3RJZA

X-ray crystal structure of the putative n-type atp pyrophosphatase from pyrococcus furiosus, the northeast structural genomics target pfr23
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
229
structure length
210
Chain Sequence
GLADVAVLYSGGKDSNYALYWAIKNRFSVKFLVTMVSETINANLTDLQARALGIPLVKGFTEVEDLKRVLSGLKIQGIVAGSKYQRKRIEKVAKELGLEVYTPAWGRDAKEYMRELLNLGFKIMVVGVSAYGLDESWLGRILDESALEELITLNEKYKVHVAGEGGEFETFVLDMPLFKYKIVVDKAKKVPCTSSGKLIIEEAHLESKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-type ATP pyrophosphatase superfamily
publication title A large conformational change in the putative ATP pyrophosphatase PF0828 induced by ATP binding.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 54
structure length 210
sequence length 229
ec nomenclature
pdb deposition date 2011-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01902 Diphthami_syn_2 Diphthamide synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3rjzA01
3.90.1490.10 Alpha Beta Alpha-Beta Complex putative n-type atp pyrophosphatase, domain 2 putative n-type atp pyrophosphatase, domain 2 3rjzA02
1F7UA 5K0TA 1NSYA 3CLUD 4ZCQA 1YIDA 4A91A 4JXXA 4QRDA 4EFKA 3MLAA 1X6VA 2GKSA 3ZXIA 1NP7A 1NUPA 2TS1A 4MLPA 1F4LA 3SYTA 4DDMA 4ZCTA 4G5YA 1B6TA 1UFVA 3X1JA 3Q12A 1KKUA 1WQ4A 1EE1A 1YI8A 3CVVA 3IVGA 2B7LA 4EG8A 1NUSA 3MMXA 2JAXA 1TYBE 2A86A 4NX2A 1G8GA 2A84A 3UY4A 1MB2A 1OWPA 2G36A 5F23A 4XSVA 3AL0C 4MUGA 2PXHA 3RJZA 4RPIA 1M1ZA 1TYAE 4NAUA 1N1DA 2GM3A 5TEVA 5LLTA 4J75A 1I6MA 1TYDE 3ELBA 1OWLA 4MWBA 1H3NA 1N2BA 3AG5A 4E1AA 2IP1A 1R6TA 4PBRA 4DDHA 2Z3VA 3QTBA 4PBTA 3SDBA 1WY5A 3PNYA 2XRYA 1M8JA 1GTSA 1EUYA 3ILVA 4ZCPA 1GTRA 1N77A 3H99A 2RE8A 1YIAA 2PG3A 3KT8A 1O97D 1NZJA 2CV2A 4U63A 1M8GA 3G6KA 4ZT6A 5KCMA 2PIDA 2A7XA 1O6BA 2A4MA 4YP6A 3FY4A 1F9AA 3SZ3A 4ARCA 5TGTA 3K32A 3P0JA 4L2IA 3Q10A 1NUTA 3IVXA 1IQUA 2HZ7A 4FZJA 4HPWA 2DXIA 2V0GA 1M83A 4XFJA 5TS2A 3FDXA 4KPUB 4ND6A 2VTBB 3CVYA 1PG0A 1N2HA 5IHXA 3IMCA 4GU5A 4PBSA 1JECA 4HJRA 1N2OA 3IOBA 2OQ2A 3N05A 1M8FA 3H9BA 1O95C 4I6EA 4TS1A 1XJQA 3FG9A 3FIUA 3DPIA 3DV2A 1WXFA 2CUZA 2DEUA 3CLSD 1KAQA 3BL5A 3IUEA 3LCJA 3Q4GA 1IQRA 4NDAA 1U3CA 3I05A 3PXUA 1RQGA 1WZ2A 2X0KA 3IUBA 5FNZA 3ISJA 5EKDA 4JFAA 1KORA 2YXNA 2J4DA 3IODA 1PFWA 3G5AA 4ZCRA 1XNGA 4KKVA 3RK0A 3ZJUA 1PG2A 1O94D 3FI0A 1VBKA 3TQOA 3UK2A 2VXOA 2CV0A 1JIIA 1G8FA 2EL7A 4U7JA 3UOWA 1KP3A 4NZPA 1MRZA 3MXTA 3RHSA 2CFOA 2ZUEA 2A1TR 3ND5A 1MAUA 3HGMA 3HZRA 3U1VA 1D2RA 4H3SA 1EXDA 3N9IA 1U7XA 2PZ8A 1OWNA 1N2EA 3ZIUA 1LI5A 1NURA 1T6XA 1KQPA 2QJTA 3H97A 1WXHA 1JZSA 3COYA 3SZGA 2E18A 2QJFA 4MVWA 1JEDA 5LM3A 4MQ6A 1ZUNA 3TS1A 2A88A 4QREA 3CLRC 1Q15A 4YBRA 1KAMA 2C5SA 4JXZA 2DLCX 1WXEA 4EG5A 4JYZA 2WSIA 1O96A 1Y42X 4UZFA 3AIIA 4DLPA 4G5FA 3C8ZA 2ZP1A 5JBNA 2EJCA 2E0IA 1QU2A 1I6LA 1GLNA 4EG7A 2WB2A 2XRZA 3LE8A 2CSXA 4KR7A 1CT9A 2D13A 3RK1A 1R6XA 3GLVA 2BYTA 1OWOA 3CLTC 1WOYA 3VGJA 4MUIA 4MWDA 4KR6A 5KHAA 1KQOA 1YUMA 2QJOA 4KR9A 1T9GR 1A8HA 3AKZA 2WQ7A 3MLBA 1T6YA 3HV0A 5BNZA 5DK4A 1EUQA 5AHWA 4CT0A 1M8PA 1BS2A 1KQNA 4ARIA 2X1MA 2NZ2A 3OTWA 1WKBA 3G59A 4L2IB 4Q93A 1O95D 3CLUC 2X1LA 3P52A 3RBAA 2CV1A 4GRIA 4MVXA 3S3TA 1U7DA 1ZH0A 3HL4A 3L93A 1WQ3A 3IOEA 3ND6A 1J20A 3GMIA 4F4HA 3A4IA 1IFXA 4PY2A 3A05A 2YWCA 3UMVA 2PZAA 3P0HA 2CYAA 3PRHA 2QTMA 3TQIA 2JA2A 1MBZA 3GUZA 3HMQA 4I6JA 5KWVA 1X8XA 2HGZA 3CVUA 1H3FA 4K03A 4MW2A 3UC5A 5TEWA 3ZUGA 3COWA 4OUDA 1T6ZA 2A1UA 4MUEA 5K0SA 1VLHA 3CR8A 2YWBA 4YMIA 1EFPA 3X1MA 2J07A 4WSOA 1OBCA 1QJCA 2QTRA 2AZXA 4MW6A 1JZQA 3COZA 2PFSA 4ZT4A 2DR2A 4EGAA 2OV4A 1OBHA 2V0CA 1JGTA 1N2GA 4AQ7A 4DJAA 1ZJWA 3INNA 1TQ8A 2H29A 1DNPA 1GZUA 5H7XA 1J1UA 1GAXA 2NSYA 2QUJA 5DB4A 3H05A 4HJXA 2DUMA 1LI7A 3IOCA 1LW7A 1O97C 4ZT2A 1QNFA 1Q11A 3FOCA 4WNYA 1J09A 4NAHA 2O5RA 1H3EA 1V8FA 4R2MA 2ZUFA 1XNJA 3E27A 3FWKA 3JXEA 2YY5A 3IH5A 1N3LA 1PFYA 1TFUA 2Z09A 3SP1A 4G6ZA 2I1LA 3KT0A 4R0NA 4EG1A 3H9CA 3P0IA 3PNVA 3CVWA 3LOQA 3SEZA 1PFUA 2J5BA 3KT6A 1JIKA 1Q77A 5FO0A 4DNXA 1PFVA 1IRXA 1O96B 1GPMA 1OD6A 1QRUA 1MAWA 4MW5A 1TEZA 1KH1A 1SURA 3ZXSA 2DETA 4MULA 2A1TS 1G8HA 1VL2A 3COVA 1KH3A 4YP7A 4P2BA 1M8KA 4MAFA 3AFHA 2R5WA 4MW4A 1N2IA 3TZEA 1JILA 1Q19A 1IHOA 2QUIA 3NV7A 3CLSC 1COZA 1MJHA 3FH0A 1R6UA 2J08A 5HG0A 1MC1A 4AS1A 4MUKA 4CQNA 2AKEA 1KR2A 5J5AA 1QTQA 3PNBA 2O8VA 2H2AA 1H1TA 3A04A 1EFVA 1S4MA 2PZBA 3IDFA 4MWCA 1U0BB 4XFDA 4MW7A 4CDNA 3QE4A 4NATA 3KT3A 2J09A 1QRTA 5J58A 3NBAA 2HMAA 1O94C 4HK4A 2BTEA 3SEQA 2CT8A 5DASA 4MW1A 2JANA 2DPLA 3HFJA 3M5WA 2QTNA 4ZT5A 1KH2A 2E21A 5LFAA 3N8HA 4EG3A 4ZCSA 3D6VA 1NI5A 1JMVA 1IQ0A 4ZT7A 2D5BA 5HUJA 3L92A 1IH8A 3RFFA 2X3FA 1J21A 3ZGZA 1MOPA 3OP1A 1JEEA 4S1OA 3ND7A 1WXGA 1T9GS 1QU3A 1N75A 2IJGX 4DDKA 1QRSA 1FYDA 4OUDB 2A1UB 2CYBA 3CA8A 3VU8A 1O5TA 3DO8A 4MVCA 1EFPB 3QTTA 3DLAA 4YP5A 2QUHA 4MUFA 1OWMA 3FETA 4DE5A 3IMGA 2GOYA 3D6UA 1FFYA 1U3DA 3IMEA 4F3RA 4K0RA 3X1KA 1EJ2A 4QBTA 1O0CA 2D54A 1GN8A 5HUHA 1TYCA 1ZH6A 4MUNA 3A2KA 1YULA 3TZLA 3N2YA 5IJXA 1ULHA 3F3MA 4UZEA 4CDMA 3ZJTA 4X0EA 1YUNA 1VBMA 1QQTA 4JZYA 5J59A 1ILEA 4EF6A 1NUUA 1G59A 2RD2A 1KP2A 4ND7A 1XNHA 3CLRD 3FNRA 4ZT3A 4J76A 4Q16A 4U8HA 4KPUA 2VTBA 1MB9A 1J1ZA 3IVCA 1K92A 4MUHA 1K4MA 4OJMX 1JHDA 2QUKA 2WQ6A 3ZJVA 1WXIA 2DERA 1HYBA 1N2JA 2AG6A 3CVXA 1I2DA 1P7PA 2CYCA 3NBKA 1NYLA 4MUJA 4BWVA 1I6KA 4EG4A 1F7VA 1V47A 1WJGA 4MW0A 4EG6A 1IVSA 1NUQA 3VRHA 4MWEA 3K9WA 2IELA 1VBNA 3CLTD 1K97A 3FHJA 5FO1A 1J70A 1K4KA 1JIJA 4I6GA 5DEOA 3KFLA 4MW9A 5H16A 2E89A 1N78A 3AG6A 4MVYA 1EFVB 4RUKA 2Z08A 1O0BA 4R2LA 3TNJA 3MUEA
