1NG1A 3KPJA 5G4LA 3PV0A 3RVPA 1EGAA 5CVDA 3NIDB 1ZUIA 3I5YA 3L1IA 1X7XB 2ZWPA 2BFFA 1DVRA 1HXHA 3BXZA 4K0KB 3GLRA 3HA5A 1BFDA 1G6KA 2ZXFA 2AEJA 4LZJA 4TKMA 3F71A 3RAJA 3TBHA 3ZQKA 1A5TA 5KIAA 5MFZA 1NNEA 1NP6A 1P81A 1TOAA 3U40A 3A4LA 3RBVA 2H52A 4KR0A 4DB2A 4AG6A 1QONA 4QXOA 2DBZA 1WHTA 2FUNB 4JSTA 3UK1A 2YWRA 5HS4A 3KOWA 3A1SA 1DXHA 1T36B 3TDMA 4COKA 2PZMA 3D5TA 3EGIA 3OCXA 1YVPA 1JG3A 1HX7A 4D7AA 2ZRGA 4D9IA 3EXHA 2BI8A 3KZVA 3O4VA 2WF7A 3F7TA 5AYVA 1RU3A 4CKBA 1ORHA 1GOTA 2VNSA 4RBNA 3IOYA 2FSGA 1CD5A 1AHHA 1JFVA 5E2BA 1P6QA 1D9XA 1WU7A 1ZI8A 4GPZA 5FXMA 1NA5A 2BRUC 3NDPA 4IAOA 4XUDA 5HM6A 4RD0A 1D0VA 2H18A 1M6EX 4O4HB 2CMFA 2ZJ7A 4LTNA 1DQSA 2QL7A 1NY6A 3A58B 1PP4A 3EPJA 3HFJA 2QTLA 2R97A 4IZHA 5AJWA 3SF8B 4D9FA 2WU1A 2ZJ8A 3G9ZA 2A14A 4PPNA 1W9HA 3S27A 3RWOA 4RPIA 4N5HX 2WTMA 3PT5A 1EJ2A 4KFRA 4YFVA 4KVFA 1I3LA 4IHQA 2H7YA 1XYVA 2AQHA 3QLUC 4M46A 1WF6A 4QT0A 4AYXA 4DIUA 5H83A 1GCUA 4G6ZA 4KQWA 4M99A 3F73A 1ZAKA 2FMTA 3ELUA 1QRTA 3UWOA 1X7WA 5FPSA 5KEIA 1V5EA 3EOZA 1PS8A 2E3JA 1F17A 2ZRFA 3FKJA 3U4QB 2ZBVA 1WOYA 3A14A 4CM6A 1JDVA 1ZM9A 3HO6A 2D2VA 3LLUA 3NWJA 3PUJA 3UHFA 4HJRA 1YE8A 3WNZA 2GILA 1AKTA 2AV6A 2XD9A 3L06A 3QUAA 2OWDA 1DZIA 2DKOA 4Q34A 1P5FA 3PXAA 3RARA 3C0KA 4MWZA 4B3JA 1P3Y1 4K40A 4NS4A 2W2MA 1L7QA 2TS1A 4ZCQA 2PSHA 4HQFA 1DBIA 4FN5A 1F51E 2EZUA 2AJLI 3FNRA 3JYOA 1QP8A 1RMTA 4XYGA 3ZWBA 5U4XA 3T15A 1AS2A 2ODBA 2RI6A 3AM5A 4O2AA 4RORA 4MSUA 3G9TA 4GPBA 1E0SA 3H2ZA 4G81A 4ZQBA 1RQGA 3DDHA 2KI5A 4GOLD 3RK0A 3ZPXA 4NF2A 1KSFX 5F4BA 1XUOA 4CCSA 5BRAA 3G2NA 3NC1C 5KU1A 4HVTA 3G8CA 1E3WA 4KK4A 5FO0A 1JQAA 1GXSB 1MIOA 2ZBDA 3H4IA 4BB5A 4DWOA 1QH0A 2WZDA 1SXJC 3DVQX 4Z51A 2DB3A 2OBFA 3OJ0A 2H1CA 1KAHA 4L95C 3RTEA 1ZD9A 1JAXA 4HADA 1RXWA 1OXUA 1U7UA 3E8MA 1D4FA 2VJKA 3WGTA 1CIVA 2CWDA 3ADPA 2X2OA 3KUCA 3NG1A 1ZRMA 3E2PA 1R5NA 3MN1A 4MA5A 2H4HA 3SM3A 4AFNA 4YRPA 5FBKA 1S3FA 2IX9A 4AO6A 2FQXA 2NPOA 1BIFA 4L28A 4LZWA 1XX6A 4OB7A 4ZT2A 1ZH0A 4WLEA 1GUDA 1J0EA 1YZLA 2O06A 5K45A 3KJFA 4F92B 1ZZEA 1N6OA 4L5AA 3ZHXA 3OH8A 2DP4E 5K3FA 3FNBA 4F84A 2MMCA 2Z3VA 3CNEA 3ESDA 4HUJA 2G7MC 2PMWB 1N6PA 1XZDA 