3RJZA

X-ray crystal structure of the putative n-type atp pyrophosphatase from pyrococcus furiosus, the northeast structural genomics target pfr23
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
229
structure length
210
Chain Sequence
GLADVAVLYSGGKDSNYALYWAIKNRFSVKFLVTMVSETINANLTDLQARALGIPLVKGFTEVEDLKRVLSGLKIQGIVAGSKYQRKRIEKVAKELGLEVYTPAWGRDAKEYMRELLNLGFKIMVVGVSAYGLDESWLGRILDESALEELITLNEKYKVHVAGEGGEFETFVLDMPLFKYKIVVDKAKKVPCTSSGKLIIEEAHLESKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords N-type ATP pyrophosphatase superfamily
publication title A large conformational change in the putative ATP pyrophosphatase PF0828 induced by ATP binding.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 54
structure length 210
sequence length 229
ec nomenclature
pdb deposition date 2011-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01902 Diphthami_syn_2 Diphthamide synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3rjzA01
3.90.1490.10 Alpha Beta Alpha-Beta Complex putative n-type atp pyrophosphatase, domain 2 putative n-type atp pyrophosphatase, domain 2 3rjzA02
2CFOA 3G6KA 1LW7A 1NURA 3X1JA 1TYBE 4GU5A 2O5RA 3IVGA 4DDHA 3ZXSA 4MUHA 1KP2A 1I6MA 4ZCQA 1LI7A 3MUEA 2JA2A 4EGAA 3MXTA 1IQUA 3DLAA 3RK0A 1JGTA 1LI5A 1PFUA 1TEZA 4DDKA 4ZT4A 4QREA 3VGJA 3K32A 3NBKA 1MBZA 1ZJWA 2X1LA 2PIDA 4EG7A 5HUJA 5AHWA 1N1DA 1TYCA 2DUMA 4G6ZA 4UZEA 3CVYA 1NI5A 1IHOA 3H9CA 1S4MA 2CV1A 4YBRA 4RPIA 2ZUEA 4G5YA 1PG0A 4UZFA 2A86A 3I05A 2A7XA 4JYZA 4ZCRA 1JZSA 2RD2A 3KFLA 2PFSA 2A1TS 4MVXA 2Z08A 2CYAA 4MULA 2JAXA 4K0RA 3ZGZA 4KKVA 1G8GA 4ZT2A 1O97C 3H9BA 3D6UA 4GRIA 4CT0A 4MUEA 4H3SA 4OUDB 1COZA 5FO0A 1NUTA 3NV7A 1JEDA 1KP3A 1M1ZA 2YXNA 3E27A 1PFYA 3FWKA 3ISJA 3M5WA 1F9AA 1WZ2A 3QTTA 1CT9A 1NUPA 2DLCX 1JMVA 5H16A 2QJFA 2R5WA 4DDMA 3SEZA 3CLSD 1Y42X 2QTMA 1N3LA 5FNZA 1DNPA 4DLPA 2DPLA 3ZJVA 1VBNA 1J1ZA 3H99A 3ND7A 2J08A 1RQGA 4MW0A 1H1TA 5J59A 4ZT6A 3FOCA 1U7XA 1OWNA 3IVXA 3UOWA 4TS1A 4MUKA 1QRTA 4MW5A 3UC5A 2E18A 3L93A 2QJTA 3LOQA 1O96B 1XJQA 3KT0A 2CYCA 1EXDA 3AG6A 1WOYA 2V0GA 1P7PA 4NZPA 4NDAA 3PNBA 1O6BA 5K0SA 3CVWA 1VLHA 2HGZA 3ZJTA 5DK4A 3CLRC 1M83A 1VBMA 4MUGA 1M8PA 3ZUGA 3DPIA 3F3MA 4E1AA 4R2MA 4CDMA 1GLNA 1K4MA 1I6LA 2DERA 1MC1A 1ULHA 3NBAA 1G59A 2WB2A 2DEUA 1YULA 4CDNA 1ILEA 1KAQA 1U3DA 3IUBA 4OUDA 3A04A 5DASA 1GAXA 4MUNA 1VL2A 3PNYA 3RHSA 1NP7A 1JILA 2A1UB 5F23A 1M8JA 2CV0A 2HZ7A 1JEEA 1QRSA 1IRXA 5KHAA 2I1LA 1KQOA 4MVCA 1X8XA 3RK1A 2J4DA 1ZH6A 1IQ0A 4NATA 4NAHA 1OWMA 1WQ3A 1J70A 3IMGA 4JXZA 1EUYA 1EE1A 2X0KA 1YUMA 4MWDA 4MW2A 1N2GA 3N2YA 3RFFA 3P0IA 4YP7A 4AS1A 3PNVA 1O96A 2EJCA 1KH3A 5K0TA 4P2BA 1QJCA 1PG2A 3Q12A 4DJAA 5DEOA 1N2EA 5LLTA 3TQIA 4EF6A 1O95C 1I2DA 1Q19A 1UFVA 3SYTA 2CSXA 1N2BA 1OBCA 2X3FA 4L2IB 4MWBA 5IJXA 4JFAA 1KQPA 2O8VA 1O94D 5HG0A 4KR7A 2XRYA 4PBRA 3ND5A 2DR2A 3N8HA 5TEWA 2V0CA 4ZCPA 2GM3A 3IH5A 5TS2A 3SDBA 2VTBB 3CLUD 1M8FA 2ZUFA 4HJXA 3TS1A 1O5TA 1R6TA 1JHDA 3FG9A 4JZYA 2X1MA 3ND6A 3CLSC 1KAMA 3FI0A 3IODA 3JXEA 3SEQA 1ZUNA 3ZJUA 4MW9A 4S1OA 1NUQA 4YP5A 3FNRA 1MAWA 1WXGA 1ZH0A 3GLVA 1T6XA 1JIKA 2J5BA 5EKDA 2ZP1A 4RUKA 4NX2A 2A1TR 3LE8A 1JECA 2D54A 4J75A 5KCMA 5J5AA 4ZCTA 4R2LA 3ILVA 1H3FA 4R0NA 1IFXA 3CVXA 4KR6A 3FHJA 1H3EA 1EFVB 1U0BB 1EFPB 4U8HA 4MW6A 2BTEA 1N78A 4ZT3A 1GZUA 4ARCA 3TQOA 4KPUB 4Q93A 4MW1A 3FETA 4ZT7A 1T9GS 1NZJA 1WXIA 4MAFA 4DNXA 3IVCA 4I6GA 4L2IA 2RE8A 1YI8A 5KWVA 2CV2A 3VU8A 5JBNA 1IH8A 1HYBA 4MVWA 3CLTC 3AG5A 3SP1A 1WKBA 3ZIUA 2XRZA 2VTBA 3Q4GA 3P0HA 1KQNA 1K4KA 3H05A 3H97A 4ARIA 1K97A 4F3RA 1KH2A 1U7DA 1YIAA 3A2KA 1WJGA 3FH0A 1MB2A 3IUEA 3CVVA 1U3CA 1GTRA 2YWCA 1QRUA 3FDXA 4EFKA 3COWA 3UK2A 1NYLA 1WXEA 4XFDA 3IMEA 2WSIA 2PZBA 1OWOA 3IMCA 1OBHA 1WXFA 4EG1A 3AKZA 2E89A 1O97D 4I6EA 4PY2A 3COZA 3COVA 1PFWA 3IOEA 3SZGA 4MQ6A 1EFVA 1EFPA 5DB4A 1OWLA 2BYTA 2EL7A 3HGMA 3GUZA 1KR2A 3OTWA 1XNGA 3U1VA 4KPUA 1R6UA 4EG5A 5LFAA 1WY5A 1J09A 1JZQA 4CQNA 1Q77A 2D13A 4EG4A 4JXXA 2VXOA 3TNJA 3IDFA 1N75A 4K03A 3HZRA 2CT8A 4WSOA 2QUJA 4HK4A 3S3TA 3HFJA 3A4IA 1TYAE 1N2JA 3BL5A 3FY4A 1O0CA 2Z3VA 4PBTA 3UY4A 1QNFA 1MAUA 4MWCA 4EG8A 1M8KA 2H29A 4OJMX 1VBKA 1QQTA 3OP1A 2AKEA 1F4LA 2DETA 2GKSA 3CLRD 2PZAA 1Q15A 2NSYA 4HJRA 1GN8A 4NAUA 