chains in the Genus database with same CATH superfamily
5LSAA 2JZOA 1KMHB 5ITZB 3I5AA 3IT0A 1SN7A 4NAVA 1Z7EA 3AUFA 3FKSA 1U98A 3VO9A 4G0VA 4WZAA 4EFKA 2FUCA 2IIQA 2BM1A 3K2IA 1OXVA 2HK9A 4OGWA 1RXWA 3DOIA 4DMRA 2W6MA 1E0DA 4V3BA 3TMKA 2XWJI 5LDDC 5KHLB 2W48A 4DLZA 3T1YB 4MSUA 1ESMA 2DUJA 2DP4E 2ZKLA 1UFRA 2QX6A 4CKBB 1M33A 4KLAA 1YI8A 2BIFA 1CUSA 1JV2B 1W4AA 2FVXA 4K9DA 1CETA 2GM9A 4OSPA 3GRPA 3IOMA 4CKXA 2HU5A 2RH5A 2V7TA 5ARBA 1ZMXA 2Y1WA 4PAMA 3VV2A 1TC1A 5ABPA 3V7WA 4PZAA 3U7GA 3GQBB 3UJ3X 3EVEA 1M7GA 3ZI7A 3I5XA 3VA7A 4MUGA 1C1DB 2CXOA 3MWLA 5JH7F 1Y80A 2QP4A 4B87A 4B75A 5JI3E 4YO8A 1KERA 1N6HA 3H17A 2QRHA 4EY5A 1VL6A 3L7LA 5M7EA 3H2SA 2E5FA 4BEBA 2WM2A 4H1HA 1G7TA 3B2EA 2QHXA 4MA0A 2DQYA 1E0JA 5GJWC 4MCJA 1H3NA 1OBOA 1N2BA 2FSVC 1VGVA 3NNDA 4MYCA 1ZW1A 4XGIA 5KQRA 4ZU3A 3EC7A 3TOSA 1Z4MA 1Z45A 1K4YA 5JC8A 3WDSA 1LK0A 2OYSA 3ESCA 1B8PA 1KIAA 2O7NA 4BVFA 1BU5A 4O59O 1KYIA 4BUCA 4BP8A 2CKMA 1QE0A 5K8JB 1GTSA 1QH9A 2JHGA 5HDQA 3RJ9A 3Q7PA 3VOSA 4Z4IA 3K8QA 3RB8A 3LF1A 3IQWA 4LPSA 1GZHB 1ISHA 1EFRD 1YDEA 3IR7A 3TIFA 2I71A 2IYQA 2OLEA 1SIUA 1B16A 2WVHA 3O2JA 2XV1A 3G6KA 2GFHA 2R48A 3BMNB 4G67A 4LKOA 1S1MA 4PICA 2BGGA 4QC2A 3A3KA 4I4TA 4HNAB 2YJ4A 5LQCA 4M8LA 5I9MA 5IM4A 1JXOA 2ZPTX 2RAPA 3CSSA 3HVHA 2Z2IA 2C2WA 5J2UB 2PGOA 3HU3A 4IP0A 2WW8A 3VR5A 2BFEB 2PMEA 5AP9A 3X1DA 4EVRA 3EGCA 4EH1A 3R7AA 4POOA 1B6GA 1OLUA 4HPWA 4R6WA 3DTNA 1CUHA 3QW4B 3FHOA 4JHLA 4KPUB 2IPAB 1UANA 2I2WA 3L8YA 4XFJA 3RYIB 1LTQA 4A0FA 3ZVKA 4DLVA 2WF8A 2BW0A 4LYJA 4XIYA 3AXTA 3HXOA 1TQ6A 3QNWA 3QVUA 3WISA 1AMUA 1J8DA 1UKEA 4UEOA 3IOBA 3GAMA 3VH3A 4HQRA 1D2NA 1UPFA 1H2BA 1Q44A 4PZ9A 3WWDA 1AKQA 1EUCA 1QE5A 5JT1A 1WSWA 3CKYA 1DCMA 1K7FB 4UARA 2R6FA 2C3OA 1ICIA 3NASA 1NVVQ 5A71A 4EO7A 2AE1A 3QFCA 1Z25A 1WXFA 5E9JA 3T94A 2JLVA 3W6UA 1KAQA 2RHJA 5ALLA 4ZFNA 3LCJA 4AXBA 3IUJA 4FMBB 4KK3A 2HV9A 1IG3A 1KI6A 1O77A 1POWA 4Q9IA 5DWVA 3B48A 3TPCA 5JQWA 1E9CA 3PTZA 2XTAA 3ZCSA 3VR4H 4EVSA 4UBJA 1NX9A 2XMQA 3OZ7A 2NU6B 4P3XA 2ZS7A 3L46A 5EKDA 4ZU6X 2LCIA 1WF6A 2FPGB 1YB5A 3CB4A 4RACA 1KORA 4KX3A 3E8MA 2XODA 4EYSA 5ALVA 1YL6A 1G1AA 3HYLA 1KQFA 2YJGA 4W5NA 1II0A 4ZCRA 1Z6ZA 5FUYA 1VBKA 2G0NA 2WDPA 9LDBA 3UK2A 1QHNA 4EITA 4V2IA 4J4BA 2X58A 2C9BA 2ZWVA 3LNTA 2PRYA 3DTVA 5F7JA 2Z04A 4RQAA 1WG8A 1XPJA 4BHTA 3NHZA 3H2BA 4GI3A 2X42A 3RSLA 1KSFX 2Q3DA 1GAQA 1HL7A 3WO1A 721PA 5HWSA 1E5VA 4HEHA 1D2EA 1XZKA 2OHIA 3FBWA 2WKPA 3QHPA 1SG0A 4LQ4A 1FJXA 2QA5A 4MO9A 5DGTA 1A1SA 1RJDA 3RHFA 3CWZA 3FAKA 3P5BA 4GR9A 3DVLA 4PXAA 1TI7A 2O2HA 3W34A 4FONA 2O1XA 5LBTA 1NL3A 3UOAB 2OHHA 1JS1X 4B6JA 1S89A 4FEAA 3OLZA 3EQ8A 4IVNA 1HDEA 1SVMA 2WJJA 3WLNA 2X0EA 2CLCX 1IU9A 2F1RA 5EUBA 4D9KA 1NYTA 4JLDA 1CZLA 4WXRA 2H8GA 5EXPA 1UM9A 1BE0A 4S1NA 5TPWB 5DU2A 4Z4CA 2ZWMA 4ZTUB 3TOZA 1KYTA 1PBTA 2PAAA 5BSHA 2G1JA 3GCZA 4JP8A 2CZGA 3NTQA 1IULA 4CCYB 5AJVB 4OHCA 3AF3A 4DXDA 1QX3A 5CDYA 3U31A 1KK3A 2AB0A 1TZMA 5DYYA 4I3GA 2Z6VA 3CF6R 3AR2A 2YS6A 4MK4A 4W6QA 3AVWA 3C8ZA 2B78A 2WWHA 4RGYA 2C54A 4KOEC 5IFKA 5ILGA 1P2GA 4WBSA 7REQA 5FWXB 3VZBA 3C3MA 4KR7A 3RKSA 1R6XA 2G06A 1UPCA 2WHRA 5JS2A 2FMIA 5HPYB 2FDRA 2GKGA 1VOTA 3IX7A 4EHJA 3VU3A 1H6CA 1PJSA 2ZJ4A 4WA8A 1XTPA 3STYA 3RYHB 1Y9JA 4HL6A 1AK1A 4O33A 5AOVA 4KXUA 3KV1A 2WQ7A 1AF7A 1JHRA 3N7TA 4D42A 5EWLB 3G88A 1BOOA 5DNEA 4IDGA 2VHJA 1ISSA 1ZGCA 2OQRA 3JASA 1CQIA 1J1IA 2PZJA 3GJ7A 4M9XA 1BS2A 2GWRA 5C7OO 3EQ6A 3CRMA 2GJAA 1DIRA 2VSFA 4G84A 4QWMA 2FWAA 2KS6A 2IYRA 3D2AA 3PB3A 1M75A 1ACLA 2HLHA 2F3RA 3R3VA 2XMBA 4KAAA 3LUGA 1FDTA 1SVWA 3KAQA 3FOEC 4W5OA 1S2IA 4BLOA 4NXNB 5J2TF 2BGRA 1XEXA 2PZMA 5TGZA 2ZGVA 1GNLA 2PU7A 2XITA 3A9VA 3F6SA 4KU4A 2O2CA 5IK2A 3BZUA 3Q0EA 5FLYA 2IKQA 2QW1A 3IL2A 3MHTA 1L5HB 2LDBA 3C4VA 3V7FA 2IHNA 2EX1A 3LL4A 2C8LA 2ZUUA 1WZIA 3N2ZB 3QOXA 2B3TA 3IBSA 3WGLA 4W4TA 2FHSA 2RHWA 1XQVA 3HCBA 5CNKA 4RK4A 2JNWA 1A8UA 1WLYA 4WBNF 2SKCA 2Z30A 3RYCA 2OZVA 3CUSA 4KVZA 5DTMA 5CFOA 4XM1A 1AOXA 2BEVB 3AUYA 1VB3A 4BTVA 5LLDA 5AOCA 4IWXA 2W4QA 1D9ZA 3A4TA 4IYRA 2QVLA 4PIMA 1DAHA 4HNQA 4GWKA 4MUEA 4YMHA 3RWBA 5LA6F 5KJEA 3E9RA 4BQNA 4BQRA 5I7AA 4DIBA 4HRXA 3SZRA 1NASA 2MR6A 2IITA 2P4UA 2VA8A 4MJ3A 4MV5A 1GGNA 1OT3A 5GPBA 4F72A 1Y82A 2FPOA 4O0MA 5KSOA 3HNOA 1OH8A 4OV6B 3WGVA 1ID8A 3OT1A 3QY9A 3M6IA 1CR4A 4JI8B 2LW7A 3UMMA 2YOFA 3NEJA 2W6OA 5HZGA 3KBOA 4OJKA 3PC8C 4TZTA 4TXHA 2FWRA 3LS2A 5ETJA 2XE7A 2NM0A 3G1TA 1TQ8A 2FN7A 2VF5X 3LHFA 3EIUA 4GM4A 1AB5A 4O2RA 4ZDKA 2EW8A 3IIIA 3FNQA 3FFBA 4KSCA 4ZTBA 4P4NA 4TVBA 2P79A 4O4HA 2NU9B 4HQ6A 3TX6A 3UICA 3F9CA 2JAQA 4JI6B 2HLDD 1LLQA 4YFVA 4C22A 4U9UA 4EGSA 3WKCA 3ZLJA 5CCXA 3NFRA 2R8OA 5LQJA 2EX0A 2PNJA 4W7SA 1HDGO 3JVEA 5I9IA 1IE3A 1FF9A 1FZQA 2XSZA 3B8EA 1EWRA 3HABA 4Y1RB 5FUWA 3HKDA 4EARA 1RABA 3OKFA 3DAYA 3TZQA 