2FG7C

N-succinyl-l-ornithine transcarbamylase from b. fragilis complexed with carbamoyl phosphate and n-succinyl-l-norvaline
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
Knots found
sequence length
320
structure length
320
Chain Sequence
b'SHMKKFTCVQDIGDLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRLSTQKAALNLGMNVIVLDINQGAWKLETERGVIMDGDKPEHLLEAIPVMGCYCDIIGVRSFARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTARPKVVMTWAPHPRPLPQAVPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYDQMKAFEGADFIYAKNWAAYLGDNYGQILSTDRNWTVGDRQMAVTNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative ornithine carbamoyltransferase
publication title Structure and catalytic mechanism of a novel N-succinyl-L-ornithine transcarbamylase in arginine biosynthesis of Bacteroides fragilis.
pubmed doi rcsb
source organism Bacteroides fragilis
molecule tags Transferase
total genus 118
structure length 320
sequence length 320
chains with identical sequence D, E, X, Y, Z
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.3.-:
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
C PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 2fg7C02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 2fg7C01
3GRFA 1R0BA 4FYWA 2FZGA 4A8HA 1XJWA 1R0CA 4F2GA 1I5OA 1A1SA 1ACMA 3M4JA 1NBEA 2EF0A 1ZA2A 3M4NA 4KH0A 1VLVA 1ZA1A 3L05A 3SDSA 1PG5A 4KH1A 1TUGA 1RABA 8ATCA 4KGZA 5G1OA 4JFRA 1AKMA 4F04A 1D09A 1EKXA 4H31A 3R7LA 3M5CA 3R7FA 3KZOA 4KGVA 2AIRA 2QG9A 4KGXA 4IV5A 1TU0A 1ORTA 1RAFA 1OTHA 4FYYA 2P2GA 1FVOA 2A0FA 4AMUA 4BJHB 3KZCA 3TPFA 8AT1A 3R7DA 4AT1A 1C9YA 4JQOA 4NF2A 2RGWA 3L06A 2FZCA 1RADA 2IPOA 2OTCA 5AT1A 1EZZA 5G1NA 2G7MC 3L02A 3D6NB 2BE9A 1RAGA 3CSUA 3GD5A 2FZKA 4OH7A 1FB5A 3E2PA 1RAHA 5ILQA 1TTHA 3TXXA 2H3EA 2FG6C 4EP1A 2QGFA 6AT1A 3M5DA 4ANFA 1JS1X 4FYXA 1RAIA 4AM8A 1PVVA 4KWTA 3NPMA 1F1BA 9ATCA 3MPUA 4WTOA 2BE7A 1RAEA 1SKUA 1DUVG 3KZKA 4FYVA 4A8TA 2YFKA 1EP9A 2W37A 4A8PA 1RACA 1DXHA 3KZMA 4EKNB 2HSEA 3D7SA 1RAAA 2AT1A 7AT1A 2ATCA 1AT1A 5G1PA 4E2FA 2FG7C 2I6UA 1ML4A 4JHXA 1Q95A 3KZNA 3LXMA 3UPDA 3AT1A 3L04A 3Q98A
chains in the Genus database with same CATH superfamily
2C2GA 3RTCA 5IBCA 1KU6A 1SULA 3RF6A 2W93A 4OA5A 3GARA 2GZSA 4I4TB 5KKCA 1WZNA 2BCGY 5K01A 3VHLB 1BJRE 3DEZA 5EXDA 5IKXA 3AJ9A 4ND1A 2OT3B 4E33A 4RA9B 4RTOA 1E8NA 3H9EO 3PICA 4K6MA 2P3QA 1EFRA 4ODIA 3R3SA 4KI0A 4O5OA 3HEBA 1UFKA 1V5GA 2WKRA 2BF4A 5KDOA 3BGIA 1M72A 2ZT7A 2PT9A 3AR2A 1C8LA 1MIOB 2N42A 1I4EB 3KOXA 1FUKA 4A6XA 4EUEA 1BRMA 2ECOA 3EZYA 1KIAA 4LYEA 1QVRA 5IBRA 221PA 3ZDCA 1GGKA 5HVNA 1XXLA 5CVVA 3BDAA 3KAJA 5THXA 4POAA 3EASA 4WBSA 1ECBA 1ZUNA 2G0TA 3LQQA 3DKRA 4KGVA 5J59A 3FLEA 3HZZA 4UNSA 4YJHB 1UPTA 3AUSA 1RT9A 2Q5HA 4K46A 4RA6B 3QELB 2CNWD 4UJ3A 3L8EA 4MQ6A 5FOXA 3OQNA 3ESCA 4GFDA 2Y93A 4AMZA 1Z5ZA 5K6AC 2HFKA 1N6PA 3FNQA 2RGNA 4DNQA 3L92A 4UVEA 1GZVA 2AKAB 2H6EA 5J4KA 4KVFA 1V95A 1YRAA 5ESXA 3RBVA 3TINA 1YB5A 4EJSA 5JCPA 1U0FA 1H9BA 2R2GA 3BIWA 4R3WA 4UBJA 4IX1A 1GPNA 3HADA 3M6UA 4DLPA 2XITA 3HK2A 2GAAA 2QMZA 1PJZA 1PTKA 3NOVA 3OOYA 3PXXA 4J1QA 4J03A 1NQXA 3GLFE 4OX9Y 4RMNA 4QTXA 3WGMA 2BP7B 5IWAB 1N2XA 5A4MS 4CVNA 1BC5A 5LQAA 4QVIA 1T9GS 3SHFA 2C1EA 2B0CA 3K2IA 4R0VA 4FHGA 3TD9A 3GJ6A 3STUA 3LKZA 4D42A 2YVUA 3D7MA 3UIEA 1E64A 1ZUWA 2VIIA 3P0HA 5E6UB 5FUMA 2OHVA 5KYWB 2CL5A 1NATA 3FTPA 1JJAA 4NU6A 4CM8B 1D1QA 4S2EA 2VDVE 4HH4A 3R24A 4G26A 2B6NA 4M4SA 2F8MA 4IR7A 3F9RA 3VTAA 2JCXA 3EISA 4HR7A 2C2ZA 4M1MA 5F5NA 4MPJA 4EG1A 2ECKA 5JYCA 3G7NA 4HG2A 4Z9FA 5GJWC 4IJMA 3UZUA 1IBLB 4BTEA 1V4VA 1W59A 2B9VA 4K03A 1GCUA 2VT6A 1T0IA 2Z4TA 5B7GA 5K3OA 2X3UA 1LPSA 2UXBB 1KTVA 5H81A 3WRWA 2FQWA 3RTEA 4POOA 1QAOA 3ABRB 4M1KA 1U7WA 2DECA 3IAHA 1O57A 3NNNA 4E31A 3H3XA 3CRZA 4KE6A 4YRLA 5BUQA 4XARA 5AIBA 2QW8A 2F2TA 4UM7A 2V3CC 3MGKA 4AJPA 1P9LA 2F3TA 1MRZA 4ZTUB 1OH5A 3T1YB 3AFIA 4C7MA 4RTNA 4MP6A 3W8NA 1XN4A 3K70C 5C51B 3ACCA 2YNMC 1ZD9A 4FINA 3NTOA 3BWDD 5DPMA 4PZAA 2J4FA 3BXOA 3UPDA 5HMMA 4DIEA 3OSZA 5AW7A 1KH2A 2CVOA 3D5QA 2A6PA 4J4BA 2WZQA 3PUYA 3CZ4A 4Z6KA 2Z2KA 4CXMA 3QUAA 2Q45A 4ZZ2A 5JMPA 3KKMA 4G9BA 4I9FA 4AWAA 4D5EA 1NLUA 3PKIA 3KHTA 4GRAA 2MMCA 1H8ED 1GG2A 1M34E 2G8LA 2A0YA 3D3EA 5HKKA 1ZS9A 4QU8A 4R6XA 4AUMA 1ZA1A 1JSZA 4FBGA 4B7UA 2CB9A 3GMIA 4KH1A 2C04A 4P3PA 3RVJA 3DDUA 1IHPA 1P19A 1XFAA 2FK8A 3EXHA 2XCLA 3ONNA 3WGKA 4CKBB 4EHAA 1K27A 1TA9A 4H0NA 2PNJA 1R5OA 4IVRA 4I3HA 5JXWA 1AKNA 2CKMA 3EFOB 1NNSA 1FBTA 3GNLA 1SKAA 4EUKA 2IS6A 4LRUA 3ASYA 5GM1A 1QZZA 5A9RA 1EVKA 2ORVA 1F5NA 5AM1A 2R68A 3GFBA 2FW0A 2HWUA 2AIRA 1L1QA 3IJ5A 4G56A 3V9AA 3BDIA 1L8OA 1FYWA 2APJA 2FPMA 4HX2A 1J8DA 1KAEA 2GPYA 3G5UA 4FMBB 1HEYA 3DEKA 4JLUA 4U2EA 1VMDA 1R74A 4UHFA 5F3WB 2HU8A 1D4AA 2A0FA 4AN4A 2G17A 2YMPA 2XQVA 4G2NA 1N6NA 3NP7A 1J39A 3REQB 3W8FA 4F8JA 5H70A 1RYHA 1ZOSA 2YBEA 1QK5A 1TD9A 4K9MA 4RC9A 1B3BA 5EJGA 2CK3D 3OQVA 3UV7A 2E5LB 4CMGA 3FMGA 3KBBA 1FJ2A 1U5BB 1XTZA 4H16A 4NZNA 1PZXA 2GVZC 1LZKA 3QWHA 4CFYA 5AW1A 1B4DA 1USVA 2AC7A 4NF2A 2KPOA 3DL2A 4B8YA 4BFTA 1STOA 3T1TA 3WAJA 4G4SO 3V4FA 2Z2ZA 3LO5A 3QW4B 4B46A 3PUJA 5FTKA 5ALSA 1E2MA 2QI9C 