2FG7C

N-succinyl-l-ornithine transcarbamylase from b. fragilis complexed with carbamoyl phosphate and n-succinyl-l-norvaline
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
Knots found
sequence length
320
structure length
320
Chain Sequence
SHMKKFTCVQDIGDLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRLSTQKAALNLGMNVIVLDINQGAWKLETERGVIMDGDKPEHLLEAIPVMGCYCDIIGVRSFARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTARPKVVMTWAPHPRPLPQAVPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYDQMKAFEGADFIYAKNWAAYLGDNYGQILSTDRNWTVGDRQMAVTNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and catalytic mechanism of a novel N-succinyl-L-ornithine transcarbamylase in arginine biosynthesis of Bacteroides fragilis.
pubmed doi rcsb
source organism Bacteroides fragilis
molecule tags Transferase
molecule keywords putative ornithine carbamoyltransferase
total genus 118
structure length 320
sequence length 320
chains with identical sequence D, E, X, Y, Z
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.3.-:
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
C PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 2fg7C02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 2fg7C01
1AKMA 1OTHA 3R7LA 1ORTA 1RAGA 2FG7C 2FZKA 2BE7A 8AT1A 3SDSA 1TUGA 1RAHA 4FYVA 3UPDA 1ACMA 1ZA1A 4F04A 1VLVA 2EF0A 4OH7A 2A0FA 2I6UA 4E2FA 4KH1A 3KZMA 4EP1A 1C9YA 1TTHA 3Q98A 4BJHB 4FYYA 1EKXA 1NBEA 3D7SA 3GD5A 2W37A 5G1NA 1PG5A 1DUVG 1FVOA 2IPOA 1RADA 4JQOA 1EZZA 1RAFA 1R0BA 3M4JA 2FG6C 2ATCA 4KGZA 3KZKA 1DXHA 3KZOA 1I5OA 4A8PA 1RACA 5AT1A 4NF2A 4ANFA 4F2GA 2OTCA 3M4NA 3AT1A 4KWTA 3LXMA 1JS1X 2H3EA 1FB5A 4KGXA 5ILQA 3L06A 2FZCA 4FYXA 4AM8A 4H31A 1R0CA 1PVVA 1ML4A 3E2PA 3L05A 3NPMA 4IV5A 4A8TA 3KZCA 2QG9A 4JFRA 1XJWA 3L02A 1Q95A 4KGVA 8ATCA 4AMUA 2G7MC 4WTOA 2AT1A 3L04A 3M5DA 1D09A 1RAEA 3M5CA 2P2GA 2BE9A 3D6NB 4EKNB 6AT1A 1AT1A 1EP9A 2AIRA 1RABA 4FYWA 1RAIA 5G1PA 3TPFA 3KZNA 3TXXA 1ZA2A 4A8HA 1A1SA 2QGFA 3MPUA 1F1BA 1SKUA 3R7DA 2YFKA 7AT1A 2HSEA 3R7FA 4JHXA 5G1OA 2RGWA 2FZGA 9ATCA 1TU0A 4KH0A 4AT1A 3CSUA 1RAAA 3GRFA
chains in the Genus database with same CATH superfamily
4OQ4A 1M34A 1JLLB 1AKMA 3I76A 5GM2A 3WYCA 3MLEA 1G8AA 2GS9A 4GUDA 5L3SB 2UUBB 2O0KA 2CJYA 3ILHA 3OT5A 3PRYA 4QJBA 4YT4A 3BMOA 3H5VA 4BQNA 4ZVTA 3OHPA 3UBTA 3A6PC 4XVCA 3ZHOA 2DPYA 4LOJA 4MRPA 1HEUA 1PJBA 2QDXA 3Q9NA 1RLUA 1H2AS 1TJNA 5H5JA 3I30X 2H29A 1M73E 1QFYA 4MGKR 4YLGA 2QM3A 2EJBA 4M1MA 4X20B 1XEXA 3RASA 1DX6A 1MEJA 1A9ZA 4GPBA 5BSRA 3SXUA 1YMVA 2GH1A 2H6EA 4IY1A 3T9FA 1EP1B 1Y1KE 4Q4AA 1YBMA 3KVVA 1E2KA 4BNXA 3CB2A 2G5PA 3B78A 2JD2A 2JHFA 4ZEWA 1JEAA 4PO8A 1JWAB 1ZWLA 1OAAA 1ICIA 3THRA 3ZUPA 2VUIB 3V7FA 4XVRA 2OCPA 3G9XA 4M0MA 5EKSA 4J7CA 4Y9UA 1BH2A 3BFJA 2AFIA 3ANMA 1A95A 3OZWA 4DV5B 3LRTA 1EFKA 2AB0A 3IIJA 4MV3A 4RSMA 4WZ6A 3TLAA 3QEKA 4PXAA 1CZLA 3K4QA 1SGWA 4I8XA 4DEVA 3IMCA 3OM1A 3RC7A 4FX2A 3K35A 3KOOA 2VNIA 3GEHA 3OOHA 3C3XA 1L7EA 3M1AA 1SHKA 3D7MA 1T26A 3LHSA 4YQYA 4K3UA 5HE8A 4D8YA 5BP7A 3AVXA 3MZ0A 2Y6UA 1MHPA 1V9LA 1G2IA 1W96A 3FUTA 1QZTA 4ONEA 4YRCA 3TGLA 4E33A 2IYAA 3KKPA 1PBNA 4U5XA 2H63A 4RVUA 2Z58A 3JD1A 3D0QA 5JV5A 1CZNA 1JWBB 3FMFA 1KMIY 4JR0A 2VRWA 4FFNA 2FWBA 3N0XA 2F1RA 4KNYA 1Y7LA 1CDEA 4HYQA 5BR1A 5AW2A 5LQNA 1P45A 4AROA 4PSKA 1ZGCA 3DUFA 1W9HA 1RLTA 3EGVA 4G1CA 1TAHA 3PIIA 4QQNA 4MW4A 1T2FA 1GU7A 4FB4A 2JHGA 1EM6A 4G86A 2ZJ7A 5HGJA 3I5XA 3PSAA 5L4SA 4M1TA 5CT6A 3FAKA 5KAPA 2E3JA 4F9FA 3IUJA 4ATNA 1QX3A 4CLOB 4JGIA 3AF1A 1HURA 3O0DA 4R84A 1KF0A 3BG5A 4LA4A 1AT1A 1V1RB 5FXMA 5HTOA 2X8WA 1J9ZA 2JZOA 3R09A 4QBHA 5KHLB 3ZHYA 3F1KA 4GMDA 3T9DA 3TQSA 1S5PA 1IULA 3L1UA 3K9NA 3KL4A 1TE2A 2IHUA 3ICCA 3HB0A 4FOPA 2WAOA 2IDMA 1MR3F 2VSOA 3N6XA 3RQSA 1B8UA 4LHVA 3H5WA 3N0VA 3H5NA 4U8HA 5SICE 2WKQA 3F5SA 3MPUA 3ZHRA 4F06A 4GD3Q 5AVJA 2C5EA 3W3AA 4LWOA 2JGEA 4TYQA 5TQ0A 1HFWA 2QA5A 1EUYA 1DT5A 1GZSA 5DRTA 2A0UA 1IMJA 4HGYA 1N78A 4B45A 1ORIA 4DKXA 2BLLA 1EK5A 4P5PA 2CBGA 2PKQO 4AJ4A 5IX8A 2C5LA 5TMPA 2D74A 2H7YA 4K6FA 3WB9A 1EUQA 4FDLA 3B2QA 3AIIA 3LXUX 3NXKA 3V4OA 2DZDA 3JAMA 4DA0A 4RMIA 1IZZA 1MIHA 2J0VA 1X9HA 1NY5A 4B79A 1NN0A 2PX4A 3V4SA 2Y2UA 1RI5A 4Q48A 5CLJA 1YQXA 2HFKA 4CXMA 3HB9A 3FCSB 1TKRA 4QBTA 3NAZA 3RVOA 3VNBA 4R8MA 1LVUA 3HKBA 1DE0A 2WUVA 2WZCA 1NLYA 1TJ5A 3G2OA 3QVOA 4IDGA 3UJ8A 4NEHB 3UV3A 3AG6A 1JZTA 3RYFA 1U0BB 1QE3A 4I2NA 4FP9A 2PX2A 4LJ9A 1G5IA 4ZGBA 5ARBA 3C7AA 1L3CA 1UOPA 5JTTA 3AX6A 4AICA 1IN5A 3V1KA 3GZ4A 1XAIA 3NB0A 3FPLA 5EA2A 3G5MA 2G9QA 3BJIC 3R5HA 4S1VA 1M6VA 2OBMA 1PFUA 2HREA 2HYIC 1KI8A 3IAS1 5D84A 1VL5A 3PT9A 2HRZA 1ADFA 4O8CA 5GAJA 3ZXSA 1EB9A 4RAQA 1HE3A 4ZPJA 1UDRA 1Z33A 4I1VA 1MBZA 2I66A 3B5JA 5CDTA 1AMNA 1X7HA 1ZK2A 4KQMA 3OTWA 3KSAC 3A3PA 3ECSA 5HOEA 1TVMA 1D8AA 2H2WA 2ZKLA 4NXNB 1NR1A 5CBPA 2YNMD 2YTZA 1MC1A 3C5CA 1JPNA 4DVJA 2R8ZA 4TLCA 5KNCD 2XE8A 2WICA 4FDVA 4Z7OB 3OECA 3CUYA 1E9VA 1QP4A 3PX3A 4MKHA 3DEAA 1W5BA 3MCVA 2F64A 2NTNA 1NUQA 1T0IA 2D1RA 3EF0A 3MTQA 1WCWA 3M1YA 3MD9A 3OBIA 4OXNA 1EWKA 4RD4A 4V24A 5EQFA 1CR2A 2PO7A 5U1PA 2ZRAA 1SUFA 4L1KA 3VV3A 2JGRA 3LIPA 4QBKA 2XH8A 5JMWA 4PU0A 