4FMCB 1RT9A 4C07A 2MMCA 5IM5A 4C78A 2VH5R 3AYXB 4EG1A 3CVWA 2ASVA 1VG9B 2C83A 1CUZA 1H0HA 3SJAA 2R7AA 4E3WA 4CR7A 3HUFA 2P90A 3F74A 1BHQ1 1NFRA 2FPMA 2LIVA 2OGWA 3E70C 3AVPA 3TW0A 1IQPA 2JB9A 2WT9A 3U4IA 4CMEA 4LIPD 2R7KA 5DTRA 5JRDS 1GTL1 1T36B 4LC9A 4M0CA 5HJEA 4GO1A 4P3KA 1J2EA 1HSZA 4XJTA 1YB2A 3DEFA 1HYHA 2BSXA 1JR3E 4N7RA 1E32A 4QOSA 1FVOA 1G8HA 1SUPA 3ETCA 3KKOA 3KDAA 3OCUA 4PHFA 5KVQA 5LIPA 4YCNA 4MB2A 2JKYA 1MW9X 2NLOA 3NT2A 1SBTA 4D9IA 5BN5B 2FZVA 2ZRCA 1Q7GA 2IS2A 3FH0A 1NKSA 1T0BA 1NLYA 3ZGYA 2ATVA 4BS9A 1AKWA 2XT6A 4Q9HA 1OTXA 4OU5A 2X0JA 4Q3KA 3WL3A 1Z7BA 3K8YA 1QVWA 2EV9A 2Z4TA 3O8OB 3PNBA 1CX9B 4JITA 3N6XA 2I3AA 1JR3D 1S4MA 4M49A 2RGUA 5AKEA 3T34A 1YCDA 4MIYA 2H18A 5E2IA 4MTLA 3R3JA 2RHLA 3B1XA 3OQIA 1QTIA 3UUFA 2OK8A 3EXG1 4MICA 1KJ9A 5CNMA 4XLTA 3VNBA 3BUSA 3D7RA 4PVCA 5FBVB 1PQYA 8OHMA 4AO6A 2FUNB 1G7RA 1XK7A 1VFPA 2JANA 1LKZA 4S12A 2PGAA 1AMOA 1P33A 4DIEA 1H5QA 4K9QA 3FKSD 3R41A 1XD8A 2HSWA 2QQEA 2ZDQA 5EESA 2R11A 4NJMA 3PNPA 1N92A 3NCHA 5C0OE 2WNIA 1E6WA 1CPYA 2J33A 1E2JA 2GO1A 4P58A 3D4IA 1SQSA 1QGAA 2DMRA 3CNOA 1XFAA 1V1MA 3O6VA 1E5XA 4MLDA 4MQBA 3LPMA 3L0BA 1Z38A 2JZCA 4HEA1 3T7CA 4D6YA 2VS1A 2RGXA 2WD7A 2KW5A 2XWBF 1GGHA 2IZ6A 3CVYA 2UUCB 1T6BY 3UAYA 2CW5A 1JAZA 5K0GA 3EZNA 3ELYA 1EMDA 3H4TA 5B6IA 3GA5A 2Z5GA 4O2LA 1CQJB 5LR6A 1RYNA 3EEQA 4ZQHA 3B1KA 2YFKA 4ER3A 1XZBA 4DMFA 2A1UB 3QF4A 1MNQA 3UFXA 5LZ9A 3FNGA 1P2VA 1E66A 5EE3A 4D0GA 2VPQA 2X9QA 5IUJC 2NXWA 1DUIA 2WVAA 3USES 1FXSA 4AIRA 3C5HA 4BO6A 3RFUA 1OH6A 5ADHA 1XEWX 1DAPA 4MUFA 5CB4A 1IBLB 1K89A 3WGTA 1CE8B 5JLAA 1FSSA 3G5MA 1V1RB 4TVOA 1GSOA 1G8PA 1GN9A 1JR2A 2A94A 1NX6A 1FMTA 3OE7A 1CUVA 5F51A 4QBTA 2OYCA 2VNJA 1IWOA 3GJ5A 1LI4A 4UUAA 4S1PA 1USVA 1N34B 1BCSA 1JG2A 1K5PA 3MOSA 2PD3A 3MSXA 5EXXA 4GX0A 4PVDA 1P5HA 3SNHA 3N2YA 1V43A 4MXDA 1DAOA 5TQVA 2GERA 3PDIA 2WM8A 2V4UA 3U2QA 3HMKA 4LBZA 3ZYCA 5IVDA 2VAPA 4FILA 3TLMA 1MA3A 4J0CA 4RTJA 3NDIA 1Z35A 3A1UA 4I9NA 1CZKA 2I78A 4PYIA 2CD9A 2QZZA 4HSGA 3SF8B 1JNYA 3D64A 1EH5A 1KP2A 1NG9A 4JUIA 3WFZA 4ALJA 1E3JA 3EYWA 5H81A 1IOZA 3PJDA 3F7NA 5FFNA 1ULSA 4QGHA 3GGPA 4TWIA 2OV3A 3VR5D 5DV9A 2FQXA 2J6IA 1MB9A 2PXXA 3D3KA 1J1ZA 5HF6A 3M81A 2J4FA 4ROSA 2V74B 4EDHA 1BQ3A 5JISA 5G53C 3DT9A 3S29A 5KWIA 4MQEA 4I99A 4DV0B 1E9DA 1JHDA 3T1HB 3EHDA 2PRJA 1QF6A 4IGKA 1DTWB 3ET4A 1GYPA 3OJXA 1W4CA 1EDOA 4IF6A 3NRJA 1CUCA 3D4PA 3T5PA 1WJGA 4V3CA 4Z7QB 4Y9TA 4BCDA 1A5BB 3N87A 5AM2A 1U2ZA 1C0IA 3IP1A 1DKOA 2IELA 821PA 1NMYA 1U8EA 5FPHA 2EHDA 1E20A 5K3EA 5INTA 3KQLA 4LFCB 3GPBA 3MAJA 2YUIA 4REQA 3I34X 3T7RA 1Q74A 1VZ3A 4DV4B 3IPAA 3AESB 4G1UC 3W8DA 1O6GA 5GMOA 3I8OA 3TGWA 4HMQA 3VVMA 1RLTA 4OI1A 4DC0A 1N78A 4GLFA 1VBFA 4P82A 1T2FA 2P6UA 4RF2A 1XNRB 2RKBA 1JIUA 1NW5A 5FV4A 1OYYA 2PLFA 1NE2A 2I6XA 4E5DA 2H59A 5JMOA 3EA5A 3P9QA 2A1IA 4BNIA 4QUGA 3FPGA 1OFUX 1RKXA 2D7JA 4B6PA 4BBJA 2PWPA 3GYBA 3TMAA 2WG0A 2G9QA 1NW7A 3UUWA 1XCMA 1QYWA 2QTHA 3BIOA 3DTVD 2OAQ1 3LDUA 3NWEA 4KK4A 4WKGA 5B2ZA 3OICA 4JN6B 4TLBA 5JEEA 4JLWA 1ZH4A 1E3SA 2C5GA 3P9NA 3TSZA 1UOEA 1JHZA 1ZN2A 3AGPA 3D3JA 3PKJA 1ZOOA 4M38A 5H68A 1CY6A 2X4GA 3H9GA 1R0RE 4JVLA 2ZJ1A 2ZSUA 4TMYA 4B4UA 4AQDA 3R5JA 2I3DA 3B85A 5LMNB 4YRAA 1ZY2A 5E4FA 5FLKA 1XHEA 2QKYA 5I9NA 1IHXA 2G67A 3NHBA 4CKWA 2F90A 5BN3A 3ZDRA 3L01A 4KR0A 2EZ8A 5A62A 4Q3AA 4HNUA 4L7QA 2VJMB 1Y3HA 3HGQA 2QN9A 2B37A 3NHYA 3NX4A 5GVRA 4BO0A 4RSRA 4N49A 2GRJA 2JHCA 4ND2A 5HFAA 4ZIRA 5A6SA 4H6PA 5B55A 6PFKA 4W5TA 1ZNQO 1OILA 1Y6JA 4XXHA 3MJDA 1HX7A 4GWGA 4JK3A 1TQ4A 4I50B 3PHGA 4ZMBA 3AB3A 3VDNB 5HZKA 4XX0A 3IDSA 3NQ41 3FZQA 1U0OC 3MPUA 4H4CA 1ISIA 1XD2A 4PNPA 4ETMA 5A02A 2J3KA 2EKBA 4M21A 2NAPA 1I5RA 4TMTA 2ZXUA 4Q01A 4JLJA 2PX8A 4E46A 1L5MA 3KUUA 3PQ2A 4E88A 5ESXA 1L4HA 2CMKA 2QTAA 4G5OA 4V2UA 1AKVA 3QU4A 1P1HA 1W49A 3ND8A 3F5MA 4LHEA 3V97A 1X1SA 3HJBA 1PEDA 1R9GA 3NRBA 2ADOA 2ZKIA 5ANRB 5EJGA 2EBHX 3UIEA 3W7AA 3P0JA 2BZ0A 1NVUQ 2IU0A 4C0QC 3AC0A 3ID6C 4W6ZA 3J81k 4Q4JA 1K2WA 4E2XA 4JGGA 2PD6A 3FNIA 3QKSB 1NSFA 3P8ZA 2D1SA 3CH5A 3I12A 3HNRA 4JC8A 4N7JA 5C8YA 1ARZA 2Y2UA 4MJ7A 2HDOA 5GONA 3HXQA 3ZPXA 3HKCB 3BFPA 1QK5A 2XQJA 4FHDA 2HNKA 3ZNPA 3IIMA 2GZSA 3B78A 4ONEA 3RC3A 4ZANA 3FRIA 1I80A 2BEJA 2JK0A 4IMIB 4AZ3A 4BASA 1XZNA 3D4LA 1X15A 4O25A 2OQ2A 1SHTX 4N47A 5EUQB 5IK2D 1S7CA 1M1NB 3WV4A 4JZKA 2X8JA 3ORFA 3H9BA 3E7FA 1W5TA 2PSDA 3KPVA 3LT1A 4YO7A 3MBIA 3QIAA 4BX0A 1ZLYA 3NR2A 3DEYX 1H2ZA 2VC2B 3OCVA 2GPTA 1WXDA 3QELB 1EE2A 1THMA 4NH0A 2FPIB 5KNBH 1E4EA 3W8FA 1KDRA 4MKHA 3I72A 5I7FA 2NVBA 4F86A 5JARA 3WZLA 4OK6A 3LX6A 1LDEA 5DT2A 3ZGNA 3ZV5A 3PXUA 4INJA 2ZIFA 4H1VA 4R7ZA 3K0BA 1T2VA 2GN4A 4N3NA 3CT6A 5JNLA 5A1TA 2A0KA 3A1VA 4Q3OA 5GINE 1E9RA 2XMCA 2ZI9A 3C6XA 2D2EA 3R1IA 4UBKA 3LDHA 3VPSA 3JR7A 1X92A 1HNZB 3PGLA 1HMYA 4WA7A 5DX0A 3L1JA 3WR5A 1J8YF 2A5LA 2QRVB 2YZNA 3U0VA 1NPTO 1PVVA 2XNJA 3WGNA 5MN5A 3K71B 3ESYA 3VO1A 3LUPA 1HM5A 1CRQA 4V0ME 5FOVA 1FSPA 2O8FA 4QBGB 1UXGA 4IEFB 4TT3A 3KTAB 3RHSA 3I0NA 5B4VA 2BUBA 4RZQA 3ZH9B 3II6X 2Z58A 2AYYA 1LH0A 1E3IA 5EEGA 5ALMA 3OCYA 2OFXA 1HOTA 1U7WA 3B52X 1PL0A 3FW1A 3HUTA 4HMOA 3JZDA 4MB0A 1EX1A 2PKWA 4O3FA 5GOZA 5AW2A 1IWBB 2PZ8A 1GT6A 