2FG7C

N-succinyl-l-ornithine transcarbamylase from b. fragilis complexed with carbamoyl phosphate and n-succinyl-l-norvaline
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
Knots found
sequence length
320
structure length
320
Chain Sequence
SHMKKFTCVQDIGDLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRLSTQKAALNLGMNVIVLDINQGAWKLETERGVIMDGDKPEHLLEAIPVMGCYCDIIGVRSFARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTARPKVVMTWAPHPRPLPQAVPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYDQMKAFEGADFIYAKNWAAYLGDNYGQILSTDRNWTVGDRQMAVTNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative ornithine carbamoyltransferase
publication title Structure and catalytic mechanism of a novel N-succinyl-L-ornithine transcarbamylase in arginine biosynthesis of Bacteroides fragilis.
pubmed doi rcsb
source organism Bacteroides fragilis
molecule tags Transferase
total genus 118
structure length 320
sequence length 320
chains with identical sequence D, E, X, Y, Z
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.3.-:
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
C PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 2fg7C02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 2fg7C01
4JHXA 1RAGA 3L06A 1NBEA 2FG6C 8ATCA 1F1BA 1PG5A 2BE7A 1RADA 1I5OA 3M5CA 2H3EA 1Q95A 2BE9A 4KGXA 1R0CA 2FZGA 4FYVA 4F2GA 2FZCA 3KZOA 1SKUA 1RAEA 3M5DA 1RAAA 1FVOA 1JS1X 2OTCA 1A1SA 3R7LA 4FYWA 1XJWA 4EP1A 4FYXA 3D6NB 4OH7A 3KZMA 2FG7C 3GD5A 4KGVA 1RAFA 5G1OA 4WTOA 4AMUA 3M4NA 3M4JA 6AT1A 1AKMA 2EF0A 3GRFA 4KH0A 3R7FA 2W37A 3KZCA 5AT1A 4A8PA 4EKNB 2ATCA 3LXMA 4AM8A 1ZA1A 3L02A 4JFRA 2G7MC 1TUGA 1RACA 1RAIA 4A8TA 4H31A 1ORTA 5ILQA 1D09A 4IV5A 3AT1A 2AIRA 1DXHA 1VLVA 1FB5A 3D7SA 4ANFA 2RGWA 3MPUA 3UPDA 2FZKA 4KH1A 4KGZA 4E2FA 3L05A 3TPFA 4BJHB 1EKXA 1RABA 2AT1A 3TXXA 1C9YA 1DUVG 4A8HA 1AT1A 3L04A 1TU0A 2IPOA 3CSUA 1ML4A 1EZZA 1RAHA 3R7DA 4AT1A 4KWTA 2QG9A 9ATCA 1ACMA 3SDSA 1TTHA 2HSEA 2YFKA 2A0FA 2P2GA 4F04A 1R0BA 3NPMA 7AT1A 5G1NA 3Q98A 3KZNA 4JQOA 3E2PA 8AT1A 1EP9A 4FYYA 5G1PA 1ZA2A 3KZKA 1OTHA 2QGFA 4NF2A 2I6UA 1PVVA
chains in the Genus database with same CATH superfamily
2AF3C 1II9A 2DOKA 2DY1A 3FA2A 1LJ8A 5THQA 2JG3A 1FJGB 1YT5A 3O90A 1GYQA 2LV8A 1I2DA 5KSPA 3UJ9A 3V8EA 1M1NB 1CUVA 1N0UA 4FFBB 1EHCA 1P6XA 1RXCA 4RXTA 4UC0A 3IQZA 4KXMA 4XJSA 1L5NA 3RV3A 1WUHS 3A1FA 1WSDA 1M76A 2JBWA 2XJ4A 4BLUA 2Z57A 1TIBA 2CV2A 1MX1A 1Y6FA 1XTVA 4HYEA 4ALMA 4TLDA 2HZ7A 2ZB7A 3JYNA 1ORDA 2I4TA 5IFLA 4WLFA 1R88A 2EKZA 2Q3DA 4TWAA 2P68A 1GAJA 3BRWD 5KVQA 1P0QA 4F3CA 1B3BA 2G3YA 1DKLA 1EB9A 2AA3A 3BIOA 3BL5A 3IP8A 1NOIA 4LTNA 5TPWA 1C7EA 5EYPB 4WK2B 4YAGA 4LJ5A 4ZYXA 5HIKA 3SC4A 2HFJA 4OXXA 4MK4A 4JT8A 4JENA 4QPNA 2UXDB 1PFQA 2Q5OA 2IIBA 2GEBA 2OENG 4DEXA 1FFGA 2R8PA 5C5EA 1EI9A 4M99A 4RDIA 5TEVA 3WYNA 4DMCA 4L4YA 4EHBA 1FFDA 1EVKA 1H22A 3EWNA 2W2KA 4KTVE 3JWGA 3SIXA 2PUEA 3AVUA 3VPAA 3S99A 3SYKA 4K0KB 1GGNA 3S5UA 1P1BA 4NS4A 5GZ1A 3DWGA 2H85A 4ZMBA 2RGRA 1O96B 4LNUA 1ZGGA 3OF2A 3U48A 1QU3A 4PYJA 3DULA 3MCAA 1K9SA 3LCCA 4BO2A 3HK2A 2GCEA 1U2SA 2NO6A 1LVHA 1MG5A 2CVFA 3B1ZA 2DUJA 3IJPA 3MUOA 4FSXA 1MEEA 4KQ2A 2YFYA 2E4VA 5FYQA 1N6OA 3R3VA 1AZTA 1L4NA 4R01A 4QGFA 1QC5A 1Q0QA 4RYDA 5HW0A 3THWB 1WPGA 2KW5A 2PGJA 3G82C 2V7GA 3TJRA 4XXHA 2WWVD 5LZ4A 3G0GA 1B1AA 3JYPA 3LLVA 3BK1A 3Q7PA 1ODCA 4E7PA 1PT5A 3K0CA 4DMFA 4Q34A 3H65A 4YR7A 2BZSA 1JKFA 3PC7A 4PPGA 4PZZA 2I34A 4KB5A 4QDJA 3E9NA 5F4BA 2OECA 4E30A 4IXNA 4PWYA 5JRJA 2AK3A 2QD5A 2A5LA 2AXEA 3K7EA 2CZGA 3AP2A 4BFUA 3FW1A 1NW3A 1XE3A 3K1JA 3ESBA 3WQBA 4D43A 5EIOA 4V1CB 1XAJA 2G4LA 3DPUA 4KWTA 4B6FA 1JDTA 4A4DA 3GJQA 2YOGA 4O2LA 2ZU0C 3AIOA 4QD3A 2BCEA 2OCDA 3OPVA 1QV9A 1ISPA 4NZMA 3QZUA 3D2AA 1SCQA 1MNAA 4QASA 4R6WA 2P1DA 3MTAA 4XYEA 1R0YA 1ZHOA 4L9RA 3T5BA 4CIDA 4PPFA 5BOVA 3VPGA 9LDTA 4IDDA 4AZTA 1NRIA 2W6PA 2GRUA 4DLAA 2JLQA 1R4MB 2H07A 1KWKA 3NHUA 4D41A 4RLSA 1NJ5A 3I73A 4BO7A 3N6VA 3HZHA 2JS7A 3Q72A 4EYKA 2HMAA 2IIPA 3A70A 1NMEA 4K3UA 3GGPA 4JLMA 2AMYA 1E9EA 2UVDA 2WJHA 1YZFA 2X2OA 2XYVA 1Y1SA 4XDZA 4B4UA 4FHDA 4YPVA 1SVSA 1GL6A 1O4VA 1PVVA 4JJKA 4F46A 4MV9A 4YUVA 1Z2NX 1VLLA 1CU1A 4BNYA 2G8NA 5K0BA 4M1TA 1Q7TA 3A28A 3DMNA 3M6LA 2O2HA 4BMSA 3ICWA 2Z8YM 2EG5A 2FX2A 3CFYA 1RWKA 4FR2A 4P54A 1YL5A 3WQRA 3AEUB 2IIVA 4O4HA 1ULTA 1SUCA 2PT5A 2CUNA 3DTVD 3LFUA 5DNUA 2CUKA 3DBHA 3OIGA 3ZUPA 3WIBA 1MB2A 2GEKA 2N1BA 3CLUC 1YCGA 1Y6QA 3GQBB 4KO4S 3FZEA 4EGCB 3JAMA 3KSZO 2W70A 1L7AA 2G82A 1HDRA 2XRFA 2F8LA 3LC1O 3WLLA 1N3BA 4IM7A 3H2KA 1OHHA 2G83A 4OQPA 3TLXA 4EO4A 5JXGA 3KZMA 5KU7A 2I22A 3FOEC 3KQSA 2AI3A 4U2EA 4AJ2A 1NR1A 1P72A 2F2TA 4ZU1X 3K5HA 3TFQA 4BUZA 4QOIA 4MQBA 4TPKA 2AN1A 2EWVA 4M3NA 4EM6A 2AZXA 2C8LA 5PNTA 2G36A 4FS8A 4XWAA 1USWA 1V4VA 2N9UA 4EGAA 1XRNA 3EZYA 3RTAA 3NWEA 2WDPA 4C7KA 1W5AA 3QI2A 4TWZA 4HG2A 2WTMA 4LE2A 1WDMA 3HE3A 3L6DA 13PKA 2IKQA 2Z9BA 3K20A 3KJFA 4HQ0A 4ZN6A 1B14A 3PGXA 1RCUA 4GPTA 4I6GA 5TSDA 4G0VA 2WE8A 5EJ4A 2C2YA 2EW8A 2BOVA 2QA5A 4TTIA 4M0MA 5CNKA 1WCWA 2GF9A 1VYTA 1NBAA 1M5RA 3N0XA 4DT1A 1QFZA 1C1DA 3MSCA 2PHZA 3U7QB 4L0QA 3OLYA 3CT6A 2ZIFA 3IHLA 