3HMQA 2HMAA 2YY5A 4MUJA 2E0IA 3PXUA 2WQ6A 3TZLA 3RBAA 1EUQA 4FZJA 1NUSA 3KT3A 3K9WA 1NSYA 1FFYA 1BS2A 4J76A 4DE5A 1G8HA 2A84A 3X1KA 2AZXA 1KKUA 2A1UA 1T6YA 1NUUA 1MB9A 3KT8A 4U63A 4ZT5A 2A4MA 4HPWA 3C8ZA 4KR9A 1TFUA 2IP1A 2B7LA 1WQ4A 1TQ8A 4MUIA 1IVSA 2J09A 2A88A 3HL4A 3KT6A 4I6JA 4ZCSA 3P0JA 4AQ7A 3L92A 4PBSA 1GPMA 1O0BA 2E21A 5TEVA 2CUZA 3N9IA 4Q16A 1N2OA 3SZ3A 2OV4A 3A05A 1EJ2A 3MLBA 2WQ7A 1X6VA 1I6KA 1F7VA 1IQRA 1MRZA 1O95D 1OWPA 1WXHA 2PG3A 4QRDA 4MLPA 4ND7A 2QTNA 1KH1A 1N2HA 4EG3A 1T9GR 2NZ2A 1T6ZA 3CR8A 1YUNA 4MWEA 4YMIA 4XSVA 1J1UA 3N05A 3AFHA 1V8FA 1Q11A 1SURA 2OQ2A 1JIJA 1F7UA 2IJGX 4G5FA 4A91A 2D5BA 3FIUA 1A8HA 3IOCA 2QUKA 2CYBA 1J20A 2DXIA 4F4HA 4MW4A 5BNZA 5J58A 2JANA 1MJHA 5IHXA 1MOPA 5H7XA 1D2RA 3D6VA 3X1MA 3IOBA 1J21A 2AG6A 4X0EA 2Z09A 2QTRA 3QE4A 3MLAA 4ND6A 3LCJA 1QTQA 1JIIA 4YP6A 4EG6A 1FYDA 1N77A 2IELA 4MUFA 3UMVA 1TYDE 4XFJA 4QBTA 2H2AA 3DV2A 3VRHA 3G59A 5TGTA 3AIIA 1O94C 3HV0A 3CVUA 2QJOA 2YWBA 2TS1A 4MW7A 1OD6A 3G5AA 3GMIA 3CLUC 3TZEA 2GOYA 5LM3A 3ELBA 1YIDA 4U7JA 3CLTD 3DO8A 3AL0C 2J07A 1M8GA 1H3NA 2QUHA 3INNA 2QUIA 1XNJA 1G8FA 1B6TA 1N2IA 3QTBA 1K92A 5HUHA 3RJZA 1V47A 3Q10A 1XNHA 4BWVA 3COYA 1QU2A 3ZXIA 5FO1A 3MMXA 4WNYA 2C5SA 1QU3A 1PFVA 1KORA 1GTSA 3PRHA 1R6XA 3CA8A 4MVYA 2G36A 2PXHA 3P52A 2PZ8A
chains in the Genus database with same CATH superfamily
1JYEA 3S2FA 1ZGZA 2G88A 1A71A 1YB6A 2GFQA 3T3OA 3WYCA 3DFIA 4FEEA 3VDXA 2JFPA 5EYPB 1WD7A 4WLFA 3BL6A 4H77A 4OG2A 4UCQA 4AM8A 2Z9BA 1F8UA 1DQPA 3FGPA 3HU5A 1CF9A 3O4RA 1SQ0A 1KDYA 3VO9A 3AERA 4RTPA 4RFSA 3CWCA 1M54A 2XEDA 4FLFA 4GPZA 1UQTA 3ANLA 3DE7X 3FUWA 3TQRA 4EI7A 1ATZA 5KYTA 5LP6F 4AKGA 2J3KA 3PDIA 4TS9A 4B74A 3VKGA 1J2EA 2WAYA 4CKEB 3G82C 3N59A 2OAQ1 1GG9A 4RACA 4BVAA 4Y0NA 2C7VA 1CRLA 3RVNA 3ROZA 3H5AA 4CMHA 4BO0A 4N4AA 3KJNA 4AQDA 2Q3LA 2SBTA 1UAYA 2VXBA 4FYHA 1VSTA 1S2DA 3H5NA 4PPNA 5COBA 4D9CA 4ZWNA 1NXQA 4LGCA 5CFMA 2IBTA 1QHHA 2FUEA 2VDPB 3U7JA 3PPIA 4BBJA 4CR7A 1HNZB 1ESDA 3K2QA 5IABA 2C8VA 1CVRA 4R4JA 4CE6A 1M33A 2BFDA 1EK5A 2AFRA 2PS1A 3K92A 1YNSA 1ZGGA 4OD0A 1G98A 5HEKA 3W77A 1GU7A 4FR0A 4RA9B 1NRJB 5T4HA 3JALB 1CZOA 3T41A 4FFOA 3ZDXB 2Z08A 3MTAA 3L1VA 4FOPA 4XUGB 2XNDA 4TX1A 3HG7A 3UWKA 3BD6A 5TE9A 3TXYA 1Z28A 3A58B 1PQYA 1JWLA 4W63A 4UE2A 4PIVA 5KYKA 4E2ZA 1R5BA 2V54A 3F4LA 4MUEA 3L7OA 2H6EA 1R50A 1QPZA 4KITB 5KX5F 3RS0A 1ZUIA 5HDQA 2O2HA 4I81A 4BX9A 2J32A 1WZ2A 3IE2A 1F9AA 1KMHA 4YQZA 5I3ZA 2WJ6A 4V0SA 1DQYA 5LZ8A 1O6FA 1L4HA 1KR5A 3NT4A 2EFYA 1GGVA 1Y4DE 4QULA 5FNZA 4LGMA 1DNPA 2GR9A 3EARA 3JQRA 3RVLA 3K1AA 3NORA 4CKCB 1C9DB 3QKRA 3RRFA 9GPBA 4D9FA 4NOKA 4P3NA 2J08A 2HPVA 4RESA 4KPFC 1H1TA 2R5FA 4L4RA 1M1XB 1XU9A 1OWNA 2YN0A 3EIHA 5FWDA 3RGGA 1RP7A 2HJWA 2RGXA 3TW8B 1XRPA 3AU9A 3LF1A 5DWVA 3S81A 3IAXA 2PUCA 1ZGJA 5FJIA 4DIMA 2DKFA 3MBOA 5F1OA 2DQYA 2FP3A 2I4IA 1AKYA 3OOEA 4PSKA 1ZRSA 5CT8A 4DT1B 2RGRA 5M2QA 1UXGA 1QNLA 4GR4A 5EWMA 3I3OA 2PGLA 5B6PA 1ORVA 2QT0A 1LBHA 2PBLA 3I9JA 4P4TA 4Q6BA 4HAIA 3F0TA 3OETA 4GX5A 1M6EX 4JVSB 4MKZA 1HG0A 4NICA 3EHDA 3DMHA 1YQGA 2NOAA 4G0UA 3OF2A 1VRVA 1EBUA 4FKZA 2E4VA 1A1SA 3NKLA 4GMKA 4XSGA 1E9BA 2ANBA 3ESCA 4M8IA 1HSZA 1O58A 1R74A 5GIPE 3HLYA 3UJ6A 1JFRA 1ZEMA 4HEHA 4EX6A 1EEXB 1L4NA 3VMMA 3BS4A 1VFPA 2HPHA 4JLVA 4EPRA 2G25A 4BX2A 3H18A 3NETA 5K09A 1L8QA 2O19A 4QUBA 3WSWA 4F11A 3WBFA 1K8YB 2QTTA 1CF4A 4ZK2A 4BGVA 2R3SA 3F46A 2EYUA 4DIFA 4J0EA 3WJ7A 4J3NA 2JKVA 1MJFA 4IGEA 4NS4A 5T8KC 1BE0A 2P6PA 2XBUA 1UJBA 2GD1O 1L5GB 3NHAA 1UMCB 4JXJA 1NSTA 1IQ0A 1HM5A 3MD0A 3O75A 1Y80A 4FDTA 3UXYA 4LJ6A 1DVRA 4HAWA 4IMPA 1T43A 1KKLA 1M1UA 5C46F 3C3KA 1C4XA 5JAQA 2J48A 2BH2A 2CC2A 2XNHA 3L43A 4WJLA 5I7SA 2I91A 5IKPA 2WA1A 4UU7A 4NNOA 3EGXB 3P94A 1GUDA 1VL5A 4NMHA 4RABA 3N7TA 3V7YA 4B73A 1Z36A 2FRVA 3VOSA 3ZI4A 3QLJA 1UBOS 5A4DA 2EDAA 3IT3A 2I4OA 2XB9A 4X90A 5HBRA 3HB7A 3ZHRA 1N2EA 2X2FA 5ALDA 3CUTA 4YALA 1NJ1A 3T3MB 4KODA 4CF4A 3FCUB 2DFNA 4LYFA 2PSEA 3NTLA 1RTTA 1U28A 1W581 3IEXA 4IXMA 4MWTA 3UOGA 4C0JA 1KOGA 2MWMA 1R37A 1Y8QB 2K2QB 1Z15A 4OO3A 2CL7X 1AVTA 2I1VB 4U00A 3SSMA 1XRRA 4F92B 1JLLA 4XLLA 4BP8A 1GPKA 4Y1RA 4ZCPA 3G1UA 1EU1A 2G3YA 3QF4A 4KE6A 1EUCB 3F3YA 4P58A 3DOCA 4QPCA 3TNDA 5CDFA 1JEYB 3H5OA 2JAQA 1YGPA 2HW8A 3QPCA 1JHDA 3ROTA 