2GDJA 3BK1A 3Q1LA 1HNWB 4Z4CA 2JJMA 3H2BA 3I04M 2I6TA 3NR2A 3OF3A 4N54A 4O2LA 1CRLA 5TMDA 3OOWA 4QUEA 3RRJA 5JZ9A 4M83A 4MV6A 4YNBA 2J9FA 3HZRA 3NHSA 1CEQA 3ZDAA 5A9TA 1JPUA 2HAEA 3QW2A 1OYVA 3D2LA 4FGZA 4DMGA 3AEZA 1L7RA 2YVAA 3I9LA 5FYDA 4ZVTA 9LDTA 1J23A 4IHAA 4DA7A 5HF6A 3BK7A 1O94D 4B7CA 1NYRA 2REQA 2Z6QA 4TSFD 3EC2A 5K8CA 4R1TA 4PQEA 5IP5A 2FSHA 1UK8A 2QTWB 4J1TA 3IHTA 4WFJA 5C7OO 3MPUA 5F12A 4MQBA 3CV3A 4MJ7A 1XRPA 5AW8A 3BORA 2VDPB 4EYGA 4KB5A 4CQNA 3N74A 3CCCA 2B8WA 1SC4A 3COYA 4YJ2B 1KFKB 1VSTA 3PNQA 3QZUA 4M1QA 3DB1A 4QC2A 5EN4A 2YFKA 5IT4A 1DBWA 3KVRA 4CIDA 1P4AA 3R09A 4Y2VA 4JBYA 3ZZTA 4WBNB 4ZZ0A 5KCZA 2OE2A 4LXTA 4B6SA 4R2LA 3CH7A 2VPPA 4TS1A 3MWKA 4J0EA 2JLWA 1C2TA 2H9IA 2FPUA 2QMQA 3NWBA 5BR8B 4PFQA 3A1SA 3DAFA 3TLCA 4E3ZA 1UDCA 1U8YA 2PJZA 1EHIA 4JL8A 5L40A 5E9WA 3BMOA 3RUCA 2ZYTX 1DC6A 4JT2A 4BKQA 3H04A 5J5CA 2Y2VA 3KLPX 4F9EA 4RACA 2H17A 3HDTA 4XPIB 5J4HA 5LXTB 1GQYA 4QPDA 1X7HA 1G38A 4JSTA 4TMWA 2VNSA 3S40A 2IOQA 4JMLA 2YZKA 1IK4A 3PVZA 3ADPA 4DARA 1I3LA 4BX8A 2ETXA 4KWEA 1RZRD 1G41A 2VAMA 2QB5A 4LJ4A 4UBKA 5I48A 2EQ5A 2VUHB 3VOTA 3VVLA 4B76A 3IUPA 5DM4A 1B73A 3GLFA 1QK4A 1WP9A 4V1CA 2EATA 1KJWA 3GVCA 4DJAA 2SBTA 1ZPDA 1JT2A 2BHSA 1DP4A 1Q3KA 2E49A 1S3FA 1UK6A 1E1MA 2WHEA 3K3PA 5DN6A 3TL6A 1KVTA 4UUBA 2AD1A 2XQGA 4MGYR 1SVKA 3KVYA 1QRTA 2ZB4A 1JQAA 1FU8A 4FBMA 3TOCA 4KI7A 3UT6A 4AJOA 5E1BA 2BLLA 3B51X 3A10A 1ZJJA 4GOLD 1KYQA 2PAFA 4JLAA 3WGZA 4H7DA 4JI1B 1AUQA 4ARZB 4EHDA 4EVSA 3NVKI 3BXXA 1X7GA 3ESBA 2XGGA 2NPIA 2PH7A 4GXNA 4NHOA 3A1CA 4V38A 4WZBA 2QM0A 4E08A 3DAYA 3UJPA 1WB9A 3VGPA 1ZXBA 2AC4A 3W9SA 4MHSA 3AXTA 3L9WA 3JZDA 2OHIA 1RM3A 3CRRA 16PKA 1KL7A 1L4HA 1P2DA 1REQA 2F7SA 2OGSA 2QV7A 3ZW9A 5LDDC 1FTYA 1LUAA 1DFGA 1NSFA 2JB9A 3A4YA 3AIIA 3BMQA 3FZEA 4HNRA 4X8MA 5JY1A 3RIGA 5DGHA 2RCNA 1KI7A 3EXFB 3K1JA 4GT1A 5EINA 5DNAA 1L5SA 5HP4A 3C6YA 3EDOA 4MV7A 2CHEA 4RV4A 5IVPA 2X77A 3GLIA 3CEHA 1Y4ZA 2GD1O 4L7VA 4TLAA 3PGMA 3VU8A 2C7QA 2HR1A 4HDNB 4LE1A 4QICA 4COOA 2FSVA 1JQDA 2F3UA 4Q3AA 1P33A 5DEIA 3ICOA 3RAGA 4BYMA 2DH5A 3DUWA 3KELA 5LCXA 1KMIY 5CA1A 3A6FA 1D2HA 4XEHA 5HCUA 1V1MB 3T4PA 1USUA 5ILQA 1EH5A 1PWYE 4FONA 1X7YB 1HA3A 1UEXC 3PF8A 3EBLA 3OLXA 5KTYA 1OFGA 3N8IA 1XL1A 3JD0A 4HPXB 1XDSA 3WIOA 5JBQA 1J70A 3W79A 3VHRA 4BLTA 1KMNA 1YZYA 1E69A 1OXBB 3ZWOA 4DV4B 1O95C 1EQ2A 2X9LA 1QK3A 2JRLA 4CKZA 2PVSA 2JJ2D 4GWGA 2HUNA 1KQPA 4B35A 4URUR 3CXUA 1UBJS 3EA5A 4PYKA 5C1DA 1PZNA 1QOZA 4M7WA 2OC9A 3LM8A 3M1IA 5BSHA 2G28A 3HN7A 5CVJA 3IHLA 4YRMA 3FTFA 3LVQE 1MC8A 1O1YA 4YAJA 5BQOA 3MJHA 3RDPA 5EJ2A 1NNLA 1U4OA 1WQ4A 4EKNB 1KMMA 3P27A 1TVKA 4LK2A 1L5KA 3RC7A 5H7XA 4PLZA 3TNLA 4XM2A 4Y1GA 4KEAA 1E59A 4AUNA 3GPLA 4XASA 3D6FA 4CKCA 2V54A 1GIAA 1Z5PA 4BVKA 1JV2B 1TCUA 2B34A 1NW4A 1URPA 1EX9A 2LCFA 3R0ZA 4FI3F 4IILA 2YC4C 4WESA 3WYAA 4EWLA 2FW9A 2W71A 2AN9A 1GRRA 4QUGA 3B1WA 3U44B 3WOHA 3I9MA 4FC6A 2UDPA 2YRXA 1DFHA 1CETA 1TNDA 1BE0A 3LBAA 3OJOA 1UZUA 4KHZA 4ZI3A 2DKOA 2Q6TA 2CLHB 4TVKA 2EYUA 2PGLA 4LI0A 2QT1A 3SEAA 3D2CA 2GZ3A 2ZRAA 2WYWA 3G9XA 3RWMB 4DADA 5T67A 4BO6A 3R3ZA 3TDNA 1NJ1A 1T5OA 3C3AA 1Z18A 3DCNA 4KTTE 1N7GA 2WAYA 5AW5A 3TLXA 3WLNA 4TWRA 4OXQA 5JAUA 2CSUA 5IWCA 1NQOA 8ATCA 1JHOA 1PT5A 2EFDB 4ZT3A 4B6QA 1P7VA 5DX0A 2WTNA 1O6ZA 4FFBA 3RUPA 2NO7A 5JVDB 1NVVQ 5AXAA 4NCBA 4I5FA 2G8NA 3HGMA 2ZJ8A 3EQ9A 5FQNA 5BNFA 3IQHX 3DEYX 3DR5A 1O6FA 2QS9A 1KVQA 3HJHA 3GDFA 1JX6A 1YUBA 5KJ1A 2PK3A 2FSUA 4UTNA 1U8FO 5B3JC 1DKOA 2IF0A 1V41E 3AU9A 5BXYA 1DWQA 4OHFA 4D25A 1E5XA 4L16A 4ZODA 3I3SR 1EHCA 4TTIA 1T0BA 3MEQA 4J3NA 1ZMXA 3FX2A 5HJ2A 1CHDA 3ZE9A 4QPNA 2MWMA 1YB4A 3T0GA 4NYIR 1HG1A 1THZA 3H6KA 1UXGA 3UMBA 4F1KA 4IHQA 2VPYA 4DLUA 3SJBA 1E3WB 1A50B 1VZ2A 3U5TA 2XTZA 1IN5A 1GA6A 4UDYX 4YGYA 3IO5A 2EZTA 1T15A 4TL9A 5IDXA 4P38A 1EFAA 1AHNA 2IUYA 3FNIA 4Q0MA 4CMEA 2J87A 2JAQA 3I39X 3EUEA 3RVOA 4JELA 3GZNA 3KQMA 3LQ4A 4HRXA 4B4OA 4C1BA 2QTCA 4S1PA 2C8KA 2PFKA 4U8HA 1KZ6A 2CGEA 4KRXA 4G8DA 4JYPA 5EQFA 3EC7A 3CHYA 3MD0A 1DBVO 1Y8RB 3GLGB 2H1HA 4EUHA 1X1CA 4B3SB 3CEAA 1LLDA 4Z7NB 2BFEB 4OEHA 3GROA 4Y2SA 4YRDA 2YZNA 3Q2IA 6AT1A 1IOZA 5I3ZA 4IYRA 4E1AA 2BKLA 4Q3DA 4R98A 2EL7A 5J2UA 4C20A 1AIPA 1J00A 2HREA 1VBKA 2PGDA 3RBZA 3OFVA 1WCV1 2YY7A 3F7NA 3N2KB 4OTZA 1KO8A 4LFAB 5B6JA 2G09A 3CGGA 4X64B 3NHLA 3AM1A 2VDMB 1FTQA 4HGOA 3IC5A 5KNDA 3FYUA 3HVUA 2R1ZA 1ZH4A 3TGWA 3ZGNA 1ZQ1A 3GV0A 1QQBA 1SXJA 3ZHQA 1W0JD 1X14A 2VUIB 4IHJB 3C7CB 3KT8A 4IO1A 2WC1A 3LX6A 1QVVA 1U99A 4G85A 1M6VA 4PLGA 1VSUA 4DDMA 1D2AA 2QP3A 3BXHA 3LL7A 4XI9A 3VZDA 4NJOA 4K6CA 2QYSA 1CZHA 1Q7GA 4KLCA 4ON9A 3DNPA 3NBFA 4RVFA 1XMQB 4JBGA 3VR5D 1P8JA 4M36A 4REOA 1DQRA 2JFBA 1RQLA 1GNVA 2G4CA 4RGYA 2R8YA 2RGCA 4I55F 3L8GA 3SQOA 1U7ZA 2I4OA 2EZ4A 4NOJA 4IRUB 3V46A 1T8SA 2AK3A 4KOAA 2JIZA 3Q12A 2K4MA 4NFHA 3UGQA 4FFLA 3ZBPA 1UH5A 2KBFA 4CNQA 4DUZB 2XXJA 1F8FA 2IZ1A 1Z7WA 4FD2A 5ICSA 1PKXA 2VSXA 3T5DA 2CFCA 2IODA 4XWOA 3ZLUA 1VMEA 3PJGA 1W96A 2RHGB 4OVKA 3NPAA 2XNCA 2FFQA 4AU1A 3SIRA 4ZAWA 1BGWA 1KFBB 1Z0DA 3T41A 5EWJA 3NVDA 5TJ9A 4F2HA 2P1ZA 4YLEA 1FDVA 4RKWA 2K2QB 5FWXA 5A6SB 2X5JO 1MLDA 2HHLA 4YVFA 3S2FA 3E5HA 4N7RA 2HWKA 4TZ6A 4YAFA 3FFAA 1SBYA 