4O4IB 4KQWA 2E9SA 3OY2A 3WNBA 3QVWA 2ENWA 1Y9EA 3ETLA 3TGWA 4DQ0A 5BN1A 4MV6A 1V1RA 1KVQA 2WM8A 1H05A 3AYZB 4NX2A 3U4DA 3W34A 2FK8A 2G28A 1SBCA 3GMIA 2OESA 3DW1X 3HQ4O 4RPGA 5J58A 3CPHA 4WXPA 2UYGA 4TT3A 1FTQA 4LF8B 2VATA 3KJNA 4FYJA 4YAFA 1NUQA 1RWQA 4DIOA 3WVNA 4FLMA 4I4TA 2O1WA 2XDQA 3UN1A 2P90A 2OCBA 4R51A 4WZBA 3C97A 5CCBA 4BLRA 3HXTA 3EFEA 2XQFA 2XRYA 4KXVA 3DR3A 4W7HA 4F92B 1DC8A 1OLUB 2C0CA 4RJLA 1I2CA 4N3NA 3MUEA 4FHGA 2PUWA 4OFWA 2FKNA 5KOHB 2FXVA 3HL0A 4IDNA 4B9AA 3PNKA 3FVTA 4PLZA 5K3OA 2HYIC 1XF1A 1YTLA 2ZULA 4D57A 1FDVA 4YQFA 5CLHA 1AXGA 3BPSA 2C04A 2Z8XA 3LGAA 4GC9A 3CR8A 1NOKA 1U5BB 4LJKA 5D6NA 4R83A 2IS2A 1NM5A 3QJGA 4Y2HA 4YAWA 3VNQA 3CZMA 1KPHA 4WV3A 4CPDA 3FR8A 1L1RA 4HDKB 4FMDB 4NNPA 3QNMA 3W2IA 1SUPA 1W85A 3GWGA 5HR5A 3EQ8A 1SBZA 2GCGA 5E4FA 2CKMA 5EZSA 4BLTA 1NBMA 3CT4A 1PJRA 1KHHA 5EXXA 2N47A 3P2EA 3E3MA 5LNK6 4BQOA 4EB3A 2HJWA 5TLSA 1GN9A 4OCZA 3LO8A 2HI0A 2HMUA 4KSYA 4JI1B 4O1MA 3D4NA 4RYLA 4CEIB 2ANCA 4RCZA 2GB4A 2KS6A 4HDCA 3WBJA 2VKTA 3WGQA 4QVKA 5JD3A 1EEXB 4L2IA 7MDHA 4PZEA 3VPXA 4R4JA 5FOSA 1JSZA 4ID3A 5SZIA 4CM9D 4A03A 3L9XA 1G1AA 2VFAA 4EJSA 1F5NA 1GLGA 3JY6A 2G1AA 2Y6VA 1AB6A 2PSFA 3M8KA 3TYXA 3W78A 2JCVA 4ZOBA 1WZEA 3TOVA 2ID4A 5E9JA 1GG5A 3DE1X 1GSOA 1XZJA 3FPCA 3IERA 4NBVA 6AT1A 3KELA 1Z63A 1ZVVA 1L8QA 5EIFA 1PN3A 3ZV4A 2EHDA 4M0CA 3R7WB 4BQNA 1Z6YA 1ISHA 4EAQA 4FM9A 1GTVA 2BR3A 1UJ6A 1BDMA 2D2EA 2IUSA 2MMGA 2CVHA 3DGFC 3VZPA 3X43A 3PENA 4BO5A 5BN4A 4WRRA 2HUNA 2PH7A 1FL9A 1QZXA 4JL8A 5ALUA 2KI5A 4Y2UA 1E96A 4BLVA 4V39A 3AW8A 2DRIA 1Z13A 2PZMA 2R8XA 2WUVA 1XVUA 3KVRA 2VZ9A 3N6XA 3PQ3A 4FFSA 4GI1A 4N03A 1N2ZA 1QFXA 3CWQA 3OE7D 4Y30A 1T25A 1CNEA 1ZJJA 3DO5A 5DCYA 2O8NA 2BEVB 1MABB 2H08A 4YACA 3NBZC 5B64A 4IXTA 4X1OA 2XXAA 5E6SB 4YLYA 4KJZA 2FETA 4JA2A 3A0UA 2IWRA 2FRDC 3GEBA 4NMHA 1KI7A 2B78A 1BJKA 4CMAA 1ISGA 4B84A 1SZCA 3NMUF 5JVDA 3MJVA 2ASEA 1U80A 4FU0A 1WR8A 3FPBA 2D1SA 5IP5A 4K6GA 5KQSA 1R8SA 1QYDA 4INOA 3FLEA 1TMYA 2VDWB 3MT8A 5J2UB 3I9KA 1B0UA 3K9HA 3T3EA 4CIBA 3H5TA 1QIEA 1V5EA 3N7AA 4DLKA 4UQPA 4HNUA 5CBPA 3KP1A 1C3LA 4BO6A 1NUTA 4FTWA 1CDZA 1MOQA 2RC6A 4NH4A 6LDHA 3ADCA 4LXHA 3EQ6A 4E6EA 2GBLA 3FBGA 4HLUC 2IYOA 3G3EA 4AUMA 1VKOA 5IZCA 1XYVA 1XN4A 3D4BA 4Q15A 2DFTA 1M34B 1YRLA 3MRXA 4CLHA 4CMJA 1Q57A 4WBNF 3WBFA 2HJRA 1NZJA 1SXJA 2X5OA 4ILKA 3N6RA 2OXEA 3C5EA 3OU7A 3P20A 421PA 4XD7D 1X92A 2WRZA 3AFMA 1WBJB 4F4IA 5FA6A 1BIFA 2NSJA 2DYKA 3B1KA 3L1JA 1Y48E 5FO1A 2VSNA 3GFBA 3IESA 3CXRA 1EWTA 1SXIA 4HQNA 4QPPA 2Y68A 1CJCA 4R40A 5BR7A 3C41J 4JKIA 4LZAA 4TS1A 4JOSA 4OBBA 1EUYA 1NYTA 5DNDA 1ZGBA 2HGSA 4PICA 3OPYI 3H1GA 4X8LA 2WP0A 1U8YA 4L3VA 2FQQA 1MU0A 3MEQA 2ADOA 1XZFA 3VI3B 4FOSA 3EHDA 1VHQA 2R6HA 2G06A 1JALA 2VG8A 2Y67A 3MT9A 1NYQA 2ON6A 2WICA 3E5RA 3PIRA 4NZNA 5DB4A 2O6HA 1EU1A 4ZJYA 2BVNA 1SK9A 1GLVA 1SRRA 4MQ5A 1K7SN 2HSGA 4ZO8A 1Y5RA 2R4QA 1J0BA 4O4JB 2BGWA 1AN9A 3SQOA 1WPQA 1ZD3A 1X19A 5BW6B 1E64A 3WKBA 4CWAA 5AKLA 1VGQA 3WP0A 4OQYA 2B25A 5B4TA 1P7CA 3AOEC 2PKRA 5IF3A 1G5QA 4PAGA 4MRAA 3PTAA 5CFOA 5EJEA 3TLEA 4ZYWA 1G6KA 3RSCA 4FZ5A 2FWIA 1GITA 4JYPA 5K0ZA 1YR3A 5CP8A 5ICEA 1CB0A 2Q6TA 2VEDA 5FOVA 3PNYA 4C6TB 2HY7A 1EINA 4KHPB 3FKJA 1WLSA 4L28A 1NKTA 3TQQA 2GJSA 2JIPA 4M1EA 4WKCA 4Y8VA 1HURA 4IPTA 4FDAA 2HF8A 1WEHA 3HNPA 4JP8A 4YJ3A 4A8PA 1Q1EA 2BGRA 5IZ4A 4Z49A 3ZDAA 5GVSA 1UJNA 5SYMA 2C3OA 3CWZA 2DSNA 4PQYA 3NUZA 4RIEA 4QPCA 3RFFA 1NW4A 4ZZ2A 5A9SB 3D7NA 3FSEA 3NV7A 3O2QB 3E03A 3WYAA 2WF5A 4BGVA 1AQNA 1FF9A 4JKYA 4PRKA 4XYBA 5L7TA 2BKAA 3H2SA 1T2NA 2AK2A 4FHCA 3LT5A 1F9AA 3P9RA 1K8XB 3HY3A 1DC6A 1RI5A 1L8LA 4OLBA 2O2GA 1DBPA 4BJHB 1JMVA 4KQJA 2YNMD 3OIUA 4NABA 3L01A 1T0IA 1PTJA 1AMOA 3AUUA 3A14A 5F4ZA 1YR1A 1RXIA 4WK4B 3OFSA 3LNCA 4NICA 5HUHA 2W4IA 4B31A 2D1FA 1NHGA 4RZHA 5BQFA 4NU6A 4NCXA 4Q9AA 4PX5A 4HLNA 1ZM2A 4JBWA 4ZT7A 3T0FA 4ECEA 3AKYA 1T2AA 4CIXA 3TLMA 2HV9A 1JPNA 3HB9A 1JQ3A 1ML4A 1E1RA 2A3NA 2MYTA 4US1R 2BEJA 1PFVA 4KYIB 4W5RA 4DF3A 2R8EA 1SB8A 1YDEA 5I4CA 1HNWB 4FEGA 1C1YA 1TZMA 4YO7A 1W88A 2AEJA 4WKBA 3HP7A 1JQAA 1E6CA 1M2WA 2I7XA 3EXAA 3L8GA 4LCEA 5BNFA 4EEKA 2ZXUA 1NBWB 2P6OA 2AL7A 3MT0A 5AI8A 4D4KA 1TDJA 4KRYA 1U7TA 2BTOA 3IAAA 4OHWA 3UJ6A 2QL9A 2DPMA 2QX8A 2XCQA 4FZRA 4HZUB 4G1EB 4PLPA 1TTTA 3WISA 2VJMB 3Q9LA 5A4IS 2W58A 4IDOA 1WABA 1NW6A 3VU0A 4BHTA 1WQ3A 3W2FA 1RQXA 1ZOOA 1KQPA 3UMRA 4I50F 4HMPA 1R74A 3T06B 3EB9A 3IPLA 1HXHA 2CYCA 4FDTA 3AEXA 5KYGA 3I9NA 1FFAA 1FTNA 4FI3F 4WBSA 1O95C 4NCJA 4HOYA 2B82A 1GKKA 3AP1A 3DBIA 1PJZA 1P9LA 1MG0A 4G5XA 2VRCD 2BE7A 4XPIA 1AQLA 1ECPA 1WMSA 1Q95A 2HMVA 3LSYA 1W25A 4QREA 4IXDA 2V03A 4DGSA 4QWMA 3G1UA 3VR5D 3I5YA 5A1JA 1C8LA 2ZPUA 3JPYA 2ZSBA 3GOHA 1WTAA 1LPSA 4UDYX 5BN3B 4WDQA 1PKXA 2AWOA 3U3MA 3A9SA 2OTCA 1T2CA 4HC4A 4Y9RA 5JAIA 4CCYA 4IFEA 1VSVA 2PPVA 2G71A 4JGIA 4L6CA 5JZMA 1PP4A 2M6RA 2PG3A 1HR0B 4TMWA 2AJBA 3EFHA 2H1IA 3DE5X 5ITSA 2J67A 4ZHSA 3I05A 4BVLA 2BFEB 5C5CA 2XKJE 3BHIA 2UZAA 3ZHSA 3RW9A 2O1SA 5GPBA 1AD2A 4BNJA 4D56A 1YUNA 2R4UA 4WXYB 4CKBB 1QK3A 3ZNOA 5C5IA 5JS1A 4WZAA 2OGTA 3WLRA 5I48A 3N8HA 4Z9BA 1AO3A 1Q7EA 1Q84A 2EWMA 5EKUA 4AULA 4F1KA 2OA0A 1QORA 3E3OA 2C94A 1QIJA 2X1LA 3GJ7A 