1I4DD 1Z5NA 2LD4A 2ZCUA 2GAJA 4G0VA 4EELA 3HYLA 4NU8X 4DMGA 4DV0B 1WNTA 2C2KA 1ZIDA 4RYDA 3PB3A 3TOSA 3ZIUA 5H82A 2QY9A 5BV0A 4MR7A 3VKGA 3JASB 2AW5A 3VZPA 5A4FS 5J63A 5TDHA 3VC1A 4B2LA 5AI0A 1OT3A 4J75A 5IW8A 4MK4A 3L0ZA 4GGOA 5AVKA 4Z9YA 2CJWB 2O06A 1W44A 2XV1A 3EVTA 4A0SA 4L8YA 5EFZA 1RJDA 3QXHA 4YJ3A 1VLHA 1DQNA 2OT3B 3RYHA 2B4AA 4MV0A 1E59A 3ANXA 3DG9A 3REFA 1X7ZB 4X7RA 2C54A 2PANA 3AY0A 3W05A 4ZQCB 4D8VA 4TM8A 5BSFA 3TXXA 1TTTA 2FOIA 1YQDA 2X5XA 4PCAA 4YCDA 3WB1A 4LYJA 2LR0A 4JBWA 2N42A 1MGPA 1PS8A 4KNVA 4HNSA 1WVGA 2AFIE 3A8TA 4KPUB 3A0RB 2K2WA 4CCWA 3PC6A 4DV6B 1UKCA 1QUFA 4E6PA 1ESCA 3I01M 3CVVA 5K3FB 7REQA 1WBBA 4LJ5A 2ZRNA 3C3WA 1PN3A 2ID9A 4CHTA 4BFLA 2C83A 2XKKA 3O38A 3SBXA 3ZWWA 3FD8A 1SIBE 3H0EA 4Y30A 4CM4B 2IHZA 1G20E 3L1HA 3WJ2A 5E3HA 4ZP1A 4V2IA 4D3XA 3A9UA 3QBDA 2XCUA 5NULA 1F9AA 3W9YA 3ZW9A 1ZIXA 5CFQA 1QRTA 3T1YB 1T0BA 3WK5A 4AD8A 4E21A 5EE0A 3DMDA 1SU8A 4MS4A 4NFHA 2JGJA 2IYZA 4B6GA 3CX6A 2OYCA 1JJVA 4G81A 4Q3BA 4NKRA 4Q4DA 4WT7A 3C5VA 4GWKA 2AUMA 1ACMA 2Q1YA 2AC4A 3KPWA 1K8XB 3LPMA 3LWZA 3P8ZA 3QLTA 4UCQA 4RWZA 1Y3BE 2AJBA 2C1EA 1MAAA 5CK5A 3EASA 2VNAA 1IN6A 2Z5VA 4FXPA 2W2KA 2G40A 1FP1D 3BWXA 5BWOA 4XYEA 3PEUA 3V8MA 3PDIB 1MB4A 1A9PA 1D03A 1PFVA 4C4AA 4RADA 4MS1A 2CL0X 2YL2A 4HPJB 3C15C 3DCNA 1CTQA 1XXLA 2GVNA 2OZLB 1A4RA 1PDWA 4QGSA 1RXYA 4QYMA 1SOVA 5JR3A 3HKEA 3EXEB 1JLHA 4R68A 4FJ2A 4RVGA 2B69A 3H8VA 4E14A 3IKTA 5ALPA 5JXIA 2XLBA 2CN1A 3MQ2A 1KOFA 4L8WB 3SHVA 1YJQA 1Q2XA 2J1LA 4X62B 4JODA 621PA 2C29D 1PFGA 1KJWA 3DQPA 1KK0A 5EHQA 1R9NA 4E7PA 1SU6A 1OCEA 1XA0A 2AZMA 1X70A 3MHPA 3MHTA 4GOOD 1E7SA 4TV9A 4RL6A 1RW4A 3KLNA 2OSVA 1ML3A 3SDBA 1N3BA 3WADA 2HGSA 1UBEA 1FYEA 3PQCA 2DBZA 4R8LA 1Y5LA 5EYPB 3EPKA 3UA4A 4EVRA 1TEXA 4ZDKA 4MYUA 4IRUB 4Y2SA 2BTQA 3QMPA 4B4KA 4E13A 1H4SA 4KSYA 3AETB 4F4FA 5I9TA 1LRJA 1AXGA 5I7VA 4FMBB 1U1IA 3E2PA 3IHWA 3H0CA 4MI1A 3LKBA 3PFCA 4WASA 5KWEA 1ONBA 2GZ2A 2HH9A 5KNDH 1N0HA 4ER5A 5JZSA 2WB4A 4C08A 3AVWA 2G72A 1P7CA 3WRYA 2FN9A 3D4LA 1NE7A 2PD4A 4NCKA 5AM2A 1F0PA 4WTOA 3ID6C 3P2JA 3PUWA 4Y2VA 2YIMA 1DIHA 1E8MA 1JTVA 2QN6A 2JDIA 2F7SA 2OOKA 1E8DA 4J6FA 4F96A 4Z49A 4D9IA 3Q8KA 4RKEA 3V2UA 1L5OA 1PLLA 1S2IA 4IYRA 3UICA 2VYCA 2YXPX 4B3TB 4FILA 2BUBA 1E1MA 3T4PA 1CUXA 3B85A 3KT0A 4DCPA 1LY1A 1Q0QA 2B3TA 5AM0A 5A04A 4E12A 3SXJA 2XNSA 3DV0A 5BN5A 3K3PA 2QHXA 3ACBA 3AZPA 1KVUA 1ECCA 3DMPA 3HJRA 4LBWA 1C0EA 2IODA 4RZUA 4WRRA 7MHTA 1DAGA 1T1GA 2FSFA 2WJ4A 1FX0B 1ZISA 5BOVA 1J90A 1LDBA 2AA3A 4JI6B 3DE2X 3E22A 2H9AA 3OETA 5G1OA 2FRDA 4MVJF 2EHDA 4XE5A 1ISFA 1SQ5A 4KJZA 2QR5A 3WMFA 3H1AA 4G8JA 4DIFA 1DAKA 2JH9A 4PNPA 2A9VA 3D4IA 2WU8A 3EULA 3IXQA 3R3UA 4RESA 3ZLVA 1FFEA 2MSLA 4TMWA 3FPJA 5KYYB 5TQ2B 2OZVA 1SQ0A 3MMPA 1HDEA 3GPIA 3NBQA 4DLXA 4BMDA 1XP5A 1X7YA 3RTDA 3F4KA 1FTNA 3IEKA 3OIDA 3O0TA 3I28A 2E4ZA 3K8YA 3CIOA 4K9RA 1MB2A 4HV4A 1YL6A 2ZSAA 1MDBA 5IAKA 3RUFA 3TECE 1JAHA 2R6GA 4J1SA 4B83A 2C4HA 3LQ4A 4ZCMA 5A03A 3CWCA 4G5XA 3LL4A 4CM8A 4X84A 1STOA 1NZDA 3OTGA 4N6OA 1RI2A 3IMGA 1K3FA 2ZP1A 2JLCA 5AJVB 4FOLA 1Y8CA 3FPGA 3QU4A 2ZBUA 3DZCA 4IJ5A 2W83A 1VHDA 2QW8A 3GD5A 4Y6GB 3ZU5A 1SEVA 4GECA 2HOQA 2PIAA 1VIVA 1XTBA 3CVOA 3I5MA 3GLSA 3IT2A 3ND7A 3PQEA 4BLUA 1PR3A 1P2TA 2CYBA 4KXNA 3N6VA 5DNCA 2BMFA 2D5LA 3E9ZA 3MPOA 5M3BA 2XIQA 5AHRA 3IT3A 3GCXA 1MC4A 1GIAA 1QPGA 1YR3A 2OB2A 4HY3A 1O2DA 2IPNA 5AWFC 1QK5A 1W29A 3ILYA 1AKEA 2DWCA 2YWFA 3TTYA 4F93B 4RNDB 3IERA 1E1RA 1RP7A 3P4YA 1XQWA 1YZYA 3DFIA 3EW7A 2M1ZA 3MJEA 3TMYA 3UK7A 2A7XA 4ZOEA 3DDSA 4BNFA 3I32A 4UEJA 5H7XA 1Y6RA 4JNKA 1V6SA 3PF9A 3V1UA 2C4NA 3D0RA 1ADBA 3E35A 2HCFA 3D8HA 3IEXA 4PC3A 3ZLBA 4C01A 1ZM9A 2KBEA 2Q3MA 4GM4A 4MRSA 3EJ6A 5ES3A 3GEBA 1WXDA 3CNQS 4R2MA 2P5SA 3Q3VA 1EYZA 1AUPA 1M8KA 1PHRA 3V33A 3NHLA 4MQEB 2I3GA 4YT5A 1G64A 4EEKA 1WKCA 1YGPA 1U2PA 4KQJA 4MW0A 3URMA 5CDFA 2BEUB 3O4FA 3LQRA 1YA6A 4B85A 1WUJS 2ZJ8A 1B74A 4PZ9A 4BNMA 4GMKA 3WAJA 1V3QE 5ALVA 1GQOA 3QXGA 3LBFA 3RS4A 2AG0A 1U81A 3S6JA 2GXSA 5T6MA 1UCFA 1RPZA 4ND1A 4MQUA 4QDZA 1LFDB 4UW9A 1TVCA 4B3DA 2Y27A 3OFJA 3T1NA 1DUSA 3IDSA 4PGAA 2A1UA 4LI3X 4EO7A 1A7UA 3NI2A 4DZTA 1JMVA 3UJPA 1P9RA 3J81A 2OXEA 2RKBA 5ICSA 1K08A 2DLNA 3H1TA 4KFUA 1DP4A 1LQ2A 1AK2A 2X76A 3KR0A 1FS5A 1U80A 5HJ5A 1TKAA 4Q7JB 4Q3AA 5JG7A 1WSDA 1L3BA 1O5TA 4WOBA 4ZQEA 4RZSA 3PNQA 4RTRA 5DLPA 4HKTA 1Y9DA 2HNBA 4QEZA 1Q1AA 4RM3A 3ZD8A 2IBMA 4KV7A 1LX7A 1XFAA 2C0QA 1ISJA 2ID8A 5HPYB 2CDCA 3QXCA 5EP4A 1HKHA 2C2XA 1D2AA 3CS3A 1TRHA 1XALA 3KPVA 4E09A 4ZDIA 1TI7A 4LF8B 1IOLA 4XWYA 1V39A 1ZM4A 4MVJG 1QH1A 1XP8A 3NBZC 4YPFA 4V3CA 1ZMTA 1RIFA 3C6ZA 3IA2A 1HA3A 4URZR 3V8VA 5BSKA 5CGQB 3I2GA 4LJYA 4YUXA 5C81A 3SF8B 1Z88A 2XGMA 4AQDA 4BQOA 2VHUA 3ZPXA 3EF3A 5GZ3A 4ME6A 3P0RA 3RYCB 2JFVA 3HP4A 3ILSA 4Y1RA 1J9EA 1W6RA 3FE2A 1PSZA 2ECQA 3NVAA 4JN6B 5CIWA 5TNXA 3WGZA 1PTJA 1KSFX 1NT4A 2UUOA 1K7CA 1VKNA 3BTUA 3DDCA 2CXQA 2IUSA 4NCNA 1FRZA 1DRVA 1C4OA 3I72A 4QGHA 1V2HE 4GR4A 5JCPA 5LUAA 5D6OA 4IIJB 2JAQA 2YOFA 2Z3WA 4Q1DA 2EP7A 3R8CA 1BXGB 2WUWE 3V7NA 1JALA 3UV6A 2CJPA 4AXBA 4TWAA 3GA5A 4M54A 3DHEA 1M6YA 1N57A 1QGED 1OZFA 1C0PA 3WGNA 1VBMA 2EKLA 2VAPA 3GLQA 3R2JA 1FL9A 2OCGA 4JIMA 