3RJZA

X-ray crystal structure of the putative n-type atp pyrophosphatase from pyrococcus furiosus, the northeast structural genomics target pfr23
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
229
structure length
210
Chain Sequence
GLADVAVLYSGGKDSNYALYWAIKNRFSVKFLVTMVSETINANLTDLQARALGIPLVKGFTEVEDLKRVLSGLKIQGIVAGSKYQRKRIEKVAKELGLEVYTPAWGRDAKEYMRELLNLGFKIMVVGVSAYGLDESWLGRILDESALEELITLNEKYKVHVAGEGGEFETFVLDMPLFKYKIVVDKAKKVPCTSSGKLIIEEAHLESKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A large conformational change in the putative ATP pyrophosphatase PF0828 induced by ATP binding.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords N-type ATP pyrophosphatase superfamily
total genus 54
structure length 210
sequence length 229
ec nomenclature
pdb deposition date 2011-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01902 Diphthami_syn_2 Diphthamide synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3rjzA01
3.90.1490.10 Alpha Beta Alpha-Beta Complex putative n-type atp pyrophosphatase, domain 2 putative n-type atp pyrophosphatase, domain 2 3rjzA02
3FOCA 1J70A 4CDNA 2VTBA 4EFKA 5LM3A 4MULA 2ZUFA 1KKUA 2BTEA 4L2IB 4K0RA 3IH5A 5EKDA 4EG1A 3CVWA 1NUSA 2E0IA 3FETA 4PBRA 3QTBA 3P0IA 5DK4A 1EUQA 1GPMA 4MWBA 3P52A 1T6XA 1VL2A 4KPUB 1MRZA 4ZCTA 1O97D 3IVGA 1R6XA 3ND6A 2YXNA 1I6KA 1LI7A 3K32A 3N9IA 5DEOA 3VGJA 3D6UA 1IHOA 1TYCA 3CR8A 1O96B 1MOPA 4MUKA 5FO0A 2CYCA 3COZA 2C5SA 2CUZA 1Y42X 2E21A 3GMIA 2QUHA 2BYTA 2JANA 2VXOA 4MUEA 1MBZA 1OWPA 5HUHA 1F7VA 4XFDA 1KAQA 4ND6A 3TQIA 1IFXA 5FNZA 3JXEA 1OBHA 1SURA 3AKZA 1P7PA 2PIDA 4NAHA 3H9BA 2CFOA 1PG0A 2IP1A 1N1DA 3P0JA 1Q11A 4RUKA 4ZCRA 3DPIA 1NUTA 2GM3A 4GRIA 1I2DA 4MWEA 3NV7A 1JGTA 3SEZA 2WSIA 1M8JA 3D6VA 2Z3VA 3CLRC 4I6GA 3QE4A 4YP5A 1TQ8A 3ZUGA 1KORA 1ZH6A 1NP7A 4G6ZA 3RFFA 1T9GR 2X1MA 4JYZA 3SZ3A 1RQGA 1N75A 3A2KA 3IVXA 3VU8A 1R6UA 4UZFA 4P2BA 4ZT4A 1TEZA 3X1JA 2A1TS 3TQOA 1M8KA 1T6ZA 3COYA 3ILVA 5J5AA 2DXIA 2RD2A 3RK0A 2A1TR 3FHJA 1N77A 3U1VA 2V0CA 3NBAA 4CQNA 2X1LA 3ZJVA 4EGAA 4MW0A 4YP7A 2CV0A 1N2OA 4NDAA 4KR7A 3L93A 2AKEA 4DJAA 3N2YA 1O6BA 1QQTA 4ZCSA 4R2MA 1MB9A 2B7LA 4A91A 1YIAA 4OJMX 5AHWA 1YIDA 1F4LA 2J08A 5H7XA 1K92A 4ARIA 3CLUD 3IMGA 3AL0C 3ZGZA 4MVWA 1JEDA 2YY5A 1A8HA 1IH8A 3PRHA 3AIIA 2NSYA 3TZLA 3KT6A 1GTSA 1GAXA 3UMVA 3L92A 1U3CA 2AG6A 4ZCPA 1J1UA 4PBTA 3HL4A 4MUHA 1OD6A 5BNZA 1KP3A 1GTRA 1WXEA 4I6JA 2CV2A 1JMVA 3FWKA 1NUUA 4K03A 1G8GA 1UFVA 1G8FA 2DERA 1PFWA 1OBCA 1O95D 3CLTD 4MUNA 4R0NA 1QRTA 4XSVA 3LCJA 3GUZA 1YULA 4FZJA 4NAUA 5DASA 1WKBA 1TFUA 1YI8A 3RJZA 3TS1A 5LFAA 2QJFA 4Q16A 1GLNA 2H29A 3PNBA 3AFHA 4JXZA 1EFVA 2GKSA 4KKVA 4PBSA 4R2LA 4RPIA 1KH3A 1NI5A 1O0BA 1MB2A 2G36A 1X6VA 1R6TA 2QUJA 3CVXA 1B6TA 4ZT2A 4MUIA 4I6EA 3CLUC 2A84A 5TS2A 1H3NA 1O5TA 3FY4A 1N2EA 3RK1A 1ILEA 4MW9A 1IVSA 2A1UB 1XNHA 1KQOA 4QRDA 1PFVA 2HMAA 3HZRA 3OTWA 4MVCA 3MMXA 3PXUA 1D2RA 1H1TA 2NZ2A 1N78A 3COWA 3RBAA 4MVYA 3SZGA 1KR2A 2IJGX 1IQ0A 1MJHA 3E27A 2E18A 1JZQA 3IUEA 3ZIUA 1EE1A 4EG4A 1WXIA 2Z08A 4JZYA 3IOBA 2WB2A 1OWNA 3F3MA 4DE5A 1OWLA 3MXTA 5K0TA 1O95C 3UOWA 2ZUEA 3HV0A 4X0EA 4HJXA 3UC5A 2TS1A 4DDMA 1WY5A 1IQUA 1F9AA 3A4IA 3MUEA 3MLBA 1TYBE 2J07A 4KR6A 1JECA 2GOYA 3HFJA 3SP1A 3G59A 3SYTA 4YMIA 1QNFA 3IVCA 3P0HA 1N2GA 1U3DA 4MW7A 2HGZA 2CYBA 2XRYA 1MAUA 4ND7A 1KQNA 1X8XA 4PY2A 4J76A 2X3FA 2OV4A 1ULHA 1YUMA 3AG5A 3NBKA 1M83A 3UY4A 3X1KA 1LI5A 2D13A 3M5WA 4MVXA 1J09A 3FNRA 3TZEA 4L2IA 1N2HA 1PFUA 4JFAA 4QBTA 4TS1A 1QJCA 3KT0A 5H16A 1I6MA 1MAWA 2DETA 3DLAA 1FFYA 2EL7A 1PFYA 1LW7A 1V47A 1F7UA 1EUYA 1VBNA 3FDXA 1O96A 1M8FA 3ND5A 3AG6A 3FI0A 4DNXA 4HPWA 2A7XA 2IELA 2QJTA 4HK4A 3TNJA 1N2JA 2JA2A 4E1AA 3HMQA 4EG7A 2J5BA 1VBKA 3KT3A 1IQRA 2RE8A 3H97A 3N05A 2DEUA 4MUFA 2QTNA 2J09A 2PZAA 1WQ3A 3CA8A 4J75A 4YBRA 2J4DA 2PG3A 1U7XA 4ZT3A 4MW6A 2XRZA 1JHDA 1KQPA 3INNA 4EG6A 3N8HA 4NX2A 1K97A 4DDHA 4EG8A 1WXGA 2A88A 1CT9A 3ZJTA 5F23A 3S3TA 1WJGA 5HG0A 1J21A 2PZ8A 3CLSC 1JIJA 3FG9A 3IODA 4MLPA 2QTRA 3ZXSA 3CVYA 1KH1A 3BL5A 2CYAA 3H05A 4Q93A 3CVUA 3ZXIA 1M8PA 4JXXA 1VLHA 1WXHA 2I1LA 3HGMA 3Q4GA 1XNGA 3G6KA 3ND7A 1M8GA 4DLPA 1NSYA 1BS2A 2X0KA 3Q12A 1NYLA 4EG5A 1NUPA 2OQ2A 1KP2A 3CLRD 4GU5A 1XNJA 2PXHA 5KCMA 3PNYA 2A86A 4MAFA 3CLTC 4U7JA 1U0BB 4MW5A 3K9WA 1KH2A 5K0SA 1TYAE 4MUJA 2PZBA 3VRHA 1KAMA 5HUJA 2DUMA 3H99A 2DLCX 5IJXA 3I05A 1N2BA 1JIIA 1NZJA 1S4MA 3COVA 3A04A 5TEVA 5JBNA 2YWCA 3UK2A 1G8HA 1G59A 1EJ2A 4WNYA 1T6YA 4CDMA 1PG2A 2A4MA 1QTQA 2R5WA 2O8VA 4AS1A 4MUGA 3Q10A 1T9GS 4U63A 1ZH0A 4F3RA 4HJRA 2EJCA 3QTTA 4ZT7A 1O97C 1ZUNA 4CT0A 2VTBB 1K4KA 1TYDE 4ZT6A 3RHSA 1QU2A 1I6LA 3C8ZA 3IUBA 1EXDA 2QUKA 3GLVA 4UZEA 2O5RA 1FYDA 1VBMA 4ZT5A 1O94C 1JILA 1Q77A 3IDFA 1COZA 3X1MA 3IMEA 1GN8A 1OWMA 2H2AA 3A05A 2AZXA 2DPLA 4ZCQA 3LOQA 3PNVA 4EF6A 1HYBA 2CSXA 1K4MA 4F4HA 4QREA 5IHXA 2WQ7A 3SEQA 5DB4A 1GZUA 4G5FA 4ARCA 3IMCA 4NZPA 1J1ZA 1Q15A 2CT8A 1XJQA 2WQ6A 2PFSA 3G5AA 2YWBA 4KPUA 5FO1A 1ZJWA 1DNPA 3IOEA 1JZSA 2ZP1A 2Z09A 1H3EA 4OUDA 1J20A 2D5BA 1QRSA 1Q19A 4G5YA 3ELBA 3DV2A 3FIUA 1H3FA 3KT8A 1N2IA 3KFLA 1QRUA 4EG3A 1OWOA 1WZ2A 3FH0A 1M1ZA 3MLAA 4S1OA 4WSOA 1NUQA 3ISJA 4MW4A 2HZ7A 1O94D 4U8HA 1O0CA 4KR9A 1YUNA 1U7DA 1EFVB 3CVVA 2QJOA 4MW1A 2D54A 1NURA 1IRXA 4MWDA 4MW2A 1N3LA 2DR2A 1EFPA 1MC1A 1WXFA 2QTMA 3CLSD 3IOCA 4OUDB 5LLTA 4BWVA 1WOYA 2CV1A 2V0GA 3DO8A 3SDBA 3H9CA 3OP1A 1EFPB 1V8FA 4NATA 3ZJUA 1QU3A 1JIKA 2E89A 2QUIA 5TGTA 5TEWA 4XFJA 1JEEA 4DDKA 2A1UA 5J59A 5KWVA 4YP6A 4MQ6A 3LE8A 5KHAA 5J58A 4AQ7A 4H3SA 2JAXA 1WQ4A 4MWCA