1GEEA 1LI5A 3I39X 1UQRA 4F9EA 2ZQ5A 1K6EA 2I4TA 2QTZA 4M83A 2JJ2D 5BT9A 1T2DA 2ZSKA 2BGWA 5H9VA 3EXIA 3VR0A 4OXQA 5LM3A 3TW6A 1UBMS 1AGYA 1QDEA 2AXQA 4L3OA 1C8BA 1LPPA 1TFRA 1TKAA 4HFNA 1YRLA 4BFSA 3ZY4A 4TLAA 4DA7A 2XSZD 2IUEA 4YRSA 2X13A 5JMTA 2H5IA 2C5SA 3H1PA 4ZVUA 4MV8A 1CY1A 3K6KA 2FEMA 4QHTA 3GQVA 4RVHA 5CT9A 4GKJB 4A2WA 2YBEA 3FCUB 1AO3A 3BWCA 1PUXA 4C3VA 4EATA 3GVIA 4G5FA 1MA0A 4UUQA 5LC1A 1W7AA 4LI0A 2EJCA 1ORTA 3NOXA 1GV0A 4GHWA 4ZXFA 1GLNA 1XXHA 2C5AA 2UKDA 2XPCA 3PITA 4ZZ2A 5CDFA 4DHWA 3CCCA 3OPQA 3TSOA 3PC4A 9ABPA 5K8TA 1SUCA 4UTXA 3CMCO 1MX3A 1OA1A 1J97A 1CU1A 2JFUA 2VQ3A 3G6WA 3LCVB 3PQ5A 4KUEA 4Y2VA 5K6TA 2ZRKA 2VK4A 3IHWA 1E3WA 4BNHA 2X2FA 4AS2A 2EP5A 3QJYA 2HYIC 1WMFA 4CLHA 1RAEA 4KR9A 4D3ZA 3VC1A 1T9GR 2DFNA 1G8SA 2RK4A 1ULZA 3BA6A 4PGMA 3KWFA 1IY9A 4RHYA 3ICPA 5JVDF 2XADA 2VHCA 1KQNA 2IYFA 1X39A 4TRMA 4HGOA 2ACVA 2WFAA 2IS4A 4L74A 4ZQEA 4IIJA 2YINC 3G8AA 1A77A 2YWJA 3ULKA 5FI3A 1BS1A 5EJ6A 2GFQA 2V7UA 1G3RA 3O84A 3ZW8A 4NHEA 1KJJA 5KYXA 5I9SA 1NAHA 3IOEA 1T3TA 4E7OA 1ZGGA 1D2CA 1XLUA 2AD1A 3PQDA 3NWJA 3DNMA 1W4RA 1KFEB 1XD9A 2JFYA 1VHQA 3DONA 3P2YA 3K4HA 3P2OA 3R0VA 3P0HA 5L40A 2CYAA 4CM4A 4DR6B 2W7TA 1ZRSA 1IZ9A 2CC2A 1XKLA 1XTRA 2HC9A 3GCGA 3Q9NA 3HMQA 1QAQA 3LP6A 4TS4A 3PQ3A 4TMZA 1EUZA 3ZVLA 1Z2AA 3ESZA 5JNRA 4JI7B 5D3MA 3K0SA 1M6WA 3IBTA 5B3KA 2ZVQX 3I92A 3R0IA 4YCBA 3FVVA 2F43A 4L0MA 5DN9A 5EJ7A 3DKVA 1CR1A 1VLHA 2H63A 2BKLA 3OPYB 4L6AA 2AG1A 3DKRA 1YBVA 1XAIA 2QD3A 5ERGB 4LYFA 1L3IA 3CWCA 4L8WB 1DWOA 2BJHA 1Z62A 3H5TA 4X24A 2NVUA 3RJTA 4BGUA 2VDLB 3SPXA 3ROEA 4E4RA 2RK3A 4KZKA 4XVUA 3EXFB 3VNQA 2ZBGA 3QX8A 4BAUA 4BX3A 4NBNA 5FJIA 3UNXA 2DWUA 4QECA 4PXSA 2V0CA 2N75A 1ZU5A 4GR5A 3N28A 3IKVA 2WJZB 4GMGA 2J3LA 2OWEA 2H57A 4DJAA 3OJFA 4MKGA 4N48A 5SV2A 2I8LA 4LWQA 1UP6A 1RS0A 4EP1A 4OHOA 1Z0AA 4QU8A 1GZUA 3GYGA 5U4QA 4JOCA 1D0IA 1ZJZA 3ZXUB 3HFSA 3PUZA 3OE7D 3QU9A 4ZQFA 4ZVMA 3P2MA 2AHRA 3SYLA 2OSBA 3WKDA 2FUKA 3RRNA 5IUNC 3O3OB 5TARA 3M3DA 2WJ3A 3WQSB 1TU3A 2GF2A 4ZQIA 3TB4A 5K99A 4NU6A 3P9IA 4CM5A 1J49A 3GO4A 5AOBA 3W5VA 2HMTA 3MS2A 1H3EA 1N6IA 1PT8A 3PDUA 3VC3A 5CLGA 1XNJA 1QHGA 4DCOA 4D9FA 4UTOA 1D0VA 4LF5B 3F4KA 1VA5A 4JQCA 1PFYA 1ZKDA 2VJOA 2P1RA 2W0MA 4FEEA 4CF6A 4QRIA 1J8FA 2RI1A 1ODLA 3U7QB 1EVKA 5JNVA 3BSSA 3DOOA 5LP6B 3HSKA 4UAGA 1FL9A 4W63A 4Z49A 2HAEA 4MQLA 3B70A 1E1CA 2OMKA 3AY7A 3DE5X 3O75A 1Z34A 1Q77A 4R1MA 4HQFA 4UTVA 1G60A 3PNKA 4U02A 2FEPA 3FCOA 4OL0A 1TUGA 2CXSA 2YWFA 1CUUA 3BG5A 2FK8A 2NU7B 4PLPA 3H5VA 4DR3B 1M2NA 4F2PA 1RRVA 2I4IA 4US2R 3DVQX 4PX9A 4KUGA 3SC4A 5KVVA 3CF0A 1P6QA 4UM9D 1WCIB 4YP7A 2Q1SA 2I6QA 5K8LA 2BFOA 3HU2A 4GMDA 1SHUX 3M4XA 3OH8A 4MW4A 1QGUB 1SCAA 1QH0A 1JILA 4RCVA 1Q19A 3HDTA 4XPIA 4O1MA 4DSZA 1XWIA 1AV7A 2FG6C 5JAUA 1ZSNA 4GZ3A 1MO5A 3OJ0A 1C7IA 2J5RA 3IJ5A 3OZUA 1JH8A 2CDBA 3N2GB 1V5FA 4MVJD 2QI9C 1J22A 3H11B 2P2LA 3OTHA 2B7CA 3HB7A 4IYJA 3SFTA 3DMGA 3QE4A 3UM9A 1KMHA 2AFHB 5ITZA 1QRTA 4KR3A 1I32A 1SZJG 2A67A 5CH3A 2XZOA 1GNVA 4PAWA 3AYZB 5FL3A 5E3HA 1Z6YA 1L9XA 3G2MA 4C1BA 4CMBA 1Z22A 5A7GA 1I94B 4D02A 1E98A 4HAYA 3VJKA 5JSFA 4RPKA 3RLFA 3HFJA 2RCYA 3PICA 2JJQA 7MHTA 2E21A 4CHTA 3DZJA 4TMWA 4CKBA 1Q57A 3WK8A 1L5LA 5F4ZA 1JG4A 1L4UA 1UZNA 1FXWA 1E9AA 4HWRA 3PIIA 5AVWA 4F4UA 2D5BA 2C2KA 4QICA 1YR2A 2JVJA 3GQBA 4C5AA 3W5CA 3MWYW 1GQYA 3AO0B 4PLFA 4D8XA 2FWBA 3ER9A 1C1DA 1QQ6A 1W44A 4NFSA 1NZFA 2UUBB 1KMCA 1JSRA 4EJFA 2CHGA 1KQ3A 1VJTA 2GMWA 2HPZA 2VCHA 2KMLA 1SM4A 5IAAA 2O06A 1KWKA 3KJNA 1ODFA 4KFTA 3ILSA 2W6PA 3OT5A 3KOUA 5TR9A 1JL3A 4LMRA 2DE0X 3NLLA 3F73A 1ENPA 2B4AA 1U4NA 1YAHA 1XZAA 3B9QA 1EB9A 3DVRX 4CL2A 3OJCA 4C0JA 4X91A 3KJQA 1U0RA 5LQAA 5IW8A 3RJ5A 2MT9A 2B1QA 5EZSA 3L8DA 1YQ9A 1X8JA 2DUUA 1ZRNA 1B2LA 1CUEA 2QAGB 4MR9B 4P5EA 1H6DA 2UVPB 1JQDA 2D2FA 2O6LA 4D0RA 5KNDH 1QUFA 3NTLA 121PA 1UFKA 1XRNA 4CHGA 3M83A 4YBZA 4HEA6 4HDKB 1EIZA 1U3DA 2PM8A 4JUAA 4F3RA 5LZ7A 1ZHOA 4KXLA 3BD7A 1AZWA 3N39C 1OE0A 1GR0A 2RGNC 1IOWA 1JLRA 1FRNA 2XVYA 4DRXB 3A2KA 5B4TA 1FTYA 4D1YA 3G49A 3E0XA 3BMNA 1RMTA 3KLOA 3KSBC 1R10A 1SAYA 3SXPA 1A9XB 4HNAA 1XKXA 4Q4LA 2W6JA 4ALMA 1JG6A 3OLXA 3NBXX 1GPYA 1YUNA 4QPNA 4EMTA 5HGXA 4KXYA 4YI3A 2ATCA 1O1YA 4LJ6A 4J9UE 1UJ5A 1UJ2A 2NYVA 5J2UA 1ECPA 2BFEA 4XB2A 5AW7A 4LOJA 1BAPA 3KB2A 2N47A 3IKJA 4CIYA 4B3JA 3TXAA 2FDCA 3RYIA 4KPUA 3KTDA 2DUNA 2R6DA 3ZE8A 4OD0A 3IVCA 4PHHA 3SSOA 3WWCA 5A1JA 4OQDA 2OBFA 3RVPA 3G2PA 2BI8A 4MQ4A 2C57A 1DAMA 5CFMA 1ZMBA 3OOWA 1GZ4A 2ACEA 2YKGA 4PC1A 2ZK7A 2WA1A 4Y2RA 2B4TO 1GRCA 4RH1A 1ADGA 3WYFA 3WMXA 2HIAA 4ACBA 4B6EA 1GPLA 5MFPA 1F7VA 1LD3A 1X1QA 3AV3A 3TINA 4MHTA 3VKUA 4KH0A 1T91A 4AYXA 4KPYA 3IUNA 1L1QA 4BLTA 3KSUA 1I10A 1X87A 3BSWA 2IYXA 3S5UA 2PJRA 2Q9BA 1GL7A 3WNVA 1FPQA 3PK0A 4ND4A 1KVTA 1UL1X 2DR3A 4XUEA 5F7ZA 3LUHA 3DBIA 3NEPX 3PQCA 3HO1A 4HN2A 3STVA 2NU6A 3SM9A 3ZJYA 4E51A 2FPGA 3A26A 1CBUA 1NN3A 4R6XA 1OVGA 1U3VA 3QMMA 1F9EA 1FTGA 1VHDA 1XAJA 5SZJA 1TZKA 4JUDX 1I4DD 3PS9A 5JPCA 3MB8A 5L3RA 4TROA 4B32A 5FOSA 4R2LA 3QUCA 3P94A 3AIMA 2G80A 3ZV4A 1T9ZA 4J0FA 5HM8A 1VE5A 1GGMA 2GK3A 1TVKB 4A91A 3DOJA 5TV2A 3SLGA 2HFKA 2PGLA 3G7UA 3WWYA 2VP2A 1NP7A 4MPRA 2IBTA 1U7ZA 3ENKA 