4PR0A 5I7AA 1GZVA 4Z8YA 3GLTA 3A1SA 1YOVA 1DNPA 2NOAA 2UUAB 1L4MA 1ICEA 4M9ZA 2R48A 5TMDA 3U44A 3HDJA 3ZVRA 4PX5A 3IURA 4WKBA 4IDDA 3T4UA 1BWQA 2J0UB 1GZ5A 4FNGA 4BKRA 5HS6A 4CKEB 1OBFO 4LHZA 4UVDA 1NVAA 2A5FA 5F3DA 4ZI7F 1CJUC 2XKAA 3HP7A 4PBTA 3ZW7A 4HRVA 4RFVA 1Z29A 3TD9A 5T3YA 1M2OA 2AR9A 4W1QA 3SOPA 3QOFA 4LMBA 3WXBA 4W1SA 4YGXB 1TCUA 1S2NA 3BC1A 4KQCA 3ZS8A 4FYMA 3HU3A 1ML4A 3V8PA 1GKLA 1WW2A 3CQ9A 1I1QB 4GIBA 5SZIA 5TT1A 2VWGA 3WQBA 3UTCA 3U5TA 2UVPB 2BPOA 3LT0A 5JTUA 3GQBA 1Z6QA 3G9UA 5GONF 3L7DA 2NO4A 2WHEA 5JLAA 4DNXA 3PNMA 4HZUA 1CUWA 3DZKA 3HRKA 4G0XA 4GXQA 4MP3A 3RS9A 1L4FA 3EVDA 1AQUA 4I55A 4KN8A 1PTJC 2X15A 1Z2OX 2P7IA 2AJDA 2PKYX 3IDQA 1NXXA 3KHTA 1W30A 1Y3DE 2WWRA 4RBNA 3EQZA 4NZYA 4LE0A 3H99A 1KDVA 2OCIA 2M98A 5BXYA 2DKFA 3UUEA 4G07A 3RKUA 4U39A 4NMXB 4RPJA 3M1IA 2WIDA 4PGHA 4QSHA 5FUXA 3NBUA 4FIZA 3RVQA 3SFZA 3FDIA 3J81k 3HK2A 2LV8A 2W6CX 1KK2A 1ILWA 1UM8A 3P5SA 3B7WA 5B55A 1A9SA 1YDHA 4WEQA 4JBXA 3OZIA 3I39X 5ALTA 3OPVA 3SZMA 5J4YA 5B1EA 2X86A 3BZWA 3G2JA 4IGEA 4KE6A 1WRBA 1CEXA 2ODBA 3COSA 1UKZA 2MOKA 1QK4A 4EVIA 4HFNA 4NCIA 2OCLA 5JARA 1QCYA 2K5UA 3TTVA 3WFZA 1U8ZA 1OLSB 2OK8A 2HCTA 4MUKA 3L6OO 3EX7C 4C5CA 5U9CA 2AD1A 4AJOA 3IAHA 2QQ5A 1BXRB 4WGFA 3L0CA 1USWA 1R4ZA 5LOVB 1EM8B 2I1LA 4PNEA 1VKJA 1UEIA 3AFOA 4PIVA 1Z26A 3ZG6A 1KETA 7GPBA 3DE4X 4JYZA 2P78A 3DW1X 3ONWA 1GNSA 1YNOA 2Q7XA 4DLAA 2WWYA 4FPXA 5GJBA 3IYLW 3KOXA 3WNBA 2B4YA 2EW1A 3THSA 1CLUA 1KZHA 2MYUA 5K0SA 2DJIA 2ONJA 1YKGA 1SA0B 1W88A 5J2TF 1P2UA 4OU4A 2OKGA 3WTBA 1WOMA 4WK0B 3BRSA 4MV7A 4R2KA 2JIDA 4RAOA 2RGNC 5K0LA 4OX9Y 4F12A 2I71A 1T25A 3QWAA 2LKCA 4HJXA 3RTCA 2PFSA 4C1NA 5L45A 2PTGA 3YASA 4LDPA 4A6EA 1A8HA 1FFSA 2BBTA 4H7JA 2YCLA 4L5YA 5DK6A 1TZCA 3HVUA 3ZGLA 2CLEB 4I4NA 4S1TA 4BJ6A 1PV4A 3T1OA 1H93A 2H2DA 5FR2A 2E5WA 4RU1A 4BQSA 4DY4A 5EQDA 3KQVA 4A10A 1OYVA 2RJ3A 4NZZA 4GKKB 3ROXA 4BX0A 4AWXA 4XLLA 4MVYA 2YRXA 2IEBA 2JBWA 2WFAA 3MWDB 3ST7A 4YUAA 2I29A 4BBJA 1ID8A 4HEQA 3K0AA 5K7SA 4RZ3A 3TBKA 3WSTA 2QVZX 2NUPA 1W2HA 1ZOPA 3AR8A 1K5HA 1RADA 2R6R1 2SNIE 4KN6A 4EKEA 3VYVA 3CY6A 1G42A 2PRIA 4I1YA 1N5IA 2I78A 2X8BA 1EX7A 3CBGA 3LLCA 4US0R 4RJKA 5D6NA 3CE6A 4QARA 4EEXA 3PL1A 1U1DA 2W70A 1FFHA 1X1EA 3CZPA 2CYAA 1G7SA 2C5AA 1EBBA 2G80A 4O3FA 1ITZA 2J46A 2LGJA 4HRYA 4ML3A 5KSOA 1XTVA 1R5JA 3G5UA 3WQQA 1P74A 1RPAA 2VK8A 3H2SA 5HTKA 5LQUA 4EKGA 2XUHA 1G9SA 3I0MA 4QPZA 4ABTA 1VJGA 2A0YA 3AVOA 5BNTA 2EZ9A 1APBA 2ZT5A 2NNLD 2ZYWX 2XCOA 3DO8A 2GN9A 1HDZA 1K86A 4EFDA 2VQ3A 3REOA 3T34A 4H1HA 3HI4A 4CCSA 5I8WA 5IJWA 1CUSA 1J2EA 1I0ZA 3EAGA 3IOMA 3RW9A 1V8BA 4HNQA 5JSFA 1T2CA 4ZEXA 4R3NA 1PQYA 3HYCA 4FZVA 2P3OA 3WE7A 3JVIA 1IB0A 2Z0MA 4Q0MA 1MABB 4UE3S 4YRDA 3UJDA 1W36D 2QVBA 3ZLUA 1G21B 1ZG3A 2AIRA 2HB6A 3DZJA 4UEWA 3SOZA 4U1RA 3F97A 2TECE 3IBSA 4D9CA 4N3AA 4XARA 1I2DA 2QZ9A 9MHTA 1W4RA 1TZBA 2ZWAA 3M8KA 4JLOA 3UMVA 1AXRA 3ZGVA 3HN6A 3MOIA 1FK8A 1Q7CA 4AO7A 2GETA 3K8ZA 4L9RA 3C4QA 2WFLA 1BMTA 1R2QA 1FIUA 3E05A 1PLJA 1JILA 4M1SA 4FHDA 3RSCA 5JJLA 2MDTA 1WS6A 3UMBA 4JKIA 2MHCA 1R1DA 2WIAA 4U5QA 3LQQA 1JU3A 2C92A 1LKZA 2FRDC 3A2MA 3HBJA 5EY5B 2G06A 4BO4A 2FMTA 2VZ0A 5I3ZA 2G71A 3WHIA 2IXTA 1N2BA 5EP2A 2GD2A 1ELOA 2CWDA 2V5AA 2ORYA 3CTPA 3IT0A 3EXIA 4PGFA 4TS9A 3AUFA 4UEOA 2JGFA 5D2CA 3VH1A 2NXEA 3DJFA 4QJIA 2BDTA 4RJIA 4F1WA 1U2EA 3RT7A 2YVUA 2PJRA 3TTSA 3UVEA 5E95A 1EIWA 3LCUA 1JU9A 2JI7A 2VPYA 1ULSA 1PJ4A 4G63A 5CFMA 2NO1A 3V1MA 5B6JA 2O3RA 4OYHA 4BEJA 2JFBA 2IYTA 3AZOA 2QTVA 4M7WA 4PG5A 1PFYA 4F2WA 1AF7A 1PIWA 2VP0A 3V4PB 3CJTA 5J2UF 1YZGA 1XJ0A 3VDQA 1EH5A 1WPGA 3MEQA 4RWEA 2XF2A 1COZA 2P3SA 4ZAGA 4LZZA 2XWJI 1JIQA 1ZH2A 4MLDA 1O77A 5DDIP 3R6LA 4ALMA 1NBEA 1NN3A 2FAXA 3BPSA 5A5DA 3RS0A 1XU4A 3QF4B 1NY6A 1N3YA 3G5TA 4H08A 4CLEA 1YHNA 5C8XA 4EMUA 3PQ6A 4DQXA 1O7JA 3D02A 3GZTB 3H83A 4GWLA 1EZZA 1GZUA 3BMQA 2BFFB 3PLAE 2Y66A 1JG7A 1W4AA 2Q5HA 4PSUA 4EHBA 4R8VA 4BECA 1VDZA 3Q7RA 2CV0A 4LF9B 1I6LA 4IVNA 3N8IA 1XU7A 3VZSA 1L4HA 2D62A 1GOTA 2OLKA 3M3HA 3REGA 5KNCA 5EP1A 4C0XA 3UBMA 4MPDA 3IRVA 2FW8A 4AY4A 3PFBA 2ZK7A 1D1SA 3Q9UA 1GQRA 3COPA 3IHKA 2F4VB 2E18A 4NCXA 4P7BA 4HO1X 4V3BA 2ZVJA 1II8B 1NRJB 4M8NE 3TQCA 1CQPA 1Q92A 4KGXA 3KUUA 2A0XA 5ALEA 1P6XA 4RJ2A 1ZUWA 2VF7A 1OWPA 3OOWA 3R0ZA 3RHFA 1QFJA 3GGSA 1KORA 3M83A 4RE5A 4L4RA 5ALSA 5DTJA 5ENVA 4P36A 1WCYA 1XCBA 4JK3A 2CV1A 1YQGA 2QRQA 2XGSA 1KI7A 3GRKA 3KJGA 4O8ZA 1QC5A 1W94A 5LR6A 2V7GA 5LSAA 3EXHC 3GT0A 4D9BA 5C52B 2H7VA 2IQIA 4IQFA 5DEOA 2W5UA 1S2GA 2GEDA 4KVZA 5GONA 3FSGA 4DDVA 3A6KA 2X40A 1TM7E 3KYDA 2HSGA 3TQQA 3V4LA 1AZSC 2G88A 4RXUA 1EPUA 4H16A 4DMCA 4BRZA 4DV7B 3EA4A 4KYUA 1C7ZA 4NH0A 4UNPA 1MXFA 3TDMA 1HMYA 1I2MA 3A6ZA 2WVHA 2R44A 1X1TA 4PRKA 4L3WA 2ZUTA 3V80A 4BFYA 1LLQA 4G85A 5BSEA 4QOHA 4BVAA 3IC5A 1QMGA 4KL8S 5L7TA 1ZA2A 3KR1A 4L08A 3WLMA 2QG4A 4CQMA 1LSOA 3OZAA 4LJSA 1NBAA 3Q7QA 2QTAA 2QP9X 3HY3A 3R7DA 2MIIA 2CEAA 2BGTA 2YNMC 3BK1A 2ABWA 3FNHA 1FDIA 5HJ7A 2YJ6A 3A37A 3WBJA 3PXUA 4KO4S 3WGKA 3VR3D 4G4SP 3QVSA 3DGEC 4IM7A 1EZ4A 4YJ2F 3QKSB 1DWQA 4UCWA 1CQWA 4E2WA 1BS9A 1QYDA 3KKZA 1P8AA 3HE3A 4NBKA 4QG7A 3SPXA 1PEKE 4YONB 2GZSA 3WB0A 4D4MA 2Z09A 1USKA 3KAQA 5LMCA 1UADA 