chains in the Genus database with same CATH superfamily
1JXOA 1H8EA 1U0RA 3OVMA 5K03A 1PS9A 4M54A 4YMSA 3KOMA 4ZDIA 2RHHA 3ZXUB 5KHLB 2QXTA 2O2HA 1CUVA 1WM1A 2ZR7A 2ZE6A 4KLAA 3GDOA 3MJTA 3GH3A 1Y7PA 4XYMA 3K9QO 1IEVA 1XZPA 1D04A 1KEVA 5AVOA 1L6RA 1KZYC 2H5IA 3R4CA 3V4SA 1NW5A 3KYBA 4FJ2A 1ISSA 4YMHA 3OC6A 4QGAA 2RONA 1XCLA 3DZGA 3Q9NA 5KU1A 4IWXA 3SNKA 4IF4A 3QOXA 1II8A 3WSTA 2PSHA 1XKTA 3L9WA 4X66B 3QPAA 2OXEA 2BW0A 1ZC4A 1S9HA 4B6QA 2NYUA 4RL6A 4Q4AB 4UE2A 1NY6A 1WXQA 3AONB 3FFXA 5DLQC 3ZZTA 4EI2A 1SXJC 3CN7A 3FVQA 1PT5A 2A5JA 1VL6A 3CTMA 4PO3X 4UHFA 5JJCA 2O3QA 3BTUA 3UMFA 3TDMA 1JQ5A 3A1TA 4TT8A 1RJWA 2XDQA 3K1ZA 1S6YA 1PO7A 3FGOA 1HLDA 3HADA 5CDTA 1MLDA 1HTWA 4GH5A 3GXBA 2I3DA 2XCTB 2KBEA 1YDMA 1NXTA 3LY9A 1MVOA 3I4LA 3UO8B 1SXHA 3LY8A 1NBMA 3R7WA 1T1JA 3X2EA 3DBVO 1OI2A 4TLEA 5EHGA 1Q1AA 4YQEA 4BMZA 2FSPA 3DEIA 4RSRA 1TQ6A 3AHDA 1F2TB 3FYCA 3HYSA 4UPEA 4Z8XA 3MJFA 1KAQA 4PPNA 4OMUA 1TA0A 5CNKA 5EWLB 3SQOA 1C9JA 4IR7A 3G49A 3RRBA 3K1AB 4I5GA 1FZQA 5EQTA 5FNZA 1CZOA 1OBHA 1PJAA 2FPOA 3UJHA 3D8SA 1A2QA 4ZMBA 4CG0A 4X85A 2AQHA 3ROTA 3KX2A 3ZW7A 4ZALA 1ZONA 3KZCA 4YJGA 4EB3A 3IBGA 3MC1A 4RUKA 2O5EA 2B25A 2CNKA 4GWLA 3R3ZA 4LYJA 1I2DA 1TRHA 4HLQB 1E3JA 2VDJA 3SC2B 4HADA 4BKUA 1E5VA 1YE8A 1YR3A 2I87A 3CCCA 3GUUA 3KOXA 1F17A 2VAPA 1V5WA 3O90A 4XGIA 3REOA 5AVWA 2AFHE 2QDKA 1FP4B 4MPJA 4OQFA 5DYNA 3SDSA 3IEMA 2H3HA 3AVVA 1ZX1A 3OCVA 1BO6A 4JR1A 3SZ3A 3P9XA 1X9HA 3ZWPA 3UUEA 1G6HA 1RKQA 1VP9A 3VR5D 4EQZA 5IZCC 1LX6A 2EBHX 1DSSG 3OPYA 4P2BA 1K8ZB 4FD3A 4OYHA 4U02A 3VU9B 3ROPA 1B2LA 3AJEA 3NTLA 4IZHA 3U3JA 3SOPA 4BQOA 1OIVA 1E9DA 3PNPA 5FFFA 5B1IA 3WMXA 1E2GA 2L2QA 5SYAA 3W2IA 3CRRA 3KJZA 3EGXB 1FNMA 2NO0A 4OB7A 4PO8A 5FL7D 3QE3A 4QXPA 3U1TA 2RD2A 5ALJA 1UDRA 5IMBA 2R2GA 4LCEA 3LBIA 5JS2A 1E1CB 4TTRA 3U1VA 4HUTA 3PXCX 1SOVA 2RCNA 3ZV4A 4B40A 5C8YB 3QEBZ 1DWUA 5JMPA 2J31A 4NAVA 1ZGHA 4PGMA 2OCGA 3PXGA 3T5BA 2PBFA 2WYVA 4R3UC 1F8XA 5GTDA 2XCSB 4NDAA 4D4IA 4IIUA 4NBVA 3TI7A 2E5FA 2O0MA 4NXMB 3GDWA 3H9GA 1MB9A 1Z2PX 1YO6A 3C3PA 4GOOD 1C1YA 1GGMA 4A91A 4C6TA 3ADCA 1JEYB 1J0EA 2NZWA 1YNOA 2UZIR 3NYIA 4LJ5A 3RGGA 3DAGA 1G3IA 5FWYB 1WMFA 3UMCA 4OL0A 3B6JA 5HE9A 1RTKA 3W1VA 3VISA 1YA8A 4M9SA 1Z7BA 3GOQA 4MS4A 1JEDA 3TQQA 2OKCA 2PV0A 2CVQA 1IH8A 1E2FA 1DQSA 2VNIA 3GAAA 1T15A 5DWQA 2JGDB 3I32A 5ERXA 3K6SB 2PD3A 3AJDA 3E5HA 5CLFA 1UFKA 2JC3A 1GG8A 4IL5A 1CZHA 1Y3CE 3DEHA 3HL4A 1KTVA 4QQNA 2PD4A 4CUZA 2BDTA 1E64A 4G86A 4K6MA 2CLFB 3DWEX 3CO0S 3BWCA 1IZ0A 4QDJA 2HLHA 4PU0A 3MIZA 4ACBA 2FHSA 4CETA 4ZZIA 4RD6A 1BRTA 2JFOA 3M6WA 3RFCA 5M2QA 3BAZA 4OXRA 3IB3A 3A8TA 5L53A 1Z68A 4Y2YA 3HJHA 2B5OA 3FXAA 2CLOB 2PZKA 3GT7A 1NL3A 2I3GA 3WIBA 2I1VB 1STOA 4ALMA 2X9GA 4B81A 1PQWA 1YULA 2Y2UA 4PQGA 1OXUA 5DIFA 1YI8A 5CEFA 3IHWA 4DJ5X 1IWOA 1IMJA 1E6EA 2WJHA 3CU5A 1LJLA 1LLQA 3WLHA 1JLRA 5ALRA 2IYQA 2OL4A 5F35A 3R7WB 1Q0UA 1IN8A 1R9MA 3FUCA 4Z9YA 4YRLA 3NIDB 1QFYA 4BLVA 1KH3A 1MQ8B 5LQNA 1GTZA 2VBIA 2BM9A 3BXXA 3OE4A 4INOA 1B6TA 2CHFA 4QUBA 1WZNA 4M1EA 1VCMA 2EG9A 5C1DA 5LN1A 4QEKA 3WK8A 1SD1A 1C8KA 2XTAA 2FPIB 2NUPA 1WLYA 3H8VA 3N59A 4MW9A 3TLBA 3FNHA 3HFSA 3WA7A 1ZOIA 1XNHA 3NONA 3KEGA 1TNDA 4JUCA 1W5FA 1OAKA 1MIHA 4X6YA 4YAEA 5AJXA 4EY3A 2RH9B 3DF9A 2VVTA 5I3CA 5CYGA 2PZLA 3RT1A 2VF7A 2RC5A 3LA6A 3V4LA 3QWIA 3R7NA 4A03A 3EDYA 1T2AA 2GLUA 4I14A 4MYTA 4DUGD 5T57A 5CIQA 4NOLA 2SKEA 5KBYA 3DA8A 1G5QA 3EIWA 3U9LA 4RTKA 2CJXA 3E5MA 1P5ZB 3RT7A 4IIHA 1C2YA 2WE7A 1ST2A 4QOJA 1C8VB 4ZPXA 1Y1RA 4AD8A 4DT1A 2XUIA 3OO0A 5BW6B 1SVWA 1CUXA 3RKRA 7ADHA 3SCZA 4FEYA 3M6XA 5DT2A 1J2UA 4YMLA 1Y34E 1E96A 1Q6YA 1CYDA 2IV7A 4HDRB 1HDYA 2RG1A 1R0KA 1EXMA 3GMSA 1H8HD 1IQUA 1F9AA 1VRWA 4LRUA 4XB2A 3SVLA 2F1KA 3UMMA 1E1CA 1MV8A 2J07A 3KQUA 3R3XA 2QU8A 2ZRDA 3LX4A 2EG5A 4XUEA 5E3IA 1R0XA 3OTQA 1LZKA 1YB4A 4UREA 2W6ID 3DMHA 4GAEA 2YL2A 1QV7A 3W5BA 5JH7A 1KIMA 2IYWA 4AJ9A 4HLUC 4WHMA 3HRHA 2AZ4A 4Q7EA 2YQZA 2BDEA 3EARA 2ZUSA 4MAAA 5LYJA 5LQKA 3GQBB 1JYEA 2OMEA 3DQQA 5EKTA 4L4ZA 4OV6B 3T95A 2IPNA 1RFGE 1XEAA 1PZFA 3OZUA 2GBGA 3QPDA 4K46A 3DBOB 4CGZA 5U4QA 3PX7A 3T7DA 1LBEA 1ZM9A 2P91A 3X1DA 3UAVA 2GEVA 3VX4A 2QUBA 1Y3BE 2B34A 1X1BA 2GDZA 4I3HA 1PGPA 1H1LA 4D0SA 1YFKA 4O2RA 2W48A 4LJKA 3GUVA 5ALNA 3QU9A 3DLAA 2EL7A 4NR0A 2Q21A 1F7UA 1F20A 1RHRA 1E0KA 1CP3A 1E2DA 1WLSA 1CUEA 4PQYA 4R1UA 2Q4EA 3SJ7A 2GF0A 4KAFA 1Z4OA 3GLRA 4NENB 4E11A 2FDXA 3ND5A 3FI0A 3KALA 3ITDA 1DIHA 5DGHA 4DV0B 1W0JD 3DR5A 4FBLA 4HPWA 1BCRB 2ZIEA 1H2XA 1LLFA 3QKSA 5FJIA 2XMQA 3T7EA 2X4IA 4JDPA 4D6YA 5LU8A 3JQ8A 2EJUA 2WM3A 3Q3IA 5HFAA 2R96A 2HJHA 1ODJA 1WQ3A 2AXQA 4BX0A 5F21A 2PG3A 4BWYA 1G6KA 1E2IA 3BCRA 4BFSA 1LPBB 3QV2A 4DMKA 4KQKA 3AXSA 5FUYA 3HHEA 2HADA 5HRCA 1FCJA 4MOWA 4G67A 4URXR 1NBIA 2NADA 2OBNA 5T67A 3DTVB 2G25A 