5IAJA 1QHGA 2ZROA 4HRVA 4J43A 4KXYA 4B45A 5K45A 2IHJA 1H4SA 2XBMA 1N78A 4RESA 4DJJA 5BVHB 5K1ZA 2YV2A 1CS4C 1D7AA 3T6KA 1YXMA 1S01A 3FBWA 4O4IF 3H9UA 4H15A 4I81A 4LTDA 4DMGA 3D5EA 2QTTA 2HREA 3ZWQA 2E18A 2EX1A 3CNHA 3HKBB 1SUFA 1Q12A 2AW5A 2QMOA 2XSZD 3AU8A 3FYCA 4RHFA 5C4IA 2GTPA 1Y5NA 4TMTA 2RHLA 2VRWA 5H4HA 4LXIA 1RRMA 1K27A 3EPHA 4J0CA 2I71A 4HUJA 3CS3A 3CJQA 4WZZA 3AUAA 1U7PA 1FOEB 4WCFC 1LQTA 2Z3ZA 4DNXA 3VYSB 2BGKA 3LZ6A 2H0QA 3KWLA 2E4ZA 5TPZA 4JP2A 3JZIA 4ISBA 5E0KB 3ILYA 1EFVB 4FDVA 4QXAA 3JQGA 4BQQA 4HNAA 1R9GA 4MPTA 3HCFA 1SD2A 2WTBA 1JU9A 4JC5A 4N40A 2WG2A 1TO6A 4M36A 4BKUA 4C20A 4RE5A 4FX5A 4A2QA 2UV8A 4Q3CA 3FZGA 3HM2A 1SXHA 1SUIA 1MD9A 4TRRA 4CQMD 1ILEA 2P2GA 3R9XB 3W7AA 3AHIA 4RDHA 4ZEMA 1XNHA 2WSBA 1CZRA 3IMCA 4JFAA 3AEZA 3ZIAD 1SQFA 2JI8A 1NJ6A 3R5XA 2XRZA 3AVXA 4H1VA 2XUOA 3WRYA 2QT0A 3M3HA 1U11A 3F5FA 5JJ5A 3AR6A 5BWBA 1EVYA 1EFTA 2P62A 2ZKLA 3G2LA 3GUHA 1QRAA 5IBQA 1ZH6A 4Y67A 3L84A 5C32A 4RETA 3QPCA 4XAQA 1NONA 2JJQA 2J9GA 3QKTA 2J85A 3LXRA 3NP7A 4IYRA 4N5MA 3SX0A 5K01A 1C9JA 3ZGXA 4JT2A 3GK3A 4QATA 5DYTA 1P1RA 2HLDD 3VJRA 3JATA 1KDVA 3OJXA 4LC0A 4UJ5A 5AXAA 5DOZA 1I1HA 1Y7IA 1Y7TA 5THKA 2IHVA 5SY9A 3GJ0A 2XB9A 4V0MA 4C04A 3GH3A 1YZTA 2BFOA 2XDAA 2XWBF 3VR2D 3RU7A 1OXSC 3WL5A 4BX8A 2C61A 1WB6A 1A76A 2C4NA 1TAQA 1Z56C 4GWLA 5HKOA 1I1NA 1ZHFA 4NCKA 4GDFA 4Z8YA 3EUEA 4PTZA 5ESWA 2BMAA 2JKYA 4W5NA 3F2VA 3ND8A 3VHXB 2B1GA 1ADGA 3DMYA 1CR4A 1PFKA 2DT8A 3UJNA 3P19A 5CB4B 2CV0A 2FWNA 4KFRA 4YT5A 4B85A 4DBLC 2RK4A 4DQDA 4EQ6B 1H2YA 5CXUA 1G0OA 4UE6A 1W49A 1CC1S 1Z5NA 2V7UA 1G8PA 2ZBQA 3OPXA 1A9ZA 4GHWA 1QPZA 1B42A 1C9EA 3BORA 4W8OA 5GGXA 5AVWA 2EBUA 1E3WB 5TV2A 4HY3A 4ADSG 3WX0A 3WZMA 2GH1A 3SS7X 5EWJB 5HILA 4TZ6A 3VXKA 3N2LA 1I5EA 2R00C 3ZLVA 5DYNA 2O07A 7YASA 4ZXPA 3CXUA 5I4BA 2JHPA 8OHMA 2HDHA 2JJ1D 2PZEA 1SVMA 2FWMX 2JGRA 5ERGB 4FR5A 4RQBA 3KHKA 3KQPA 3PHGA 3EGDA 3G2HA 2CK3D 1K4KA 2OWEA 3D4LA 1N5KA 1H42A 2R68A 3MD0A 3CG4A 1CQXA 3PNPA 4I3FA 4Q1DA 4TVOA 2ADMA 2GAOA 1U0NA 3ONEA 4M1ZA 4UTRA 4FFPA 1P39A 2XWSA 5J2UF 4BIMA 2X5JO 2HCBA 2O3QA 4YIHA 1JG7A 4BGIA 1QHHB 1XA0A 2NZUG 5JH7A 4I1OA 3F47A 3DF7A 4HNQA 1VJ0A 3PCRB 1XHLA 2XQKA 3W8EA 2A0YA 5LQKA 4DTIA 3UHPA 3VZCA 4JJEA 2LVBA 4INPA 3QXCA 4EGSA 2WHXA 3MGBA 3Q5GA 4URYR 1USKA 2MWMA 3LDAA 1LPMA 1TU4A 4IH9A 4ZQFA 4M60A 1QGYA 1W6UA 1XKLA 1IEWA 4P32A 4EUHA 1NE2A 3GRYA 3H5NA 3A3NA 4R8RA 1HOXA 4LI3X 3TL2A 4KQ9A 2J3QA 4COOA 4TM7A 4KO2S 1KMIY 1LPBB 3DAOA 3BL6A 4DZZA 2YIMA 1WHSB 1P80A 3H1FA 4L5JA 3PRJA 4E1VA 4E3WA 1ZL2A 3SDSA 4IHJB 4QOEA 1FDIA 2V7WA 4MEJA 4EKYA 5FNVB 4B2PA 2PSJA 2IUUA 3WG9A 3RKRA 3GFPA 4GMHA 2YVLA 3CSSA 2Q7DA 3W8FA 4F96A 5JQGA 1OWNA 2CXNA 2Q46A 2X76A 3AL3A 2A94A 1NMYA 1R0XA 1T1EA 3HNOA 4LGMA 4UTXA 3RIMA 1D2HA 3IKLA 3INRA 1H0SA 3AJAA 3VGJA 3RS8A 3HDJA 3SHFA 4Z7QB 1CYEA 5B53A 2JZCA 3THSA 3U13A 3ZNQA 3GGGA 2ZWAA 3DFMA 4OV6B 4EMTA 3L4KA 3FSRA 1XD2B 3L8EA 4WH0A 1N6LA 5IYZF 1X7HA 1IIBA 1T6BY 5FV4A 2Z4SA 4HJXA 1Q19A 4XCVA 1H4QA 2W42A 4UOQA 3A1UA 3LWNA 1T36B 5DV9A 1T3ZA 1XTRA 2G9RA 5AM0A 3RUHA 1NBEA 3ZWPA 4NDNE 3FFAA 4RTMA 3MTBA 3OBBA 4WEQA 5CTJA 121PA 2R79A 1BFDA 3P97A 5FWAA 3KD2A 1F48A 2ZAIA 4LUCA 2H2FA 1VSBA 4MWCA 2V59A 4ZVTA 1UAGA 2BRUC 5GV8A 3BJRA 2AX4A 2MMCA 1QE3A 2QEQA 4MH0R 2P9EA 5JY1A 2VHVA 4LECA 1WVMA 1ESZA 1N2IA 2PIDA 2ZGVA 3ZE7A 2MYNA 4I6JA 4N0PA 8LDHA 2XUZA 4DM7A 4JZYA 5FWDA 4V0SA 4QTYA 4CGZA 1IZ7A 3AK4A 4WA7A 2HRCA 5HE8A 4PC2A 4OU4A 3WLMA 4IOMA 7REQB 1GJRA 4EPRA 1W0JA 4YAEA 2X9LA 1J2TA 1YASA 4Y1FA 4CCSA 4RA9A 4EY3A 3EQ2A 5BOSA 1HETA 4F97A 2X8WA 2ZJFA 4E5KA 4J0QA 1V37A 2GUGA 4YCLA 4EF6A 3MWJA 4KW7A 3ZWDA 1CUGA 2YIJA 1FA9A 2GM3A 1U7UA 2VPZA 2BH2A 2AR0A 4PO8A 2QTFA 3DONA 4RGQA 2JGMA 2CJWB 4B80A 4BCCA 4EUEA 5TRTA 4C4ZA 5IT4A 4G0YA 1BS1A 1FP6A 2GM9A 2WEKA 3SF8B 3LOPA 2VTBB 4W1SA 3EPLA 1KWGA 3QU4A 1RACA 4ZCRA 3SCZA 3BDIA 4A8TA 2NVUA 1F2TA 5KNDA 3QKRA 1E6EA 2HWYA 4NYJQ 4UNSA 5PGMA 5C81A 1CVIA 4RZIA 5A4FS 2NSLA 1D6JA 3LW8A 2W2MA 3OWXA 5LYJB 1K7EB 3RC8A 4LRQA 1DCTA 2SCUB 1FYDA 4GO1A 4FQ7A 3ACDA 4ZV9A 1LTKA 2F55A 2X0RA 3GBPA 1EA7A 1YONA 4OHRA 4NJMB 3CX7A 3O4VA 1OXMA 1DQZA 1EM8A 4F38A 5JATA 4YJGA 1NQOA 4A73A 1N3IA 1KO1A 1QB8A 1I3CA 2H8GA 2YS7A 3ECAA 1AUOA 3FWKA 2IXTA 3JPWA 4FC7A 2F1HA 3ZHRA 3KQKA 3AKCA 3W5HA 4RHTA 1RKUA 1PL0A 1G6HA 4Z86A 3UKDA 3VR6H 4CM6A 3OLCX 1GGMA 3B1VA 3FMOB 3LF1A 3MWFA 5HKLA 2K87A 1JEDA 4EPYA 4BQEA 3SPXA 5LZ7A 2B5OA 1X8JA 3CGGA 1UC5B 1E6MA 2FSFA 3OU6A 4L8GA 1Q0HA 2C5AA 1Z26A 2HU7A 1OVGA 2ZRCA 4FFWA 2VUIB 1NFRA 3RHZA 4YBRA 4HT3B 3WC4A 1RRKA 3S7ZA 2B1IA 2A9OA 4E5DA 2CJXA 4ZCPA 4N0QA 4ZCTA 3QW4B 1R15A 2XOKD 4MRMA 4MR8B 3WV5A 2V3CC 2ZAMA 5LD2C 2RIRA 4P1ZA 2BUBA 1IQRA 4O2RA 4NBUA 3ZEAA 1XMXA 2YZ7A 1MIOB 3C1UA 2Q7XA 4Y2GA 3QPUA 4HAYA 4N3BA 3CZPA 4F5YA 1NUUA 4JLNA 1X86B 4QJ5A 4F7WA 1JLHA 1ULAA 1PG5A 3C48A 5E9AA 1NXPA 4OG2A 5JAUA 3WBBA 4CLRB 2YMLA 4G56A 1MA3A 2GDJA 3H4IA 3UZUA 4HH1A 1H85A 1U8XX 3U1BA 2QTWB 4U3JB 3ABZA 2QRPA 3TINA 3WNQA 2W9XA 2LPMA 2JDIA 5D3QA 4HGZA 3LDUA 4Q3EA 4U0JA 1MOZA 3K9CA 3OOEA 5I4IA 3EGXA 3WOHA 3KE8A 1CUUA 4QXRA 3TBHA 3QMVA 1ZK1A 1WHTB 2IHYA 3DYIA 1M54A 4K9OA 5KVAA 3DL4A 3KKZA 3K1AA 1QGZA 1RWMA 3H04A 