4BLTA 4N01A 1ZGGA 1IAVA 2P9YA 3ULKA 1PVOA 4REQA 1X7YA 1LJUA 3FFBA 1DADA 2H8KA 3LUCA 3QHQA 1DAMA 5SICE 3RS0A 4YIHA 4FUTA 4YAFA 4G0PA 4QHTA 3NVAA 1PF7E 3ETNA 1SZPA 1ORTA 4I55F 2B69A 2C9MA 3F3KA 3E9RA 2J45A 3L5KA 2ZYDA 5HGXA 3LHIA 2YC4C 4EHJA 4NKRA 3ZV3A 4JV5B 1ULUA 4P4GA 5D85A 3HYCA 4I4NA 4LY3A 5KNBH 4RTOA 3KALA 2XW6A 5A7FA 4S3MA 5L9AA 4V0NA 4XYEA 4H18A 8LDHA 3TIVA 4E12A 1KFEB 3KX2A 3U7HB 3M33A 4WI1A 2BTQA 4YGXB 4KBFA 1WA5A 3EYWA 3CH5A 2X22A 4EFLA 2WT8A 1FFDA 1IFXA 3FR8A 1IE3A 2Y0CA 4A5OA 4P86A 4RFSA 4DM7A 1JA0A 4RL6A 3PNOA 5A5DA 4YVFA 4NMHA 2HQRA 3VR4D 1ZIOA 1HFWA 3N87A 1KTIA 2IS1A 3SC2B 1B3RA 1NI5A 2TRSB 3QPUA 4J4HA 4UUQA 3AP1A 3ZDAA 3N6RA 2FUEA 4BGEA 2I7DA 1QLJA 3GFBA 4OREX 4HLCA 3AEYA 1Z83A 2VBFA 2XVMA 3PD7A 4XCVA 3F3YA 4YV1A 1C1XA 1JLLB 1BX0A 1HQYE 1YVDA 3CCCA 3PTZA 1BXRB 1Z0FA 2EX0A 3O3OB 3TO5A 3DHYA 3ZV4A 1UDCA 4D4IA 1HC7A 5AVRA 2X2PA 3LL7A 2O9JA 3UF0A 3LZ6A 3DTVB 2X9QA 1JG6A 3DAHA 3C4VA 4OHCA 1FJXA 1MAHA 1U1FA 2P30A 4FDMA 2CMKA 3D5EA 3MAAC 3FPJA 1DV2A 2NXNA 3IXLA 3QE9Y 1DCMA 1E77A 1FU7A 1NNI1 1K7YA 1U7OA 2PL1A 4ETIA 3PFFA 2P2ZA 4LYAA 3K92A 3DBLB 4DLWA 4KRYA 4RTJA 3FHLA 1BS9A 5E8JA 4BNHA 4BFZA 2G1AA 3D1VA 4RF3A 2YOHA 2X0EA 4LXGA 2WLSA 3MQFA 1JJBA 1U9IC 3WGGA 1DARA 2HRCA 4DQXA 1SO8A 5JWRA 5JTTA 4DR2B 3QRWA 5JAPA 2F3PA 2FB9A 2Q5OA 2WYVA 3KZXA 4Q3BA 2RGNC 2VIIA 1VA4A 2H5IA 2V58A 4LV6A 4TSFD 2W9XA 4V0ME 1GDTA 2FK7A 2FETA 5CHEA 5G1OA 1ZD2P 2J3DA 2NXWA 2NUPB 3HA7A 2F4NA 4IDAA 4J7CA 1PQWA 3BJIC 4L74A 2O7QA 4PZZA 3GEBA 3OT5A 4EVIA 1WW8A 3AEKB 1IVNA 3BS4A 5PNTA 2ET6A 5I7HA 1II8A 721PA 3IEVA 4R8KA 2ECFA 2H9YA 1GJRA 4IGAA 4EJ2A 2JFUA 2YBDA 3EHEA 2XGOA 1S9HA 5EZ5A 3DDNA 4TUYB 5J59A 4LQCA 4M22A 5CX1B 4B7XA 1KZHA 4IDHA 4QJ3A 3BHNA 4NV0A 3G7UA 1VCHA 5F7XA 4QHYA 3H2GA 1BE1A 4BCBA 2GTPA 1QYCA 3KV3O 4AL4A 2FP4B 4S1OA 5HS6A 4F8EA 3ZDRA 2NSYA 3LBAA 3HUTA 1E2JA 4OH1A 2O52A 1B15A 2P1DA 4KXQA 5B1SA 3ZTYA 5AVSA 1ZW1A 1RPNA 4GBMA 1T8TA 4D02A 2PV0A 2MSNA 3L7MA 3H5VA 1JV2B 4UBIA 3RNOA 1XAGA 4EUEA 2I1QA 3WG9A 1KDTA 3DBRA 3L7CA 4YRJA 4DRXA 4ZTZB 1RFLA 4W5NA 2H2DA 1PE0A 2FFAA 2HU7A 2J1LA 3A7DA 3O90A 1O8BA 2RGWA 5KX5A 5D3ZA 