5CFQA 4DEXA 4REQA 3GC6A 5LA6B 2ZWPA 2FGJA 4PC3A 3RW9A 3TD6A 4P38A 2R5NA 3M33A 4PG7A 1QG4A 2YWRA 3FSEA 5DH9A 4GX0A 3T35A 2Q2VA 3ES9A 3OU2A 2W5UA 2YOHA 3IBSA 4HQNA 3BD7A 1UMKA 2MT9A 3ACBA 3HKCB 1G66A 5CB6A 3CVUA 4M86A 4AN0A 4PXYA 1NC3A 4PYMA 3HJNA 3KC2A 1L1EA 1VLHA 3G9ZA 3EDMA 3KSMA 4G26A 4R84A 2E7ZA 1P45A 3IP5A 2GUWA 2RCYA 6ABPA 1NSYA 3I9KA 5HJ7A 4OLJA 2O3JA 4Z86A 2GEJA 3FPGA 3R76A 4EJ0A 10MHA 4MLDA 1XTKA 5KCMA 2VOJA 2X5XA 2QVXX 3D43A 1FFHA 4FFSA 4ARSA 3NMUF 3KJIA 2P79A 4LX8A 3N87A 1UPFA 3FDZB 3RYCA 1M33A 2CXXA 2QG9A 2X9QA 3CUSA 5I51A 1XPRA 2H63A 2V5AA 1HY3A 1Q3TA 1QTRA 3E58A 3JYPA 1KAMA 3OT1A 4I46A 1XRQA 4PINA 4DFDA 4HAXA 4ER7A 1L4UA 1MABA 3G2MA 5CUQA 2FPRA 3GLIE 3INTA 3EULA 5IC5A 1OZ0A 3GJ6A 5BP7A 1N0VC 1XTVA 1UEXC 1WV1A 1ADJA 1PL6A 1QF6A 1CZLA 1JT9A 5A4FS 1V4BA 4Y0AA 2HU8A 3WYBA 3EFOA 1G59A 3FYTA 4EMUA 2WMNB 4JA2A 1V1RA 3H9QA 4Q3EA 1TVEA 1Z33A 3AI3A 3EIFA 1DAOA 2YJGA 3G0IA 5D3KA 4KQWA 2FKAA 3WHLA 1UBFA 2Q2WA 2YV4A 2AUMA 5ABPA 3H5OA 2QN7A 4MUMA 2R5WA 3QKRB 3G7SA 4LSZA 5C5IA 3SHTA 2JLWA 4HYQA 3B5JA 5IABA 1U8TA 1B3RA 2WDZA 3UJAA 1WHSA 3LVBA 4P4TA 2W2XA 2BMJA 4WOJA 3ZDDA 2C2WA 1E7YA 1X42A 2V03A 2DOKA 2C3OA 3L4BC 4H6PA 4NFSA 4A2QA 2Y99A 4R8LA 4TMXA 1WCYA 3JQPA 3PVZA 1IY1A 3S2FA 2FJPA 2VTBB 2UYCA 3USCS 4EO9A 2GYVA 4RD3A 4FYVA 3PQ3A 3WLAA 1IYZA 2H1IA 5JRJA 1JKJA 3T38A 1R3UA 3Q1KA 4GG1A 4YAWA 4DCNA 1I3LA 3VZPA 5H3LA 3DT8A 1AB5A 3ILHA 3BK2A 3TIGA 1RAGA 3KKLA 3ZCVA 2YJ3A 1YZQA 4J0CA 1F0PA 1V48A 1EZ4A 4FM9A 3Q7PA 2JLCA 3OCJA 3FCUB 3L0DA 3A6DA 2C3YA 3K8QA 2P77A 4QXAA 1ZM7A 3ZWNA 1TM7E 3PDIB 1SBZA 1P0PA 4X3PA 5THQA 3R20A 3KQVA 4IFEA 2H2AA 3DHVA 4NENA 1LPPA 2A0UA 4LI3X 3Q5EA 4QRHA 4Z2YA 4AMVA 5IEBA 2V3CC 3MT7A 1P1RA 5ED4A 4RENA 2FXVA 4R9NA 4N9QA 4WKBA 1E1NA 3VXKA 1FFAA 1VMAA 1QO7A 5CFOA 1U28A 1ZHHA 3OIWA 4WNIA 4ZC8A 3LT2A 4IMIB 1RM3A 4N7MA 4POOA 4G5QA 1GQ2A 4H4CA 4N8EA 4P81A 3ROKA 3ZIDA 4RNDB 2ZYSA 4B0PA 4UEQA 1SQSA 3M6LA 4FTWA 2CT8A 5EJ7A 1P1FA 4IFTA 4MHSA 2P2NA 1EGMB 4OHKA 4GZLA 5CVTA 2KJQA 1NPDA 2QTLA 3MG9A 4WDQA 2Q5EA 1KYTA 3IOEA 5EFOA 1KE2A 1JZSA 3T6KA 3ZD9A 5ALLA 1B14A 1HTTA 2AFIE 3BJIC 5AIBA 1GLGA 1EBBA 1A97A 3UT5B 4IIDA 4A6XA 2XVAA 4JUAA 4CF3A 1S89A 1QHXA 2I0FA 3C70A 3IQZA 3ZVMA 2IEBA 2ABWA 2DKOA 2H4HA 2VZEA 4WCFB 5FPSA 1TMKA 3GA5A 2HMWA 4PZEA 3EXG1 5DI3A 3ZE9A 3QSYA 4N0MA 3AEUA 2C54A 4KQ9A 3RTBA 4DWWA 4KDFA 3C7KA 2DWPA 3EWNA 4FMPA 4AJ4A 5JUWA 4RHFA 4IUYA 8ATCA 3EX7C 4G0MA 4RBNA 2EJWA 1B76A 4QOHA 5A0VA 1ADGA 2XH8A 3QLUA 2DULA 1W73A 2HHLA 3O4RA 4HUQB 1U7DA 4MYSA 4KR9A 3VTZA 5CFNA 3HVRA 4ILEA 5DI9A 4IDOA 3VPXA 5AJVB 3ND9A 4Q18A 1KYVA 5KJ6A 3MYRA 3NANA 3VR6A 4R16A 4GR9A 2OYCA 3MGGA 1I3OA 2I7DA 2VOEA 2X19A 2ZBGA 1U9ZA 5K4GA 2N1BA 1V5IA 4L6AA 1XC7A 3H9CA 1EFPB 1U0LA 5JVDB 3H2YA 3R40A 1COWD 1G20B 3ZJUA 3NPMA 1GADO 4RF5A 4BASA 2WWWA 2RJ3A 3HN6A 4MQ6A 4N40A 4RETA 3FB1A 1E9SA 1I1NA 2QUZA 4Y2HA 1POXA 1VKZA 1I7DA 1MP0A 4AQ7A 3T41A 3EVTA 3IPLA 2DQSA 3LWNA 2NPFA 1QGOA 4D9CA 4B71A 4R0MA 1GLVA 1I1HA 1OROA 5DBOA 4D0LB 2Y68A 5CAEB 1A96A 1QIMA 5BSUA 3MTDA 4K0RA 1G9TA 2BVNA 3AGPA 1UPUA 1SOMA 3Q7RA 5IJAA 2IZ5A 4IXTA 1L8QA 1NTRA 1QHYA 2CLLB 2ZJ4A 4UTRA 5CA1A 3IPRA 3ZNPA 2VP0A 2BMEA 4HNVA 2IPMA 1GP2A 4NXNB 1I5OA 2GSWA 3H42B 1IY0A 4ZO9A 4K28A 2XIJA 4KPUB 1XPOA 1K3TA 4XIGS 4E12A 1F4VA 3BGDA 3T5GA 5JYCA 4B3JA 1II8B 2HCTA 4QT4A 4ETNA 4Y2UA 4JI1B 1UF9A 3FM9A 4KE7A 1PSDA 5DOVA 3TZCA 5LU9A 3LP5A 1DKRA 4EJMA 2P0YA 1MJ5A 3KSRA 3SR0A 1EPUA 3G0OA 1SNYA 2Z3ZA 3N07A 1T0PA 5A1JA 2BMFA 4R81A 1JFLA 1ODSA 4HQ6A 2P6UA 5LXTF 3DVAA 1P2UA 1RD4A 1GKLA 3FBTA 3FYUB 4TSRA 2K2QB 1LK0A 3M4NA 2UUBB 3OLQA 4TVOA 1SZDA 2ZWOA 3WZ2A 1B16A 3QFSA 3BK7A 3K0EA 2RKOA 1EB9A 4C2UA 4GBGA 3V7UA 1SHZA 2FG6C 3ZWWA 3EY4A 4DG8A 5FUVA 4YAUA 3P19A 1VXRA 2X15A 4HYEA 4OMFG 3QMVA 4W82A 5E7IA 4BCDA 3WGIA 4W5NA 1GU1A 3MNFA 1L7MA 4ND1A 2D0OB 4B0OA 4F46A 3U0VA 3PGVA 2ZAOA 2GFQA 1DO0A 3KEOA 2C4WA 2FWRA 3CZCA 3S29A 4F5EA 2Y1DA 5JNWA 3B3FA 2XR1A 2DKNA 3KQWA 4L07A 1Y6GA 3CW8X 2IP1A 4LHVA 4QEZA 1N5DA 3P0JA 3TGLA 2ZI4A 4AWBA 1DXOA 4O25A 4E08A 4PHCA 2MSCB 1ZY2A 4OAOA 2E4YA 5BMVA 3OIDA 2WSIA 2VN8A 3HDHA 3PUJA 4UJ5A 2OZEA 3AL3A 4YDSA 3DBRA 3OJEA 2MU1A 1CNFA 1GUFA 2IU4A 2FWMX 2R8ZA 3L2OB 3LQ2A 4GYJA 3K7EA 4QU0A 1MC5A 3TH5A 1FJXA 3RFFA 4B80A 3A1EA 2XNCA 3VH2A 1NF2A 2HMUA 1C0IA 3LTNC 2I03A 5JXHA 2ZB2A 1CUSA 4ZARA 4BRSA 4DLXA 3O38A 2IF0A 3LSTA 3BMNB 4QASA 2R8XA 3TJMA 4J3FA 4BNZA 3U3RA 1M8KA 2C5GA 2V54A 3BK1A 1U5BA 4HRXA 1JFRA 1Z26A 1OXVA 4IGKA 3ZGNA 2MHCA 3DNMA 3F71A 1QE3A 2BFBA 3GEEA 4F06A 5F3RA 3PQ2A 5H4HA 2A59A 4B75A 1EQ2A 1RFLA 4UUOA 3IPCA 4WINA 1PJCA 2AW3A 2A5LA 3OPNA 1JXAA 1YD7A 1KFEB 3WK7A 1K08A 4KAAA 5TQVA 2WKRA 3W78A 1GTJ1 3QE2A 3R3UA 3WYGA 1F06A 3D5EA 1OI3A 1NDUA 2W00A 3AVTA 2FK8A 4IAOA 5DRTA 3SXUA 5HKBA 2QPTA 2A92A 4DCJA 5KYTA 2GXAA 1YE5A 2E48A 2YOGA 3NIGB 1FSPA 1V5FA 1HLFA 1RCFA 3C3CA 3GVXA 4PXAA 4R2MA 5EE3A 5FA6A 1ZM3A 1AS2A 3ITKA 1GFSA 1KYXA 1ML4A 4L9AA 3DLPX 1N6HA 1YIAA 1YACA 2O0LA 1R5OA 3R09A 4JJ7A 4RMGA 3H5LA 5CPBA 4OO3A 4DLLA 4NZOA 4OK6A 3L5KA 2Q6KA 4ZDWA 1VIMA 2OXRA 4MV0A 1R4ZA 3WWZA 4DIEA 4JAVC 4YT4A 5C4GB 1A8HA 2RHMA 3GPIA 1MNQA 2CD9A 3DZHA 2FQQA 1DBRA 4IDQA 4DNOA 