3SQDA 5HIJA 3U4GA 4TTAA 4TT3D 3LUCA 1TO6A 3T1NA 5JYBA 5LIRA 1UBSB 1RSZA 4U7WA 3S2EA 4DCJA 4IDNA 4QU9A 2DPXA 3VNAA 1OB2A 4Q9KA 1PSWA 4GSLA 1E6EA 5FUQA 2VNIA 4EUFA 4JC5A 3UXYA 2R8ZA 1CIVA 1X1BA 5BXYA 1DAIA 3A1WA 2M6SA 4N39A 4QPZA 3IUPA 1AQYA 2VRWA 1D4FA 1ZOSA 2DU8A 1U3GA 1GWNA 5DPMA 4AO7A 2B2NA 3JARB 3TSAA 4DNOA 4UDXX 1CB0A 2GNPA 3H5WA 4HKTA 5TPWA 2FPLA 3B51X 4R1PA 3ZV7A 1C9MA 5JZMA 1TXGA 3TTXA 1W2HA 3KP1A 3U6BA 4NAUA 1NQWA 4H27A 5M34A 1PS9A 2VLBA 4QDJA 1T5TA 5DRYA 5FDFA 4CCYA 4QNRA 4WNCA 5DM60 1XK6A 5CDFE 2CL6X 1K5DA 3OQMA 3AR3A 2R65A 3EB9A 4W5HA 1JDSA 1JXAA 2HZBA 4EI9A 3BFXA 3C39A 5B30A 3L8GA 2MDTA 3AW9A 3C1TA 4E1AA 2P1DA 1OGJA 3GRKA 1QS0B 2PEZA 4WKCA 4A6PA 3T5BA 1YIOA 2IWRA 3QTBA 4PBTA 3UPDA 5FWXA 2GXQA 2ZSJA 2IBMA 3BSYA 4RD3A 1UJ4A 1ZVVA 3LZDA 2H5EA 4R9RA 2WM9B 1EUYA 1PQPA 2V3WA 2DUWA 4DN6A 3ILVA 3D1LA 1K8ZB 2E6UX 4H3KB 3VAAA 1DAEA 1DXYA 1H93A 1QONA 1Z73A 2ZZKA 3D6HA 4LFBB 1GV1A 3KQSA 3RYHA 1YKSA 2CMFA 3JATB 1X1RA 1QQ5A 1JAXA 2BGIA 5DOVA 4C5CA 4P0QB 1T9KA 2R68A 5EWLA 5L4SA 4EY7A 1BRTA 4FWBA 4DLBA 1Y34E 3LWZA 4HO1X 5SY9A 2YV2A 1EXMA 4AY5A 1R5OA 4DIFA 4YP6A 2IYNA 2C5EA 4HD8A 4JBIA 3TVDA 1ZJ4A 3A11A 2W6CX 3TUZC 3DBHB 3ZE0B 3T0IA 1G16A 1GTZA 1XI2A 2BM0A 2JVKA 4P84A 3ZZUA 5KVAA 4TPKA 3VZRA 4UEJA 4G85A 1IMJA 3CVOA 3NHMA 2JFQA 4C4RA 1W46A 3CEAA 1LFAA 4TWBA 5DYWA 4ZAFA 4BVJA 5JYEA 3IQEA 5CD1A 2VH1A 4BAZA 1K7YA 5JNTA 4M98A 4WUVA 3SMQA 3RRXA 3S7TA 2JAPA 3KJZA 1UODA 3L7AA 3D7MA 2CCGA 4XGRA 4Z0NA 1L5HA 4UM7A 1YR6A 3KLNA 3RVJA 4AKGA 4ZV4A 3ASUA 3I2GA 3QLUA 4PFSA 1ZJYA 5AI0A 3RWOA 4BO4A 4J1NA 4XR9A 1JFLA 2TRSB 3VOBA 3AJ9A 4TS1A 3VO8A 3RVOA 4W7HA 5J4YA 2BEVA 4ZKDA 2Q41A 1C80A 3C3BA 1PHRA 2P65A 3BGIA 3L4KA 1IZ8A 1YE8A 4GOLD 1JQJC 4BZPA 4GPAA 3VUFA 2QLFA 1U8ZA 2TMGA 5IVHA 1DCTA 1ISRA 3FR8A 4U0JA 3IPYA 4PM4A 2AMJA 3LTEA 1DC5A 2AEMA 2YOGA 2P9TA 2W2KB 4IFBA 5TMPA 4JP1A 1YFJA 3G68A 3BS4A 3NPAA 1PFWA 3A6EA 1RDFA 4YJDA 2FP4B 2AWNA 1NONA 2J6BA 1NOJA 3MPOA 4ENSA 1GVNB 2GM4A 1ZD1A 4YRNA 1Y9DA 1JIIA 1G8FA 3W9UA 4U2CA 5IJ0B 2J5KA 4Q19A 1RW4A 3I2JA 2N0SA 3LK7A 5FKJA 2A9VA 4QTYA 3D0OA 4XARA 2HBZA 3D2LA 1RHRA 1P1KA 2O8CB 2TECE 2YMLA 3AJRA 4OA8A 4LISA 3H2ZA 4YJHA 1OLOA 1B76A 1NKTA 3L6EA 3OI7A 4QDTA 1ZL0A 5K5EA 3FHTA 5CJJA 4H77A 4RDXA 4M53A 2P2CA 1NURA 1S9HA 1QYCA 1KQPA 4AW9A 2I7VA 4FBMA 4IAOA 4C6RA 4YRIA 2GXSA 4QFMA 4Y1RA 4EJ2A 2AD5A 1QQAA 3BGWA 1SUWA 1LNZA 2FWJA 1JEDA 4YV0A 4UM5A 1CJMA 3X1XA 2HBRA 2NPOA 1PP4A 2J3QA 4TRNA 4A16A 4BL5A 4FBLA 2EU8A 3FGOA 4DUPA 3INRA 5CA1A 5T4BA 1OTYA 4CEHB 1SU7A 5EJAA 5CYPA 1Q84A 2IP2A 2TMKA 3ASVA 1RYFA 4FI3C 4KVGA 4PFJA 5CX4A 5WRFA 4JXZA 5CM8B 2PU5A 3B6JA 3NONA 4JYZA 1RP7A 2OAEA 1GG5A 5IXYA 4ITRC 1RZ3A 1X86B 4PG7A 1WPQA 2O54A 4UAJA 3LY8A 1P72A 2CXXA 2WJ4A 2OB2A 3IVAA 1ZI6A 4Q0MA 1T36A 2HWUA 3OQ6A 2OOKA 3LH5A 1A5TA 3BC1A 3GDOA 5DI9A 2GLTA 3LLMA 1U7HA 4Y1FA 4YN3A 4QYSA 4W5RA 3L3BA 4QO8A 5DDIP 4LCBA 4F21A 3D6MA 1KNXA 2P5YA 1ZUD1 1ZO8A 3IQDB 1KOFA 3T4UA 1V8DA 4EFLA 3IBYA 3DNFA 4KJZA 1T5SA 3FAZA 3SS8A 4HT3B 5BN5A 2Z95A 2BONA 4YRZA 1BMQA 2I9KA 1KR5A 3A4MA 1U81A 5DP2A 2PZFA 5EMJA 4KR6A 2RBGA 3IQXA 3H19A 4MR7A 5B1DA 2P4QA 3DGFC 3QFTA 1ZISA 2FFRA 5F77A 5KYYB 3UAZA 2OCXA 5HILA 3U3RA 2AC7A 1LS6A 2ERXA 5CA0F 3ZG6A 5IKMA 1T6YA 3R44A 4XCVA 3R75A 2PXCA 2FRDC 1NXOA 3EA0A 1SC6A 1KEWA 3EC1A 4OA5A 3IQIX 2XWPA 1UMKA 4OQPA 2L42A 4ZEMA 3LHKA 1J39A 4DA6A 3PPIA 2AK2A 3CEJA 4PLCA 3R0JA 3SHWA 4WV3A 4E32A 3O8LA 4CFZA 3KE9A 4BE4A 2ESRA 1XCLA 2QL7A 4GMHA 5BW4A 5CLHA 4O3MA 4GP9A 4CIVA 1BEZA 3M6AA 5C7LO 2OFFA 4U7TB 1N0UA 5JCPA 3L49A 4A1OA 3L7DA 2KSQA 3Q2IA 1QV7A 1JE1A 1M10A 2OM2A 5KI6A 4G3XA 1SC1A 4YAEA 4RK0A 5A4MS 4KI0A 1Y6GA 3GMIA 2SICE 5AVSA 3PLAE 2FVYA 1PGPA 4AXXA 1P4HA 5TVKA 3RVQA 3HBFA 1S1CA 2CJFA 2AFVA 3C7TA 3DLCA 1UPBA 2ODTX 3GAZA 1RI1A 4A82A 1M2HA 1KYVA 2BMWA 3Q5GA 4RZHA 3SX0A 1I5OA 4WLOA 2V6JA 4KZPA 1N7IA 1NFQA 3GZNB 3OHSX 5EJ4A 1LBIA 3AERB 4S05A 3DDUA 3M1LA 3HWX1 1HDRA 4RVUA 1WPGA 4I6JA 4OYRA 4NF2A 2VWPA 1CQJA 3AGQA 1KDTA 4WY8A 1N5MA 4GH5A 3ZKAA 3WYEA 3QX3A 2EX4A 1PU2A 4RULA 4YV7A 3UCEA 1G4AE 2VK2A 4JLOA 2A1UA 3SM3A 1AV6A 3EVFA 2PUJA 1FFSA 1H1DA 3IIEA 5DHUA 3T7KA 3KXLA 1OBFO 4UEQA 5LP6C 1CJSA 2OTCA 5L7TA 1FC0A 5YASA 421PA 2OXFA 3V4RA 4ZI5A 5C80A 4JQOA 2VTKA 3M9XA 1UINA 1G8MA 2B8WA 2B4YA 3BRCA 3PNSA 1V1RA 4LZNA 3ZY3A 2O8NA 1OBHA 2AHOA 3OCJA 3PJEA 1XDBA 2GN6A 1N2GA 1RRFA 5ALYA 3ZQKA 2HYDA 3FYDA 5EIHA 4FDMA 3T52A 3RFXA 2PZGA 1HZJA 1J7JA 1L4BA 3HCOA 3NWOA 4X7PA 3R2JA 3ZDFA 4CV1A 3GLFB 1J1UA 3N6RA 2NSYA 1U8CB 3UPUA 3H1EA 4MMYB 4LBWA 1XVTA 1Y6FA 4DQ0A 1ORWA 3IOCA 1F0YA 4QXMA 2IQIA 4JLPA 4Z6KA 4G0YA 3H04A 3UGTA 4KRYA 4NG4A 4GOMD 2P2DA 1FU7A 1PNQA 1KTVA 3SF8A 3FPSA 4P86A 4NU5A 1E3DA 3ILYA 3PLNA 1V37A 2W6JD 3ECSA 3I9V6 3PE4A 1UBTS 4HDNB 1QHHB 5CXXA 3FWKA 4P32A 4YMWA 4ENQA 2GZMA 1HLFA 2HTFA 2JI6A 1Z6GA 5LPNA 1IIRA 1MR3F 4O4IF 2BR3A 3VYTB 4DAOA 1VE7A 1P19A 3WQQA 4HVLA 3KT0A 1T9BA 1KWGA 4NZYA 1VE3A 1EM8B 5CURA 1JHQA 1TO2E 1OUMA 3NXSA 5FBWB 3KZMA 4N76A 4IO0A 4N65A 2R3SA 3AUXA 3CO5A 4V02A 3UT6A 1DTWA 1Y9ZA 1HG1A 2GDJA 4NBSA 2J7PD 4MKIA 1E2UA 5EAIA 3BH6A 1FRZA 4C4SA 4DA4A 4YTEA 1YDHA 1YZLA 4X90A 5DEIA 2IW1A 1BU8A 2I6SA 3WY9A 