3RJZA

X-ray crystal structure of the putative n-type atp pyrophosphatase from pyrococcus furiosus, the northeast structural genomics target pfr23
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
229
structure length
210
Chain Sequence
b'GLADVAVLYSGGKDSNYALYWAIKNRFSVKFLVTMVSETINANLTDLQARALGIPLVKGFTEVEDLKRVLSGLKIQGIVAGSKYQRKRIEKVAKELGLEVYTPAWGRDAKEYMRELLNLGFKIMVVGVSAYGLDESWLGRILDESALEELITLNEKYKVHVAGEGGEFETFVLDMPLFKYKIVVDKAKKVPCTSSGKLIIEEAHLESKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-type ATP pyrophosphatase superfamily
publication title A large conformational change in the putative ATP pyrophosphatase PF0828 induced by ATP binding.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 54
structure length 210
sequence length 229
ec nomenclature
pdb deposition date 2011-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01902 Diphthami_syn_2 Diphthamide synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3rjzA01
3.90.1490.10 Alpha Beta Alpha-Beta Complex putative n-type atp pyrophosphatase, domain 2 putative n-type atp pyrophosphatase, domain 2 3rjzA02
3GLVA 2DEUA 2GOYA 1ULHA 2QJOA 4MW9A 1FYDA 1N2OA 4EG3A 1EJ2A 2IELA 3X1JA 4MW0A 5F23A 3BL5A 2VTBA 1F7VA 1ZH0A 4ZCTA 3CLSD 4MUHA 1N78A 1WOYA 5FNZA 2A1UA 2I1LA 4X0EA 4EG6A 2RD2A 1N77A 1PG0A 3G6KA 1WQ3A 5AHWA 3CA8A 4K03A 2JAXA 3PRHA 1D2RA 1NI5A 1ZH6A 3N2YA 4I6GA 4ZT6A 3CLSC 1JMVA 2XRYA 1J09A 2QTNA 4MUKA 1NUQA 2CUZA 3CVVA 3RBAA 3OTWA 5H16A 2AKEA 1VBKA 1GN8A 4OJMX 4YP6A 5J58A 4KR7A 1NUTA 2HMAA 1ZUNA 3FI0A 3H05A 4YMIA 2X1LA 1PFYA 2BTEA 4S1OA 4R0NA 2RE8A 2A88A 4F3RA 1SURA 1TYAE 1TFUA 3DPIA 3RHSA 4A91A 3LCJA 3QTTA 1XNGA 2C5SA 3CLUD 1G8HA 1N1DA 1T9GS 1R6TA 5FO1A 1MOPA 2OQ2A 5LM3A 3UC5A 1EUYA 3A04A 4MWBA 3L92A 3H9CA 4U8HA 1TEZA 5HUHA 3CLUC 3PXUA 4DLPA 1XJQA 4MVXA 4G5YA 2PG3A 1TYBE 3IOBA 4FZJA 4UZEA 5DEOA 2DLCX 5H7XA 3ZJTA 1VLHA 3GMIA 4MWDA 1GTRA 2A86A 1FFYA 1KH3A 1Q77A 3K32A 4MUGA 2A1TS 4PBSA 1KP3A 2X0KA 2J08A 1O0BA 4HJXA 1EXDA 1UFVA 1IFXA 3AKZA 5TEVA 1YIDA 3S3TA 2QUHA 4P2BA 1X8XA 3H99A 3SYTA 3AG6A 5DB4A 1KH1A 3HV0A 1YI8A 2CV1A 1N75A 1JEEA 3FOCA 2CV0A 4ARIA 4DDMA 4DE5A 4DNXA 1QRSA 4YP7A 4MW5A 3HMQA 1JIJA 3KT8A 4NX2A 5TS2A 3RFFA 4HPWA 1WY5A 3TNJA 4KPUA 2DERA 1KR2A 4HK4A 1A8HA 3FH0A 2CYCA 3IOCA 3TQOA 3TS1A 4ZCRA 1QNFA 2J5BA 1J20A 2JA2A 3KT3A 4EG4A 4R2MA 1M83A 1U7DA 3DV2A 4MW7A 3HFJA 3ZJVA 4EG8A 5DASA 5IJXA 1IH8A 1U7XA 1JEDA 1TQ8A 1MB2A 4YP5A 3FWKA 2Z3VA 3CVYA 2TS1A 2VTBB 4CQNA 2Z09A 1KAMA 5TEWA 1X6VA 2DR2A 3SDBA 2A1UB 4BWVA 1P7PA 4MUFA 4WNYA 1JGTA 3VU8A 4MVYA 5EKDA 3P52A 3A2KA 4I6EA 1NUUA 2QUIA 3IDFA 1B6TA 2R5WA 3ISJA 2CYBA 2PZBA 3KFLA 4MAFA 1G59A 4JZYA 4U63A 3P0JA 1YUNA 1KORA 3COYA 1M8GA 1MAUA 4MUJA 3CLRD 1GAXA 2HGZA 4MW4A 2DUMA 1OWPA 1R6UA 2CT8A 4ND6A 3UMVA 2EJCA 3ND5A 4PBTA 1XNHA 1VL2A 3MLBA 3H9BA 1ZJWA 1H3EA 1IHOA 3HZRA 4MUEA 2YXNA 1I6KA 5BNZA 1JECA 5KWVA 3TQIA 1J1UA 4PY2A 4JYZA 1MRZA 3UOWA 1T9GR 4J76A 3COZA 5LFAA 4ZCPA 1S4MA 1WQ4A 1M1ZA 3AFHA 3N05A 1COZA 3ZXSA 2E21A 4EGAA 1QTQA 4ZT2A 1NZJA 1JZSA 2ZUFA 3FIUA 3NBAA 2J09A 1K97A 1HYBA 3SEZA 1WXEA 3INNA 4WSOA 3N9IA 1NYLA 1PFUA 2Z08A 1U3DA 4ZT7A 3FHJA 4KKVA 3N8HA 3DLAA 2NZ2A 5J59A 1RQGA 1NURA 3OP1A 4NAHA 1TYDE 3NBKA 3CVUA 4ZT3A 1YULA 1JILA 2A7XA 2A1TR 1H3FA 1I6MA 1VBNA 4MW2A 5LLTA 4DJAA 3IH5A 4CDNA 5DK4A 3HL4A 4JXZA 2CV2A 1DNPA 4QRDA 5TGTA 2BYTA 4MULA 4YBRA 1WKBA 1QU2A 1OD6A 2YY5A 1O97D 1T6YA 2CFOA 4OUDA 4KPUB 4DDHA 4EF6A 1I6LA 2PZAA 3F3MA 4ZCQA 1EFVA 2GM3A 3Q10A 3ELBA 4MWEA 2DXIA 4KR6A 1O95D 1M8KA 3RK0A 2E89A 3PNYA 4EFKA 1BS2A 1O97C 1KQNA 1F7UA 3VGJA 3E27A 3ZGZA 1IVSA 3X1MA 1F4LA 4HJRA 1O95C 3M5WA 1NUSA 1N2BA 2V0CA 3DO8A 2A4MA 4NATA 4CDMA 3IVGA 1ILEA 2QUJA 1U3CA 1V47A 1GLNA 5HG0A 4MVCA 3CVXA 1LI5A 1EFPB 1KKUA 1WJGA 1JZQA 1NP7A 3AL0C 1N2IA 1QU3A 1PFWA 4F4HA 1WXFA 1O94D 2D54A 4MLPA 3KT0A 4J75A 1QQTA 3PNVA 4L2IB 5FO0A 3P0HA 3NV7A 2CYAA 5IHXA 3SZ3A 1EFPA 4RUKA 1VBMA 3IVCA 4XFJA 2PXHA 3FNRA 2JANA 2IP1A 2A84A 1M8PA 4ARCA 1KP2A 3LOQA 2WQ6A 4AQ7A 4CT0A 4L2IA 4U7JA 4QREA 2QJTA 2DETA 2D13A 3ILVA 4E1AA 3KT6A 3COVA 1MB9A 2ZUEA 1KH2A 2EL7A 3COWA 4MWCA 4NDAA 4Q16A 3TZLA 3CVWA 4GRIA 1O6BA 1NSYA 2B7LA 1TYCA 1OWMA 1R6XA 1NUPA 2ZP1A 1WZ2A 3D6UA 1J70A 3UK2A 1O96B 1Y42X 4ZT4A 3Q4GA 3K9WA 4XFDA 2QTMA 1MBZA 1JHDA 2J4DA 2E18A 1IQRA 3CLRC 1IRXA 1GPMA 1WXGA 1YIAA 1K4MA 4G6ZA 1O96A 5KHAA 3IVXA 2GKSA 2YWCA 3MLAA 1K92A 1OWOA 3A05A 5JBNA 1IQ0A 2WQ7A 3ZIUA 3PNBA 3JXEA 4EG5A 1XNJA 3AG5A 3FY4A 3H97A 1J1ZA 4NZPA 4ZT5A 3RK1A 4MQ6A 1H1TA 2QJFA 4G5FA 1N2GA 4MW6A 3RJZA 3CLTD 3X1KA 3IMEA 1MAWA 3VRHA 2QUKA 4GU5A 3IODA 1N2HA 1LI7A 2V0GA 1MC1A 3G59A 5K0TA 1WXHA 2DPLA 3IUBA 2CSXA 2O5RA 3FETA 1H3NA 3CLTC 1M8FA 3ZUGA 4MUIA 2D5BA 4OUDB 1CT9A 4Q93A 3LE8A 2HZ7A 3MMXA 1EFVB 2NSYA 1U0BB 1IQUA 3SZGA 3IMGA 3SEQA 4JFAA 5KCMA 2J07A 3CR8A 2AZXA 1Q11A 1K4KA 4NAUA 1KQPA 2WSIA 1GTSA 1G8FA 2VXOA 1QRUA 1OBHA 2YWBA 1QRTA 1KQOA 2H2AA 2PIDA 3TZEA 1Q15A 3A4IA 4MUNA 2X3FA 2PZ8A 3G5AA 3ZJUA 1G8GA 4QBTA 3ND6A 4MVWA 4MW1A 1EUQA 4RPIA 1JIKA 4ZCSA 3IOEA 1I2DA 1N2EA 4H3SA 5K0SA 5J5AA 2G36A 1KAQA 2XRZA 2H29A 1OWNA 4R2LA 3U1VA 2OV4A 1YUMA 2PFSA 1J21A 1JIIA 1F9AA 1N3LA 4PBRA 3MXTA 3SP1A 3QE4A 2E0IA 3P0IA 1PG2A 4K0RA 3QTBA 3MUEA 3GUZA 4DDKA 3HGMA 4KR9A 1O5TA 1V8FA 3ZXIA 3UY4A 4AS1A 3D6VA 3ND7A 1EE1A 1T6ZA 1WXIA 1M8JA 2X1MA 4XSVA 1MJHA 4EG7A 2IJGX 3C8ZA 1QJCA 3L93A 4I6JA 1O94C 5HUJA 2AG6A 3IUEA 4ND7A 4TS1A 4JXXA 4UZFA 3FG9A 1OWLA 1T6XA 3I05A 1PFVA 1GZUA 2QTRA 3FDXA 3IMCA 4EG1A 1Q19A 1O0CA 2WB2A 1LW7A 1OBCA 3AIIA 1N2JA 2O8VA 3Q12A