2ZYIA 2DLNA 5HDQA 1PG5A 1GPJA 4KB5A 1SC9A 4R69A 1D4FA 4BECA 4LQDA 2PWZA 1OF1A 5BNZA 1Y8QB 4MVJF 3R44A 4EDFA 4JP1A 4I6JA 2YXLA 1EG7A 3NJRA 3W5JA 3IC5A 1EIWA 4RYDA 2OHJA 4OB8A 5IKPA 3R6DA 3OD5A 1IJFA 3VR4H 4BVLA 3ECSA 1G8FA 3JRXA 4XB6B 1FLNA 1XLVA 2CXSA 2ZJYA 2I29A 1OBCA 2G9NA 5JO0A 1IK4A 2KLBA 3L4BA 1PYGA 3R0XA 4FONA 4I7EA 1E3MA 2VHQA 3SIPA 3IQXA 3B1YA 2XIQA 1EFRD 1QQ5A 1OFIA 1U2SA 2JHGA 4LV8B 3KFXA 3NHAA 1DS6A 3WJAA 3ZGLA 3KOZA 3GMTA 2WNHA 3RREA 4J2HA 1WVMA 3TO5A 5A71A 4BP3A 3KQKA 1TGVA 4F2HA 2NU7B 3UHPA 2ZTHA 2ZUVA 3CFYA 1XXHE 4XPIA 1P17A 3Q6MA 4BLUA 5IDWA 2TMDA 2IS2A 5F33A 1RYYA 5KVCA 4JXZA 1TEVA 2A2ZA 3AUFA 4PG8A 2GKSA 3FLMA 4AY2A 1VRCA 1PS8A 1E2QA 2J3JA 3GLHA 4G5RA 2WBLC 4HAZA 2BP7A 1CD5A 3NM6B 1OTYA 5CW2A 4C3OB 4E7PA 3QX3A 5AI0A 2ZJAA 2G8LA 1ABFA 4S3MA 1KMQA 2FR0A 2CY0A 1HDRA 2IGBA 5GVRA 3RE1A 4E5NA 1X9GA 4Z9XA 1R12A 4YI5A 5EAIA 4LHWA 4ZVLA 2P3SA 5ALKA 1IVSA 2XYHA 4UDNA 1NW7A 3FHLA 2NSHA 4M87A 2IPXA 1SXJD 4JK3A 2GKOA 1HDIA 4MVCA 4S24A 5JRDS 3N2NA 5L3SB 3MMXA 2WYIA 2P6OA 1Z0AA 3FZGA 4CU2A 1PD0A 4CIVA 1ECBA 1UXJA 2FX2A 2R86A 3DTVD 1GT91 5HP4A 4HDSB 2AN5A 4BQQA 4YCAA 4AP9A 2Q3CA 2R1VB 4EG4A 1NM5C 1RZUA 3ZIUA 4WFIA 4UAGA 2HQSA 3NCTA 4X3OA 5T41A 3UWDA 4M46A 1TM1E 1MB4A 1XZFA 1TC1A 4Y1RB 5JYEA 4KE8A 4E5DA 1QSGA 1Y6JA 3BBLA 4Q15A 4KHZA 4XVRA 4E31A 3I45A 3UWMA 4CM7A 1ZIYA 2ID7A 4UVHA 4X7BA 5EWJB 3NG1A 4RVGA 1JVNA 1OLXB 4BVGA 4HJXA 3IUMA 2C95A 3PWSA 5IH3A 1C4XA 4CR7A 2P0EA 3STXA 1QWSA 1QHEA 5ESWA 3SKVA 4Y2TA 3NKVA 2ZM5A 3FJ1A 3O4VA 1E9EA 1SHUX 3GAFA 4NH4A 1RHQA 3E9EA 4JBHA 3E70C 4N54A 2ZE5A 3G59A 4OLHA 4KNVA 1JQKA 1RHKA 4PE5B 1RRFA 3WFJA 3ER9A 2HIAA 2EX4A 1JR3A 1OYOA 1L9KA 3OFND 3V8PA 3BORA 4XEHA 1L5KA 3SBEA 1G6Q1 3KPVA 4ND7A 1TLLA 4Q7JB 2VATA 3H4MA 1E6KA 3OMXA 1XDSA 2OV4A 1PBTA 3OETA 3X2FA 3VU9A 2RGYA 3W9BA 2O5CA 5EJ2A 1L0BA 3WL3A 1XRSB 3UGQA 3ZIAA 2PUBA 2Q8QA 4GPAA 5JNRA 1DKOA 1QKIA 3L8FA 3NJ8A 1YK1A 5YASA 5K4HA 4RJ2A 3E84A 4I5EA 4D25A 1T8RA 2B4AA 4TS1A 3L4EA 4EHKA 4ZQCB 4DZRA 3A9WA 1NNUA 4P58A 1U2DC 4X97A 3CUWA 1G2QA 2IE8A 1QQ6A 2OECA 4M0EA 4I1YA 3C7AA 5CJPA 4DBLE 3C24A 4DW8A 3DAYA 4G8DA 4D0GA 1H1LB 2I67A 2NO7A 3OQOA 2FTKE 3SHWA 3G89A 3AG6A 3PJEA 4ARVA 1DU4A 3VYWA 1Y89A 3A3OA 3I53A 3M5CA 2IELA 3GHHA 4GMGA 4MA4A 2JGFA 4TL6A 1Y9JA 1O95A 1YZFA 3K8OE 3QLTA 4JBXA 4D9GA 2V4UA 1YCFA 1RLUA 3VI3B 3EAFA 3S99A 1JAXA 3B6KA 5AOBA 2Q8NA 1SD5A 3E48A 2WOJA 3F78A 2ZJ2A 5AKLA 1NBWB 2PZAA 2DFDA 2A7QA 3KB6A 4I1IA 4AJJA 2WABA 3DOUA 2Q2QA 1Z8FA 5JY1A 5C46F 4RDIA 4H77A 3IQDB 3KXLA 4G3XA 3UMJA 5LL6P 5SYNA 2PGAA 3GJRA 1SRRA 5JYBA 4RHCA 3C0KA 1T3LA 1YRHA 2XHZA 2Y0DA 1J21A 3HA7A 1BROA 4XOUA 5EMNA 5D86A 1JIJA 1KJNA 2QWXA 2ZRKA 3THOA 3DTVA 2XQVA 3NAMA 3VHRA 4LF7B 2QMQA 3OSUA 1YOVA 1YZUA 2ZYDA 1JWLA 1MW8X 4I99A 4Z7QB 3MCVA 5GMOA 1G2IA 4Z6KA 2PYDA 2PZMA 2PK3A 3OQIA 4QU8A 3TOZA 4ZMSA 2X0FA 4LOIA 5A5DA 3ABRB 3QFHA 3GRRA 3ER8A 2FH5B 1JT2A 1WMEA 2ZI7A 3DC7A 4MS1A 4BMXA 5A7FA 5A4MS 2E4ZA 4P7FA 1B43A 3W6OA 2X8AA 1Z8HA 4DGSA 3OHPA 3R9XB 1W9HA 2BEUB 3MCWA 3NDIA 3DR3A 3RIGA 4NJMB 1N0WA 2JHPA 1FDIA 1RQLA 3N2KA 4EO7A 1SCUA 3MOSA 3RI3A 1E1YA 1MO5A 1TZCA 4YNBA 3A70A 3VSDA 3RYIA 4P6VF 3TG2A 4UVDA 4TTTS 3K9WA 1KH2A 1YNSA 3ZD8A 2DWCA 3S28A 2W2KA 5AVJA 3T1NA 4BWGA 1VPLA 2PGXA 2C9YA 1WQ1R 3VMMA 3GPCA 1O9BA 2GA8A 3OCWA 3QU7A 4WBXC 4BFVA 4CLXA 4Y0VA 1XVVA 2OORA 4EJ6A 1AKVA 3I05A 5IBQA 4EKGA 1KHTA 1QJ4A 4O0MA 2XADA 4KRFA 4C5BA 1E2HA 1I2BA 2VT6A 4M38A 4P0TA 3U31A 4X64B 1Z28A 3JYNA 1XZQA 2WYOA 3FR7A 4RL4A 2OY0A 1OTXA 2YUIA 3VH4A 1QP7A 4XEUA 3RDPA 3PDJA 4M83A 5AUQA 4N5NA 3BDVA 3VU3A 1PZGA 3A28A 2SNIE 1O6GA 4HATA 4F12A 3A4VA 3ANNA 3CG4A 3LWBA 4WY5A 2R66A 1IBKB 4R7GA 3WYCA 1NMYA 1EVKA 4AYXA 5K2OA 2VSXA 1I0ZA 4ABTA 5ALDA 3DONA 4N9WA 3T06B 3JYHA 1JKMA 1GU0A 3FA2A 3QIVA 1JQLB 2D2EA 2DQZA 4MI6A 4P4SA 2X4GA 5KNDH 2IHYA 4D4LA 1X7YB 1XMIA 3UJCA 4F3RA 4YAGA 4HJRA 3MRSA 5JZBA 2G70A 2ZE7A 4UXHA 1XEXB 1SVIA 4BNGA 1ZIPA 3C6MA 3E9RA 3JWHA 4KIJA 4ZOLA 4Z1OA 3F6RA 2NUBA 1U2PA 3O3CA 2Q41A 1P0CA 3OZIA 3HMKA 2R7NA 3AGQA 1D07A 3L7KA 4FFDA 5D3ZA 1DCKA 3BMXA 1LK7A 4NYIQ 1P7YA 3SFTA 1JHPA 1YQTA 3A4LA 5DXAA 3WADA 3WHKA 4B2YA 1PNRA 3PGMA 2CKMA 3W5VA 1O94C 1NM5A 1EUZA 3GOHA 3ORYA 2Q1SA 3GBVA 3LBAA 4YN3A 1T9AA 1UM9A 2LCIA 4ATNA 3IDFA 1COZA 2H52A 2Z2XA 2PSEA 3EWSA 1L7DA 3IMEA 4HXEB 4DTCA 2AI1A 3EZ6A 2IH5A 1E58A 2B1QA 2PMKA 3K0CC 3ROZA 2F62A 4H1WA 4RVCA 3W1WA 2X8BA 3BWMA 1A04A 4NU6A 2YFKA 3ESAA 3ZE2B 3MFQA 5B7NA 2BFEA 3H2GA 4IS3A 5HRUA 2QKYA 5CB4F 2I4RA 2GZ2A 5FUWA 4XWAA 3RAGA 3J80A 1UFQA 3ANLA 4V0SA 5I7HA 2CK3D 2NYVA 2PH7A 5HMLA 4JBIA 2DF8A 2PX8A 5HGJA 4RPLA 1GQYA 1ZNXA 3D7KA 4YAFA 4IIBA 5CH5A 1DC8A 2EFHB 2R3SA 2ZREA 2ZT8A 3BIOA 3EVBA 3ZDFA 1N34B 4URYR 4U3JA 1W25A 5A3JA 3ITEA 1YV9A 3KR1A 4EHNA 4TYQA 4OUDA 4URVR 1Y8RA 2D5BA 1QRSA 4Z4HA 4YS6A 3MRXA 3C16C 2Q0HA 3P2OA 4JOSA 4HV4A 5IZ4A 5IS2A 1NIPA 1CB7A 2BMVA 4HEHA 4LAFA 1Y6FA 3QPUA 4RD0A 3RCBA 2OUKA 1PIWA 1UC8A 2F8MA 4TSFA 4EB8A 4BUZA 2AXNA 4B83A 4BQFA 2I8LA 1HZZA 1MAAA 3K16A 1G2OA 2CCGA 5ETJA 4C1BA 1SU7A 3DLTA 4OF4A 3PQFA 1P62B 4S1OA 1Y7HA 2Q5QA 4H2DA 3LF2A 4KR2A 4DB2A 4LRQA 2HL6A 2WWHA 1FP4A 4WOBA 5AK5A 2PRYA 5DPMA 3EVGA 5FTJA 