3BXEA 1SMKA 2EFJA 2J3JA 1YACA 4NR0A 2RGNA 5AYVA 2RH8A 1M2OB 3WAKA 2XIJA 4EY4A 2JFHA 5BWLA 1Q7BA 2A0FA 2SBTA 3MF4A 1WDWB 4A92A 4P54A 3ZDQA 4WFQA 2O3UA 3KWLA 4IIYA 5GIPE 1IJFA 4BRSA 2GYVA 1VHTA 3O9VA 2B6HA 1Q7CA 2ZYVX 4BN5A 2Q4RA 3AESA 2XYRA 1DRWA 4E5NA 4MGEA 3PFCA 4WESB 3VZQA 1NU8A 1WA5A 1SUEA 2ZRJA 3EZYA 3IDFA 1QM5A 3CC8A 5FTWA 3H2GA 3S28A 4R05A 2GRAA 3CH7A 1Q1GA 4Q1EA 1PFKA 1V8OA 2PKEA 2QVYX 2XLCA 3D1VA 3TI9A 2QAGC 3VPBA 4AX4A 1FW6A 2LP4Y 1K06A 4B9AA 3OX4A 3BMQB 2WAOA 4XQGA 4BJ1A 4PZYA 1D7OA 3ONVA 4KO8A 3RRBA 5KJ1A 3M6LA 2O7SA 2G1UA 3KKPA 1D1TA 4MX8A 2GF0A 1BVUA 5CHYA 2XI4A 2P62A 1IXZA 3TRKA 4BMPB 1QFXA 4MI6A 4B2LA 3HGTA 2YQ5A 1EINA 3WA6A 5LOVB 1PV2A 3S8MA 3V1YA 2PJZA 2BBSA 3T06B 1W19A 4L16A 4OQNA 4BFZA 5HUJA 4NMLA 4ARAA 3QI7A 4X65B 3DW3X 3EVGA 4DPMA 4AS3A 3CPSA 3ZU3A 4CM7A 1O6FA 4DSNA 4JMLA 1BKSB 1LC3A 4JLKA 3LKBA 5L7WA 1U0LA 4CMGA 1SIOA 2P0AA 1PBNA 3EEIA 1N75A 3HHEA 4JV5B 3FCYA 2V8OA 4OXIA 3I9FA 1N57A 2LKCA 2XMPA 4FGJA 4LGYA 3BQ9A 1SQ6A 1YZQA 1QRSA 2VJMA 3B7PA 3DUFB 2O6HA 2ONCA 3FNBA 4AUMA 1J6UA 3R76A 2FH5B 4LJKA 4N9WA 4LPKA 1ZM9A 3ZU6A 4DDUA 5DNYB 1EFPB 2BUCA 3NTUA 2ETVA 1GUFA 1P9LA 3QTTA 2O8DA 2JJ1A 3UUGA 5BSEA 3CURA 2Q9UA 4MV4A 4QOIA 5ALQA 1HE2A 2ZRHA 1INLA 1KYQA 1GNQA 1WEHA 3CX7A 3KUKA 3C45A 3EA4A 2Q2VA 5E6RB 3E2IA 2XYPA 3K1ZA 4K6MA 1W4BA 4TYNA 1NRIA 5LWQA 3WBFA 1MQSA 3TK1A 4Z51A 7YASA 5K9ZA 3NHLA 1TYCA 3TZHA 3RD5A 2G5TA 2C9DA 1YULA 1E1YA 3DHWC 3GZJA 4TKUB 4Q34A 1PNOA 2OY0A 3L1IA 4LOHA 1GPDG 3U7IA 4BFWA 3KOOA 5J4HA 1LSSA 4MRRA 1J5XA 1XRSB 5JD3A 2FI1A 3TCXB 3RVNA 5CEEA 2BMVA 2J1LA 4G23A 4HX9A 1L4YA 3QZUA 4FCWA 1Z5ZA 2FW6A 4DG9A 5SY6A 3U5TA 1KGSA 3X1ZA 2ANCA 4Y2YA 3QKSA 3DXYA 3VYUB 1FRQA 3O93A 1XNHA 1I9GA 5GZ6A 1NUHA 1JHPA 1WNFA 2JASA 4M54A 4DDVA 3K15A 1GZ6A 4XWAA 2BH2A 5EUMA 2I4NA 2VFAA 3QU7A 3W4IA 3ZLBA 1QVVA 2FF7A 4KIJA 1G8JA 3NNNA 5LDHA 2XOXA 1YQDA 1RAGA 2BT4A 2XCUA 4OJMX 2QGNA 1EDDA 1H4TA 3GC6A 3SD7A 3UAXA 2RGEA 1M1NA 1D6SA 1FUEA 4B8WA 2IHBA 2OM6A 1G0NA 2YC2C 3C3EA 4ZHSA 2Y71A 4TL8A 3CUEF 1UWVA 3RGGA 3EQ7A 3ZGXA 4EKEA 2IC5A 2E4WA 3G1WA 2OO7A 1M6EX 1Z5VA 2IEZA 1P7ZA 2X14A 1Z37A 2O14A 3QELA 5E1DA 2FPIA 2J32A 1B93A 3K9WA 4E4YA 3ZDCA 1SG6A 2D62A 2I65A 3JZAA 1E7RA 1B6RA 2PKXA 3FHJA 3G2IA 3JQ6A 1YQGA 2JJ8A 4L3VA 3TEMA 3WK7A 4DCCA 5TS3A 4DCGA 4ANFA 4A15A 1GZVA 1JIJA 2X8BA 4HYQA 5A9TA 4BGVA 1JFVA 3KFLA 4LOAA 3OC0A 2WP8J 1G2OA 1ZUIA 3IDOA 3ILHA 1QNLA 4PQEA 2QRVA 5TJHA 3TQSA 3SJ7A 5H02A 3H4IA 1YJAA 4D7AA 2HEIA 4DQLA 2HCRA 4OH7A 3KVRA 3M8KA 3T9FA 1RM0A 1LX6A 1W1WA 1EK6A 2Y6UA 4QUJA 4TXLA 2ILTA 4XW2A 3VU1A 4BBPA 1X2EA 4E13A 1MF7A 3FMFA 3KTAA 4JXXA 1G3MA 1OFTA 3KUDA 3HJTA 4NCHA 2GUGA 3A1NA 3HVJA 3S7ZA 4G81A 2Y9PB 3BIXA 4NRDA 3T35A 3DZIA 1RWPA 2J3IA 3BCHA 3VPXA 4G5YA 1RXEA 3PRJA 1C9EA 2DKFA 2VRNA 3FTPA 4MIEA 2EAUA 3G3EA 3HXPA 4P2GA 2G83A 4XUCA 3CCBA 1JHVA 5LYYA 1QOQB 4F5ZA 2J7KA 2QTBA 3IOYA 3C43A 4CCAA 3IXMA 1ZGHA 3MMXA 4LSMA 4E3ZA 2BSQA 1TKCA 1V26A 1TF2A 1QV6A 1PGOA 3GLRA 4MRPA 4WXMA 4LA4A 1T2NA 1DAGA 3M7IA 1T8PA 4W1PA 3MMPA 1YZVA 2WTNA 2ZUCA 4M1ZA 3THYB 1Q14A 3OT4A 4FS3A 2A6PA 3EEOA 1ZN7A 2I5PO 3GDGA 4W9RA 3QLEA 1A2OA 3HC7A 4IZ6A 3PUHA 4RENA 4Y6QA 1PZGA 3HO6A 1OIVA 4ZO8A 1E61A 4EX7A 1YMQA 2BEKA 1OF1A 1FFHA 3ITKA 5D87A 3OQHA 4R98A 4FR5A 1Q0RA 2NUBA 3R24A 4FJ0A 4JFRA 4JIMA 2OORC 2CUKA 1KMIY 2XUGA 3D8BA 2B0CA 1DG1G 5EJ2A 4AKHA 4DOMA 4CKYA 4LJ7A 4ZI7B 4K81B 1EGQA 1RAFA 2YHBA 3H87A 1G7SA 4MQMA 5AVYA 2B6NA 5G40A 1R66A 1IJBA 2I62A 2F1HA 3LKZA 3SBOA 1WY5A 5H70A 5IS2A 3LAWA 4HDCA 4ZI3A 4RTSA 3MWDB 1XZ8A 4KWHA 3MYYA 1DQRA 1T6NA 1HDXA 4G9BA 2AZ4A 1WSAA 4UHBA 4Z4HA 1F1JA 3C6QA 10MHA 1I3KA 3ZY2A 2X7XA 2PG3A 1A8SA 1DO2A 2PIAA 1E7YA 2C31A 2FP3A 3MT9A 5ENVA 2FZGA 1SD5A 1F6BA 2QLLA 3BULA 3QLVC 4Z7OB 2BKEA 1Z33A 3UAGA 1EM6A 4LAFA 1BYUA 3QJGA 3U9SA 4TZ6A 8ABPA 3NM6B 5DI3B 1EGHA 3AF4A 1V2HE 3E7XA 4P5PA 3M5CA 3ZWVA 4DNFA 5HM6A 2X7JA 1U8FO 4G4SP 4PYRA 4WLNA 4FB5A 3JSXA 1JU4A 1YF3A 1YCFA 1ZM3A 1Z63A 1OX5A 2RGCA 3AX6A 2E3JA 2OCPA 2QPLA 4FLMA 4KKXB 1MVLA 5IJZA 1MW8X 4CN9A 2Y99A 4MA4A 4EY3A 3S8EA 4FYPA 4FM9A 1EZZA 1XP5A 3OF3A 2Z2YA 1JKJB 1RI4A 4XQ9A 4KNVA 5IHXA 1XYYA 3FJYA 5E4YA 4EB3A 3KCQA 3WWPA 3PA6A 4HAXA 4QGAA 2IE8A 2EBWA 1HTBA 1M5RA 2DC1A 1A4UA 1LBSA 2GCEA 3UOGA 1L1EA 2HGSA 2OVBA 2ZSAA 3AEZA 3FDZB 3N58A 2NADA 5E3IA 3GFGA 2PSSA 1WMAA 5LXTF 4U6SA 3TLYA 1K3TA 1Z5PA 3OIYA 4LXUA 3UHPA 1WTAA 3UH1A 5IT5A 3SQOA 3BL5A 5A4IS 2YHUA 4U00A 4ZYVA 3KETA 2VHTA 3E3LA 1CY8A 2M32A 2WKWA 1EESA 1OSNA 2FYTA 4D4JA 3FTFA 3OPYA 3W79A 4DG8A 2DH5A 2BKVA 4YAKA 2IYWA 4W5JA 3K0AB 3Q7EA 3GT7A 4F12A 2UYHA 1VMKA 2FF5A 1QYXA 2OBXA 3DO6A 3EXFA 5BMVB 1NU6A 2WAXA 3A6KA 3M4NA 4EPWA 1JLMA 3BB4A 1ZCAA 3M34A 3A2LA 3CNNA 3BWMA 4IW3B 1GFWA 3TQOA 3ETDA 2W5UA 3R3YA 2OXTA 3D5EA 3GOQA 4LI3X 2FFBA 1AF4A 2R6GA 4FZ5A 1UBLS 4OJNA 5ALUA 5A4FS 4NLLA 4N8EA 1CYDA 4G0NA 1XTBA 1K3FA 3HKBB 2WUWE 2WY2D 5K4GA 4IHQA 4ZREA 4NBTA 1SBZA 2WPDA 2OE2A 2O23A 1X77A 1BZYA 1I2MA 1EXDA 1MUUA 4HB2A 5I48A 4WEQA 1OWNA 2W6IA 4RC9A 2CZQA 3HRHA 4F0JA 3DAGA 2WVJA 1OZGA 2YMMA 5BW6B 2HUPA 3DQQA 3WNCA 1PGNA 1A2KC 2ZRQA 4BNJA 2UZ3A 4NS1A 1M6NA 1V9CA 1S96A 2ZREA 3E9CA 1XPOA 3OD1A 2NO4A 1V5GA 1QHIA 