2FG7C

N-succinyl-l-ornithine transcarbamylase from b. fragilis complexed with carbamoyl phosphate and n-succinyl-l-norvaline
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
Knots found
sequence length
320
structure length
320
Chain Sequence
SHMKKFTCVQDIGDLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRLSTQKAALNLGMNVIVLDINQGAWKLETERGVIMDGDKPEHLLEAIPVMGCYCDIIGVRSFARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTARPKVVMTWAPHPRPLPQAVPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYDQMKAFEGADFIYAKNWAAYLGDNYGQILSTDRNWTVGDRQMAVTNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and catalytic mechanism of a novel N-succinyl-L-ornithine transcarbamylase in arginine biosynthesis of Bacteroides fragilis.
pubmed doi rcsb
source organism Bacteroides fragilis
molecule tags Transferase
molecule keywords putative ornithine carbamoyltransferase
total genus 118
structure length 320
sequence length 320
chains with identical sequence D, E, X, Y, Z
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.3.-:
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
C PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 2fg7C02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 2fg7C01
2BE7A 2EF0A 3R7LA 1RAHA 2H3EA 4H31A 3CSUA 3L02A 3GD5A 4OH7A 5G1OA 4JQOA 3NPMA 3GRFA 1DXHA 1TUGA 4EP1A 3R7DA 3L06A 3L05A 3M4NA 8AT1A 1OTHA 5G1PA 2FZGA 4KH0A 1C9YA 1SKUA 5G1NA 3TPFA 2OTCA 7AT1A 3KZKA 2FG6C 4ANFA 4BJHB 1ZA1A 1RADA 3M5CA 3SDSA 4AT1A 2G7MC 1RAFA 3MPUA 2FZCA 1F1BA 1RACA 4A8HA 4JHXA 1PG5A 3UPDA 1FB5A 1A1SA 2HSEA 3AT1A 1FVOA 4FYYA 1EZZA 3L04A 4WTOA 4KGZA 3KZNA 2QGFA 1ORTA 4FYWA 3TXXA 4KWTA 2ATCA 4E2FA 2FZKA 2AIRA 1R0BA 1RABA 2AT1A 2W37A 3E2PA 3D6NB 4KGXA 1XJWA 1ACMA 4EKNB 4AM8A 3LXMA 3M4JA 4A8PA 3R7FA 4F04A 1RAEA 2BE9A 1TU0A 1AT1A 2IPOA 5ILQA 1JS1X 8ATCA 2YFKA 2RGWA 2FG7C 4IV5A 1EKXA 2P2GA 4JFRA 1VLVA 1R0CA 2A0FA 2QG9A 1DUVG 4A8TA 6AT1A 1I5OA 4NF2A 4FYXA 1EP9A 4F2GA 4KH1A 4KGVA 1PVVA 3KZMA 3KZCA 4FYVA 1ZA2A 3D7SA 1AKMA 5AT1A 1ML4A 3Q98A 4AMUA 1RAGA 1RAAA 1NBEA 1D09A 3KZOA 9ATCA 3M5DA 1Q95A 1TTHA 1RAIA 2I6UA
chains in the Genus database with same CATH superfamily
1JU4A 3PQFA 1ACJA 3ND7A 1YVEI 1FYEA 3ETGA 5ALYA 4YJKA 1GPLA 4XCQA 3A6FA 1YZHA 5EGSA 5KNDD 2XGSA 2IE0A 3GEMA 4HAVA 4QECA 3RFFA 1FLDA 4KX5A 2KB0A 2NU9A 4OL9A 3V1NA 3GZJA 4N1AA 3RHFA 3H99A 4NVRA 4TVOA 2BEUB 4IMRA 2A5FA 3ROQA 3HVRA 2HMUA 1T2FA 4WGGA 3R7DA 1X8LA 1V41E 3R3YA 5LMUB 2GEVA 2FU5C 4NWIA 1EWTA 1ZK4A 2YTZA 4TUYF 5CJ2A 4U7GA 4G2TA 3AIOA 3H9BA 3S2IA 5EG5A 3W3AD 3X1KA 4W5OA 1HYGA 1BRTA 1YJ8A 2ORWA 1SG0A 4P4GA 5I51A 2B2XA 2RC6A 2ZYIA 1E4VA 3NM4A 3U13A 4F96A 3SJ7A 1BEUB 1ENPA 1ECFA 1P5HA 1U9IC 4G6ZA 2G9UA 1G66A 2OBYA 4I2NA 4M8IA 2J08A 1U7XA 1Z4QA 4C4XA 2JLZA 1H2EA 4L4XA 1L5ZA 1T5IA 4C22A 5J3JA 4MQBA 4QU5A 2HO5A 4ZC8A 3ZN2A 1BW9B 1HRKA 3E9MA 1DX9A 1U2TA 1XKXA 3JQFC 5D5HA 2FPXA 4KOEC 1E9RA 2VZEA 3GG9A 3H11B 2E4WA 2DLNA 3FY4A 3HDGA 3INTA 3GBVA 3RRZA 2WT9A 3WK5A 5I47A 2I3GA 4G1UC 2JZNA 1X80B 2XLBA 3HPRA 4BP1A 3PPYA 1NVVR 4QWMA 2OV6A 2PGXA 2E18A 2IPAB 1V48A 3OURA 3MCZA 2AYXA 1EYZA 3KQOA 2HV9A 3PFCA 1QV7A 2BW0A 1BSVA 4MVJH 2J3EA 4M9SA 1Q1AA 4HLNA 2ZRDA 3TW0A 1M1XB 2Q6TA 3GRKA 1TK9A 2VNHA 1CDDA 4QU8A 1NLZA 1A9ZA 3B82A 4KK3A 1M0TA 1PKXA 4TUYB 5D6NA 4GXNA 3NANA 3QA9A 2GOYA 4AUNA 4H1TA 2WM3A 1LLUA 1SAYA 3HY3A 5FFFA 3L0BA 1EAMA 2F1RA 3PDHA 4QM6A 3UHOA 4U0KA 4GE3A 4WLOA 4IOJA 1NT2A 4GOOD 4XWKA 1GM5A 3L92A 1W9HA 2DR0A 1PYOA 4NSNA 4D8TA 1K2VN 1QOQB 2WVGA 2NM0A 1ND5A 2HQOA 3EPRA 4E33A 2Y99A 3DGEC 1PFQA 4GKBA 1E64A 4BVLA 2DC1A 1QNLA 1KYYA 3H5TA 3I9V6 2UXCB 3AH8A 4IXDA 3KV1A 2QD3A 3R5TA 1YMQA 3O9VA 4FFRA 3ASUA 5D5PA 4BMOB 5A4FS 3DBLB 1A27A 1LI7A 1LLDA 1Y1RA 3COYA 1E7RA 3OCYA 4ARAA 2VUHB 5F5XA 1U3FA 4BIMA 1W87A 3N7TA 1A8IA 1G3UA 4C0SA 1HUQA 2J3MA 2XUQA 3Q3GE 4C20A 3OM9A 1XTKA 1NQWA 3PDIA 2GVZC 4DSOA 2IIBA 3TFQA 3KZCA 4FC6A 4CUJA 3H7IA 3THXB 3GUCA 1Y6JA 1KVRA 1MGOA 3BK2A 2GLTA 1J0XO 1QHHB 3M4YA 3Q98A 4JLMA 3K72B 1NC1A 1NPTO 1EIWA 4RTLA 3UJNA 3OIVA 2ES4A 3LGXA 1SCNE 1Q16A 2P27A 1XZDA 2PANA 4Q1EA 4V0LA 4Y9TA 3W2GA 2NU6B 4N54A 3II6X 2QVLA 1XFAA 1PT7A 1P80A 2VRCD 3LKVA 2VEDA 3M82A 3B9RA 3JPYA 5K3DA 3IX7A 4MGKR 4TS4A 1NGSA 3HA2A 3LCRA 2JCXA 2J46A 1F8FA 4G63A 4TSKA 3DBRA 3PQ3A 3GOQA 1EEHA 4HLCA 4HQNA 3CPSA 5AVTA 4Z8XA 1NWHA 1XROA 5EJ5A 2X1MA 4CM8A 4MVXA 4LC0A 1GNTA 1A9TA 2C78A 4NYJR 5FPPA 1PNOA 4CIVA 1VLJA 2WR8A 5EWLB 4N41A 4HXGA 4MB2A 1XNHA 4CKCA 3DWFA 5AVUA 5DFAA 1E8MA 4GLLA 3ZBQA 1PWZA 4IKOA 3RS3A 4EHLA 4QZVA 2AF4C 1FC0A 1UXOA 3MT9A 4OQMA 5E1DA 1DIBA 1EMDA 4RGVA 2WTXA 3TWOA 3KJEA 3SJBA 2B4AA 4NU8X 1U1IA 3ANLA 4K8OA 2IYPA 3FROA 1D7OA 3BD8A 3SJAA 4BDSA 1H8HD 1SQ5A 3OP1A 1XTZA 3I92A 3M81A 2HSEA 2C7PA 2Z3WA 5TQJA 3Q8KA 3SZLA 5EMLA 1EHCA 5KTKA 4JYMA 3ZH2A 4XD7D 1TW2A 3WL6A 2VZ0A 2ET6A 2HN9A 3HXKA 3K8ZA 3GX1A 1J1UA 4LY0A 4WXRA 4ZYVA 4XLZA 5JH7B 4G9GA 1BOOA 1MIOA 2A2ZA 2F59A 1GTMA 2FSGA 1XT6A 5T3UA 2ISQA 4YIKA 4DE5A 5JEEA 3KUXA 3QTTA 2VWQA 2AMYA 1HDOA 1MX1A 4LXQA 2QDKA 4MEAA 3CVWA 2HU2A 4IBOA 4D9KA 1AY0A 4NONA 2AD1A 5JAIA 1NATA 3H5IA 4WOCA 5KYWA 4RXMA 5EE1A 1T5HX 5MN6A 2W2PA 