4J3NA 3KXKA 2I2BA 1SCUB 3JZAA 3S1LA 1A3CA 2Y1OA 4UBNA 3BF8A 3STWA 2BGWA 4QWMA 3FNQA 3OZXA 4LGVA 1CEXA 3ETLA 1YGYA 3B7GA 3D6AA 1A1VA 5D6OA 1YR9A 1N3YA 3M1AA 2NSDA 3BJMA 3TTXA 4BKPA 2EFYA 5BOSA 1GYRA 4O1IA 3Q8LA 4NATA 5JEDA 2JGMA 4Q3DA 2QUIA 3RF6A 1OPRA 5TEWA 1RW4A 2G0AA 2CJFA 4HGOA 2NUAA 2C7BA 3QVGA 2OGWA 1Z6AA 5DFAA 5BVHA 1SXJB 2WC1A 2Y05A 2NAFA 4GPTA 1ZUNB 2VR1A 3Q6IA 4K1XA 3FJYA 4KCGA 3KG2A 2ACVA 4DMRA 1CY4A 4OP2A 3F47A 4BO0A 2XYVA 4HXGA 4M0FA 3L84A 3L43A 2OHFA 4JU8A 1JLSA 2ZIAA 3HBJA 4FOOA 4KL8S 2Y77A 3PV0A 1VE1A 1GTVA 3KO8A 2ZWAA 1IZ8A 1CVRA 4FIDA 1GA6A 3A6FA 3A6ZA 1PSZA 5KSPA 1DC7A 3TG8A 3P52A 4YMGA 1DP4A 2BEKA 4PLCA 4DPKA 1PWHA 3MW8A 2X8JB 5BW8A 5C80A 1C1DA 4L5AA 4HL6A 2DSNA 2RK3A 4XM0A 2YHSA 2WU3A 3OPYI 4CV3A 5DNAA 1EHCA 5EJ8A 4KGZA 1DIOB 1U94A 3FMIA 4YIKA 5DN9A 1SMKA 1LTQA 2C0CA 4P54A 3DS8A 3EGIA 3M9WA 3T15A 3LW8A 3ZDQA 1J0DA 2JZCA 5D3QA 5E6UB 2FP3A 1Z4PX 2QR3A 3IPAA 4BFTA 2E5LB 2JI9A 2FUG6 1NVAA 4GMFA 4L8GA 4U6SA 1UDBA 5DSXA 3ZWCA 3CPHA 1MA3A 3U81A 4GPEA 2QZ4A 1Z0SA 1XJ5A 3KAJA 4OK3A 5IC4A 5T7BA 2QTVA 3DJYA 4MIEA 4LV6A 1U04A 4WXEA 4B7UA 5CJ2A 2JNWA 4WNCA 2ECQA 2ZVDA 3ETHA 4MQLA 5IF3A 3TNLA 4FLFA 4KXNA 3BYZA 5JD4A 1XP8A 1TCAA 4JDUA 5FBKA 3TR5A 2WICA 4MS1B 4O4HF 4KQFA 5BWBA 2WWIA 2ZULA 3OWHA 4CQMD 2PCLA 1RQRA 3CZPA 4MDHA 4TWRA 2ZBDA 5KNCH 4GSYA 3GROA 1VSUA 3KCNA 4DV2B 3A6HA 3ADDA 1B6GA 1YU9A 1DXQA 2XDQB 5G3ZA 2QPOA 4X65B 4YLEA 4FNGA 3I30X 2FMHA 1NXQA 5IX8A 4KR6A 4KODA 1R8JA 3RYIB 5JV5A 1LVUA 2BSXA 1IY2A 1S2LA 4RZUA 1UWCA 1QUEA 1XQYA 1NGSA 4ECAA 1R4NB 4LY6A 3UC9A 1GL6A 1FFCA 3VU8A 1NVVQ 4RSHA 5G2OA 1TEZA 2F1IA 3R5SA 2HJRA 4L5YA 3FAKA 1M66A 1P1CA 1GG2A 3H1BA 5DTEA 2HK7A 5CNIA 1P5HA 1QIEA 3TQSA 4DUZB 1EDEA 5A5VA 3ILVA 4CEHB 5CHYA 3DTNA 3BHNA 4C78A 1HM5A 2DXIA 3HBNA 4HB0A 1FS4A 2EZ4A 4UE3S 3KQOA 4XRGA 4UQPA 1N77A 5HJEA 4Q02A 2B8NA 2VUSA 4E5MA 1KI9A 2BBOA 4YP0A 5KDDA 1RWOA 2PUJA 4U2CA 1E69A 3OIYA 4YRNA 4FHEA 1UBRS 1ZGZA 4HDRA 1YJCA 4N03A 5D85A 1BD3A 1VLLA 3K0KA 4JYBA 4KG7A 4TVKA 2BFFB 3ADBA 1DMSA 3SLGA 1QB7A 1OX4A 4D4HA 2W22A 2AI3A 3MXOA 3TLJA 5ICEA 3HCEA 3CUVA 4QPZA 3ZBQA 2X2FA 3ED5A 4IHQA 1H65A 2HT6A 4A23A 5HF8A 2OO7A 3UWSA 2FSGA 1N8NA 4JJEA 1VQ1A 4S0ZA 2HDNB 1BAPA 2OCPA 4MB2A 5EYPA 4AKIA 1MOSA 2H7VA 3NCHA 1BE0A 1JE0A 4BHTA 2PX4A 1SKYE 4QARA 2Q07A 2EFEB 5CM8B 1ONNA 4K26A 3PQ6A 3JVUA 1KYWA 4HWPA 3ICPA 4K40A 4XGQA 4B84A 3WAKA 2X3UA 2J3QA 4CM4B 4A8JC 4I5FA 4RZQA 1HNWB 4NDNE 3UXHA 2XCRB 2VQ6A 3K2BA 4OQ4A 3SJCA 4J0EA 1UOQA 4RIFA 5FTNA 1TKBA 3KOOA 1HQKA 1I9GA 5T6BA 4S05A 3DE3X 1MQAA 1ONOA 4KFRA 5AXCA 3WIVA 1XAIA 1W44A 2BFEB 3L7OA 4XJSA 4E5SA 5FWXB 4YJ2F 5M29A 1DRWA 1X1CA 1MJGM 4TV8F 2EZ8A 3DFUA 2CCKA 1K2WA 3FD8A 3OZFA 2POCA 3K09A 2YXPX 5AFSA 3IBYA 3RD5A 2CJPA 2XZOA 5EIAA 5KTKA 4NJOA 3N0RA 5KJCA 1WUYA 2C99A 1E4EB 4H3HB 1J39A 3BFXA 3QVKA 5FBHA 4ENSA 1JQEA 2QAGA 3WMRA 2R60A 4J7UA 4X20B 4OSPA 4BNKA 3B9PA 5CG2A 2HR1A 5LNK6 4KSYA 1NMQA 4RH0A 1ZSVA 4XTRA 3UHFA 4YAOA 1ZK2A 4PBSA 4PSUA 4U2DA 4EZIA 4RFSB 1UJNA 5I5GA 1UBGA 2YC4C 1L4LA 1NC1A 3S0JA 2VP5A 3EVZA 3IUNA 1I51A 3CLUC 2GM9A 3PLAE 2OCIA 1Q0LA 2AJDA 1ORTA 1UZAA 3B82A 1EGVB 4RE5A 2VF8A 4PIVA 5KWEA 1PZNA 4LOAA 2BPOA 1GG9A 4QE3A 1I80A 2G06A 1OQAA 1SRQA 4TL7A 2WD9A 2IYOA 2OZPA 3IESA 4OP3A 2DP4E 1EAYA 2QVBA 1NN3A 3GWZA 5JFOA 3AOEA 1KJQA 2WHQA 3L3BA 2E55A 4US2R 1ADYA 4XLTA 1G291 1MRSA 2V7EA 4UNIA 2YZKA 1EUCA 1NDQA 1XCPA 4MVYA 4UTXA 2FLKA 5BUQA 1HKHA 1IAQA 2OZLA 5IVPA 1Q84A 5JAUA 1WXIA 4LYFA 1E7QA 2LGJA 1UP7A 1QRRA 1O08A 2W11A 3PX3A 4F0JA 3TCKA 4B3XA 1Y5LA 3UUGA 2FNAA 4AJEA 2O7SA 1FF9A 1YRBA 1QIHA 2ZDHA 3RYHA 5AVZA 4NBRA 2RJNA 3PYXA 1NLMA 4ILKA 2ECPA 3WGQA 3E9YA 3CMCO 1EJ0A 1MOQA 4FYXA 1JB9A 5KAPA 4WJZA 4IQ8A 2B2NA 1XROA 3LUJA 4KBYA 3SAJA 2JH8A 4KX3A 2QG4A 4YUWA 4QNMA 2JJ8A 4YMIA 3I9FA 4AUEA 1R0CA 3CCFA 3CGGA 3E5NA 1GD1O 4AJHA 3D7LA 5A0TA 3AHHA 3THSA 4AJLA 2HGZA 2FN9A 3LCVB 4YONB 1QYWA 6YASA 2WSMA 3HJUA 3QKRA 2RBEA 3DVSX 3OZAA 2ZYGA 5DXFA 3GPDG 5CMLA 4HHEA 1AGXA 4GDFA 4Q48A 3ZLJA 1N4AA 1Y7LA 2AJBA 2PUTA 4QU5A 4ZQBA 3QEJA 1TJ5A 1E5XA 4LGYA 5JFGA 1YB7A 1UMCB 4L2IA 1DKPA 3S8MA 1E2JA 1MRNA 3GNSA 1A72A 4S1PA 4QBTA 4ZYVA 2OV8A 1THGA 4M9ZA 1IBRA 1NQAO 5ICMA 3ENZA 3QKWA 1JLLA 1NLUA 2BR3A 2J7PD 2HPZA 1WXXA 3ISVA 5KSOA 3HE3A 1QOQB 3VTFA 3EEBA 3FOFC 1WZCA 1JFFB 1M34A 3BE6A 4IRXA 4QATA 4RAOA 3IO5A 3LNTA 5JECA 4LG1A 1RM5A 2F67A 5DBGA 3ENNA 4FI3F 3NGLA 2OWEA 1XLUA 3VZBA 1A7AA 2FZKA 2W2OA 3PBKA 4LJ4A 4D5EA 4P98A 4OJNA 5D84A 5JZSA 4JI2B 3I04M 1PJBA 2RHRA 1DUSA 1L4NA 4F3NA 1C9NA 3CA8A 1TF2A 2WKSA 1GXSB 3LP8A 3ZQKA 5IYZB 2CGEA 2QTVB 5AM4A 3BXZA 3EXFB 3E22B 2F9FA 2PLFA 2YV5A 3DC2A 1H1DA 3GLTA 4LEIA 4KMSA 4AYWA 3P8ZA 1SB9A 3KAPA 1Y5IA 4ONEA 1DB3A 1CULC 2VYFA 3ZJTA 4M0MA 2GN2A 2D5CA 1WJGA 5JPCA 1ETUA 2FEXA 4HVTA 1M0SA 1L5HB 2N3ZA 4NCKA 4QOGA 3RFUA 5DM60 2QMOA 2W2LD 4PGAA 4B4UA 2Z6UA 1GZVA 3CVYA 3N7TA 3IILA 1CZUA 1ZMXA 4PX5A 2EBUA 3MWLA 4O2AA 2PS3A 1GRQA 1Z4QA 4UFNA 2WM9B 1G21B 3D7NA 4FX5A 2BR5A 2NNWB 4MQUA 5EFZA 5K3FA 3Q4GA 4C7XA 3C2QA 4RTJA 1XNGA 2FSSA 3RPEA 1OR8A 3WLRA 4A15A 4KWTA 3LA8A 1NPTO 2AD1A 3NAZA 5HUQA 2QU7A 5LZ8A 3OBBA 1V1MA 1WA5A 5DNUA 5JSYA 2ES4A 3ONDA 2VJAA 3MSCA 