2GFHA 4QJBA 2JHCA 2C2WA 3VKWA 2J0UA 3BEOA 1Q7CA 2X14A 1HFKA 1SNYA 2P9ZA 3GEPA 3H2SA 3VH2A 4GMXA 1HLGA 4JFRA 5J47A 1AA9A 1RJFA 4WD3A 3TOXA 3EMDA 4OUKX 4RPKA 3FTFA 2JIRA 3NTLA 3QVKA 3AFIA 4FGZA 2G72A 3SSOA 1C0KA 2XUHA 1KPHA 4C9BA 1JJIA 3M9XA 4GUDA 1DBWA 3CS3A 2GJKA 2I4MA 4DG9A 4TLMB 5GV7A 4HDNB 4ZOBA 7REQA 3I23A 1P2VA 1OQAA 2BC9A 3DDUA 3DAFA 3EGVA 3RABA 2R0QC 3VKHA 4UPDA 4JI4B 4QWWA 1KWGA 4MRPA 2J67A 1L7VC 3WQHA 4A4DA 4FSXA 1MORA 3ETEA 4R69A 1CSEE 2VJNA 1UT8A 1RLIA 3JWIA 2A1UA 4AN1A 1C9MA 1OXVA 3DBHA 1W7AA 3R9WA 1WKVA 3LA6A 3UKOA 4IQ0A 2JGEA 4JCOA 1FS4A 5TEVA 4ITRC 4RO0A 4GICA 3TSCA 1WW3A 3GJ5A 4PY2A 4CFYA 2OYSA 2V7TA 2ZIAA 3NBFA 2DPGA 1OAKA 1R4MB 1N3LA 1ZSYA 2SCUB 2PFSA 3ZHTA 2GZHA 3T5BA 4ER3A 7ABPA 2YN4A 3ADCA 2EX4A 1KDZA 2WM9B 4PYRA 2DHDA 5B1IA 3M1LA 3V48A 5JS1A 2Q5FA 2PKXA 3HUDA 2BZGA 2OVBA 3SEFA 3HZOA 4AJPA 6Q21A 2OAGA 3BFPA 5I47A 1YRYE 4K6OA 5B53A 4IIVA 4NV3A 4Q03A 3RRNA 1KZ9A 1YI1A 2B78A 2UUPA 1HA3A 2J5QA 4HS4A 1EWYA 1UT6A 3SVZA 2VG8A 4B7AA 4EJSC 1KRXA 4KN8A 3G2QA 1VHDA 2IHYA 3AU9A 2EU8A 5DV9A 5AUOB 4G2NA 4RZHA 3I3SR 1NMYA 3K09C 1Q21A 5L51A 3UFXB 5LDHA 5FLXA 4ME6A 3CBQA 3GGGA 2B98A 3OTHA 5FI1B 1SVLA 3GBPA 3T1HB 2XRZA 1GGVA 3K0BA 1XF1A 5FHRA 1EVKA 2XUPA 3MQ2A 1LLUA 2P27A 3O9ZA 3DW1X 4AJ1A 4X8HA 3C6BA 3I9FA 4UOQA 4JLMA 5FUBA 2V3WA 4D4GA 2HEIA 2CJWA 3C98A 2A9RA 3CEPB 1J25A 3LYAA 4MW9A 2IZOA 1DEOA 1HORA 1NFQA 1O2DA 2P4SA 2YRWA 3CC8A 5AI5A 4G1FA 5F5LA 2ZM5A 1SRQA 3R5TA 2OB2A 4CGYA 1I6LA 4YR7A 2VDWA 3BRCA 3B48A 1N0WA 1XL1A 3ESCA 4JBHA 4NEGA 3SF0A 1GGNA 3KSZO 3U4DA 2C84A 1KWKA 2X1MA 2PR7A 3P9CA 3ODPA 2PT6A 4R31A 2ZQZA 1DWQA 3VVLA 1ECCA 3DE2X 4J90A 1CY1A 1M8FA 1GITA 1PAUA 3IA7A 3ZH2A 4LHEA 1T2NA 1T13A 3QI7A 4Y9DA 1ADYA 2CXUA 3VPXA 5ALYA 2GMWA 2ZRMA 1TZ2A 3VH1A 3WWDA 2F1HA 3GG2A 3LBNA 1M6YA 5B1YA 1XQ1A 2GM9A 3D8TA 3L0YA 4WLUA 5IG2A 1I7QB 5FHQA 3AJ9A 4DR6B 3USZA 4REOA 4PX3A 1MH9A 2H5EA 1Z8HA 1Z2DA 2CL5A 2IF2A 2PTGA 1P77A 3IMCA 3UB2A 3WLLA 3R7DA 2X0DA 2CUNA 4FILA 1FYVA 1OKKA 2A9JA 2BLNA 4N5IX 5SZJA 2R1TB 3DM5A 4FGLA 4TVOA 1BSVA 3RSZA 4OG2A 4AP5A 4AC9A 1ZYUA 3QHPA 4NNPA 4G9GA 2OENG 2C31A 3EA0A 3WY9A 5JU6A 