2R751 1KTVA 3WMWA 4KE9A 3ZV5A 3PD0A 3FPBA 5IEBA 1A1VA 3N59A 3S27A 3EIEA 3F67A 1JHOA 4CM5A 4PZUA 4AN0A 4N3GA 2NV6A 4KSYA 2QVCA 3DL4A 1G7SA 4JFRA 3E3NA 1YJAA 2HBRA 2QVYX 2WLSA 4MHSA 1K98A 3AIMA 5FLEX 2JGNA 4P4NA 5L95A 3OLXA 3HV2A 4B1FA 1VKJA 3FYDA 4MV8A 3V1KA 3THYB 4X1YB 5ALFA 4M46A 1C8KA 1AK1A 5EHZA 4DDUA 3T6KA 2VNKA 3IA2A 5FV7A 1XJCA 4FEAA 4A91A 3KSDO 2P1ZA 1QGYA 4NR0A 5B58T 3L8EA 2IVFA 2FFHA 1HV8A 1JEQB 1KEEB 1VMIA 3UFXA 3PL5A 3DHYA 5F5NA 4ZK2A 3LPCA 3G0HA 2ZYAA 3TO5A 2ORED 2C7OA 4EA7A 4AJ1A 5KYYB 1KZ9A 1NRWA 5J4HA 2EWMA 4AMUA 4ZYYA 2Z3ZA 5REQB 1N8TA 3KVYA 2HHHB 3V46A 2Z2KA 2HHJA 4FHDA 3BXOA 4X97A 5EWMB 4YRIA 3ORYA 5ALZA 2HADA 5EE0A 4F11A 3P2JA 2ZCJA 4YV2A 3TKAA 1NVVQ 3AJAA 2N0SA 5J2UF 3S2YA 5ALDA 3SM3A 2C97A 2GRAA 4GKKB 3QE0A 2GNOA 4RDIA 1LDMA 5EQTA 1U7TA 3VAYA 1VIAA 2VHEA 3IR6A 1FFGA 3RKSA 3U3OA 1YOVA 2PZEA 3KOYA 1I6LA 5DOZA 4BEBA 2Y27A 2YIVX 1OPXA 3UPDA 2FV8A 5JY1A 1QVZA 2XQJA 2XTJA 1Y5MA 4RYDA 1IRIA 3K9HA 2R5WA 1X3SA 3AETB 5I7AA 5C34B 5AESA 1UXHA 2P78A 3MWEA 2CKMA 2F1OA 2ZR9A 4YFYA 2VHVA 3O74A 5B4TA 3BXXA 4DG5A 3TQRA 2C8LA 2GQ0A 5IHPA 4CW7A 1Q2UA 4X24A 4ND8B 5AKXA 3CZ4A 4PLWA 7AT1A 2XY4A 2AFIA 3T12A 4M8NE 1OFUA 2ZFUA 4DNFA 2EX1A 3B6JA 5I9MA 3VV3A 2C7GA 1TEVA 2X4DA 3ORRA 2QL7A 4G0PA 4YUWA 4PHGA 2KHZA 4O4HB 2IYNA 2XZDA 1AXEA 3VFDA 4YA6A 4BVAA 3LUFA 4K03A 4W7HA 2QX8A 1F2DA 1K7CA 3HVKA 1KU0A 3PSAA 3QE2A 5J5AA 2JF0A 3C3WA 4N7RA 3U9TA 2YVKA 3PEVA 5IDYA 3OQNA 1WMFA 2B69A 2C2XA 2X6QA 3IQWA 5GP1A 3IIIA 3W4JA 4NMMA 1YBFA 5EP3A 1L7EA 1RHJA 4UMEA 4YQZA 1IDN1 3P0IA 2FW9A 4XXHA 4C89A 2NU8A 2NUBA 4J2HA 3IO5A 5JQWA 4ZT2A 2FZKA 1TA4A 5L4LA 1OUMA 3ZI7A 1FSZA 1MG0A 4BMVA 3R7WB 2DR3A 4RJTA 3R3HA 1FFHA 2XRMA 1RXWA 2XMPA 1CSEE 3BXGA 2GXUA 3REFA 4TYQA 3VSBA 1W5TA 2HPZA 4BGEA 3L1VA 1VPDA 2H2IA 1E2FA 3OZAA 4P3KA 2EHJA 1XZQA 1KZGB 4NFSA 3MJVA 1BXRB 1SQSA 1YVPA 5FXMA 4JLAA 3RAJA 3AZQA 4IIJB 5I7HA 4DV0B 4DQLA 1OREA 5GADl 2F3QA 2FQYA 4IRXA 5LQSA 3UYKA 4P8RA 5I9BA 4DSNA 3MLBA 1QR6A 4RA9B 1OAAA 2B82A 4P3OA 1DUIA 3IUSA 3SG0A 4UUMA 4CIXA 3LUKA 4P3NA 1Z38A 4UZSA 2EKPA 2WMDA 3R9IA 3ILVA 1EFTA 1K1EA 1L4MA 3EARA 3L4SO 2OESA 3T8YA 5K4GA 2G06A 1XO1A 3Q11A 5CJJA 5DNWA 2XCTB 1IZYA 3PC7A 3WKAA 1QONA 1XP8A 2R1ZA 4FM9A 3KZMA 1D0IA 4G24A 4FGLA 1E7SA 3LT5A 4IDOA 3LY5A 4M99A 1T3HA 2FF5A 4JH0A 1JQ5A 3PUVA 3RYTC 2YJNA 3M6MD 3DAGA 5FUVA 1VI2A 5L45A 1KOLA 3HB9A 5DSTA 1VLLA 2ZT8A 1JPVA 4H6XA 4Z9FA 4LNUB 4DQVA 3S8YA 1NMQA 2OXCA 4ZAWA 2YINC 4XX1A 1K5DA 1X7WA 2DPXA 5D8DA 5JH7A 4KPYA 5KYTA 2O1SA 2IWRA 3VC3A 4WN9B 1D2HA 1QHIA 1VB5A 1N0VC 2OENG 2VJAA 1G18A 1U8XX 2PG3A 3EWAA 1HEYA 5CEEA 3RSFA 3FTNA 3AEQA 3VC2A 3S0JA 5CGQB 3EZLA 4QC2A 5ETJA 4EH1A 1VBKA 1X9GA 5JZMA 1P1FA 3Q12A 1EXDA 1Z6YA 4REQA 2WSBA 1T8YA 4EYEA 5A1TA 1SK9A 1Z45A 3DR5A 3L5OA 5JMPA 1JSCA 1QG6A 1N6LA 3ZY6A 4D79A 3L7IA 3VZCA 1TVKA 3WMXA 2E55A 1VOTA 3KEMA 1OD6A 1QP7A 1I9GA 3KWMA 2AVDA 4LXYA 5EKDA 1U0RA 1YJBA 1Z8FA 3BUSA 3P2YA 4F1WA 4BE7B 2ZCUA 4H1UA 1ODSA 2X8WA 3GLFA 5G1NA 5LM3A 1R00A 2XGGA 4DCCA 3VM6A 5JMWA 3BWBA 4G8BA 2DUMA 4ZVOA 4G2NA 4WECA 4IFTA 3F3SA 3BE4A 4WERA 1PLKA 1FTSA 1H8HA 2PMEA 4KQMA 4AJNA 8OHMA 5IT9A 4A8HA 1HDXA 2VQ6A 1L6RA 5MHTA 4YY3B 3ICOA 3TRFA 5COQA 1RQPA 3MPOA 3OT5A 1V5GA 2CUKA 3STTA 3PGLA 1E89A 1XCMA 3HXMA 2CVQA 1HDIA 2ZUSA 1HI9A 1R6DA 1KIFA 2OGSA 3C3EA 3NHLA 3IO3A 1C4XA 3I52A 2BUAA 5J2TF 1VIDA 3G9UA 1QZXA 2MYNA 4Y2QA 2X77A 5LMCA 1FE8A 2EV9A 3GJ6A 3GL9A 3MUOA 4ZT6A 4LSZA 4QKQA 1N6IA 4WESA 1G8AA 2LP4Y 3LWDA 2IT1A 1Q0TA 4JJEA 3ZY3A 3M8KA 1WD7A 3ULKA 4YMWA 3KFVA 4B31A 4YRPA 3LX4A 5L53A 3C5CA 4NBRA 2HAEA 3OTWA 3FYUC 2ZAIA 2VN8A 1T0HB 2GASA 3JS5A 4OGKA 3KZ1E 4RY0A 2QIOA 1WDLA 2IODA 4X93A 2DY1A 3D3KA 2XZLA 4HN9A 2GO1A 3WO1A 1CF4A 2IPOA 1IZ0A 5CYGA 2PGOA 2BMJA 3BTOA 2EJUA 3DB2A 3E9NA 4RA6B 1XCJA 3HN2A 2BGTA 4B76A 3IXMA 1N33B 4IZOA 3HQ4O 4BKQA 1EH5A 5A9SA 4IX9A 1CUBA 1KY4A 1RI5A 2VPYA 4FGZA 2CL5A 3R0QA 4PF1A 5HIIA 1YS4A 3IILA 4OIFA 5HF9A 3KSAC 1T1GA 4ED9A 1M2KA 5DW3A 4TTTS 2AHOA 3Q8MA 2ECOA 2HRBA 3BGVA 1QP8A 4LDRA 4IGAA 3O8OA 4ZEWA 3USCS 2BIFA 3K6SB 3HDJA 5I9TA 3STXA 1P1KA 4HQLA 2GFIA 5GV8A 3F97A 4EFNA 3PVZA 5ALGA 5CNMA 1NNSA 1B3RA 1KOFA 2PX4A 3KJZA 1DBSA 2HA6A 3CXRA 1NBEA 4BJ5A 1U0JA 3U44B 3VVBA 1AH2A 4EGAA 3G9QA 3USES 4R9NA 4J2OA 4Q6WA 3NP7A 4U6SA 1Q95A 3IIEA 3PCTA 3FB1A 3MCAA 3DL7A 1LPOA 1BD3A 4U0JA 3JRWA 4OXYA 4Z99A 5BW6B 1PTJC 4Z53A 1AMUA 7REQB 1VCHA 3TTUA 1W29A 1VRVA 1PK9A 3LF2A 1RRVA 4L4UA 2YWRA 4DLYA 2NSJA 2O52A 2IRWA 4L5JA 1PR5A 2H8KA 2I67A 3GDWA 2WIGA 4S3MA 4UEKA 1ETUA 4QTXA 4QOFA 1PX0A 3LV8A 4R9VA 1H3EA 2Z0MA 3TBFA 2ZXFA 3I05A 4H59A 3ZIAD 2FMIA 3ESRA 3UXYA 1CP2A 5F9HA 3U6KA 1IUPA 4QYMA 3H4TA 4WX2B 5CHEA 1SU6A 2QTCA 1Z5NA 2OV2A 2EIHA 4MWEA 1RADA 1JYSA 1PG2A 2I3AA 2WJ4A 3P4UA 4WFJA 2FPIB 5I7UA 1YUMA 3HJBA 1XRRA 3EK2A 5AFSA 2Q3FA 1THGA 5D3KA 2YV4A 1Z2NX 2HA5A 2JGKA 1I51A 2ZI3A 1KETA 3FM9A 3KSRA 3DE4X 3QJYA 5TPWB 3GUYA 4D3SA 1OSNA 3KDPA 1OGYA 2VEOA 1T4MA 3L0CA 4NLLA 2BSXA 5LOVB 3UUEA 2NU7A 4UC0A 2BCJQ 4ZOBA 3OF2A 5LWHA 3FVRA 3L6BA 4QO8A 2W2MA 3DD1A 5GTDA 3ZI4A 2D54A 1T9BA 4DMUB 4ZICA 3NH6A 3E3MA 3AVWA 2VAXA 3FPCA 2PKEA 3T34A 2OO7A 5LXTF 4Q7QA 1KEKA 3EGIA 3KTDA 4G5YA 