3E5RA 1CNMA 4FD2A 4FE4A 3OIUA 2ZS8A 4KYVA 4WFKA 3U7QA 3UGQA 4E5KA 5J4LA 5LP6A 3SHQA 1V11B 4OHRA 5FD8A 4RGVA 4WX2B 5E38A 1EP1B 2WSIA 2I80A 3T3NA 5LBUA 4F4CA 1IBMB 1A9RA 5JS6A 4D4LA 2P6RA 4EO4A 1XDUA 3L05A 4FJ1A 1YOBA 3X2SA 1M34B 3MMNA 4RKFA 2YJZA 1QPZA 1YGYA 1WCIA 2DPHA 3KQYA 3TD9A 3ASZA 5M3BA 1S2DA 2GK4A 2PVSA 5SICE 1L5GB 2ZUTA 4DEXA 2D5LA 1QGUA 4A4DA 2Q9AA 4ZVTA 2EGUA 1KO7A 1RAIA 3VYWA 3SDSA 3ZEIA 4ICIA 2BYTA 2OQIA 3VGJA 2D3TA 2P6OA 2H4JA 1R9JA 2MWMA 3HH8A 4YPFA 4EENA 2XUAA 1KQOA 2PBFA 3NJ4A 4JJEA 4DPKA 3KAKA 4YX9A 4TLLB 4WN9B 3IALA 3N2GA 3WLPA 2PMWB 2PSFA 2DJIA 3H11A 3HV0A 5BNZA 3DFMA 4AZTA 2PK3A 4CNBA 5CPBA 3VYRB 2A5YB 5B7NA 3ADBA 2AFHA 1PL6A 1N7JA 3Q87B 3FPCA 4U7DA 4B3RB 1AC5A 2GBIA 5JHHB 3ZDYB 1NVDA 4M7PA 5TY0A 2VXBA 2GJSA 3ZNQA 2XZPA 3PFKA 4JOBA 1UJBA 4L1KA 4DR7B 4UHFA 1VKNA 3K53A 1PX2A 4YAGA 4V1CA 4GRIA 3AQIA 4IPTA 1RKUA 1UZAA 1YRHA 2Q3MA 2Z83A 4GR4A 4H1UA 3I2HA 4JR2A 3U40A 3W8EA 4F93B 1LLUA 2NUAB 1KOGA 1RLJA 1VG0B 1X1EA 4J0KA 4BIIA 1TLLA 1W35A 1RPNA 3L93A 4BNFA 1TX4B 4DEVA 3L7BA 3QPWA 1KEUA 3ROFA 2H7XA 3KVNA 4EJ6A 1A1VA 3EGXB 3TTWA 2BSAA 3WYNA 1RFLA 1R9NA 2A2ZA 3FB1A 2IZZA 3OCXA 4QHYA 3ZHRA 2J9FB 3G2LA 5CVVA 2QTMA 3LYLA 4ADSG 3MVEA 2PNFA 1KC1A 4WHMA 3VGPA 1CEEA 2FFQA 1JPUA 2BHSA 1F51E 4D56A 5IN4A 2I1QA 4K03A 4BYMA 1EWYA 4RAQA 3DF9A 3UWSA 3JSAA 3EPLA 3GFBA 3RAGA 1B15A 2ZI7A 3CTPA 2I3BA 2OCDA 1WTCA 1E2BA 3EXG2 4YFYA 4EAQA 4OG2A 5DNDA 1L8LA 4RO0A 4X7BA 5FBKA 5LUBA 1PZXA 3CBGA 1EFUA 5HNKA 1KO8A 1PR0A 2CCJA 2WHPB 3H65A 4HFMA 4M1SA 2QAGA 4MR9A 4WOBA 9GPBA 5DNUA 2UVPA 4GVXA 4KHPB 2IHUA 2NUTB 4ZVQA 1XMJA 1B8UA 2X6TA 4E2FA 1E2NA 1OLSA 2XHEA 1H5UA 4QEKA 3CV3A 2JJ1D 5DLYA 1J8VA 1JYFA 2B20A 4DBVO 2COKA 4L9RA 5HYVA 1C30B 4I3FA 1YR7A 4LK3A 1FUIA 2VPXA 1O3YA 1UPUA 1JEJA 4L9AA 4JCOA 4JEMA 4DRXA 3W5JA 1WP9A 3ZVRA 4ZALA 3UK1A 3IQZA 1NC3A 4LRUA 4YYZA 1UEXC 1A9XA 2VL7A 5H5JA 4ZYXA 4BLSA 2A5JA 4A73A 3MJTA 4M1KA 1ZJ6A 2R1ZA 5D6NA 1URPA 5C4IA 1TTQB 3IDQA 2YV1A 2DQ4A 3E27A 4M86A 3M4YA 2FOXA 2ID7A 1B8OA 1DKNA 5EHNA 4Q18A 3V7UA 4URUR 1ZIPA 4WLFA 1OXMA 2O4UX 3O8BA 3MM4A 4ROTA 3HR7A 3NC0C 1X7ZB 4YRTA 4AYWA 4MV3A 3SEZA 1SVUA 1OXTA 2DWPA 4WXYB 4LNUB 4UXJA 4R51A 5AVOA 1QGDA 3N70A 1NYRA 3F9IA 2Q3EA 4X8LA 5LQDA 3KWJA 3NDJA 4KIWA 3LQ2A 1B1CA 3D59A 5ERXA 2PV7A 2XR1A 3OA2A 2E1RA 5FUMA 4Q1DA 3E22B 3INTA 3MJEA 1KH3A 2R2AA 3AEQB 2I4LA 5HBGA 4LYDA 3ZVNA 2E49A 2FZKA 1Z4PX 2O5VA 2J9ZB 2NN3C 2Y0CA 4PN3A 1PJBA 1COZA 3WK9A 2A8YA 4R2HA 5EP3A 4FHFA 5ADUS 4YJ3B 3D3EA 2QRPA 1JEAA 3ABOB 1DBPA 4M87A 1E62A 3PIRA 3BT7A 4YIHA 3EQZA 2ZEJA 3QPBA 2FZ4A 4MWCA 5H0IA 3NDPA 1HC7A 1G38A 4OU4A 4L51A 2YCBA 3C98A 4ZA2A 5IAGA 2EZTA 3G9ZA 4CETA 2BTEA 4K6GA 4LYEA 2YFQA 2IA5A 2HD4A 2C3UA 3EH1A 5DASA 3WB9A 4N7MA 4AIIA 5U4XA 2HF8A 4AMYA 4ZP1A 2DPLA 5IBRA 3THOA 5LQSA 2EKDA 4J0EA 3TLBA 3DD5A 2XH8A 4G97A 3TL3A 4QQRA 3OZXA 4RTOA 4RVGA 5EIXA 4YRQA 5F76A 2CJPA 2IK8A 1SELA 1JE0A 3JW8A 3SKVA 4B4OA 1XU9A 2YY7A 3EIOA 3HNPA 2R62A 1L5ZA 1T35A 4WNIA 4IS3A 4IRUB 5T7BA 1HBJA 2RG7A 3BN3A 1OZAA 3RIEA 1UDCA 3X0DA 3LUDA 4Q4DA 3I4FA 1MOPA 1PL8A 1W25A 2C4NA 2Q5HA 2XGGA 4I1RA 4J3FA 3RBZA 4DQUA 4RKEA 5JJCA 2QT9A 1X8LA 4YRFA 2YVKA 2NIPA 4OQLA 5IBQA 3VHQA 4INOA 2VYQA 4RHFA 3W04A 4MEBA 4PINA 4XZ3A 3QPUA 3T5CA 4BJHB 5AKGA 1WL8A 4I1IA 3L1KA 1QX4A 3G0CA 3H1GA 1KJ8A 3HDGA 3LVFO 3P4UA 3T3DA 1N6OA 3UEOA 1NWHA 5I6DA 5JYCA 4TYQA 2OR3A 1QS0A 3QE0A 5FB3A 1A8PA 3ZWQA 4BUZA 1LZKA 1Z26A 1T15A 3O4FA 2I1VB 2AS0A 3IEVA 1EWQA 3DWFA 1OWMA 1JQKA 4NBKA 3P0FA 3EPHA 1SY7A 4QJ3A 2H4ZA 4MWOA 1ORVA 4OLJA 4IH1A 4KMSA 4OHYA 5FWYB 5AW0A 3DJYA 3OO1A 2QRQA 1YJCA 2ZCUA 4K87A 4XWWA 5A06A 3ABZA 4NWIA 3JATA 1UC5B 4BAGA 3QKIA 4IIUA 3KHKA 3N8DA 5H8WA 3GLKA 3PEWA 2YRXA 4HC4A 4RFLA 1QG4A 4IBOA 1USGA 4O5OA 5KIAA 1NR5A 4QATA 3RC7A 2Q2OA 4WW0A 4CG0A 2WAAA 3ZJTA 1ECCA 3DMRA 3DL0A 1IAVA 4YCCA 3FPFA 1EWTA 1SBQA 3N2KB 3HBJA 4D97A 5CCEA 4NIMA 3W2FA 1CZOA 2ZANA 4EF6A 1ZI9A 4EGQA 1JA9A 4I9UA 3U4QB 3NHWA 3L0DA 3EVNA 1FNBA 2BFBB 3K9QO 2OORA 2XJ4A 3GEBA 4X1IB 4F8YA 3KAJA 2IT1A 3EIEA 4HV4A 1DC7A 1CEXA 4J6EA 1T3SA 2VHYA 3VNSA 5CAEA 4HN4B 2XCSB 3OY7A 2DVMA 3KHSA 5T4HA 3IUMA 2H1LA 1IZYA 3BSFA 3G0HA 4JEUA 1PTJC 4YONB 1XBTA 1FNSA 2ZPUA 4BQIA 4YPVA 4Z4FA 1XR3A 1Z2CA 3DDCA 1P7PA 2JLUA 1RWQA 2W2PA 4U7FA 3SLRA 4BO7A 1AQUA 1YONA 2NPIA 3OPXA 4O0LA 2R84A 5HRUA 4POAA 4EG6A 2VP5A 4ARUA 3H3XA 3A4LA 5AWFC 5K0BA 3BB3A 4EB6B 1V8ZA 2IOYA 3QLVA 1QKKA 3VOTA 1CF4A 3L7MA 1CTQA 3NTXA 4QFBA 2WSBA 1RKQA 2D4HA 4Q1FA 2DCUA 4TLMB 5FIUA 5CU7A 1J70A 5AKJA 3TCNA 5BR7A 1UZLA 3SXUB 3F97A 2FGKA 3T7AA 3OKAA 3HA3A 5HA5A 1J23A 1YVPA 1DEXA 4ZYWA 1NGSA 1DE0A 3P27A 3KR1A 4TN1A 1QFYA 3ANYB 4MA5A 2FFAA 4RUKA 2FP4A 5ED0A 3O26A 4A8JC 4C3ZA 2P3OA 5C8XA 3EPJA 3P4YA 3NTOA 1V95A 3E9ZA 4YRCA 3WBBA 4PN7A 1A9OA 4BTLA 1GY8A 4BVAA 2HRBA 4EVIA 1TQ2A 3TL2A 1C2YA 5IJ0A 2WZDA 3VPAA 2A9PA 1QHSA 1TM3E 1DJNA 4K9LA 3C15C 4DQDA 3ZHSA 2MOKA 3LX8A 2VG8A 4QJ5A 5EWJB 3M2PA 1TGYA 2O8CA 3SYTA 3TIIA 3NBMA 2HHHB 4ZCTA 2C5FA 2VSXA 4HH1A 3TF5A 4JYMA 4BE7B 4IMJB 4P35A 1EX7A 3OWHA 4UD6A 2PSHA 3JWIA 5IC5A 1OZ0A 1HGXA 2JAXA 4HS9A 3RUFA 1L7EA 2WIKA 1ISMA 1K88A 3UY4A 2YMPA 4C76A 5G1NA 1PT7A 2OBMA 2G36A 2PKCA 2W6ID 