3D6TB 1GTVA 3TKYA 1P9WA 4DGSA 1SXJE 1YDMA 2O8VA 4G26A 1ZITA 3W04A 1KL7A 4F6RB 5FA6A 1I2DA 3N2YA 4UKDA 3ZDCA 1NBAA 3KSMA 2P65A 4OAOA 1Q74A 2OAP1 4PGFA 4BO3A 1ACJA 2X8AA 1N0UA 4DNPA 1FLNA 1E63A 5DHTA 5BQ3A 3LK6A 3LQ1A 4ZHQF 3AKDA 1SM4A 5G40A 3E1KA 5JNRA 1P7VA 1YUBA 4M1WA 3ABSB 5A5EA 2KB0A 3I73A 2P5TB 1D2NA 2RI0A 2UUAB 4L0CA 1BMDA 4ZCTA 3PNLA 5JDIC 3OLVA 1GSHA 2ZE6A 4MJXA 2D13A 2NSDA 1XJWA 3L07A 3CE9A 1FNSA 3GJ7A 4XD2A 1LBTA 2FFJA 1R16A 3TPCA 1XIVA 3VSDA 3U1BA 4PSDA 1RQLA 3NH6A 3N5CA 3R40A 4ZEWA 4A73A 4ZMSA 1V1JA 3RFVA 2YVAA 1R0KA 1S3GA 2C1XA 4HSEA 4RPLA 3BJEA 3D6JA 4JLBA 5IUNC 4B7CA 1DC6A 5M7EA 3QFTA 2GASA 4TV8B 2VPPA 3RYIA 2XMZA 3GPDG 4D0NA 3IPAA 1X7HA 1T4CA 2AW3A 2PL5A 4TVSA 5FFFA 1ZHOA 2BFCA 3IDAA 3K4PA 1UXKA 3G88A 2D1QA 1OROA 4GVLA 5EUMA 1DX6A 2HSDA 1DOZA 4NG4A 4C4PA 5LMCA 1QTIA 3ND5A 2D6FA 2BTEA 4Q9NA 3CLVA 1FDIA 3X0DA 1FP4A 3FSEA 1WW2A 2PXHA 3KTAB 4GBGA 3EG9B 1N2CE 4BKMA 2WA1A 2FRDC 5EUBA 4YRZA 1Z4PX 5AW0A 2FEAA 1DZ3A 3A1VA 4JENA 1N4DA 1V45E 3RVQA 2I29A 5J9FA 3PEWA 2JJ8A 2ORVA 3GLUA 2XB6A 1U1DA 2Z2XA 4MXDA 4QU9A 4RM3A 4TXNA 3UTDA 1L3IA 521PA 3QEBZ 1ISIA 1XZFA 2CL0X 1VTKA 3O0TA 5KTYA 1ZWKA 2QAJA 3I04A 1XLWA 4A8JB 1JIJA 3ENNA 2JGAA 2GN1A 2W4MA 2W4IA 3IBGA 1TVKA 1HOTA 1Q44A 3BWDD 1NX6A 3UMMA 4QELA 2VFAA 3C39A 5I9SA 3ZCSA 2OCPA 5K8TA 1V6AA 3GUYA 5I9MA 1KMQA 3VR4A 4ZJYA 2XTJA 1AVTA 1WSBA 1DC3A 2CNNA 2C58A 4LVUA 1QIGA 2ZJ4A 1X8XA 4RD1A 4U3JB 4JNCA 2V7UA 2HX1A 2OFOA 4E14A 1TJYA 3IXQA 2IY8A 2R6GA 2VJCA 3HEAA 3KR9A 1HM5A 4Z5XA 1LBSA 1M8KA 4LF6B 4RD3A 1IQRA 1JQJC 1NF9A 3DEYX 3NC0C 3OPYB 3VO2A 4YUYA 2M98A 1ZP6A 1Y5RA 4WY8A 3WV5A 2YZ7A 1M5UA 4ZEVA 1DBSA 2I54A 4YMLA 4IJUA 1KZ4A 2YCLA 4P2BA 4MV9A 3MHPA 1L5HA 3UJ8A 3GB9A 4ZAYA 2C9CA 3RYCA 3LUKA 3STXA 1MO4A 2HF8A 1QTNA 3ZU4A 3QWIA 3L4KA 1DO8A 2WNHA 4JJIA 1P7PA 1VXOA 3CH7A 5K05A 5E8RA 1P61B 4NOLA 1XEAA 2AOWA 1LB1B 3FJOA 2HQSA 1RPZA 1F3LA 4ID3A 3R8CA 1NAHA 3EZYA 4U7FA 4YAEA 1EXVA 4HDKB 5T8KC 2XIJA 3WBBA 2A88A 3PVSA 4TSFA 2BGNA 1VE6A 5BQPA 3QPCA 3F90A 5ITVA 3IKTA 1QVZA 5GINE 2JIZD 2SHKA 3P2MA 4H31A 3UAWA 4RHFA 3DT6A 3QEMB 5FH9A 1SXJB 1SHUX 2CFRA 5C0OE 1OPRA 3X2EA 