4IZIA 3K9CA 1OZHA 1YRQA 5AW1A 1Q21A 5KWVA 2AS0A 1HXHA 4XPZA 4HATA 1B73A 1P6UA 2XDYA 3ROZA 1N1GA 2ZQZA 3TD6A 1Q1BA 4NG4A 1BCRA 1NULA 1Q6ZA 4G65A 4GBGA 3SSOA 2X23A 1SJ9A 4A5OA 5L3QB 5L8VA 3KB1A 5FBWB 1P8JA 3EXHA 4CT4B 3P9QA 4Y6OA 3PXDA 1QJ4A 3ZYCA 5FWAA 3DKRA 4DLTA 1LXCA 4MLPA 1NUSA 3NM5A 1JSLA 2JKYA 3KBOA 1W1WA 5KU7A 3FHTA 1GSIA 2NO9A 2OCXA 2J3JA 2RHTA 1CQJA 1JEAA 3DONA 3EZ6A 3LA6A 2V7WA 4S2UA 1N78A 3VGJA 1H9BA 4P5EA 3NOOA 2GPBA 4J7CA 4UAUA 2VBIA 4MULA 4H60A 2JAQA 1R0ZA 1C1XB 1GU0A 3HADA 4MGZR 3LQRA 3GU3A 3FZNA 1XMXA 3U80A 1VP9A 3AINA 1L0BA 3FKJA 4UNPA 3SR0A 1A5SB 5BR8B 4E4RA 4NS4A 2HC9A 4RY9A 1XZJA 5TS3A 4W4TA 1QS0A 1BEZA 3IPAA 1VHQA 1IOVA 4FR2A 5LXTB 4BYMA 1KIAA 3UKJA 3VNAA 1N7HA 1ZD3A 3FTQA 4PFQA 3VI3B 4DRZA 2MJLA 3U7HB 4NQRA 4IJQA 1P4AA 4FPXA 3B89A 3KLNA 3EB9A 3PYLA 4G67A 2N3ZA 4UM8B 2WYOA 3MTDA 3R2JA 4PYLA 4XASA 3V9PA 3ADPA 4M8KA 1M2OB 1Y0BA 4B7UA 4YQFA 4G0WA 2YZMA 4ZYUA 4YJ2A 3DL0A 1LK0A 4Y1EA 4LOJA 4AKIA 3A70A 1QO9A 1A2BA 2R6FA 3KB8A 3Q85A 2AFVA 2PLAA 1KO5A 3MAGA 4PPQA 2HBZA 2CCJA 4EITA 1YKSA 2W6OA 4AJHA 1BJRE 3FDXA 4WV3A 4YAKA 3QMPA 1WCIA 4GPTA 5IJ0B 3WIBA 4KFUA 1SXGA 1A5BB 2ZAYA 5AM1A 1LVUA 4PFJA 2D13A 2MYUA 2A5YB 4FXPA 2PRSA 2H6EA 5BR1A 5JNWA 4EQ6B 2TMDA 1EJ6A 1G5TA 1SXIA 2RH4A 2ZAMA 2KQUA 3CEJA 1GQ2A 3BXEA 3HYLA 4E3ZA 4OX9B 2W71A 3UT6A 4RK1A 3B3GA 1LK7A 1V3TA 2WVJA 4F91B 4HX9A 4IQ4A 4YCNA 1YHNA 1WMAA 2IYQA 3KQKA 3SZOA 3TMKA 2J7PA 2MIIA 4A0HA 5LD2B 2HT1A 1XF9A 1VFNA 3IP9A 3JQAD 1YXMA 2IXBA 1RSZA 2PL1A 3AJRA 1M1YE 3C6QA 2YL2A 1Z9BA 5BOSB 1K0UA 1I1OA 2EDCA 4JP2A 5HUHA 1UQUA 2OBFA 1EFUA 1I4LD 5FR2A 5TGTA 3UATA 1PR3A 1SVOA 3PF8A 4F06A 4YLYA 1MB9A 3IC5A 4O4IF 3D7NA 1JHRA 1BFDA 1AZTA 2H1FA 5THKA 4B7AA 2PJRA 3O03A 4TT3A 1V8FA 2ZGVA 5HK8A 1UPCA 2ZUWA 4PQGA 2KLBA 2P9FA 4BMYA 1RVDA 1ZQ1A 2QLNA 3AWDA 1WBDA 1G59A 2PCLA 2Q4RA 2P30A 3GFQA 3UC9A 4A23A 4X92A 2QMQA 5DZSA 3RFTA 2G6BA 2Q3CA 1Q14A 4M88A 5ARCA 5D3ZA 3WGQA 4DFDA 4J8PA 3JD0A 3DTVD 3JX9A 1JAHA 1GG5A 1SIUA 1WMBA 2ONKA 2BT4A 2QV7A 3NKFA 4FR0A 5L51A 3I2GA 4AULA 3W5AA 1GEEA 2M6RA 1VGRA 3CVJA 4R9SA 1JHUA 2OAEA 2NXNA 1S2DA 1GRRA 2OCGA 2CL6X 1R9GA 1EVEA 1UK7A 2V55B 5KDLA 1V1MB 4G85A 4WCFA 2PLWA 3WGMA 3PEWA 2IZ6A 1JHVA 1WD5A 2DQYA 3TTTA 2DG2A 1E1CA 4GGPA 1DMRA 5KI6A 1Z8NA 4JBGA 1DQSA 4JVOA 1SCBA 4ODIA 2ZXUA 5CDFA 3WLIA 3H8JA 2G09A 3VKFA 3GLFE 4M6WA 3LBNA 4J4HA 4ND4A 4O59O 1JHDA 4GMFA 4DQDA 1ZD4A 1ZYUA 1ZLXA 2B4YA 2GPYA 3CZ9A 1NAIA 1RWXA 1D2MA 4XDZA 5EIEA 2PXAA 1DJQA 1TKBA 3WLSA 3ONNA 5E2AA 1JR3D 4O2BF 2EATA 4ZHQA 1XNGA 2VUSA 3A28A 3KKMA 4JBNA 4TXNA 4Y7CA 1YTLA 2OZLA 3VYWA 4KRYA 4M60A 4CLEA 2NO4A 4OMUA 4HTFB 1QRAA 4H4CA 1GZ7A 1QAMA 2CYAA 3B3FA 1XLTA 4ZVQA 2ZUCA 4EG7A 1V1JA 2GPNA 3N0XA 5BQOA 2YMQA 1MR3F 1YRLA 2F3UA 3T4XA 4BFYA 4V3CA 3G9XA 4GMDA 3REGA 4O4HF 2DZDA 2AG6A 3O4HA 2Q1WA 3RVSA 4HWGA 4R5MA 3RIXA 4HJRA 1JAXA 1PJRA 1IBKB 4LYAA 2ZRFA 3T1TA 2ZJYA 5J4LA 3M33A 2JIRA 3E82A 4KXLA 5L6MB 1NYRA 1Q15A 1WKBA 4KU4A 4WXHA 3O4JA 2WNSA 4P7JA 2G9NA 5CM9C 3HBFA 1GPNA 4D9BA 1EZ4A 4RSMA 2VJQA 3N2EA 3ETHA 4ND3A 4B80A 2W98A 2VHJA 1V8PA 5JSZB 2OILA 5B1SA 1BHQ1 1US8B 3DKKA 3P4YA 2XUHA 4FXOA 1FXUA 2PAAA 4QT4A 3AI1A 5C80A 2X0KA 2H4JA 2VBFA 2NV2B 3EPLA 4BNHA 3I4FA 5CA0F 1ZHFA 2REOA 1UC4B 1VYHA 4RLHA 3Q9NA 3JQ7A 5FWXB 3WWEA 2Z83A 5HS6A 2C4VA 2Q5JA 2BSQA 1OB5A 5JFGA 3L7AA 5JS6A 2FR0A 3CEAA 1HURA 3T5PA 4L4ZA 4AFNA 3SGLA 4ITUA 5ICFA 5JFTA 3NTOA 4GEKA 3V2GA 3ZVKA 1FB5A 2GXSA 2PYZA 1DQZA 2GA9A 1K92A 2R6JA 1FMTA 2R8PA 5CLJA 1S89A 2FWBA 4YCJA 1R74A 1OLXA 2WT4A 4JUIA 1D1QA 3B6ZA 4FYYA 4WTOA 1WX1A 5REQA 1BAPA 2UZ1B 3QZUA 5ALUA 5BO5A 4AKTA 5JTUA 2JK1A 1HYQA 4IDCA 3PZRA 1EFLA 4JLOA 4PHTA 2CFIA 3NW9A 4M0EA 4PSVA 3ZBUA 4BZQA 5B6IA 5BVGB 3ECAA 1XUOA 1C2YA 2BONA 2OD7A 4YJ2B 3RC1A 3W4KA 5IZCC 3G2MA 1YGPA 1O8CA 5CW1A 1EJ0A 3MK31 4UNQA 2AIRA 2WJ3A 5CIQA 5CVDA 3W9YA 4X66B 1A5ZA 2UUOA 1F4PA 2ZTLA 1DX6A 3OKPA 3HSYA 5BWOA 4N3AA 1ZUD1 4B09A 2XCLA 3CF4G 3RT1A 2XYVA 4EECA 1G63A 4TMYA 3SQNA 2OZVA 1E1RA 2WF7A 3ZQ4A 4G1BA 1K6EA 1TU0A 4CL3A 1EGVB 4EHBA 2ZT5A 4P0TA 4F9GA 2B4RO 1Q1NA 4M7PA 1YZQA 3LL7A 3UK6A 4A8JC 2ATIA 2EJVA 5GAJA 3FCCA 1V3VA 4QRIA 5CVJA 1XMSA 1DL5A 3WBFA 1NG1A 1HE8B 4NS1A 1AN0A 2GZHA 2UVPB 2ZT6A 3FCXA 2CHUA 2XECA 1THMA 3K0AB 1R0XA 4GPBA 4I7EA 4C29A 4HVLA 4POOA 4LZLA 1KZ7B 2BM9A 3QTLA 4LQCA 5HKKA 1ZMBA 3CJTA 4F3TA 4O08A 3IESA 1JHYA 5JO0A 1DAKA 1JT9A 2W9XA 4Z49A 3C6XA 3VO1A 4B3HA 1Z15A 1PVVA 3WDKA 1IZ8A 1NMYA 1KPGA 4KFCA 4XAQA 3ED1A 4MUFA 3FMFA 3PGVA 3GI1A 4MCJA 4TL9A 1B8OA 1C7RA 3TI7A 4BEVA 5HIAA 3VR3D 4WRRA 3X2EA 1ZI6A 1Q7RA 5J2UA 3VHXA 1G20E 1UINA 2VF5X 4DUGA 1Y98A 1AG9A 3VR0A 3ZVRA 1FYVA 4KAXA 4RKFA 4PW0A 1K7EB 4CLRA 1O9GA 4Q9AA 4YJ3A 3PDJA 3PUJA 3WFIA 2Q4DA 4QTYA 2I5PO 1R5JA 1YJQA 1JTFA 2A67A 1P0CA 2YUIA 1TD9A 4KC0A 1JEYB 2JAXA 4QVGA 3ZD6A 4K0KB 1DXQA 1EM8B 1CC1S 2EYUA 3A2NA 5LZ4A 3TEMA 5BUSA 3K2QA 4CRWB 3ERCA 1JDBC 3VNQA 2ZBFA 3ENZA 4PEVA 5ES4B 4NBUA 1H5QA 1B0PA 3OFSA 1BRMA 2DKOA 1X8KA 4G5QA 1YS1X 2B3DA 3E9EA 3KV3O 3EGVA 5ADUS 3QE3A 2I1WA 4JI5B 3F6RA 3WL8A 4L5IA 4PCUA 3IAAA 4CDNA 1KI1A 3OQMA 4V0OA 4PRKA 2IY9A 1DJNA 1IOWA 3OX3A 2ZWAA 3T52A 4DR1B 4HP8A 1Z5GA 1M2EA 1GN8A 1KWKA 1DDOA 1NXWA 