2KLBA 1NUHA 4XOUA 2AB0A 3GCDA 3R6TA 4KGZA 2PE5A 3G2KA 3SHWA 2DC1A 2DPGA 1XRNA 1ZUNA 2VNHA 3OX2A 4KL8S 3O7WA 3C7DB 3O4FA 2FK7A 2YJ3A 3O3CA 5FF9A 4DS3A 1HPLA 2I4TA 4ENTA 2ZJ5A 1WCV1 4PZLA 1QM5A 5HK8A 5CGZA 1GO2A 2FPPA 2X0EA 4HAOA 4CODB 3FE2A 4OB8A 1E6KA 2GYYA 1Y89A 1E2IA 3FOBA 3SHQA 5KCMA 3WNQA 2YYAA 3KQMA 3T38A 4HXFB 5D85A 5D3MA 3WGNA 4XUCA 4EEXA 1WSAA 5CB6A 1LDGA 1PYGA 1MW8X 1Y1LA 1H3EA 3EEQA 1Y3FE 3K9QO 2Y1KA 4U7DA 5DW0A 2ZIXA 3K5PA 3R77A 4HH4A 3W8EA 5JOQA 4RTMA 5EMLA 2EWMA 1XCOA 4KNWA 4ZFNA 1PS8A 1FVXA 3VH4A 2IYVA 4CIDA 2DX7A 4KGXA 4XX1A 2J7PA 1DKPA 1T9GS 2PKQO 1SHTX 4GOOD 1KZYC 2C8KA 4RLFA 4Y18A 4YMWA 2QX7A 3RM3A 4N1AA 3ZX5A 2CZQA 3SHTA 5LOVB 3N8DA 4UVDA 2R1TA 5KNCD 4MRMB 3VU9B 1AUXA 2FN4A 4U0KA 4JT9A 3JY6A 1KPHA 1JDUA 3VNQA 4A2QA 4C0AC 4M6WA 4OVKA 3D6MA 2NT4A 2CJPA 1GIAA 1WKBA 2VF2A 3ODGA 3R7SA 2P2ZA 2R7AA 5BV8A 5JZMA 2YZ7A 2O8CB 3OMLA 1OW3B 3W1WA 2VYFA 4NMXB 4GO1A 1HZZA 3K5IA 4MR7A 4MYSA 2XHZA 1E9SA 5DM0A 1WPQA 1EG7A 3MHTA 3TSWA 4JYPA 2FPIA 4DPLA 3CSDA 1DKRA 3DTVA 5TGDA 4F9TA 4HEA1 3VZPA 1GKYA 2XWPA 3GGGA 1BDIA 1MHPA 2CMKA 3IUEA 1BE1A 1K5HA 3ZK9A 4RDXA 4LZPA 4OI0A 4M37A 4ZYTA 1ZCZA 3SVZA 1V16A 1CULC 2CLCX 4H17A 2Z6VA 1M6HA 3W5CA 2H17A 2NACA 4Q1VA 3JQQA 4XVRA 4BJ6A 2HR1A 3EXG1 2EWWA 1ZH4A 3JQ6A 4XE5A 1GPNA 1XT6A 2IXGA 3B13B 1K7CA 2J0UA 3IUPA 2AN1A 1PQUA 2HK6A 3DLCA 3PX2A 4H0CA 3RCBA 5E0OA 3OP4A 5TXGA 3D0OA 1NDHA 2AA3A 2P3QA 1JJFA 1QQAA 4GPBA 3T3IA 3HVUA 2ZSFA 5I8PA 1UZLA 2Q3EA 1GZ6A 4RFSB 3U3OA 5A9SA 1PQWA 5ERXA 1E4YA 2I62A 4C0QC 5TS3A 4JEMA 4B75A 3E7XA 4GLFA 4DUYB 2XWQA 4QAJA 4QPZA 2WJYA 2Y1OA 1IAQA 5DHAA 1UWVA 1RMTA 3RYCA 2OO7A 2W4MA 4N0DA 4B40A 2PX5A 4TYNA 1E3EA 5LUBA 1NWHA 2C57A 1R0WA 3VAYA 3OLCX 8ADHA 4GZ5A 2ATEA 3ZCUA 1FW8A 2G71A 1X1AA 5LL6P 2DPHA 2FETA 4QOFA 3UB4A 4N8DA 1OAKA 3SF0A 3GZJA 1E1CB 3MT8A 4KZPA 4DZTA 3LUHA 4WSOA 2VP6A 3CIOA 3MOIA 4HK4A 1RWBA 2YW2A 4Z8XA 4AMYA 4DDVA 2BFDB 3ACCA 3MILA 4K6GA 2RGUA 5KAPA 2DHDA 2HLPA 5AJYA 3X1ZA 2R9VA 2IOQA 1AO0A 1YZFA 2QENA 4K2HA 3SXUB 4DADA 4YGXB 1RC8A 2VL7A 3GRZA 4LQCA 3DB1A 4JP5A 4JI7B 3MLEA 3E3AA 1LLFA 2OCXA 3N2LA 2GWRA 2XCLA 4HADA 2PMFA 1ZM4A 1UBRS 4A2CA 4HQRA 4BQQA 2PJUA 2GCOA 3SJAA 3VYUB 2EW1A 2OO3A 3A70A 3ZTYA 2YY5A 5HZKA 3PXUA 2JLAA 4J0GA 2C04A 2PQ0A 3WADA 3ZBQA 2OZVA 4JR0A 1CNEA 4R7GA 3V33A 5KWSA 1UH5A 5A7HA 4QXOA 2H4WA 1GDTA 3DLTA 3RANA 4WA7A 2GUGA 4CM4B 1DKOA 1DTSA 3KOXA 3SX2A 3LKZA 4J0DA 5JCJD 3HU3A 3LFUA 3VSBA 1SC4A 1CUHA 3HY3A 3RVJA 3U7IA 1N36B 4EKEA 5A4KA 2NSJA 3CWZA 1SUIA 2DWCA 1WCXA 3SJ7A 4Y2GA 1J39A 1PL6A 2ASVA 1QCDA 1DCMA 3UMBA 4IV0A 3AF2A 2O7SA 2RHOA 5FV7A 3L49A 4NV1A 4IZOA 2P5TB 4BPRA 1Z0IA 3VU3A 2EBFX 3HJAA 2R1VB 3MQFA 1P0IA 3VZRA 2IP1A 2ID4A 1THZA 2AFVA 2OVFA 4LTMA 4AYWA 4K9NA 2EERA 4HVCA 3P0JA 1R27A 1CFZA 2RKWA 3OG9A 4S0XA 5CVUA 5FB3A 1GPJA 5TMEA 1GPMA 3ZD8A 3E03A 4PRZA 4QPPA 4P2GA 4Q16A 1KSHA 1BIFA 5M3BA 3PXBA 1KP9A 3SF8A 3W5VA 4AY3A 4OHBA 1M2JA 4R9UC 3GLSA 3RADC 3EF3A 4YVFA 2PZEA 4KH1A 3S68A 3L4EA 3TDKA 3BTOA 4OHRA 4TV8F 5GQSA 3W2FA 3DOHA 4BCDA 1O95D 4MLPA 1FMJA 3G0DA 1C0EA 1JG4A 1Q7EA 3IKLA 5AVUA 3WK8A 1KIMA 2ZTVA 2HUNA 2ZTUA 3EQ9A 4IZHA 1LTKA 2WQZA 4P5PA 4B3TB 1LJUA 4BPBA 1U28C 4AT1A 3NDBB 1E3LA 1KMCA 1C5KA 1OX6A 1Q0QA 1GPWB 1YL7A 4XGNA 4Z54A 4F5EA 4IWYA 2PL5A 4I9GA 5DLDA 1L9XA 1DKNA 5TPWB 2JDIA 1WM1A 1R4ZA 3CM0A 1SQFA 4CMBA 4DA8A 2OESA 4CHTA 5BMVF 4FS3A 4KCGA 3LX4A 6ABPA 3NQ41 3RV3A 1F20A 2XBMA 3UAGA 1HF3A 4N18A 4WESB 1RADA 1P4HA 1Z38A 4IV8A 3EPHA 4RNDB 3JTEA 2GXSA 2ZREA 4TV9B 2DHRA 2IHZA 3QBDA 1V2GA 2C0QA 3A6ZA 3KQKA 1FUKA 2RAUA 3EBOA 1RLJA 3LPDA 1YQWA 4I5DA 4WY2A 4ZAZA 3JSXA 1V11A 2VP0A 3QE3A 4M7RA 4RGVA 4WBNA 4DCCA 3WS7A 4DSUA 1AGYA 1NXOA 1N1GA 1T8YA 2YL2A 3HV2A 4BKOA 5CDTA 1T4BA 4F2GA 3RAGA 4AMUA 2WM3A 2QT9A 3A4YA 1BX0A 3ZE1B 4KMOA 1C0KA 4OHCA 3QRWA 2V3WA 1CETA 1P4RA 4FCTA 1NONA 2YYYA 4PYKA 5F1PA 5IC4A 5FI5A 4LJ5A 3TNFA 3SYKA 1AUOA 3HNOA 3O03A 4M36A 4NE7A 4Q7MB 1N32B 3L7NA 1PW7A 3F9CA 2QGNA 4G5XA 1M34A 4MKXA 3KK0A 3RLIA 1TA9A 5CA0F 5AVYA 4X62B 4ZU3A 1SVMA 3LBHA 4H7PA 2P4HX 3AETA 2QV0A 1MJGM 2OFPA 1A88A 3FWHA 2P3SA 3GHHA 3OCJA 5CTAA 5FTMA 2TS1A 3UUGA 1ZW6A 1QV6A 2OHIA 3G5AA 1VG0B 3HA5A 4LHEA 4YRTA 4EI8A 4L22A 1ZRNA 3NPAA 4WOKA 3KDSE 2FZEA 2ZJ6A 4TKUA 3TD9A 1TUIA 