2IXGA 3E4DA 2PLFA 1X9IA 3PHIA 4JGGA 3RJZA 1MV8A 4IG9A 4AMUA 1O6CA 2WKRA 1QRDA 2ZSIA 4JL5A 4L4XA 3TR6A 3EOBI 1DFGA 1GQYA 2W0SA 4D0LB 1L2TA 2CXQA 3ORYA 2OP0A 5AKKA 2PRIA 3A70A 3RUDA 4C0WA 3K9LA 5BQXA 3JQ9C 3O4FA 4JXJA 4FYMA 1ZSVA 3MWDA 4MR8A 4CEHB 2GEUA 2VPQA 1DELA 4B85A 2C8JA 1U7DA 3LBHA 3NOQA 2XUFA 4UW9A 1DBPA 3PWKA 4CCYA 3TZBA 2WSIA 4LS3A 3S40A 5DTIA 2WF9A 3C8HA 1VE7A 5T3UA 3WNDA 4EG6A 1VYTA 4KAXA 2GHRA 3WRXC 3NDBB 2HAEA 4W63A 2ZTHA 4J2HA 3DBVO 4WX2B 1TJ5A 3NNNA 4BGIA 1LKZA 1O6ZA 5BR7A 1MJFA 4G97A 4IBOA 3AF2A 1I2ZA 5BRJA 2VTBA 5H1YA 1FSZA 5MFPA 4C04A 2EWMA 1UPAA 3L8YA 3NP9A 4Q05A 2CHVA 1CFJA 4OPMA 5DF1A 3P2EA 2L42A 5H3CA 1MX9A 4LX8A 3TRIA 2VBGA 2ZR9A 1Y5MA 3B2EA 2AK3A 4MW7A 1RVDA 1TEZA 3WB9A 4URZR 1SXPA 4MAFA 4DHEA 2GERA 2V9ZA 3QVSA 4IPTA 1NIPA 2SBTA 2R7AA 3P4UA 3L41A 3EAFA 4MB0A 4DQUA 4UNSA 4QSHA 1RXVA 5KNBD 3AF5A 2W42A 1SHZA 2SNIE 3OP4A 1N2CB 1M10A 1DS6A 1E5DA 3BRQA 3JV7A 4GM1A 1IHOA 5IDWA 1QE3A 4UXIA 1DO2A 3WRYA 3FDZB 1D07A 1XVUA 3PXUA 3GEIA 1KKLA 2H2GA 1AY0A 4AF8A 4BV2A 1A9XB 5AHXA 1FZTA 3WLJA 4G56A 3EJ6A 1T10A 2GCGA 3LYLA 1C7JA 4H6VA 4TKUB 5C53B 4I6JA 3RS3A 2IPMA 3D64A 4HB4A 3VHQA 2D3WA 3IDZA 4FT4A 3SAJA 1WJGA 1R10A 4L8WB 4WMLA 3HJNA 1CZRA 2Z8ZA 5EWJB 3SR0A 2P6RA 2P7IA 3LT5A 5DNDA 5EXXA 4XWAA 4YLEA 4YRTA 5KVQA 1IXYA 3BM5A 1OF1A 3DHWC 4FE7A 3BB3A 1GU0A 3ZYZA 2WTNA 1UUFA 2DKNA 2R8RA 1E1LA 1NMEA 4KSYA 1FTGA 1U2DA 2QMQA 1UC5B 1U3GA 5DNEA 2JEOA 5KJ1A 3RR2A 1DFIA 3EWNA 1J06A 1I24A 2GEFA 2VUTA 1BQ4A 3K05A 4RKFA 3HVUA 4B2PA 4BRUA 2FR8C 2Z1DA 1A5SB 1V26A 2B82A 3FBWA 3NR2A 1G5RA 3VYUB 4BO1A 1KYXA 3PHJA 4EB0A 4YAGA 5IM4A 5FWXB 1IMJA 2RARA 1UT5A 3JWGA 5D5QA 4DQVA 4K28A 1A9QA 2BTOA 1IXRC 5BT8A 1XMPA 1B1AA 2CJXA 4N54A 1LI4A 3RANA 4FX2A 2A3NA 4R2JA 3ZJYA 1OJLA 1EFVB 1W48A 3T7AA 2I34A 1V47A 2IYAA 3CY6A 1G8PA 1QX4A 2II6A 1FUYB 1LQ2A 1OI4A 3RYHA 4FFRA 4M37A 2CMDA 3ET4A 5EKTA 5JBIA 4UEKA 3ANYB 3MGAA 2I2CA 4Z0PA 4M0CA 2GD1O 4UVHA 4XIJA 4AMBA 3F78A 3DL0A 3IV9A 1U6IA 2AW5A 1X86B 2V6MA 4L0DA 4UQPA 1GAJA 4F9GA 1DG9A 1CE8A 3THWA 3P20A 5JDCC 4AMYA 4AZVA 3HV2A 4YMWA 4JQCA 2NXCA 1PV4A 2FDXA 3HXLA 4O4JB 3T3PB 4P3OA 5IEBA 