3E9DA 5FP0A 2BP7B 5FWNA 4QIHA 3WGKA 4YT8A 2I7DA 4GI2A 4DCJA 2ZRAA 4YDRA 2F8TA 4RKQA 3LT0A 1CHNA 3NWPA 1L7AA 3NC1C 5ITSA 3MINB 7ADHA 2IC5A 3THWA 1YUBA 1U6KA 3JQGB 3V3TA 4HRVA 4JI6B 1Y3DE 1MRNA 1XQVA 2NTYC 1E5TA 2JAUA 2XUAA 1UMCA 4HDKB 4AROA 4DMHA 4EAAA 3GGDA 1Q5PA 3VHXB 1ZH2A 2PZ8A 3FLMA 4CPDA 4ZGBA 5TQ2B 1MC4A 1NVXQ 3FOEC 2PX0A 1P19A 3NHUA 4XR4A 2GBLC 4JBHA 1JA9A 1Z82A 4PTLA 3HCNA 5CDSA 4D9IA 5IHXA 4P08A 1PAUA 3CZ5A 3H04A 1C7FA 4P4SB 3UMBA 5C18A 1PEYA 2P11A 3JZFA 3I5UA 4HADA 2O8CB 2WSSD 4IHKA 4AECA 4O29A 1XHLA 1XPUA 1FRNA 1SC1A 1M8GA 1SFRA 3AKDA 2NAPA 2ZE8A 1ZD1A 3EIFA 4JYAB 1IU9A 2H2FA 5DI3A 5IAGA 1N5DA 4F2DA 3CPEA 3MT8A 4MYTA 5AJYA 2MCFA 3CLSC 4QDKA 5JWHA 4YCLA 4I99A 2VYQA 5ED0A 4ESHA 5JAMA 3PNPA 3PITA 5DB4A 5DHSA 2WTUA 1P2UA 4JQYA 4M3NA 1WBJB 4TMVA 4BDTA 2ZI9A 1FTWA 2XSZD 2QLBA 2DSNA 4MVYA 4RFSA 1CUUA 2YVUA 1CRLA 1G5RA 2VJMA 2OSVA 3C3BA 5EZYF 5EXPA 5BY2A 4FLMA 3K2IA 4C7MA 3HN6A 3GLFB 3BRWA 4YACA 3MOIA 1FFYA 3C1UA 1MEEA 4GUDA 3IP1A 4BFXA 4E5SA 1NSTA 2PRJA 3R1IA 2BR5A 3L0OA 2OK8A 3AUXA 2HDHA 2QI9C 2YASA 4MPPA 3NAGA 1TT5B 1XI2A 2Z2IA 3BGDA 3A1WA 4FOPA 3WGNA 1ESZA 3D02A 1XRLA 1QZTA 3TEJA 1ICIA 2JIZD 1EVKA 2A9RA 3EVCA 2QAGA 2VTEA 2Z3VA 4B83A 1YQXA 5JH7F 1HOXA 4X0EA 1W19A 4B4VA 4B43A 3P19A 4UU1A 5F78A 5AI0A 5H4GA 1AX9A 4L1KA 2BY4A 3JQCA 1TPZA 1SCAA 2QY9A 5ESXA 6ADHA 4QHTA 3C4VA 1G21A 5E9QA 4RADA 3CXUA 1P3Y1 1RAIA 2PD4A 3KD3A 1HFWA 3ZOKA 2VTVA 2V0GA 3KG2A 1IK6A 1G19A 1Q6YA 2GRUA 2ZTHA 3A1CA 2G5GX 3FNQA 1W8DA 4M0MA 4RABA 4UXIA 4DIOA 1XWIA 4OP1A 4RH1A 3T3NA 4LGVA 4X1KB 2DVMA 3X43A 3SQDA 3U19A 2RAVA 4GKAA 4Z6KA 3S81A 2YOFA 2NZ2A 4WW0A 5K0NA 3ZWMA 2J0SA 4L8GA 4UDNA 1ZD5A 5CDFE 5IFLA 1X7ZB 1E0DA 4GO1A 5WRFA 3ZWDA 4FONA 1XQ6A 1G4UR 4J0HA 2PMKA 3ZV4A 1TQHA 4DIDA 3NBXX 3QMMA 3L8ZA 1G8GA 3RUIA 2C9MA 1L5HB 2C54A 4P3YA 5DRYA 4BMZA 3O9MA 2W6NA 2BHRA 3AOEC 2HF9A 3RYIB 3GFGA 2H7YA 3EGXB 3B5EA 3I76A 4CZ2A 3SNHA 5A5DA 1CR0A 1WCXA 3DFFA 4BFTA 3LUBA 2FZ5A 4KG7A 4RPKA 4XTRA 2NADA 2JEYA 1DADA 4LKOA 4I1PA 2L19A 1RZ3A 2H29A 2BI8A 1E0KA 2FPUA 2ZIFA 3FXAA 2N42A 4G1EB 1JALA 4MLDA 1PT9A 2IW3A 2ZYTX 1O6FA 2F1IA 3LNTA 4ETIA 3UYLA 2IIQA 4TKVA 2NQTA 4EGCB 4QBGB 3WK4A 3KCNA 1N2GA 3EA0A 4JQZA 2Q7OE 3D2LA 3Q2OA 1ML3A 1N3BA 2TRSB 1G8KA 4FGSA 1I2CA 3R23A 2OGWA 1J2YA 2NU8B 4JI0B 2JLYA 1TMOA 5FL7D 4MS3A 3VHQA 3ZHZA 2QVXX 4U6NA 4URVR 1ONBA 5JC1A 2HA3A 4OQEA 4OYLA 1BYIA 2JL1A 3TMYA 2X9QA 5I8ZA 5A7HA 3QE4A 1A5AB 3LGAA 3LX5A 1FNBA 3O9ZA 4PLPA 1RMYA 1SQ0A 2X4IA 3F3MA 3QFFA 1T0PA 1I3OA 4KQGA 1Y8RA 2RHWA 2O3JA 1SU8A 4ZIRA 1ZNYA 1P60A 2IY8A 3DAOA 2CL7X 3H1AA 2G40A 3N76A 4UPVA 4DA9A 3LCMA 2YR0A 2QZSA 2AMVA 1OVGA 3O8LA 4YYZA 1GDTA 1BMTA 3D6VA 4LF4B 3FDZB 2IUYA 4N8DA 5KVAA 1JE0A 4BWGA 2JFPA 2IEZA 5T41A 4MV9A 5H5JA 4B6QA 3WYCA 3W0LB 1QSGA 1B0ZA 4BKPA 2O4UX 2IH4A 4OB8A 2VOJA 3PB3A 5ALSA 3AO0B 1F17A 3ZHVA 3WMGA 2DETA 2ZSFA 3HUUA 4Q15A 2BZSA 1X0VA 2QP4A 2Y71A 5B57C 1CJUC 4MP6A 5CH5A 4HLDA 1NBOA 4PHCA 3AHHA 1RLUA 2B7LA 4JI4B 1KE1A 1O08A 1XEXA 4GT1A 2YC2C 1YCFA 2D62A 5EJ7A 2A0UA 3LZDA 4GPEA 4U2FA 1E6UA 1LPAB 4G4SO 1R88A 1FMLA 1DFIA 5EZSA 3VR5D 1M2NA 1ZESA 2H7VA 4E5KA 4Q4AB 4V0KA 4Z4HA 3V8QA 2PXHA 5AHOA 4M4SA 3OAAD 3JYPA 5JJIA 1U4SA 4JLVA 2AGVA 2FW8A 5C4MA 1QKKA 2WB4A 3WL5A 1E0SA 2QTTA 3KYCA 3D6UA 5A02A 4CL2A 4LF5B 1CR4A 2DPGA 2EFJA 4ARIA 1O94D 1X7WB 4LXHA 5DHQA 4CCWA 4EMSA 1K6JA 2RB5A 2JNWA 3BK1A 2JZCA 4QPNA 4AMZA 3FVQA 1O89A 2A4KA 5IDWA 5CEFA 2HJGA 1JVNA 4PRZA 3EPJA 5BT9A 1OV6A 4JLUA 3GUHA 3PHBE 1HNWB 1QO0A 3JQ8B 3AHCA 1AZWA 1KFEB 1V37A 4EAQA 4PSAA 1PNVA 1YR6A 3PYXA 4KOAA 3QX3A 4X1IA 1GWNA 3HU2A 3DUFB 4YRQA 3A1UA 3ZKWA 3OJEA 4WHMA 1BKYA 2XKJE 1U0FA 3IUEA 1XMJA 5A0FA 1AUXA 1MJGA 1N6RA 5FTNA 3ZVNA 2GARA 1YVDA 4X6YA 3QF7A 1X3LA 5J63A 3W2HA 5JRZA 2DE0X 4EYQA 4ENWA 4RZ2A 1Z68A 4I1SA 1ORHA 1H0KA 2D2IA 2HO4A 2X7XA 4R5HA 1WXHA 3OHMA 4WDQA 1FFSA 2CK3A 1Q0PA 1FPQA 4RZUA 4DYVA 1X7YB 4JI8B 4TMZA 1ZMTA 4X7BA 3FSGA 4H3SA 3KQPA 7MHTA 3MCWA 5ALQA 2FETA 2P4QA 2HQRA 4A2WA 1W34A 3FTDA 1XEWY 2ZAGA 1R5OA 4GC5A 3F6YA 1BC5A 1O6ZA 3FCUB 3PLNA 5K4HA 1YVRA 4PLVA 4PSCA 2C92A 3T4UA 3VA7A 4EGQA 1JH9A 2I9KA 3ASZA 5ECGC 5LQNA 1F60A 2I8LA 4C6TB 1ZRMA 2C9ZA 2OWDA 3QELB 1I1QB 1DBVO 2C96A 3QPDA 4YLEA 4V1CB 1DAPA 2B6NA 1Z07A 1H2BA 1O9BA 2L17A 1RLMA 3DFKA 1E1QA 5E2BA 1HSZA 1XALA 3MD0A 2UZIR 3E9RA 4KACA 1XLUA 2G5CA 3CRMA 4DSTA 2BJWA 2Q9BA 3K35A 1ID1A 1AN9A 1EXMA 4L0MA 5FOTA 3TZKA 3A6EA 5A5FA 1NVDA 1S9DA 3D6TB 1AKWA 1NDQA 2Y1KA 4K6FA 4TM7A 2WHQA 3IEXA 5C52B 1LS1A 2MHCA 4N8EA 1QTIA 2VIIA 3JQ9C 4UCQA 1RLJA 2C8KA 4R7ZA 1UEIA 1U8UA 2VJCA 3B85A 3N53A 4KNVA 3BDIA 4RPJA 2RMKA 4LV6A 1ZZGA 3WHIA 5DIFA 4Q1BA 1HLGA 2ZJAA 2JHAA 4QG3A 3IQHX 2QRKA 4BVEA 4DM3A 3C3JA 4L3OA 5FPHA 1G8SA 2GXQA 2HCBA 2P4EA 1COZA 1WHTA 3LT2A 2J0UA 1LRKA 1UKEA 1L5HA 3W1EA 4NJOA 4XLLA 3UICA 3ICEA 4UTOA 2TS1A 2C00A 3T5DA 5F3DA 1XRMA 3KQLA 4WASA 2QK4A 3DE2X 4L8FA 1FA9A 1GO2A 2OUIA 2VATA 3BIXA 4JCOA 4FFSA 1CY2A 1CS0A 1KSJA 1XTQA 1CYDA 1L4GA 3DMNA 3BHMA 1JV2B 4KUHA 3ZK9A 4D74A 1E7QA 5HRAA 1CDZA 1Z2AA 4D3DA 4H0NA 2QEQA 1COWD 1W30A 4LY3A 3VSDA 3GPDG 4O4JF 1EK0A 1K6MA 1CRZA 1A2OA 1IWOA 2PL3A 1H3FA 2CMKA 3CW8X 4M1SA 2A1TS 1TIBA 3H4VA 4OOEA 