3PUXA 4K6CA 4ZC1A 4TV9B 1LC3A 1TF5A 3CN7A 2CFIA 4IQ4A 3V8QA 3LO5A 4L57A 3MMXA 4X91A 2WA1A 1VI5A 5TGDA 1SQGA 1YC2A 1N2SA 3CPSA 2VJKA 1Z2PX 4J4TA 1TMOA 4MR9A 4E0BA 2NXNA 3LC7O 4QDXA 2WQ6A 1ZMBA 3C3KA 3OQBA 1P18A 1DL5A 4Y9DA 5AXBA 3DCNA 2GM4A 5T5QA 4MW4A 5EWMB 5LL6P 5JSHA 5IMBA 1ECCA 2H7XA 1N6NA 3ONNA 5FA5A 5JZ9A 4E88A 2QW8A 2ODTX 2Q1XA 2C1XA 4JOQA 1US8A 4WY8A 3CUYA 3IOCA 1ZUNB 3F6YA 4DCMA 1FPQA 2F3UA 3HB1A 3QPWA 3DL0A 5DP1A 1U94A 2IVFA 2PMCA 2VZ0A 3QEBZ 4JR1A 1J7JA 4TROA 1V3QE 3OZGA 2XGJA 4LJ9A 2V54A 3D7LA 4JNCA 4LZJA 2F3RA 5U4QA 2BFFA 3ZW8A 1UBTS 3MFQA 4XR4A 1S8FA 3UUFA 3GA7A 4GX5A 2C54A 2B69A 2GPAA 4ZXFA 1T43A 2DF8A 5J43A 2WI8A 3RLIA 3UMGA 4YQEA 3WRWA 5AXCA 1GTRA 1LSJA 1SC3A 4OEHA 1EHYA 3LU1A 2ADFA 5HM8A 3FDFA 2OYRA 2WAYA 4MWZA 1HY3A 4QT4A 2ZSIA 4Y9UA 2OB1A 1KOJA 1PZGA 3TTWA 2ZYTX 3R6TA 1N6PA 1NTOA 2IU6A 3C5VA 3EYAA 3GGCA 3IE2A 5AUNB 1R8JA 3ZXYA 3EC1A 1RMYA 1RBQA 2BFNA 1QHIA 4Z1MA 1E3QA 1NASA 1W52X 5EUBA 4BNIA 1MB4A 1Y33E 3K0AA 1HEYA 3VC1A 4B48A 4YMGA 4EZIA 4JOCA 4E31A 4QJ3A 1KDPA 3V46A 2QGZA 3LUBA 3ER9A 2TECE 2VF8A 5P8WA 2B35A 4RA6A 2V7EA 1GDTA 1A27A 1LSOA 2WV7A 1QVZA 3QXSA 3R9KA 2HK9A 1JV2B 4LBZA 3T3PB 3SMVA 4G07A 2AGVA 1X14A 1IC6A 4MI3A 4BB9A 1QH9A 2M32A 3F6RA 5HX7A 4JEUA 4JI7B 1WNFA 1UF9A 5REQB 9MHTA 1V11A 3ZS9A 4BVBA 5DN6D 5L4NA 3M83A 4ILEA 4MUNA 2RGCA 3D0RA 2ZUFA 2NUPB 1KYQA 4DAEA 1V48A 3I0ZA 3LW7A 2WAMA 4XH9B 3D4IA 5C3MA 3IILA 5KYWB 2JVJA 3QELA 3OKAA 1A9PA 4LRTB 1F6DA 1ABEA 2ZJ0A 3INNA 3DM5A 4I1RA 1JHYA 4ENVA 3UW1A 4G9EA 2ZBEA 4D0SA 3SE0A 1QKKA 4LKOA 2GJAA 4MB6A 1SH7A 3GN1A 1FFYA 1GILA 5KNCH 3AILA 5CB4F 1JKXA 5DM1A 2QRZA 4M88A 5HFJA 1LBSA 4RLFA 1P0FA 1U1FA 2A5GA 3BAFA 3DMRA 1MJGA 4QU9A 4V03A 3ZIDA 4YXFA 2P3SA 3FOZA 1QCDA 1TGYA 2Q5EA 3K0BA 4MARA 1NYRA 3UPUA 1DKQA 1E2NA 1BJRE 3QX3A 1KQOA 3GLQA 3OEED 3GDGA 3IO3A 4KIFA 4G5YA 3WK4A 1BD4A 1DHRA 4IMIB 3C45A 4OH7A 4PX9A 3WIDA 4K86A 3A6DA 1LB1B 1Q11A 2WY2D 1PDOA 1LX7A 5F2OA 4FFDA 5L3RA 1SG9A 1C1HA 2IZOA 4I1UA 1P31A 1XDBA 2R6ZA 4KU4A 4CG0A 2Y9PB 3LUCA 3QXGA 3AESA 1KJNA 4QKQA 5B6IA 5C4MA 1FSFA 2PYDA 4EMSA 3UAYA 2VJOA 2ZSJA 4HK4A 3C4VA 3JQ9C 4TYYA 1IM5A 2J4FA 1BGXT 4BATA 1GUDA 1Y6ZA 2A35A 1FNMA 2QN1A 2BH9A 5E9QA 2X4GA 2BM9A 2AG5A 3GCXA 3KKKA 5AK3A 3IB6A 3UHJA 2FPPB 3EZGA 3CKYA 3Q3VA 3IELA 5HPYB 3UHFA 3V32A 1VE5A 2XVXA 2ODNA 2OG1A 4IX1A 4UBMA 5BVGB 1DBSA 1SCUA 2VJAA 1NNSA 3FRJA 4JLKA 3IIJA 5DHQA 4Z9FA 1OREA 4RTOA 3EW7A 4Q9JA 2RSLA 2YHIB 3BMCA 3G2KA 1XQXA 3L7AA 1MO4A 3AG6A 3N70A 4PGHA 3UGQA 2I4RA 2PRJA 3TSZA 1E2QA 4XWKA 1Q92A 2F67A 4DLSA 5LP6B 1SRQA 2VWQA 1OPXA 4OJKA 3ANNA 4WASA 1AXRA 4PQRA 3S8MA 4BV2A 2Q0XA 4AKIA 2R11A 5AM2A 3Q9NA 4EPTA 1TADA 1S89A 3LBAA 1PD1A 4RJ2A 2CE2X 2HJGA 2IYWA 4DV4B 1SELA 2VDVE 3T52A 4GKVA 3G7NA 3JQEA 2C3UA 5KWEA 1KZ4A 2OOSA 5BORA 3D31A 4KUHA 3B1JA 3ESQA 4IHJF 4I3HA 1PR9A 2GPBA 4EY8A 5FNVF 2GPJA 2J31A 1J0DA 2C5BA 2IEAA 3H4TA 5TT1A 2VDOB 2VQEB 1NG9A 3QVOA 3GELA 2A9RA 3BH6A 3V00A 3ZOKA 4AT1A 4CG3A 2GLUA 3LUFA 1DNPA 3OEHA 3OZAA 2J6CA 4DYVA 3EVBA 4UATA 1KEVA 4ENQA 4YRZA 3U4GA 4G23A 2FA9A 3GL9A 4UMEA 4CHGA 1EVJA 4QEZA 3HP1A 2WUWE 3N74A 2VDNB 3IV6A 1UOOA 2TYSB 4D9KA 3HUFA 4UREA 2P9TA 3OF3A 1FTGA 2XUHA 3JWHA 3SIWA 3PEWA 3VH3A 1LBHA 1YV9A 3E9MA 3PPXA 2WWFA 4C4XA 1F7VA 1ATIA 2BEWA 2DR3A 2FSPA 4FP9A 3ZZMA 2MSWA 1GNPA 2GO7A 1YMUA 2JGIA 4IFTA 3ZHCA 1KNQA 1J6UA 1DMSA 4GMXA 3IPRA 4KRXA 3CO0S 1POWA 2AMVA 3BH7A 3B85A 3PFFA 3K0FB 4FJ2A 4J91A 1RXEA 1OMOA 3ASVA 1CP3A 4NC9A 4HVCA 4NHEA 1YS6A 2V98A 2D0PB 2G4CA 3EVGA 3NORA 2G88A 4RTNA 4D3FA 4B3MB 1HE3A 3V7NA 5DN9A 1ACJA 2JFXA 3DE0X 2O2YA 2GAFA 3CBGA 3PHIA 2F3PA 1LQUA 2HADA 1WMFA 2CXXA 5MN5A 1J9ZA 2EC5A 3FMIA 4RSRA 3ZE1B 4R2JA 2A1TS 4WN3A 4XJXA 3B38A 4PGMA 5FPSA 1HZZA 5EIWA 4RK0A 5EHZA 1M1YE 1R10A 2I2WA 3ITNA 1OZHA 1PZHA 1LTHR 2FYTA 2O2DA 2YWGA 3C3PA 2RIPA 3BYZA 5EVJA 1G7RA 1D6SA 3R77A 2P79A 2Z5FA 1NJFA 3DJYA 3I1JA 4KVFA 4Y2JA 4NV3A 1NJ8A 2BMFA 2EGGA 1I4OA 2B7BA 5G41A 2I8AA 5AQ1A 1PKEA 4DANA 2NZ2A 3QQ5A 1B8NA 1TYAE 2PGDA 2P9FA 2PZFA 3P45A 3OOYA 3Q2OA 2I2FA 2Q1YA 2BUAA 2PU7A 3KB6A 1IN4A 1GU0A 4RF2A 4CM9A 3A6EA 1UMDB 1T91A 1ODKA 2IT1A 1KKUA 3EMKA 3T9AA 1UK8A 1ZL0A 3ZXXA 1S3SA 1I1OA 4NMWA 5ALRA 3O8QA 3LPLA 1TQ8A 4KI7A 1NXXA 3TK1A 5LYJF 4Z4QA 2AEFA 3WGUA 3R4VA 4JQCA 4B87A 4CTMA 4K46A 1BZYA 1BXGB 2ZTVA 2GDZA 4LJ8A 3EE6A 1XX6A 4XZ3A 3OP1A 4AECA 1JQKA 4TMYA 3MCZA 1JDUA 1T8RA 1MN6A 2NW6A 3NEJA 4LYEA 2VT3A 4ETNA 4AY6A 1QVRA 3CLUD 4GOKA 4ZVMA 4B6EA 5DEOA 2RGDA 5DNCA 3SC2A 1FDRA 3HXPA 2AXPA 4RJKA 3I32A 4MKRA 2NYVA 3IP6A 4YRIA 3PR2B 5ITZA 1PR2A 2JHFA 2W8BB 5E1DA 1NN0A 3OE7A 1KZYC 2GMWA 2X5KO 3MINA 4KR9A 2VQ3A 2W6NA 2QJTA 2UUPA 1F60A 2ZJ7A 3EXFA 4G5OA 4YBZA 4M9XA 4O02B 4AUEA 4ZYVA 3V80A 2OV1A 4YJFB 1G0NA 1WS6A 3NHZA 4A0FA 4DSZA 1EZ4A 2WNHA 4GE0A 3L4JA 1SBTA 2C2GA 1CEEA 1G9TA 4A0RA 4BWFB 2AJCA 2EKQA 4NI5A 2OUIA 1E7SA 2YOHA 5AI6A 1F4LA 2X0JA 3SWWA 2X77A 3DEFA 4EG5A 5EJMA 1NQ5A 4UVGA 1PNRA 1ZC4A 3TTYA 2QG9A 1KH1A 2PL9A 4PANA 4XFJA 2J3KA 4IUBS 1FP2A 4ZZ3A 2J0QA 2OKGA 4L15A 2R751 4L3OA 1KI9A 2JEOA 1NW7A 4IJVA 2NT3A 4M1WA 1V3UA 1SN7A 1V8FA 2IY7A 3QV1A 1SVNA 1PX0A 3JWEA 2YWFA 4HRXA 1K7XB 3WMRA 2H4ZA 5BMOA 4KR7A 1MHPA 3OT1B 