chains in the Genus database with same CATH superfamily
3EWNA 4M8NE 1XWFA 4D43A 2PE5A 4Y1EA 4CM8B 1WDTA 1ISIA 2I9PA 4TV8F 5LQKA 4Q02A 5LLDA 4RTKA 2PEYA 5CD1A 3CG0A 4UTZA 1U5AA 5FHQA 4N65A 4CM9A 3PGA1 1ANKA 3PF8A 3ASUA 3THYA 3DLBA 2WIFA 1NAHA 4AJ1A 3EEQA 1P6XA 4EKGA 3LYAA 3JD0A 4GM1A 4MPDA 1QQBA 3GCGA 4HD8A 3PR3A 4DR1B 4FMCF 3T1VA 4PR3A 1CPYA 3E18A 2VK8A 5C35A 2O1EA 3EZXA 4H15A 4CQLA 2HXYA 4K03A 4CR8A 1OOEA 3OZVA 3GUVA 2QX7A 4O4JA 3RH0A 1B00A 4A6PA 4JB2A 4BGDA 1ZH6A 4JBLA 4IXMA 4Q9DA 2NU8A 2UXBB 3RM3A 1U81A 5FLXA 4L02A 1JQ3A 2JZOA 3QYAA 4MKHA 3IAHA 4Y2SA 1T0BA 3OPVA 2FR0A 2ZRIA 5CVEA 1UCFA 2YZMA 4A27A 4DIFA 2QG6A 3LUJA 4Z8YA 4WAUA 3HCPA 1DJLA 1VBKA 3H9UA 3I4CA 4R6WA 4YP6A 5GZ6A 5JS7A 4KR7A 2AJTA 1ORVA 3HO6A 1FOEB 3NEPX 4PXAA 3ZYZA 4AY3A 2WYWA 2UKDA 2W2OA 3JQBA 1KZHA 2BTEA 2JFWA 4S1OA 4G0YA 1AMUA 4YP1A 3WL8A 1RWPA 4IILA 1TJNA 4MI6A 3RHSA 3UT6A 1M6HA 3CZ5A 1Z82A 2FLVA 4GZ5A 5HILA 4MS1B 1QHHA 3JATB 1I1QB 1DG1G 1JR3D 4H18A 3LOPA 1YKFA 3M6UA 1WPQA 4G1VA 5TGDA 3VR3A 3ZNPA 2IEBA 1N2SA 4MH0R 4GVLA 5FO1A 3VHXA 3QXXA 3AI1A 3WGKA 2ISQA 4BNJA 1U1EA 4B9AA 1L5RA 2ORVA 1Z39A 2Z9DA 4KR3A 2C2KA 2GTHA 3H9CA 2XAUA 2IEZA 3OUTA 4J0HA 1SXIA 1ZVKA 2HBZA 3DQZA 3MUFA 1E4OA 2I7XA 2ZIUB 4UCWA 3O6VA 2W6IA 3H4MA 2VPXA 2VR1A 4F06A 2TMKA 3L4SO 2J3IA 2CXSA 4B80A 2VT7A 4JJ4A 4R0MA 1QZ3A 1Z2AA 4L85A 5ILOA 5KU1A 3TTTA 3WWYA 2PT9A 4PNZA 2JI8A 4RJLA 2WWVD 2HBRA 2ZB7A 1NU8A 4YAWA 3KEMA 3DTVA 1A4RA 2I2XB 3IXQA 4X97A 3RKRA 4CIXA 1KMHA 1KNXA 3IPRA 4Q4JA 5FCDA 1SD5A 3IAXA 3ORYA 5IAJA 3DKIA 3VKWA 1NVMB 1OYOA 2XI4A 1K66A 3B6EA 3IKVA 1IZ9A 3ORFA 3GJXC 2C84A 4JEUA 1LI4A 3BN3A 3I1JA 4MV1A 2B0JA 2L0XA 4YCLA 1UZAA 3EDOA 3CIOA 4DCCA 5AVVA 3BE8A 5G4KA 3WQRA 3WK7A 1SCKA 4HGPA 3HV0A 2GF9A 1JXMA 3PNSA 4IF6A 3QVGB 4P8RA 1FFGA 2P6RA 1DV2A 1AV7A 2FN3A 3G79A 4PFSA 1PDOA 4DDMA 1JG6A 3RV4A 1DWPA 5DHPA 5CA1F 3TOSA 1T2NA 3KT8A 2V55B 2J32A 3B7PA 3FZQA 5KAMA 1JX6A 2ZYSA 4QNMA 3ZWMA 2BHTA 4JBYA 1BROA 1YA4A 3TRKA 5IT4A 5KQPA 1T29A 3OQHA 2XEDA 2MSWA 1EG7A 3BHJA 4JK3A 4BOYA 3TD6A 4CTKA 5A4AA 3KRTA 3AWDA 3MAJA 2BGMA 4GC5A 3EARA 4IZIA 2DHRA 1ZHFA 3RSOA 4FYIA 3LLSA 4L8GA 3WRWA 1F2TB 2YFKA 3KQMA 2I2CA 2DHCA 2P2NA 2GTIA 2FU5C 2XB4A 2ZBQA 2NZXA 3DE2X 3DWFA 3IUJA 4BKMA 4WGFA 2VBFA 4MXDA 2ZUTA 3F78A 4MEBA 4RHYA 4C06A 4XQ0A 1TQ8A 4M9UA 2Q6KA 3D4OA 1ZCBA 3R7WA 4KXVA 3ELYA 2Z3VA 4DM4A 4YMUA 1Y4AE 3UUFA 2I55A 4V0KA 5BUCA 4PZEA 4II2A 2QORA 5JNUA 5TEWA 1XROA 1QANA 1X9GA 2GDJA 1IE3A 1VL0A 5LP6C 1QDLB 3T5DA 3RFXA 4CYMA 1E2IA 3C39A 3P0EA 3ZZ0A 1GIAA 5BOSA 4BATA 2HSDA 1E96A 3KU4A 2PRZA 3HNOA 4WNYA 5JQGF 2I2WA 5C8YF 1JEJA 2OGZA 3K94A 3P52A 4CTNA 3SJZA 1V5FA 3IPLA 3UV3A 4XD7A 3WZMA 3VPHA 4F3KA 4WKCA 5AIAA 4RPKA 2GGSA 3L7JA 2E7ZA 3HXKA 4FQ5A 3IUNA 5UKDA 3KUXA 1AB6A 1KY2A 5DX1A 4J1TC 1P29A 1ZUNB 3NTLA 1GAEO 4YY3B 1JDZA 3QWIA 2QMZA 2JI9A 1WR8A 1DUVG 2FZGA 1B16A 1NRXA 1OWPA 1VCIA 1WD7A 3I9JA 3URKA 5EXSA 3U5TA 2WWYA 4OI0A 4QYTA 2X6QA 2JAHA 3LDAA 3ND8A 3K0HA 1XQ1A 4QEZA 3VR5H 4PBTA 2FW8A 2IY7A 4KO3S 4NH0A 4I9NA 3AVXA 1OA1A 2DX7A 4KGXA 4JI6B 3CVJA 1ZJWA 3OKFA 1NJGA 1L8AA 1PS0A 1JFVA 1UL1X 2V96A 2LGJA 5AKIA 1YR7A 4Z4CA 2FWIA 1TTHA 1SQSA 1T9GR 3KPWA 3KK0A 4Q1VA 2Q1UA 1ZIOA 3OLVA 2MWMA 3IPYA 5MDHA 4HQKA 2BVNA 4J90A 1COZA 2NN3C 3WMEA 4EGAA 2HMVA 4X91A 1KP9A 1M2GA 2O1WA 1J23A 1Z7YA 4KXUA 5DO9A 4Z0HO 4B6SA 4YNBA 4DYVA 5KWVA 1E1CA 2B3DA 4AJ4A 1IBMB 4PC2A 4WK2B 1MNAA 1X42A 2G1KA 2JNWA 4LZZA 4JELA 4EX7A 3ANTA 3DMFA 2PRKA 2Z08A 4PIVA 5CYOA 2ZAMA 3SJBA 2R2GA 3N8HA 2P30A 3DLAA 3MERA 2GPSA 2REQA 1EP2B 3ITNA 2QMYA 4BO9A 2VNJA 1L4UA 2ZSFA 4DR3B 3HB0A 5IXSA 2WWFA 2I3GA 2JDIA 5PGMA 3D4IA 3TGWA 1ZLYA 1P0FA 1UKBA 3O8DA 5AXCA 3QLUC 1DCTA 3RC7A 4HNAA 2MYUA 4DJAA 2XT6A 1FFXB 2D1RA 1QFSA 5T4EA 2YXLA 3P9ZA 2JIBA 4MJXA 2FR8C 4XTCS 3UEOA 4TVSA 5BXQC 1XMOB 2BYTA 3NIDB 1S3GA 4MULA 1WKBA 5K3CA 4RYDA 3SXJA 1UC9A 3H5NA 3WV4A 4BY9E 1F8UA 1QU2A 3IMFA 1TF2A 4FCCA 1E0SA 4MKZA 2Y1EA 2ALJA 5K7SA 3K30A 1F5SA 3AERB 3ZE9A 3EC7A 1QIEA 1RR6A 2OWEA 1B4DA 3PUKA 5DULA 2AA3A 5L7WA 2WUGA 3GARA 5HIJA 1MA0A 3LXMA 4QDKA 3AP2A 2D7JA 2OCIA 5CIYA 2EKPA 2ZCVA 2B20A 2QZPA 5EMKA 1YQWA 4JI3B 1XL1A 3BMCA 1NJSA 2VQ6A 3HRKA 3GP8A 3RUAA 3TO5A 3VSDA 4DC9A 9ABPA 2QVYX 3UHFA 4AKGA 4TLEA 5FEMA 3UHOA 3ZD9A 1RRCA 2OXEA 5FDFA 3TL6A 2AUNA 4F85A 5BVHB 1JAYA 1QLWA 1TB4A 1FLAA 2CLOB 3A8TA 1N2BA 1COWD 3O4FA 1W59A 1ZYUA 2FGKA 2G71A 3E6AA 1PL6A 4TWIA 3V1UA 4PHGA 3BXOA 3HXMA 1JP7A 1USWA 3CTMA 5C2JB 3C6QA 3H1PA 3WYNA 1CY0A 1OXUA 5J63A 3JAWB 2GBIA 3EJ6A 4HGYA 5CYFA 4IDBA 5J40A 3SZRA 4XTRA 2XCSB 1ZD2P 3CWQA 4YRQA 4B5LA 2D06A 2D54A 3AEKB 1CTQA 3BUSA 3A6HA 3HJGA 4UVEA 1XDWA 1YONA 3CFYA 3GL9A 1BDBA 3AILA 2W58A 1NKTA 4V38A 4B1FA 1DARA 1C7QA 1GOTA 1LS1A 2GEFA 3QFHA 3C1AA 1G5HA 4HDRA 4CBVA 4MZDA 1CEYA 1L7DA 