5DE3A 3NAQA 4QLBA 2Y1FA 3X43A 3EG9A 2C4HA 3E05A 2WD8A 2IIPA 2X5JO 3H2ZA 1AK1A 4XQ9A 5KAMA 5LP1A 2G80A 4UEKA 5KTOA 1OY1A 1K9VF 2ODBA 1IBSA 2Q3FA 1Z29A 2YFQA 4FFRA 4RCZA 4B76A 4AJNA 2IQ5A 1OU4A 3U7FB 4PVDA 1D6NA 4YRGA 3BM5A 1RYNA 3CH5A 3LC2O 1UKBA 2W2KB 3H5IA 4MVJA 4NHEA 2XHEA 4LHXA 1JIIA 3VBCA 4X8OA 2UZ0A 1RSZA 4FDUA 5JISA 2MSNA 3KZ1E 2PT5A 2RAVA 3U44B 1C1XB 1YBVA 1MIOB 2B6NA 3AIOA 3LQ1A 5ALYA 5F5NA 4ZV9A 7REQA 5FTLA 1QG0A 2PA3A 1Z9BA 1QO0D 1E4VA 1SEVA 3HP7A 5EXEA 5C35A 1DT5A 1W30A 5U1PA 4WV3A 3WFZA 4WACA 2FRDA 2H6EA 4DV5B 5BV2P 5H8WA 1X7XA 3G17A 4M0LA 5CYFA 4ZAGA 5LXTA 1RZRD 2B61A 2P9CA 4JCCA 5J4KA 4QKQA 2BEWA 3DNPA 3PXAA 1XZMA 2X86A 3LZ6A 1AIPA 3EGVA 3VZRA 3GGPA 4ZIRB 5KYXA 2V8OA 4UMFA 4X6XA 3NEYA 2IXBA 2W83A 3AJAA 4OB6A 2AUTA 2VRWA 3SSAA 2CLIB 2IXTA 3G5UA 3NALA 4NNOA 4EJSC 5A5FA 1CBUA 4BLOA 2I62A 2HMTA 2J67A 4CDRA 4B34A 4LVOA 3DKVA 2HFJA 4DNFA 2UXDB 2WF9A 2YTZA 2ZXEA 5I7FA 1FTYA 4TKVA 3GLVA 2XBMA 3KJNA 5H81A 1NVFA 4MLCA 4N49A 3VTAA 2DBYA 1LS6A 2IYSA 2WJ4A 2Y92A 3D31A 4MWOA 4QPCA 5CLIA 1AMUA 4HYTA 1D09A 4YAJA 1OZAA 2WM8A 2WQZA 3A9VA 1MNAA 4I55F 5ESXA 4NSNA 3ZGOA 1COWA 1AS0A 2AJTA 4K88A 5KDOA 4OJTA 4QECA 4IO1A 2WR8A 5LZ5A 4IV5A 1AN0A 4UEOA 4R05A 5K0NA 1P2TA 2WYUA 2FSHA 2OSBA 3V34A 2WZBA 2XITA 3AJ8A 1X92A 3PJRA 4EUFA 2VTDA 4EAAA 5TQ2B 2FPUA 3EGCA 4NG5A 1UCFA 3DLHA 2IHZA 2QVGA 2XUOA 2B9EA 3JY6A 1TC2A 1Q83A 1JG4A 1Y33E 1Z0JA 1PJQA 3EGWA 4UARA 2W2QA 5E9JA 5L9AA 2WZCA 3PWTA 3Q15C 5JDCC 4FKMA 2R8OA 5DJ5A 4Y9TA 3ZCRA 3AY6A 3QUAA 3UAXA 3VR5A 5AK6A 3UMRA 2PGJA 2C9ZA 2YMPA 1BJKA 1T5SA 1SZPA 4RGBA 3SM9A 3I0MA 2Y1GA 2CFIA 1RXIA 4CM1A 2UVPB 3DD5A 3W3AA 4RHXA 1OAOA 5BUZA 1SBIA 1B4DA 1H3EA 3X1XA 1PAUA 1SPXA 4IJ6A 1WKVA 5J40A 3KE9A 2CNWD 1XRLA 1BEZA 1FX0A 1RCUA 1TMGE 4G5YA 4P8RA 4Z0NA 2BKAA 4QA9A 3E2IA 4GKBA 4BZXA 2QSUA 3HR7A 4OSOA 2B36A 3OQNA 3BBPA 4RFVA 1C7FA 1VHWA 4UULA 2X0DA 3T0GA 5JASA 3DD1A 2LR0A 1H9CA 4EAQA 4JGBA 2B2CA 2D5AA 3NHUA 4KLRA 4V0MA 5ADUS 4YCCA 1JHXA 1GWNA 2D8MA 3IBFA 3OZBA 4M0DA 3TL2A 2HA6A 1M7GA 1Z36A 4FYMA 2G08A 4MUYA 1TKRA 2V5VA 2EATA 2P9TA 1ZOPA 1XFAA 1CUZA 2OQVA 3VDMA 4ZFNA 4IBOA 1OIWA 1NRJB 1U3FA 3EH1A 4BNHA 1ZICA 3UAGA 3HJTA 2QRLA 5JS7A 5KTSA 4D92A 3TIIA 1R9NA 2V3VA 4R8SA 4TV9B 2D3WA 3CISA 2J30A 4GYKA 3RTEA 1V4NA 4TRMA 1Q6ZA 3UT5A 3NTXA 3QX7A 4DLBA 1BMFA 4PNZA 2BZ0A 1VECA 3D8HA 4RK0A 4V0LA 5J59A 4CQLB 2WSBA 1IUPA 1XXLA 4TKMA 1E3EA 1GT6A 1LF0A 1X7GA 3BERA 4B33A 3DQZA 3IOMA 4FNOA 4II3A 4PX3A 1PNTA 3EZLA 1WSWA 1RR6A 2D1YA 3L06A 3NT5A 3P5SA 3FWPA 4ZTUB 2ZAGA 4YFYA 3U16A 1IL0A 1ZW1A 3QVGB 1OZFA 4FGSA 3KZKA 2P2GA 2BMDA 2W2TA 4AIIA 2DY0A 4L2IB 1SCJA 3M34A 3FDJA 3QYAA 4HLNA 1GTMA 4TQGA 5FIUA 4IJWA 3RT9A 2MJLA 4D8WA 1PTJA 3NUGA 3C74A 3QY0A 4E3WA 3FCOA 3VH1A 2O0HA 1G0NA 3K70C 2GAJA 2ZYUX 2I8CA 3RSCA 4PV7A 3QHQA 2A33A 3AFNA 2QLMA 3NEPX 1GM5A 3P0EA 3QXHA 2GBPA 5AKHA 4R8MA 3F98A 5G40A 2WWYA 3ND6A 4HSGA 1KJJA 1H8ED 1KI6B 4C01A 2YXEA 2YWGA 1SB8A 2B94A 1O4WA 4IDBA 4EARA 5CITA 2UXBB 1E3WA 5FAKA 2R00A 2QYTA 4O5AA 4NC9A 4GYWA 3CH6A 1FZTA 3PPYA 3QA3E 1EK2A 2GVZC 4JQYA 4CHTA 3I9OA 1M74A 4MJLA 3L0YA 1CPYA 1DOAA 1JDZA 2QN1A 1QIGA 3N0XA 4N39A 4B2LA 5HVNA 4KR3A 4X5OA 1N5RA 4C4ZA 4GMXA 3VOBA 1UANA 2PGNA 4GLOA 4DLSA 1ODIA 3UPTA 5EXSA 2J45A 2YJNA 3I1YA 3D3KA 1PK9A 3PF9A 4QPNA 2XEDA 1SKMA 3PEFA 3Q3CA 2GHRA 2BFDA 4BJ5A 3K6SA 3TQIA 3CYFA 2XLBA 2PLWA 2ILVA 4D57A 1BS1A 3UKJA 1VKOA 2IUSA 4U7TB 1VI2A 2E5WA 4L6IA 1RLTA 2UYGA 1VLVA 2X5NA 2N46A 4RF2A 1FTGA 1N1DA 4B73A 3ZZUA 3UW3A 1HRDA 4JLOA 1KDZA 2HJGA 5IM4A 1E2UA 1QDUA 1W88A 2O8CB 2VF5X 2FWNA 3HBLA 3K6KA 4FHGA 1TCVA 3DMGA 3WKEA 1NP3A 4MP8A 2JLZA 1KOGA 4UUQA 1S2MA 3MJ4A 4YP5A 2HIMA 1ADCA 1QWOA 3HNOA 4L4UA 3SX0A 1XZCA 1VCOA 2WMDA 2X1MA 4DMUB 1ARZA 3PC3A 4CKEA 1WMDA 4CLRA 3IXMA 1UFOA 3E7FA 3B3JA 4J4HA 2A0YA 2YV2A 2XWQA 1GVHA 4ZT4A 5ALVA 5CDFE 3ZHYA 3H3JA 3CNQS 4OBEA 5DNDA 2XNDD 3GP3A 5CM9C 4Z3DA 1ZI6A 3SI7A 4L8FA 1P2DA 2HDHA 3M7IA 2WUWE 1LDYA 1QF9A 2FPXA 1DTSA 1U8AA 5J5AA 5I3ZA 4XM2A 3D54D 4Z7NB 4JIGA 4MUXA 4ZEOA 3AUUA 5TC4A 4AX8A 4J1TA 4JP2A 1YASA 1DBSA 5H9VA 4WXPA 4GOJA 1E66A 5D8DA 3HSKA 5TF4A 1O57A 4GL2A 1Q7GA 5GZ6A 1CZRA 2AF4C 3BAFA 3LZCA 1IZZA 1LBTA 3L7DA 4LSGA 3V2GA 1VZ3A 4D98A 5A6SA 4XWKA 1PK8A 4ZYYA 4BFZA 5K0EA 5DCWA 1R9JA 3BMQB 1X0XA 3QX9A 1KEZA 3DEFA 2G9QA 1E1QA 1L8OA 1Z7YA 3DMDA 3IJRA 5LLSA 1Z7EA 4JR0A 4Y9UA 2WIBA 3T61A 2AEMA 5LQJA 5J1TB 1K92A 5LYJB 5KKCA 1RWMA 3R3HA 821PA 3AHGA 5CYPA 3GPBA 5BNFA 2VBFA 3VR2A 3ESYA 2F3TA 2JAQA 3TZLA 4F2DA 2PSSA 3NNDA 1V8BA 4TRNA 1GTSA 2BMWA 3L92A 4G1EB 3MD9A 4I9UA 1J1UA 2ZYWX 1G5HA 2CE2X 2PR2A 3MMPA 5KYUB 1RJFA 3CXRA 2F8LA 1GZ4A 3EW9A 4MKFA 4ZZ1A 1EDBA 3FWKA 4LXYA 4MWSA 4EY8A 1UFVA 5EMLA 2XLCA 1M5RA 5KYNA 1U8YA 2O9JA 1K6MA 1GU7A 1U1EA 4NYJR 5EJGA 3O0DA 1R0WA 3VYUB 3ZLBA 1Y3HA 1E3WB 1ISGA 2KS6A 3EFBA 4C7OB 4QFMA 5EGSA 4TMZA 2B1JA 2G82A 3JQQA 4BP9A 4FZJA 2GEKA 3FAZA 2UYOA 1NMEA 2XPCA 1PTKA 3IFSA 3Q7IA 3EUAA 4I3FA 2HQBA 2YS6A 3C8MA 4P9NA 4REOA 3OUUA 1BE1A 2WIAA 3PRKE 4A8JB 4IIXA 4PTYA 3QG1A 4A6EA 1W47A 3FKQA 2QAIA 1AGNA 1YQDA 1B8OA 2IGTA 4KKVA 3EK2A 1CV2A 5K8IA 1R8SA 1WCXA 1WNTA 3JQGB 2GERA 5BWLA 1SVLA 1UKZA 3GW8A 1VJCA 1FTNA 3D4LA 1VE9A 