4YP5A 4DCVA 1ZOOA 2O2DA 3SXJA 4NEQA 4RTPA 4KO1S 4N9QA 4Q21A 3OA0A 3DV2A 4CM9D 1TEHA 4EM6A 3OTOB 4HJXA 2GHRA 5CCDA 1DC4A 2NU6A 4RANA 3IQXA 1SBZA 5E7MA 1XP5A 3IDFA 3E05A 2GPWA 3K6RA 4MVJG 3RI3A 1IHXA 1G0OA 1J20A 1SXQA 1KQFA 1AV7A 3IBGA 4QOHA 3I9NA 3ICPA 4KXFB 4ENUA 2WP8J 1UPBA 2IDMA 1TC1A 3TRIA 2ODBA 3E58A 3FPSA 3FNHA 1J8VA 1E1MA 4D7AA 4UHCA 3LFUA 1D7AA 4L7QA 4KKXB 3TKLA 3OKAA 3UB4A 1FXWA 1Z8HA 4MW4A 5JLJA 4G4GA 4PO3X 4Q93A 1U94A 1E3SA 2I9PA 4E15A 5LD2C 4XVCA 1CUDA 2G07A 4QVIA 4L78A 3BORA 4LZAA 5CEJA 1HETA 4Q18A 4YAUA 2IOQA 3KT3A 1R6AA 2HCJB 5A9TA 2CXPA 3DD5A 3IQZA 4IZ6A 4UATA 4BUJA 4DYHA 5EOVA 1RJWA 3K53A 3KQMA 2AZTA 3ZR4B 3EG9A 3NRBA 3QBDA 3BF8A 2Q6OA 1E4YA 3FFTA 2EXXA 1P9WA 2BFNA 1UOOA 3H9JA 2PY6A 1KAMA 2O07A 3A1TA 2YIDA 5FUBA 5G41A 2C2BA 3T3EA 4ZZ1A 5B6PA 3F47A 3W5HA 4HNVA 2ONZA 1NJ5A 1P17A 1T2DA 2P9HA 1IBSA 2RHRA 3CJQA 3MNFA 1OLOA 3MPUA 2DU8A 3TK1A 4DCGA 4Y0NA 2P1DA 4NU0A 3KPJA 1JUDA 1PG5A 3MWYW 3PUWA 2BC9A 1G7TA 1LF0A 1BMFA 5KVSA 1AK2A 2BPOA 2OG2A 3KUUA 4FZ3A 1DC7A 1TZ2A 3JR3A 1JG2A 4ZP1A 3SCZA 5K3OA 3UTDA 5AW2A 2BF7A 2D3WA 1QF7A 2H85A 4BNXA 2C8VA 1NYQA 1P73A 2YN4A 1MENA 2B8TA 5IDQA 3AVYA 2LCIA 3GIDA 4ERNA 3B36A 1JJFA 4IICA 5FF9A 1L5KA 3E2MA 1OXBB 4LTNA 4ZRDA 3AI7A 5TQ2A 3SR4A 3VPFA 1O7JA 3UANA 4CI0B 2JIMA 1MGPA 4YMGA 2YKGA 1F7VA 1EINA 4W8OA 2PEZA 3OEED 4WLNA 1M6NA 1ZCJA 1OH6A 1XDUA 1B2LA 4EOGA 2XVXA 3JYQA 1M34B 3ABRB 1CP3A 3BPSA 3DOJA 3U1TA 1NQXA 4DOMA 2C1EA 3LQ2A 4Q4CA 5CD9A 4GI7A 2JS7A 4BO4A 4EY3A 3TBHA 2YFHA 1RYZA 3FF1A 4F3YA 4B82A 3SVTA 1GTSA 3R7NA 5JD6A 1YS7A 2BFEB 4QTZA 3CKMA 4DIMA 2IEBA 1JS1X 1N75A 3PIIA 5TRTA 5EFOA 1AA9A 2M9MA 1FVHA 4P7BA 5K3EA 4RD4A 4NMWA 5EJMA 2DM6A 2XNJA 1RYYA 3JY6A 5B5SA 4PIVA 1EVQA 1HMPA 3MJRA 1Z63A 3EXG2 2WRZA 4B3FX 4QBKA 3ZQ6A 3PJRA 3OIFA 1TK3A 5FUYA 5IX8A 1Z73A 2R0QC 1D6JA 4K2AA 1M0WA 4R2KA 1D1PA 1JFVA 2VPWA 3CE9A 1N3LA 3DMTC 3GBSA 4F46A 4GYWA 4O4LF 4HDAA 2GAAA 1E2BA 4YUXA 2I2FA 3QU4A 4TOIA 2Q5IA 1SHTX 4O63O 3C48A 4G4IA 3NEJA 2JCYA 2XNCA 3IXLA 1L5WA 4PFKA 3HWRA 1KO1A 1R0YA 3C3PA 3Q2IA 1AKYA 4XWTA 5LLTA 4NDAA 2YZ7A 2AI2A 4IWNA 5C5IA 1LQTA 1OYWA 1UBKS 4MS3B 3RVKA 2A0XA 1XRPA 2Z8ZA 3NALA 1ND6A 3RPEA 1VHLA 1T8RA 1XRNA 4I9UA 3AR3A 3LCJA 4C5CA 2NSLA 2E5FA 3HR4A 4QQ8A 5FOWA 2J31A 5EPEA 3SOPA 3W2TA 4P22A 1JYFA 3EY9A 3QXHA 5ELLA 4YRRA 1BU5A 1O03A 2AWNA 2I6GA 2OCPA 2Y9PB 3GT0A 1ZK1A 3HV0A 4LY9A 4FYMA 5LCXA 5KC8A 3BZBA 3S8EA 3Q40A 1I0ZA 4BCDA 4HUQB 3RSQA 2DWUA 9ABPA 1CYEA 2GEBA 3RBXA 1TFRA 3BH0A 2W6ZA 2PFKA 1FUUA 4IUCS 4UHEA 1NW5A 4WZAA 5EP4A 5I7OA 4BQEA 3RJMA 3WO0A 5ALVA 5DJ5A 1H4SA 5B1EA 4DSAA 3I28A 3SK0A 2FVXA 3MTBA 3NS7A 4N0DA 3V6LA 1Y89A 2NPIA 4X6LA 4C88A 1A9XA 1O5OA 4P32A 5HQJA 5AVZA 3ZQJA 3GO4A 1C14A 1OV4A 4WESB 1U28C 1ZWLA 3OHPA 1VE9A 3WJAA 1QPZA 1LY1A 4P34A 3HJTA 3ORQA 2XX3A 3ZGLA 4EJ0A 5BOSA 3QGMA 4MTCA 1HY3A 1OA0A 4AZWA 3QX7A 1I4OA 3M6AA 4RETA 5H59A 3UJ8A 4D1YA 5KIAA 4LMPA 3D4PA 4RMGA 4UEJA 4F2WA 1R8XA 2PBRA 1U65A 4O2AA 1JQJC 2HXYA 3UAXA 4DLKA 5JV5A 1X7DA 4B8ZA 1PYDA 2FOIA 4O2BB 5CMLA 3O93A 1U3TA 4MKFA 1U7OA 3RHSA 2CK3D 5TB5A 2M32A 1ZI8A 2IYFA 3F4LA 1KK0A 3AERA 2H00A 3UUWA 3K4HA 5H81A 2NTJA 4TV8B 1P0FA 5JRDS 3GJYA 1DOHA 1U2RA 4Q48A 2QRUA 1X80A 2VH1A 1JZQA 3A4YA 4MSUA 4R01A 1RFGE 2H48A 5C7OO 2W6IA 1ZP6A 3L6CA 2GR9A 2AFHB 1OIWA 1KAEA 2JLRA 3KALA 3BRQA 4MR9B 1K6XA 2ZU0C 5ICGA 2O5CA 1R0BA 4BBJA 5MN4A 2E4UA 3TR6A 5LNK1 2CFTA 5KWJA 5FOSA 1NN5A 1CZOA 2RHBA 1QO0D 4UHBA 5BW5A 2CNLA 3BREA 3DEKA 4A8PA 4NJEA 4Z0NA 2QXUA 3Q6MA 3SC6A 2J6IA 5LQAA 1PDVA 4H3VA 5LR6A 3IURA 2JI4A 4JB2A 4X7MA 1OYVA 2IJGX 4OHOA 5F52A 3BIJA 4Q7KA 1C9NA 3AR9A 2WJGA 3NCHA 4IXTA 4OHCA 4CR7A 5AKLA 3HFSA 1I36A 3LJKA 6LDHA 2IITA 2XJ4A 3ANSA 4MQLA 4Y2GA 3UA4A 4AQYB 3CO5A 2YZNA 1SC6A 2QY6A 3JWJA 3OAAA 5JYBA 3QNMA 4ZVLA 1ZL2A 3V8PA 3H83A 3SX4A 3VYVA 2VAVA 1QGDA 4PZPA 3WGIA 1DUSA 4M1OA 1Z28A 4LVOA 1ECBA 1MB3A 3QPWA 5F23A 3TLXA 4ZKDA 4GPAA 5TMBA 3ENKA 2WA1A 2Q07A 3UCXA 4YRJA 5ITWA 1JDJA 5AKKA 5T4EA 5FJIA 1DXOA 1EP3B 1H3NA 3KEOA 2A0KA 2R7MA 4WY5A 2BFEA 2BDTA 3EJ6A 3CSDA 2ID7A 2A9PA 4OQNA 3V48A 4AO6A 4B5KA 4CM3A 2CWWA 2FSSA 2NVOA 2HWWA 2B6HA 1VJ0A 3HC7A 1VL2A 3PVSA 5C7LO 2ASVA 4FE3A 3KJIA 1CUZA 3MELA 5ALPA 3V6MA 3G89A 4DDWA 2AK2A 1JEOA 4RD0A 2XYHA 2Y4NA 2XNSA 3L41A 3ZX5A 1GZ3A 1M34A 1MU0A 4R8VA 1YZUA 1VE3A 4P4TA 3LO5A 2CNDA 3NC4A 1XRQA 2ZYGA 1QHNA 4JVNA 4NX2A 2R4TA 3T9EA 2D5CA 4ENSA 4C43A 3FMGA 3PUYA 2VPQA 3MXOA 1A50B 3NI2A 3AHGA 4J3JA 3WRVA 4ZCQA 3UJ6A 4RHEA 1G2OA 4Y9UA 1QQ7A 1SNYA 1Y1KE 3FCYA 1UBHS 3AR7A 3IEIA 4QREA 4WA8A 4WKOA 1RWOA 1L1RA 2A7XA 2V6BA 3DDWA 5ARBA 1FFEA 1G16A 3DAPA 2CUTA 3I9OA 4FOTA 4PQYA 1QH8A 2YWDA 3OQIA 4QGAA 3D8HA 2VO1A 3GFRA 3O2JA 3WNCA 3WK9A 5BWMA 1M8KA 1ZXLA 1IEVA 1D2NA 3TSCA 3GHHA 5C8YB 2HTEA 1NXOA 5E3IA 3E61A 1QNFA 4FZRA 4CXMA 3G1TA 1NWCA 4LVCA 3COVA 3FMPB 3GC6A 3LAWA 3P45A 1K8YB 1W4BA 3IH5A 1KJZA 2B1QA 4N18A 4RPCA 3ZLJA 4TRMA 1OI4A 4RENA 5DX8A 3EC2A 4KMOA 3KBBA 4OB7A 4AJ9A 1HEIA 4OHKA 3GLHE 2X14A 2YWHA 2EW8A 1JBEA 3GP8A 1UKBA 4GR9A 2MR6A 4XCXA 1Z33A 2HU8A 1UPUA 4LWOA 4C0HA 4WBNA 4YXWD 3CLUC 1P1HA 4Z86A 3KOOA 3CHYA 4G84A 1CG6A 1SKAA 3K96A 5DHAA 3IAM1 3JATB 1N2CA 1YBMA 2R6GA 1J8FA 