4HWGA 4W8HA 1KXZA 1TM2A 2I4OA 5CVVA 2Q0QA 4S1TA 3ZW7A 3KVVA 1ORRA 1YBFA 3COPA 3HNRA 3WB1A 4RTSA 1DAOA 4JLUA 2XMGA 1ZG3A 3QNWA 4LJ4A 3ASYA 4XD7A 3RS3A 2QUBA 3U4IA 3W7BA 1GCOA 4MMYB 4EKDA 2IYEA 4OYRA 3K1YA 1ZH2A 3W4IA 3A4IA 3LP8A 4F0JA 1KK1A 4Z4EA 3EQ7A 3F5MA 2BZ1A 1EK2A 3VNBA 1IAQA 3JYLA 3WGNA 1JYSA 1XTTA 2BV3A 2HHAA 3GPBA 3HYNA 3VPBA 3ZU3A 1MJGM 4J4BA 2Q29A 5C8YA 5JNVA 4DV6B 5HZMA 5YASA 2O8DA 4IF6A 3IAUA 1M1UA 2N46A 1E6WA 2KJQA 4TV9F 3KPVA 1RE1A 3CH4B 4JJFA 3F8SA 4EUSA 2HWWA 5KTPA 3NYRA 2JFGA 4BMPB 3C24A 4IDAA 5LM3A 1SXPA 3MJHA 2PJUA 3FTNA 4CMKA 5FWYB 2II6A 5JCOA 3ROMA 5DCUA 3MXTA 4LPSA 3SIPA 1A69A 2CV1A 1TF2A 1ZYUA 3TTSA 4B2LA 2R6AA 2DLNA 4JQYA 3BMQA 2VTDA 1G4UR 1R00A 1UJCA 4RAOA 2IOYA 4UUNA 2AKEA 4D4HA 4LVOA 4U39A 4ZVQA 1N6KA 1T35A 3GDWA 1AGXA 4ZQGA 1GVNB 2DR0A 3UKOA 7ADHA 3PGA1 3THYB 1W36C 5ICMA 3I61A 1SKQA 3D8BA 2ATIA 1DKNA 3GLSA 4FWTA 3WNDA 3PXCX 4HQRA 4XARA 1JHUA 5CJPA 2HHLA 1EUCB 1N3YA 5CM9C 5K3FB 1Y3AA 2ONCA 5DI3A 2ZRFA 1OBFO 2FW6A 1ZI8A 1QANA 3SXPA 5BSEA 5CB8A 4PZCA 1L5MA 1Y4UA 1GN8A 1GNQA 2OV8A 2IW1A 4ZOLA 3IDZA 3N3AC 4WW0A 4QUIA 1YB5A 1MENA 4A7PA 3KB2A 1XI2A 3QWIA 3GLGE 2GHQA 2R1TA 3ZPXA 1Q2UA 2FJ0A 1Y8QA 4H0CA 4KXLA 4W5HA 3RS0A 3WK7A 3ZK8A 1NN1A 5JS8A 3C6MA 1YJAA 5ICGA 1EGMB 2P6UA 5SICE 1H0RA 4WVFA 3RT1A 4E70A 3Q0IA 1YE3A 2QKYA 3OKFA 3VJLA 1L7NA 3H9BA 1C81A 1EGHA 2X42A 1ZC3A 4MJ7A 1O87A 1ZOIA 3E5MA 3HB0A 3L7IA 4ZARA 2RAUA 3CRW1 4P4UA 5D1HA 1T4GA 2D0DA 1RZ3A 3PG5A 3RK1A 2YNMA 3K9FC 2NV0A 4MW6A 2PMFA 2W2NA 1UJ4A 2IV7A 2ONJA 4H7DA 2J87A 1Z62A 1VA4A 1VPLA 3N2YA 4R2IA 3GLIE 2GN0A 2HSWA 1ARZA 4RZUA 3EJ6A 3T5DA 2GKGA 3RFTA 4CRWB 3D8RA 3GEMA 3Q3EA 4BWVA 3MLAA 4L8VA 1L5OA 3CR3C 2FUKA 2Q3EA 1D1SA 3M3PA 1UP7A 4LY9A 1XCGB 1VPDA 3CNEA 3LT4A 1H2BA 2VDMB 4PW0A 1DJNA 3LKVA 2BGGA 4BP9A 1K0UA 3IMGA 3BXGA 1YUBA 1B1CA 3A7DA 1MPXA 1E9DA 1TC1A 3INGA 1E8NA 3B3AA 2BFDA 5T4EA 1CZKA 2R97A 2DWPA 4ALLA 2GCOB 2VHXA 1ORVA 2DECA 1T9CA 2NTNA 4RY8A 2Q6KA 4B7XA 1ZGHA 2XYRA 3RSSA 1YZNA 1QQBA 1BOFA 3CF2A 3NAGA 1SKYE 2FP4B 2HCFA 3ONWA 2JBAB 3P5SA 1QX4A 1C4OA 3L7MA 4WDRA 3VU3A 3C1TA 4UM7A 4S35A 1DAMA 4RV9A 2FPIB 1DWUA 3TLGA 1VRVA 1H0KA 1M2HA 4MVJI 2VJPA 3HR4A 3JQAB 3NBXX 5EHGA 4EA7A 4MKIA 3VZRA 2AXNA 1W0KA 1Z5PA 2VJLA 3GBSA 3H0KA 3L0CA 4J49A 5LQJA 1WXXA 3VYRB 2VRCA 1IZ0A 4KDRA 1N5DA 4BJ5A 1ULSA 3ZBPA 1IHYA 1LPPA 4NH0A 1X74A 4GX1A 2Q50A 3KZOA 4MS1B 4CKWB 2HMYB 3MWDB 2EARA 3EEQA 2E6UX 2IPAB 3P9XA 5CDTA 2QAGA 2B8TA 5AKXA 3HRIA 4CQLB 3N76A 1D5CA 3KL2A 4YK7A 4PR0A 2OHVA 1VG9B 3HVKA 1IBKB 4WXEA 5FL7D 5BYKA 1BS9A 1JAZA 4OI1A 2HRDA 2G9ZA 3G49A 1PK8A 3UTDA 2ZVQX 5F35A 5A9RA 3T94A 2EBHX 4QLBA 3BE4A 3VQTA 1QGAA 2V5VA 2JLSA 3QEAZ 2R9VA 1FSSA 4DR2B 1SA0A 1GZSA 3X1YA 1RKXA 3CZ9A 1L3IA 3E7PA 2RJNA 4HLQB 4CE6A 3WRXA 3EXHB 2GN4A 3LXUX 2Z1DA 3UFBA 4G85A 1E3LA 3N5CA 4IVRA 4P7FA 4OL9A 2REXB 2V96A 3RVJA 4DRXA 2WE7A 4QFDA 3ZVMA 5IKEA 2VYVD 5LP6F 1ZZGA 4AIIA 3ML1A 4W9RA 5HJ2A 2FNAA 1EPUA 2ZAYA 3CX8A 3OE1A 4YRRA 4MKZA 1FW6A 5DXFA 1M1YB 1RLIA 4MOWA 1SKMA 1BDIA 3IAHA 1I10A 2Q3FA 2QVZX 4Y2PA 1XRRA 4RPHA 4FHZA 4GOOD 1CF9A 4IIEA 3HJGA 4JBYA 6ABPA 4D92A 1TZKA 4P3NA 1ZN2A 3O03A 2ROQA 4MW5A 2QNIA 3OE4A 1B0ZA 2PUJA 4RZ3A 1T1GA 3I45A 2XSZA 5TVGA 3RDPA 1FFXA 2YQ4A 3A4VA 3RSZA 3RG2A 1UKYA 3NO4A 1P1JA 3SXJA 5A62A 3VNRA 4IX9A 1MP0A 1YL7A 3JW8A 2VA8A 2ZYHA 1JEEA 1KI8A 1U8UA 3TAHA 2M2IA 2O8VA 3WDKA 1KMNA 2EAUA 1L7EA 2P6NA 2J8ZA 3A2MA 3KKQA 4HSGA 1HL3A 5J2TB 4ZT6A 3R7DA 1MLDA 3V97A 1K3FA 2DPXA 3EY9A 1U6IA 4TV8F 5EA2A 1KTVA 1G66A 3KQQA 4OBXA 5FULA 4NEQA 3TQSA 5CDUA 5B30A 3FMFA 1F51E 1FFCA 1IQ0A 2POCA 3TL6A 3AHJA 4BBAA 4CCWA 5K3SA 2VPYA 4PO3X 3I6ZA 4AY2A 1UQUA 4CQMA 2XAUA 2VXOA 4MA4A 4GPAA 5DHFA 4M0FA 1OWPA 1SG0A 1RVDA 4RNDB 5IG2A 3JARB 4EFLA 3AFNA 4R7GA 4EHHA 4IIJA 2F3QA 2IH2A 2VYQA 4OHOA 3W3ZB 1EP9A 1BD3A 3FPHA 3BCSA 1SHJA 4I1VA 4P36A 2R0QC 3RYTC 1K06A 2QAJA 5TQ0B 4NF2A 1DCMA 3B9RA 1QDLB 5F9HA 3KSDO 4DSUA 2FMIA 1CE8A 4PQEA 1O08A 1MIHA 1AKYA 2GARA 2GZAA 3DBOB 3SLRA 3WB0A 4EL5A 2WZDA 3T0IA 3C8ZA 3ENQA 2GZ1A 4RF3A 4FDLA 1ZGAA 3RSLA 3MBKA 4HJRA 1Q6YA 5JPDA 1XZHA 3WA6A 2BFCB 5ITWA 3WADA 3ZGNA 1E1CB 1QBGA 3TUIC 2CXTA 1XWFA 2LBPA 2B7CA 2GAAA 2V7TA 4IDQA 2VJCA 3L4BA 3UJPA 3H1EA 2GZ3A 4NOJA 3TJMA 1GGEA 2ZPTX 3H6GA 4HTFA 4Q1AA 4I5FA 4WMLA 5FUWA 5KMGB 2YWBA 4J07A 3EVTA 4X00A 2EFDB 4DLVA 2PR2A 3REFA 5B36A 3V2IA 1DEHA 3DXXA 3T7SA 3M2TA 3QU5A 3SAJA 5I7WA 3O0DA 3KKEA 3ZVLA 4CMEC 2EP8A 4EX6A 2PUDA 4DARA 5LQMA 3B60A 4YP6A 3SQXA 1N9KA 5H9VA 5JCJD 3CURA 4WX2B 1NF8A 2ID9A 3AETB 1AZSC 2W2TA 2LDBA 1EVIA 2ZSHA 3PSHA 4DM3A 3KQLA 3DKPA 3HCNA 2GHIA 3DTYA 1H2EA 1P4RA 2CUZA 1N5JA 2EX4A 4WNAB 3CA8A 1BHQ1 3IUSA 3L02A 5D01A 4Q00A 5ALIA 5DWQA 4N7BA 5C8ZA 2V1UA 3SEQA 3GT3A 5GMOA 3HN2A 1H3FA 2GPTA 3TLZA 1U63A 5DM2A 1ZCFA 1FRNA 4Y2TA 3I5AA 3PT9A 1YH3A 2O0HA 1RKBA 3C3WA 2QN9A 1G1MA 1UPXA 4ZVPA 1E62A 4EO9A 4V0OA 3O47A 4BMZA 4H6PA 4WLOA 2JJ1A 4GM0A 4IINA 1ODSA 1VLVA 2QXUA 5AVKA 1QS0A 4NJOA 4GR5A 1TT7A 5E1BA 5TQ2A 4JGBA 2CK3A 2R87A 1KI3A 2JLXA 1QTQA 2ZJ8A 1TJ4A 2XYGA 4HAIA 2QY6A 3S8YA 2R8YA 2IXEA 1E66A 2CL0X 2X8JA 3K1TA 5D00A 1M2OB 1JAHA 5FLKA 3GG9A 4OLFA 2IV2X 1JIJA 3UMFA 1DT5A 4IMPA 2J0UB 1W4LA 5FXMA 