4XI9A 1F2VA 4DTCA 2H92A 4DRYA 1K98A 2JFVA 4AQDA 1NP7A 2F90A 1E5VA 1FLVA 3AF4A 1QGDA 3FIJA 3OVMA 1QYDA 2ON6A 4IZOA 5E1MA 3TOCA 3UCFA 4CI9A 7MHTA 1M1NB 1QMPA 3CZ9A 4XLZA 2FRXA 4MYCA 3WIEA 4OBBA 5BVHA 2DUMA 1GUFA 2VP3A 2JFFA 1I3NA 1JU3A 3UAVA 4IR7A 4KLCA 5HIMA 2PWPA 4EW3A 3TLJA 1P91A 5C5EA 4TZTA 1DQZA 2FN3A 3DTTA 2GNPA 3LLCA 4RXUA 3DQPA 2C4HA 3BGOS 2QN2A 1M2VA 3H16A 2VPXA 4NMWA 3CN7A 5K4GA 1I0LA 3CUUA 4JYPA 3BTSA 4WLNA 4Q9KA 4JJEA 5HF9A 1GA4A 1EJ6A 3CMMA 3PSHA 5GZ3A 4CQJA 2W2VA 2X9LA 3GMIA 5KNLA 4FXPA 1I10A 4II7A 4LJKA 3FBTA 2X76A 2BGKA 1KMIY 2XUDA 3MWGA 4UPVA 4H7FA 5JADA 3ZBPA 2NU7A 2I4TA 3RG8A 3RFUA 2LWIA 3O03A 2HIHA 2VK8A 4OK3A 3VZPA 1XDDA 4J7UA 1QLHA 4V1CA 3UGTA 2B21A 1T9HA 3LTNC 1DQYA 2HH9A 3KOOA 4J1QA 2V54A 3OT4A 4KDRA 4MW2A 4O4HF 4ZO7A 5DRYA 1DJPA 2GEDA 2R96A 2OHFA 1D2HA 3KTOA 4MA0A 4MV0A 4OF4A 5TJHA 3UB4A 4X20B 2OO5A 5CEFA 3VTZA 1Z7YA 2O1EA 2WT9A 2XITA 3U81A 3LUBA 1Z45A 3S2GA 2HWKA 5JQGB 2CLCX 2R86A 3CIOA 3ORFA 1T3TA 3KLOA 3HZZA 1CFZA 1JR4A 1MX5A 1HDRA 1V16B 2HFJA 1P7YA 3LUHA 1OLSA 3S70A 3PENA 5CM2Z 4CDMA 1TRKA 1U7HA 2ORIA 4LZAA 2PZ8A 5E9QA 4L5JA 1NM5A 2J3EA 2AXEA 3M1YA 2NUTA 3I2HA 3D7KA 3QX3A 5AIBA 3CLUC 4OTZA 2V9PA 1F1JA 2J4CA 4PIPA 5GOZA 2B8NA 2F43B 3WMGA 4EYGA 5KYTA 1F4LA 5JT1A 2VH5R 1JJVA 1DDOA 4K05A 5BSHA 1FSSA 3TI7A 4BNIA 3IV6A 2F3SA 2M6LA 4ETWA 1PGPA 3B36A 3ZCUA 1WKCA 1T0HB 3HR7A 4ZV7A 3JWEA 1N3BA 3A6EA 1QHFA 3D6FA 3N0VA 4AJHA 1HNWB 5ALLA 4Y9SA 2FPMA 3OJLA 3QGMA 5D6OA 2DC1A 1L8OA 2LV8A 1ZCFA 2GZMA 4LE1A 2PMEA 2VKQA 3TQOA 1YZGA 1XVLA 3O8OA 4L4ZA 1YRHA 2IUFA 1N9ZA 2O2DA 2RCNA 1OXBB 2K2WA 2EXXA 2A5YB 4FCTA 4MI3A 1IJBA 1YQXA 3AT1A 2O2JA 3B85A 3WJ2A 2IHZA 4BKRA 5C9ZA 2PEYA 2PJUA 2C2GA 2QSZA 3ME5A 4B79A 4U6NA 5JV5A 2QRPA 1FDTA 2X9NA 2ZI6A 4OXNA 4KMRA 4RFVA 5K0NA 4LC9A 2QJTA 2DYKA 1AKEA 1P9LA 1H0SA 4B71A 4D9CA 4ZIRA 1LVHA 2H3EA 3LO5A 1XEXB 4B3RB 2HL6A 5IYZB 1LX7A 1OXXK 2HTFA 2VAMA 4FHEA 4F4IA 1AZTA 1QVWA 3E7FA 3ZEAA 4UTPA 4ZYUA 4HATA 3IESA 2FI1A 2ATVA 4NWIA 3NBYC 3H4MA 4QBIA 4X84A 3EQ9A 4NPCA 4NIMA 3WBKA 3HFSA 2WJAA 1Q14A 4A0RA 3C7AA 4OQXA 2VSFA 2IV2X 1R6BX 4GO1A 2PPLA 4HRYA 1GRRA 2BEWA 2G3YA 