2A94A 5CT8A 5D1HA 5HKLA 4AXXA 1E0DA 2WAYA 1T4MA 3IUJA 3NC0C 1N36B 1ZD9A 4OHFA 4RFSA 3UB3A 2VWHA 3IT1A 1MC8A 3LUGA 4UQOA 1DKNA 1RRCA 5CXUA 3VOTA 1NOKA 2JIMA 2CCJA 2WTXA 1JLHA 4TTJA 5CVVA 1IZ9A 2JIBA 4HVLA 3T3NA 4G8JA 2LV8A 1IDOA 3D7RA 4R5MA 3T8YA 4PC7A 2YMLA 1GGEA 1D6MA 3QXJA 5FI5A 4US0R 5IARA 4R9SA 4E22A 5D87A 1KR2A 2G1JA 4XASA 3RROA 3TL6A 3B70A 4NH0A 1CE8A 1L7AA 4TN5A 1NULA 2XXAB 1GAWA 1R5BA 4PO1A 2PKXA 1T43A 2X8WA 3K73O 4W9RA 3BGOS 3OZEA 1KY2A 4PZZA 5C52B 2RMKA 3ZWAA 3ZY4A 4F3CA 4FPXA 1AQYA 3UC5A 1U0NA 1WY5A 2FMFA 1HNNA 1UPCA 2WD7A 1X70A 4BZZA 3KOUA 4PZDA 1J8VA 3NH9A 1VKHA 3ZWKA 1A9YA 4PSAA 2H1SA 3EVNA 4NV1A 2AR9A 5TS3A 5FV4A 3OY7A 1IDN1 1N2GA 3ZV7A 1Z18A 2V9PA 5JE8A 4MS3A 1PL0A 1DX9A 3RWBA 4F4UA 3LSYA 1PKEA 3F9RA 2X9VA 4HC4A 2VHWA 3R74A 4CI9A 1NNSA 2C5BA 1SCKA 2D13A 2P4UA 3KD3A 1GYPA 4QGGA 4WXMA 4Y6OA 4G1BA 4DCPA 1FYXA 2ZJOA 5AJUA 3B9QA 4LN1A 4FHZA 5G02A 4DZTA 2NTNA 1V11B 3OX3A 4NZZA 3G6WA 5P8WA 3W05A 4OI1A 1YHNA 4I50F 4IDPA 2WY2D 3STVA 4X44A 1F48A 1I6MA 4PHHA 3R5KA 4KZKA 2GJSA 3BRWA 4JP8A 5E2AA 5GAJA 5IT9A 1V47A 3NFRA 4KQJA 4NIMA 4KTVE 5I5EA 2OBBA 3I9V1 3RJ9A 1REQB 4X8LA 2I2AA 3C6BA 4H31A 3VO9A 1Z4KA 2QS9A 4WY2A 4ZI7F 2Q3HA 4HK4A 2VJMB 1N2JA 1AKWA 1SPBS 3BCHA 4HWTA 2QZJA 3QV1A 4M89A 5IWCA 1YL5A 1C30B 2NV6A 1C9DB 3SXJA 1JXMA 3PEVA 1YZNA 2HRBA 3JQDA 1W5TA 1XSEA 2WNSA 4HZUB 1DKUA 4D9HA 4ARUA 4ARBA 3TB6A 2KBFA 5EP2A 4W5RA 1GUAA 1UBMS 3E4CA 1JL3A 1K97A 4LZOA 1JPJA 1ZD1A 5EUMA 1Q44A 4RWEA 5IT5A 1GZ6A 3G0HA 3T9AA 4DV7B 3MB8A 2J8ZA 4O02B 3BC1A 3AWDA 4KE6A 5ICSA 1WXDA 3R3SA 3JSAA 1IG3A 1V8PA 2NTVA 4M1TA 4C1NA 3SYKA 2JAPA 3ZTTA 2QN9A 3HKBB 5TQ0A 3HKDB 2QTRA 1ZD8A 5TV2A 3RKUA 3TW0A 4EYQA 3AM5A 4GBED 2O48X 1XQ9A 1PRYA 2QHXA 3VKGA 2WAOA 3VHXA 4RQAA 4PZAA 2ZRIA 4DZZA 2H31A 1IC6A 1P3Y1 1GUBA 4GGOA 1VG8A 5EIBD 1NUPA 1LCIA 3TK1A 1TUBB 5CFPA 3K70D 3D3JA 2RKWA 2C4NA 3M49A 4RM3A 3RIYA 3H16A 4V03A 3RVKA 1UDWA 3SIWA 2M2IA 5HWSA 2CUTA 2ZRGA 4GOXA 4DR4B 4KO4S 5A2GA 5C8YF 4OIMA 5BV8A 3AJ9A 2W2PA 1TYAE 3BGSA 2C1EA 3M81A 3ULKA 2FZGA 1YAJA 2DUMA 3DO5A 3FLBA 4I4TA 4JWTA 3C6ZA 4B7ZA 1J5PA 3FCSB 4YQFA 5HM8A 1V3TA 2BF4A 4M9RA 2XXAA 1RXEA 2Q5OA 3DL7A 3IBCA 4HFNA 1OC4A 2P90A 4ZTZB 1H6DA 2JGKA 4C7MA 1JB1A 4L4YA 3T7RA 2XZPA 4G9EA 3II6X 4WNYA 1NG1A 3AKCA 2VHZA 3K0FA 5EJAA 4HAVA 4TZTA 5JROA 1RWVA 2WUDA 2XYRA 4N7BA 3ESXA 4R31A 3GZTB 3W5UA 2HCRA 1KPGA 1R6BX 2VPXA 3CRW1 3N5KA 4JQOA 3EFEA 4N5IX 4RHEA 2A57A 2IZ7A 5FT9A 4BE7B 4EZEA 1JYFA 2CN1A 1EI9A 1WE2A 2GQ0A 3DBLB 4AF7A 4CL8A 1ZK1A 2XWPA 2Y0BA 1T8WA 3LCUA 3EIUA 4S1TA 5LIRA 4EMSA 4QGBA 1OREA 4DV4B 2HJSA 2XGGA 4CT0A 2F1HA 3U4HA 3TVYA 3C85A 2L17A 1YDGA 1FA9A 3SX2A 1QU2A 1QAOA 1UWLA 3GCXA 4CI0B 4RQUA 4QJ3A 1QYVA 1XDBA 3GCDA 4C3VA 4B85A 4B46A 4ZO7A 3K6RA 4CL0A 1UZMA 5CLJA 2QIPA 2XUPA 2OHIA 2O59A 1S7CA 3BRSA 4US1R 3PEEA 4E1BA 5AVRA 3A9TA 1TA4A 3RS7A 1SK8A 4C7OA 1GCOA 4EUNA 3ENVA 5F2EA 2ODQA 1W2HA 2C4MA 2I6QA 3KZXA 3VPGA 1AMOA 2VWQA 3NDBB 2PX2A 1EFUA 1Q0TA 4C6TB 3W5AA 3WO0A 2YZMA 4NEQA 2OAP1 1RNLA 4A6PA 3BPSA 1NX9A 2GRJA 5FB3A 1TM2A 1N6RA 1V26A 4B5KA 4LJ6A 4OATA 5GV8A 2IXEA 5HXAA 4EHLA 1PLLA 5DB4A 2ORVA 4L50A 3ICVA 5HKAA 2BIFA 3DYIA 3FI9A 5FLKA 5GOTA 3JYLA 1Q0SA 1EU1A 1U9IC 2GWHA 2W0MA 4NZPA 5G1PA 2YHBA 4CQMB 4EGSA 2PE5A 1GQQA 1HFJA 4FFWA 3QVTA 2YWBA 3KU4A 4ED9A 4Z4FA 4RXUA 2VZ9A 3Q85A 4P4NA 4UFPA 1GAQA 2PMDA 1FDRA 2H0QA 2Z09A 2NU8B 2ZJ5A 3OJXA 4EITA 1XDZA 3F3SA 2I3ZA 2R84A 1AUQA 3SZLA 2AFHB 3KT8A 1QKKA 3LHIA 2O2JA 3I2KA 2ZRMA 3CJRA 5DOZA 3T34A 2EAUA 1OWOA 1T8UA 2PTGA 2GXUA 3HUDA 4AQDA 3ABSB 3MLAA 4G89A 4FDLA 5K3EA 4BO5A 1ZNYA 4ZQHA 2PN1A 4WXHA 2J32A 4CMIA 3ZCTA 3IYLW 4UPDA 5BSKA 3B1FA 2A0FA 4M98A 4CMAA 2HXYA 3FNEA 2X77A 2EJVA 4H59A 4AK9A 4GPD1 4K6OA 4LI0A 4UHCA 3W2EA 3QE9Y 4HQLA 3E15A 3H1FA 3P9YA 5CVCA 3VR1A 2QZ9A 2WUEA 1N8KA 4HLUA 3H2BA 3LZDA 3ZHSA 2DR2A 3TOCA 4JB2A 1RZ3A 4Z4CA 2P69A 4AKHA 4OUDB 4ZV7A 4BWVA 2C3MA 2VS1A 3CSSA 5CT5A 3NKLA 2PCJA 3HEAA 2AEFA 3OEEA 1RPTA 2PO7A 4ZU3A 2AXPA 1CJUC 3I5YA 2X13A 2ONCA 3UYKA 3WJ7A 4ALKA 4AROA 1KOFA 1P75A 4MKXA 3O8QB 2R11A 3KCQA 3QLUC 3LLSA 5J2TA 1T5LA 2YZ7A 4WEOA 4LZWA 3E4DA 5LB2A 3PVSA 1Z74A 4XVCA 4RS3A 4CEJA 3FOCA 1YMVA 3Q8XB 4U2KA 5KQSA 4W8GA 1NFFA 1P44A 1KIFA 3MOGA 5A6VA 2VDLB 4FZVA 2AK3A 3EXG2 3ZOKA 1SUDA 4I5IA 2JFNA 2C9OA 3O84A 1S8NA 5KNCD 4YCNA 3CVWA 7MHTA 2OD7A 2CVHA 3P71T 4KQGA 2Y3IA 3FLEA 4GP6A 5HRAA 1U5BB 1SG0A 1VYHA 4KO3S 4GQBA 3T94A 4J1TC 1NVTA 3I1FA 1CS4C 5EZQA 4B2PA 3PHIA 5DK4A 3U4DA 1SC1A 1LDBA 4MMZB 2H4ZA 1YE3A 3V8BA 1JH8A 2DR3A 4R2HA 3P0FA 3CUYA 3HCCA 1MRZA 1HG0A 3KUXA 1MO4A 5AP9A 5B6JA 3QYPA 2GS9A 4RDHA 3I2FA 5HOEA 3TAXA 5L45A 1U4SA 1N0HA 3R7SA 5GADl 4CL3A 1NJSA 4B9AA 5BRJA 4P0QB 5J9FA 1ATZA 3UBTA 2BDUA 1Y9ZA 2FEWB 2K87A 1GZ7A 1US8A 4D8YA 4E03A 4MKGA 2B4YA 2OGZA 2RK6A 4CCAA 5ITZB 2FK7A 2ZZMA 3MJSA 3ZDZB 4PYNA 5DLEA 4FU0A 4K9RA 2C5SA 3JATA 1QZXA 1CQZA 2O52A 2LIVA 3A6KA 3F96A 4QUAA 3FN4A 4GHWA 4CNQA 1YMQA 4I5DA 1FSSA 1M1NA 4MZDA 1V71A 2HRRA 3TSCA 2ZVJA 4MRPA 1MO2A 3V97A 3ZCPA 4AZTA 4YCLA 4KQMA 2YY7A 5F3DA 4CT4B 2BGJA 1IHUA 1XTIA 2HUPA 2IY8A 3KKQA 2ZSEA 1X7DA 2JEOA 2IT1A 2QNBA 3W1EA 3WO1A 3RUCA 2EL9A 3N8IA 1D8TA 3T3EA 2CDRA 2C2KA 