4DMCA 1XPOA 4F6CA 4RWEA 2WE8A 2VG8A 2ZUDA 3DEZA 3G85A 1GA4A 3GT3A 3R5FA 4IZ6A 1E1MA 2LXNA 4N39A 4JFRA 4X44A 5TQVA 5JWHA 3K70D 5JS7A 1L7XA 2QUHA 4PGFA 1I1OA 4WZZA 1KVRA 1FDSA 5HUHA 3EG9A 3F90A 1HZZC 3OCYA 5P21A 1SR8A 4B79A 2XD9A 3JPWA 1A9RA 2FPPB 1YTUA 1GY8A 1UM9A 4JIMA 1JE0A 1Y1TA 2I3ZA 2NG1A 3ML1A 4YJ3A 2JH3A 2AEEA 3M34A 1PFVA 1GTSA 5D3MB 1YAHA 5F77A 2KE5A 1ZUWA 1IUOA 1PI3A 3CBGA 1QRAA 3VOTA 2GYUA 5LYJB 1LW7A 3AHIA 3EA0A 4GU5A 3DXXA 4G8CA 3GLGE 3PHBE 3E23A 2EKLA 4IJQA 2JD0A 6CHYA 5F2NA 2H2WA 4FJ1A 1GNRA 3L8EA 2F17A 2ZS9A 2VAVA 1NW6A 4FUQA 4NZYA 1P7ZA 1G21B 1UJCA 2I33A 3HB1A 1SN7A 3NJ4A 5AK3A 2Z2KA 2ZXEA 3P2JA 4L0DA 1QV9A 2PWAA 4Q66C 4UMVA 4O4JB 2TMGA 3SLGA 1PFUA 2IH2A 4C6RA 4ZI7A 2R1TB 4Q4AB 1DC3A 1C4WA 4HD8A 4NFLA 3V8VA 2AE2A 2PIDA 1WW8A 3OICA 5AW6A 1ZVJA 4EO7A 5TX7A 2C98A 3D8RA 4RH3A 1YF3A 2JHFA 4Q4JA 3N0XA 4OQEA 5F5XA 4F38A 1DO0A 2R7LA 1F2TB 2QNBA 5CIWA 2D1SA 4XDGA 4EHLA 2Z1NA 3LQKA 3AVTA 2FLVA 3DVLA 4MCJA 2VA9A 1S9DA 2PGJA 4R69A 5EPUA 1P5HA 4ZVNA 4DHWA 3CH7A 4MVJD 2R7MA 3UYKA 4JB8A 4Y6QA 2A9OA 1XVAA 1R15A 4OYRA 2YRFA 2NADA 2X9NA 3TD6A 3H1EA 3KE9A 2JAWA 3FYSA 3IDAA 3TDMA 2CNWA 3I04A 3IA2A 3ZIAA 3AKYA 3RG2A 1BXGA 4JJGA 3QMPA 4BBAA 3JARA 1QIHA 2FYTA 3KXKA 4X20A 2CNDA 5KU1A 4PEVA 3AUAA 3DM5A 4IIXA 4KV9A 3EXEA 3L6RA 4BTEA 2CLKB 3G7UA 4G5OA 4KFTA 3K4PA 5C53B 1XCBA 4AI6A 3NTXA 2XUQA 3MT0A 2X4DA 3WKCA 1LJLA 1S2OA 2WJ4A 3AIKA 3EA4A 4IEIA 1T6BY 1ULUA 5AIBA 3G0GA 4G86A 2YXNA 3JQPA 2NU6A 3H2YA 4LDQA 4CCYA 3HFGA 2WMNB 1YJAA 1JMVA 2B1JA 2AJBA 2B0JA 3BEOA 4OEHA 9MHTA 1GXSB 4WHMA 1H2ZA 1BS1A 1KK3A 1D9XA 2EZUA 2R00C 3RF7A 3ZV3A 1ZNWA 1J1ZA 2HQRA 2WZCA 4FKBA 4MHTA 1QBKC 1XVTA 3PCTA 2WWGA 4YCJA 4L78A 5ALQA 5ECYA 5KTYA 3DQZA 3JZFA 2OFXA 1U7XA 2B3TA 2Q1WA 2VK4A 4N01A 3PJGA 4BY9E 4U2GA 3MSCA 3G8AA 2X2PA 1LWNA 3O6VA 1J7KA 4I99A 4RJKA 2I4MA 2F90A 2XUHA 3IX7A 1F51E 3G0BA 4E5YA 3GBPA 4JZKA 1EUDA 2J31A 3C16C 2YFHA 5AI5A 1AGPA 821PA 3B2QA 2GZDA 1IMOA 5HK9A 2AXQA 5IDWA 3EBLA 1QHIA 1KEUA 1P7PA 2VDNB 2M1XA 4MYCA 5SYMA 2V0GA 5KINB 4RZIA 1WUIS 3DMPA 2IPNA 1PR9A 4N41A 4QU0A 4UHCA 3ZHOA 2I7DA 3WP0A 3GFOA 2GCOB 4F1WA 3NBXX 4F97A 2EKQA 1PV1A 5D6NA 5G3YA 3R5KA 3G2JA 4LE2A 4O2BA 4HV4A 1QKJA 5FA5A 3VH3A 1R0LA 3UB3A 3K96A 1SKUA 4LDNA 5ITWA 2UUAB 4U8GA 3NW9A 3KBBA 4EPWA 1U3DA 3AR2A 3DEHA 3KLBA 4MUNA 1PG5A 3N76A 3N6VA 3GLUA 3GX1A 1INLA 2PS9A 4K7JA 2H5IA 3PQ2A 4R0VA 4WFIA 3UPTA 4GEGA 1XTJA 4JX8A 3ETDA 4EKGA 4DL9A 2BFNA 1P1IA 1G8SA 1UMDB 3TPFA 4D4HA 2VT6A 1EA5A 4NATA 3LQ4A 3RVMA 3HN7A 1K7SN 1Z7BA 1XZLA 4RY8A 1CS0A 1OTYA 1YUMA 1QH0A 3E4DA 4CKBA 5AM3A 4LWQA 1GSHA 1DRWA 5I4IA 1ODKA 1K8RA 3JAMA 1RR6A 2UZ3A 3WHPA 5H3LA 4MDEA 2HWXA 4DRYA 5KBYA 1TNDA 1XLTA 2DY1A 2D8AA 3GOHA 3PPVA 1TM4E 5IAJA 1K5PA 5JE8A 2EJCA 4JWKA 4X54A 2Q5HA 5KKCA 5K0TA 3ZGXA 1QJCA 2D2VA 4DJAA 3FRJA 3EA5A 8ABPA 3K71B 1PFQA 3KALA 2PX6A 2H4ZA 2ZE8A 3AJDA 4X1OA 5C32A 1EP1B 3L8GA 1H1DA 2FSHA 1V1RA 1Y98A 5C3UA 3RTBA 3RVKA 2CZCA 2V98A 2Q49A 5H82A 1SKYB 4TLEA 4MWBA 4WBSA 1HEUA 1KGSA 3WI7A 1IVNA 2O8VA 5L3ZA 1O94D 4TN1A 2I6QA 3I2KA 4UFPA 4YHHB 5LB4A 2VBFA 1RCUA 1V8ZA 2JZOA 3PQCA 2CMGA 4ROSA 3QMVA 2FU5C 2ZRIA 5ETJA 4RF3A 2QVYX 4JJIA 1P1RA 6LDHA 2WKRA 4JCCA 4I3GA 4C6HA 1UMBA 3ZZUA 4I8XA 4OMDA 4UBNA 4GW3A 1E2HA 4PPGA 1G17A 1XCLA 1R6TA 2BI8A 1KRHA 2D4HA 2K6GA 4QQRA 4UTOA 3KOYA 3OLXA 4FGUA 3H1GA 3KWFA 3H04A 4L6CA 4B2LA 4CV1A 2QM3A 1KAMA 3KZ1E 5L7TA 5JEEA 4DRZA 2PKQP 5AVQA 3H1TA 1X13A 4PVCA 4CEHB 1MVOA 1Q1AA 2HZBA 2GEVA 4XEHA 3IPYA 4CTJA 3K6JA 4A27A 1AKEA 2I54A 1WXGA 1ZH0A 2F3TA 2O3UA 3AR7A 2L18A 4XQ0A 3EVEA 3DR5A 4GI2A 3EVCA 1OX5A 1GUYA 2W48A 2ZIAA 3FUVA 3PCRB 3U4AA 3F8TA 3NRCA 5KDDA 1VRWA 2D54A 1D0SA 3BBPA 5AW8A 3HL0A 3TZQA 3TSOA 2G6BA 5C37A 1DZIA 5E9QA 3EDQA 3FYUA 3NBUA 2TRSB 1DWQA 1W29A 1W75A 2BEVB 4HGPA 3KQWA 3LHIA 1LH0A 4DLUA 5DE3A 1BO6A 3QFFA 4NOMA 2I8CA 5K4AA 5G0TA 1U0BB 1XFDA 2GX6A 3WNCA 1R88A 2CHEA 2YV2A 2GHTA 4NBKA 4NK5A 1AGXA 2I0FA 4L5IA 5BT9A 3ZD6A 4KPUB 3TUZC 1BGWA 2CXOA 2ERXA 3FROA 3GVCA 3Q40A 2V7PA 3MCUA 2A9QA 4H0FA 4PZUA 5CLQA 4MAFA 3QEOA 1LPBB 4PLFA 1DCTA 4C21A 4CL0A 1SBHA 5B3KA 5CLJA 1BXKA 4BE7B 3MF4A 3C2QA 3GU3A 3E05A 4FMDB 4HEJA 4X1IA 5TJHA 4D9EA 5EWLA 1G6HA 3FB1A 2H48A 4YUVA 1QGOA 3EZ2A 4FJ2A 1FDRA 1TCAA 2BM1A 4OIMA 3K9GA 