4H7JA 2GGSA 2J33A 2J0SA 3U60B 3L46A 2PMKA 4IDFA 4GQIA 2HCRA 2ZKLA 4AKIA 2JANA 4NU6A 3GGOA 2J87A 2R25B 4X1OA 3W4JA 4MUYA 4EHDA 1PBTA 4Y2VA 3R3VA 2VYVD 5CDYA 1UXGA 1NW8A 2HJHA 1C80A 3N0TA 1ZIDA 2JAHA 2QMEA 4PLFA 4L9RA 1R4ZA 4QLBA 1GQ2A 3C7TA 3ZZNA 4JK3A 3WB2A 3PPWA 4NARA 5FBVB 2XZLA 2QD1A 1DWOA 1WF3A 1C7ZA 2HRBA 3NASA 4RIEA 1YVUA 1CY7A 3LF1A 1OBOA 3MZ0A 3SC3A 4BOYA 1G3MA 5CT5A 2DTEA 5BYAA 3E3LA 1L0BA 2XKJE 4C0BA 3NEJA 1HLPA 1RZUA 5J43A 1KVSA 3A11A 4MRVA 3F8TA 1AS3A 3URKA 3WL5A 1BW9A 2X8WA 1YBFA 3UT5A 1NY5A 2ZWIA 1K8XB 3OZVA 4I8XA 2HF2A 1ZMOA 3AUSA 3U49A 3HR4A 4G8DA 3UMCA 5LL6P 1EGQA 4L85A 1N5LA 2B94A 3KOUA 4IHJB 2ZVDA 3IEPA 1GKIA 2XE4A 3O2NA 4G5YA 2AQ8A 3CLHA 5IBPA 3WOVA 4D3FA 4NYMQ 5C3MA 1GNQA 5KQRA 1E2GA 4KKXB 1QIMA 3FYUA 3GBVA 4Q93A 1M3SA 3BB4A 4IGFA 4WGFA 2JIZA 1NOJA 3K5WA 4U0KA 4QZVA 3OUTA 2ZS9A 1M1YA 1Z5NA 2RGBA 3DNPA 2FMHA 3MTDA 4CUZA 2AMYA 1E1QD 4XWOA 4G1UC 3GH1A 1P5ZB 3DNFA 3O8RA 1F8FA 4KQHA 2IKSA 4IDNA 1PNRA 1LLFA 2ZB4A 1Q1EA 5IBQA 1KAOA 2E89A 4YCBA 5KYXA 4FR2A 4E13A 2O0HA 1NBHA 5DGCA 4N5NA 4D6YA 4G0YA 4FZJA 2HQOA 4CTOA 1SHJA 2IHKA 3EC1A 1BGVA 3RIGA 3HU3A 4TM7A 4B48A 1ENYA 1KNXA 1BHSA 3LUJA 5T67A 1QNFA 4G09A 2GBLA 3E7WA 5KMGB 5FADA 2ZJBA 2BBSA 4MS1B 2VHZA 3ICOA 1YGPA 4UNIA 1PO7A 4O8CA 1O4VA 2IC5A 5CXSA 4ZO6A 2EYQA 3OE4A 2BJWA 5DZSA 4TQGA 4RDXA 3EFBA 2ONCA 4UD6A 4QDZA 5EESA 1MAUA 3I1JA 4QWMA 4YJDA 5GONB 1D6MA 1RAEA 4OM8A 5HKAA 2XE8A 4M21A 4UTOA 1EFPA 1XTKA 4TWZA 5EYPB 2W8ZA 3ZNQA 4DJDC 5B3KA 3HP7A 2QZPA 1KI7A 1RJWA 2IITA 3MF4A 3HY4A 1WZCA 3PSAA 4QYSA 5ISMA 1UMKA 1DKRA 4FMBB 4J0HA 5M34A 3N2GA 5TF4A 3TM5A 4DR1B 1AUOA 4O1IA 3SVLA 2ZKIA 1EK0A 2FWMX 1OPXA 5KNBA 5LD2C 5CNMA 4RVGA 3QOYA 4HGRA 1IIRA 1FVOA 1WDMA 2PBFA 4TUYF 4Y2QA 1R0WA 3BHIA 1CIPA 3IVAA 3MBIA 4AY6A 1WX1A 3DZHA 4EZBA 4DJ5X 1TCBA 4X6UA 1EP3B 3VOSA 3DGFC 3IO5A 4YAJA 1O0BA 3WXBA 2O19A 1HFJA 1JHVA 1YZ3A 1SVKA 3CVOA 3IS3A 4OMFG 3FYSA 1JEDA 2YZNA 2X77A 2ZAGA 1XQVA 4MQBA 5TQ0A 3GLIE 5AHWA 1WUIS 2I6SA 3EDRA 3RBXA 2PH5A 3M5CA 1KVTA 1R1DA 3W1VA 4XIYA 1F7UA 1X87A 1XRSB 2QP9X 1HDGO 2WWVD 3ZU6A 3LGXA 4K3UA 1A5AB 3KAJA 3Q40A 4PG7A 3AHHA 3L49A 4XX0B 