3SC6A 2WVHA 4OAPA 3W1EA 4ZOQI 3DLHA 2Y66A 4QTZA 2OZLB 5LYYA 4LFAB 3IIKA 4PZ9A 2XTMA 1U6JA 4MJXA 4RENA 5D2CA 1PSWA 3JQ8B 3RUCA 2CVZA 4R3NA 1YVEI 1E7RA 3ZE6A 1E4EB 1TEVA 1UPFA 2WUEA 3D5TA 4DJFC 2V4ZA 3GDFA 4PN7A 4CXMA 3R6GA 1L4EA 4B33A 3ZV5A 4V38A 1J49A 5A6VA 1FSGA 4TXNA 3QLVA 1ZJWA 3IC5A 4D2IA 1OU4A 4XUCA 2Z2ZA 3NTQA 2VDKB 2FRXA 2OD2A 2WKQA 4MYTA 3EPRA 1QE5A 3H9JA 1N8KA 3FYUC 4MQFB 1KP9A 4Q9NA 1E60A 1FFBA 2REOA 1QIHA 3V9AA 3OZTA 4X94A 3EEOA 3JQCA 4GE3A 5DM70 1E0JA 2C84A 1G19A 4FCWA 4G63A 3KUKA 5EHQA 5TXGA 5ULLA 5WRFA 1F06A 4KZPA 4XVHA 2I6UA 1Z4MA 2ZG6A 3MWEA 3E81A 3OKPA 3FROA 4RSHA 3T9CA 2RD2A 2WSMA 1MA0A 4CKYA 4S1VA 3ZBTA 1U2EA 3GLIB 1X77A 4KRGA 4CMHA 5E7JA 1JRLA 1TCAA 2OILA 5F21A 5GOZA 5LB2A 4A27A 5IFKA 5K6TA 4DM4A 3TMAA 4B4DA 1Q3TA 4C7JA 4D8WA 3RANA 3FOCA 3I72A 3O8LA 3KPUA 5BV8A 221PA 3ETGA 2VPPA 2WHYA 3BTOA 2CNNA 4DC1A 3TVYA 2O57A 1GXSA 5HQTA 1NAIA 2WU8A 2X14A 2ABWA 3DFKA 1SOWA 3GVPA 4KLRA 1NNEA 1Z29A 4BV8A 2YTZA 1G42A 3VUFA 1G5PA 2PBFA 3CUWA 4J94A 4QODA 4AP9A 1DRWA 1SKYB 2RGGA 4Z4FA 2F8SA 3PHJA 2FLKA 1DQYA 2QVBA 2PIAA 3Q0TA 3EZ6A 5AJYA 2JGAA 3IEUA 4WACA 1NT4A 5AJZA 1ANKA 2ZANA 3DEIA 5SZKB 3QLEA 1CJKC 4OH1A 4LV6A 1ENZA 1YFKA 2ZYRA 1RJFA 2OCGA 3WK6A 1ORWA 1JE0A 1E9CA 3QOWA 2ATCA 2EFHB 1OPRA 2NOAA 4BCDA 3E2MA 5IS2A 3ZVNA 1N33B 2EW1A 3HB7A 2R48A 4LDJA 1J2YA 1T5LA 1KRWA 1PG2A 3QG5A 4FR0A 1I7NA 3W90A 1IVYA 2YC4C 1NLMA 2Q1TA 4OUDA 4B3SB 3QE4A 1RJWA 3EXG2 2QPAA 3IP1A 4PQFA 1AGYA 1MAHA 1NU6A 1P2TA 1P73A 4UE2A 3OCUA 1DXHA 4NECA 1O6ZA 2PR7A 1PFGA 3A1SA 2GD1O 1H6BA 3O2SB 4D8VA 5IJ0B 4L95C 5KUTA 1B6SA 4PWZA 4IRUB 3RIHA 1LV7A 4D0GA 1PJLA 3Q6NA 1M75A 3IVGA 4OIFA 4UHHA 4F9FA 2HA2A 1QYIA 4FNOA 3KHTA 1T2FA 1ZISA 4EJSC 1PZFA 3GEPA 2WD7B 2BGNA 1P17A 3BHJA 3JQFC 3NVDA 5EXPA 5CCXA 4JLPA 4PGGA 1XLTC 4D97A 4IGAA 1PDWA 1OH6A 3MGCA 3COVA 3WLKX 2BGLA 1KA9H 4NZPA 5TJ9A 3RC2A 2DM6A 3NASA 3T3NA 2YASA 1WOYA 5DZSA 3QKWA 3E3AA 4CM3A 3AJ9A 4NAVA 2DKOA 1TA9A 3N2IA 4BRWA 3WQSB 3BBPA 3A6KA 4C0AC 4KAFA 1C5KA 2W2PA 1Y80A 1U3VA 2E6KA 1IOLA 2HWXA 3IDSA 3NBUA 4FW9A 4A3SA 4EWLA 3E3LA 2A67A 4PXYA 4ZFNA 4Z4HA 3SZGA 1KS9A 2GVNA 3IDQA 3LNTA 4P2BA 4RY2A 3TW4A 3CLSC 1R27A 2AHOA 4PNZA 3RYIA 2IU3A 1HBJA 1NXOA 3ZH2A 2OEPA 3U09A 1DU4A 3CLHA 2NTEA 4L5YA 5LCXA 1KU6A 3PJEA 3E8SA 1EB8A 1UBFA 1AM4D 2CXPA 2DFKB 2DKFA 3TIVA 2LNDA 3J81k 3W9BA 1IVNA 1MAUA 1FJXA 1SBNE 5JBNA 3X1JA 2ETXA 5ALWA 2QIPA 3DFUA 4NRDA 3VSDA 4B4KA 2ODPA 1KOLA 3JZMA 1JDBB 2ZE7A 3JCZA 2ZT6A 3AVPA 3NVAA 1G6OA 3HI4A 3IGFA 3TW8B 3W2GA 1U2DA 1VPWA 2A59A 4F5WA 1SWWA 1KMCA 1IUPA 1VSUA 3UMSA 1KQGA 1N2OA 1R9JA 3TB6A 3V4OA 2VQDA 4DXAA 3HADA 4ER5A 4M9CA 2ZATA 2P41A 4YGYA 1IUNA 3N28A 2ZBUA 1EFPB 5IZCC 4ZA2A 3UK6A 3WDLA 4IY1A 3ELUA 1O58A 3VU1A 1I6KA 1F6BA 1B00A 4H0NA 1U7OA 1O6BA 2HRQA 1AQIA 4ERNA 4OXRA 4KXXA 4BE7B 1N2XA 1EK0A 1GOTA 1ETUA 3EIXA 3B53X 4DR1B 1GZ4A 1EJ2A 4EYQA 3PL5A 1V8BA 4OHFA 4QUEA 2E4AA 1ZVKA 1PK7A 5F5LA 3WTBA 1IBMB 1HORA 1UEIA 1JBKA 3FXAA 1BXKA 3PVSA 3L1HA 4IVQA 5FLEX 3WICA 3WE7A 2BTQA 4H2DA 1QQTA 2WINI 5I9BA 4CM4B 3LXMA 5EQTA 4F8JA 5JJIA 4AKHA 3PGMA 1AVTA 5CIQA 5ERXA 4ETWA 3A10A 1OCEA 3KWJA 1WUKS 1N57A 4WINA 4YDRA 3G23A 4OQ4A 1NVUQ 1VKZA 4Q1EA 4U1RA 3BKXA 4RHYA 3H9CA 5JDCC 1BWSA 1NNI1 4HAXA 4N5DA 4XDHA 1NIPA 3F6CA 4NBKA 2YHSA 4MWGA 1T8SA 3YASA 5TPWB 1OTYA 3KKOA 4GPD1 4K3VA 4L75A 5E4TA 1ID8A 1TTPB 1A88A 3DVQX 3N59A 2PBLA 2YINC 4IZOA 4EZEA 2YWRA 1A95A 1BQ3A 5CH5A 3HEAA 3B7WA 5IVIA 2F1OA 4ZV7A 3TR0A 4L7VA 1HDYA 1VHJA 2HF9A 3R0ZA 4P92A 2IS6A 4LYDA 1B6RA 1XQ9A 1ZMTA 4HRAA 4Q1CA 1DAEA 1HA3A 3NETA 5D5PA 2XWQA 1HDCA 1PZEA 2PFKA 2QX6A 2W2KB 3L8YA 1Z34A 1WZUA 1N8SA 2X4IA 1G7CA 3IAM1 4TN5A 3V4RA 2FW1A 3LA8A 3LXXA 4NE2A 4O5OA 2XH8A 5JNUA 2VH2A 4EHLA 1NRJB 1PYGA 4BKMA 4LNUB 4EI2A 2HJSA 4GGMX 4DDUA 2EEZA 2LKDA 2XTNA 4PZ0A 4YCCA 1I4DD 3M3DA 4DEYA 2C0PA 5TY0A 3ZK9A 1LLDA 5KTNA 3MS2A 3ECCA 1CJMA 4C6HA 3BKWA 3U3OA 4FJ0A 1WBBA 2H2DA 4Y2VA 5A3JA 2P91A 1QC5B 4YRDA 1S7CA 2E5WA 5D3ZA 5GONA 1SXJE 5BV2P 2ZJ2A 2G5CA 2CL5A 4AI6A 4MAFA 1F4PA 1Y6GA 3RVQA 1KHTA 3UAZA 3E15A 2QRLA 4IXWA 2I6SA 3DPIA 3FNBA 3Q8KA 4GPIB 2UXBB 2JIZD 3LX4A 3MTEA 4HQFA 1QWSA 4JSRA 4HUQB 2R85A 3PEFA 2ERCA 5H82A 1PQ4A 4L07A 5FUBA 5F2NA 1WZ2A 1ML3A 1RC0A 4FOTA 1RM3A 5JOQA 2IDMA 1BMQA 2ZJ4A 3WLJA 3PVCA 2CLDX 2H4WA 4OU5A 2X13A 1GQYA 1HMYA 3I6QA 4HH4A 1J8DA 4RZSA 4Y6RA 4CV1A 3I1YA 4BDTA 2F1RA 2QP9X 1B3RA 3NJ4A 4PIVA 2I3DA 3FPKA 2H16A 4J2OA 3VTAA 2PUBA 3J7TA 3NYIA 1OR8A 4Y0VA 4TXMA 2B92A 4BLWA 1OZGA 3T9EA 4B73A 5GY7A 1E1QD 1X1BA 1TKBA 4RKYA 1JHVA 1XK7A 3EHEA 16PKA 1IOVA 3NDIA 5EG5A 3RQSA 1CF2O 5CXSA 4DSTA 4TQUS 2QLNA 3O6VA 1VLMA 3CUUA 1JDPA 1VJCA 3V2GA 1ADJA 1U1DA 1R0SA 1HEUA 2JIQA 3OJWA 4JYMA 5A7GA 4DA0A 4ZO6A 1JZSA 4BMNA 1GZHB 1L9XA 1FS6A 3AXTA 3EEBA 4DG8A 3HV2A 1TXGA 2VCEA 2A58A 1KJJA 1FFEA 1T8UA 1VYUA 3PTZA 1QLHA 4MIYA 4UUPA 3OEEA 3REOA 1YJCA 1ZONA 1DP4A 1V3VA 2H1CA 5KREA 3EDQA 1EBFA 5B2FA 4IXMA 1I24A 5MFPA 5BXYA 3W77A 3OUTA 4OQZA 3PRHA 1KVSA 1OBVA 3IV9A 3H17A 4ITVA 1O6CA 4R8MA 3WIUA 1DTEA 2XB8A 4H27A 5LPNA 3B7PA 3O95A 4IG9A 4KSCA 1KERA 4ESEA 2AOXA 4OMUA 4FB4A 4J1TC 4N82A 5K0FA 5AKHA 2OBYA 4RFVA 2CNWD 2VHQA 2VLIA 5DYWA 1QMPA 1DI0A 