3ZIAD 1ZGGA 3QYFA 3WI7A 4DSUA 1MTOA 1ISIA 1P2SA 1UKEA 4N8EA 5C4MA 4L95C 1UXJA 4O4HB 5ALRA 5L4NA 1DKLA 3J7AC 2BP7A 3WP0A 2WZBA 1RFGE 3AEUB 1TF5A 3NGXA 4QTZA 3IQZA 4YDRA 4PHTA 3NHYA 3N0TA 3WL5A 1DIGA 3NIDB 1P0MA 3KDSE 5DM0A 4ZZ2A 1W36B 1PEAA 4RTLA 1ADGA 1M2EA 2DKOA 2ZWPA 1P1FA 4PPGA 3DBVO 4BO6A 5C32A 1SRQA 2XUOA 5CITA 5K45A 5LJIA 1YUBA 2AOTB 3CG0A 4HDMB 2OYSA 3ZNQA 4RHXA 2X42A 3RIGA 3RVMA 1CQXA 4WN9A 3V1NA 3JATB 3PPWA 3IBYA 4YY3B 2COKA 1J1UA 1B2RA 3UOWA 4YHHB 2QROA 3GFTA 2C77A 2PYDA 1LBIA 5LQCA 1G0OA 3U7GA 2I7VA 1SCAA 2PGOA 5FV4A 4KR3A 4GVLA 1CUEA 4RQUA 1EFAA 4BGVA 4CIDA 4DN6A 4DIOA 3PX7A 1O8CA 2A92A 1B0PA 4EHNA 1YJCA 3EDOA 3IE2A 3ORRA 1I5OA 5E0KB 3W1EA 1X94A 4UVEA 1IU9A 1QOZA 2UZ4A 4RTJA 4HH4A 1U04A 1IBRA 4CDRA 3S2GA 1V37A 4X63A 3WGIA 3HP1A 2DTDA 5LJLA 1WMSA 4M0CA 1WOYA 4KXMA 3ODPA 2XUZA 1OHHD 4MVJI 4DDTA 3EISA 2FK7A 2CJXA 3AB7A 3SM9A 4F3KA 1ODJA 4B3GA 1U9YA 4LVUA 3GFPA 2H8KA 2A86A 3BAZA 5CXUA 2ZUWA 6ADHA 2FPIB 3GF4A 1CIJA 4FUTA 2BUAA 3N53A 4WCFB 2L69A 3FSGD 5A05A 4DMHA 5JDIC 3QG1A 4YWHA 5B36A 1A04A 1USIA 1PNOA 4OHPA 2ZJ2A 4RXTA 4BNYA 4JLVA 4RVNA 1HLFA 3CNNA 4RPCA 4RK7A 1XZBA 4XLTA 1CQZA 2I4NA 5BSHA 3WNCA 4CVNA 1UBOS 2YJNA 3NEAA 1WA5A 3N59A 2I62A 3ZDDA 4RTNA 1XQ6A 1WV1A 1SKYB 2XWSA 5G41A 4HVAA 5ISMA 1CJVC 3GO4A 2FDRA 3FZYA 4B0PA 2B25A 4GSYA 1EDBA 2XE7A 3D6TB 3O2JA 2B98A 2PCJA 1ZI8A 2QLMA 4H17A 2NWQA 1P4JA 3W2TA 2RGRA 4R0NA 3F9RA 2VH2A 1NPDA 5K2OA 1GRCA 1LI4A 3F73A 4AG5A 2HRDA 3E5RA 1BJKA 3WWDA 1WXWA 1PW7A 1ZMBA 3H11A 3JV7A 4XX0A 5TEVA 2Z98A 5ER9A 4URFA 3QXJA 2EBUA 4ZFNA 3R7SA 3X1YA 1M9NA 1KDPA 3ESRA 3OZXA 3H2JA 4ZEOA 2I2BA 3T4EA 3IBTA 1C4KA 1NBMD 3KEMA 4L0MA 4MB0A 3RTGA 1DXOA 4CE6A 4KPYA 1U9ZA 3C7KA 5HYVA 2O7VA 1J99A 2ZRKA 3B9PA 3EGOA 4FWBA 4TYMA 2V3VA 4LJKA 2Q2WA 4NYJQ 4WOCA 5DYYA 4JI4B 4M0FA 4D41A 1V16B 1QGAA 2ZRFA 4LZAA 4AX8A 1NRXA 1YA8A 1PTKA 2DE0X 1G66A 2HBQA 3MJVA 4QPCA 3GVIA 3H3FA 4XPIB 5HCNA 5AW7A 1MB3A 3QQPA 3IESA 1MNQA 3I05A 4O25A 3AKZA 1K8YB 2O59A 2PXCA 4K6CA 2QNBA 4QFCA 5FWDA 1EXNA 4MX8A 5FH9A 3PWKA 2R8BA 1NBME 1PUIA 4OU5A 2VJCA 3SJBA 1MHTA 2NXWA 3X3HA 1E5TA 2SKEA 1JFTA 4AFNA 3UQYS 1VRWA 3EFOA 4MRNA 2UVQA 5FORA 2QRVA 1L1EA 2ORIA 1DQPA 2YHUA 1C50A 3WLLA 3G82C 4XQ0A 2X2PA 3WICA 2H9YA 2ZFUA 4HWOA 1UOEA 3D4PA 3GEPA 4OAPA 1VJDA 5GGYA 3JQAD 4MKXA 4HTFB 1OTXA 2PM8A 3N2IA 4UDYX 5IBPA 4TV8B 4KPEC 3Q88A 4XQGA 1A1VA 1CV2A 1E1QA 2XTJA 3L5KA 3ETEA 4BO2A 2Z1NA 3GARA 2KJQA 3HVJA 3ESCA 4KAFA 1R3UA 2QB5A 1JR3E 2Q6TA 3KD3A 3VKWA 2XOKA 1T4DA 1U9JA 3IE0A 3WIEA 2PWYA 3UMJA 1X8LA 4OQYA 5F78A 1BXKA 2RKWA 3SIRA 1EVYA 3DPIA 2HKIA 3OF2A 2W2PA 4RGQA 2VP9A 5HX7A 5FAXA 4EQ6B 4LY0A 2F2TA 5KVVA 1UP7A 5IKEA 2I1VB 1EK2A 1FRVA 3W0LB 2HF7A 3DOUA 3BGVA 2O5CA 4BE4A 3COYA 1DRWA 2CMFA 1ZK1A 2JG3A 1X1QA 1MX1A 3JYOA 3N2LA 4KXYA 4N01A 4UEKA 4BC0A 1PNRA 3W5JA 4DLKA 4F86A 5KTRA 1J0CA 2E49A 3M7IA 3OY7A 3P32A 4ND8B 1H2HA 3FYUC 4K46A 4ZHQF 3WB2A 3TG2A 1KO8A 2ZUFA 1MIOB 2WI8A 1VYVA 2JATA 3EZNA 2AEJA 4Z7JA 2NV2B 5CVJA 3UGQA 2BFWA 1AD2A 3ETHA 1GGVA 3VXKA 1FYFA 4QJ3A 2IH2A 4YT2A 4BNTA 2H1WA 1NHGA 1YL7A 2QOEA 3E82A 1KRWA 1EE9A 1QFXA 2QTTA 5MN4A 1TM4E 4I6EA 5LB2A 3JX9A 3A1VA 4YK7A 1MOZA 3L7MA 1NFFA 3DAFA 3E6AA 4Q3EA 4BFZA 2YXNA 1E2UA 4H6XA 2QU8A 3KAPA 5TF0A 1VE9A 2JCVA 4LCBA 2D6FA 1WHSA 2AKAB 2H7XA 1GAQA 3A31A 2BEUA 4PYKA 4BUZA 4HLQB 1X8KA 3QE4A 2QI9C 3UG7A 5JE8A 2AW3A 3C3KA 1GVNB 4V1CB 4ZYTA 4HGPA 5TPZA 5CJJA 5TEWA 1RT9A 1YCDA 2XKBA 4C0QC 4JP2A 1JIVA 1XTIA 4FINA 1E0AA 4IVPA 1CZOA 3SZGA 1XOIA 1MO3A 4BCDA 4KKVA 5COAA 1PV2A 2BMJA 3PD7A 3E3NA 3T15A 4ZHQB 2MINB 1COWA 4OF4A 1I2CA 4YAKA 5CFLA 2CDBA 4JP1A 3R7BA 4FGJA 1NG9A 4G1FA 3EDQA 4HQLA 4HUJA 4PAOA 3VSEA 4CLDA 5CLHA 1U7OA 2QUJA 3LXRA 1G38A 3B1FA 5FLEX 1EFVA 1FUEA 3R3VA 4EJFA 1H8ED 5J5CA 1KPHA 5HK8A 4V0RA 1UJ6A 5EI5A 3BE5A 3KHUA 2FMXA 2EL9A 2PQ6A 1LBTA 1JL3A 1Y7PA 3SQOA 3KYIB 3K09A 3ENQA 4TLDA 3WLJA 2HJVA 1XLVA 3DOJA 4FEYA 4Q82A 4TVBA 4AS3A 1CQIB 2VA8A 5CURA 4KN9S 1X74A 2CUTA 1RRVA 1UBUS 4HTAA 3E3MA 1U3CA 3O90A 4O1IA 2ZCVA 4RHFA 1IY0A 4Q00A 3SXUB 5J43A 2W37A 4F7DA 2J6HA 4D3FA 3HB1A 4G0NA 4QELA 3VNRA 3VR6D 1MMFB 4UBNA 4BBZA 4C2UA 3HWRA 5ADVA 1GNQA 2UYHA 3IS3A 1HYGA 3MG9A 4RHTA 1QQTA 2A0KA 2FG6C 4GZ6A 2JA2A 3FGZA 5DLEA 4BGUA 2FX2A 1UM9B 4RD3A 3WK7A 2WM2A 2E7ZA 3R40A 3HJCA 3KZOA 2G70A 4TRRA 4WXYB 1CC1S 2AEMA 5MF6A 1MW8X 3CN7A 5CNKA 2Q4BA 1GZ7A 2R7MA 1PS9A 821PA 2FJPA 4JH0A 4MLZA 4PQFA 3WLKX 3G59A 2WD7B 4TQUS 1HUQA 4DLWA 3DZBA 3PWSA 4K0RA 5J2UA 5K8IA 5CR9A 3NRJA 4ALKA 5KTTA 4NS4A 2PLRA 4X8LA 3AR3A 5AJTA 1ZUD1 4UHCA 1NSFA 1OV6A 2CLLB 3D7RA 2ZXUA 2IU4A 4XJXA 1F2UA 4FYXA 1PG0A 4GLLA 2DLCX 4LYFA 1Z0FA 3JCZA 4IIHA 2EJTA 4Z4GA 2P91A 5IN5A 3U7RA 3Q7EA 4A8TA 1UIRA 3T7AA 1B42A 3SZRA 2L42A 1UC8A 1YJBA 4OFXA 5ENDA 1W93A 2YZKA 3PCRB 1XMIA 1ZJ5A 3UT6A 2ADOA 4JB0A 4P93A 2IZ6A 3M5DA 4PAQA 4TYNA 2XB6A 1P29A 2I1WA 3QITA 4KRGA 5I7SA 5FR1A 4Q01A 1KR2A 3BFXA 3MWKA 1O08A 4DWWA 3QJ5A 2E1PA 1SBHA 1L7VC 3R6TA 3H05A 3IHLA 5T4HA 3WLQA 1WETA 4EUSA 3GAAA 4CT4B 1IUKA 1WR8A 3JZIA 3BRWA 2OXFA 4XM2A 2CHEA 4DF3A 2I03A 5L4LA 3I73A 3KKOA 5I6DA 1QVWA 5D86A 2W2OA 1SUSA 1T9ZA 2XSZA 3VUEA 4DDMA 1UIMA 4GI2A 4RZIA 2FW7A 4KAJA 1L4BA 1CUZA 