1Y3IA 1ZN7A 3CB2A 2IUUA 3T9FA 3ABQB 4EGAA 1HE3A 1E3SA 3SS9X 1L5OA 2W2KB 4WLOA 3LECA 3WK8A 2QTCA 2WJGA 4C1BA 1IN1A 5CXUA 1BGXT 1XRLA 1DX9A 2VHVA 2VZ9A 3BMQB 5IANA 1W35A 1H42A 1BYUA 3BSWA 4EB6A 2HDWA 1RHQA 3CX4A 1J6UA 4K0RA 1T6BY 3LS2A 5I7FA 5FULA 1RQXA 3HUUA 3REQA 3H9GA 4DSZA 3FWHA 4Y2SA 1JWLA 1NTOA 4H60A 4AN4A 3CF6R 3VA7A 3TMYA 1ZNQO 2BFOA 2GBFA 3PQ7A 3U17A 4DIFA 1I6KA 3BXFA 3TPZA 4DIOA 4LMBA 1UMCB 2XYVA 5B36A 1NBWB 3E05A 2Y92A 3F6YA 4MDHA 3BA1A 5AJVB 5GMOA 4MQ6A 3FPKA 3RODA 1P6XA 3LBIA 1U0FA 2CXPA 5JXIA 1V39A 2J30A 4I55A 2OHOA 3GRYA 3HCCA 2PRSA 3QU4A 4JWTA 4CM4A 1BJKA 3AUUA 3FVRA 4IS2A 3MPUA 1GP2A 1ST3A 2QVBA 2ZJ3A 1E3IA 3ILVA 2MSCB 4A2CA 2A9PA 4C78A 2VEDA 3BB1A 1DKNA 1VKOA 4HI0E 1NVUQ 4QBFA 3U1TA 3FPLA 1SCDA 4EK9A 4CIYA 4NJMA 3TNJA 2PMBA 3TQHA 5JJKA 3AR5A 3HDGA 1GL3A 2GN9A 3U56A 4BB0A 1C1HA 3RVRA 1G6OA 3S68A 3ZI4A 4HGYA 3BDAA 3N8NA 4W5WA 3ZDEA 4L07A 3ZKAA 2OXFA 1V71A 3P97A 2X13A 2EVWX 4BBPA 3FFTA 3G68A 2JEZA 4E15A 1DU4A 2VF4X 3SWWA 3PHGA 1X7ZA 1JLMA 2PYIA 1A95A 1KS2A 3PUHA 3W4IA 4HVCA 5AUNB 4JB3A 5LU8A 4QOSA 3VNRA 2EJVA 2HA3A 3V8PA 1BD3A 2G9ZA 1GZDA 1B6RA 5FFMA 1EFLA 5DWQA 3MELA 1WXEA 5LOVB 3A3KA 2RKOA 3F46A 4RCZA 1WBJB 4DA7A 4EJFA 4KRGA 3WKCA 2B7LA 3M5PA 1TYBE 3K70B 1KI6B 2HV8A 2WIFA 4XTRA 5FNZA 1JZTA 3PICA 4DUGD 3S2IA 5KO2A 2QPLA 3I62A 4X94A 1G3IA 4F4UA 5IM5A 2ACVA 3CF4G 2DWUA 4LGYA 4CTMA 1UKAA 4NBNA 3EASA 1R6UA 3KLNA 3QWHA 1C50A 4DMFA 3T1NA 5JXWA 4J94A 3C15C 1DNPA 1JKXA 3EJWA 4ZI5A 2V7GA 4C07A 4KXWA 4NFHA 4KPFC 3THSA 1QGAA 2ZIUB 3FGPA 3JQ6A 4DCVA 1FX1A 1C4OA 3F5FA 3AUKA 3K9FC 1OH8A 3KXKA 3QUQA 4IIDA 4TV9B 4WKPA 4KSBA 4HXGA 4RAOA 4NU8X 2VLBA 1JFSA 1TUEA 2ID9A 2QSJA 3IUNA 3OA2A 4J2TA 5IKPA 2QLTA 4KQIA 1YCHA 4HB0A 1XWWA 4N0EA 3DOEA 1N5KA 3A4TA 4ZC1A 2X1VA 2OL4A 4Y2UA 4JT9A 4CFZA 4E21A 4RYLA 4B4VA 2P6MA 3VDMA 2QN1A 1RVV1 4NEHB 1Z6PA 3D3WB 4WDRA 1S2GA 5DBFA 1R9NA 4K8OA 2V9CA 3LHSA 4OHRA 4A5SA 4BNDB 3GLIB 2V4UA 2HU5A 3EIHA 3FMIA 5G4KA 2JAWA 5DASA 4NBSA 2DFDA 4OI2A 2COUA 4IUCS 3COJA 3HTXA 2YZ2A 4KW7A 2GN4A 2REQA 3R7FA 2F3UA 3LFHA 3OPYI 4JT2A 4RK0A 4GIBA 5DSZA 5H8WA 3DAOA 2ZUTA 1BZYA 1NVVR 1F7VA 2AN3A