1H94A 2YRXA 4TTPA 3DQPA 3M9XA 4FEGA 2JAHA 2X0IA 4Y18A 3HABA 4QJ4A 4DT1B 4OO3A 5GZ1A 5H9WA 2A86A 1XAGA 3OT1B 4NTZA 3V32A 3C8HA 5AKEA 4DLWA 3HKCA 3KHTA 1FU4A 4EUHA 2C95A 2BVNA 1IPHA 4CQLB 5JD5A 2AMJA 4EMBA 5EAIA 2WVAA 4FFNA 3AUYA 3TLZA 4ARSA 2IUEA 1TU3A 2R48A 4O25A 4O6VA 1NBMA 1VA5A 1C0PA 3E5NA 4OMFG 4EHFA 4OMCA 3RYIA 2UVPA 3BB4A 1A3CA 1EVZA 1SUPA 1VLVA 4KVFA 4BWVA 3AL0C 1KRXA 2QNBA 4HQ6A 2R8OA 4QLOA 2XXBA 5HILA 1OXKB 1Y1TA 1DTWB 4Z4CA 4R2WA 4ISBA 2ZATA 4B3BA 3UJBA 4TYNA 2YHIB 4OYHA 1OLUB 3U7FB 1XTUA 3IUBA 4FTWA 2GXAA 3D1VA 3OP4A 2G5TA 2VL7A 4O2AB 5M3BA 3ELYA 1E99A 1VI5A 1GGVA 2YQZA 1M0SA 1BFUA 4RPLA 5G2OA 4XX0B 4MW2A 5BNIA 1KAHA 1QOPB 3DMHA 3NJ4A 3C70A 3GGCA 3PNMA 1GXSB 4Y7DA 1FP1D 4R0NA 4YAEA 4DM7A 2X42A 2XMSA 5BORA 2ZB4A 3OFND 1MDFA 1RAAA 2D06A 2J1LA 3H3JA 4HPJB 2O3UA 2GUGA 4NFLA 2P35A 2CNWA 1P61B 5DCUA 1ESMA 2CMDA 4YMTA 3G2QA 3PNBA 4RHYA 4AZ0A 2C4NA 2NVUA 2BGIA 2HLPA 5AK3A 4R6WA 1DKOA 2RJOA 2PQ0A 2Q27A 2HNAA 3PXCX 1Y4UA 4RKRA 5E2IA 4BX2A 4EA6A 4UKDA 3T99A 3VJRA 4AJKA 2FRDA 2J9FB 2JFZA 2QW8A 3EGOA 3F4KA 4Q39A 3LYHA 4J0KA 4OL0A 5M34A 4R3WA 4JJZA 3W7AA 4MO9A 1NTOA 1WULS 1UPXA 4X44A 2B35A 2HK7A 3QXCA 3NU1A 4N12A 4KQ6A 3EOAI 4YGXB 4TWJA 5JCJA 1RPNA 4EG3A 1Z25A 1TF5A 1UEJA 3P9RA 5EKUA 5ILGA 2E4AA 5G02A 1NHWA 3I42A 2RK3A 3MF4A 4HK4A 6Q21A 4E30A 1Z22A 4LBZA 3WTCA 3EFEA 3JD1A 5CNIA 3ZWOA 1TYZA 4KR0A 3MJ4A 1IE3A 1N1MA 1Z0JA 3H1EA 5DK6A 2IK8A 1YKGA 4I1VA 2P90A 4RUKA 1H2YA 1T9ZA 2XRFA 4IQ8A 4P5PA 3WWOA 2ZUDA 4BLTA 1ZIOA 1YONA 3LW8A 3LKDA 1C4WA 2XUJA 2VWPA 1SR8A 1GVHA 2I8AA 3CO0S 4I4TF 4JHLA 1X1QA 4JVMA 3DKVA 4ZO8A 1PGPA 1O1YA 5GJVC 4AWBA 4QLBA 1UDCA 1Q3KA 3AG6A 3BZUA 4UHFA 2WWIA 4UBOA 1PS0A 3V7UA 1UMCB 1IN6A 4MW7A 4EGFA 1Y3FE 2ZJBA 2NU9B 4QGBA 3QEMB 3JYHA 2RIRA 1DPFA 1VMEA 1P8AA 2VT6A 4JA2A 5L3SA 3LWBA 3ELWA 2Z6VA 3GELA 2FP4A 3GGJA 5AJZA 2WFLB 3IPXA 4PYNA 1WE2A 1UZLA 4YJFA 3KXPA 2HTFA 3LXRA 3H1GA 1OAOC 2EOAA 3WV4A 1CULC 1QC5B 2ATCA 3DDHA 4R2XA 3D6JA 3AZPA 2Q2WA 4EGSA 2A9JA 2DWQA 1YMVA 1MKYA 4J9UE 4KQ2A 2OHFA 4ZPJA 1I2BA 4WINA 2CF6A 2TMKA 2GCGA 1P2DA 1NPDA 3LXMA 4XIJA 4OHVA 1U2EA 3QMVA 3Q3EA 2I7XA 4WZAE 3DUFA 3ZKWB 2ADFA 1UZNA 2QN6A 1L5YA 4BTVA 5F73A 1KDYA 5LZ5A 4S12A 3G2JA 1KEVA 1PFVA 2M98A 3KX2A 1CUEA 1HF3A 1SHUX 1WTAA 5FL3A 5TPZA 9MHTA 1ZVKA 3G5LA 4FYPA 5CLLA 1PW7A 1E2QA 4MI9A 4OHWA 2XD4A 4IZHA 2R25B 3ND5A 1WZ2A 4NL4H 4QOSA 1U2GA 4KJZA 3V34A 2GETA 2J9RA 1C9EA 4TVKA 4B3DA 4TTJA 4YJGB 4BBZA 5KTRA 3P20A 4KN8A 1QDUA 5FIUA 3TAUA 4IIBA 3OQJA 1GCIA 4EQZA 4XB2A 4UU8A 4MS1B 5BSMA 4CLOB 4CMIA 4ATNA 3I32A 3S2ZA 4PZAA 2CD9A 5JXJA 2X3UA 3U40A 4F4HA 2QAGB 2YHSA 3BMNA 1PP4A 4M0PA 1UBTS 2ARKA 3OQ1A 4TTSA 5DCLA 2WWYA 3DBHB 3FOZA 1ECLA 1S02A 1HX7A 4ZCSA 4QEDA 1NRIA 4FGJA 1AZLA 4UOQA 2PL9A 2CB9A 4YMHA 3FNIA 2P3LA 1MB4A 1K0FA 2O57A 5IYZF 3KOMA 1A95A 1CUJA 1BS1A 1U90A 2MT9A 2EF0A 3H2GA 4K9MA 1OIXA 3RYCB 2P6MA 5J4KA 1EB9A 3CMMA 1SCIA 2NTNA 2WFMA 4J3FA 1CQPA 3QU7A 4PC1A 5SZHB 1J42A 2XGOA 4EJSC 1YSCA 3PV0A 3W90A 1VBNA 1VPLA 2J33A 4NCKA 1J0CA 5DNAA 1ZXXA 1YE3A 4JGBA 5GM2A 3ROPA 1JNXX 3U1VA 1GG9A 3K6SA 2HRZA 4MR7A 1G5HA 2XE6A 2C83A 1R8QA 3FZGA 1IY0A 1K63A 1N2ZA 4LTMA 4AF7A 1ESDA 4WZAB 2CXXA 1CB0A 2DRIA 4R1UA 3LIPA 4XR9A 1QFYA 3BGWA 1CIPA 3W5VA 4EFKA 4DV6B 2FFBA 4LGCA 3TPFA 4E5UA 1RZRD 1UM8A 3RGGA 3NWJA 1MTOA 1ONOA 1DTEA 3KUDA 1UBSB 3NCTA 3PFKA 2RGNA 4XKJA 1CZNA 1NZFA 3WE7A 2R3SA 3DEAA 1NVAA 3G5UA 4Q3OA 5ESDA 5JEDA 4R1PA 4Q9LA 2GTHA 2FEOA 2OSBA 4YP7A 4JC5A 4XYEA 3WIDA 3NXKA 5BT8A 2NZWA 1DG3A 4FDTA 4QX6A 2BMVA 2B94A 4C7KA 3DV0A 3TGLA 2G70A 2Z56A 4RTRA 1FVOA 2RHMA 5C0OE 2AJBA 1U3WA 1JKMA 3FFXA 1V7ZA 4Y6GB 5LJLA 4TLBA 2QTZA 3QVOA 2FW1A 1SRQA 3S1LA 1NQ5A 3HYSA 3R6WA 4YCMA 1WABA 2QVZX 2Z5LA 2WU4A 5JCXA 4EZEA 3A25A 2XD9A 2YYYA 4UTRA 1GL6A 13PKA 3DMDA 3PFIA 2B30A 5AHXA 4TZTA 3R6LA 2X7JA 4JMLA 2B36A 3A6JA 4BKRA 2XDWA 4I5IA 1R6UA 5AKHA 2XA2A 2C9YA 4YMUA 4UDYX 1I80A 3DVAA 3K9WA 4UUBA 5LYJB 1I0LA 5D7NA 3LQQA 5CFLA 1JE1A 2X4LA 4U4AA 2Y1OA 4A6EA 2W11A 3O95A 1OFUX 1VM6A 3DG9A 4REMA 1RQXA 2IYWA 1UPAA 4BAZA 2GHIA 1RPAA 3KEGA 2DHCA 1MT3A 3Q7SA 4Q9DA 1GJRA 1TQ8A 2WF9A 3MYYA 4S35A 1IG3A 4ZGWA 2G0NA 4BP3A 2GN0A 2JKZA 3GHYA 5LB2A 4IRUB 1WCYA 2HFJA 5IARA 3SHWA 1UCFA 1DIRA 1M72A 1SELA 3QP9A 3E48A 3F8SA 4DCMA 4D4LA 5LOVF 5JHGB 3CNQS 4FLEA 4QUJA 4TSFD 3UMCA 2PGJA 3P0HA 3FI9A 3OE5A 1Q74A 4UBKA 2QL6A 1FRZA 1EFRA 3D4LA 1TVEA 2X9GA 3FJYA 2HI0A 1YU6A 2QRLA 4XGRA 5J59A 4ESOA 1V6AA 2AZ4A 4KYTA 2I6FA 3ICQB 1NONA 2XITA 1KMHB 2I4NA 2VFAA 1QF6A 2C3OA 2J48A 2I3DA 3RFCA 4CU5A 1ML4A 1UWVA 3CZMA 3MRSA 4URUR 1SZCA 2H4HA 4PGMA 3DE0X 1IWPB 3IKJA 4MV7A 3GCZA 3HA5A 4YN3A 1SXHA 4Q1VA 3KTFA 3I6ZA 2XE4A 4D45A 5K0SA 3LPDA 1K6IA 3LLMA 1LC0A 5L3QA 4NCAA 3DJYA 4EA8A 2ZIVB 1WVIA 3RNOA 4EO7A 1JHZA 1JEDA 1V71A 2XTNA 4LCJA 4ZQEA 1EG2A 2Q3BA 5D1NA 2UYOA 2AN5A 2XCSB 4BWYA 3EX7C 1VIMA 1GZUA 3ZHSA 3ZEAA 3B51X 4U5QA 1ZUNB 2NO1A 3O4VA 4J4TA 1CBUA 4NRDA 1R3UA 3MIIA 2O8NA 4LCBA 1MCZA 3IBFA 3TW6A 3UG7A 2IOHA 8AT1A 2GM9A 5KTOA 2ACEA 2ODEA 3NAMA 3E8SA 2RH8A 1ZZEA 1UQRA 1JG7A 1UUFA 1XXHA 2YXLA 1GRNA 1LI5A 2BR4A 3G2KA 3UWPA 1CHDA 4EJ6A 3TE7A 2DFKB 1DIHA 2E4YA 5F5LA 4NE9A 5HZKA 3FPLA 1OBOA 2WTEA 3DXFA 