4KXWA 1VMIA 3ZS9A 4PYQA 2O2YA 2PSJA 5JZBA 4KMMA 1NP3A 2H5JA 1YZYA 3K4HA 3NHBA 1IYZA 4KHZA 3PZBA 3DZGA 4NNJA 1QVVA 1WHTB 2BFCA 2WWIA 1G0OA 2Y0PA 3KVYA 4DNOA 3DBLA 1NU6A 4GRIA 4EUSA 2YS7A 4IVPA 4RBNA 1X7GA 5AHRA 4B7UA 2A57A 5BY2A 1O89A 2WTNA 2ATIA 2ZJ0A 5ICFA 3ELUA 3T3OA 1YVRA 3CPSA 4EJ0A 4UUBA 1PFQA 2NOAA 4ETMA 1IU9A 2XMPA 3KUCA 2BMVA 4HI0E 1L4MA 3BSWA 4WXYB 5K0CA 1RSZA 4EYEA 5EMLA 1XAHA 2CLLB 3S4YA 2OLKA 4NZ9A 4ETNA 3G8CA 1QTIA 2X2PA 4LEIA 2W2VA 1KAGA 2E48A 1S01A 3G49A 4Y2HA 4DV3B 1IEXA 3CURA 3NLLA 3LDHA 3UFXB 4F9TA 1J33A 4U7FA 1GITA 1DIRA 1NQ5A 3CX4A 5KYTA 3MAGA 3K2IA 3WRXC 5LQUA 2R8BA 2AWNA 2VSFA 2YRFA 1VLVA 3L77A 1NC1A 3M4YA 3T61A 3T9DA 4RJKA 1KSGA 4KKXB 5CFZA 2P11A 4IIJA 4EPYA 3ZBQA 3HUFA 4PPNA 4OJKA 2HAEA 3BIWA 3ZTYA 1FFHA 4K6MA 1SBNE 5AI5A 1BCSA 1L5HB 2VCHA 3AI2A 3ROKA 3ZDXB 2AJCA 1TUEA 4F3CA 1G17A 1OH6A 5KX5F 1Y3FE 3USZA 4LFBB 1LSSA 5BR4A 1T5DX 3MGKA 4UDYX 3TZQA 5B4TA 3VUEA 1GNLA 5MFPA 1QDUA 1GKKA 3GNSA 4QTTB 1KMIY 3G2QA 1U1CA 1Z5OA 2QTVB 3EG9B 3TSWA 2GAFA 3VHLB 3PPYA 4X1YA 4AG3A 5L3VA 5BN4A 4DAOA 4JBWA 2DR0A 1NRWA 3QX7A 5ED0A 2BDEA 4KI7A 4LNUA 4D56A 1NOJA 1G8JA 3I1YA 1IZ7A 2XOKD 3EOZA 3KXIA 3KALA 4B4UA 3OOEA 3ZWXA 1BEEA 1SVSA 4EVIA 2C04A 3L7KA 4KVAA 4L5IA 3RAJA 1BXRA 3RSSA 5CA0B 3FI9A 1MOQA 4ZVTA 1KOFA 4GKBA 4IFTA 4QPDA 2NXCA 4EB3A 3WISA 3V32A 5EERA 3I3SR 3TUZC 2ZM5A 3U0VA 5E9QA 5FX2A 4S1PA 5FTWA 1XXHB 2OORA 3QXSA 4Y6QA 3PTLA 1I3KA 1U0TA 1EWVA 1SIWA 3DMRA 3FKSA 4RKYA 5DVZA 5EYPB 4WLFA 3Q8MA 3U3MA 3FUCA 2PMCA 2OZKA 1R8YA 2JLRA 3F7OA 2W4IA 2YWBA 4QQFA 2O8EA 5CVDA 4YROA 5FBZA 4DOMA 2JHGA 3MHTA 2Q07A 3NC0C 2PD4A 2VDUE 1G8GA 1MO3A 4IJQA 4M9QA 3AF6A 2Z5GA 3OFSA 2IEGA 4NYIR 5CA1A 1WQ1R 2O8CB 1E1KA 4BX8A 5IF9A 5JWOA 3HZHA 1V4VA 3CZMA 2C2GA 2VJMB 2FPUA 2JJ8A 3RYFA 3GLFA 3CMMA 2RHOA 3KETA 1K27A 3O90A 4OL0A 2G36A 3FCCA 5BUSA 3BXHA 3GRZA 4JSRA 3T15A 1JMKC 2ZWPA 4RX1A 5JV5A 2Y0BA 5L4LA 3I5YA 1ZM9A 2AFRA 2OKGA 3ENZA 4R2LA 1P2SA 5KNBH 1APBA 4RTPA 2PXCA 1SN7A 4B3TB 3QVUA 4QXAA 1GT91 5EIOA 2HCTA 1J90A 5CDYA 2Q1XA 3OQNA 1IOZA 2GZAA 3B82A 4LDQA 3QE4A 1AS3A 4UD2A 1EVLA 1BG6A 1GRQA 3K6RA 4JJIA 4HQNA 4WOPA 5I7FA 2LIPA 2C7RA 2EFYA 1KDPA 1SEPA 4HDAA 1SM4A 1TO2E 3GHYA 4G1UC 5DM60 4DDKA 4F6RA 5FUQA 5JCXA 2ZS7A 1S5PA 2C03A 2UUOA 2Y67A 3MWFA 3T7SA 3DD5A 2D62A 4KQEA 5DYIA 2WYUA 3GGOA 5KOJA 1L7MA 4OAOA 1VIDA 5ALLA 1M0EA 5M29A 4C7VA 1E7RA 2AFHE 4J49A 5IKXA 3JYQA 4B8ZA 4XIGS 4NR0A 3TJMA 3DDNA 4EMBA 3HU2A 4OH7A 4DIOA 4BN5A 2C2YA 4AD8A 1QB8A 4TTQA 3NRJA 5J4LA 5JQGA 2FFQA 5LL6P 3H13A 4UZFA 3IT0A 5C8YA 3VAAA 3TJZA 1P2TA 1UBTS 4ER6A 1T6XA 1KC3A 1VXRA 4R9RA 4I4CA 4X24A 4C03A 1EP3B 1RXCA 2P1DA 3I28A 4RHXA 1JHMA 3GLVA 1NW4A 4LHZA 3ID6C 4OQQA 3EQ2A 2QJOA 1RXEA 1CS4C 3EDYA 2LP4Y 3EGOA 4Y0NA 2WLTA 1ISFA 3E58A 3OVMA 3NOVA 1QFMA 3JAMA 3V2HA 4E03A 2QRKA 4MV5A 3T4PA 4KXLA 3WG9A 3V2GA 5JQWA 1XSEA 1MIHA 4G8DA 2OZVA 4LBVA 1N3YA 3VTKA 1OLUA 1GFSA 1M2EA 2H31A 2FZ5A 2I6FA 1UXGA 3CLSD 3LIPA 3ABIA 3JQDA 4TMWA 5HXAA 5BQFA 1CRZA 4TZTA 2Y1OA 4Y1GA 1PVDA 1CUBA 1NI4A 2GN6A 4B3BA 2OHJA 2GZSA 2D59A 1NASA 4O4IA 1JLLB 1IN4A 2CFIA 1MOZA 3MD9A 2A9KA 2JAXA 3C8DA 3L6RA 5ARBA 3CZPA 3W8DA 2JW5A 2X0NA 3QYFA 1E2JA 4ZT6A 1OI3A 4LHVA 2G7MC 2B4TO 4TYWA 1ONPA 2XEXA 1JH8A 2XNDD 1JKJA 2Q5QA 1FUYB 3VV3A 4WD3A 3QJYA 1FZQA 3FM9A 4W8HA 4C4SA 5I8PA 1LDBA 5JANA 5ALWA 1EDDA 1AGYA 1PZXA 2AQHA 3PPXA 2QSYA 4ON9A 4DCGA 3JARA 1UAAA 1PFYA 3DE7X 1XEXA 1FNDA 1KWGA 3OHMA 2D7DA 4R0NA 1K3FA 3HP4A 3MMZA 5ALRA 4IG9A 4EO9A 5JBIA 3PV0A 1VE9A 3OE1A 2RE8A 5D8DA 3R7LA 3GYBA 2WR8A 1COWA 1SZPA 5BQ5A 4H6XA 4OYHA 1Q95A 4EY5A 3T7DA 3WHIA 1OA0A 3HZZA 1CDEA 4RD3A 3D4LA 1R6TA 3TTYA 3OTIA 4ALMA 4ZQCB 1MOPA 1PGJA 4KN6A 1GVNB 4J0CA 4FDUA 3RVRA 3A04A 1H2RS 1DOAA 3NKVA 1E2BA 3MWGA 1G8MA 2OCAA 1ZL0A 2YXEA 3GIWA 3N6RA 3VI4B 1JFLA 1XP8A 4F0JA 5H70A 3H87A 3PXUA 2FQWA 3AR8A 4ZVVA 1AH2A 3WKDA 1T36A 2IE8A 2BKLA 3GFVA 3A9VA 3IP5A 3PUYA 1XJ0A 4KXFB 1RLTA 2ZJ1A 4P3OA 5AW6A 2JJ1A 3GGDA 1PL0A 2FN9A 4ZQGA 2PSHA 3BKXA 3N39C 1IHYA 1PX2A 2O2SA 4BP9A 4JUFA 4PCVA 3WLNA 1FSSA 2IDKA 2LKCA 3ET4A 2FK8A 2K2WA 3FZNA 4WPGA 4D4JA 5BMVB 1WW8A 2W71A 5KEIA 3UNXA 2YN0A 1IIBA 2V8OA 4PX9A 4CLOA 5FOTA 2E4YA 1FFYA 2A67A 3ED5A 4C2UA 4U2GA 4CL8A 4NC9A 4DEVA 1KQFA 5LQRA 5ER9A 1AGXA 1NQVA 2NYAA 2PY6A 2GWRA 1Z8FA 3DE1X 4MX8A 1JA9A 3BXZA 3DJYA 1BU8A 1GARA 1X7XA 3UKDA 4AECA 3EUFA 4WGGA 3PDJA 3PEWA 3ZHVA 4DILA 2Z3ZA 1YIDA 5WRFA 4RS4A 4IYRA 3KXLA 3DQQA 1UEXC 1QZXA 2FVXA 1HYHA 1YI8A 3SKVA 4BNIA 2JAUA 1RWKA 2ZT5A 4U6QA 4NOKA 4KO1S 3W2TA 2XADA 1IOVA 1PSWA 4TVBA 3S8EA 1RWXA 1Z56C 1XDUA 1DX4A 2QM7A 4DY4A 1QG2A 1BA3A 2MMGA 2WFLA 4DCPA 5G3YA 4NPHA 4B35A 5EQDA 1C9DB 2PWZA 4J4HA 3TRIA 3VR5D 4EA8A 4II7A 5DYGA 2HGSA 3CLVA 2NYUA 3CZQA 1M33A 1GYPA 2VCYA 4X95A 4KODA 4RPGA 1UOOA 3ZN2A 4N3CA 5CFOA 2ADFA 4EG4A 1S2OA 1EFUA 4K6FA 4R2MA 1PTJC 2VJLA 3DV2A 4HMQA 1IWBB 1SNYA 4G5GA 4JROA 1NJ1A 3B3GA 4A10A 4BEWA 5IJXA 2IDJA 3DP9A 2FW9A 4NXMB 2VJDA 2VHXA 2XTZA 3MTGA 4V3CA 2P2GA 3THYB 3D31A 3NWPA 5I9BA 1PW5A 4EHNA 5HK9A 5A7FA 3W5BA 5KMGB 2D6FA 2I4LA 3ZDFA 2M32A 5AVKA 1G9SA 1KQ3A 3RJ9A 4YRSA 1S96A 2HV9A 3N0VA 4NE2A 4KPFC 3RIMA 3WX0A 3UJ9A 3G9UA 2QQ5A 4LRUA 4CQLB 1E9BA 