1Y3HA 3HKCB 3HCDA 2BKVA 4UXHA 1B8PA 3PXCX 5E9AA 1BX0A 4JUFA 2YV5A 3GIDA 5JDCC 1OIXA 1YB4A 1DAEA 2ZWOA 2ZUUA 2XJ4A 2HX1A 2JIMA 2I34A 3JWGA 4J07A 2PV0A 5CXSA 1QGUB 3ZI7A 5FLKA 2VSQA 5TVGA 2YXLA 2CVFA 2R6AA 3G2HA 1V8PA 5L3VA 3EK2A 4M55A 3RSOA 3VHXA 2PX3A 1QV9A 5IYZB 5AW4A 3UHAA 4AZ0B 2HNKA 1BQ4A 4M1KA 1O95A 5JZ9A 2XHZA 2IYPA 2BGJA 5DOZA 1SOAA 5EKTA 4GPEA 2COUA 3TSZA 1XYYA 4TV9B 1H2YA 1L4UA 5DXAA 4WLEA 3KOMA 2F59A 3RD5A 3ZE2B 5KPJA 4Z4FA 4C9BA 2YV1A 1U8FO 2IHYA 4GOJA 2Z57A 5DNEA 1Z3CA 3Q0EA 4NBTA 2VTVA 3ROFA 3QLVA 2PBZA 4NBVA 5CB4F 1SIOA 1W2WB 2ZUSA 3CCCA 4OJNA 3R76A 2C2YA 3DTNA 4FKMA 3EZXA 2ODWA 1PGQA 2Y0DA 1DC5A 2B0JA 4LZLA 2QVXX 3E9EA 1X42A 3TLKA 1I4LD 2XUAA 3KBBA 3ONFA 1H6AA 4LBVA 3RIYA 4DSOA 2J0EA 1I0IA 3QPBA 5LNK6 1AURA 1CNFA 3DHVA 3H9JA 3K1AB 4PRZA 4G26A 4M1OA 4PYMA 4AMYA 2FHPA 2PH5A 4H1VA 4TGLA 3VNAA 1GPBA 2ZRHA 1J33A 4XWKA 2YMPA 4I1UA 2BMWA 4YCLA 2OHOA 5BV8A 1Z8HA 1LW7A 2GJAA 2Q50A 4R1MA 3I12A 3LVRE 2B6NA 2QZSA 4TL9A 4YS6A 5GMOA 4MRVA 1NP7A 3T3IA 4IKOA 3AF3A 3OOYA 2XCIA 3JQGA 4BV9A 3OE1A 4NF2A 2IBSA 2AN9A 4WKCA 1P72A 4MDFA 3F4BA 4PPQA 5EMHA 3A04A 3RKSA 3VGJA 1M1YE 4BZWA 2GNOA 3NNSA 5TIIA 3PTZA 5H3LA 4EMBA 2H2AA 2J9ZB 1C7QA 3FNBA 5FTWA 3UMYA 2FNAA 1IM2A 1SVMA 3DAPA 2WD8A 3COJA 4X5OA 3GFFA 3OM9A 4AX4A 4HX9A 2JI4A 3LH5A 3KQSA 3K94A 5CD9A 4PAGA 5AUPB 2I0FA 2RBKA 1IBMB 3I6YA 4EHJA 6LDHA 4QVKA 5E6SA 4BVFA 4GOND 4CQJA 1K92A 3O47A 2C0PA 5KJ1A 1SVWA 4N3NA 5KHAA 1KQGA 5HZKA 4ZTUB 4RV9A 3BD8A 2XNHA 4OHKA 1H8EA 3DUWA 1VPVA 5J2TB 2O8BA 3OPXA 4S24A 1LS1A 1T5DX 4EUEA 2VJNA 5JZOA 1U28C 4L0QA 3ELYA 3PQ3A 4CKZA 5LWQA 1LH0A 3KT3A 2RHDA 3RSFA 4BNDB 1N5JA 1ZD9A 4JI2B 1HNNA 2O48X 4R4JA 3UXEA 2FGKA 4IINA 4FDMA 2ZUVA 5B6IA 4M8KA 1J39A 2QYSA 1OYYA 3L7LA 4D97A 4M46A 1R8SA 1XHFA 2EERA 1KU6A 3PDWA 3M3DA 2WJVA 3N39C 1ZCJA 2QNIA 1HO3A 3OO1A 3OQHA 2QJWA 2QXYA 3QYJA 3EEBA 3NKFA 4YBRA 4ZRMA 1V95A 2QQ0A 4UUBA 5HR5A 4MVJM 1NLMA 1YRQA 3EPRA 3L49A 3ZDEA 2ISSD 4Z4IA 1ULBA 2RGWA 1NVKA 3Q7SA 1JG4A 2HHLA 1KEEB 1T10A 5GVRA 3NNDA 3GT3A 3SLGA 1NXVA 3D2CA 4NPHA 1ODCA 1GN9A 3MAJA 1KY2A 2Z08A 4GPTA 4GZLA 4DCOA 4A73A 2XY4A 1GM5A 1ZOOA 1K6IA 2AYXA 3AEKA 2HJHA 3VHQA 1Z7GA 2J08A 3N07A 4HB0A 1A5SB 1YONA 3NM4A 4YI5A 3VVMA 2P8SA 1CY0A 3MB8A 5EUMA 3AFGA 3R3WA 2D0IA 3QELA 3CUWA 3NW9A 1C8VB 1G1AA 1G291 2QD1A 4QXOA 3STHA 1V16A 3LA8A 5IEBA 2Q4RA 2NU8A 1NX6A 3HU5A 1BS1A 3LX5A 3SEFA 3TTUA 1HX7A 1YL5A 3BIJA 1Z36A 3DLHA 2W2MA 4WNCA 4HH1A 4C7KA 1SHLA 3BDAA 4HFRA 4DQVA 4MHOA 4OSOA 1TUBB 5AW3A 1GGJA 3HNPA 2YZNA 3I8SA 1P4SA 1K4KA 4OX9B 1LNQA 1BFKA 3F3YA 4Q39A 3T1VA 2ZU6A 2B4QA 2O07A 2QVLA 3B52X 3IDFA 4Q3DA 3AUUA 4EAAA 4Z2YA 1TM3E 5JNWA 4FGWA 2GZDA 3MWFA 3E70C 3NP7A 3QLEA 3PJGA 3CZ9A 1QH9A 3F6CA 4CMGA 1HDYA 3KQYA 3KSRA 1KDOA 3L84A 3NH9A 4OLFA 3IDAA 3ISTA 5B7PA 2GZHA 5J4HA 4BQIA 5EXXA 1W1IA 4FC7A 2TSYB 3CFYA 2Y68A 2IYOA 3HQ4O 4NMWA 1D4FA 1UKAA 4Q12A 5C8YA 1LLDA 4FB5A 3ZQKA 2WAXA 5HRAA 1Q77A 1ZM3A 1IAQA 3DT6A 4P4TA 2A9RA 3AETA 1TQ8A 2P4SA 4XWGA 3X1JA 3RSGA 8LDHA 1DXQA 1GTG1 2XUQA 3Q3EA 5SV2A 3RTEA 2QBYB 2I8CA 2BTOA 4M1EA 4M0KA 2QZ4A 4ZRDA 1H69A 3ZCTA 4CLRA 4MWTA 5LZ8A 2ES4A 3A6HA 2YJ3A 1S1MA 1K06A 1OXBB 2GEKA 1P5RA 1GXSA 1RHMA 2G67A 2W6IA 2QX4A 3CZQA 1X15A 3EWAA 4M9CA 2ILVA 2DQZA 5DMHA 1QWOA 4TYPA 4Y67A 3ROQA 2Z4TA 2IIPA 2GOYA 1RQ2A 2RHRA 2X7HA 3T7SA 1JDBC 4MEBA 3TD6A 1O97C 2FE4A 1XPUA 4PVCA 3VVLA 5F98A 4U7JA 4EY7A 5KQLA 1KXZA 1CS0B 1PT9A 1DAPA 3UGTA 3DW3X 3KJQA 1N5OX 1I6WA 5IC5A 1N8TA 1VZ3A 3GJ3A 1QAOA 2KW5A 1RAEA 4M9XA 3EC2A 4UCFA 2O8CA 3C3DA 3EPJA 3IR7A 3BMXA 2Q7OE 1H8HA 2QLLA 3B2NA 1AUOA 4PZEA 2EG5A 1KYIA 3MD0A 1TLLA 1KAOA 3IMKA 4NFYA 1N1GA 3D54D 1H0RA 3RC8A 3NHBA 4ZV9A 8OHMA 1SVKA 3HYSA 1IHUA 1QB8A 1WHTB 2QMUA 5AI4A 4F4CA 1JTFA 1MJGM 1YAHA 4R16A 4UVHA 2LIVA 3GPDG 3NO4A 4XGIA 4YRRA 1XHEA 3UB4A 3U44B 2B8EA 2O2XA 2RHBA 1KU0A 1CUYA 2XI4A 3U1BA 1MQAA 2F1IA 3T7EA 3UQZA 4QTXA 4I3FA 3LC1O 2PAFA 4JT2A 5FWYA 4ZVVA 3PR3A 1RSZA 1USVA 1CW2B 4NC9A 3SR0A 4IIJA 3D3NA 4C4OA 5BPHA 5KYWA 2AI1A 4IG9A 4MGZR 2QUKA 1ONNA 3DNMA 2QP3A 2IPXA 3LNTA 3AR7A 4HQKA 5EMMA 1WUIS 2VDJA 4ITVA 1U0OC 1QSGA 2QVCA 3PFGA 2C9BA 3UIEA 3IOBA 3GWZA 4RA9B 5A5VA 3R7LA 1FX0A 2Z8ZA 2QRJA 1QBKC 3LHKA 4HYYA 2L2QA 4LDAA 5BWLA 4C5AA 1CS4C 9ABPA 4EA7A 1WQ3A 1UFKA 3F7MA 1HOXA 5FEUA 4UHKA 1GG5A 3GGPA 1DJQA 1JEOA 1QYRA 1TEHA 4LN1A 5EGNA 3BRQA 4U2BA 4NR0A 2D0OB 1UOQA 2QI9F 4CM9D 3EZYA 4ENVA 3EXG1 4K0KB 1GL9B 2WVAA 4ACBA 1O5OA 3CLSD 3KKMA 5K1ZA 4OK3A 4LYHA 1AQNA 1PUJA 3RS2A 1I13A 2H31A 5LQDA 2XDWA 2QM0A 1ZC4A 4D98A 1AY0A 4JXZA 2DTEA 3DM9B 4NIMA 3NDBB 1P60A 4LRXA 4PINA 2Z04A 5KVQA 1WW8A 2NXCA 1SWVA 3LUGA 4P34A 5EHXA 2VUTA 1DKMA 1N2CA 5HA5A 4PGMA 5K09A 4YCBA 5BQ3A 1T0UA 4JYCA 5IP5A 4G9EA 2VYVD 3KB6A 4LWPA 1R0BA 2C61A 4R2JA 4R5MA 2HJ9A 1Z6YA 3OU2A 2YH2A 2O8EA 3DPSA 3CGGA 4YN3A 1MO4A 4R6XA 1JSXA 1FDUA 3ZU3A 3NHRA 4OHFA 5ANRB 4AUKA 1Q50A 3OT1B 3LA6A 4EVSA 4RGBA 4KLNA 3KVYA 4TLMB 4OP2A 5EXPA 4H3SA 3CIFA 4P4UA 4Y1GA 4BJ5A 5EXTA 1FEZA 3HVRA 4RIHA 3RBVA 4Z9FA 1TAQA 1KVTA 3DHNA 4F9EA 1KAHA 1K9SA 1NVTA 4BQFA 1ZVVA 4H7HA 2MSDB 2C4UA 4PHCA 4WCFA 2XT9A 4ENUA 4YYZA 1ZXXA 4LDNA 3C3JA 3IAUA 3JPWA 3O3CA 1C3LA 1XKXA 2GHIA 4NQRA 