2VO1A 3JARB 5L3QB 1IFXA 4HEQA 3SF8A 1ADFA 5HIKA 2QRKA 4IOKA 4I1SA 4M7OA 4WD3A 5IU6A 1S2DA 3BD8A 4U7PB 2G1AA 1GEEA 4OREX 1RAIA 4NAHA 4CM8A 3JAMA 1TO1E 4CLOA 2E3JA 1U2GC 2ECFA 3D0QA 1U9YA 4MIOA 1DT3A 3ZW9A 2GTHA 4B6JA 2R7MA 4DA8A 4ZCRA 1DEKA 3DPIA 1NUTA 1VP3A 4OHUA 2E1PA 5KB3A 2EW1A 2HSJA 3NR2A 3S81A 3LL4A 2A8YA 5HFJA 2Z3VA 1WEHA 1JUDA 2Q8PA 2WB4A 3RC9A 5J63A 4BX9A 3THXA 3V4ZA 4B17A 3S2ZA 1D1QA 3OJLA 4IDEA 3CX7A 3ONEA 4L9SA 1PW7A 1C7JA 4U2BA 2WKPA 2HU5A 4DANA 1GPWB 4L85A 4TL9A 3I1IA 3GFSA 2NU7A 4UZFA 2DAPA 2YN2A 1QQBA 1T5OA 4ISCA 4R6WA 3LS2A 4ZA2A 3TR0A 4GVXA 3ROXA 4P34A 2YN4A 1UOOA 1YC2A 3NO4A 1D2GA 3TSWA 3QI2A 3VM6A 4U7DA 1EVZA 3GDFA 3QPCA 4RPCA 2IFTA 3FPJA 4ON9A 1T25A 3CB2A 3HKCA 2C04A 5ICCA 3AKEA 3IHLA 2C31A 5EP1A 1BW9A 4RACA 3EEYA 2X1LA 4CQNA 5IEJA 3R7LA 5MN6A 1QS0A 2YZ2A 1HT2E 4RXMA 4K2AA 3MZ0A 4F45A 3N8DA 1QQTA 6PFKA 1P18A 4FR5A 1VHQA 4Y30A 1P6QA 1E3LA 1UKEA 2IW1A 3L8CA 5LOVB 1SKQA 2VHTA 3PGXA 4BJ3A 2I65A 1Q3KA 3U4IA 1T5BA 3C1TA 3COSA 1RPNA 2D2VA 5ED0A 1KFKB 5LOVF 5LPNA 5SV2A 4NOMA 4OYRA 2AFVA 2OYSA 4TWJA 4DGQA 2WJAA 1V7QA 3UAYA 4C4YA 3IP7A 2IHJA 2OAGA 2CDBA 3PRHA 5HHTA 2NSYA 5JTUA 2VT7A 1GAXA 1K7XB 3VZCA 1OXMA 2CHQA 1IM5A 4KYTA 2IF2A 2QBYA 2NWQA 4AM8A 4FDVA 4UHKA 2TYSB 5DCUA 4R40A 3ZHQA 3A9RA 621PA 2XKKA 1J2EA 1WXEA 3PI6A 2XVMA 4S1NA 3E7WA 3HKEB 4YRSA 2JGNA 3AYXB 5K09A 1G8GA 1KKMA 4L72A 4UTNA 1SHLA 2L19A 2POQX 3CZ5A 3PC7A 3FZYA 5KYUA 4B6FA 4NTZA 2FRVA 2CXUA 4UHEA 4WKOA 5CBPB 4PZ0A 3BFJA 5IFLA 1MR3F 5KIAA 1DQNA 4S2EA 1IUOA 2B3TA 2AF3C 3SC3A 3GEMA 5J2UA 3G2LA 4MUNA 1GGFA 2COEA 3EWAA 3JALB 4K9OA 4QO7A 4EWLA 1DDGA 2ZIZA 4OU4A 3DULA 1Q1ZA 4KP7A 2HHHB 3KP1A 2ID8A 1GFZA 1NJ2A 5DASA 1TFUA 2EQBA 3K4HA 4EECA 1IPHA 4Y3UA 3FSGA 3G0GA 5DT9A 1AA6A 2GZSA 1N5MA 2LKDA 2Y1EA 3ZS8A 4AC9A 3AFHA 4J29A 4OQMA 1IAVA 2OCKA 1EE2A 3DPUA 4B3FX 1YBHA 4D4MA 3PYMA 3GJXC 4RPIA 1KEUA 5EXTA 2JFGA 2QM0A 3O2SB 4HOYA 3C8UA 3DBHB 3LJKA 3NOXA 4MIKA 2JJQA 3V7NA 1PVVA 3KKNA 4PAQA 2WWVD 4IG4A 3QHPA 1QLHA 3WHIA 2ZDGA 4JC0A 3C87A 4M8LA 1TFRA 4D99A 2NMVA 2VTVA 1HE8B 4LYEA 1QV9A 4FZ5A 4C6HA 3O8CA 5HBGA 4JKIA 2DHQA 1GPUA 3WDSA 1TRKA 2MWMA 2PVCA 2XE6A 1HT1E 3ZKWB 2BE7A 1L8XA 1SBTA 1GN9A 3CLVA 1KI8A 2AJCA 1VLQA 4RKQA 3KLBA 1Z08A 2BEVB 2Q46A 3ACDA 4OM7A 3T7JA 1BQ4A 2R44A 3SVTA 1DG3A 1NXOA 2E18A 3E0XA 5AW6A 2F3SA 6ADHA 3H1TA 1CR0A 1W4AA 4YUYA 3IRVA 4Q3AA 1G5TA 1S8FA 3W4JA 4I4LA 4CF6A 1RMYA 4E4YA 4EVQA 1OH8A 3MJCA 4OX9Y 4G4JA 4J1SA 2O6HA 3C3DA 5KWSA 4KH1A 1IHYA 1YOVB 4M8SA 2R47A 2Y9PB 2PSFA 4EPRA 3GJ0A 3VBEA 5FH9A 1FFXA 4RD1A 1IN5A 1BQ3A 2HSEA 2NQTA 5CPFA 4F9EA 3IURA 4Q5IA 5FR1A 4JI7B 4H35A 5DW0A 3QKIA 3VZSA 5G3YA 5H83A 4O59O 4DUYB 3GLIA 1R6AA 4YGYA 1TYBE 2FZWA 2MIIA 3L8GA 4WCFA 4IRMA 3TOXA 1HL7A 3PIDA 5JLJA 1NWHA 2O2CA 2VPWA 4MWGA 3PFBA 5K1ZA 2Q3BA 2WPNA 2ZSDA 4ZZ0A 2CYBA 1EUCB 1W0KA 2IHKA 1TDJA 1TL7C 1X38A 4WAUA 5TPZA 3WLKX 5CLLA 2OCLA 2R2AA 3HLTA 4TWIA 3W8DA 3F6CA 4RKFA 1EVLA 3ZV5A 1P9LA 4LY3A 3OLVA 4Y2XA 5JS6A 3SWWA 1NN0A 1NR7A 1M83A 3G5TA 3FJOA 2ERXA 5GZ3A 3QELB 3WYDA 2PLNA 3M5WA 2DH5A 4H6VA 4ESEA 1Z4MA 2HA3A 3A3YA 1Y1LA 1UBTS 4ML3A 5IT0A 5ICFA 1F0NA 2RAFA 1I3CA 4FDMA 3AP3A 1Y37A 2BWJA 2AI2A 4RHYA 1DBPA 3CSDA 3GLUA 1V11A 3CIFA 4Z4GA 1U0JA 1YR8A 1FLDA 3WTBA 1EUYA 2DMRA 3HUUA 1CLUA 4R1LA 5AJHA 1RC0A 1JG6A 1US8B 3AV0B 2V65A 4YQYA 4OHYA 2QBYB 1KI2A 2HJ9A 2PGIA 3VR6H 3ICCA 3E35A 4CF5A 1MO6A 1PJ3A 2FPGB 4J16C 3PWZA 3PFWO 4NS4A 3R7AA 3SYNA 3VU1A 1Z4IA 4YHHB 1WBBA 3JRNA 3VH3A 4F11A 1QYDA 2PJZA 2ZRHA 3MBIA 1VBKA 3MQ2A 1CQIB 2E6KA 2R5FA 3KEQA 5FTMA 2F7SA 4N5LA 4KOEC 1DFGA 1U9CA 4J75A 4P1ZA 3DOOA 1LB1B 1YZGA 3FX2A 4GLBA 5FV7A 3TQFA 1ID8A 4V3CA 2CNLA 3SFZA 1B1CA 1WMBA 2WPDD 4Y98A 1O5OA 1IRIA 2ENUA 3AU8A 1O6FA 1XLTA 4MR8B 1D1PA 6CHYA 2VJQA 4P3PA 2FJ0A 4FXPA 1QGDA 4YLGA 2HA7A 1J97A 2OHXA 3IDSA 3T9DA 1V8ZA 4FFPA 4YWHA 3CE9A 3VC2A 4EA9A 3PG5A 5ARDA 3T9CA 4ND2A 4KXYA 3ZXSA 4YYZA 3OQJA 3Q3HA 3L40A 4BVFA 4F71A 4BN0A 1PZHA 3ZXIA 1JSXA 1RI1A 2IOYA 2C88A 2PKEA 3NWJA 4DM7A 3M70A 3OE5A 3G6KA 4YP1A 1F12A 1UMDB 4TYPA 3LO8A 1QRAA 4MDFA 1BS2A 4GF5A 3CINA 4S1VA 5I7EA 3LM8A 1IBLB 2LZ0A 1C2TA 4U1RA 3L7NA 4N18A 3PNYA 2CFSA 3D8RA 1ZMRA 5CURA 3DAHA 2D7JA 3N8KA 1OVMA 5TJHA 4DY4A 1FP1D 4Q3OA 2O2EA 1E4YA 2QRQA 1B00A 2PUEA 1Z6GA 3WB0A 1BJRE 2A5GA 3ZK9A 5JATA 2OB2A 4DUGA 3JPYA 3TSOA 1TD1A 1RAHA 1GNVA 2Z1DA 2TSYB 4GO1A 3TLAA 4RVOA 4GM4A 2FFHA 4UBIA 5F9FA 2Q0XA 2CEAA 2CF6A 1L3CA 1QS0B 2IP4A 5BYJA 2PH3A 4K9NA 5LBTA 2XKJE 3O73A 1DRUA 2OD9A 4QPPA 3N0TA 2ZSBA 1P0QA 2P9HA 2EGHA 4UAUA 3RRNA 1B74A 3IR5A 1GA1A 1HXHA 1RRVA 5DU2A 4TV9A 1T6YA 2A4MA 2XA1A 3AU9A 5COAA 4DR2B 1AQ6A 1O54A 3JWGA 1E9CA 1ZCBA 2V7XA 3JQ9C 5HCIA 4BLQA 1DEOA 4WKCA 4KXWA 3K0FB 2O3RA 3SZOA 4WZZA 3ZKAA 3H17A 4UM8B 1E5TA 3O47A 2JKYA 1MEOA 4KLNA 2G4VA 2I6TA 3G79A 2ANCA 3PR2B 4HDKA 3VC3A 4ER6A 2ZT5A 5LCXA 4EYOA 2VDWB 2WWTA 3RAJA 4DRXB 5AW1A 1SOWA 4F4IA 5ECGC 5CP8A 3KTAA 2EJCA 2HBQA 2C8LA 1QHIA 4MV3A 4MR7B 5T8KA 2ZFUA 1V6CA 3H13A 4NCHA 3RHSA 1QM5A 2G76A 3DO6A 4N65A 4PHGA 1CDZA 4IY1A 4YLYA 3KR2A 1TJYA 4DL9A 3DL4A 1NN1A 2HLPA 2VBCA 3L18A 4HGNA 4LFAB 3VV2A 2QTWB 3L8DA 1AUOA 5L95A 3PS9A 2X7XA 3SJAA 4B1FA 3LQ4A 4ZT5A 1A5AB