1JGTA 5ICGA 4M7OA 3QELA 1KSFX 4G5OA 4UAVA 2NU8B 3W3AH 2ZUWA 3LWDA 4W6QA 1N8KA 2F3TA 1QF9A 2D1SA 3MLEA 4BLQA 5IVHA 1CR6A 2ZIXA 2CYBA 3OJFA 4ZHSA 3LHFA 5NLLA 3VJMA 1ATIA 2JIZA 2WJYA 4EDFA 4ZTZB 3OJ0A 5BSEA 3IAUA 4BO7A 1U0HC 1KARA 1QE3A 4OLFA 4I50B 2YJNA 5IKEA 2JFYA 2NGRA 3IP8A 3DNPA 4YR7A 4H9GA 2EX4A 2XUFA 1B41A 3VVLA 2ZJOA 1FTGA 2WABA 3KKKA 4KIJA 2GR9A 5REQA 3FUTA 5BORA 4ZRMA 1OW3B 4KDCA 4D74A 2GN4A 1U3FA 2HH9A 1QHHB 1E6WA 1Y48E 2QAGA 4JUBA 1EM6A 1H4SA 1DBQA 2XWSA 1EDEA 1XTIA 2IS6A 1H6CA 4RMNA 4FWBA 5FNVA 3VHXB 1QO0D 4L8FA 4D6XA 2HA7A 3DFUA 2DYKA 2GCEA 4BZXA 2BSXA 4FDMA 3WXMA 1ZAKA 2C4VA 2WNIA 4J76A 4A73A 1CY8A 1HFKA 1NR7A 2ZRLA 1ZXLA 2KQUA 2ZSBA 3W1VA 3WFJA 5LFAA 2ZBRA 4QUIA 1HT2E 1NVUQ 3BFVA 3VTAA 5AT1A 5K8IA 1JHUA 2HB6A 1EWRA 3BICA 4QAJA 3W7BA 1Z6ZA 1Q6ZA 2PZFA 3EDRA 4MRNA 2NTEA 4TLBA 2P8SA 3MTAA 2C57A 3D9QX 3C85A 4N3GA 2C9OA 1AIPA 3PGJA 3OM8A 4WFIA 3WYGA 2JLYA 1E9EA 5CIWA 1LPAB 2ZUBA 3U4HA 1EVKA 4E4RA 2FZLA 2A0XA 1W581 4MVJE 4Y30A 3RUCA 1KMHB 1XZQA 2EZ8A 2R25B 4BFCA 4R83A 2JI4A 2X19A 4PSCA 4JLJA 3EFOB 3U7EB 1FPMA 3T7KA 1K7FB 2UXDB 1J56A 2QTTA 3SX0A 5KKCA 3OPXA 3TGPA 1CQJA 3W9UA 3O4VA 1A04A 3ESRA 5ALOA 1JWLA 1Z4OA 2NO9A 2IU4A 4FYWA 5ICSA 2A7XA 2ZPTX 2ZRMA 3ONNA 2QZ4A 3VO8A 3N7TA 4GLLA 2OMKA 1LSJA 4WL0A 1H2XA 2GM5A 2R79A 3PDUA 1RXUA 3NO4A 1VJRA 3HO1A 4JXZA 1WUHS 3LVQE 4H1HA 2X6RA 2KHZA 1A5BB 1R6DA 4Q1EA 5IKMA 2CV2A 4JODA 3AVVA 1GILA 1JEQB 2DQYA 1U0FA 4UBNA 2YWJA 4I08A 3VZDA 1AKRA 1OD6A 1DC6A 3BBLA 4JP2A 5IFLA 1M1YE 4JJ8A 3D81A 2G63A 3B8HA 4B83A 3KVRA 4J0FA 5L8VA 1FQJA 2C2ZA 2D1FA 1ETHA 2QN7A 1DINA 1QQ6A 4WCVA 4XFKA 1W0JD 4LHXA 4MINA 1N8TA 2GLUA 3DDCA 1VYVA 4W82A 4WY5A 4D3DA 1H2HA 3M81A 1DAOA 2X9QA 2XRMA 2IFTA 1CF4A 3S2GA 1S0UA 2J9GA 2BMAA 1U9IC 2H5IA 2QPOA 2RGWA 3CWZA 3I37X 2QL5A 2G4VA 1V3UA 4FBMA 1EWYA 2ZYIA 3M70A 3QU2A 4IMIB 1QPGA 2OESA 5F76A 3UPTA 4HLCA 3JZMA 4LJKA 4BPBA 4I99A 2DFTA 2TMGA 1KXZA 1ZDMA 2XNDA 2YL2A 4OQNA 2JVJA 5C31A 1R37A 3DR3A 3QVJA 2GZDA 1UM9A 3ABZA 3OEHA 4HWSA 1GNTA 1Z07A 1IJKA 1Z8NA 2VN8A 2XWQA 3QUCA 2DU8A 2A9VA 4X3PA 1LI5A 2PX6A 3TXAA 5B12A 1Z4MA 4UMVA 2LDBA 3I6QA 3UAOA 3OOJA 5IKOA 3QF4A 3AUJB 4QNNA 2CLMB 1A95A 2BDTA 3CRQA 4Q6WA 1Y6RA 4J43A 2HREA 5EKUA 3KT0A 3DBRA 5B7GA 3NC1C 3Q7SA 4LQCA 4FE3A 3I4LA 3QV1A 1PUXA 221PA 1X1BA 2Z58A 1V11A 3F6CA 5K3OA 5BSVA 4Z53A 2J5RA 4IJKA 4XFJA 1CFZA 1W2HA 2HJ9A 4HUQB 3V1MA 4E5VA 1XTQA 4A92A 5LBUA 4MGIR 4QYSA 3QQ5A 3ZHBA 1JBQA 2YWFA 3LOQA 4AQ7A 3FFAA 1ZU5A 2HO4A 4RXUA 2RHTA 2HLHA 4N54A 3B1YA 1G8PA 1O4VA 3OSUA 1EFDN 1X87A 4L6AA 4RPLA 1YR8A 2B0CA 2DWPA 3LUFA 1NJ2A 4LSZA 4YDSA 4CU5A 4WJLA 3SBOA 3AM4A 4MUBA 4OG2A 2ECPA 4JWTA 2H1HA 1IXSB 3LPAA 4QRHA 2ZIAA 1YDHA 4NDAA 3JTEA 1P2GA 4U39A 1CNMA 1B74A 4UASA 1XRJA 2X3YA 2H4WA 4IDQA 3KE9A 5IU6A 2OXTA 1FF9A 1YB1A 1CYDA 2ZYRA 2P4UA 4LRYA 2GRAA 2NADA 2V5AA 2X8WA 2ZDHA 3CX3A 1WA5A 3ZUPA 4YPVA 3BILA 4N6GA 4XXHA 1XLVA 3AH8A 2P3QA 1KF0A 3C3YA 3BQ9A 4KRGA 4QQRA 4IIEA 5G0TA 2GM9A 3L7BA 5EJFA 3IHWA 2J41A 1I7LA 4OHVA 2CJWB 3II6X 2NU6A 2AF4C 2PD3A 2NNWB 4Z4QA 2QZZA 3UIEA 3L8EA 3ZW8A 5JWHA 1VIMA 2E18A 2WD8A 3BRWD 3FKQA 4QUDA 1PAUA 5E8RA 3HP7A 3V80A 4GFDA 1GPMA 4KGDA 5BYBA 5JAZA 2QGNA 4Z9FA 3CT4A 4YXWA 4P5EA 2AZTA 3CPJB 4O33A 1G19A 4V24A 5BQOA 1OFTA 4Q9JA 4FJ1A 3DAFA 2F59A 2IWRA 2YIMA 4OLHA 2BBWA 1SIUA 5JBNA 4ARUA 4EKIA 3CJRA 2WQ7A 1LQ2A 3DONA 4N8DA 5KNBD 3RO7A 4BFSA 2HSWA 2PK3A 2ZTHA 1EM8B 3ZDZB 2KLBA 3IPAA 1FPQA 4OQFA 2J9RA 3PXGA 4YA6A 4E5NA 1W88A 3RK1A 1T3HA 2HW8A 5DF1A 4DMCA 2W2KA 3H8VA 2PS0A 3IEPA 5KYWB 2HPVA 4ZODA 3IMEA 3OTQA 3OZ7A 2IEDA 4L3OA 3Q7QA 4MWTA 1RI2A 4HNAB 4F7WA 3MMPA 2Q3CA 2HM7A 1MJ5A 1KEEA 1U7HA 3SIPA 4A8HA 3MIZA 5FOQA 1MC1A 4ZO9A 4I1RA 1AKMA 2EP8A 3K31A 3QUAA 1CQWA 4M0PA 2A5JA 1AXGA 2ZZNA 1LPMA 3DYVA 3ZYCA 3MT0A 1WD5A 1ECJA 3K35A 4KLCA 4GBED 4M1SA 2R1VA 5KYYA 2Z5VA 1K06A 1FZTA 1RVDA 1ZLXA 3E4CA 3AY6A 2MR5A 1GGNA 4N5LA 4BU1A 2CE2X 1GM5A 3WL4A 1T24A 1V41E 1DEHA 1Y8RA 2QRVA 3P1JA 1KVSA 1MOSA 4JSTA 4X20B 5CJPA 3VKUA 5K0GA 4MAMA 3SR0A 3QEMB 1X1RA 3ASYA 3TSCA 1CULC 3BMCB 4LDJA 1FJGB 1G8FA 4KE9A 4Z51A 1RPJA 3GDHA 4IJUA 2ZE8A 2H2AA 5DM2A 3PVCA 5CLHA 1UC5B 1KOLA 1VYTA 2WV9A 3CH4B 4FQ8A 3T94A 1HE3A 1WNFA 2QYSA 5AVQA 2FLWA 3HXPA 3PDWA 1M5RA 3GT7A 3KLPX 4PC3A 2D0DA 4N5MA 2HCRA 4F45A 1LNQA 1HE2A 2B61A 3UUGA 3PFNA 3TW6A 3PUIA 2QLFA 1G8KA 2QW0X 3EZLA 4G23A 3ZWOA 4YRCA 6NULA 4R4JA 1E63A 1M75A 1UPCA 4UD6A 2YDXA 5ARDA 2A35A 4RZSA 1DTWA 2AC7A 1X7ZB 1QTRA 2H2HA 4MDYA 3AR6A 4URHA 3QG1A 1FNSA 1FJ2A 5F73A 3KJIA 3B7GA 1N0HA 4X64B 4PBRA 4LK2A 4UHHA 3G0HA 3FZGA 3TOZA 3M6MD 1AO3A 1MORA 3VNRA 2WILA 4HDRB 2MSNA 3EXHA 3UAGA 5IBPA 3QI7A 4BGVA 5CCEA 4UCXA 1M76A 4KR9A 2WSSA 4CKYA 1Q44A 3RS2A 3JWGA 3ND7A 1C0IA 1QFZA 4U3JA 3ITEA 3C15C 2Z1MA 2WOJA 4QXOA 4AAYA 3I2FA 4ESOA 4G9EA 4ROSA 4XSVA 4R1MA 3T5CA 1PR9A 2BFCB 4E11A 3INGA 1CUWA 4H35A 2Q6LA 3VVBA 1NGSA 4FMCB 5L3ZA 3AVYA 3X1ZA 3VKGA 3MSCA 3WJAA 2GJAA 5CDFE 1KZ9A 4OAQA 3RSFA 2FMXA 4OBXA 3TLGB 4PNEA 1RAHA 2ZWIA 2M9MA 3GAAA 3B1FA 2HSJA 3S55A 3JD3A 1U4OA 4XR4A 3T3IA 2JBAA 1P74A 2H59A 3FDXA 4QPZA 3SD7A 3SFTA 2E87A 3OUUA 1PNRA 1XDGA 2XKKA 1RBZA 3PEVA 4KR0A 3BMQA 3HCAA 2QD2A 3K7EA 5GJWC 