4JL5A 4DUPA 4JXXA 4AP6A 1A9RA 4MYCA 2ZVJA 4MNTA 1MJNA 3PQFA 4FEAA 4N1AA 4RZQA 4Q9KA 1XTZA 2DPHA 3CY6A 4MEBA 4TKMA 3DBHB 2Z9DA 2B21A 1KO4A 2YYZA 4UAJA 1KMQA 5IYZA 4UOEA 1N92A 4Z4GA 1TW2A 2VHJA 5JDIC 3GU3A 3ABRB 2ZSDA 3GJ3A 5JAPA 5ES4B 2R1VA 1YR2A 3A4LA 3NIBA 4KPUA 2P7HA 3FZQA 3AG5A 4OQLA 5EMKA 4FNAA 3S2IA 4AICA 1YUMA 1ZICA 1C1XA 4B7CA 4QOFA 5DEIA 5CURA 1FNNA 1OWMA 2WHEA 4DB4A 5CCEA 2I6GA 4YJKA 5HEKA 3NHAA 1K6JA 2VO1A 1U1CA 2C97A 1Z88A 3HV0A 1YJXA 3T5GA 1CD5A 4FDMA 4OHUA 2VDUE 3Q3CA 1ULUA 1CR2A 2YYYA 3D6TB 3H18A 4G97A 1U3TA 3GFTA 1M73E 1JPVA 1ZN9A 4AW9A 4KO1S 2CMGA 1VL1A 4P6VF 4B3BA 2GZRA 1HQCA 1JWBB 3ZKAA 4DIMA 1WSBA 2P9ZA 1BWQA 1VB5A 2IYTA 1B8PA 2R7AA 3TE7A 3KHUA 1NX9A 3NPMA 1CY0A 4D42A 1X1EA 3EC2A 3AFOA 4DT1B 1GHTA 5HKBA 1C1DB 2BMJA 2YWCA 3ANYB 4LYAA 4CF3A 3RAEC 2G67A 5I5GA 1RXVA 4OI0A 3AIMA 2VAMA 3UUEA 1DELA 3UT5A 1LS1A 1W29A 1WULS 1YS7A 3ENKA 3L9WA 3VMFA 3OX2A 5IJ9A 4IL5A 1MQSA 1CETA 1V1RB 3FVRA 3UOWA 2EYUA 2RKWA 4PZLA 5FUVA 5G3ZA 4GOMD 4CUKA 2ZYSA 1CJBA 1YC5A 4X6YA 4Y2YA 1S2MA 2JHGA 2ZI7A 4WOJA 5FTLA 3GP8A 1T1RA 1Q7GA 2RG1A 2HDWA 3NYWA 4N3AA 1T4BA 1WKBA 1GZ3A 1BWRA 4YDQA 3A4TA 2MOKA 3W8NA 3D7RA 4EHFA 3UC5A 5DW3A 1ORHA 1Y4AE 3O9ZA 4M1SA 3T3DA 4BNXA 4I4TB 4XEHA 3ZJVA 2XDQB 1LRLA 2BONA 1W581 3KVNA 2KX7A 4U63A 2WV9A 2ZM6B 3H87A 1LK5A 4M86A 4XX0A 4WJKB 2Q5HA 2XI4A 5DGCA 5JU6A 1ICEA 3ZQUA 1CRLA 3QMPA 1D6MA 2YFHA 3QKUA 4JS0A 5A7FA 2B1QA 2YN4A 3AVVA 3N0VA 3FNHA 3N05A 2CVQA 1JNYA 4F3NA 4DUZB 3FE2A 2NU9B 1GQQA 1RWBA 3IURA 2H57A 2ZE8A 1MAVA 3M1AA 1TU3A 3RU3A 2EATA 3IFSA 1PWYE 2H1OA 3C2QA 1JBQA 3QU9A 6YASA 2C20A 1O0BA 2A0XA 3N0WA 3DF9A 4PC3A 4DN6A 1W85B 4GX0A 4CT5A 3ICEA 1R3DA 1T0BA 1XDDA 4WZAE 3LYHA 3L93A 4LNAA 4DUYB 1SUAA 1KJIA 3WGYA 2PMWB 4LWQA 1C41A 1DAHA 1PDVA 2JK0A 1P2UA 3LP6A 1NPDA 3PRKE 1QCYA 3MTJA 4RMGA 4YI5A 3N8IA 2BP7A 1HFWA 3OD1A 4RDCA 4AM8A 2C7OA 3JQAD 4UUAA 4I9UA 3FKQA 4MWTA 5CHEA 1XJ0A 2WJ3A 5I01A 3S2ZA 3GUVA 5JALA 1U0BB 1XOIA 1E5TA 3D8HA 3GEEA 1GNVA 3BFKA 3JQQA 1W0CA 1VPTA 4L2IB 3I9OA 4LV8B 4AF6A 2FCRA 2H31A 1ZNXA 4ZICA 3FGZA 3B5IA 3BIJA 3SYMA 3RUEA 2KPOA 1GNSA 1TVCA 1UDRA 2C8JA 5FCDA 5LU9A 3R41A 1P2DA 1L0BA 1QZTA 3CZ4A 5KTSA 2OHOA 1OGJA 2QQGA 2WT9A 1WMEA 1M0EA 1Y1PA 2FOXA 2XV1A 3KJGA 1UDAA 4LY3A 5A4MS 3HSSA 4E22A 3EUWA 4MLPA 2WOOA 1FDWA 5F1PA 3P94A 1X7YB 1G8MA 2HH9A 4BZQA 3DTNA 3D81A 1PJ8A 2ZUEA 5BN4B 1Y7LA 3QWBA 3IBYA 3F1KA 1JAIA 2CVOA 4KWEA 4JR2A 1JR3E 3N8GA 2GGSA 4ZIRA 2AFIA 3R75A 4B2YA 4R0NA 3CPJB 1AKNA 3IQGX 1X7DA 2DUMA 3W8RA 3WAKA 1S3IA 2K6GA 3OSZA 1O0CA 3V2HA 1S0UA 3TZKA 3IMKA 1Z75A 2ZUSA 1G5IA 3U6KA 2DTXA 1TK2A 3P7MA 1SK8A 4JXZA 2XXAB 4QHYA 2RGAA 2AXQA 1Z06A 3DE4X 4PC1A 3CU5A 4C2BA 2YHAA 3NHFA 3WQHA 2AVDA 2ZRDA 2P69A 5CLLA 4O2AA 1DDIA 4YTEA 5C1BA 2OE2A 1U1EA 2FZEA 4Q3LA 2C7VA 1AZLA 1PLKA 1KSGA 2HHHB 3DG9A 2R8RA 1ZSYA 2AJTA 2JARA 1NAHA 2JAUA 3FCOA 3GUCA 3HMQA 3OZUA 4WOCA 2NADA 2M6SA 2IF0A 1V7CA 3U4CA 4R71A 4YONB 3KG2A 2HR1A 2G1UA 4DCUA 1NHWA 2Z2IA 2IHUA 3LK7A 1SOUA 4MRPA 3UW3A 3R9IA 5TJHA 2EWWA 5CBPB 1E77A 3IEXA 2QR2A 1UC8A 2HF2A 3OFND 2O59A 1ISRA 1JLKA 1PYDA 3RC9A 4IYJA 4KQGA 3VPHA 1FUEA 1NF2A 4ABYA 5LN1A 4AP5A 2GRJA 3GEIA 3GMTA 4D9MA 3KU1A 1WF3A 2JPDA 1BYUA 4FE7A 4B3FX 3WLQA 4OL0A 1H1LA 2YCBA 1VKRA 3UFXA 4QDKA 1SXJB 2OB2A 1I14A 1Q1QA 3I53A 1NIJA 3L0IB 1UWKA 1WU7A 3DCYA 3Q11A 3B1XA 2VJBA 3VNSA 5CFMA 2IX9A 1H5UA 1W44A 2QMEA 4K26A 5GVRA 2R44A 3A58B 3Q3IA 5D87A 2AE1A 4AY3A 4EP1A 3HACA 1J4AA 2ZP1A 5AM3A 3PU6A 3GLFA 3NGMA 2DTDA 4HPJB 1PR6A 2DR2A 1Y6JA 3V1NA 2QHXA 2YWJA 2XQIA 3JZDA 3T1TA 3PJDA 1YJ8A 1QMGA 1E1LA 2V3WA 1DKRA 4LQCA 4OSPA 4OSEA 4ZQHA 2OSVA 1LNSA 3WHLA 4Q3BA 4O4LA 3KT0A 5EUMA 4J4HA 2CHUA 2OR3A 1JDNA 2ORED 4KIUA 5GJVC 6REQB 1PUXA 2DHQA 2JNWA 1YFZA 3BA1A 3ZU2A 3IEMA 3GFOA 2ZSUA 3UJ7A 3MBIA 4B43A 4Q4CA 1WEKA 1BX0A 1A2BA 3N1UA 2PMEA 4MKHA 5EQJB 3B2NA 2QI9F 4IV5A 1SIUA 3BWMA 3U9TA 3V1TC 1FMTA 3G9ZA 3L0BA 3TW6A 5CFNA 3KBOA 2K4MA 3PQ7A 4OGFA 3G6WA 4B74A 3KR2A 2GBPA 4WAUA 3ND6A 1WV0A 4HB4A 4O08A 1J07A 2H5EA 5ALVA 4ZO4A 3IBGA 2W93A 3MFYA 4PS1A 1RTTA 4ND4A 5C53B 1Y1KE 1A97A 3UG7A 4BO9A 3TGLA 1QXSA 2LWIA 1IEXA 1DS6A 2AQHA 3E9DA 4GMFA 4K87A 3R0XA 4RV5A 5EJAA 3DZGA 2MYPA 4JJZA 4YJ3B 3AH8A 4BRUA 1AJEA 1SJ9A 2GYVA 4IVNA 1V96A 3UAOA 2CSUA 1PW5A 1LZKA 1L6RA 1QJCA 1W2WB 2J3IA 4DYDA 3SJZA 4PF1A 4D4MA 4HX5A 5M3BA 4CMGA 4J1SA 2JH9A 3K8ZA 4F9TA 2I33A 1NQVA 4CKCA 2PZJA 3AOGA 4M8LA 1KDYA 3KM0A 4N5IX 4K9NA 3IA7A 2X1MA 3BULA 1OQAA 1F2UA 5IH7A 1M6NA 1AH2A 5F5NA 2MCFA 4FXOA 4Z3OA 1DJMA 3T7RA 4L1KA 5CLIA 3TIGA 4R31A 3VMMA 2OXCA 3PXXA 4OYHA 5CEJA 1RQNA 5T64A 1J70A 3B20A 3FUVA 3BJEA 2CZQA 3F96A 3GC6A 1ZXBA 5P21A 4QUJA 3E22A 1A8HA 1H2FA 3UV6A 3V1KA 4U7DA 3PX2A 1EGQA 1DOZA 1F9EA 4MVJP 3WZ2A 3B2QA 5CLJA 5JV5A 5TMEA 1OIXA 4Z99A 2FRDA 3PP8A 1XZAA 2BBWA 2P27A 3MQ2A 4XA8A 6CHYA 1EESA 5COAA 3ZJ5A 3OKCA 1KYVA 3C7KA 3MMZA 1Z28A 2P3LA 3T1QA 2FEKA 3OD5A 3BSWA 1Z74A 1QRRA 2A3RA 2NO9A 1QRDA 2C5EA 2X15A 2YJZA 5E95A 1UODA 4YP7A 3ZW9A 4E4YA 5AUPB 8ATCA 3VHLB 4XLZA 3F5QA 1CP2A 2ZIAA 5CNMA 1SB9A 1DLJA 4J3FA 1EX7A 5IM4A 3BVPA 2Z1MA 1E2MA 1W88B 2DBYA 1MTZA 3Q2KA 3FTPA 1KARA 4LBYA 1R4ZA 1WP9A 3DE3X 2QM7A 2J45A 3DEKA 1XXLA 2QM0A 