4YCCA 4MJXA 4Z4EA 1JKJA 3SF0A 4C2AA 5EJ5A 4KMSA 1L6IA 2CC2A 4D9NA 4GQAA 3TW6A 4XCVA 3HWWA 1F0KA 1K8QA 3W1VA 1XDBA 3UPUA 1JDUA 2O1XA 3IJPA 2ID7A 3HEMA 5CBPB 3X1DA 1T8WA 3SK0A 4AB1A 3PBKA 1IUOA 1IUNA 4OYRA 4HATA 5AKGA 3HCRA 4Y6PA 1EGHA 3FB1A 4NU0A 3P2YA 2W98A 1E62A 2I6SA 5FYDA 2XCLA 5IN4A 5IVKA 2LCQA 1NG1A 1IN4A 5F2KA 1Z22A 2YIVX 2H1HA 3WYAA 3OZTA 1CRPA 2O2SA 4CM3A 1HNZB 1GPKA 1RQRA 1X80B 5CH3A 1Z8DA 4BCCA 3G2LA 4FZJA 2VHVA 4HZIA 2VDNB 1QLWA 5JNSA 1E32A 3DDZX 3TM5A 5FPYA 5JQGF 3KD2A 4DSZA 3VX3A 2W6QA 2OAGA 2WUFA 1K2VN 3ESXA 3P94A 4W5TA 4KODA 3TEFA 2H9IA 5I48A 1KZ4A 1XK6A 1OFUX 2BF4A 3DC2A 1CU1A 3V32A 4TPKA 3GNQA 4CTNA 2YHSA 3GAFA 5FBVB 4PPYA 1DJOA 4FFRA 1JA9A 3LI2A 4QUGA 1TU0A 2ZSDA 5JS2A 2PQMA 2WF7A 4BEBA 5FP0A 2FPMA 1AO3A 1GLGA 2B82A 4HD8A 1QV7A 4AN0A 4N5DA 5AVXA 2BFBA 2CNNA 4BLSA 2HA6A 2FMIA 2WOJA 3LQ1A 4I55F 3LOUA 1X80A 5KREA 4NU5A 1R6BX 1OC4A 3NBXX 4AN4A 3HCEA 1YDEA 1U63A 3EUEA 2AQ8A 2WTAA 2W71A 1U4NA 2JCBA 3AKDA 5KOHB 4W5NA 1AV7A 1MOPA 2IZ5A 1ZX1A 1PJCA 2GKGA 4LE1A 4Z7NB 1ZW6A 4M99A 1JJFA 2IZZA 4HXFB 1J5XA 2AOVA 1ND5A 4PS0A 3NWBA 2F3QA 2J32A 4FFWA 4TLLB 4XH9B 5JD6A 4NJMA 5PNTA 2HIHA 4GGPA 4INPA 4BNHA 3IQXA 1KHTA 1JFSA 1E9DA 2VOEA 3DE0X 4R40A 1LVHA 1MAWA 1R18A 3TD2A 5IS2A 1XMQB 4ZQBA 1K6EA 3E3OA 2VWPA 3FLMA 2PLNA 4M53A 3KSDO 1E6MA 1U7DA 4DYHA 1XRNA 2V6BA 2OMKA 2IP1A 4O2AB 1Z0ZA 4OREX 3VYUB 3FOEC 5JJIA 1SD5A 5TS3A 1CF4A 4TMFA 1L7PA 3HUTA 4YMTA 2GFQA 4RTPA 4P4LA 4CU2A 1QGYA 4KCGA 3K73O 4JLDA 2I2WA 4ON9A 2ZYRA 1BXGA 1T2AA 1K7FB 1TIPA 2OXIA 1YVUA 3A2KA 1G8HA 1XELA 5AKJA 5K3EA 1U98A 2QPOA 4DUZB 1Z34A 1N75A 4BFXA 5A5EA 3WL6A 1NUAA 1YBFA 1YS6A 1TF7A 2J31A 3DOHA 3OG9A 4OGFA 4NEGA 5C18A 1ODSA 5ALHA 3LZDA 3WGMA 2BN4A 5KQGA 3H5OA 2H5IA 4ZMBA 4YMWA 5KZMB 4OQXA 2BBWA 1KK1A 4KO2S 4ZV7A 1FA9A 1GYQA 1W1UA 3RAPR 2R96A 1KO5A 1DBQA 3ORYA 5KNCH 2R5WA 4OG2A 4ZVSA 4C4ZA 2UZ0A 3AL3A 3LJKA 4FDUA 4LNUB 4U7GA 3RVSA 4EHLA 1ZMRA 1P19A 8ABPA 5L53A 5FNVF 2WT8A 1U8UA 2WG2A 2J3MA 1XDUA 2BEVA 4RORA 4MV9A 5DF1A 2GJKA 4Z9BA 5IZCC 1Z17A 5IM4A 2O4UX 3KVNA 2OGUA 2OO3A 4IHQA 2OHHA 2X4IA 4BOYA 4REOA 1EAMA 4OMUA 1R50A 3WZLA 1ESMA 5JAMA 3G89A 2AN1A 3E8XA 3MRSA 1G63A 3P1JA 3PXEA 4X90A 5KNDA 2EKDA 3KKQA 3TJRA 1P80A 2NU9A 4MW6A 4JLKA 4YDSA 3UF0A 3FYDA 3MBIA 4FFVA 2WDZA 4KQ6A 3ZDYB 3ZGYA 1Q1BA 1E7RA 4J0QA 2JZNA 5DHRA 5EIBD 3EVEA 4OK6A 4AZWA 4AUMA 4CMCA 5DM60 4LJAA 5K8LA 1MLDA 3L46A 3MFYA 2BELA 2FOXA 3CF4G 2D4HA 4IXWA 4D6PA 2AJLI 5JI3E 4UHHA 4J76A 3K1TA 2CV2A 2HF8A 4ZDJA 3B5IA 3WDSA 2AFHB 2RCNA 4KHPB 1T9GS 1YULA 3GDGA 4Q9IA 2AOWA 5DM4A 4UZEA 4IVQA 3FYTA 3I62A 1PWEA 1J56A 2AUNA 1E1LA 3KUKA 1XKTA 2IYSA 3AHJA 2YDXA 2RI0A 2RH8A 2FFJA 3E1SA 4CI0B 4MWDA 2GUGA 3UK2A 3Q11A 1OILA 4H7IA 3NUGA 1B1CA 3C98A 4K3VA 1RR6A 1RQXA 3CSSA 1J6UA 1OFTA 1XZJA 2QPAA 5HIJA 1GT91 5TE9A 4GR9A 2FPXA 1I2BA 3EW9A 4HXEB 5IWAB 3OQOA 1Q20A 2YRWA 5HDBB 4HI0E 3NYRA 2VP2A 3EIOA 4ZYLA 5C35A 3WDLA 5J47A 2BI4A 3HUEA 1B23P 2O0MA 1GGEA 2PSFA 4J16A 4UAVA 1IVSA 2XLCA 3PZBA 3CH7A 3Q2KA 4UJ3A 4ZAYA 3IJEB 1YNSA 3AINA 4YRJA 3NHPA 3KB1A 4BNIA 3MCTA 1PQWA 2WVJA 1LRKA 3E22B 3AEYA 4CF4A 3EH2A 2BV3A 4O59O 4KXWA 5EHIA 1Y7IA 5K3CA 1PJQA 3CKYA 3I6BA 3QZUA 2F90A 3GY0A 2HLHA 5KKAA 5B58C 1LLFA 4OA8A 4MUIA 3NOOA 4LC9A 4B2PA 4MNTA 3X2FA 2QQFA 4N18A 3T7IA 1VB3A 4PZLA 5EGSA 3TQHA 1V47A 1Z13A 3LUDA 4QLBA 3LPCA 2WV7A 3FROA 1S9DA 2IGBA 1G6HA 2JGAA 3VAAA 5LZ5A 1H6DA 3LYHA 3TLCA 3NJ4A 1YBAA 4MW7A 2Z6UA 4KQKA 1IWOA 2Z83A 4NESA 5KBYA 3ZQ4A 1IOWA 3PKJA 2XB4A 1L7DA 1LUAA 1NZFA 3AEKB 5EINA 5IBQA 2ASEA 3TW0A 2DR2A 3G5AA 3Q6NA 3D7LA 2AX4A 1UZLA 3AILA 5AICA 1EFCA 1ZO8A 2ZR9A 4NBRA 2VT6A 1F14A 4O4JB 1IE3A 4MQEA 5I9BA 3M3PA 4QT4A 2XXBA 2QY6A 2EXXA 1YGYA 3PUIA 5LPNA 1IHPA 5GVSA 1O54A 1PZNA 2NW6A 3H5LA 1VYUA 1GA4A 4M83A 3OVMA 2QD2A 4WNYA 1WZEA 1H5UA 3IP9A 2PV7A 1EZ1A 1ZCZA 2ONKA 4LMAA 1Y5NA 5K9ZA 2YASA 4FGKA 1BJTA 1MPTA 3HO6A 4PLGA 1TQDA 3GJ4A 4ZU3A 1B73A 1HORA 3ND8A 2JL1A 2VLIA 4RLSA 4RDHA 1USUA 1OIVA 2IY9A 2WIJA 4YROA 3R0QA 3WY9A 5HHTA 1VFPA 5JQWA 3THYA 2NZXA 3KOYA 3L04A 4QXMA 4A91A 2FKAA 4OI4A 4ESHA 2JFOA 4FVTA 3TOZA 2ZR8A 2JA1A 4M49A 2FR1A 3L82B 3SHFA 4AF7A 5C5EA 4O2BB 3LLVA 4IZHA 2W2VA 5D7BA 2C7BA 4KMOA 4IDAA 3K6SB 1XRJA 3C8UA 3FN4A 2VHZA 3OTIA 2QRUA 5B7GA 5ALWA 4DV3B 3TW8B 5KX5B 2Z2ZA 3BB4A 1R7RA 4BKUA 2O2JA 2Q0HA 2W6MA 3BX1A 4H1WA 4BO1A 1XZ8A 2XUDA 3G0GA 2JLZA 2ZIAA 1JR2A 4E15A 1J2YA 1I4EB 5GY7A 2B35A 1K6MA 3U6KA 3I9LA 4B4WA 4Y0NA 2QR3A 3K0CA 3QM1A 4D44A 4FWTA 3COWA 1OFIA 3PI7A 5A0TA 4WNIA 3BDIA 3ZE0B 1QLJA 3OP1A 4OM7A 4RPLA 1Y81A 3RUDA 5JZMA 2Z5FA 2CF6A 2YW9A 4G5SA 3S27A 1Y9AA 1C30B 3EWSA 4J7XA 3UMSA 3OLYA 1KGDA 4Q7KA 3OIVA 3TOCA 3H13A 2FFRA 1DHTA 3ORHA 4K2AA 1EWVA 3GPLA 3BJMA 2AFVA 4PTLA 2HSJA 2P67A 2Q9UA 6REQA 3A3NA 2VNJA 4CJXA 3TLEA 1ZM7A 5B4UA 4ZU1X 3TXAA 4E0BA 2WIKA 4YRPA 1G5QA 2VJLA 3PQFA 1WHTA 2I3BA 1MB0A 1QHSA 1KH3A 4ZVPA 2IYRA 5LBTA 4YA6A 5EIAA 4A6DA 1SC1A 1PL8A 3EBLA 1CIPA 3ROPA 4IV8A 3JQFA 4LK3A 3U37A 3EIXA 3HCAA 2WHRA 1BGXT 2O3TA 3A4IA 5CB6A 4EUHA 2H2HA 4XLZA 4YNBA 3O9MA 2LCFA 1CZKA 1UK8A 4RFSB 4B6SA 2X77A 1EKXA 2PWAA 2IVFA 3DHWC 4UREA 5FF9A 5K6AC 5KYXA 4L3OA 4DGQA 4V0LA 3GROA 3RV4A 3L18A 1IQPA 1POXA 