4TVKA 3LT4A 1V96A 4YJGA 2W6JA 4LXYA 2PO5A 4BC0A 3DZ8A 1JG4A 5LYJF 3G2KA 1ZIYA 2GYYA 3I09A 4IL5A 1RAFA 5KNCA 4NV3A 1P77A 5FD8A 1C0LA 2EKLA 1P5JA 2IELA 4X63A 3F9CA 1VHWA 1N92A 3ZU4A 4NFYA 2XNHA 2Z2YA 3LUBA 3EZGA 3L49A 4IIJB 2XZOA 2RD2A 5IC4A 1XHFA 1GRVA 1YS9A 1WQ3A 4BLTA 2HCFA 4Z9XA 4C9BA 4H6WA 1SOUA 2GAJA 2FFRA 2XGSA 5JASA 5CIQA 3MRVA 3NWEA 3OT1B 1F1BA 5A2QA 3TTUA 1ULAA 4NDNE 3I9LA 4G81A 4Y98A 3T3HA 4YUYA 1OAKA 1WXXA 5EE3A 8OHMA 1S2LA 5ES4B 5BUZA 3MGGA 5KQSA 3Q9SA 5BN4B 4BJ6A 2VNKA 2BEVB 3SQDA 2B3TA 3ESQA 3IS3A 4R71A 2W2XA 1E3IA 4LNUB 1ZINA 3DL0A 1ZG3A 4QARA 3ZVNA 3VA7A 4NH4A 2VT2A 1YS7A 1EA5A 2YOFA 3HO8A 2WUDA 1U90A 3WLMA 2ZBEA 4BNXA 4DJDC 1MC4A 1MRSA 4OQZA 1KEKA 1H9CA 4RK0A 2Q29A 3C3DA 1NBEA 1SXQA 3DPIA 4JYMA 3OMWA 2IK8A 2JKVA 3CLUD 4AC9A 3ZWBA 3ROGA 1G8HA 1HYEA 2CNDA 1YZVA 3M4JA 5DYYA 2FQQA 2ACWA 4BNZA 4K6OA 3ONEA 1A7AA 2AEEA 3NIWA 4K88A 2IOHA 3PGVA 4LZLA 2WSBA 4E09A 1K3TA 3K70C 2IIPA 4PYMA 2PAAA 1CV2A 3TQQA 2INGX 1QHEA 4WCFA 1F6BA 3KB6A 3TQHA 2O8EB 1WMDA 4EUKA 4COKA 4C07A 4BX0A 4LNHA 4Q9KA 4M7PA 3PDIA 1EXMA 2NWQA 1G6KA 4MVXA 4E12A 5HIMA 5C8ZA 2I2AA 3PDHA 3AUKA 2PLRA 2QY9A 4RPCA 1KHHA 4M6WA 2V4UA 1NBAA 3DEFA 1LK7A 1SHLA 2JIRA 3OJEA 3DDOA 1NM5C 4W6ZA 1DBVO 1N6NA 3IUQA 3RYFB 3GLFB 2E5WA 3QY9A 4F3NA 2VNSA 2BE7A 2CB9A 4B7AA 1UBNA 4HOYA 2WPNA 1RXIA 3A6DA 4EI7A 5BVGA 1LV7A 2GKOA 4M3NA 2W2PA 3H1FA 1KYWA 2EW1A 3GLKA 2WVJA 3GVHA 5DH9A 4C6HA 4HEJA 3VZBA 3W3AD 2II6A 1F8YA 2CCGA 3R9IA 3NUQA 2C99A 2G7ZA 4J9VA 1L7BA 1KYIA 4P53A 1ZD1A 2JCXA 3DL4A 4KQJA 1MAVA 3GEMA 3IBGA 3AF0A 5IMBA 1NX9A 4EKDA 4F6RB 1ABFA 3CUUA 4OTZA 4YBZA 4EHHA 4WZAE 3T5BA 3KQNA 1IOLA 3AO0B 1SXJE 1UBOS 4JOCA 2JI7A 5KOJB 1R9NA 1U2PA 1R0BA 1ZESA 2COKA 2BONA 4MDHA 1WPXA 2XIQA 1QLJA 4QYIB 3C3AA 4RWZA 4HPWA 1U9CA 1W5AA 3WIEA 4AP9A 2OYCA 2QRLA 5AK6A 4EOGA 3QFTA 4B6RA 2DPGA 3GRVA 3TQOA 1X86B 4IX1A 5C8YB 1C5KA 2NU7A 3MWJA 2OYSA 5JXWA 1ZIXA 2ID4A 4IIYA 4M2LA 5TIIA 1MB3A 1EVZA 5CT8A 4KLRA 4NFHA 3C3BA 2J0UA 3G0OA 3ODGA 1ZX1A 3ZD7A 3BGWA 3PNQA 4DV6B 1I94B 3AJAA 3VFDA 1F9EA 3GEIA 1ZXBA 3IBFA 3UYLA 3GRAA 1KSJA 2CDRA 2Q4RA 4KWCA 4RC9A 2Q0QA 1VB3A 4ROTA 4TQ9A 5TVKA 1Z6TA 3JPWA 3OIWA 5K51A 3KUDA 1T0UA 3KOWA 4JU9A 4B46A 2ZXUA 4K86A 4OJTA 3KZ1E 2YBEA 1PSZA 3JQFA 1R5OA 5JPDA 2Z6QA 1ULZA 3HU5A 3K09A 4ZV4A 3SHVA 1NI4B 2NTNA 3FUWA 3R3WA 3RTAA 3WL3A 1MABB 1OKKA 4C4TA 5EJ5A 5HIAA 4O4IB 1GPLA 5E2IA 2I34A 4AZ0A 1J4AA 1TZBA 3VDRA 3YASA 4P31A 1POWA 5JTTA 5FOXA 1L1QA 4A6EA 4CGYA 2O3TA 4JLPA 4AF8A 5JLJA 1Z5GA 3T9AA 1AVTA 5G0SA 4BX9A 2ENUA 1MJFA 1JKJB 3SSMA 2GK6A 3FDFA 2XYQA 2UZIR 3JPYA 1EFKA 3KFLA 3R23A 4IG4A 4PM4A 2XMDA 1A97A 1ZMXA 5FBWB 4XIIA 3N28A 1OFIA 2AOWA 1VBFA 1TADA 3EIEA 4H59A 1H2ZA 4ZYLA 3LP6A 2H00A 3DUWA 3LBFA 5MGBA 5ITSA 2O6LA 3JARB 1CB7A 1XEXB 1SIOA 3E23A 2VF8A 4X7PA 3H2ZA 1I4WA 3EUWA 5KKNB 4JCCA 4HNVA 1F0NA 4CCAA 3NOQA 1HSZA 4X7BA 3IKJA 4FK8A 3V6MA 2YFYA 1P3JA 2IZZA 2WMOB 1CR4A 4KPEC 1U0EA 5IT0A 3QOYA 1WBDA 5IW8A 3ZGOA 2O2XA 1M6VB 4E5UA 1DBWA 3W5AA 2Q5EA 3KKOA 5ERGB 4L74A 1R2QA 3WDLA 3WAGA 3GG2A 3HZRA 1XQVA 1Y5NA 2QXYA 1C8VB 3JALA 3T7AA 3OEEA 2Y05A 3QWHA 2PMKA 4ALLA 1Q0LA 4PY2A 1U8FO 4MGHA 2IIQA 4G36A 2CFSA 3DVQX 2Q7OE 1TU3A 5CM8B 1GZHB 3VDNB 1Q7GA 1F2UA 4Y6SA 4S1WA 1TQHA 3EMVA 3GRCA 5DP1A 1NUAA 1XRMA 2RH8A 5JLAA 1VYHA 2BMEA 4BKUA 3O4IA 3B6KA 1WUIS 2C5FA 1E2HA 4EO4A 4PW0A 3C7CB 1RWVA 1SRQA 1T9DA 1WS6A 2QMHA 2NO6A 1SHZA 4DBLE 1DXOA 1UR5A 1JW9B 2OHGA 1HYBA 4MSUA 2IWHA 1QIIA 1DG9A 4CLOB 3IT1A 4D4HA 2H65A 3GYGA 3LQKA 1GZDA 5KDLA 3SFVA 1U3DA 3KPUA 1C1HA 4M8LA 4NG4A 3WGHA 4ALKA 3C0KA 5E0KB 5AP9A 1JN0A 2NZ2A 4V03A 1T91A 4D80A 1K63A 3O3OB 4P86A 2YZ7A 1X7XB 1NONA 1NV9A 3QTLA 4WI1A 3QKUA 4C2BA 5JCZA 5GONB 4BAGA 3V7WA 1YULA 3WBJA 5E2AA 1ORWA 5ENZA 4MV9A 1OHHD 2WYVA 1SCUA 2YQ5A 1H3FA 4PAOA 1OVGA 1UBLS 2A9RA 4ZDKA 3HLTA 4TWJA 5FP0A 1DWUA 4NY1A 1SOAA 1MJGA 1HTBA 3AZOA 3FDJA 3GRKA 3GUHA 3KIPA 3RJ5A 1TC2A 5AVSA 2HU2A 1SKQA 3OQOA 4D9BA 1LBQA 1CE8A 2F90A 2TSYB 2G3YA 2QW8A 1REQA 2WFLB 2QRGA 2YY5A 4AZVA 5KS2A 1GFIA 2C31A 3ORQA 2CFOA 2XWPA 1AKNA 2ZUSA 3AGPA 4QSHA 3G5MA 1EH5A 1OZHA 5IC6A 3ZLJA 2YUTA 1QE0A 2X2OA 2X6TA 1Z12A 3QWFA 4LSGA 4KR6A 3AMVA 3P9RA 4GMXA 1AO0A 4MR9B 5EQJB 3CV3A 5FULA 3AVTA 4HNTA 1POXA 1FE8A 1VQ1A 4WA7A 4JI5B 3BF8A 5M3BA 3T6KA 2Z1NA 3ANLA 3R0VA 1F7UA 7MHTA 5FBQB 4GR4A 4C5CA 2GJ8A 3IXLA 2NVUA 5CT5A 3N2IA 5DBFA 2ZK7A 3CQ9A 4UTPA 4TS3A 2J9FA 2GUGA 4FR5A 4H0NA 3FFBA 3R6LA 3AQIA 4K40A 3IBCA 5LB4A 5JTUA 5B53A 4URXR 2F9LA 1N8SA 1TO1E 3LUGA 4MCIA 3SKXA 1X74A 3GJ4A 4DJTA 1D8TA 1MP0A 4IV8A 1WJGA 3UMYA 3DJFA 3AY0A 3ORRA 4OGFA 2OSBA 1Z0IA 1ZMBA 5EIBC 3OIGA 3P9NA 4N5HX 3OICA 5AHKA 2A5YB 2LWIA 4GZMA 1JNYA 1MTOA 3WRVA 4B6EA 4C3OB 3GN2A 4FEYA 4L2IB 4N3AA 4FCTA 1TJ4A 3PYLA 3WKBA 1RM5A 1B15A 3QEAZ 2E4XA 2YJ6A 3RIXA 4ZGBA 5AJZA 4WT7A 3VI3B 2RK4A 2ZIXB 3I2GA 3VV2A 1QUFA 2I5PO 5LYJA 3KWLA 2ZRGA 4ZU6X 1KK1A 1U8EA 3O31A 5DLPA 5CNIA 3RVBA 1MR3F 5D3MA 4Q19A 1KZ7B 4AXXA 3GCWA 3AETB 2V7QA 4UVHA 1TMKA 1OFUA 3G5UA 5EP2A 1RZ3A 1FP1D 1CRPA 2N47A 5DISB 3D0QA 3AOEA 3B8EA 2YVAA 3LJKA 5FAXA 4DIMA 3ETJA 4MRMB 3KLOA 2HDWA 2R86A 4RS3A 1NVEA 1K8ZB 2GAOA 2J3QA 3O3CA 5LBIA 3TR6A 1Y0BA 2CDAA 3MBOA 