1PDOA 4X71A 1GN9A 3LWDA 4UNSA 3DBLA 5KEIA 2VTBA 3BJIC 5B4VA 4WTOA 4S24A 3NWOA 1T9HA 2ZKIA 1M0SA 2FZVA 1VPTA 1K97A 2Z95A 3JW8A 3OOYA 4NULA 3EG9B 1YJBA 5CRIA 1YI0A 4G1FA 3HCBA 1RHKA 1VSBA 2X8LA 2XEXA 5HOQA 1XXHB 1YDEA 2W58A 4ZOLF 9LDBA 4D25A 2PRZA 3ZH2A 4A10A 2H1HA 4F4FA 4D56A 1AQNA 3KR2A 2X1HA 4MV8A 3T9DA 3TM4A 1W47A 3SIRA 3DA8A 4H3KB 4NNJA 4HB4A 2UYOA 2PTHA 4JUAA 1SEPA 3FNIA 1XTPA 2QD4A 4TS4A 2FN3A 4CQMA 4RW0A 3GLKA 1DP4A 2GZRA 2AQKA 4LJAA 3TTVA 2AEMA 2YXPX 4FEYA 1KDOA 2E89A 4R71A 5CA1B 1DKQA 2GWHA 5BOSA 2CE2X 3DAYA 5K0JA 4NHOA 3HUUA 1AMNA 4QYMA 3BXGA 1L4KA 1Z0DA 1RMQA 3A1SA 3IOEA 4R1PA 3UKDA 4FI3C 3T35A 2GA8A 1MAVA 1ODSA 5U9CA 1JDVA 2CJYA 4Z9XA 1YBFA 4HYQA 3F4BA 3FMIA 4UASA 1D7AA 1RWQA 1XNGA 3BMQB 1JH9A 4B6EA 1W49A 3BQNB 3LH5A 8OHMA 3WOVA 1DTWB 3TQHA 3NWBA 5DGTA 1EEHA 4CCWA 4WXRA 5IJAA 2NZYA 3U44A 4UNQA 3GLIB 4D3YA 2QVLA 5FA6A 5AVSA 521PA 4WH0A 4X7PA 4LXIA 1I30A 1TIBA 2C58A 3MHPA 5F98A 2BGTA 2NZJA 2IGTA 5J5CA 1JDSA 5ITSA 1UBLS 5EZYA 1J2RA 2PX3A 2C83A 2UZAA 2YHAA 4K26A 4OP3A 3TZKA 4DYVA 2ISQA 1L5WA 2EKZA 5HCIA 2XCIA 4TTAA 1YASA 2ZDGA 4FGKA 3S3TA 4BRZA 3R5HA 4DTIA 1RE1A 3JAKA 1N7IA 1QGUB 3FCEA 2AH5A 3EG5A 1ZK3A 2QZPA 3AUXA 3IP7A 2AOUA 5FYDA 4K3VA 1YCFA 4LYHA 3AWIA 5BN5B 3L7DA 3T5TA 3RS2A 1NX9A 4OJQA 5BQFA 3KE8A 4WD3A 2JGMA 2Y27A 1VYVA 3A28A 1C0IA 4RM3A 3RBZA 4IV5A 1T2EA 3AF5A 3QVVA 3AU8A 1V7CA 1Q7RA 4BMXA 1B93A 5K8LA 1ZN2A 3GRYA 2H3EA 4GRAA 4ICIA 5FWXB 2IH4A 3QEMA 4DBLC 4FZ5A 3C6MA 4ESVA 1IEQA 5CFNA 3EOZA 1QG2A 4JL8A 4XWAA 3JWHA 5CVDA 1TCUA 5MDHA 4EPYA 3ONVA 2JLSA 2BKUA 1JR3E 2W00A 5TVKA 3C7KA 3UCFA 2P79A 4HGZA 1TC2A 1ZR2A 1JLKA 4X1YB 4B4WA 1UK7A 4B31A 3BJEA 1G8HA 1M2HA 5BT8A 1IN7A 3MUNA 3HRKA 4M3NA 4D3XA 4JJ6A 4U63A 3HGTA 2JPDA 2Z4RA 4UM9B 1JHQA 4KR0A 2A5GA 3WLTA 2FDRA 1VIMA 1TAUA 3CGGA 5EGNA 1SRRA 1LLUA 2FPOA 3L1KA 4C4SA 3D31A 2VDVE 1VE7A 3DCYA 2HA2A 4YAEA 4I14A 5G53C 2DHQA 3ED1A 1O6GA 3ZBPA 5I7HA 4OYYA 3VR5D 3ZDYB 2NTJA 5JZOA 1ZI6A 1VLJA 2HDOA 2VHUA 3HL4A 2OV8A 4I6JA 1WUTA 3SQNA 4IOLA 2GGSA 2ONKA 3VISA 2C4KA 2BLNA 1H4VB 1HDCA 1PQPA 2E4ZA 1PEKE 2GHRA 2WVJA 5E1BA 1C4OA 4HKTA 4W7HA 5JSZA 5EFOA 4P7GA 1W59A 3L7MA 1PGQA 4HGRA 3JASB 2BGGA 3OA2A 3CUVA 2GZAA 1SZCA 3GUYA 2O0LA 1MPXA 2OGSA 2V8OA 4JODA 3O92A 2FF5A 4EMBA 1IQRA 2B8EA 2OBXA 3L9XA 4MKRA 5JAPA 4XJXA 3VPCA 2AG1A 1LK5A 3HJGA 5I47A 1Z2EA 3TRFA 4F96A 5CJPA 4YMIA 5FWYA 3TSYA 3T12A 4UM8B 4AJNA 3GAMA 2E6UX 4Q3AA 2Q45A 1FNSA 1GOTA 1C3EA 1QF9A 3CRZA 3TTUA 1MV8A 2GEFA 2QAGA 5IM4F 3IB6A 1TUBB 5LP6C 5EHXA 2A6PA 3QU5A 3QX7A 3A1NA 2EGHA 1S2MA 2O6HA 4ZOQI 2JZNA 2DOKA 1GPUA 2ST1A 3E2PA 1N4AA 2XT0A 3D59A 2VQ3A 3DDSA 3ESAA 4I1RA 4JOBA 5G0UA 3CE6A 1PL8A 3H8SA 2V9ZA 4PAOA 4YRMA 1KYWA 1EVLA 3VTAA 2PBRA 1TECE 3EUFA 3HO8A 3I8XA 4R9RA 4LOHA 4XRGA 3GLTA 1PT5A 1TM5E 1Q22A 1TQHA 1CCWA 1T36B 2Q2OA 5AK4A 4C7VA 5F3WB 1UPTA 1PLLA 2QMHA 1NATA 1ZGCA 1WEKA 4KACA 2H4JA 1AD2A 1E92A 1V6SA 3T3GA 2ZVQX 4Q00A 3RTEA 2QTRA 2R97A 1CP2A 4B6JA 1IDOA 1MEEA 1T9BA 3BX1A 3VC7A 3PEUA 1U7TA 2BONA 4Y98A 3MTBA 3EF1A 3A1DA 2AZDA 1W1WA 3K9NA 2OA0A 4RVSA 4PO3X 4MP6A 4B47A 4B6GA 1Y6RA 5BORA 5GZ1A 3PQ4A 4H59A 1MUUA 3FYUC 1WUYA 1Z0FA 3QE9Y 4C07A 1U0FA 3F5QA 3GJYA 3DL7A 3E70C 1Z68A 5AK0A 2JKZA 1NYTA 4IMRA 3DZBA 4HVAA 4JQZA 4XYLA 4XWTA 3R3SA 2QJOA 2NO4A 3C8MA 4DLYA 2OL4A 2AV6A 1OD6A 1J9EA 1WZCA 3WR5A 3L8YA 3VC2A 2QJWA 3PFGA 5EMMA 1FVHA 5LQKA 3F6RA 2VTDA 3M3DA 3RU3A 4WY5A 5KJEA 5LKRA 1ABFA 1G5PA 4GYYA 4LJKA 1PR2A 1U9JA 4OHOA 5JRZA 3OKFA 1QFYA 3G0IA 3C3WA 4RKEA 1YRQA 2A5FA 4OKIA 1XV5A 1RBZA 2JG3A 3INNA 5ER6A 5K3BA 4H6PA 3RC7A 5EHZA 5IF9A 4NFSA 4D97A 3U56A 4TYYA 3BGIA 1PZEA 1E99A 1NOIA 2V58A 2FWPA 1TW3A 5BXYA 1QU2A 3TGLA 1ORRA 4LZZA 1YZYA 3UJBA 2SICE 5PGMA 2QP4A 3A9WA 1PGNA 4KRXA 4CR8A 1V9CA 1BS9A 1QU3A 1F5SA 3O4GA 2WV7A 3O74A 2H4XA 1AV7A 3HJNA 4MVYA 1HUQA 1U2SA 2LCIA 3RAEC 1KK0A 2R11A 3NTRA 4KTTE 4XA8A 4A2PA 1A7UA 5BSHA 3X1JA 4C3OB 2YY7A 1UBEA 3BKXA 3DDOA 1P45A 4U4AA 2XNDD 2RGGA 2WEKA 1Z5ZA 2YWFA 2QG4A 5EVCA 5FTWA 3WX0A 3J7TA 3LK7A 1Q0HA 4QELA 4G65A 4RK4A 5IAEA 4FHZA 1NVMB 4EGAA 2O4UX 5IBQA 3ZY2A 1U2GA 5C51B 3K6SA 3HDVA 2NAFA 3PWKA 1G20A 1E20A 4MWSA 1BVYF 4QREA 3A6KA 2V0NA 3K32A 3N8GA 4J6EA 4AKIA 1X42A 1H5QA 1GQOA 5CM2Z 3NVDA 1WMAA 1Y63A 1D03A 5ICFA 3E22A 