5D01A 2R8XA 2AHOA 3WOHA 2BDEA 5JPCA 4QVIA 4DW8A 4Q9KA 5EQTA 4TMZA 2JFWA 3HVIA 4KSCA 5B3JA 1U0SY 3BSFA 3WSVA 1BRMA 4Q4LA 4UULA 4OI1A 1JHQA 3M33A 1R8XA 4HG2A 2BHRA 3EG5A 3QLUA 4W5RA 5C7IO 3X0DA 2JIOA 1Y6ZA 5HXAA 1YVEI 1Q17A 1SELA 2WPDD 4N1AA 1JSCA 1MJGA 1XRRA 1WXQA 1EBFA 1U0TA 1O4VA 3CJQA 2NXJA 4FGSA 2Q0XA 4IIVA 2GZ1A 1WF6A 4PE5B 4MR7B 2AF4C 3PGA1 4KIUA 4KB5A 4RA6A 1BTOA 1IIBA 5HRCA 1S4QA 1KRXA 3BD9A 3EWNA 3V5NA 1ZN7A 1R0CA 3UWSA 4F4DA 1QLHA 1HR0B 5EJ8A 2YR0A 1W85A 3EFEA 5K8UA 1U8YA 4Z5XA 2IITA 1TZJA 13PKA 3WQSB 2O50A 2X9NA 2VZ8A 3BWDD 4G5FA 2GO1A 1PDOA 1E0JA 3FGNA 4MS4B 1XJWA 4IZIA 3RVPA 3ENNA 1U0GA 2ZREA 3PXAA 4HWGA 1X1AA 1E6CA 1SAYA 3RREA 3VVCA 2FUG6 3RSQA 2AT1A 1DX9A 2HTEA 2QDKA 4HWRA 1FSSA 5EWLB 4C4SA 3B13B 3CLTC 5DFAA 2P8JA 1TUBA 5BT9A 2VTBA 3U3JA 2A2ZA 5F5XA 5FQOA 4E1VA 4QODA 1Q3HA 1W0JA 2G07A 4KSBA 3V6MA 3RWMB 3N74A 1QIMA 1QC5B 3IHTA 4P22A 5A4MS 4DV4B 1WP9A 5IDWA 3RT1A 1N2ZA 1TL7C 3HKEB 2P2LA 1QZ3A 3S8YA 4JJZA 1W5FA 3K0AB 4GQIA 4IQ0A 2EV9A 4BFTA 2HRQA 3MW8A 4L9AA 4X45A 4PZUA 2OZLA 3SMQA 4C4YA 1I1NA 1Z0DA 4YBZA 5I7OA 2B21A 2J3KA 3RC1A 3B6EA 4PLYA 1FSPA 3ADKA 4BVJA 5C1BA 4R71A 1OLXB 5A6SB 1FLVA 1FXWF 2ZBFA 4EKYA 3VR4H 3LDHA 1HYQA 1Z56C 4I08A 1MV5A 1L7AA 4LF5B 3PYMA 3D3WB 2AKEA 2G4VA 2X22A 3PGMA 4XM0A 3VR4A 1OXTA 1GD1O 1LQUA 2FEXA 1SEPA 2GCPA 3SP1A 2QD5A 2M1XA 2PKQP 1IVNA 4B7XA 5LIPA 2YZ7A 4HBGA 3HWSA 2D7JA 5A1JA 5E2IA 3JQAB 2C7OA 3PS9A 1ZH6A 1H0KA 3NEJA 4UC0A 2ZPUA 1ST2A 3OU6A 2O0LA 4QEKA 3ZDZB 3UN1A 3JWEA 1RS0A 3W7VA 2V6FA 5G53C 5J4KA 1C0LA 2ISCA 3KSUA 4Y2QA 3SDZA 2J59A 4U3JB 3W4JA 3DBIA 2IWHA 3L7AA 3IJ5A 1LK0A 3DTVB 5CDHA 2ZTMA 4LCEA 2V65A 1BU8A 4D96A 1J4AA 1B7GO 2X6RA 3TLBA 2CKMA 2PJDA 3AQ4A 2Q6IA 2HW8A 3W8RA 1KMHA 1MJFA 4MVJH 2CLIB 3I3OA 1RQGA 2J5XA 2MMGA 5CFPA 1BQEA 1U9IC 3TTXA 1QM5A 2XRMA 1J09A 5A4IS 3KOWA 2EGHA 4ARSA 1Y1TA 3QA9A 1G0NA 1K27A 2GZRA 2PGIA 2ZAOA 3AESA 3H17A 4K88A 2NU9B 3S81A 2K7ZA 2VPIA 4ENPA 1CFZA 5CEEA 3LT1A 4B3MB 3WBBA 1U1CA 1O03A 2D1TA 3E58A 5FTNA 3INYA 5HM8A 1AC5A 2H0AA 2ZTLA 3F98A 5TY0A 4CG3A 4XVHA 3A36A 3JALA 1SBTA 4F56A 3CRNA 3E4DA 4RJLA 3S28A 1ZNZA 2FEKA 2XVYA 4L4UA 1E3SA 4MTLA 3GBPA 4NLLA 4L07A 3LM8A 1PWZA 4INAA 1I7LA 3DLCA 4N40A 4B7UA 1B6RA 3FYSA 3FPBA 4BNUA 4ZOAA 1UBTS 4LQ4A 2IZ1A 5FUQA 2ZJ0A 3VNQA 4MAMA 1YV9A 3T41A 4HDAA 4J2OA 2YV3A 3PLRA 5HBGA 4FXOA 5KSZA 4KXVA 2QTBA 4BQQA 4FN5A 2E0IA 2ZBPA 1U99A 3EUWA 1SZCA 2FG5A 4IHJA 1ZBQA 5FEMA 1NVVR 3O95A 3MWYW 3HB7A 1JWLA 3MA0A 3EQ2A 3EIFA 4KIWA 5HEKA 1SHUX 3LUFA 1N6LA 3ISJA 3T1QA 2DFPA 4JLUA 1HZZC 1QG6A 5DE3A 4EG7A 3CNLA 3VH3A 3TW4A 1GCOA 1QIIA 1W0JD 4C76A 4NOLA 5A0FA 1Y1RA 2PR7A 1U0FA 4ARUA 2C96A 3MTGA 2B78A 2H1VA 5CLGA 3N2GB 5HK9A 1V43A 3LD9A 3IPRA 3NUZA 3NPAA 3B3AA 2Z56A 2ZAMA 3L7OA 3VO1A 1U2SA 5F7XA 4XOUA 3SHWA 1G19A 3LZCA 1XU9A 3NTXA 3ZNOA 1YIAA 3C48A 1RQPA 3B82A 4HSGA 3RU7A 4ECEA 2ZG6A 2AN3A 4YMGA 1YFLA 2FB9A 4CGYA 5TXGA 2DVMA 4XB2A 1VG0B 1XL0A 1GWNA 4I1RA 1Z28A 4P7JA 5AVTA 2KMLA 3TVTA 4E5DA 3JQPA 5T5QA 4JI3B 4H7EA 4GEGA 1C7FA 1ZW1A 5I7RA 4RK0A 1D04A 2QSJA 3P2EA 3SD7A 4LPKA 3VTAA 3JZFA 2HWKA 2Q5JA 3B12A 2ZSHA 3MGGA 3PHHA 4I66A 1MDFA 4G5YA 9ATCA 1YDFA 3LGSA 4N47A 5A4JA 1P9WA 1JE1A 3CSUA 3FOWA 2BFDB 5KJEA 4DILA 1E5XA 2R1VA 2JGNA 4BRWA 5FJJA 1GA6A 3L7CA 1LQTA 1W76A 4EJSA 1ZD1A 4UTZA 1RAGA 2IH4A 4FFBB 2NO9A 3EGWA 4X7MA 3SQDA 3WG9A 3I2JA 4O0MA 1QQ5A 3PHCA 4ND5A 2B7LA 2JBAA 1P1KA 2HU7A 1L8LA 3OLXA 2V7QD 4ND2A 2PNFA 1AS2A 5BVHA 1M2NA 1P31A 2NO6A 4BBPA 1AIPA 1Y1QA 1TADA 3FHCB 3UPDA 4OL0A 4ZO4A 1JKIA 2OAEA 2EZUA 3MS4A 4Q4JA 4BEWA 6Q21A 1GKUB 3FHLA 2BFMA 1O6FA 4WZBA 1CY7A 5L8VA 3GBVA 3WRXA 1XDGA 2G5TA 3FKSD 3E5HA 4GGMX 2BGLA 4BN0A 1M2HA 2W9XA 3WYEA 4BU0A 1OFHA 4Q9HA 2C94A 3JVEA 2YFQA 4YJKA 2VEDA 1XA3A 3W2IA 3E03A 4UPEA 5IF3A 2O1WA 1M75A 4FYYA 4C0HA 1TJPB 4NYJR 3U7EB 4FD2A 4AS1A 1KY3A 2FWAA 1TKCA 5B2EA 4PLWA 1COWD 4F3YA 1N3LA 1PT8A 5GQSA 3GLIA 2Q0SA 2Q5FA 5F9FA 1R6TA 3GEMA 1UBMS 3WYBA 1UDBA 4EA6A 3HDYA 2ZI5A 3QIVA 3NS7A 4FYKA 4QYIB 3IJRA 3LCJA 5FUWA 1K3TA 5LQAA 4CN8A 2VPTA 3NC0C 4HUQB 2FEOA 3WKCA 2G4CA 2H4XA 4NAVA 3OE7A 1DUIA 2XYQA 1Z4QA 2R2GA 1NTRA 2P9HA 1OWLA 3T5TA 5CG2A 4LJLA 1XLTA 4EX6A 3FWZA 4QEDA 1SKYE 3GX1A 1B1AA 2E87A 3TSOA 5EE9A 3FDJA 3BE8A 1GQ2A 4EJ2A 1KFKB 3A26A 1C3XA 1DKUA 1U0JA 2G25A 2JW5A 2WOOA 1T1EA 3ZY2A 3ZKWB 1XLUA 3I6QA 4KGDA 1IY9A 4RM2A 3RIHA 3TSCA 2YMLA 3DZFA 1DIBA 4GS5A 4ZAZA 4AM8A 5CCXA 3N7TA 1NJFA 1P81A 1UKVY 3KLMX 3ZYCA 2EX0A 3S1AA 2Q3HA 2BTQB 5HW0A 4UTOA 2GBPA 5E6UB 4XI9A 4ZJPA 2BKAA 3DHYA 4A92A 3SF8A 3DOCA 2JPDA 3OEYA 4HB3A 4R8SA 1N92A 2CFSA 2V3CC 1QVRA 2JIZD 2REBA 3CUSA 1SD2A 4Q3LA 1XCPA 5JCZA 2W6PA 4U9UA 4QO7A 2JVJA 3MCUA 4ETMA 5JXHA 3TQTA 4QBFA 4B44A 2A5LA 4UMEA 2VJAA 4V0QA 2X41A 421PA 4DUYB 4BL5A 5EJ9A 4JR2A 3VC2A 5IT5A 1N7IA 1GDTA 4OB7A 1DEAA 1E2PA 1I7NA 1QAMA 4Q93A 2V5VA 1A1SA 3GWGA 5H81A 4QATA 1N2HA 2O2DA 3JXEA 2BR4A 1N5MA 2O52A 4HDSB 1Z7EA 1SBNE 3ETCA 3OZUA 3MGBA 4LC1A 4NBNA 4QIHA 2ZIEA 4FFPA 3ROKA 3ZDRA 1GG8A 1XZNA 3NONA 1PQ4A 1VL6A 2QKYA 4LRYA 3U39A 1Y63A 1WV0A 3X43A 4KVFA 4LFBB 4DIEA 4NG4A 1CR0A 5G3YA 4EG4A 5GJCA 3O82A 2IC5A 1OKKA 1FZQA 2D8MA 3DFZA 4GLJA 3ZDXB 1NGSA 4KX3A 3H9UA 1GL3A 1KHHA 