3MUFA 5MN6A 2DUWA 3GEEA 2ACKA 3LSYA 2QRMA 1YL6A 2GYUA 1HE5A 1XKQA 3GH1A 5HF8A 1PGNA 4BAUA 4BNNA 3K0HA 3BHNA 3SN6A 4DDTA 5KU1A 5DM70 4R9UC 4ZXFA 2NQ2C 3TCNA 4PHFA 2C5LA 3VJKA 1KYIA 3WNCA 3BIXA 1TU4A 3NEPX 1SHJA 2I7DA 3A4TA 4C4AA 1DZ3A 3TGPA 1AX9A 1ORTA 2ZREA 3EF1A 4KV9A 4PN7A 5KYKA 3PFCA 4FC7A 1DKPA 2DF8A 1EGMB 1YUMA 1I10A 1K97A 1YH3A 4O4JA 4U7GA 1NSTA 2V4MA 3EOBI 1YR6A 3NT5A 3EZFA 3TQOA 1DC4A 3ESZA 1NYLA 1F17A 3UAYA 3FM9A 3WMFA 1LRKA 3PDIA 2GN4A 2QROA 4CM1A 1DAGA 1A04A 1OLSB 1YQTA 4ARVA 1A9YA 1NC3A 1TW2A 1YZHA 2QN8A 3WYNA 4RGVA 2P6RA 4OOEA 1UBUS 2CF6A 3I42A 3WVNA 3Q0IA 4LC9A 2AEFA 3EMKA 3QY0A 1QHHB 2FN9A 3FE2A 3OZCA 4U7TB 2X86A 2DUNA 4KK4A 2YS6A 2HA0A 1Y8CA 3K5IA 3N2YA 4GSYA 4HQ0A 5CW1A 3VNAA 1XU9A 2GGSA 4BMPB 1H2HA 4XTCS 1L2TA 2ORIA 4KQJA 3ZDRA 2XNDA 4CM3A 3T06B 5AXDA 2G4LA 4NU0A 2RI1A 1DX9A 3G8CA 2JGMA 3WBJA 1JDBC 2AE1A 2PV7A 1VJTA 3OZWA 3WIBA 1U8TA 2AEEA 4JCOA 2WJIA 3JATA 3VBEA 1ZDMA 3GFTA 2AN5A 1RTKA 1X94A 4UMDA 3VR0A 1XTPA 4GO1A 2E37A 1SIOA 3FPBA 4WCFA 5D1HA 2ZSKA 1K63A 5A5FA 4UPDA 3EPHA 2N0SA 1H2ZA 2AYYA 1FSZA 4P9NA 1E6UA 2IGTA 4ZRNA 5TGDA 1HOXA 4H6WA 4UW9A 1XTRA 1OPXA 2QTBA 4OQPA 5H16A 1XD8A 4C21A 4QGBA 4C0JA 4FGJA 4MMYB 3RU2A 1V7CA 3TM5A 2IZ0A 5L3SB 1BWSA 1T1SA 1CJMA 5DWQA 2NP6A 1OASA 2JCGA 4HGNA 1AZTA 4TLLB 4E5VA 3QPVA 2JBWA 4DYVA 2I6SA 3DDHA 3T7EA 4KQ9A 4F5DA 2GCNA 2CT8A 3P94A 1SCNE 2VK1A 2ZATA 3OWOA 4NCAA 4MYDA 3H4MA 3BFXA 3N3BC 1YQWA 1ESNA 1K5HA 2N75A 3ZNNA 2XAUA 2C2XA 2RGEA 3N70A 1DKRA 2QRPA 1IJKA 1PP4A 1XMVA 2JD0A 3FRIA 1PO7A 3GRFA 4G24A 4Y8VA 5HGJA 1EK2A 5TY0A 5A5EA 4GOND 1KJIA 1AMNA 1R8JA 3T15A 1XCOA 3C4QA 1I3OA 1TKAA 2Z04A 1MAWA 3IYLW 1Z06A 5D86A 1LRLA 1T8UA 3DC2A 4UM9D 5ELLA 2VUTA 1OU0A 3N8KA 4K6HA 5C2JB 2QVXX 2X5OA 3W5CA 2ID8A 3F3MA 2I3ZA 2EGUA 1FFBA 4M37A 3FNBA 3AEQB 2XBUA 8LDHA 4E70A 1ISIA 3UQZA 4TV9F 1J8QA 3NDPA 1X74A 1FVHA 4F86A 1WF6A 4CQLA 5BQFA 5DK4A 2PRIA 2HLPA 4DLVA 1E60A 4FIZA 4ID3A 1EGQA 4X41A 5JS6A 3LJKA 3NBKA 1R0ZA 1I2BA 2KYRA 5LJLA 3R5KA 3SSMA 4EUSA 5A0VA 4FZ3A 2X2FA 1EAMA 1R0KA 2OO3A 1E94E 2VJQA 1T6XA 2GHIA 3C6BA 1U0OC 4Q24A 1TQDA 5DBIA 2XBLA 4R2KA 3ZCQA 4LJAA 4PQYA 1LBIA 4X6XA 1OXVA 4BNDA 4IIHA 3L0OA 4BE9A 2V55B 4K9KA 4ALJA 1UJNA 1OAOC 4KHPB 4NFLA 5JNWA 5TMPA 3PNOA 1M1NB 3L6EA 1OTHA 2FR1A 4FS8A 4PYOA 4RKEA 2ENUA 4WK0B 1G20B 4CZ2A 4QFDA 3EXIA 2I3AA 2WMOB 3SICE 3BEDA 3I64A 2QPLA 3KTAA 3SX0A 2QRVA 5EIHA 1QGZA 4D0NA 2QTLA 4FB5A 4AW9A 1TZBA 2XZDA 3ZY6A 1S1CA 4IIYA 4R6WA 2V59A 5KVQA 2AC2A 1KVUA 3F6BX 3LP6A 3OMXA 5DYGA 4MI1A 4HBGA 2C00A 3FZYA 3HHPA 2FZCA 4TWJA 1PLLA 1G1MA 1TJPB 2V96A 3D6TB 3WIVA 3WWPA 4ZI7B 3RFUA 2GR9A 2GJ8A 3G2IA 1ZR2A 1ZH2A 3DEIA 2JG3A 1B6GA 2PWPA 1LJUA 3RE1A 1Y6JA 3M6LA 2QN9A 4W5NA 4UD2A 5D2CA 2V9CA 3JVIA 5A4DA 1IOVA 4IG4A 1LDYA 3IPRA 5HUJA 2GRUA 3KJZA 1KIFA 4LF9B 4XLZA 2RONA 3MTJA 3M9LA 3E27A 1AA9A 5IAOA 2N46A 1R7RA 1K5PA 1CUFA 2I03A 4CHTA 4RKFA 2WQ6A 2A35A 1HT3A 1N6RA 2OILA 2V58A 3D7KA 3FWNA 5ENDA 4JL6A 2GZRA 1GL3A 1VTKA 3H65A 5FV7A 2FX3A 3HI6A 3W34A 3PWTA 3ET5A 1DBIA 4DJJA 4J91A 1QJ4A 3IHWA 4QA9A 1Y6GA 2YJ4A 4NCIA 2OD7A 1ORVA 2K7ZA 5H02A 1O8BA 1W4ZA 2HCTA 2WT8A 3BGSA 4QT0A 3ZHUA 3L1KA 3E4DA 3GGJA 4R5HA 3QWBA 1PNVA 3T7DA 4L75A 2YWBA 2P9TA 2QM7A 1HFEL 2X2OA 1X7WB 1SRQA 5CURA 4B85A 4HNUA 2W2KB 3AF4A 1XHFA 3OZSA 1PE0A 2EG9A 4Y9DA 5JRDS 3MTBA 2P9QA 4O4HA 3ZVRA 4CEIA 4B7AA 5EG5A 5B30A 4Z0TA 1WPXA 1TMOA 3U48A 1W2HA 3NIFB 2O3QA 4I36A 4S35A 2TMDA 1OIWA 3FZGA 4BMDA 2QQGA 4EF5A 2XKKA 3VH4A 2IDKA 2PUEA 4KYTA 2GB4A 4BL5A 3PIRA 4FXPA 2VBFA 3A3PA 3OI7A 1VM6A 2E4VA 1Z6GA 2YWCA 3CLUC 4BV9A 4R41A 4KDCA 1P1BA 4PC2A 4IOJA 1SXPA 2XRFA 1DO8A 2EF0A 2ZUWA 5BNTA 4BZXA 4MAMA 4CR8A 4MWEA 5CGZA 4RABA 3RODA 2WUGA 4IIVA 1GPDG 3ZV5A 1KMHB 1TM5E 2GJSA 4DNOA 5AVOA 2M1XA 1M2NA 2DRIA 5BNZA 2HHAA 1I9GA 2JW5A 2WW8A 4R0NA 3WFJA 1CS0A 2ASVA 1QCDA 3EXG2 2BGTA 2KWIA 3E8SA 3PUXA 3K6RA 1IJEA 2FWIA 4QYXA 5FI5A 5IK2D 2WUWE 1LSOA 1E32A 1V39A 1VJ5A 4FDMA 3I2HA 3STWA 1L4BA 2B1RA 1NI5A 1WVIA 3DDZX 4TMFA 3FIUA 1NJSA 3IVGA 2OV8A 1UDXA 1BDHA 1UKAA 3BRQA 2AQKA 1OYWA 2X2EA 1KDYA 4S05A 2XT6A 1ZVQA 3EHEA 1GZ6A 3D4BA 3GQBB 1PIWA 2O0MA 4N5LA 1G0NA 4D4GA 1ZHOA 3QX3A 2BOVA 4LG1A 1BZYA 2OYSA 3UCEA 3KOOA 5A04A 1JNXX 1Y81A 1ZRMA 3L0CA 1OGYA 2GK6A 5AM5A 2VXBA 4O4IF 3BRCA 2J3HA 3B6EA 3PTZA 3GBVA 3LYUA 2ZU6A 4JQOA 4CQMD 3TCKA 4FE3A 3JWEA 2H7YA 3FUUA 3OTWA 1SBZA 3L7NA 3MJDA 4IDCA 3RWOA 4C3ZA 2HUPA 3G8YA 1IFXA 3CXRA 1I13A 3OEWA 4ZGWA 3P0JA 4DKJA 5YASA 5KI6A 1RXVA 4FMCF 4AJEA 3HO1A 3Q85A 3TO5A 1GL6A 1HYEA 1XC7A 2OL4A 5AP9A 2V6MA 1Q84A 4IQ0A 2QXTA 2ZJ7A 1EK0A 4BNIA 1RWKA 2B94A 2ZBUA 5J1SB 2IHNA 4C0BA 2CVQA 4I3GA 4TZKA 5CJJA 4F5ZA 2PUDA 4TT3A 2JI4A 4OIMA 3G1TA 2BM1A 1JHXA 3WL4A 4CLOA 5FBKA 4GGMX 4AKHA 1NNI1 1XKXA 1BH6A 3DMRA 4HY3A 4YXWA 5L8VA 5HUHA 2JLUA 3IOYA 2YYAA 4JVMA 1N0UA 3ND9A 3M1YA 1U0EA 3NPMA 3LY5A 3KPUA 1HORA 5EHNA 4LNAA 5F2EA 3C6ZA 1DMSA 1NW7A 1T25A 4UZEA 1KEWA 3ZK7A 1KP2A 4G0YA 4RTPA 2O1WA 3T0FA 4LOAA 5BRNA 1DIRA 1ECJA 1H2AS 4BV3A 5I7FA 1G3MA 4BBZA 2BGJA 5T4BA 2YX1A 3IAXA 3IL2A 2A92A 4RCZA 4FKZA 3T61A 3GGOA 3MILA 5E0OA 4TVBA 2ROQA 2PSSA 4X8LA 3I37X 4R9VA 3NIBA 3UK6A 1ZCAA 1ZUHA 4V39A 5IJ0A 1L3BA 3W5HA 1L5QA 