1V35A 4HFJA 1NSFA 4EJSA 1OPRA 3T7SA 1SMKA 1LXCA 3KNZA 4J16A 3B6MA 4N12A 1SG9A 3LSTA 5KOIA 1LSJA 2FFBA 1QZZA 1LVUA 2DFVA 2XYPA 2H65A 2YVLA 3NYRA 4D81A 2XCRB 3A6EA 4J1QA 3UHOA 2A7XA 3LBAA 5AVRA 2FSIA 2IZZA 1ESCA 3NNNA 1ZD2P 5K3AA 1YKFA 2BR5A 2WNHA 1TO2E 3ETEA 3NC0C 1UANA 3U26A 3QKSB 5AP9A 3I5UA 5TF0A 4LC0A 1Q1ZA 2V96A 1PJCA 3AFNA 3DKIA 3IERA 5TSDA 2P35A 2QLFA 3ZKWB 2QIOA 1X14A 5E1DA 3SDZA 1NHWA 4CQMB 5I48A 1V3QE 4KKVA 5B1SA 1ICIA 4O2LA 2OM6A 4KUGA 5DLYA 1J97A 2R6GA 3WYNA 2EX4A 3F78A 1L8AA 1CZLA 1OBOA 3D6UA 3INGA 3H5VA 4QU9A 1RYYA 1Y3CE 1H2WA 2NVBA 2C9YA 1KVSA 5JBQA 4HDRA 1BXRA 3KJQA 4TZ0A 3GEHA 3Q11A 2UUCB 1JA0A 1MJNA 5HMLA 1H2YA 2MR6A 1HT2E 3F96A 5ALMA 3CUKA 1N8SA 1CQJB 1NWCA 4DXDA 2BUBA 3LG2A 1CQIB 5K45A 4O4IB 4LMBA 1OSNA 2DPLA 5EJ6A 4B3CA 1CP3A 1NQTA 1W5TA 2XGMA 2IE8A 2AE1A 5F9HA 2EKBA 3MINA 4ZYXA 2O2DA 1NW3A 2HO4A 3MCTA 1KYVA 2IIBA 3FOCA 1NAHA 4HG2A 4KLRA 2IYXA 2R4TA 4R2WA 4EO4A 2QMEA 1VKHA 1JDTA 4YCLA 4HQ6A 2RB4A 4GM1A 5DYYA 2PWPA 2Z04A 3AHGA 2YDYA 1E6MA 1ST2A 3QFTA 4FHGA 1Z2PX 3WICA 3LOQA 2BMFA 5IASA 2PU7A 1MC8A 4KQFA 4KVGA 5AK5A 3EZFA 4JT4A 5LCXA 3GY0A 4YN3A 4M1MA 1LBQA 2JD1A 3O3NB 3C0KA 1W88A 4I55A 4HN4B 1PEDA 3CLRC 1M83A 1KMMA 5DI9A 2NGRA 3PR1A 3FNQA 2QE7A 4HATA 2ZJYA 3RU2A 1TEVA 2DFKB 4RTJA 1VFNA 1XD9A 4RXUA 4BQNA 5A0TA 1GLNA 1KU6A 1ZIPA 2O0JA 3FNBA 3I72A 2PS3A 3HCFA 1IBRA 3TAXA 4AO7A 3OTQA 3NG1A 4PO8A 2WYWA 1P0PA 2F2TA 4C6SA 3RW9A 3T0FA 2IYLD 4FGWA 4PANA 3CEHA 2CL6X 1GPH1 5EEHA 4J1SA 2REBA 3MWJA 4PQFA 4F5YA 2AFHA 1NW8A 3H7AA 4KBFA 3ABSB 4RX1A 3B7PA 4KHZA 1UADA 1RS0A 1EM6A 3AVYA 3EZYA 3BBLA 3E9CA 3OT5A 3E2MA 5BPFA 1IRXA 5AW1A 3ZZMA 2OBBA 3C5EA 4TXMA 2J0EA 2NTEA 3KJXA 3NHMA 3VJLA 1H1LB 3USZA 3LLVA 2QQEA 3OQPA 1CDEA 4ID9A 4HFRA 4QGAA 2EL9A 4ZTZB 1MG5A 3MJVA 2FQXA 3BXHA 4C4XA 2QRVA 1CPYA 4MWDA 5JRDS 1I4EB 3N2YA 3JWIA 1M1YE 3QA3E 4XQGA 4DXAA 2F55A 1CUWA 1Y5MA 4EHHA 3VSDA 3CRRA 1I10A 4J9UE 3WA7A 1TTPB 3HUFA 1UZMA 3HVKA 1ZK0A 1ST3A 4XYBA 4FQ5A 2WNIA 1FVFA 1R6BX 2B7BA 1LSSA 4BBPA 4EEZA 5DFAA 2XXJA 3UFXA 3LQ1A 5K8IA 4X85A 1VE1A 3CKKA 2MINB 4OMCA 3PIDA 1OBCA 1TOAA 3Q2KA 3OQ1A 1GD1O 4GI3A 5HG0A 4PBRA 3OOWA 1WHTA 4EIWA 1FSFA 3G9UA 5F3DA 1QIFA 1FK8A 3UAXA 1HV8A 2CKMA 2QAGB 3IT2A 4HJXA 4RELA 1OIWA 1R00A 4WFKA 3KVNA 2ZJ3A 5LXTA 3VPAA 1O5TA 3GJZA 1E8DA 1UM8A 4D79A 2BBSA 4BQEA 4KPYA 5DTQA 2QQ5A 4ZGWA 3AX6A 3GUCA 3SEQA 2Q50A 2UZ1A 4FE7A 3VOBA 4C4RA 4LFAB 3WRYA 1OXXK 3UVEA 1CR1A 5ARCA 1CZUA 3G7SA 4NWIA 4WZ6A 4BATA 1ZZGA 4RJTA 5CDSA 4B82A 1NOJA 3A3NA 1Q5PA 1VHDA 4EQ6B 1WPRA 5A5EA 5G41A 1HFWA 1CS4C 2OBYA 3E6AA 3C3XA 2DUJA 1NYRA 1RSZA 1KY3A 3IBYA 1X86B 2H7VA 3DTVD 5BSMA 2ACWA 3I0MA 3L84A 5IMBA 1KO7A 3FTQA 3ILVA 3O8NA 1FU4A 4LI3X 4PSUA 3U3XA 4GZ6A 5TB5A 3V1UA 5LU9A 4C89A 4YCNA 4K87A 3DBVO 2XMCA 1M73E 1KJ8A 1UBJS 1T2NA 5EP3A 5JTUA 4MJXA 3I9OA 2H2DA 5CXSA 3H8JA 1DFIA 3G9XA 3L40A 1OTHA 1G7CA 4UXIA 1HMYA 2AMFA 2VHVA 2C2KA 1W94A 3NHPA 1RDFA 4JEIA 2VDJA 2P2YA 3SMQA 2QW8A 2VQDA 4JYAB 2GN2A 4TGLA 2WYHA 5DHSA 2CHFA 2G7ZA 3FPHA 3NOVA 3F49S 5JNTA 1U2GC 4G0MA 3HPQA 4D3DA 2UXBB 3JAWB 5CT9A 1CHDA 2GILA 4FMCF 4P36A 3I6IA 3ZIUA 2DQSA 2PQMA 3AHCA 2XRZA 1RYDA 3P0HA 1MTOA 3EY9A 4EJMA 2XMGA 2HCTA 5DXAA 4BASA 4EJSC 1GTZA 1XQXA 4UEJA 4ZHSA 2P91A 3Q5EA 3DPSA 2RH8A 3SICE 1LPAB 2VHQA 3NXKA 4TRNA 5F1YA 2AFIE 3T7EA 3FH0A 2PIAA 3UICA 1E7MA 1TU0A 4ZICA 4BLPA 3PUZA 4XVHA 4N82A 2P2LA 1BOFA 3AUTA 2ALJA 3QG5A 4NFHA 2ZBUA 2C4MA 1NE7A 2X86A 4Z9YA 3V3KA 3O1IC 3O95A 4REMA 4WN9B 1WXEA 1XZGA 3N2KB 1XMIA 4MWZA 3MTEA 3FVWA 4M8NE 3RKUA 2PLFA 3PQDA 5B2ZA 3BWMA 2O20A 4PGMA 1RI4A 4B2YA 3VJMA 1P1BA 4WUVA 1I0IA 5DHRA 3ZWKA 3LLCA 1OA0A 4BMDA 3R24A 1NI3A 4MS4A 2B69A 2ZIFA 4WJZA 2X4IA 1UOOA 1P5FA 1H2AS 2EL7A 3OY2A 2ZSHA 2B4QA 2VF4X 3ADKA 3FW1A 5T4EA 4KEAA 2C77A 3V8EA 4B6FA 2W8BA 2JFYA 4E15A 1J0BA 3R7WA 1UPXA 3NIWA 2WHPB 4NHEA 2V3CC 2YJ4A 3TINA 3E22B 4IFBA 4GOND 3LUBA 4B6RA 1XVIA 1GQYA 3C1TA 1QO0D 1UDXA 2FTKE 3E5HA 1VPEA 1X92A 3EY4A 1MVNA 3UJ3X 4UW9A 2YIVX 4F5DA 3D02A 3OCCA 1TTQB 3SM9A 2CVFA 2O23A 4KO3S 3K9BA 4GNRA 3FOAA 3AVUA 1ZLYA 2H5LA 4R1MA 1X9IA 1O08A 1XJ5A 1N2JA 2F3PA 3EVGA 3HU1A 2Q29A 3W5BA 4JI2B 1OI3A 2ZWMA 3R7LA 4C88A 5FBVB 5EJ9A 3VAAA 2XUAA 4IJ6A 3SBDA 5HRUA 5AM4A 4ON9A 4G07A 2AKEA 3LXMA 2QD1A 2PAFA 3M4YA 