1PT8A 3H19A 2QAGB 4P32A 1V6SA 2IPXA 2XR1A 3O92A 3O8OA 4PG7A 4HV4A 4M1OA 5A0FA 1S2DA 4B81A 4DLBA 5FNVB 2B7LA 2AWOA 1PD1A 3A25A 4OMFG 4BDTA 3IKTA 2K7FA 2EBFX 2JIQA 1C9JA 3CRVA 3OZCA 4AJEA 1PW7A 2VATA 2QVGA 3F6BX 3MA0A 2PLWA 1YFLA 3AU9A 4WLEA 5GIPE 2QQEA 4AULA 4R9NA 1KYVA 3ND9A 4KAJA 3R4CA 3AONB 1WULS 4ACAA 2O59A 5EHXA 1U0LA 4ER0A 2QTMA 3PPIA 3ETHA 1WSDA 4Q6BA 4Z4FA 2XMSA 3FOAA 4DV0B 3LX5A 4UM7A 4EYKA 4D3XA 3H0KA 3IO5A 5HE9A 1NBME 1T9KA 4DUGA 2C4WA 1V37A 2ZRHA 4L6IA 2XT0A 2D2FA 2AMYA 4ACBA 1WZNA 4L28A 1VJCA 1TCCA 4Q9LA 5L3SB 2O8DA 4RAQA 5A71A 3U3XA 5KPJA 1UZUA 5KPDA 5JCPA 2GXUA 4OHRA 4HXGA 4ZJPA 1LDGA 2VYCA 3X1DA 3O4HA 1CQJB 3E7XA 4QQ8A 4RF4A 3H97A 3I9V6 1D7AA 4NZPA 1UZMA 5AM3A 1M73E 1H8ED 4ZXPA 3BSFA 1BKDR 2Z9CA 1W94A 2PUFA 2C00A 1LY1A 4HWRA 4RZUA 5EZQA 3WGQA 3OPMA 4AJIA 3ADDA 3REQB 3RS7A 4UBKA 4XX0B 1K4YA 4LV8B 3GWZA 4MDFA 1MPTA 3P32A 5AM1A 3F7TA 3W9SA 1YAJA 1J22A 3JWIA 2YV4A 2CSXA 4P58A 3VPGA 1M8FA 3GT4A 4AN1A 2G4LA 1SU6A 3AM3A 4EB0A 4FZ3A 1F17A 3KEQA 3G9TA 3GJ7A 4LSMA 5B2ZA 3LE8A 4W7IA 4JLUA 1EAYA 3HU3A 1RPTA 1TAHA 1G5TA 1E99A 1U7UA 1XZKA 3I9NA 4NJMB 3REFA 1AZTA 4TKVB 4EI8A 2Z2IA 3FGNA 1ISPA 3I3OA 1N1MA 3HU1A 2R7MA 3PC8A 1MC5A 4H0FA 3U5ZB 1UUFA 4FEAA 2MYNA 4BFYA 3UCFA 5EEGA 1L4YA 3LLUA 4B2PA 1TUIA 2AC2A 1A8PA 3OX1A 1R27A 2R48A 3OECA 5LP6F 4B47A 1Q15A 5IEBA 3DAGA 3BVPA 4R3WA 5HEKA 4EHIA 4ZYYA 3GLGB 3A11A 3TIIA 3ZD6A 1EX6A 1L6RA 4MVWA 4J2OA 4C0XA 2XDQA 1H2AS 1UM9B 1RCTE 5T5QA 1RBQA 1GDHA 2C95A 2VEOA 4DARA 1WUTA 7REQB 1OZFA 1OROA 3P7MA 4F9EA 3UG7A 4TYYA 2I62A 5COAA 1TA9A 3T41A 3K5IA 1K9SA 2CWWA 1SKAA 1G63A 3GW8A 3DBRB 3EEFA 3WI7A 4XUDA 4JT4A 3ECCA 2C9CA 2BFOA 1F9AA 3ZJTA 1BX1A 1JA1A 2AFVA 1V11B 2PEZA 1TD1A 3EJWA 4D02A 2AZMA 5BV7A 5JZVA 4GR5A 3U62A 1M54A 2JH9A 2BGNA 3KTOA 1H0RA 3PQDA 4HRYA 4JVOA 2P41A 2B8JA 2OBYA 4K0RA 3RNOA 3MUEA 1M0SA 4A5OA 2XB2A 1NW8A 5CEFA 1GNPA 5IVPA 3L6CA 3Q3IA 4P3PA 1WCIA 1E7MA 5KSWB 4E31A 3T4EA 4AS1A 2P91A 5EP4A 4X44A 1IATA 1HEYA 1DQZA 1E2DA 2RDMA 1WDMA 1M8JA 3UWPA 4HR7A 4PR0A 3GT0A 4GVPA 3HV2A 4UAGA 1Y6GA 5SYMA 3L93A 4XPZA 2IY8A 3WYEA 1ZGBA 4N8SA 5JO9A 1L7VC 3A1VA 3VYVA 2NQTA 3WLSA 3HTXA 3DTTA 1ULSA 1X92A 4XJTA 1VXOA 4OL9A 4C78A 5A1JA 2XVXA 2CVOA 4S2UA 2J9ZB 4HC4A 4FHEA 3BKWA 4FE4A 1KVQA 1L4KA 3QLVC 4MWOA 4BLPA 1YSCA 1OFVA 2WLSA 4KQMA 3OO1A 1VECA 2PMEA 1JIXA 3RRZA 3BYZA 3NKFA 3AFOA 2DFDA 5B55A 4CG0A 1CEXA 4CQMB 1JU9A 4YCSA 4FJ0A 1PWYE 4LUCA 4YRBA 4JLBA 1RKQA 5A9TA 4H1WA 1IBSA 3WAKA 3KPJA 1DHRA 3DAPA 4MW0A 2WTAA 4QECA 1KJNA 4O2AF 1XBTA 3NHUA 5HHTA 3GRPA 1GSIA 4JVNA 4K7JA 4E13A 3E9DA 3E05A 2QYOA 4PG6A 3T3PB 2UYOA 1B23P 3F5FA 4HFMA 5FL7A 3TTSA 1NW9B 3A6KA 1YS2X 2G0NA 3MJFA 3IIEA 3DXFA 5C32A 3W2HA 4W5WA 1SWWA 5GAJA 2JF0A 1W88B 4X8LA 3WMFA 1BVHA 3KLMX 3AI7A 4BNDB 3B1JA 1J09A 4NBKA 3TH5A 1YZ3A 1UIRA 4K46A 1EXVA 3GLRA 1I1OA 1E8DA 1C9MA 3UJ8A 1XELA 4E32A 5KI6A 2NP6A 1WU8A 2ZSUA 3G8DA 3NAMA 2JASA 3DT8A 4G9BA 1KEEB 3L3BA 5IJ0A 4JB8A 4WZBA 3RC3A 3Q9NA 3U9TA 1OSNA 4OP2A 1WZUA 2PTHA 4LA4A 1CC1S 3C41J 3E8SA 2QRJA 2VDKB 3ZGVA 4HAVA 5KYXA 4GYKA 1HDCA 1TMGE 3DMTC 2ZCJA 1N34B 1MX5A 1BWQA 5A5EA 4RVHA 3WHLA 3TSAA 1R4AA 4A91A 1DL5A 3ZDQA 5EC8A 1XNGA 1E3WA 3LQ1A 2GN0A 5EZ5A 4XDHA 3RVJA 3UT0A 4Z7OB 2QRVB 5G41A 3LHKA 3ZH9B 5LMZA 5ETJA 2A9JA 1ULBA 2YCLA 3EA0A 3GZ4A 2BBTA 3I76A 3UB3A 1CJKC 3CKYA 4LE0A 1PDVA 4RGVA 3CO0S 4KOAA 3GLUA 2O3SA 1OB2A 3ZQ4A 2I9KA 4PPYA 5DT9A 3VR4A 3C5WP 1BVUA 1MVNA 1NZFA 3PRJA 4F3YA 4NMMA 4TZ6A 1W85A 3KZVA 1GP2A 3BE5A 5B30A 3B9BA 3PWSA 4FZJA 3V00A 5HJEA 3PIDA 1ISJA 5E9AA 2Q6IA 3DZDA 3LQQA 3HY6A 1X1CA 1GKLA 3B48A 1YTLA 1MKYA 1GSAA 1RKVA 2WJ3A 4QJ5A 4L27A 4N82A 1LK5A 2F48A 3D6JA 4ZD6A 4FOOA 2PX0A 4J29A 1GKUB 1XRRA 2DLNA 3LGAA 3PFKA 4GPEA 1DTWB 2VH5R 4GEGA 1UK9A 3ZQUA 1TJPB 2H57A 2XWJI 4REQA 3ROTA 5FPTA 4PLHA 1B42A 3FPCA 4IRUB 2R44A 1H69A 5FYDA 2VKTA 3BSYA 4PYKA 1FMCA 2WWGA 4NTZA 4ZQBA 2F00A 5GJVC 3EXHB 1HDIA 4KSBA 3W3ZB 4XVHA 1Y7IA 2QN9A 1T3ZA 3HCBA 2QUZA 4H31A 4ZYXA 3E2MA 4MWSA 2X0FA 1ZAYA 2QN1A 3IALA 4YLGA 4M54A 1DRVA 3IJEB 4MUAA 3DZIA 3BE4A 1X9HA 1CHDA 2J6BA 1VMDA 2JVKA 3K16A 3K9LA 2MHCA 2X2FA 2BD0A 3OZGA 5CK5A 4DNXA 4EUHA 3I30X 2QVLA 3BXXA 2DT5A 3PP8A 1NDQA 1WSAA 3Q0TA 2GH1A 4CIDA 1HDGO 2Q3JA 3CH6A 2ZBUA 3L0IB 4D3YA 3QMMA 2FVYA 1V43A 3JASA 4AT1A 3TMYA 4IOJA 3HCEA 4RL4A 2P9HA 5E6UA 4BQNA 3G85A 4QA9A 3NASA 1WB5A 4ZCRA 5C5CA 3CG4A 3EVNA 3VTFA 3N86A 4B6JA 2F1RA 1GG8A 3BMQB 3FDZA 4KQIA 4LC1A 5IABA 2GLXA 3O26A 3HJNA 4HP8A 4BKOA 4XRGA 4YJGB 4KHPB 1LTKA 3LL7A 3RAPR 3F74A 1ZGGA 3I4FA 3NH6A 1DKRA 4L78A 3OM0A 5JAIA 4JXKA 4PZPA 1ECLA 1P5RA 4UMFA 5LXTF 1P72A 1V6AA 5HDQA 3DLHA 3NI2A 3FWKA 3CVYA 4YMVA 1NNSA 4UNIA 2X0DA 5C1OA 3I62A 1Y1SA 4DQVA 1RWBA 3Q3EA 4RLFA 4JB3A 4NPAA 3HJUA 4Z49A 2OBMA 1OXSC 4LVUA 1SVIA 3M2TA 5LQJA 4TMZA 4J0EA 4AW9A 2PXXA 1WU7A 3E5HA 3G2IA 1UPXA 3OX4A 4GWLA 4MUYA 3R74A 4BQSA 1DAFA 1YL5A 3P5SA 4GMHA 1NQUA 2IXAA 5BUQA 1KA9H 2R5WA 4TRJA 4MAFA 3MQ2A 2F55A 4G85A 5KKAA 4DA4A 2NPIA 4F5DA 3H6KA 3DZBA 4LQDA 4LPSA 3ZNQA 1T5IA 1YI1A 1RJDA 1YVEI 3C43A 4QVGA 4TLCA 5D87A 1ISMA 4F8YA 4ZVSA 3TM5A 2BGWA 4HNRA 1QV7A 3BD6A 4J1SA 3R09A 5JY1A 3QPDA 2Q5LA 3AHEA 2QX8A 4IVRA 4DG9A 3ZWWA 