3O5AA 5I4KA 3DFMA 2PUAA 3ZJUA 2OV2A 1VKHA 4YQYA 2CHUA 4HWOA 2IDZA 2WMNB 4JHXA 5EMMA 4OMDA 1M2OB 3W6NA 3JQCA 4PQRA 1UT6A 5CCEA 3OH8A 1CNMA 1HE2A 4KRGA 3H97A 4OQXA 3KG2A 2EC5A 3CE9A 3K8YA 1L6IA 1P2SA 5ISMA 2C4UA 3DF7A 4CMJA 3V5NA 3T4UA 3QSYA 3K6KA 4D9IA 1Q20A 1WPQA 3UWOA 4EQ6A 10MHA 1EEXB 2DT5A 1GKYA 2QN2A 1NA5A 4KMSA 2ZBDA 1XEAA 4X20A 1A9ZA 3TVYA 4RJIA 2UZ0A 3Q3GE 3BM5A 4NMHA 4GL2A 1UKBA 1T5TA 3TW8A 3KZ1E 4NYJQ 3I1FA 4GRDA 2CBZA 3GWZA 3FOEC 3AKZA 1N2HA 4N7MA 4B2LA 1YZGA 3ZC3A 3K1AA 3I30X 4EH1A 2P9EA 4I7EA 2FPPA 3ID6C 3ZI0A 3BMNA 1RJ9A 1V7ZA 2C84A 1GU1A 3H2ZA 1OF1A 3PLRA 2C4MA 2ZI6A 3ZGXA 4D8UA 5KU7A 4EHIA 1P17A 3I2KA 4GZ3A 1V45E 1A9QA 3CNLA 3P9NA 4GEGA 4BPRA 2F4NA 2NSJA 4OL9A 3WNVA 3LOPA 3K0KA 2MJLA 4WKGA 1IEWA 5HIIA 4EG4A 5KOHB 1QKKA 4Y6PA 4LF7B 1UEJA 4M46A 3ZD7A 4KXFB 3JQ6A 2NTJA 3AERA 1QE5A 1PJSA 1MCZA 4X6UA 4UPEA 4B7XA 4KKXB 1KI4A 2YIJA 3BHJA 3P97A 4N0QA 4Y2UA 1UBNA 3EAFA 4FOOA 4ER5A 5J23A 1EESA 4LBZA 3AXSA 1GD1O 4TM8A 5HOEA 2VS1A 1QZXA 3LWNA 3C87A 3KT6A 4BUJA 3PHJA 4Y1FA 2JGIA 3AEUB 3NRJA 2XCQA 4BZPA 3HRIA 4DUYB 4OG2A 3NNSA 1UMDA 4GQBA 1OYOA 1DX4A 4HAOA 5DCLA 3DMYA 3G89A 1X3LA 4YRTA 2O0HA 4UCWA 5F51A 1IRXA 2IXEA 5J40A 3QJGA 4K0RA 4ZANA 5JSFA 4QBKA 2GEUA 2OAEA 3G3EA 2E85A 4IWNA 5BMVF 3AI3A 4RYDA 4YJFA 4HZIA 4X62B 3I01A 1W5TA 2ZCUA 3GPBA 5BN1A 4AY3A 1GYRA 4I3FA 3BRWD 3LCMA 4GOOD 4WMLA 2ZP1A 3FMIA 1KDZA 1UDBA 3RSFA 1I3NA 4KO1S 1TTPB 2DERA 1MJGA 4BX0A 5HX7A 3UXMA 1L9XA 2COUA 3GLHE 5C5EA 2IHYA 2Y3IA 2JKZA 4OHOA 4X6LA 2O8CB 4Q7KA 3IURA 1T1RA 5CDSA 4CNBA 3U4IA 3QVVA 4QOGA 5BO5A 3HKBA 3KZXA 2WDZA 1RC1A 2PT7A 1QYIA 3RM3A 1CY1A 1QCCA 2QD3A 4IH9A 2RFLA 3AF1A 5DYYA 3DT8A 5AFSA 4GMHA 4Z0NA 1TC1A 4CN8A 1PFKA 1GSAA 2OCPA 4TTAA 5ITSA 2IP2A 2VQDA 2O20A 3TQTA 1VLZA 3BGVA 3LLSA 3MIIA 5DHAA 4BGIA 3JQAB 1GEEA 1SCUA 4MDFA 2FOLA 2IEBA 3O8LA 3DYIA 4ZTZB 3LKVA 1GADO 3A1VA 2IEZA 2Z2XA 4PX3A 1T0PA 2PMWB 3OSUA 1HTTA 4DMFA 3L04A 5IANA 1T36A 4CMKA 1N3YA 1VL2A 3PNYA 1KOGA 2XCOA 3G79A 1BOFA 4OU5A 5LVAA 1X80B 2Z9DA 3DYVA 1OXMA 2H1FA 4GHWA 1SY7A 5I9BA 4YN3A 4C7VA 2IEAA 3SXUB 1WCWA 3DFUA 3ETNA 4NQZA 5L7YA 2JIDA 2VF7A 2CHVA 2G7ZA 2OXTA 3ZHBA 3OE7D 4BFYA 4OLFA 1ZA2A 2D0OB 1JE1A 2UYYA 1WDLA 2WM8A 2IS4A 4OB6A 1QH1B 4KPUA 4BWVA 1SUBA 2ZJAA 1UT8A 5A2QA 2VQFB 4TRRA 1NW8A 3QLUC 4FFOA 3E5NA 3ZDZB 1U94A 1JI0A 1FMLA 1P1JA 4LEIA 3FWYA 2BTEA 1H6AA 5E38A 3MS4A 2W6NA 1JTEA 2JI9A 3FCUB 3HCEA 4TRJA 3MTGA 4IOLA 1GFIA 5GVRA 1JUDA 1SUFA 2NX2A 1H2WA 2VPXA 3A58B 3K53A 2ECFA 1QFYA 4OBEA 1EE9A 1J8YF 4TYQA 5BV7A 2QZ9A 1MEJA 4PXYA 1MB9A 1K5GA 3G0OA 2BZGA 1JLMA 2I65A 4A6PA 4BB5A 4E03A 2W2OA 5LKRA 2OKCA 3AR5A 1ZIYA 1J22A 3L7LA 4H0CA 1WXFA 4C7JA 4NXMB 2IC5A 2CYBA 3DKPA 3AIKA 1A5AB 2O0LA 1GCOA 1N75A 4YJGB 5IYZF 1QQ6A 2ECPA 2P2DA 4WKBA 4JB2A 3EX7C 2I6QA 4RM3A 3ZIUA 4OM8A 4I55B 5AM2A 1W8IA 2DUMA 2WWTA 3TQFA 1I6KA 1U11A 4CPDA 4AJHA 2GTIA 4EMUA 1G8MA 1O77A 3O7WA 3IXQA 4UXHA 2X13A 2M1ZA 2DXIA 3NHFA 1XF9A 4KR6A 2FF5A 2OCDA 3K72B 1ZLYA 1KH1A 1WUTA 3AP2A 5BWNA 3W4KA 2ZM5A 3KALA 3S5JA 2G40A 2HN9A 4LRWA 1RZ3A 3UMFA 3WYCA 1DKMA 2CB0A 4N03A 4X7PA 1V3UA 1U7DA 4OB8A 3BJRA 3L7CA 4HK4A 4BMNA 1B8PA 4TX1A 1E6MA 1PSDA 4UVHA 4F6RB 1XA3A 2VOEA 3P9QA 2LP4Y 2JGKA 1I33A 4HTFA 3FTQA 4V24A 1G21A 2FW7A 1V5WA 2E18A 3NRBA 2R7MA 2QE7A 3QU9A 2XGOA 4NCXA 4C1NA 1FFSA 1X70A 5JHHB 4W7IA 1AHHA 4EHKA 1QYCA 2MINB 3MRVA 4ES6A 3ZJYA 5JWRA 4ZVSA 1JS1X 2PZAA 2NU6B 4D26A 4MA0A 3EAQA 3A28A 3K8OE 3FNHA 5D5HA 2PCJA 3L8DA 1NUPA 3IJEB 4G0WA 1J33A 1THGA 2BGKA 3L40A 2YQ4A 4TMVA 3WRVA 1E7QA 1JAXA 3BGOS 2ZPUA 1CRZA 1FFGA 2Q9AA 3IQIX 5CW2A 4DLXA 4ECEA 5J2TF 4WXEA 2A0KA 1KK0A 3RASA 4LMRA 3SF8A 1NBWB 3JQGB 1CIVA 1IZ7A 1U3FA 4ZA2A 3KLNA 2W6QA 2LZ0A 4ZJYA 2RB4A 1KORA 1TB4A 3OLYA 2ZI3A 3GB9A 2XDWA 4Z9AA 4LC1A 4OGGA 2PBRA 5CPBA 1XJQA 3D6UA 4JLNA 4EZBA 5CBPB 2WG2A 1NBME 1W1UA 2G3YA 4NBSA 2QTRA 1XTBA 4M21A 5EZ6B 4E2FA 2W0SA 1I4TD 4ZVVA 2RIRA 2I4TA 3DV0B 5GGXA 2A9VA 1Q14A 4BQFA 4AG6A 3L0PA 2WP8J 2XE7A 4EVIA 4AY6A 2FP4B 4US2R 1EJ0A 2Q4RA 4IDDA 7MDHA 1I4LD 3SQMA 2G0AA 3HU3A 1C3VA 2XVXA 4QXAA 4Z3KA 2IXGA 5BWMA 1I1NA 2VNIA 2Z8YM 3B1YA 3EFEA 4FGUA 2R6CA 4M99A 3CZ9A 2O2ZA 3TTYA 4F7DA 3LVRE 3WV4A 4LQCA 4CJXA 5JRJA 1J8VA 1B42A 3UT5B 1GDHA 1NQAO 3DTVA 3ER6A 3QKSB 4BRWA 2CXUA 2HU5A 3GFRA 4XUGB 4M0DA 4LV5B 1H8HA 4IIGA 3KZVA 4BRZA 1CZRA 2R6FA 1SC6A 3DEHA 3Q3EA 2G76A 4L07A 3ZNQA 4BVLA 1AK1A 1PS0A 2HXYA 4GI2A 3FDZA 3K7EA 4IKOA 1GL9B 1VLMA 4QJ5A 4Z4IA 4WEQA 3FPCA 1NVEA 4DDKA 2UUCB 5CT6A 2CVFA 2EL9A 3NUGA 4L4ZA 1G7CA 2OAGA 2O8FB 2E9SA 4KWIA 1YQ9A 2HXSA 1ST3A 2VK2A 4FJ0A 2ET6A 3HVJA 1FZTA 1CJUC 1XQYA 1XD2A 4G97A 3TR0A 2DHDA 1NMQA 1G55A 2Y1XA 1T4GA 3QFTA 4KPYA 1E99A 2WU1A 4JJ6A 4LX0A 1EHYA 3I2JA 3U1VA 1GZUA 1E98A 1RKVA 1TYEB 3GLHA 2G07A 2OCLA 4V2UA 5EJAA 4NU5A 1EK6A 2VJNA 2H16A 4Q1FA 3QWIA 4HI0E 2NZJA 4ZREA 2E3JA 5J63A 2BFPA 2WD8A 1WCIB 2BISA 2CFIA 3A4IA 4PCAA 4WXYB 1HDIA 4AT1A 5DTIA 1Y98A 1P61B 2AL7A 2PCLA 2P9JA 3QLJA 5IUKC 2W5UA 2ZE5A 4ZI5A 2CDAA 1LU9A 2OOKA 1ZSNA 2C78A 2VG8A 3HBMA 2H63A 1JTFA 3TTSA 3UB4A 3H3JA 1P1HA 5E7JA 3ZYZA 4BY9E 5EMKA 4HYQA 3QF4A 2W8BB 1XJ0A 1VSBA 1YU9A 2L18A 2O14A 2QYOA 4PPGA 4TV9B 5BV8A 4QAQA 2R6GA 2H5EA 2NT4A 