2YJ6A 1RU3A 3NPAA 2ZIZA 5G4KB 4GGMX 1M33A 1SC9A 1VP3A 2HJSA 3VZRA 4GBJA 2ZSDA 4KXXA 4OHUA 2XLCA 3L1JA 5KJEA 3UGJA 3UPUA 3TJRA 1X92A 1NAHA 4KPFC 3UH0A 1GYQA 3CQ9A 3IQFA 1V8BA 5FB3A 1FZTA 1PFGA 5CFZA 2PSJA 3VDMA 4E1BA 1TW3A 2OXRA 1NOIA 3DNFA 3Q0TA 4GYJA 3G5TA 2B34A 4FQ5A 3RIYA 2PMCA 1KRHA 4KFTA 4BMNA 1PJSA 2KE5A 2OMEA 3E6AA 4CIWA 4A82A 3DMRA 4ZXFA 1W4AA 5K4AA 4IVPA 1Y1PA 2O2XA 3K9BA 1YF3A 1ZINA 5GGXA 2VA9A 5T4HA 5T5QA 3A3OA 5T4BA 5B58C 1B6SA 3JVIA 4JY7A 3DFIA 4BC0A 3ZWYA 3M7IA 1IY1A 5AW0A 3K94A 2V97A 3ABOB 5IXJA 4MCHA 5K6RA 3A9SA 5KC9A 3L4BA 1NVBA 1YJXA 3B70A 3BTUA 3PQ8A 3RS0A 3SI7A 2O5RA 4G23A 5K0EA 3OQPA 1VRCA 3CFYA 4MITA 2G04A 3K9LA 4MW1A 1ZD9A 1NBAA 5C53B 2XTAA 3C39A 4AJPA 4V0ME 3E9YA 4DQXA 2ACWA 1YVUA 2VNSA 1DS6A 4II7A 2F67A 1GKYA 1FL9A 2JIOA 2R1VA 3E5RA 1EGHA 2FUEA 1RJEA 2F00A 3F8TA 3U7RA 2JHFA 2E1PA 4XM0A 1AURA 3FBTA 3BCSA 3RUDA 3KLMX 2DQ4A 5A5EA 1SU7A 3AIKA 4E6EA 2VHQA 2D8AA 2ZRLA 4NF2A 3DUWA 3OUUA 2HMWA 3HDVA 3QVGA 4ZMSA 3UF0A 1E9AA 2HFKA 2JGLA 3GLIE 4X91A 2R2GA 4XQ9A 3K6KA 2R7AA 3U49A 2IP4A 3JRXA 4HQOA 3Q1KA 5F7OA 2PD6A 5DBIA 1D6MA 3WRYA 3S2EA 1IN5A 3WIUA 3GPLA 1FNMA 5EWMA 3T7KA 1UBGA 4UBNA 1DT3A 4XSVA 4XQEA 3PKZA 1C3JA 3PQ5A 4Q00A 2JAPA 2Q6LA 1JQKA 3OU2A 1V1RA 2QWXA 3AVPA 1QWOA 2R7LA 1HQDA 5E7QA 2YZKA 4P80A 5DGHA 2ZYVX 4YB8A 2IZZA 1RLOA 3F6SA 4KUEA 4L73A 4B45A 5HJ7A 1PQUA 4IMPA 1NMEA 3VR6A 4PSUA 4OH1A 4QRDA 3TZEA 2XCOA 2R97A 3U4MA 3CLVA 4IHJB 3AESA 4FFMA 3ORSA 3R9WA 2Y05A 5HCIA 2DT8A 3QY0A 2PXCA 4PLGA 3LGSA 2BGRA 1FDUA 2HWXA 1E1CB 2IHVA 1EX7A 2QT9A 2VPIA 2XMGA 2ZI7A 2EKDA 4J0JA 4DGSA 4JAVC 3TXYA 3OSZA 4V0QA 4PZ9A 2CZCA 2W0SA 3EEBA 3QKRB 3PR2B 3DQZA 1TU4A 1H4TA 2QB5A 4G4JA 4CTKA 1F8XA 5IAEA 5IUJC 2Q3JA 1I5EA 3BKWA 4TMKA 5JCOC 2QD2A 4C4PA 2ERCA 3ADCA 1FS5A 4X3CA 2ZIEA 4HEA6 4NE7A 4BGUA 1WMDA 3BHIA 3K0FB 4HAOA 4OPMA 1Z06A 5EQFA 2IYVA 3C43A 3HKBA 5K3CA 2W8ZA 4Z4EA 4BNDB 4MDHA 4WLFA 1I6WA 3IODA 3ONWA 1HEUA 2AOTB 4EG5A 2GN6A 6CHYA 1V3QE 3EAQA 3P9ZA 3H6HA 3PJGA 2QLFA 3UTCA 3ILSA 5KQSA 1C3LA 4JLBA 2Q6VA 1EFPA 4HDNA 4URWR 3ZTWA 4WEQA 1QAOA 3RQIA 3DOUA 3KFXA 3O47A 4WD3A 1U7DA 1WSAA 2JGDB 1TM2A 2ISCA 4CEIB 1GAEO 4OA8A 1T4BA 4MCAA 5AK6A 3CZAA 2H9IA 4C04A 2ZYDA 2OORA 4BO3A 4FDAA 1A9SA 5C1IA 2HIGA 2P9ZA 3NGMA 4IDDA 5J40A 3HB7A 2ETXA 1VG8A 1ENYA 2A1TR 2C1ZA 2X2PA 2W4MA 3GGPA 1QC5A 1WG8A 4L5BA 3AWIA 2IP2A 1E5VA 1VGVA 3K0BA 1FJXA 4RDHA 1NXTA 4LK2A 1QLJA 4JZKA 1TJ4A 5IUNC 4O0LA 2ORIA 1BA2A 2VTBA 3WRWA 3CWQA 3IIMA 3DXYA 4UNIA 3ZUGA 3ONVA 2R8BA 3JVVA 4W63A 4ABTA 2IHKA 3N8IA 4K9OA 4EVSA 2PYIA 1EU1A 1AT1A 2NXWA 3TIFA 5TF4A 2O8FA 4MRSA 1R8SA 4LF6B 1SIWA 5EINA 1QLHA 3V1MA 2FFQA 1EJ2A 3RF6A 1ICEA 5L7WA 4R9RA 3GLKA 4A6PA 5SY9A 4FNOA 4PAOA 1MO2A 1XB2A 2A0FA 2DOKA 1SEVA 2BP7A 3NX4A 4N6OA 1HZJA 3K1AA 1JDSA 3ML1A 5HK9A 1RWQA 3VVLA 4DQUA 3NG1A 2V7XA 2MSDB 1RHQA 4HUJA 2Y76A 2X1HA 4FDLA 2UVDA 4OGGA 4PS1A 1KMMA 1KSGA 5CK4A 3OPYI 2BMWA 4UQLA 3GZNA 3N7UA 3K0CA 3NT5A 3K92A 3R3UA 3NJRA 4L0QA 5EUQB 1XTJA 4AMGA 4D92A 5CFRA 2XXAB 2WJ6A 3MGCA 1WSBA 4LHZA 3TZLA 1ADGA 5CDGA 2IEIA 1T13A 4UHKA 1ZH8A 1TM1E 4ZRNA 4C4RA 2GD6A 4QTUB 5FI0B 4AF8A 4AAYA 2DR2A 3HY6A 1MAVA 3PLAE 5CXSA 3VDRA 1KO4A 4G0ZA 1YZ3A 5THXA 3V4OA 4YV7A 1YB1A 1QZUA 1GV0A 4H18A 5K6AA 1LJLA 1UWCA 3D59A 3AG5A 3CTMA 2RHLA 1L1EA 1VYVA 3AKEA 5D51S 2BDEA 3WLOA 3PF9A 3EA5A 1E61A 1MV5A 3S5UA 5I5EA 5I3ZA 1WVMA 1UKCA 4MMYB 2B0JA 1ZK2A 3AXTA 5LBIA 1E9EA 3AHDA 3KYDB 3MC1A 4G56A 3F5FA 3O1JC 4D99A 3QFTA 4G5OA 3GLGE 4HVTA 3HDYA 1R4MA 5KX5F 2N46A 5FUXA 3U31A 1WXIA 3IDZA 3FR7A 1ZN9A 1ULBA 3DLBA 1D07A 1NX9A 2GEJA 5C8VA 1YR2A 5HJ5A 3ZE9A 2VYVA 4DV7B 5KNBD 3UJHA 4HDRA 1ZY2A 3B1WA 5U9CA 1QFZA 2QUBA 3U9LA 2B4TO 2H63A 4R0VA 4XE5A 2BBWA 4BO5A 4EK9A 4Y2VA 4KW7A 1XGKA 4HXFB 2RE8A 2CV1A 1NZDA 2YV1A 1HE3A 2AA3A 1A8UA 1BVRA 1TPYA 3ISJA 3MJEA 4O1MA 4ZQIA 4A6XA 2DWCA 2Q7XA 2QLMA 3HB1A 4IEEA 1OKKA 4WBXC 5EIAA 4EHHA 2ZW9A 4ZI7F 4IKPA 4L3WA 4O2BA 3OWOA 2VHWA 4FFBB 4XGNA 4GOXA 4JP1A 5DX0A 3ZW9A 1VKOA 3BCUA 4LHEA 4EUSA 2BLLA 2BM8A 2PBFA 4I3FA 5HBGA 5GIOE 3FUVA 3ER9A 4KWTA 1NJ6A 4XLTA 1GGMA 4IMIB 1L7OA 1OFGA 1UF9A 4M8LA 5TXGA 4OGFA 3RTGA 3VBCA 2XMCA 5EXTA 1JEYA 1H9AA 1U63A 3KJQA 1G4HA 2C7VA 4OAOA 3P9PA 4TZKA 3HKBB 1HH4A 4EPXA 3RSHA 5DEOA 1KBZA 1ZCFA 2QP3A 1YQGA 1O6CA 1GNLA 2WWFA 3ZW7A 3QSYA 4EQ6A 3QFSA 2P8JA 5J2UB 4PC3A 1QQ6A 3VNBA 1C3OA 4A9AA 1NQTA 3GQBB 4NFHA 4PAQA 5JOQA 1XNRB 2VP4A 5AI9A 4LVUA 5IUKC 3JQAB 4JT9A 1IHUA 1RKUA 5CBPA 3U4HA 1G64A 3QXSA 1SO8A 2GEDA 3O0TA 4NV0A 4Q34A 4UUNA 2PS9A 2JASA 2OCIA 4DMRA 1XTIA 3ZDRA 2CC2A 3LP8A 1SBIA 3GLRA 1Y3HA 1X1SA 1CR2A 1D5CA 5AXCA 2IOFA 3NVMB 4N5IX 4IUBS 3SFVA 3BKXA 3J81A 4YPVA 2PKYX 2VUIB 4HN4B 1SUEA 3RAGA 2GZSA 2DHDA 2WBLC 2REXB 2QKYA 1PD1A 2D2XA 2O3SA 3DOEA 1IY8A 1C5KA 3F6EX 1JLKA 1XL0A 2GF0A 3H2SA 1LRJA 4D82A 2VXCA 1P4HA 1IHYA 1X1AA 2Y0CA 3UIEA 2PS3A 2O8DB 2DPLA 2FCRA 3Q7TA 4TKLA 4YAFA 1DB3A 5FBZA 5FFNA 4EABA 2FPLA 3PX7A 1DKLA 3RC7A 3OO0A 3UUFA 1JIQA 1A9OA 1Q84A 1LSOA 2C5GA 3G13A 4PX5A 5FTMA 5HF8A 5SY4A 2XZOA 4CEIA 1A71A 4HNQA 1RWMA 3LKBA 4H4EA 1TKAA 2VXYA 5L4SA 3KQHA 2OFOA 1RYEA 4BN4A 2BZ0A 3EXAA 2WE7A 1G1MA 3C98A 1ESCA 3ZLBA 1DEOA 1SUFA 2V6FA 5AW9A 5EZ5A 4U7JA 