2QF7A 1GA6A 3MGAA 2WKRA 1UPBA 2ZDGA 1DWOA 1I2CA 2ZAYA 3PICA 3CINA 4KAFA 4NV1A 4WDQA 1XQ9A 3KLBA 4OSOA 2XAAA 1ES9A 4YQEA 1HE8B 1QIJA 2AS0A 2VHCA 4J3FA 3O4GA 4PZUA 4O2LA 2QLLA 5IRCD 3KJQA 1NIJA 2XE6A 4XUEA 2FKAA 2IP4A 3L05A 3KDAA 3L8HA 5HRAA 4Y0VA 1A7JA 5JATA 4JYZA 5CVVA 3UOWA 1M2KA 1W96A 3WTCA 2OZEA 2WNSA 1YJXA 1L7NA 2EHJA 2XUAA 3PDIB 2H0QA 4KXQA 4KB5A 2YIDA 3VYRB 3HJBA 2OAEA 4XVCA 3KVOA 3W4IA 4AN4A 2BJHA 4RJIA 4DQLA 2FSPA 3ESBA 1ZJ4A 3WK5A 4CHTA 2I66A 3H1BA 1NZDA 1MO2A 1WBJB 1X38A 4GE3A 2ZI9A 4NCAA 1V4BA 1YQXA 1ZK0A 3D5EA 4RY0A 4D9JA 2PWBA 4DQDA 2JJ2A 1OX4B 2XX3A 5A4KA 5BVGB 4RY2A 1WKCA 2ZS9A 1F06A 4CMCA 4QULA 4MQBA 1DUSA 5HBRA 1F2DA 1A76A 3QLEA 3LM8A 3VM6A 4A8JC 2Q4OA 2ZR9A 1ISSA 3ZW9A 5IF3A 2Y71A 1NMQA 1G3QA 4M60A 4A6DA 5DP2A 4JL8A 1BX0A 1NF9A 4BECA 1HT0A 1T15A 4IDCA 3KOUA 3REOA 1YZUA 3SCZA 3Q7RA 4GC9A 1CUVA 2V5UA 3ZHYA 4F3TA 4CNQA 3HA3A 4QFMA 5FJJA 1A9RA 3HSYA 5EWMB 4W99A 4A2PA 3KYCA 1P7CA 4JEMA 3S5UA 4MQEA 3PNOA 4OHBA 3K8YA 1KJ8A 1BKSB 1E60A 3H11A 4MYRA 2PXAA 1EDBA 3EVEA 4F2WA 3W6ZA 4M83A 3LCCA 2WY2D 5TJ9A 4N48A 1PGQA 3A2NA 2VLBA 2ZRBA 1LW6E 2WSMA 4HKTA 5GZ1A 3QKSB 4GX1A 1DO8A 5EXTA 4J1TA 1Z8HA 1LA2A 4BFLA 2NU7B 2IIVA 1YCFA 3AY3A 2F9FA 5F9MA 4ZMSA 1T0IA 2IUEA 4I8XA 5DBGA 4GH5A 5CEJA 3U2QA 1FRVA 4R2IA 4RVOA 3T0GA 2M6RA 3G0GA 1YA8A 1PZNA 3PF9A 4Q3KA 1GL7A 1V8BA 2WJAA 3HCFA 3MB5A 4KYTA 4EYOA 3KTAA 1T1EA 2FHSA 3H5AA 3HYLA 5KYVA 5DOVA 2P78A 2PH5A 2XCOA 3OQBA 3R5TA 4TSFD 1D1PA 3ABSB 4UARA 2P2ZA 4I9HA 2V0CA 5FLYA 1YU9A 3QFFA 1GU7A 3NP7A 4KH0A 4MYTA 4NATA 3GXBA 3NONA 2V6GA 3F6YA 2FQXA 1U2QA 2VRBA 3P19A 5AKLA 1U3CA 2ZQYA 5HKAA 1EJ0A 1MVLA 2YXDA 2FUKA 1DCFA 3B9QA 4F72A 3RAEC 1DEAA 2ODTX 1J0CA 2C1EA 2X5JO 4AIIA 4Q7LA 3K6SB 2OB2A 1BQEA 2EZUA 5AOVA 1SVUA 1E6KA 1DFHA 4OA8A 1P4AA 1TGVA 3R7DA 5CXUA 5C4IA 2P7IA 4CIWA 3CN9A 3A28A 5IHXA 2F6RA 2H1CA 2PH7A 3GPBA 2MINB 5I9IA 2QT9A 5L51A 5CM2Z 3SAJA 3C8UA 5ECYA 2A9QA 3FNRA 1CCWA 4JCOA 4J6EA 4ARCA 1QYVA 1KI6A 4LJLA 1JXOA 1UDBA 2HNBA 1VIAA 4DG5A 4XJSA 1R5JA 1RJ9A 1RAEA 4ZIRA 3EVZA 5JYDA 1DMRA 2QJTA 2VT3A 5D01A 2R3SA 4PAGA 1ZJYA 4O2AA 1XKTA 4UBOA 4BUZA 5I5EA 4TMKA 2X5XA 3CNEA 4XUCA 4X84A 5DW0A 3K9FC 2I4IA 3G2JA 3HKCA 4V0MA 5FUXA 1AK1A 3QLUA 4EJ2A 3V8NA 1KY4A 4Q16A 1UZNA 4C30A 2R1ZA 3CX8A 3LYHA 5AJWA 2WVHA 1AQJA 5EI5A 2XA1A 4B0PA 3FSJX 1KDYA 2SECE 3ZKWB 4OX9B 1YQGA 5DKFA 3ABQB 5KJ6A 1TYCA 1H42A 3ACDA 4A0GA 3JALB 1NUPA 1QOZA 2I6SA 3D6UA 3S29A 1N6IA 1TCUA 2G77B 1ODLA 3GGSA 5JROA 1EFAA 1ZRHA 1R4ZA 1F2UB 1UDRA 4IKOA 1BC5A 1KIAA 1JPNA 1YKSA 4PSAA 3QLTA 4CEHA 2CD9A 2R7KA 1ISGA 4HZIA 2G5PA 3I12A 1CETA 1GL6A 2FX2A 2VTVA 3M6FA 1FS5A 2DR3A 4CMKA 4E1BA 5EA2A 1N2CB 4N5IX 5CVJA 1Z0DA 1NVVQ 1I80A 1W34A 1KZ1A 5BWCA 5JH7F 1CS0B 3HNPA 4R54A 1CUAA 3KS9A 2BFFA 4CLEA 3IE1A 2HUNA 1F0PA 5BW8A 2Q3BA 3BWYA 4JENA 3U3RA 2WSYB 1EIWA 4Z7NB 4WNAB 3PNBA 2WBLC 4G2TA 4WUTA 5G1NA 1NT4A 1L5GB 1PT6A 1ECBA 2GYUA 4KN9S 5B1DA 3S1AB 5BV0A 2F3SA 3JTMA 2Q3FA 2ZB8A 3AIMA 2YMPA 4LMPA 3K5PA 4ZICA 4EJMA 3WKCA 4NSNA 1WMBA 4MR7B 1TM1E 4REOA 4V2IA 5FF9A 1SCUB 2C9YA 4GOXA 4KGZA 3ANXA 4FT2A 3AF4A 3OE7D 4D25A 3ZY2A 1THTA 4GM4A 1PI3A 3ED1A 5IG2A 7GPBA 2AK2A 2VO1A 4GU5A 4F9FA 1DUIA 4HF7A 3CZAA 5K99A 3B7WA 5K8VA 2V0GA 1QP4A 4LJ8A 4JOQA 2G6BA 1T1JA 2P6NA 1REQB 2OCLA 3CLTC 3G9XA 1K2VN 2DQZA 4YDHB 4G8CA 2QXTA 4M1MA 1UOPA 2G82A 4OBBA 4I7EA 1NY5A 1EFLA 1KMMA 2GBFA 2H1OA 1XCGB 1X0XA 3GFBA 4E4TA 5ALPA 2PSDA 3TMAA 1T13A 2NMVA 2DLDA 3WB9A 5JZOA 3AJ8A 1EUCA 1CVIA 4CQMD 3L7LA 2VCEA 4L76A 3IEKA 2P69A 4DY6A 5E3IA 3DCNA 3QE0A 1C3JA 4AX4A 2AZXA 1NW3A 4EUNA 2JL1A 4JQOA 2WSIA 3GD5A 5TPWA 4E30A 4Q39A 1RNLA 3AHGA 3FN4A 2P2SA 3BCUA 3KSAC 5JMOA 3BB1A 4H6PA 4Y6RA 3O8NA 1Q2XA 3O8QA 4FFLA 4PX5A 1RZRA 4KR2A 1RVV1 2LW7A 5K6AA 1KC1A 3RIGA 1BGWA 4NABA 4G1FA 3SDZA 2CVZA 1LDEA 2GKGA 2Y92A 3A3OA 4PHTA 1V9LA 3IOEA 1HNZB 4JL6A 4LYYA 4EKYA 1JFFB 1O9GA 2EW8A 2NO4A 4CL0A 4C29A 4MUXA 4DIUA 3AY7A 5AVJA 1ZL2A 3L6EA 1HPLA 7ABPA 1KAQA 4AICA 2X9NA 1M1UA 5FB3A 2NVBA 3CUTA 2GESA 1XMJA 1FDUA 4TV9F 2GXQA 1JHOA 2FMFA 3ESZA 3KQOA 3OLXA 4JIMA 2Y8EA 4A0RA 3U19A 2JLZA 5ALEA 1YDMA 3HR8A 3H8JA 1G9TA 3NBZC 2OGTA 3IOMA 4PGAA 5FUYA 1HK7A 3HZOA 3DP7A 3O82A 4HVTA 3T1QA 2JFPA 4C6TB 1FFDA 4YJ2F 3P0IA 3TEJA 5LYJB 5DNVA 2B8EA 1P19A 2CSUA 1P33A 3QTBA 1K88A 2O0MA 3PJGA 4GECA 4NBVA 4O1HA 5B4UA 1DKMA 3U7JA 3X1WA 1E6EA 3CU5A 4C4PA 5LXTA 1U9ZA 1LVHA 3EW9A 3QMWA 2C7BA 1QG4A 3KJNA 4OXYA 1T6ZA 2JI6A 2AOUA 3EGXA 3Q3VA 3DHWC 3I53A 3DV0A 4MRAA 4ZOEA 2GVNA 2OPHA 2HX1A 1KEVA 1V25A 1Q84A 1O94C 3ZDYB 1XALA 1P8JA 2AG6A 1WMAA 3P2EA 3O8OB 3C5HA 4HFNA 4NBTA 4RF3A 4FFWA 3U3DA 1CEEA 5AESA 3WLHA 4EPVA 4F91B 3I8SA 3CJTA 5FTNA 1CUHA 3LFUA 1G41A 2FE4A 3N0XA 1PFVA 5JEEA 2OUIA 3NT2A 4DB2A 1EI9A 1Q19A 2IUFA 4LG1A 2EVWX 1O0CA 1TKCA 2FPLA 1P31A 4YN3A 5TXGA 1SD1A 3LYLA 4QGHA 4BC1A 1AHPA 2DGDA 2MSEB 1TUBB 2QN6A 3EPHA 3ZC3A 5LNK1 3ZQKA 3PUJA 3WDMA 5T57A 2DM6A 2XYGA 4QOGA 2HA5A 2GDZA 4YC7A 3ZE0B 1CZNA 3NZEA 3FYSA 3TIVA 4AS2A 3P0RA 1C8KA 4JJEA 4RAOA 1C7RA 1SWVA 3RC2A 3DMPA 1PJ3A 2O3UA 4UE6A 3SVTA 5I8WA 1J24A 5CTAA 1PEDA 3TD9A 5A6VA 2V6JA 3CEAA 4ZP1A 4C7OB 2DPHA 3M89A 2UUBB 5ALHA 4XLZA 1NA5A 3KOMA 3LUAA 2XVZA 2W22A 4A8PA 