1E1RD 1KEWA 3ME5A 1Z68A 2VSXA 2J6IA 4JV5B 3DE5X 1R5OA 1NYLA 1XIVA 2C2ZA 4ESVA 3V4RA 1MGOA 5DNYB 1GITA 1R0WA 4EI9A 1C1DB 1WL8A 2LWIA 2SHKA 3HRIA 3U1VA 2E21A 3V55A 1KH1A 2ZDGA 1B6SA 1SD1A 4MIYA 2A5GA 3PKZA 4R3WA 5HVNA 3K70D 1Q0TA 1O4WA 3QPCA 1L5SA 4LHWA 1A4IA 4UTXA 1F7VA 3AFNA 1V8ZA 2IS2A 3IIKA 2OFPA 3P2KA 4M9QA 4PHFA 1B43A 4P3XA 2BI7A 1ZNYA 2EW2A 2MMCA 3ACDA 4P32A 5DGIA 4IDEA 1LPBB 1L4EA 2J9FB 3NR2A 4B3RB 4YEDA 3UWMA 3W8EA 3JZAA 3GJRA 4PZYA 3F8TA 4AY3A 3KETA 4CF5A 2K7FA 4MXDA 2BFAA 1VI2A 2NT3A 1E1YA 3CINA 4JR1A 4UM7A 3GEDA 4N0MA 1WCXA 3KKKA 3SR3A 3DAGA 2P41A 1E60A 1RRFA 5C37A 4EO4A 4EZIA 4R1OA 1I4TD 2IPLA 1SULA 2P6NA 4OFZA 1QS0B 1UKYA 1ZK0A 2O2GA 1IQ0A 3ECCA 3LY7A 3DFKA 4IAOA 2FYTA 4C6TB 4ARBA 1RACA 1E3MA 3NORA 1NNI1 4M2LA 3LBAA 1UJ2A 5BSUA 1T9BA 2HSWA 3AHGA 4TKVB 5JROA 2BH9A 3LXMA 1YUMA 1NPTO 1JZQA 4TTAA 1JVBA 4CHGA 3W8NA 3P52A 2XBLA 4B1FA 3C45A 1OXKB 2P79A 3EJWA 1KERA 4G9BA 3K0EA 1C3VA 2VCEA 3KAKA 5E7QA 1PV1A 4DXDA 2P1RA 1DFGA 1F8YA 5ALZA 1Q91A 3U7JA 3WMRA 1HYHA 1C7RA 3F96A 3ISVA 3OU7A 4NAUA 5DBHX 5BN4B 3BRWD 3IDZA 3FCYA 1V48A 3IPYA 2JAXA 3LHFA 5E2BA 2NUBA 1UMDA 2HJGA 2PBFA 3C43A 1LPPA 2PZLA 2YRFA 3GUYA 1T8UA 1POWA 4IMJB 1Q1EA 3GJQA 3T35A 2V45A 1H5NA 4FJ0A 5DU2A 2CXSA 5CG1A 2QM8A 3W34A 3MOSA 3LY9A 1OB2A 5CD1A 3EVAA 4IRXA 1ONSA 3G0HA 1DVRA 1DAIA 4ZKDA 1GZHB 3INNA 9LDBA 3A4VA 1KZYC 2V7TA 2HHAA 3L7NA 1ODKA 4MW1A 1SKMA 3QX7A 5ALIA 1T2DA 4ZT5A 4A1FA 3D6VA 3LRXA 4MOWA 4WZAB 4JFAA 4B7AA 4ZC8A 1U2QA 4IH9A 3K15A 4PPNA 4D6XA 5DBGA 1VE5A 1HDOA 3HFSA 4HSEA 2MWMA 2P9FA 3BGIA 1GTRA 4DA8A 1T5TA 3AJDA 4F8EA 5FHQA 2VP3A 3PUKA 2P9JA 3AESB 4EMTA 1BXRA 1UFOA 1WDLA 1WZNA 1XMSA 3ND6A 3KOZA 2WB2A 2VZLA 3O4RA 1T9CA 3PQ2A 4GMHA 2P1DA 4BQPA 2QUZA 3IDOA 1HFKA 1THZA 4WVLA 2YC4C 1FLAA 2GDJA 1KYQA 2VJQA 1PK9A 2C5GA 1ATZA 1PR4A 3E3LA 3S8MA 2XWQA 3C5WP 1TFUA 3JVDA 1I36A 3WQHA 2PRKA 3K96A 1Y34E 3I5AA 5KTOA 3ITKA 1VM6A 4KEAA 2QMZA 1OH8A 5B1SA 4RY2A 1Z16A 3LVFO 4WESA 5DXFA 5C7LO 3RS3A 4LTNA 3IILA 1BGVA 4OBEA 3AZQA 4XCQA 5CNJA 1ZVMA 4W6ZA 3FHJA 4KREA 4C3ZA 2Q3DA 1PO7A 3WGTA 4M0PA 1X9IA 1LBQA 2RBGA 4WL0A 4TV8A 1KQPA 3IP3A 1A8PA 1MIOA 2AJCA 4QXQA 1DV1A 4EPYA 1ZUNA 3SKYA 2IP2A 4JZYA 5BW4A 4AKTA 5LP6C 3WBKA 3V2HA 1QE5A 1M6NA 4C3OB 2VLBA 4A82A 1JAYA 4MUNA 2H4JA 2VQEB 1AUVA 3L8ZA 2QW0X 1E3JA 4CETA 2FF5A 3K6SA 4B6EA 4B3XA 1MX5A 1BEUB 3L5OA 1XCLA 3P9SA 4FE4A 1ZHOA 2ZM5A 2C7VA 2HXSA 1D0VA 5T8KC 2AJTA 2BGGA 3DR5A 5H80A 4Q34A 1HPLA 1XZAA 4PFJA 2XMGA 4BUJA 5IVPA 2Z5LA 4XPIA 3UC9A 2O9JA 2YXDA 3QKIA 2AMVA 5FL7A 3ZWMA 4CEIA 2NPIA 3ENZA 2OCAA 4PYIA 1E2JA 4QU0A 3WAKA 4LRWA 4DCSA 3N3BC 4WGGA 5U4XA 2J3IA 3QRWA 4R0VA 3VC7A 3M2PA 5GZ1A 4A03A 1IRXA 4Z9XA 3ZK9A 5AR1A 2X58A 3ETJA 4ODIA 3UWPA 1D6MA 1WVMA 4CDNA 2PKXA 3I0NA 3TNLA 5LYJA 3WISA 3FPHA 2C57A 2ECOA 4RCVA 5CT8A 2G9ZA 1XQYA 1B93A 4HLUA 2GD1O 2WW8A 3L43A 3SC3A 3N2YA 2CW5A 2PZKA 4D79A 1GHTA 2H92A 2C00A 3OLWA 1Z63A 2VEOA 4PRLA 2O3JA 2P62A 4NBUA 4ZTBA 1Y8AA 4ZAWA 1HT1E 2DFTA 1D9XA 2JFUA 1B6TA 3AEZA 1PD0A 1SC6A 4HWKA 4G1VA 4DUGD 1PL6A 2UYQA 3BMNA 3F5FA 3FRIA 1CP3A 1NC3A 4C2BA 2FPOA 3AKYA 2O54A 3BS4A 2UZIR 3VKFA 1JA0A 5BR4A 1YU6A 1LJLA 1WHSB 5JS7A 1JQAA 3G7NA 3PYLA 4UBLA 1CX9B 3DXZA 4MWEA 4AURA 3KJZA 1UBFA 4I6JA 1SXJD 2AWOA 3S29A 2G5CA 5EJ6A 3F0TA 4EUKA 2DERA 1SPBS 4FYWA 2VQSA 1HT3A 1RP1A 3LIIA 3P9QA 3R77A 4N03A 4O4LF 3SJZA 1L7XA 2Q8QA 4K1XA 4HB2A 3FRHA 3OJ0A 3PUYA 2OLJA 4I5DA 4IMRA 1ZUIA 2B5VA 3CB4A 5F2OA 3P9IA 4PN7A 2CVHA 2APJA 4PG8A 2HEGA 4JBGA 3IIMA 3Q2OA 4KIJA 1KKUA 4X6YA 4B2YA 1QR2A 1X19A 2FLWA 2Q1SA 3VR2D 5HQJA 1GR0A 2WTBA 1Z0UA 3AHDA 3DT8A 3KXKA 4HXGA 4RPKA 2MSKA 3GJSA 4N3BA 4XX1A 3EXAA 1KE1A 3RK4A 4MR9B 2AYYA 1BDMA 2YQZA 4DWOA 1P39A 2PO5A 4OXIA 5LYYA 1BROA 2RDMA 1X7ZA 2ZYTX 4L15A 4R7GA 2GPTA 5SY9A 2RI1A 2CLDX 2BKEA 1VKOA 1C7EA 3MWEB 5H9VA 3T1HB 1Y6JA 1RJ9B 3GA0A 2LRHA 3AERB 4H3VA 4J9VA 5CCEA 1QX4A 2EP8A 4I8IA 4D9GA 2HO5A 4G8CA 4F3CA 2CLMB 1JH9A 1OX4B 2VC2B 3IP7A 2LZ0A 3JZMA 3KHSA 4KI0A 2UVPA 4MWCA 4TQAA 5I3CA 3IH5A 4KVGA 4W1RA 2V7UA 2QX8A 4OYYA 4IJ6A 4F2PA 3H2YA 1XTJA 1IY2A 3TOVA 2W11A 3AHEA 3V4VB 4YPVA 5TC4A 4YAIA 2FSPA 2G5GX 3GLHE 4KOAA 2G0TA 4BWGA 4M7PA 1N5DA 1CZUA 4X1YB 5KTSA 3VNSA 1HDIA 5FLXA 5EMJA 4F4IA 4RKRA 4BJHB 1IPEA 2XRZA 1N2CB 3QWIA 1V7CA 3T7TA 3DCIA 3K9CA 1G6Q1 2IDKA 2GHRA 2ZYDA 3OAAD 1FVOA 2IRWA 1E5DA 3ZX5A 2IU3A 1SVSA 4Q24A 4GC5A 4U8GA 4R5HA 5JATA 3EEOA 1ZD5A 2BGWA 3R0JA 5M29A 3F4LA 2GA9A 1KL7A 3BL6A 4IFTA 5LMNB 2VWQA 3B20A 3K9HA 1NLUA 3R5SA 4I4TB 2GBLC 3E2MA 3LFHA 4L0DA 3U3RA 1JT2A 4G1EB 5DVZA 2ZSUA 5KOIA 3FA2A 3T1TA 2P77A 4MKFA 1Z5ZA 4QPJC 4ZVNA 4ND4A 3ZWOA 1ISHA 2RGXA 1JLMA 1LBSA 3FGPA 4PLZA 1CSEE 4A0RA 4ANFA 3FTQA 2YWEA 5LOVA 4BB5A 3P19A 4M8SA 5KNBH 5FUVA 3AW9A 3MGKA 2JLQA 2AMLA 1F48A 4IUCS 3SN6A 2DOKA 3IBGA 2RARA 1E6EA 4OPMA 4YH1A 1YZNA 2PBLA 1FXSA 2FI1A 2R6ZA 5JY6A 3DCJA 4B76A 4QM6A 4GLBA 1R4MB 3L06A 1Z8NA 1J23A 2IEYA 3ABZA 2Q27A 3MBKA 4KZPA 2GM9A 4ABYA 5A9SA 3PE6A 1E2QA 1RXIA 3H9EO 2I9PA 4MSUA 1R0KA 4CBVA 5IC6A 2ZBVA 4JS0A 1YZ3A 2I3DA 1CERA 1ZJZA 1VMIA 5BRAA 1Z5PA 5LA6F 3PWTA 1M2KA 2D06A 3EA5A 5AJUA 1X2BA 2C7GA 4EW6A 1QP7A 1AS0A 1Y3CE 1ZJ6A 2QLNA 3IAM1 4GPIB 4IX1A 4KO3S </