5JANA 4Z4FA 5IMBA 1Z5WA 4EKEA 2YVQA 3MTAA 3N0VA 3OZDA 3UJ9A 3K1ZA 3DCIA 1X1BA 1CUVA 1G2QA 1V0JA 2FOXA 2VYCA 3LO8A 2FN4A 4RGBA 1J7KA 1KZGB 1EVYA 4BHTA 1ZRNA 4N3NA 3FW1A 5CB8A 2GF0A 1ESEA 1AO0A 1O4WA 5IUJC 1A9XB 1ZI6A 1SWVA 3OCCA 1XE3A 4WN9B 1EP3B 1M1ZA 2PXXA 2QQFA 2AFIA 1MX5A 1W4CA 3T0IA 3ABOB 3L6UA 5TEVA 4CI0B 2FR0A 4G23A 3ZJVA 2Y68A 3LUCA 4D0LB 3RIEA 4EJ6A 1RMTA 1XVAA 1E3SA 1C3OA 2PO7A 4U2KA 4C87A 4I0WB 3KZKA 4Q48A 1TAHA 2QTVA 3AETB 2I6GA 4YCDA 3QNWA 5AVKA 4A2CA 4PG6A 4W7HA 3NYRA 4BFXA 2ESRA 3ZGVA 1JQKA 1SUDA 3MERA 2GFIA 4ZCSA 3VU1A 2GZDA 3U61B 2V7UA 3KL4A 4CLRB 2B8TA 1YA4A 2JIQA 1N5RA 1PZHA 2GHRA 3O8BA 4EPTA 3FNFA 4OSOA 3GBSA 3OKAA 3H17A 5KNBD 2FI1A 4IZIA 3QHPA 1G3QA 2W6JA 4IAOA 3KXDA 3SG0A 1B0AA 3OA0A 4IIJF 5CCXA 5JY6A 1C29B 2QW1A 2IDMA 3GX1A 4HB2A 4NZMA 2HF7A 3KWLA 2VHWA 2ZAYA 1WCYA 1Z4LA 3WK6A 5BWLA 5JECA 1UP6A 3DDOA 1BCSB 3EVNA 4TXJA 5DNDA 4YUWA 1X3SA 5HK9A 2X6RA 3DVSX 2HLNA 4EEZA 2B92A 1LBEA 3C1OA 2LV8A 5LP6C 2D7DA 1T3TA 4D4KA 3NU1A 3TJRA 1M6EX 4F2PA 3JARB 3L4JA 1DAPA 1KA9H 2FWJA 4EPRA 3IT2A 5HPYB 1GPWB 5SICE 1Y3HA 1YWGO 2I1QA 1N32B 4PGHA 1T35A 3GDWA 1QC5A 3CLSD 1OH6A 1RWMA 4G1CA 1H69A 5LZ4A 3HWRA 2YMMA 3W3AD 3BIFA 1OZ0A 1R27A 1D4ZA 4QXMA 3RUIA 1QRAA 1AVTA 1W36B 2H18A 5G0TA 4KUEA 3FKJA 3KOYA 4Y2YA 3WB1A 2BFFA 3UAOA 4EO9A 3BCSA 4YB8A 4DEYA 2AWOA 2E1RA 3T1HB 1QP0A 1LDMA 1UK7A 3VM6A 2NYAA 7ADHA 3GFQA 3HM2A 4JQCA 2VJBA 2CMKA 4RS3A 1WO8A 4MKRA 2HJGA 1SG6A 1JN0A 2CUTA 4IJWA 5FULA 5C80A 3RAEC 1KZ4A 2V7PA 3FOWA 4KCGA 1PJ8A 2XH8A 1IBRA 3IUQA 3QKUA 5JUWA 2NPOA 3I6MA 4GR9A 4HDRB 4KQHA 5I9LA 3V4LA 1PJBA 2HNAA 2NYUA 3ZY2A 3FYDA 3IKTA 4JXZA 5TT0A 2X2PA 3MAJA 4B31A 2YDXA 4QNNA 5FFMA 4D02A 2VI5A 2ZE7A 4B81A 4D80A 1IIBA 1RBMA 3N8HA 2GMWA 2IU6A 1MV8A 4KQ6A 1CNFA 4OGWA 4E2XA 4EI7A 4M0UA 2PX5A 2WJ4A 3AJDA 3AP3A 1YNOA 3LCJA 3JALB 3BB1A 1PWZA 1QH9A 1XLVA 3UFXB 1IWOA 5JSUA 4L6IA 3OT5A 5ITWA 3BH7A 2XUIA 2QRHA 4GLBA 1NBMA 3AHCA 4LMBA 4Q66C 1U7HA 4NPCA 5DM2A 4YAIA 4M88A 5IHPA 5BN5A 4HN9A 1NZFA 2WJWA 4L4UA 5EUMA 3EK2A 1LS1A 1GTJ1 3A1UA 3P52A 3THWA 1OWNA 1YDMA 2OGTA 1OI4A 2VEOA 1QVWA 4OQEA 3OICA 1O8CA 3F6EX 1ND6A 3Q5DA 4G3XA 3I2IA 4CHGA 4CDMA 5G0WA 1M2FA 1QV7A 3AHIA 4RENA 1IXKA 1NUSA 4RMIA 1XZHA 1JA0A 3N1UA 4ND3A 2FE4A 1P4GA 2IHJA 3KM0A 1QAQA 1GGVA 1J09A 1ZVVA 2BH9A 1SB9A 5H82A 1GTVA 2AKYA 1ULAA 3E0QA 1KXZA 2C77A 3HYCA 3RCBA 3LDFA 4D97A 1UOEA 1AQ6A 2A94A 4UAGA 3ROZA 2Q50A 1INLA 2ZITA 1XZGA 3OFJA 3K9BA 3P2YA 5BSEA 4N1AA 1P7CA 3AVWA 1E0DA 4O4IB 2GK4A 4GYYA 2W37A 4L8YA 3DVQX 2IPLA 5A9SB 2WDPA 2F3PA 3F1LA 4A5SA 2G6BA 1J07A 2DFNA 1UPCA 1TK3A 2ZSDA 3O1IC 4OBWA 3TZKA 3JXEA 5AKGA 1KXJA 1YS4A 4R7ZA 3EH2A 3W5VA 1FJXA 3K70B 1XDGA 3A31A 2XDAA 3H42B 1U9JA 2GPBA 4LXYA 2R1UA 4JNKA 4MS4B 2M6SA 4K9QA 4PLWA 4H08A 3FNRA 4RLSA 2X6QA 1OLUB 4FMCB 3REOA 1IOWA 1UDRA 3SMVA 3ZIDA 2FEAA 5EFZA 2PMEA 4GNKA 2PUBA 3QBJA 1ZMOA 5BN3B 2Q3CA 4QEZA 4WI1A 4YALA 2QQEA 4UHDA 4FN4A 1VLLA 2QRKA 3HJBA 3ENQA 5CP8A 2EFYA 1IYZA 2XXAA 3K05A 4AN0A 4ZQCB 3E53A 3GAMA 2C59A 1OZGA 5ADHA 4AYWA 3K92A 3V97A 1RKXA 1JAZA 5A4FS 5A6VA 4PX2A 2FR8C 3UV6A 4ZVRA 4G4IA 2HO4A 3L05A 3OZBA 3BWMA 3KKNA 4UVDA 1VE7A 2OMEA 3WYBA 2DWQA 2Q3MA 1FS4A 1RBZA 1ZI8A 2MCFA 1EXMA 1PI3A 1IPEA 5G4LA 1ORIA 5SY6A 4PRKA 3KXPA 1I2DA 1ARZA 3WNZA 1ZD2P 2RHCA 1YC2A 3UW3A 4II2A 2O0JA 1K8YB 2C3MA 2HQRA 3WSWA 4YJ3A 5JWHA 4QQKA 1P2FA 1RI1A 1NDHA 5KNDD 1KFEB 2NYRA 3DZJA 3E9NA 1TEZA 4WLFA 5NLLA 3M6FA 3QWFA 5HTOA 4E22A 1YKGA 1J56A 2C8VA 1KZ1A 4TTSA 5IS2A 3K94A 5IXYA 5CA0A 5GJBA 2ID7A 3WL7A 1TRHA 1TLTA 4UUMA 3D4OA 1NQ5A 4PO1A 2RC5A 3ROGA 1GNRA 1T2CA 3THYA 4JV5B 2Q6KA 1AUPA 2WHQA 2VRWA 3FPLA 2EX1A 4BFLA 3LLUA 5JPCA 1EG7A 1P1RA 2GEVA 1QO9A 2WSLA 2G83A 4BXOB 1T4CA 2G1JA 1ZU5A 1U0SY 7YASA 3L0IB 2DHQA 2WJVA 3VR3A 3W8EA 2OCXA 3ZIAD 2NU9A 3T54A 3COSA 5C3UA 5MF6A 1BDIA 2NAFA 4LXUA 4NOLA 2AF4C 4DCJA 3WK9A 3PXEA 1F7UA 4U7PB 3HI4A 3P5BA 2F9MA 5HBRA 4XWYA 3WLAA 3LCCA 4RZHA 3QU5A 1Z4NA 4EY8A 4GS5A 2BMDA 1C9JA 3KVVA 1A4XA 4DNFA 1UJMA 1B16A 3E3AA 2I71A 4KPGA 4L6AA 4MWBA 2ZYHA 1TMKA 4DCGA 5BVHB 2TMGA 3VDNB 4DIMA 4I46A 5JD4A 1XALA 3H1BA 4PZ9A 4NFSA 1NLYA 3TQHA 1M2VA 1J0DA 5BUZA 2GUWA 3B1FA 3PLNA 2I1WA 4PHTA 1G2OA 3MSCA 3T3EA 1TF5A 2Q2NA 4HWSA 4ZO7A 2GNAA 4B6EA 4C0KA 1JG3A 1SKQA 1AUVA 1CC1S 1TT5B 2O2DA 1KGDA 3R3VA 3CUEF 3T4XA 3VTKA 3ZJ4A 4CM7A 2QZ4A 2BGGA 3LVFO 1GKIA 3VGJA 2AJTA 3NANA 1L4MA 3P19A 5B36A 3L4KA 1RRCA 3GRYA 2PXCA 1FYEA 4RY2A 4BB9A 3F2VA 2EJTA 2ZBFA 3UJNA 4JJ8A 2O3SA 3BAZA 3JVUA 4EY6A 2G5PA 2POCA 4OJYA 2R6R1 4P08A 3UC9A 1XZIA 3NKVA 3KUDA 5KHOC 3CUKA 5FWYB 5JTUA 1P2GA 5DASA 1FMCA 1R0SA 4C78A 2WVJA 4F91B 3RYIA 4LIPD 3HQ4O 1O96A 3O84A 3P26A 4K1LA 5AIAA 1K6EA 1YTLA 2P9HA 4TTRA 2NUPA 4DDHA 3NTLA 4K0KB 4YCAA 4PO9A 5FBVB 4B47A 1DG3A 1E4OA 3WC4A 4GMXA 4UHHA 5BMVB 5LB2A 4O0LA 3TQIA 1UXKA 2VJAA 3KQOA 4BYGA 3ELBA 5K3CA 4F2GA 3ES9A 4H7EA 4FSDA 4CRWB 5ETJA 2DY1A 3N58A 4UUOA 2WNIA 3HDJA 4R8SA 3R7WB 3V9PA 3ZY3A 3QE0A 2M2IA 5DK6A 3AHDA 3LYAA 1R9GA 1XROA 1LSSA 1SBQA 1XZDA 3B2QA 1L8AA 3W77A 5ADVA 3ROXA 1QO0A 3K0FA 4MVXA 3B48A 4ER0A 1EUCB 2YWHA 1A2BA 4KFUA 4CL0A 2B30A 5EXEA 4IFTA 2DFLA 2JFZA 1T1IA 4UBMA 2XRZA 3HJGA 4KXMA 2VYNA 1HNNA 