4GUDA 1WU8A 4HLUA 3CX6A 1RE0A 2NU6B 4QWWA 4R1OA 5EZYA 5HBRA 3SKYA 3K9WA 3TTUA 1E6LA 4C0HA 1IU9A 1QKIA 3M2PA 1KFBB 1UINA 1UMKA 1WXIA 4KBGA 4WBXC 3ZXIA 4A0QA 4LF4B 1E58A 4FGSA 3AY6A 3OZIA 3MVEA 1NN5A 1U9CA 3DL7A 1RYMA 4EFKA 2VP0A 5DTIA 1JWLA 4MVYA 1OAAA 2HWUA 2P11A 4ND2A 4ON9A 3VSEA 1E98A 2BMEA 4RTKA 3U60B 3VKWA 5L4SA 3RR2A 2CCGA 2L19A 5T7BA 5AYVA 4KUEA 1K6IA 2IP1A 4IZHA 5GJWC 1EFUA 3UMMA 4RULA 5JNWA 1JSLA 4O4HF 2OZEA 2PQMA 3PNMA 3SFTA 1ZK3A 1SULA 1XWIA 2GKOA 1V8PA 4IV8A 4JUFA 4CGYA 1ZAYA 4I19A 1T5DX 3O7MA 2I6QA 3S2YA 4N5HX 2P6MA 5G40A 1TUGA 4G41A 1YNSA 2AS0A 4Q05A 4R9UC 4B9EA 5CK4A 3NKVA 3F3KA 4HL6A 1DTWA 5H02A 3KDAA 1N25A 2HRRA 1OZ0A 1L7XA 4K8OA 2VYVA 1FE8A 1OIWA 2R8BA 1QCCA 1ZGCA 3A05A 1XQWA 5CIWA 1FB5A 5TC4A 3I3OA 4IEFB 3AOEA 1JFRA 5KWVA 4CUJA 4H17A 1E9FA 2Z04A 4I14A 2Y0EA 1AUPA 3EW9A 2C42A 1JG3A 4LK3A 3HJHA 4DPKA 3OJEA 5C7LO 2BFPA 2IUYA 5LKRA 1ZRHA 1TRHA 1U7HA 2IYAA 1EDDA 3ZVRA 4YMTA 1X1AA 1YKGA 2GFHA 4YCNA 4HKTA 3HJAA 1SVUA 1UJ5A 5FI5A 3LBIA 4G1MB 1LBEA 4X6XA 4AWBA 1JNXX 5KBYA 1CZLA 1HT0A 3B51X 4WZAB 2CMKA 2I55A 4FB5A 5LXTA 3L7JA 4ACBA 2OSBA 3AINA 1EE9A 2DBZA 3GAMA 4CDNA 2CDNA 2BCGY 1NI3A 2W2LD 1UM9A 1SU4A 1V7PC 4I0WB 4KLCA 3TNYA 3VOSA 3NC0C 3FUWA 4XASA 4NAUA 3INYA 3TFWA 4B44A 1IEQA 3WGTA 3QE2A 3VVCA 1JKJA 1VBFA 2J5XA 4HWKA 4CIVA 1GQOA 1ESNA 1ZN7A 2GN2A 3KBBA 2WJVA 3C3AA 3HR8A 3PI6A 4GI2A 3PHLA 4AZ0A 3FLMA 1GRVA 4WLVA 1CEQA 2HSEA 4HAZA 4B76A 1OLSA 3A9RA 4GP6A 3VR6A 4YR9A 3D7KA 3OIWA 3P96A 3E9EA 1E2BA 2G77B 2OGWA 2F4NA 4FJ1A 4YUZA 4EMBA 2EZ8A 1JL3A 2XT0A 1JH9A 2UVQA 3IV7A 4OA5A 1OH8A 1WG8A 4G8BA 1R6XA 1CZOA 3V2UA 3WL6A 3AI1A 5IDVA 1I7DA 1XQ6A 3QWAA 4FN5A 2X5NA 4OD0A 5AVTA 4MWBA 1C14A 4I4TF 4RADA 4BVJA 5HMLA 3L7OA 4UEOA 1DCFA 3G8CA 3KHSA 3OCVA 1KR5A 3QX9A 5ESRA 3QVKA 1PRYA 2FX3A 3R5KA 4ZQEA 3JQGB 2QQ0A 4HNAB 3T9DA 1OKKD 3IHTA 2Q62A 3C43A 2BDTA 3CVJA 4DSNA 4JSTA 4LXXA 4WT7A 3S29A 2C96A 3ED1A 5EFOA 4F5ZA 1YK0A 3ICPA 3B6EA 3R23A 4AO8A 2Q4EA 2OKCA 4P34A 2VXBA 4EYSA 3EXIB 2GBGA 4ICIA 3AO0B 3AR8A 3P4UA 4XIIA 5LA6A 5K0CA 5L8VA 3X1DA 4AUNA 1JW9B 5F77A 3ROXA 5IK2D 2FJPA 3FGNA 3ZD8A 4HVAA 4BEVA 2EBWA 1R50A 2ZI9A 1XFDA 3VX4A 5A3RA 3I12A 1PQUA 4J1QA 2PK3A 3HDHA 1WDWB 1XRSB 1T5IA 2EG9A 3NBYC 1TCCA 4R1TA 2GN6A 3RBXA 3TZQA 1UKCA 3HZRA 1J8MF 2E48A 4Q1VA 4YJ2B 3AL0C 1YQXA 3COWA 5KQGA 4I1SA 4Q3KA 2CLCX 5F5XA 2W8ZA 1V1MB 3FNRA 1O95A 2HRZA 1TYBE 1LK7A 4UHFA 4HV4A 4F12A 1NDUA 2GX6A 1IXKA 5KHLB 2ZXEA 2G25A 3NB0A 4YRQA 3TPCA 1V2GA 1QHFA 5B2ZA 3W4KA 4I4NA 4TMXA 3ORSA 1UBEA 1N6IA 1QHEA 3AGPA 5JNSA 1LF0A 4ZOCA 1PVDA 2NUTA 1G41A 3MAJA 2NYUA 5IEBA 5IJXA 1Z2EA 2OHJA 1U8AA 2P4QA 2Q5FA 4RH0A 5ICCA 5LJLA 5EC8A 1MVLA 3KEGA 3D6FA 5L45A 1FLNA 1SC6A 1YQTA 2AI2A 1QG6A 3IQFA 3TM4A 4UU1A 3JVEA 5AOAA 4HATA 4BC0A 3SICE 3KTAA 3QFTA 2X8AA 2VWHA 1R7RA 3BSYA 3PE6A 3PE3A 5KJCA 3C6YA 1UPUA 4OI4A 4G4JA 2YJTD 1TM3E 1BXRA 5G53C 1RI4A 1GSAA 2A1TR 3QEMA 1J42A 3C3EA 5FWNA 1YNOA 2OXFA 1P29A 5AK6A 3S2SA 5FUYA 3GAZA 4CDRA 4JXKA 3LP5A 2GI4A 2P1RA 2ATXA 3IIEA 2WHQA 3SJBA 3VI4B 4A8HA 4BNKA 4CT4B 5JAZA 2V6GA 5AW8A 3UMVA 4UHBA 2IJGX 4AUKA 3SY8A 5KDLA 1AMNA 1YHNA 4ZJUA 2XF8A 3OO1A 2QB5A 2NXWA 1AV6A 1V8ZA 2X2EA 5IC4A 4F4JA 4PRYA 5LU8A 3RU2A 1YCDA 4GH5A 5JVDF 4MPRA 3KYCA 3NHSA 3SS9X 2PKQO 2PWBA 3X44A 1CUDA 1TO2E 1RKVA 1U5AA 3C6BA 4U7HA 2JL1A 3ZXSA 1I6WA 1FSPA 5IBCA 3TAUA 3F4KA 1DIGA 3C87A 5DHRA 5LQRA 4UOZA 4RFLA 3ONVA 4UCFA 3NIGB 2WYVA 1Z2OX 4LXUA 4PYLA 3PC2A 3SYTA 2OY0A 2RGBA 1F8XA 4FFMA 4C0WA 2RONA 4RX1A 1VE6A 2SBTA 3KZKA 1WPXA 4MVJG 1S4MA 4YIKA 1ZIXA 4IQFA 2PGAA 2R5FA 4FPXA 1JE1A 1EVEA 2OBMA 4D9HA 1TX4B 1RU3A 2GA8A 4WCFA 3HBJA 3BUSA 1T24A 5J63A 1ZLYA 1KP3A 5J23A 3MB5A 1TLTA 2FZVA 3DAFA 3H5OA 1Z3CA 3LUGA 3ND5A 4RD6A 4UDXX 4A9AA 3ZGVA 3U56A 1RYNA 4CT0A 5T57A 4HNGA 1SUEA 3TECE 1E69A 4DIDA 1XT6A 3CHYA 4EGJA 5JQGB 3SNHA 2XVAA 2FW0A 4LW8A 5IN5A 3U31A 1XTJA 1IBCA 5ECGC 2RH9B 3HJUA 2GNAA 1NXVA 3SLGA 3CONA 1K5DA 4BVGA 2ACKA 4L9WA 3R3XA 4RC9A 1BU5A 3HDQA 1FDTA 4C01A 1NUPA 5TR9A 3HJBA 1P2FA 3OQMA 5KNCA 1DOHA 2JKVA 3DVLA 3DMHA 3IMFA 3K6RA 1Y5MA 4L4SA 4ZZ0A 4AKGA 5CG2A 5HF6A 2RKBA 5DM60 2ZR9A 3TLYA 4AMZA 1V95A 1T5HX 3EVDA 4OMCA 4PX2A 4UAGA 4XPZA 2BFMA 4HRYA 3X1KA 5L3SA 3FRIA 3T7IA 3W5CA 5EE5B 4BCBA 2YW2A 1HT2E 1OOEA 1YE8A 3KFVA 3HEMA 1MBZA 2QAIA 4E5YA 3SZ3A 3DOIA 2FPMA 4CR8A 3QPAA 5HVNA 3GNSA 4K7JA 1ZR4A 4ZCQA 4UEWA 1MC4A 1OGYA 4J2TA 1L4KA 4XQEA 4Z3DA 5JPCA 4JI6B 2A7QA 2VNIA 4OYLA 1JF8A 1QHYA 3W7VA 1RYEA 3NBKA 3HKEA 4LBVA 3F8WA 2DU8A 4W5JA 2XADA 4YJ3F 5AVOA 2OBXA 4WQMA 1SIWA 2WZQA 1NQAO 2AW3A 1VYVA 1OA0A 1DSSG 3B5JA 3S2FA 3B48A 5H83A 3WLHA 3O91A 2J5QA 4O29A 4RA9B 2VIIA 1LJLA 5BOSB 3TG8A 2ZIEA 2Q2QA 4E2YA 5K0TA 1S2IA 2XY4A 1PQWA 1SCBA 5FTMA 1E3IA 2GBFA 1QAQA 4FKBA 4CL2A 2PE5A 2C4MA 1Y8RB 2PZBA 1VDMA 2QMYA 1XTSA 4F6RB 2JI6A 1ODTC 3RC7A 4MICA 2X8BA 2RHTA 3UB4A 1FNBA 4TVBA 3KAJA 3ODGA 5FOWA 1PV1A 4BWYA 4C88A 5IVPA 3U4MA 1QH1A 5JHGB 3S27A 1M8JA 4RABA 3NNNA 1RT9A 2R00A 2XTZA 2NVUB 1F2TB 3D8SA 3K31A 3QKRB 2RJ3A 1CQIA 4QNNA 3KQOA 1QONA 4KLAA 1NFQA 2YHBA 1Q0RA 3EN0A 3M70A 4G65A 3MJDA 5HDBB 5LBIA 1AHIA 2V0GA 1Z4IA 4LGYA 2ZRAA 4IDCA 5B58T 4H7FA 3P9PA 4IEIA 2QVXX 4OFXA 4D4GA 4BTEA