3R3UA 1MFPA 2Z98A 1P4RA 3E18A 4CEHA 1UCFA 1B4DA 3SK0A 2G0TA 2BMEA 2HF7A 3W1VA 1OXKB 2P9CA 3IERA 3UKJA 1Y5IA 3GJRA 4GF5A 4BEVA 4E03A 4EZBA 2QZ9A 4J0HA 5LLTA 4XFKA 3O2NA 4Q7JB 1RD4A 4RSMA 3ELBA 4XCQA 1LS1A 1UAGA 1PO7A 3GRZA 3HWRA 4KQKA 2EKZA 2X1VA 3DLIA 1R27A 3EGDB 4BWYA 4MP6A 1QKIA 2XGMA 4PBRA 1S7GA 2X5NA 2Z2ZA 4V0OA 1V4BA 2YH2A 3GEGA 3A28A 4PO9A 4J94A 1TD1A 2YWHA 3OCWA 4CQLB 3N0WA 3OM9A 1YHZA 2AMFA 4FFOA 4L72A 2GN8A 2WK1A 5C5CA 5CITA 2AFHE 3R5KA 3C4JA 4KSYA 3O21A 3H99A 2RE8A 1BDJA 1SFRA 1GFZA 4JODA 1OQAA 5KYYA 2QVCA 1MPXA 5K1ZA 3RSFA 4PZEA 3R6DA 3TBKA 5KSWB 3O4GA 3C6ZA 4H17A 4I4LA 2PO7A 3TPFA 5K4HA 2W2VA 4J3NA 4KQXA 3M9WA 4MUAA 1E3MA 1NJ6A 1H23A 4K05A 5HJ7A 2EKQA 3HCFA 1N9KA 2ECQA 3D2CA 3SOZA 3PDCA 4FOLA 2XA2A 1H2EA 4QLBA 1U2QA 1EG7A 1Q7TA 1RYZA 5JUWA 4MGZR 1K86A 3WFIA 3CJTA 2QN6A 3AM3A 1SKBA 3AH8A 1IQUA 3KOMA 3FVWA 2C7GA 2H5LA 3KM0A 1SCNE 2FN4A 1JLHA 4F38A 1ND6A 5DMXA 3OU6A 5KO2A 1R0LA 3RNOA 3OQOA 1K08A 1RRCA 5CFPA 1N2OA 4FKBA 5FYQA 5JLJA 3CH4B 4WCFB 1IHDA 2IDKA 1DDIA 2RBKA 3GFVA 1U9YA 4WADA 3PQ4A 4KBGA 4RV5A 5AIAA 1O8BA 1ZM2A 4KQCA 4CRWB 4RIGA 3FMVA 1M5UA 4WLVA 3GZNA 1YBFA 2KM1A 3AERA 3G17A 4K9KA 5HRAA 1OU0A 1W96A 1R4AA 1XTVA 3KVYA 5JFOA 5AVJA 2PMCA 1RWVA 3WSWA 2AJCA 3GCWA 3FVRA 1LBHA 2W2NA 3AUAA 3DQPA 5HZMA 4FD3A 1NWCA 1SKYE 4J29A 2IL1A 2P5UA 4QDXA 5E9AA 3UB3A 3WLAA 2PE5A 1Z36A 1ZEJA 2VJAA 4P9NA 4NC9A 2GKOA 1NR7A 1X8KA 1XWFA 4U7HA 1IUNA 4W8OA 3NV9A 4Z9YA 1SXJB 1R4MB 1II8B 1N8SA 4L8VA 2GPSA 1FJHA 3OE1A 1C3JA 1MXFA 4AJIA 5I3CA 2OWDA 2GCNA 2HWKA 4TV9B 4ALNA 5I8PA 5IUKC 2PX6A 1RRPA 2X5XA 1O2DA 1K75A 1XNGA 3CM0A 4WACA 3IKLA 1R3UA 4YY3B 2Z2KA 1C4OA 1YE5A 3GUVA 5J40A 1CRLA 1XAHA 1C14A 1C3EA 3I64A 3PTAA 1QLJA 1P2UA 4LEIA 2JCGA 4DT1B 1KXJA 3WZ2A 3EZGA 4NFHA 1E7MA 8GPBA 3GLFA 3BREA 3E82A 4UMVA 2QT0A 3BILA 1BDBA 2JFPA 3C6KA 1WV1A 4NU8X 1KY2A 4OB8A 4B47A 2GN9A 2QDKA 3DMDA 2HLNA 2QYHA 5DFAA 4BGIA 3RROA 3FJOA 5TQ0B 3DEIA 3RS5A 1W5BA 3KU4A 4YYEA 2Q7DA 2VSNA 2H51A 2QJTA 3ABRB 2UZAA 1X7GA 2ERYA 1WXHA 3H97A 3KJFA 1IB0A 2IDZA 4HDNA 4KMMA 1QHHA 4Q39A 1ONPA 2BMDA 3SZGA 5BY2A 3EX7C 1U90A 3HZHA 1S4QA 6AT1A 2D0PB 3HG7A 1B0UA 3ZIAA 2IZ1A 4AX8A 3LQQA 2J3MA 5E2BA 4RA9A 3JAKB 1IY1A 1Q15A 3ORHA 3PNLA 3AUUA 3DOUA 4KO3S 1PZFA 5FA6A 4RE6A 4AICA 4BP1A 4C01A 7MDHA 3W78A 4UNSA 3BK1A 1U04A 1UDBA 4FC7A 1Y1SA 4A26A 4DCVA 3LA6A 2XGOA 2Q5LA 3L0OA 1Z5WA 4H4EA 1Y42X 5MDHA 2B99A 5KQMA 1DGQA 2IPOA 1SVOA 2YASA 5HF9A 2GD2A 4CODB 5L4NA 4DM4A 3V3KA 1NAIA 4B3IA 1LDNA 5B6PA 1T2AA 2RGWA 3S2SA 3RU7A 5B2EA 1M2OA 4DJDC 3L8FA 2CNDA 4M46A 2CY0A 3RBXA 3HLKA 5A04A 3WWEA 3QWAA 1FRVA 4JOSA 4MR8A 1WKVA 5AVQA 3EN0A 3PI6A 2R6R1 4G1MB 1FP4B 2ZRLA 4MWDA 5BO5A 1KJZA 2Q5EA 3A7EA 3KKEA 5BRJA 4CM8B 3ZXYA 2QD4A 3IKTA 1YJBA 2R97A 4GZ5A 4WESA 1Y5RA 4Y1GA 4D25A 1A8HA 4E2WA 5KYTA 2P91A 4PYKA 1RC0A 1EZ1A 4AJ4A 5ED4A 2H08A 1RVDA 3U81A 4H6VA 4IDHA 3D0KA 4R5MA 5DIZA 4KYTA 2Y9MB 2P8SA 3W9SA 1JRLA 3NAMA 1VSVA 1L5SA 3TEJA 3PDJA 4RZ2A 4UVEA 1LBEA 3G59A 1RFGE 5CUQA 5AUPB 1CFJA 1XN1A 4Z2AA 4NMHA 2H65A 5JAMA 4CLDA 3GFOA 1FDWA 1QV9A 2B7BA 2QV0A 3L06A 4PRKA 2XT0A 4B73A 1ATIA 1PQ4A 2GZ3A 3IXQA 5DNAA 2H1OA 2R4UA 2C7QA 1PG5A 1IK6A 5DGCA 2K7ZA 2YJ3A 3H2IA 5KCZA 1N32B 4BIMA 5LOVA 3F5QA 1AXEA 3C74A 4LTNA 5BRAA 1JTEA 5CA1F 1YSCA 5CEJA 4U2KA 3GJYA 1J42A 4F4HA 4OQEA 1KDVA 1QP8A 4AJ1A 2YR0A 3FKJA 4PY2A 5EJ8A 4GGOA 2YWCA 1QIJA 4UBMA 2P0EA 3HCDA 3OFVA 1IRIA 3OOHA 1ISFA 5JZVA 4EZIA 4JJIA 2D1FA 1E18A 3MGKA 1QGOA 5K0JA 3EPKA 2VPTA 3OLVA 4OXXA 4LMPA 4R1NA 4X20B 3QVTA 2RI0A 3E15A 4UQLA 3AVYA 2H3HA 2RHCA 3DE4X 4OO3A 2BFPA 4LY6A 1X0XA 3SHVA 4W9MC 3DUFA 1GQFA 5KPJA 3D02A 3WMGA 3LT4A 1XTIA 5GQSA 2IUUA 1EFPA 4OH1A 4E11A 4ZXPA 1C9JA 4OIMA 5EYPB 3TWOA 1ZOIA 5IKEA 4RF3A 1B73A 1ATZA 1RAHA 2W2TA 3EYAA 3L0YA 4OJYA 4A8JB 4BZXA 1ETUA 1UXJA 4J6FA 1LRLA 4ZK6A 4KQ2A 4H7IA 5A4AA 2ZRDA 3RFCA 5HKLA 3GMTA 3VR1A 3VZCA 4AO8A 4ZZ0A 1HK7A 1BA2A 4TX1A 4LE2A 4RQUA 4IFEA 1EFTA 3K6JA 1GAEO 3CZRA 4RQTA 4PHGA 1TECE 2JD0A 4D4HA 2BJWA 3BL8A 3TQRA 3ZTWA 5GZ3A 2WHEA 4TKUA 4WIAA 4J16C 2NYRA 3D4NA 1OAOC 2VHZA 2DUMA 3I30X 5KQSA 2RKWA 3OZEA 1E1KA 2QRNA 3PD7A 2VI5A 3BA1A 3EZ6A 1V5IA 2WUFA 1VLLA 4YHHB 1ZL2A 2P41A 4XIGS 1VKRA 4TTVA 1KBQA 4O4JF 1P0PA 1MTZA 5HFJA 2BEUB 2FEOA 5CH8A 2IPMA 5LZ8A 3Q9UA 2IZ7A 3IC5A 3PJFA 5BSUA 5DBOA 3TZCA 4CL8A 5THKA 4LJYA 1EJ6A 5AXCA 3ZLTA 1HQYE 4S24A 3W4KA 3OZSA 1BWSA 2ZT5A 1R8QA 4D57A 3ME5A 3WIUA 3NBFA 1CZNA 1JBKA 1JEOA 1WKCA 2ZJ8A 3CUUA 4NE9A 4ZOBA 1GUYA 1YVEI 2J0VA 1OIXA 3A9UA 1DKMA 2AOUA 3G0OA 4FHCA 4WKBA 2J5BA 3RNLA 3FOFC 5G0WA 3UJ9A 2FW0A 4BVLA 4DNXA 4NK5A 1IRXA 2YJ5A 2ZTHA 4L8YA 3N7AA 4LJ8A 4QOFA 1VJ1A 3C70A 1QIEA 1E8NA 4HB4A 2GAJA 5EMKA 3VNVA 3UWPA 1IL0A 1BTOA 1MC8A 1V45E 2QM8A 2XTJA 3CZAA 3K9BA 4JI3B 3WJ1A 2VDKB 3ZHXA 1KZ6A 3C3CA 1DRKA 4QAJA 1QRAA 3SHTA 3I76A 2AMVA 1PT6A 5FAKA 3TIXB 1RYBA 1NSTA 2J31A 2WIJA 4Z53A 3LZCA 1DKLA 4IIXA 2EKPA 3GH3A 3LWNA 1IONA 4H4DA 3QE3A 1MJHA 1UBFA 2OHVA 2IS6A 1FSGA 1V8BA 4X54A 4UREA 1AHPA 3U4HA 1M2GA 2WJIA 4CQNA 3ZKWB 1TM4E 2Q07A 1CG6A 2OSVA 2QZJA 1R5BA 3E3NA 3WG9A 1IY8A 3MBKA 4PHCA 2P3QA 2WZBA 3AETB 4A5OA 5CDGA 1P7YA 3F2VA 4BNZA 3PNQA 3TYXA 2A9RA 1TEHA 1NVTA 4BC0A