5CU7A 2KW5A 4A0HA 5BO5A 1ECPA 1U7ZA 3E82A 5JVDB 4JKOA 5AVUA 4YX9A 3IQZA 4I8IA 5DEIA 1VG1A 4KIFA 2C0QA 2B4YA 3LX4A 2BF7A 3HWX1 4YLEA 2O2IA 2DKNA 3DW3X 3MJDA 3OTWA 4JSYA 3WGNA 2E1PA 1FDOA 1GXSA 2WK1A 5M04A 3U9SA 1U0JA 3RVPA 1CLEA 5JS1A 3KB2A 3KEOA 1C1DA 1AA6A 1FSFA 4W1SA 2WJJA 5ILGA 1SCJA 3EIHA 3VYSB 5C52B 5DWQA 1N2ZA 5ALVA 2G88A 4EJSB 4CKEA 2FEPA 1QK4A 2DMRA 3WB1A 4DLXA 1GTG1 2HJRA 4I9FA 5F7ZA 1Y8AA 2EYQA 2H2GA 1RXSA 4RF2A 4KE8A 1XI2A 5ARCA 2BFAA 3E15A 3LW8A 3P26A 3PEUA 3TVYA 3IUSA 2YXBA 4P08A 3V8MA 2VBIA 3UC5A 2W6PA 4I1IA 4U7GA 5LM3A 1IB6A 1EUYA 3M5DA 5JJ5A 4OU5A 2P2CA 2VJAA 2VI5A 3EEYA 2NUPA 3PJFA 4XAQA 3B6MA 3D7KA 1R5BA 1RRFA 3GEGA 1P3Y1 2Y99A 4IDAA 4LMBA 3FYUB 4WX2B 4LJSA 1UXIA 4TVOA 3NATA 3O7WA 1L8OA 4D26A 3VH4A 1X1TA 4L5AA 1WRBA 4OM8A 1JF8A 3G6WA 4X61A 3TCNA 2J85A 3PXCX 4IDGA 1T1RA 2BM0A 4HN4B 1FNMA 1F3OA 3N0TA 2XDQB 4GOLD 5AK5A 1QTNA 4ARBA 4FS3A 5JNSA 3RW9A 4E7OA 3QA9A 2P9JA 4XR9A 1FRFS 3SQMA 3AYZB 4G67A 4YACA 3WRYC 1VDMA 1L7AA 2PN1A 1JR3E 2I3BA 3EH1A 3GMIA 4Q48A 4YDRA 2UAGA 3GJ0A 1GSOA 3EMDA 1Z4IA 3H2YA 1NJ8A 3ZHXA 3TVDA 1MD9A 1GSHA 1QVRA 3CE9A 4TLDA 5KTTA 1NBOA 1UFVA 1ZD8A 3VNVA 3ZK7A 1XPUA 2C8VA 1D2MA 2PGJA 4E2YA 3T1TA 1JI3A 2MIIA 4L4YA 4LJ7A 3AKZA 1IXKA 3ADOA 4YS6A 3VQTA 5HFAA 1GR1A 1XZCA 5K5EA 2RH5A 2W43A 5JISA 4GLBA 3QVXA 4DDTA 2FUEA 3GR6A 1XEFA 1T10A 2VZEA 3AVWA 1WCIB 2ONKA 1KNQA 3FJYA 4Z0NA 1AQNA 3AHCA 4R84A 1ECFA 5DXAA 3ZQ6A 2I8LA 1Y5RA 5EHZA 4ZXFA 3QSGA 1HL3A 1QP7A 3RFFA 1U4NA 1DI0A 2CVQA 3E7WA 1SBHA 2JEZA 4OGWA 1K8QA 3PG5A 3AOGA 4P34A 2GPBA 1HFJA 1LNSA 1ZITA 3IEIA 3ETNA 4HK4A 2DG2A 5CFPA 3I42A 5LC1A 3KJHA 3OQIA 2D4AA 4GWKA 3QE3A 2CXNA 3H8SA 2IYLD 2PQMA 3NXSA 2WG2A 3FZEA 3OZFA 4MI9A 1VRWA 3O0DA 1AUVA 1YC2A 2PYZA 4QEDA 4CWAA 1V5EA 1FA9A 5EUMA 4V1CA 4FBGA 4OQMA 1E7YA 2KWIA 3DVAA 3ISVA 3EZ7A 2RIRA 3DOOA 1R00A 3I32A 4FILA 2FQYA 1P5HA 4GMFA 1T3SA 2RBGA 3EDCA 3G5TA 5A4MS 3OLZA 2R6CA 4FNMA 1ZD9A 1RRKA 2WM9B 2Q9BA 3KHUA 4MA5A 3WMGA 1M66A 1UKYA 3D6NB 1G5QA 5ALDA 2RMKA 3K8ZA 3G68A 3O7MA 3OCXA 4JI2B 1C7IA 2Y6UA 4QELA 3M8KA 2HRZA 3PHBE 1IDN1 4O6VA 4L5BA 2AI3A 1TW2A 4BJ5A 4BO8A 5IN4A 1A9ZA 5A2GA 4IDFA 4M0UA 5KC9A 4UTRA 1CQXA 3OCUA 4Q4HA 4AM8A 4BO0A 4DLTA 1GNQA 4D9HA 1EPUA 1QHGA 3TI9A 3VZQA 1I7NA 1ECGA 4NFSA 5DGTA 3O83A 2G70A 3ROQA 4UXIA 2QMOA 3VU8A 1YGYA 4XCXA 3DF9A 4NBLA 3SIWA 3OWHA 2NZ8A 3AUTA 3VXKA 1B76A 3A1UA 1MH1A 1IZZA 3QENA 4R1SA 1PR5A 3IDFA 5THXA 5CMLA 5EUQB 4DT1B 4ZREA 2PZBA 2XBMA 3PQ6A 2OAGA 4P7BA 1WXWA 3EWAA 3PNPA 2DFVA 2IPNA 4QT4A 1VZ2A 4RD0A 5IJ0B 4DR2B 4JP8A 5B6JA 3WOVA 4DMFA 4WZBB 4JLNA 2EFJA 4I1PA 3NWOA 1EUDB 1QG6A 1F0KA 2E4ZA 2YH2A 1THMA 5KYXB 4W9MC 3LCVB 3PGLA 4C43A 4MW4A 1D4ZA 2ZE6A 3INRA 1G2OA 4KLZA 4YR9A 4NU8X 1A88A 1SFRA 3HCRA 2OAP1 3AL3A 1FVXA 4WJZA 2FNAA 1HV8A 1HKHA 2QTZA 1E92A 1K7SN 2O4UX 4YT5A 1EXWA 1XF9A 4ZVPA 4F2PA 3RU7A 4WQMA 1G18A 1XZHA 3S7ZA 2ZJYA 2W6OA 3TTVA 1EJ6A 5HF5A 2AJBA 3IAM6 4HAXA 3SZMA 1PTKA 5I45A 2J0SA 2G1UA 5EZ6B 2ZRPA 3ZHTA 2PJZA 2FOXA 2BFEA 3HRHA 5B5SA 3OO0A 2VAPA 3EAGA 3AI3A 1V5GA 3LXRA 1U94A 1RYZA 4NOLA 1DC3A 2EQ5A 1IMJA 3G1TA 3KUUA 3PD7A 1LRLA 1YH3A 4EY4A 3D6AA 5T41A 4G5HA 1UXKA 5FPHA 2ZTLA 3N05A 1DWQA 1W85B 1EE2A 5ITZB 1IK6A 1U0SY 2IYVA 2YRWA 2OA0A 4XQEA 4B17A 1NZJA 1O87A 4M7RA 3K0CA 2DBQA 4LI3X 4RZIA 4LY9A 2Q9UA 3ELWA 4NBWA 1GPKA 2D5AA 2QENA 1VKOA 1MO4A 1UINA 2AVDA 3LG2A 2Z5FA 4WIAA 3TTXA 1SG9A 4EY7A 4P84A 1D0VA 3FTEA 2WC1A 4WSOA 1ODIA 2PUDA 4I1SA 3TCKA 1RYDA 4BTLA 1TKAA 4CDRA 1OH8A 5J59A 1MVOA 4D6PA 3HJRA 2A0WA 4REQB 1YVUA 4HDCA 5M5BA 1NLUA 3RUHA 1MXHA 3FX2A 1P2FA 1RBYA 1KXJA 3KHTA 1JJAA 4CM4A 1ZS9A 3AT1A 3O5AA 1B3BA 4L3VA 4BTEA 1CUXA 3S1LA 3CM0A 2ECQA 1CUSA 1FP4B 1JPUA 1P1JA 5GP1A 3VPAA 2DB3A 3R0QA 3R9XA 3Q7TA 3JQ7A 3WL6A 1OMOA 4P7JA 1QWOA 3N0WA 2Z2XA 1TIKA 2Z95A 4ZOAA 1KKMA 2CLFB 2FMIA 1VSQA 2I7CA 1M1NA 3OIYA 2FY8A 3G0DA 4LECA 4IO1A 3AR7A 3U4GA 4QUKA 1PO7A 1R0WA 4FX5A 1W0KD 4V02A 4FM9A 4M9ZA 1F8FA 2JS7A 5BMOA 3GJ5A 3TG2A 4Z99A 1JQEA 1HDOA 3MN1A 4TV9A 4UVDA 1N5KA 3GC6A 3JD2A 3VKVA 4F5YA 3DO6A 3F3MA 3MG9A 5E6UB 4FYXA 2ZKIA 4MWEA 4XWAA 2CKDA 4E0BA 3LGXA 1O95D 1P1IA 4XWOA 5A62A 3H4TA 3WNCA 2ZT7A 1PWZA 3F3YA 4AG5A 3DB1A 2GZMA 3IAEA 1LXCA 5AK0A 1ZRSA 1N4DA 3TNFA 1QZTA 1MZPA 3OU2A 3R3UA 5KSPA 4RDHA 3QA3E 4ZN6A 1P2VA 5DX8A 3VUFA 5AKEA 1VJTA 3GBVA 1QLHA 4EZEA 5BXYA 2V45A 5DTRA 2IVZA 4ZQHA 3B38A 2IBMA 3QF7A 4HZUB 1NVDA 2P75A 5CBPA 5D3KA 4EYGA 2F9MA 4JDUA 1HLDA 2ET6A 2WZQA 3IPXA 4DW8A 2EAUA 2I87A 3HJAA 2XGGA 3AR5A 2QUJA 3QE9Y 3OH8A 2FWBA 1V47A 2X8BA 1GLNA 1ZM2A 1D03A 3EZ2A 1SC1A 3GCDA 4MVCA 3BFKA 4BL5A 5ECWA 4HUTA 3H1TA 1KKUA 4MVJA 1JZQA 3GCZA 5TT1A 2ASEA 1QU3A 1QZZA 4MVJM 3RK4A 1VLJA 1RACA 3EGDA 3ACCA 3ZR4B 4K8OA 4C0BA 3QGMA 5CCDA 4ND8A 4YFVA 3O21A 4UEOA 4S05A 5FO0A 1JSXA 4WFQA 4ZEMA 1JKFA 2C9ZA 2G9QA 4X66B 3EW7A 1IK4A 5G40A 4B3SB 3UWDA 3ZTWA 4BLOA 2C58A 4LOAA 3NIGB 3ZE2B 4KL8S 2O1XA 2NO1A 1UK8A 4DAEA 3E7DA 3L7IA 2QUBA 2W2MA 2GBLA 3H2GA 1A69A 1B7GO 1EK6A 1W5BA 3GPCA 1RYEA 1B6SA 2AL7A 3G2HA 3WOHA 1ICIA 2OXRA 2VJBA 3DCYA 5CJ2A 2R11A 3OOHA 1WETA 1FBNA 2J7PD 4X6XA 1JDBB 4KWIA 5BNWA 5DNDA 2IYFA 4MR8A 3I6BA 1YHZA 3X2SA 7MDHA 4LI0A 4UTXA 4RPJA 1JYFA 3TW4A