2OPBA 3ZWNA 2D2FA 2NSYA 5AUOB 5ITZB 1E2MA 2A59A 4MRPA 4W5TA 3UH1A 4B6QA 3Q3JB 5ICMA 2ZR7A 3VUEA 1VJ5A 4IHKA 1ZM3A 1KZ9A 4HDRB 3OZCA 1EA7A 1BXRB 1YA8A 2VATA 2NTYC 4Y6PA 5I9TA 1N2CB 4YX9A 7AT1A 4QE3A 2Y05A 2VNKA 1H94A 2JW5A 2R1ZA 4XXHA 1UODA 3U39A 4YV2A 3ZNOA 3V1KA 5IDQA 3KBOA 2VDRB 1QG6A 1PT9A 4N9WA 3S6JA 3EGWA 4CIXA 2NU7B 4D8VA 3U7QB 2ZIUB 2A0WA 4DKXA 4U9IS 5DMXA 1Q6YA 3X1KA 4G0NA 4KC0A 1WAMA 1FP6A 4A5OA 1G9SA 1KZ7B 3RUCA 2CCJA 3OOSA 3EMDA 3R1IA 4QGFA 1TT7A 2B2NA 2GN8A 3L46A 1DRVA 3VR6A 2JDID 5A62A 3LBFA 3TGPA 1BCRA 4ESEA 5JXGA 4KR9A 1TFUA 2YC4C 3TCNA 2B7LA 4ZK6A 1DDIA 3IR5A 4ZVQA 1DB3A 4F71A 2YW9A 2Z4TA 4WIAA 2GAIA 1KO8A 4G1UC 1SU4A 4LDZA 4OQXA 5BR4A 5HS4A 1GITA 3IRUA 2QSZA 3UKJA 3ZXXA 5HP4A 2C0PA 4ZRDA 3UJCA 2BHSA 3BOSA 2NPIA 1ULTA 3H75A 1ORTA 5LMNB 2BJHA 4CLEA 1ZOPA 5C52B 1GUAA 1MX3A 1TRHA 2GXQA 3C3MA 3HXLA 4FR5A 4OBEA 2FA9A 4D80A 3AOGA 5GIOE 1ZR4A 4BYMA 1DMRA 2L19A 4BJHB 1HT3A 2H7YA 2ZWPA 3DV9A 3BE5A 4ND7A 3VFDA 4B34A 1MOZA 4MOWA 3ZCSA 3WQRA 1TIPA 3QHQA 2VK2A 3WDKA 5BYAA 3EBPA 3W2GA 5EA2A 2AHRA 2O7QA 3CR7A 5LC1A 4AULA 1GQSA 2N75A 2QRJA 3QXSA 4E5KA 3TBFA 1IN5A 2HK8A 2OCBA 3QY9A 3PA6A 5DLQC 4DBVO 5BR7A 2OGWA 4NCKA 2QRQA 3H4IA 1Q0SA 2QMOA 4N03A 2B83A 1W5EA 3GG9A 3PFKA 3Q2IA 3TCXB 1M6VA 3ZE7A 1E2BA 5HNKA 1DAEA 1NXXA 1RJEA 2VZ0A 4EDHA 5K0BA 1H6BA 5IXYA 2C5GA 1DS6A 5CT4A 1Q50A 1CG6A 4EABA 2SKCA 3KP1A 4DCOA 4LE0A 4BNDB 4D9MA 4F4HA 1DC4A 3RC1A 3W8FA 2QMYA 5LSAA 3ZVRA 4C7OA 2QRVB 3SR3A 3SOZA 4NENA 2IX3A 5FNVB 2GI4A 3WRYC 4UHEA 1D2RA 3D6JA 1J2UA 5AJXA 1SOVA 5DTMA 4ASUD 2EEZA 2AG6A 4DQ0A 4RSGA 4XQ9A 2W6JA 3REQA 4NG5A 3KOUA 1S0UA 2QPAA 4R05A 4EYGA 3LBIA 3I32A 5GPBA 5KYNA 2GK4A 4F2HA 2O8BA 1NVXQ 3BB3A 4B7ZA 1U65A 4H7IA 1JWBB 2COEA 2PJDA 3LA8A 1MJGA 4UM5A 5BVHA 2GPNA 2IIVA 1YZNA 1H0SA 1NBMA 2JNWA 4UEOA 5DXJA 4BFTA 1COWA 3PX7A 4JHXA 1TU4A 5CT6A 1ZL0A 4O6VA 3O91A 2YN4A 4KIJA 2GDZA 3OMXA 4PE5B 2Y0CA 2FW9A 2VJLA 1WHTB 4DFDA 2XWBF 4RAQA 1P4AA 1TQ6A 3PGJA 2I3AA 3UMGA 3UWDA 3F3SA 2O9JA 2COUA 4UFOA 5LXTB 5A4AA 4P0PB 2V7TA 3LKVA 3VZQA 4JQCA 1RAEA 4AC9A 3F7TA 1ESEA 1XTBA 1ZVKA 1E94E 5ILGA 1DBQA 3T34A 1A0OA 1QYVA 1AZWA 1S2IA 3AEKA 3L1JA 2AZTA 4NQRA 4ZARA 4YMLA 1G2IA 4IIFA 3EC7A 5KNLA 4WNCA 3BM5A 4I8IA 2H7XA 1UXHA 5DYWA 1CUIA 1N2IA 2HMWA 3NAQA 1JBEA 2H2GA 4RC9A 1PUXA 1EXMA 2A8YA 1JR2A 1XEAA 1CZKA 5EMNA 3IAM1 1KJZA 4RPGA 3ZE2B 1PT7A 1XZNA 1J8DA 3MRTA 5KMGB 4X95A 5C4GB 3KRTA 3PD7A 3LT4A 4XI9A 1RHQA 1MDBA 2P9TA 2PRIA 3FNHA 5E4YA 3OKAA 3D1VA 1Q2UA 4FE4A 2OZPA 3PE4A 1U5BA 2C9BA 2JGLA 3QI2A 3QKTA 4NZ9A 1CQWA 4PWYA 3G6KA 3VI3B 4D6XA 2CNWD 1C7RA 3IIJA 1E2GA 1S3IA 2WAAA 3NBQA 3ZIAD 3OJ0A 2I3BA 3FNGA 1SNYA 2NO7A 3OJEA 2TMYA 4HO1X 4DDHA 3HWSA 4PYJA 1RQNA 1KK1A 1FZTA 1Q3TA 2XNJA 2NXNA 3DNFA 2XA1A 3Q9LA 2C84A 1EAMA 2YVQA 4MQBA 5EL0A 3B3QA 1KDRA 4JY7A 5AVVA 4AX4A 4RA6B 3TIGA 1C1XB 1M2KA 1ZXXA 5FIUA 3TLGA 5JQGA 1LFAA 1JGTA 1R3DA 2POQX 2XAAA 5G0SA 3S28A 4FOSA 4BB6A 1CB0A 4JUDX 3MBKA 2RARA 2QZJA 2FX2A 3E7DA 2JH8A 1B42A 1KA9H 3DL0A 1N1DA 5DBGA 4C22A 4C0WA 3H87A 4EW2A 4EGQA 4D0SA 1Y7HA 4B4UA 1NVWQ 2HB6A 3OE5A 4UCXA 5BW5A 4BEJA 3FR8A 3THRA 3RF6A 4V0RA 3AF6A 3QZUA 4DVJA 2IEAA 4J4TA 1P3JA 2Y3IA 3MAAC 1ZHOA 4B83A 2VRBA 3QX8A 3WY9A 3LQRA 4XX0A 1JAZA 5D84A 8AT1A 1MC4A 5AJUA 1HDIA 2LGJA 3WG9A 4PQGA 1LDEA 2ZVDA 3FNEA 5JC8A 4CEIB 5C5DA 1C1DA 1TLTA 2GMWA 4O63O 1VLLA 4EUKA 2ERCA 4DIBA 3RQSA 4LRWA 4H1UA 4KE9A 2MYUA 1OI7A 5GZ6A 4GSKA 5JZBA 1O97C 2LW7A 4S12A 1F48A 4RPLA 9LDTA 2AL7A 1D8AA 2D1QA 2HIMA 3LJKA 4D99A 1FNDA 4ALIA 2HA4A 4HBGA 2V74B 5EHNA 3AI3A 1US8A 3H42B 2QR3A 1OKKA 1D4OA 2BUCA 1V8BA 1UK8A 2ONZA 1M1ZA 3ISJA 4AJ9A 5K8JB 4Q3NA 2GM5A 3ILYA 4FYXA 2D5AA 2BEWB 2MOKA 1CT9A 3JPYA 4FHFA 4G24A 4K9LA 2H2HA 3D3EA 4HAZA 1XLWA 4R1SA 4XWGA 4YONB 4URXR 3II6X 1W0JA 2A30A 3K72B 4DARA 2F1RA 4ZZ2A 1L4GA 4A6EA 2XLCA 4KYVA 4YUZA 3L7YA 3X1YA 4V0MA 3I6BA 4YJHA 1BJKA 3ZG6A 1AT1A 2FKNA 2Q3JA 3VI4B 5KOJA 2A5YB 4R3UC 5AXDA 1JG1A 3O0TA 2HIHA 3QVMA 3R44A 2FHPA 3I2FA 3T4UA 3FCSB 4FFWA 5H81A 5SZJA 3TTWA 1RLIA 3VR5H 2ET6A 2RBKA 4LSMA 5JH7F 3DMTC 2VC2B 3UHAA 3AGQA 3EMVA 2IUEA 3F67A 4E4RA 2CLEB 1A8UA 3GNLA 2E18A 5DZSA 2CD9A 1NVTA 3VYRB 4A0QA 1EDEA 5K3FB 1XJQA 3OT1B 1QFJA 5CCBA 1EXDA 4HAVA 4QBFA 4BC0A 1WOYA 2OKGA 4EZEA 1FTGA 1O6BA 