4WJKB 3SM3A 8GPBA 1JE0A 3A32A 1XLTA 3ZHXA 5BVGA 3KYDB 2Q6IA 2QAJA 2H7XA 5F9MA 1R8YA 2W6ZA 4B3TB 4PRZA 1HMYA 2O8BB 2Z08A 4Y7CA 3UPTA 2O9JA 3GJQA 4DY4A 3B12A 3B8HA 1QWSA 4FM9A 3WLHA 1U6IA 4G0ZA 2P41A 4FGSA 4GVXA 4UTZA 3TLAA 3AVXA 3IJPA 2J5KA 3GF4A 1DARA 3Q41A 3H9GA 1HT2E 1M10A 3AU8A 2BRUA 5FI1B 4K2HA 2P2GA 2EGGA 1W46A 3U1TA 3KOUA 4RH3A 6REQB 1I7QB 3A25A 4DDWA 2C42A 4DIDA 5DOVA 4EW6A 4JL5A 5AO9A 3PXAA 3CGWA 3OOSA 3WRXC 3O2NA 1ST2A 4L0CA 3K6SA 3OUUA 3JD3A 2JH3A 1DQZA 4P93A 1B0PA 2ZTMA 2BR3A 1GAQA 1ID1A 3QEKA 4B45A 2Q07A 3L1JA 4JA2A 4ETWA 1Y3BE 3PE4A 3LC7O 1NJ5A 1QHEA 2R751 3H4IA 3S8EA 1LD3A 2BFWA 1PV4A 1IWPB 5KKAA 4PLHA 5KUTA 2C2KA 1BRTA 3MJRA 1LJ8A 4REQA 3CT4A 4UBIA 3OHSX 3KTDA 1S96A 1QNLA 4Y18A 1DWPA 1F2DA 2FX5A 2Q5IA 2V7QD 3IKLA 3LQFA 3TQRA 2FX2A 2Z58A 3X1XA 3TVTA 3LD9A 1N57A 1AE1A 3H19A 2VTBA 3FAKA 4E2ZA 1XGKA 2RGDA 3HY6A 4YTEA 1MT0A 1PYDA 2AHRA 5DI3B 3WXBA 4YMUA 5KOJA 1KEKA 5JU6A 2PVCA 1U9YA 3RC9A 5GY7A 2C03A 3RREA 5IYZB 3JAKB 3UANA 5JISA 1CQZA 1LTHR 2ZEJA 3H0CA 5JFTA 4K2AA 1E96A 1GPJA 2P1DA 5FB3A 4D0RA 2QUHA 2RGNC 2NV2B 1XCMA 1ENOA 3GFGA 3GZJA 5KNCD 5JPDA 1SCKA 1KTIA 3BG5A 3D6HA 3LC2O 3U7HB 3O26A 1CZOA 4U2DA 1A9PA 3UY4A 4BVBA 1NG9A 2X5NA 5JJBA 1PZMA 3SKYA 1P9OA 1OT3A 3IQGX 2NP7A 3RHSA 2AOUB 1QF9A 1ZOPA 2ES4A 4XFDA 4B09A 5HS4A 2PUVA 1NVUQ 3G2JA 3J7AC 1DAHA 4JOSA 1QVAA 2XF8A 3F97A 5H3LA 4IHKA 5JALA 4TYMA 2IYWA 1V47A 3DNFA 4JB8A 3RSOA 1FYFA 1P6UA 3CZRA 4UXIA 2FUG1 2QL9A 1R64A 5FOTA 4LSZA 3HS3A 2IK8A 4NH4A 3WLRA 5TXGA 3T52A 1PNTA 1DIOB 2HT1A 2VK8A 5DXFA 2V3WA 3QBEA 4MP3A 1GSIA 5F2NA 1C14A 1NVMB 5T4FA 2VYVD 2FMIA 2KI5A 3OU6A 4H4CA 4RTMA 4URXR 1TADA 4EELA 4R4JA 4PG4A 1GTMA 3AL2A 3J81A 3NBMA 2VHVA 3JRXA 2P6UA 2B1IA 1XLUA 1Z6XA 3EXAA 5I7VA 2NYVA 3FXAA 3CVOA 1Z4KA 3R41A 2W00A 5HRCA 3JYNA 3DOCA 3LGXA 3EG9B 3CUSA 4RVSA 1FP6A 1E3TA 2EARA 3H7IA 3CSDA 4KN8A 5GJVC 4JDUA 3VR4H 1HL7A 1MA0A 4GW3A 1CF9A 3VU9B 5J2TB 2PSEA 1ORDA 3TE7A 1PVOA 1LPNA 4YMTA 2NU7A 3E9QA 5ALDA 3NAZA 3X1KA 5LC1A 4BS9A 4KK3A 5FAKA 1BKYA 3A4VA 3T7IA 3U7QB 1VJRA 3PC8A 1HOTA 1Z26A 1QMPA 4MWTA 2ZI5A 5L3RA 2I4RA 3RJZA 4DRXB 4NSNA 1MD9A 2ZIGA 4MGHA 4ZRDA 5JZBA 3OLQA 3HKDA 2YINC 1CULC 2ZSEA 3Q40A 4RJTA 4ZK6A 1HSZA 5CDFA 2OXRA 1L5GB 4B3HA 1FZQA 1FVOA 4W9RA 5C8VA 2QAGA 3EQZA 1NVDA 3DFIA 2WFZA 3O6VA 2XDQB 3K5PA 3BQMB 3LUHA 4FFSA 4MITA 4UHCA 1A1VA 5IDWA 5H5JA 1CR1A 1GT6A 1II9A 2C99A 1N2EA 1P0MA 4EY3A 1LDEA 1MU0A 1CZNA 1QP7A 2HB6A 3NGXA 1JECA 4JDPA 1W8DA 1NFRA 2I78A 4OXXA 1X42A 3C3XA 3GUYA 3HWX1 3M49A 3PQ5A 4JB3A 2NO9A 1TYCA 4KMOA 4DCMA 4J75A 3R3XA 2FWRA 2D1RA 5DBFA 2JZNA 4YQEA 3ZCRA 1VYTA 3WDSA 2N3ZA 1FQJA 4XYGA 3MWEA 5AI6A 2MYNA 4I8XA 4IDHA 3SBOA 4B75A 4KTVE 4MAAA 3OPXA 4O2AA 1ZHFA 3R77A 5G40A 3WKAA 3SKVA 2DPLA 3IALA 3RT7A 3U19A 1ODCA 3NKLA 1T6ZA 3C3CA 2I87A 4XW2A 1Y7TA 3OPYA 2F8TA 3H18A 3MMNA 3OOJA 3PYLA 4IXDA 4FNAA 5D7BA 2R6DA 3WAGA 3VSBA 3EVTA 1O5IA 4B4DA 1XQ6A 2ZR0A 1R4NA 2HBZA 4TUYA 3ADDA 1SQSA 4D9BA 3P9KA 1JZQA 4LBVA 1BDMA 3UB3A 5KZMB 4CLEA 4GF5A 1M6YA 3OX2A 3WIDA 2GUGA 4HX5A 5J1TB 2RI6A 1G8JA 2AI1A 2ZRMA 1ITZA 3F71A 4GMFA 1Y33E 1JG1A 3PGJA 4RK1A 4AF8A 4BLRA 3PNPA 3ZQ6A 1SD1A 4QEKA 4D79A 3DGFC 5D8DA 3TECE 5B2FA 1YFLA 4HDSA 3CZMA 2AQIA 3C4VA 4PPNA 2QD4A 3DLAA 3HB9A 3UUFA 3D4IA 1EVIA 2A1UB 2NTNA 3FGNA 4D8YA 4EA9A 3W9UA 4WNAB 1FDOA 1Y0BA 2JBAB 4DG5A 2OENG 4BWGA 1YBMA 3GJ3A 5K05A 1NOKA 3ILSA 4FNOA 3MMXA 4NCHA 5CNJA 3KFVA 1XCJA 3ZD9A 2HA4A 4K8OA 3H6HA 2GJ4A 5HIMA 3C70A 3RSSA 2Q3LA 1L5FA 1A2KC 5G0VA 3L9XA 5LPNA 4URHA 1DTWB 1T5BA 1TUIA 4J76A 1A7JA 1YK1A 2BN4A 2MSCB 3LIIA 4IDOA 4NZOA 2ZB2A 2B1JA 1O2DA 1A1SA 2G25A 4MUKA 4EFMA 2B61A 3H75A 4A4DA 2Z5VA 1PCXA 3DE4X 4FXOA 4PM4A 1X0VA 2I1LA 4AMGA 2JJ1A 1F1JA 2BTQA 2WABA 3Q9SA 2R1VA 4BX2A 4EIWA 3LT0A 4JU8A 3SZ3A 3RROA 2AS0A 1VYHA 3TSAA 2LD4A 1H2FA 2B35A 1SHKA 2VPWA 3HY3A 2AYXA 3EIEA 4WOBA 2VYFA 3RYCA 2F9LA 1SVMA 4L50A 5T8KA 4GL4A 2PE5A 2AFHB 1AS0A 4GR4A 3Q7IA 2FPXA 5DYNA 1DUSA 1V96A 3P71T 2XTAA 4JLWA 3TOZA 1P0QA 4GG1A 1ZQ9A 4OCZA 4EZIA 1PW7A 2O7RA 1RM0A 5KHAA 5LLSA 3IMGA 1Q7CA 3ETDA 5DBOA 5DHSA 4CKWA 1WXQA 4RVUA 4EKDA 3FVQA 4IIJB 1Y89A 4BBJA 2Q27A 5FA8A 3EARA 4CCYB 1LCIA 2ZTLA 3C15C 4FLFA 1PJQA 4FWIB 2JDIA 4N41A 4E5PA 2I3GA 1SK8A 2HJSA 4FHZA 4KBYA 4NBKA 3UWKA 1PHRA 4ZQEA 1VKJA 4L8LA 4E5KA 3GVXA 2XR1A 4P4LA 2UVPB 4YREA 3U4MA 2MSNA 1ISHA 2D2VA 1O08A 1SZDA 3CE6A 3O21A 4QQNA 3FNEA 5ADUS 2G9RA 1S7CA 3H83A 1U2QA 1P1FA 3DBVO 3DOJA 5E1MA 2GNPA 3W7AA 2EFEB 4BC0A 1S89A 3E9MA 4TMTA 4X65B 1CUDA 1JU3A 3DOUA 4MR7B 3SJUA 1JLHA 1KO1A 1Z0SA 2DR0A 4DC9A 4FZVA 4RESA 4ZC1A 5K6AA 3I34X 2JI8A 4ERNA 6CHYA 1D6SA 1MG5A 3HYRA 1P5JA 3DBOB 4XJSA 5ALYA 4D81A 4XB2A 5AVRA 1SD2A 3EMVA 3HACA 1IG0A 1ESDA 3I53A 1K7SN 2AI3A 1CQIA 3O31A 4GMGA 4N8SA 1V1RB 4P0TA 3R3HA 5F1KA 1FFXA 3ZDXB 2JGLA 4Q1AA 3DE7X 4KN9S 1H6CA 1G6OA 3K4PA 3NBUA 4IXTA 3U4QB 4C3VA 1U0GA 4L2IA 1YQQA 4CN9A 1Q3HA 4LYFA 3QKWA 4J16C 3VBCA 2YASA 5B5SA 1WHTA 2TYSB 5CG2A 1B2LA 6ADHA 3SIPA 4Z54A 2QP4A 3CKKA 4LJ7A 4WXPA 3NHMA 3USCS 4ZDIA 4OMFG 2AJCA 3KR1A 4XWWA 1JAHA 2B5WA 4HLNA 1RAAA 2C3OA 5CT5A 3MNFA 5KQRA 2VH1A 1MO4A 4X1YB 1G8YA 5CGQB 1WV0A 2BEWB 1GLNA 1V8ZA 1JMKC 2QVGA 4Q1CA 3QMMA 3SS9X 