2CMFA 2X3FA 2QRGA 1E4EB 1R8JA 5EQJB 5H82A 4E7OA 4LPSA 4OK3A 4DABA 3WADA 1X1CA 2HGSA 2OE2A 5T8KA 5ADWA 1CJTC 2LKDA 4HMOA 2FNAA 5ER6A 4AZ3B 2XBMA 3OFJA 3V9AA 5JXGA 5KJ6A 3NTRA 1E59A 1KJIA 2WZDA 4V0MA 4D3ZA 1MOQA 1W581 4G26A 3COSA 3DZBA 1RE0A 4MKIA 4IF4A 4E94A 3NOVA 2OCDA 3LM8A 1LD3A 4QHSA 5C31A 4PGFA 1ETHA 4AJEA 4V02A 1QTRA 1LK5A 3SYLA 5EHXA 1X15A 2GPAA 3ZD7A 2XVYA 2P3OA 1YWGO 2I29A 3AYZB 3KYJB 3UMFA 3TLAA 1IXRC 2NG1A 4R2IA 5DLEA 3Q2KA 1GVNB 1FOEB 1N5RA 2CJFA 2CJWB 1NKVA 1V16A 4JLDA 4US2R 1XA0A 3NNNA 3ZWKA 3FWKA 3GUVA 4K26A 4XGQA 1ATZA 2DJ5A 5KPJA 1UBEA 3PXGA 3RIHA 4CM4A 1ZW6A 2H3HA 3RANA 1P5RA 2X2FA 3WB2A 1H2RS 4L4RA 2Y1FA 5DHTA 3AR5A 4B84A 2AG1A 1RTKA 4LYHA 1TCAA 1X70A 2FKAA 2ZBEA 3PEFA 4J7XA 4NULA 4BX0A 1SXPA 4RPHA 5FA8A 1KY2A 4HAIA 4I8DA 4LKRA 1Z7EA 1QRRA 3LRTA 1FFBA 4B7ZA 2B92A 4DC9A 1TGVA 1L7XA 1VCOA 2QAJA 4A1FA 1J1ZA 1G291 1JEJA 2OMKA 5EMMA 5FCDA 2QSZA 3CISA 1ULUA 2IY7A 2PSFA 1G20B 4ND5A 3TQQA 3HVJA 2VBCA 4MV6A 4UBJA 1X7HA 5C1OA 1HQCA 2I62A 5AJTA 4DSUA 1TCUA 2ZAOA 2O2CA 4B33A 3KR2A 3KEQA 5G53C 1E2HA 2H31A 3AEZA 3AU9A 5AOAA 1JDNA 2VAPA 3JAWB 4D5GA 4BWFB 2DQZA 2K87A 2XWQA 3AHJA 3KYBA 3WOVA 4CTNA 4E0BA 1Y37A 2BEWA 2QQ5A 2WV7A 4JLNA 1A97A 1KEEA 4U39A 4JI2B 3COPA 5DXAA 5EERA 3EWSA 3BJEA 4RACA 3DHEA 1UZUA 2C2OA 2BZGA 1PF7E 2IE8A 3BJMA 3PK0A 5C8YF 3U3MA 4Y1RB 5E6RB 1KDVA 5IC4A 4R40A 2C7QA 3INGA 3WAJA 1N2IA 2EF1A 2VNAA 3JQ9A 4FSDA 3V42A 5LP6C 1OILA 3ROXA 3H5AA 3OI7A 2AD5A 4POAA 4I5GA 5EIWA 4HV4A 1DMSA 1PZXA 3SLKA 2ABWA 4EB6A 1NRXA 3OESA 3OMWA 2P2DA 3KELA 2LTAA 2VSXA 1JYEA 4LHXA 2ZWIA 1P1JA 4QATA 1Z2CA 2AOTA 1U1FA 1R9JA 4FGUA 3QKTA 3TECE 3PIDA 3VC1A 1WSWA 4PO9A 5EWJB 3PICA 3BEDA 4H6VA 1ZJ4A 1G98A 2ZYRA 4TTAA 2YVAA 3UBTA 1P0MA 1RLIA 2SCUB 4OD0A 4MDYA 2PVCA 5CCEA 4JX9A 2G0TA 4PY2A 1VECA 3Q8WA 2G1JA 5IM4A 3ZZ0A 1UDRA 3F96A 2A3NA 1EXWA 2QN8A 2VHCA 5HFNA 2YDXA 2XCUA 3LYUA 1K86A 2QRQA 1E2DA 1PS9A 3JD2A 4LBWA 1CW2B 4OJMX 4PZYA 1P4RA 1XZKA 2LCFA 4AB1A 1I33A 4O3MA 1PJ2A 1BA3A 4P31A 2CLEB 3NTLA 4G1CA 1NNEA 1JW9B 4Q03A 5HZMA 2NMVA 5JS1A 1EXVA 1Z6XA 3G2LA 3FYSA 3QUBA 4LC9A 4R7TA 1HSOA 3ZGOA 3OEHA 4DEVA 4DQKA 4PCVA 3VMFA 2POCA 3H5RA 4JP8A 3IVGA 3OX1A 2ZUTA 2CHQA 3NBMA 4TL6A 5JBNA 3VYTB 5GPBA 4UDOA 5FNVF 1IQUA 1E3IA 4Y0AA 5AW6A 3EODA 4QNNA 3EGWA 4DLAA 4NJMA 5AJWA 1FY2A 3O8RA 4D98A 1KH1A 1PBNA 3IS3A 4I50F 3GAAA 3ZDFA 2AR0A 2G08A 2WB2A 1TJ3A 3O73A 5G0TA 2AFHA 3M5PA 1XZGA 1U9CA 1ZIDA 4OTZA 3GJ3A 3NHMA 4BJHB 1T9DA 2PT7A 2ZU6A 2XI4A 3EAFA 4HDOB 5A6SB 3TOSA 3TUIC 4E11A 3HWSA 3OHSX 4MCIA 4DC1A 1VJCA 3VOAA 3S1AB 2O50A 1XMVA 2A78A 3JASB 4C0KA 2QM8A 1TUBB 1ZM2A 4DILA 5J2TA 1DAIA 4XM1A 1ZOIA 4QU9A 4NPAA 5D1HA 3QLUC 5LJIA 1H93A 4CL0A 2O5VA 2FGJA 1JFRA 1O2DA 1C3VA 1KFCB 2CHEA 2R85A 3AXSA 3P71T 2V3WA 3VOBA 1ZGJA 2H4FA 4KN5A 4PNPA 3IE1A 4XWGA 2IPNA 3G6KA 4MQEA 2QN2A 4R8SA 4FFLA 3O3CA 4NCHA 2NUAB 5CB4F 1DHRA 1KMQA 1NUPA 1Y3CE 4FW8A 4B3JA 3B13B 4IDFA 3CLSD 4JNKA 4X71A 1IY2A 2I99A 5K8LA 1ZR4A 2L0XA 3HCAA 5PGMA 2HK9A 4A6DA 2NO0A 3ZK7A 3BF7A 2IZ0A 3ABZA 1AHIA 4HTFA 5J4VA 1IHOA 1G2IA 1YNSA 4KGXA 5TEVA 3VQTA 2PLRA 1A04A 3TJZA 5DWQA 3D4IA 2ZEJA 2EZ4A 3AKZA 3U61B 3HXQA 2OZPA 4HQFA 4KKVA 4FCWA 5B3AA 5C7YA 4HS4A 1MPTA 1MTZA 2MMCA 3B38A 2BKUA 2VRCA 3C3XA 3I5XA 1URPA 1Q19A 3TQTA 1XU7A 2VDVE 3TVTA 4IUYA 4INOA 2MR5A 2Q6KA 1U0TA 1EK1A 1V96A 1ST2A 4I4TB 1XMOB 1YUNA 1IQPA 5K0CA 5F4ZA 2BTEA 4EJFA 1DV2A 1VLMA 2V7UA 3NBYC 4UQOA 3TINA 4C87A 1U3CA 1ZGAA 1CZHA 4HR7A 2EJTA 2P2LA 3FOWA 3ZDBA 1I7SB 4WN9A 3UM9A 2OZLB 3HL4A 3ROMA 2YRFA 4KAFA 2XAUA 5A6SA 1DTSA 5JCZA 5JS7A 1H9CA 1Z16A 1YKFA 3TB4A 2P4UA 1RM3A 1I5OA 4J07A 5JNVA 4ES6A 1D4ZA 3BWEA 2VYND 2O23A 4F2GA 1PNQA 3HO6A 1BZYA 2O3QA 3PQDA 4Q37A 2CGEA 3VISA 2Z43A 3ZE8A 2UZAA 4D9JA 1AS0A 5DBGA 1Y80A 2YS7A 2B7CA 1WA5A 3AF4A 2RONA 5F1OA 4Z0PA 5NULA 5I9SA 4EW3A 3HZOA 4RMIA 4OEHA 3RRMA 3GXOA 5JJ5A 4LFCB 2E37A 2FMHA 4D0SA 3K5PA 4QFDA 3D4OA 5D3MB 3UK7A 1YT5A 2BISA 5E38A 3MTAA 1OH8A 2AOXA 1FDVA 3CUWA 3N2IA 1LSSA 4HSGA 4OHXA 2EDAA 1WWKA 4PYIA 4WPGA 2MSLA 2R9VA 3RUHA 2IDKA 1GUDA 1U3UA 1V3UA 4FC7A 3TLKA 3EEYA 4BO2A 1PWXA 4ZAXA 2QRVA 3H3FA 2PT9A 2IDJA 5LZ9A 4C01A 1X1EA 5JZVA 4JLPA 3CU5A 3CLHA 5IN4A 3KQWA 3AP2A 3TMAA 2Q0SA 1LZKA 3RVPA 4D4GA 1HNXB 3ZHBA 1TZCA 1MDBA 3O82A 4OH7A 3U26A 1P1BA 1RC0A 2P2NA 5DWDA 3FSRA 1YQUA 2GHTA 3GA0A 3MMNA 1QG0A 2PUVA 2P40A 1R6BX 3RWBA 5C35A 3SEQA 1WR8A 2QU7A 1WB6A 1DEAA 5FUMA 3TW8A 1P3JA 4CKEB 2AFRA 4DHEA 1EX1A 1SPBS 3BD7A 2IEGA 4DV2B 3WGLA 1R5BA 1INLA 2FZGA 4A7PA 2BF4A 4EYOA 1XQ1A 2P0AA 3Q15C 5BVHB 3E7WA 3I9KA 4ZVPA 2I0FA 3KKNA 4EBBA 3WGUA 4PG7A 1W0KD 3SC2A 1AKVA 4E31A 1TO6A 3BB3A 3CW9A 4QG7A 1I3LA 1CS0B 4ZMRA 1J9EA 3PDWA 1Z0DA 1P3DA 3LQ1A 4IEFB 1B8UA 3PXEA 4ACBA 4E2WA 1O96B 4HWRA 1J90A 3V3KA 3AGPA 2CSUA 2BELA 3FMVA 5I9IA 1K5HA 4MB0A 4BMPB 5IJ0A 2BEWB 1UH5A 3KWFA 4LYGA 3SEZA 1MHTA 3ZXUB 1MT0A 3FRJA 5K5EA 3V1LA 3VYSB 3F73A 2E85A 2ODPA 1XZCA 3NUZA 3E23A 3QI2A 3TW8B 1RQ2A 1IPFA 4KREA 3EEIA 3CIOA 3WZMA 5CLFA 2P3SA 5JDCA 1POWA 4J1SA 4RMHA 2AX3A 5CJPA 3DO5A 2HF2A 3EJWA 3WMFA 2Q1UA 4G9BA 1QE3A 4GPZA 2O14A 4MYCA 1YAJA 3CZPA 3W5JA 4XWAA 1PZFA 2PBLA 4BVGA 1K9SA 4ND8A 4ZZ0A 3KTAA 5KSOA 3P5SA 2HZBA </