1UMBA 2FSVC 2H11A 5JCZA 1TTTA 4L4SA 4UCQA 4WCDA 3MC1A 4AZVA 3C8UA 1ADCA 4TMXA 4PPFA 4DREA 4YAKA 2WIGA 4MWSA 1EGVB 2D2XA 3WLIA 1AQJA 5LL6P 1X7ZB 1QQ5A 4Q9HA 4NS4A 1LDGA 2G9UA 3ROEA 3C39A 3DYBA 2P1RA 4XOIA 4MCHA 4AF7A 3W5BA 2CXOA 1SMKA 3ABIA 1OLXA 5ALJA 3ZBTA 1L8QA 5JYEA 3N9IA 2P4UA 2JNWA 4NE7A 1VCOA 4I8IA 3KOMA 4BLOA 2H2IA 5TJHA 2ZE8A 5CIQA 2HIGA 2XADA 2LUOA 3KR9A 4FFRA 1NYQA 3MK31 3TWOA 4CG0A 3IIKA 1T9BA 1E3LA 4AP9A 3IOBA 1P72A 4MQMA 3VU0A 1N2SA 4EW3A 1EAYA 3A4NA 1LKZA 2I62A 2ZQZA 5J5AA 2Z3WA 3AFGA 3IQDB 4QDKA 3ZVMA 1LWNA 2OD2A 2YFYA 1GPLA 4ZCRA 1XYYA 1NYTA 2WWHA 1DADA 4Q4JB 2BH2A 1BJKA 1NUUA 2A78A 2YNMA 3DMHA 3ZE8A 4C05A 5EPOA 1JBQA 4FHFA 4C4ZA 1L4YA 1XVVA 2W6ID 4K81B 4O0MA 2NM0A 4ZICA 3NDIA 5FV4A 4HDMB 4M1WA 4PO8A 3GLIB 1NT4A 1NF2A 3GELA 2C29D 3W6UA 1E6LA 2F43A 1IU9A 2R6AA 1MTOA 1DO0A 3LOUA 2R8ZA 3U3RA 3L07A 4DSOA 3B9RA 3OIFA 4HDKB 2EZUA 1UPFA 1XYVA 3TPZA 4Y6QA 3V4RA 3S1AA 4BO1A 4BUZA 2ZAMA 1G1AA 1GRCA 1WR8A 2C5BA 1VPVA 3A1WA 4E2WA 1OZHA 4KDEA 1FPMA 1A27A 4LDPA 2ODPA 3OJXA 3N39C 5KDDA 1HYGA 2PGOA 4QQRA 4QYWA 3H2SA 5EZYF 3FKSA 2ZBQA 5AK3A 1ZK4A 3MBOA 5DRTA 4ZO6A 3WGGA 4WLEA 1SOUA 4WKOA 5JCXA 2CDCA 5G02A 4AKSA 3I12A 4YK7A 5TQ0B 1WBDA 2H0QA 4NYMQ 2JLVA 4ZFNA 2FFBA 2GAIA 2MYTA 5D84A 1PKEA 1PYOA 2ZIZA 1JDNA 3G85A 3AJEA 1FRQA 3UJ7A 1G3UA 4E5DA 4FW9A 4MS1A 3UV3A 1LW6E 1Z7GA 4ANFA 2DPGA 3S7ZA 1HDYA 5B2EA 4MZXA 3CBGA 2VZ8A 1AKEA 1JR3E 3SZLA 1K89A 3MYRA 2ZSHA 2Q3BA 1JHZA 1WUKS 1ULTA 2FUCA 3M9XA 4O2BA 2XLBA 1K8ZB 2CD9A 2V45A 4ME6A 1DXYA 2BCJQ 4R2XA 4YP0A 3TRIA 3B1ZA 4TKLA 4QLBA 5LMNB 2HH9A 1HNZB 2E4AA 1XCLA 5DCWA 4W9NC 3KHKA 1YDFA 5ED4A 5JSYA 3K09C 1EP9A 3CUUA 4ND4A 4RUKA 5IKMA 1UR5A 1IEQA 3AB8A 3CWQA 4F46A 3LT1A 3L8YA 4GGOA 3EVEA 1Y48E 1VE6A 3D7SA 4URVR 1RHMA 1NNUA 1VIMA 3GRAA 2W4MA 5AVXA 3DMPA 3R3JA 2WD7A 3ZGYA 1IBMB 1I30A 1ZICA 2XRYA 1HFJA 2IYEA 3HGQA 1A5BB 3U3KA 1T43A 2FWMX 3P9PA 4R31A 3ULKA 4DWVA 1Q3TA 4IEFB 2VN8A 2QTGA 4QLOA 1VG9B 3WB2A 4LZLA 4D8TA 3KSBC 4HGQA 4IDGA 1PR6A 2NNWB 1M33A 1BVHA 3HB4X 3WX0A 3O3MB 2HZBA 3HXKA 2J6BA 1SBHA 4TVSA 1US8A 4W1RA 4LHYA 1WL8A 2WSBA 5LDHA 5FAXA 1YR2A 1N33B 3CPSA 1DC7A 3REFA 1C4OA 5CFMA 1PLJA 4EB6A 2QE7D 2XQJA 4QLAA 2X0FA 5EGSA 4BKRA 3U1BA 3OFND 1W94A 5A7GA 3O8RA 5BW8A 1M2JA 2BBTA 2QU7A 3RS7A 5BSWA 2Z95A 3FYUC 3AIOA 5ALTA 3JRWA 3D59A 2IITA 1DV1A 1H0RA 2QL6A 421PA 2H8KA 2I7CA 1B8OA 1SXJC 1UQRA 1GGJA 1XRLA 2VAVA 1P4JA 1I2ZA 3AVOA 1QO7A 4M87A 5G2OA 5K8TA 2RDMA 4XQ9A 1CE8B 2G9QA 1TIKA 1BMQA 2XW6A 1V4NA 3TD6A 3UK7A 2OLJA 3FBGA 4DLYA 1I0IA 4ZZIA 1WVMA 3LK7A 2B1GA 1CNEA 3RSGA 2QTMA 2ZWVA 2CHGA 4MTLA 2QLFA 2Z2JA 1FNCA 5HRAA 5IPFA 2HLDD 2EW1A 4YT5A 3X1ZA 3ZI4A 2GM3A 4INZA 2C7OA 3DM5A 3ZKWA 1TQ4A 1GTRA 5FOVA 3ZWAA 1YS1X 3MCUA 2BEKA 3R40A 5CTJA 1ZVMA 3DLBA 4DR7B 3DOHA 1EVJA 3JVVA 1TECE 3QYJA 3LUJA 3O4VA 1F9EA 4I6GA 1N34B 4RDHA 2QRQA 4OQZA 1LPPA 1ZM2A 3COZA 3AW9A 4PYQA 1KPIA 1V37A 4H1WA 1WMAA 3AFHA 1KJ9A 4B0OA 4BQSA 2JATA 4J4TA 5CU7A 2OPHA 2WAXA 2XECA 2WY2D 3ISVA 1AO3A 1Z6TA 3HKEA 3CTPA 4Q39A 3DQQA 3GMDA 5IZCA 2BD0A 1BA2A 1C0LA 1FNNA 3K30A 1QXSA 1ZJYA 2PYIA 3D3KA 3LFHA 2WSYB 3O95A 3PKJA 4QOEA 4U7DA 1VC2A 2ZJ4A 1I7NA 1T2UA 3A9CA 3KIPA 3QXGA 4U00A 4PLVA 3DTVD 1U0TA 1EK1A 3WMEA 4ARBA 3LDHA 4RMHA 1IHYA 2IXBA 4ONEA 4QBFA 1LSJA 5GOZA 4C01A 4OF4A 4U7FA 5D3MA 3W7BA 2G80A 3AONB 1QB7A 2JGDA 3IB6A 1RPTA 1IZYA 2XMDA 5FA5A 1KRWA 2RE8A 4Q7LA 2HL6A 1RJFA 4JAVC 1THTA 1H2YA 4DNPA 5SZHB 2JAHA 4DLRA 5ENVA 1FLVA 4JGIA 2IIQA 1HFKA 2O50A 3ON5A 3RV4A 3OIWA 1IUKA 2WJJA 5CUQA 3VDRA 5TPWB 1CUZA 2WHYA 1X19A 2CL6X 3C5VA 2NXNA 1KY3A 2BJVA 2OFPA 5EWLA 3M6IA 1KAQA 4ZJUA 2QT0A 1IAVA 2P6MA 3CEMA 1CPYA 2GN0A 2OQRA 3EEQA 3G49A 3B7WA 3FVRA 3PSAA 4B3FX 3R0VA 4KXXA 2ZJ1A 4D8XA 3G1WA 3JVEA 3VC2A 4HWRA 2Z4SA 3KEOA 2NWQA 1U7PA 2WB4A 3BJZA 1NWCA 3A2KA 3RAPR 5AI8A 3FCAA 1HZZA 2R7AA 5C8YF 2RD2A 5JAZA 1U8EA 4I81A 2X8BA 5CLLA 1E2KA 5LB4A 4YUAA 3U4AA 1ECGA 2I2AA 3ORYA 1K0FA 3MGAA 3OURA 3G5LA 4HSEA 4MUBA 5E9JA 1Y3AA 2HPAA 3RANA 3BULA 3JASA 3WADA 3QVGA 1ADBA 4TLDA 2CNDA 3UNXA 3IVAA 3ZU2A 4B1FA 1NMYA 4L6CA 1DBSA 1KDOA 4Q4HA 5KYGA 4PINA 3KUUA 1W88A 3M4JA 4UHJA 1AXGA 1T9CA 4XM0A 4S1OA 1TUBB 5ALHA 2FEXA 1VHQA 3WHIA 3J81k 1G8AA 1FC0A 5IXSA 4EM6A 2QHXA 3BB3A 1N1GA 4HAYA 1YFKA 1SIUA 2E4ZA 4U02A 3IPLA 4WCFC 1MX3A 2BR4A 3VPHA 4ARZA 1HQCA 4BNVA 1RD4A 1T34A 2P91A 4RJ2A 5JXGA 2Y4NA 1XVTA 3E9ZA 2H08A 2H5IA 3BFVA 3KPWA 5H59A 3RTGA 1ZR4A 3EOAI 1NXOA 2F55A 3VX4A 3B82A 4NABA 3HN2A 2CDNA 4IL5A 4WDRA 2R00C 1V26A 1N2CE 2XKJE 4Q34A 2QQ0A 4BB0A 5FFFA 2GF9A 1OSNA 1Y82A 1JR2A 3NVMB 1CEYA 2WVHA 1DKLA 3AFNA 1VKNA 5EHZA 1BMFD 1KYWA 3DBLA 4Q01A 3UAWA 2W70A 5MHTA 2IY7A 4RD4A 2IW1A 1ZY2A 2GZHA 2D5LA 1IK6A 1QP4A 4EARA 1L5ZA 1FQOA 1UAGA 4C5BA 4CF4A 1GDTA 3VRHA 1BGVA 4GR5A 1E6CA 1YJCA 2IUFA 4NG5A 4P81A 3KPJA 3OEED 4L7QA 3WK7A 1ZIDA 3LF1A 2EFCB 4D7AA 1GQ2A 2FG5A 1WM1A 2R6JA 3FIJA 4BN5A 3BWEA 3O8OB 4F2DA 4II7A 3TLYA 3E5MA 2I7TA 4AKIA 4Q4LA 2GBPA 2JJ8A 3WGHA 1AB5A 3WL5A 3BXGA 5F9FA 2FFJA 3MUNA 5EI5A 3SJAA 2FN3A 2QJWA 2RJ3A 4RM2A 2P9BA 2WF9A 2UVQA 1XB2A 4QDZA 4R9NA 4LFCB 1DLIA 1L3CA 3EE6A 4LNHA 4Z4HA 4LECA 4GX5A 1VLQA 5FI3A 3ZE0B 2QMYA 5KAMA 4AIIA 3K8ZA 2H7VA 3SM9A 5JJ5A 3GXBA 2BHTA 4MYRA 1OPRA 4Y1EA 3UCXA 1VRVA 3WZMA 2XIJA 2EBHX 4AKTA 2B4QA 1JGTA 2AXEA 2A9RA 1WOYA 1Y7PA 5JLJA 3MW8A 2QDKA 5BQPA 1J1IA 3HYSA 4RF4A 1KE1A 4KSCA 4BO3A 2W58A 1BX0A 4R16A 4A0QA 1EWKA 2RHRA 1FRZA 1GCAA 2DHEA 2HHJA 1J9ZA 2R6HA 2E55A 2PZKA 3PEVA 4FS3A 5FIUA 4ASUA 5KNDH 1VHLA 2OFWA 3DXFA 3MTDA 2PA3A 5DE3A 3DMNA 1TMYA 2QLMA 3EVBA 2B82A 3H13A 5AH0A 1VA5A 3LLVA 1X87A 1ETUA 1L4KA 2JZCA 4H59A 2HDOA 4BFVA 4FFPA 4YAGA 4MX8A 1FDSA 5BOSB 3RC8A 3H0KA 1PJAA 1FIUA 2Q2QA 2VT3A 3T5BA 3I76A 2V4UA 1ANKA 3CUVA 4PGMA 1AKVA 3EGXB 3Q6IA 1K4KA 4BMYA 3PI7A 1AG9A 2IEDA 3I2YX 4KZKA 2X58A 5HQ3B 3COWA 3SNKA 4FZ5A 4OQYA 2RK6A 3SX2A 4RORA 1CYEA 1N9ZA 2E21A 1ID8A 2DULA 1TF2A 3D6AA 3BTSA 1NMZA 1R5NA 4HLDA 1EA7A 2H2GA 3OUZA 4U3JA 4RF5A 5COBA 4TLBA 5EUBA 5IDYA 1CQWA 3UENA 5EKUA 4DCOA 4Z7JA 4FWBA 3QBDA 4YRSA 2IKSA 2EOAA 4ZKDA 5ALWA 4RD2A 1AC5A 2CLOB 4MUGA 5EEGA 4A0GA 1OWLA 1DTSA 4M8IA 3ABSB 3GLIE 4NZPA 2J46A 1RJGA 2P90A 5CEEA 4Q19A 3PK0A 3G8AA 2C96A 1PT7A 3G9QA 4NZZA 2J59A 1VLVA 4HNVA 3PD0A 1T10A 4RADA 2WR8A 1T6YA 1XXHA 4FE7A 4JQSA 1K5DA 1GTG1 1RQ2A 5EQDA 1XV5A 4A27A 4DF3A 1F2TB 5ALGA 5JMTA 4ZV7A 1R6AA 1JFSA 2J32A 3KVOA 2VJCA 4Y6OA 2AI2A 4LY6A 1LNZA 1U3UA 5KQSA 4WASA 1KP9A 5F98A 3RUEA 3LRPA 1JJBA 3W04A 4PVCA 1M8FA 2BEVA 5DT2A 2TRSB 3FCOA 2NTEA 1TDJA 5BMOA 2HJWA 4GLFA 3DLHA 4XVQA 3PNSA 1E3WA 4Y2XA 2IIBA 5UKDA 3AJ8A 4NJEA 4KX5A 5FPHA 3CMCO 3VSDA 4PBSA 4TTPA 2PR2A 1LB1B 2CWWA 4MQFB 2XUKA 1Z4JA 2A9PA 1E9EA 4FYYA 3I4CA 1GILA 3PNKA 3SSAA 4EQZA 4J7AA 3W2TA 1MC4A 1H0SA 3SDZA 2JI6A 5FO1A 4LPKA 5H3CA 1KH3A 1FNMA 2H1WA 4AIRA 1OTXA 4BOYA 4IZHA 5B1YA 4Q1EA 2QK4A 4JJEA 1KP3A 1CR6A 1MOZA 1IHXA 1V11A 4JP1A 4E5UA 1NKVA 2WT4A 2V9ZA 3GOQA 1JILA 3KHUA 1TW3A 3Q3JB 4HMQA 4AUKA 1NG1A 3EW7A 4J0JA 4O2RA 2AKEA 3CX7A 2HSWA 4CWAA 2UZ1B 3Q88A 1XWIA 4KOEC 1NVBA 4GU5A 2UYQA 1RAHA 4HMPA 3NV9A 3IP5A 5F1PA 1GKUB 2IY9A 3C74A 2R86A 1EFDN 3LL4A 4ZGBA 1EGHA 1ABFA 2YXEA 4HLUC 1SC1A 2C5AA 2A5DA 3EGVA 3OZRA 3WA6A 1V6SA 2IXDA 3VX3A 3HYNA 3LV8A 1SUWA 3IDZA 3OZ7A 3T9DA 5B1IA 2WZDA 1T9HA 2WFLA 1V71A 3WG9A 5EPEA 3A37A 1Z22A 2P77A 4F3YA 2ACEA 2QE6A 4RLQA 5TDHA 1DHRA 1N5DA 2PLAA 2ZRPA 5CT4A 5LDGA 3RRFA 3FYHA 4H35A 4P5DA 4C0WA 4LYYA 4JJAA 1RJWA 3TSWA 3WMWA 2PWAA 2ZQYA 3ZHZA 2IPNA 3M83A 1J42A 5AW9A 3QI2A 2D6FA 1X8JA 3C2QA 2NUTA 2I9PA 1T8WA 3NFYA 1Z47A 3VNBA 4D9MA 1XQWA 2HDHA 4AKEA 4B2PA 4QDXA 3R5FA 3QK7A 1XIVA 3SE0A 1FQWA 2ZXEA 3MRSA 1N2CA 1U9IA 3BH0A 1GHTA 1VZ3A 4R8KA 2V98A 3ELWA 4L5IA 4RJKA 3QITA 4HS4A 3NDRA 4Y9TA 3KFXA 3M6MD 5B57C 2YRWA 4KQMA 4M8SA 1EEHA 4R7GA 3FAZA 1UAAA 4IIXA 2VK4A 4RY9A 1LLQA 1P91A 4NU8X 1S2IA 2A9OA 5CJPA 5JZOA 4FT4A 3WGTA 4E6EA 1H2XA 3ZXUB 3WGLA 1Z74A 1JMYA 1EU1A 1PL7A 3C98A 3LW7A 2Y0EA 1QG2A 1HRDA 1WD7A 5HS6A 4NJMB 2LPMA 3PFHA 3S8YA 2VA9A 5AVZA 1E3IA 3QPDA 2FMUA 3PJDA 1RS0A 4V2IA 3HL4A 4M9XA 1COWA 1PR3A 1L7XA 2PFGA 4QUIA 5I9SA 3T8YA 5EMHA 1YA8A 1CR4A 1O97D 3TS1A 2NVOA 1GGFA 4KBGA 4BQOA 1VXRA 3OT1A 4DRZA 4EKGA 2P62A 4J9UE 1WLYA 4ITVA 1GQRA 1ZFNA 4UBOA 3WL3A 5K8VA 1Z5VA 3R6WA 4OV6B 4PSKA 1JFFA 1P5HA 2H52A 2ZBPA 3BBLA 4N65A 2B7LA 4II3A 3VDQA 2CXXA 5HYVA 2REXB 3MMPA 2ZJ6A 3P2OA 5KNCH 2B25A 1N0HA 1H93A 1JRLA 1G5PA 1F20A 1TQ8A 2HSDA 4KE8A 4DR4B 4M98A 3NC0C 3OZTA 2WILA 2P5UA 3QYFA 4KAJA 1C9KA 4CI9A 2DPXA 1C1HA 1OXXK 3ELUA 4XFJA 1OZAA 1XZJA 1Y5IA 1QB8A 4FDAA 4C76A 3ZWMA 1RRKA 4WSOA 5AXCA 2JCSA 4N0MA 4CM9D 4Q9DA 1TKBA 2Q0QA 3DL4A 1CBUA 4S2UA 5BUCA 1XEWY 2J30A 3NOXA 2FMXA 3MG9A 5DW0A 5FTWA 3WGJA 3CG0A 5TF0A 4B3DA 4PZYA 5CMLA 5IASA 1QHFA 3IR7A 1ZRSA 3KNZA 4C2UA 2C94A 2CLCX 2ODEA 3ISJA 1MC5A 4GVLA 3QEAZ 1GNLA 3R0QA 3TB6A 4BU1A 2IYLD 4JT9A 5KOIA 3E9EA 1JEQA 3FTEA 1GGHA 1WUJS 3L6BA 1DC3A 1ZJ6A 2EGHA 1JDPA 4KLRA 2E6KA 3F0TA 3KX2A 2L19A 3JAWB 1LTQA 4JLMA 3H5AA 2B2CA 1RHJA 2BGNA 1E79A 1QBKC 2Q4TA 2QSYA 3V8EA 3N0RA 5LIRA 3FPSA 1ODTC 2YMQA 5HIJA 4DBLC 2IBTA 3QLTA 3FDIA 2ZULA 2ZAOA 1R3UA 2H31A 2FVXA 2X0JA 3IAM1 3IMKA 1FP2A 1QO0D 4J0KA 1N9KA 3ST7A 3ZW8A 4AY4A 5KS2A 2EFJA 1G4HA 1YFJA 3CO0S 1D7AA 3KAPA 1YOBA 4UQOA 1SAYA 1UKVY 2J6IA 2FPIB 4Y67A 3AVUA 2PS1A 2IX3A 2YN4A 3GC6A 1CY4A 2OAQ1 1EM8B 4KQCA 4G5SA 3JX9A 3A04A 3KXIA 3K71B 5DULA 5CX1A 3LZ6A 3OTQA 3DE6X 3QMPA 2D00A 4NENB 2FUNB 3JQAD 1R5BA 2E1PA 1XYGA 3RB8A 3TJMA 5KB3A 1F12A 4NARA 2VJMB 4WGGA 4AECA 1XSEA 4HLCA 1GZ4A 2ZI7A 3DOFA 1C1DB 1MPXA 1C1XA 3U0VA 5FWDA 3W8RA 4IICA 4RHXA 4HOYA 1AN0A 2X23A 4JHLA 3B1XA 2GCEA 2H65A 1Z0FA 3FSGD 4QNMA 3C8ZA 4ZTBA 3TMYA 4YMVA 1CQXA 2BEJA 4ZAVA 2FW1A 1NBHA 4X54A 2HBYA 5EZYB 4BASA 1GO2A 3KYCB 4PFJA 5F77A 1UBFA 3M34A 3PCRB 3MINB 4KFRA 4DVGA 4WT7A 4ZMSA 3UBTA 1OROA 5JH7A 1WS6A 3GO4A 3MJTA 4PG7A 3HLKA 4B44A 4FGWA 5KQGA 1DOHA 3H5IA 3O8NA 2A67A 2DG2A 4GPEA 4QYIA 1G4UR 1VJGA 1C7ZA 3FA2A 3VYVA 4MIOA 3LZCA 3VR6A 4E4RA 3QMVA 3CW8X 4FSHA 3DE1X 1PU2A 2YYYA 1HR0B 3TZBA 3UQYS 2QL7A 1ZESA 3LBHA 5F78A 1NN5A 2FY8A 1UBSB 3R9XA 4CL8A 2JAPA 2H4XA 2BFBA 3NFRA 3NEYA 1FNBA 2IUUA 2VTDA 5THQA 1ONNA 1OAKA 3DOOA 2GPTA 4JC0A 4WINA 3HP4A 1ODFA 2YIVX 2J0SA 5TE9A 4JYAB 2P75A 2NT3A 2QX8A 4HH1A 4QDUA 2R4TA 1P4RA 1ESZA 3B6MA 2ZIFA 4QPCA 1AU9A 3UHOA 4CDGA 4OLJA 1CJVC 1FSFA 3RUHA 5KCMA 4DCVA 4DZZA 1DVRA 1EP2B 4GE0A 4NZ9A