2O3RA 4MEJA 3MRXA 2OMEA 4EELA 2IUTA 1CUVA 1UC8A 5DK4A 1QQBA 3SMVA 3FBGA 1G42A 4Q3OA 3AYXB 3PVZA 3IA7A 1Z62A 4CDMA 3TQSA 1KXJA 4JLBA 2HN9A 2NPOA 4FFBB 1XZIA 2GSWA 3TBHA 4EARA 2WFMA 3ZZ1A 1P6QA 5C2JB 2I2BA 2VT3A 1Q1EA 1YQXA 1G59A 3GRUA 3M1IA 5EXPA 3CUEF 2ORIA 1XKXA 2X8JB 5DASA 5JAHA 4QJIA 4WZBA 1DADA 1T5BA 3RHSA 4AX8A 1BDBA 2FUCA 3OUTA 4PYMA 4H16A 5J4HA 1KEWA 3IVRA 4INPA 4IXWA 3NZEA 3GLGA 1ETHA 3ITEA 2GJSA 4DJEC 3A32A 5I51A 2M98A 2FW7A 4FEGA 4MVCA 5ICGA 3CNEA 3RC3A 1VE5A 2PSDA 2OAGA 3P8ZA 4WLOA 4UNPA 2F9MA 3NHKA 4ECAA 3CNQS 4EJ2A 1Z73A 2R6AA 3ODPA 4MGYR 1OFVA 2JK1A 2OR3A 1EE1A 2X0KA 2X15A 4H31A 4KX5A 4X5OA 4YT8A 5JNVA 3FCCA 4MDFA 4KRGA 1WLSA 2XITA 4W5WA 2O2EA 1ZJJA 1A04A 2QG9A 3N28A 1R6DA 3HNRA 4ZREA 5EE5B 5SZHB 3V97A 5JNSA 4QHTA 3R5TA 2EATA 2X1VA 5CCDA 5A06A 5AD1A 3CCCA 1P18A 4P54A 5AW3A 1OJ7A 1L5SA 3SC2B 1YD7A 4CG2A 1NT2A 4UQPA 3FGNA 3TF5A 3LUJA 4G0PA 4JJ8A 4RVOA 3TQIA 4AY4A 2C8JA 5J2UA 3RSQA 5C8YB 3RSLA 4HNQA 2F1HA 4BXOB 3EODA 4RTNA 3IUMA 1FTYA 1RKBA 1EWTA 2BRUA 2LRHA 3MMNA 4HT3B 1LB1B 4KR7A 1XNQB 2VJMA 4ZVLA 3P2IA 1IDN1 2JLRA 4JJ4A 3S1AB 3JATA 4HQ0A 3S5UA 1U5AA 5IXJA 2B20A 3V9PA 3EXG2 2D7DA 3AY7A 5FX2A 1ZWKA 2FFJA 3EIEA 2FMXA 3K4HA 1M0WA 1NI4B 2CXHA 4Q47A 3NANA 3EZLA 6GPBA 3I23A 5BRNA 3HB0A 1QWOA 4C7BA 2G5PA 3FI0A 5BURA 4N40A 3UPUA 1E61A 4IHJA 3V8QA 3ESZA 4AO8A 5DNCA 2MCFA 4G56A 2H31A 3T9EA 4RXTA 4YXFA 2X8AA 2HWYA 3BAZA 1FXSA 4KG7A 3ROXA 5IWAB 2OUIA 1MXFA 2R68A 4TKLA 1KBZA 1NMXA 2C95A 3ZGYA 1T6XA 1V43A 1Z39A 4KXWA 4PC3A 3PLAE 1CJMA 2BFCA 1VJTA 1QIEA 3NVAA 2WM9B 5HTKA 2YX1A 4WKOA 3UWPA 1H3FA 3C5VA 5AHXA 1HQKA 1R9JA 1VMIA 1QIDA 1GRVA 5DNAA 1WBJB 3V1MA 1RCFA 4YC7A 1Y33E 2M9MA 1S89A 3R5XA 2IYEA 4DMMA 3T7DA 3OIVA 3T1OA 5I4CA 3R8CA 2AJCA 4IOJA 2WTBA 3IP9A 4KFUA 3B78A 1DL5A 2V03A 3HBFA 2LDXA 1YB4A 1CIPA 3NASA 4MPJA 1GTL1 2HSEA 2WP8J 4PZPA 1YB5A 1WXIA 3GT4A 1KFKB 4URZR 3H5RA 3K20A 2QBYB 3ENVA 5FFFA 3U16A 1NRWA 2A78A 2VSOA 4X9XA 2FAXA 5ALGA 2OZLA 2ZYUX 3C3CA 1BDHA 2BFFA 2QX9A 4JOSA 1SC6A 3L01A 4MH0R 4LFCB 1GG8A 2OAP1 1UF9A 2HNKA 5DMHA 4JLDA 2DBZA 1VL8A 1YFJA 3RFCA 1Q17A 1XCGB 4KGVA 5SZIA 3IIEA 1JJAA 1LBSA 3WK6A 3GGDA 3G5TA 1FY2A 2XKJE 5EJ5A 4M54A 4UE6A 4N5NA 1U0SY 3A26A 4R40A 3TB4A 3USES 2Y0BA 4MCIA 4QDOA 2BM9A 3VR2A 3RGWS 5DGHA 3W9BA 1DEOA 3P2KA 5ESRA 2YWCA 5A4IS 2LP4Y 2X0IA 1F6DA 1E7RA 3BILA 3IP8A 4LPKA 3SFVA 1QIMA 3T4EA 2GPSA 2ERYA 3LHDA 4PYOA 3W6OA 1U5BB 1FQWA 2QB5A 3RRBA 3R3HA 1KWKA 4LF5B 5BUCA 3VC3A 3PQ5A 1JFSA 3GP8A 1U0JA 4PHGA 4ZN6A 3ZU3A 2OLEA 4RMIA 4INOA 3MIIA 3TR0A 5JANA 1AKTA 1E2FA 4NJMA 4B09A 3ICQB 1PR0A 3TLYA 4MARA 1SVUA 3CZRA 4CM8A 5ECGC 4L50A 4R83A 5D1NA 1C1YA 2EARA 2HMSA 4X93A 3ZVLA 5J63A 1K8QA 4ENWA 1R6UA 2R7KA 3O9VA 4RMGA 4XWOA 3E81A 2JGEA 3WKEA 4EG5A 2HJRA 5A5VA 5KC8A 1QZTA 3BIJA 3KTFA 4FWTA 3ICEA 3D7LA 3PC2A 4D4IA 1HDXA 3B9PA 1T8PA 1ZC3A 3LPLA 2J7KA 3M6FA 2PJZA 2VYVA 4J7CA 4M8LA 2E3JA 4BP3A 3OPYB 4TL7A 3C87A 3DKKA 4MP3A 4PO1A 4IIVA 3WGTA 3B9RA 1NF8A 4KLAA 2J5XA 3SWWA 2WF8A 1I33A 2AUMA 2OV2A 4QFBA 3W6NA 3WWOA 4RDHA 3CNOA 5A3SA 4IFTA 3RRYA 2XGJA 3FLBA 3H9JA 2QZSA 4X1KA 4HWSA 4TXLA 2KS6A 1JIUA 5ADVA 1C1DB 1U2PA 5L3VA 2J5RA 1UJ5A 1JKXA 3F8SA 2VBGA 1TGVA 2RHGB 4C04A 5ICEA 4UBJA 3I58A 5C34B 2Y1CA 2E48A 2NWQA 4RIIA 1PYOA 3CLRD 4F4JA 1Q15A 2X76A 3ME5A 3TL3A 3TG8A 2R47A 5ULLA 3WGQA 3P9NA 4JASB 3UV7A 2IUFA 2A33A 2WHYA 1ZM2A 2P4UA 4EFNA 1KOFA 1X1SA 4ZO4A 5F7OA 5JVDF 2FEOA 2R8ZA 2XMRA 5F5LA 2WVGA 1W34A 3X2FA 4MYTA 1SD2A 4GX2A 2DGDA 3Q8KA 4LDRA 4TPKA 1GFSA 4ATNA 1ODCA 2C29D 4YQFA 1BS2A 2QW1A 3R0JA 2BFAA 1OLXA 1BFUA 2WWRA 3BZBA 3KAPA 3SQOA 5HKAA 1Y1SA 2ZW9A 1Q7CA 1GUBA 4L5BA 1VZ3A 1T6YA 2O57A 4HB0A 3Q72A 4C05A 1NMQA 3ZU5A 2EKDA 3NKVA 2IS6A 5JSKA 2ZIGA 3W4JA 1J06A 1XG5A 1GAJA 4BZQA 2C4VA 4HNAA 3ZNQA 1NPTO 4XZ3A 1WW3A 4U2DA 4ZDIA 2P6UA 4IXNA 1T3SA 1B0AA 1I01A 2OK7A 1TVKB 3EH2A 4R1OA 4Y9DA 5E6RA 4KLNA 2O2XA 4A92A 3DLIA 3NTUA 2V7QA 5PNTA 2PEZA 3E9NA 2CFCA 5C0OE 4RVDA 1AKMA 1KL7A 3NHUA 4RE5A 5TEVA 1YAJA 2XZDA 1Q44A 1FPMA 3PVCA 4M83A 3X2SA 5MFPA 4W5QA 5BO5A 2C07A 2YJGA 5IJWA 3IIIA 1U5CA 2OXRA 1CXZA 1K98A 1EGMB 1N6KA 3EIXA 3MUFA 3UJ8A 5IFLA 4HQKA 1V3UA 4HN9A 3NUGA 5ALPA 2ZTHA 2W6OA 2O8FB 2G9VA 1BWRA 1N6IA 4CUZA 4ZA2A 2P30A 4EFDA 4NL4H 1I4LD 4K9OA 4MQFA 3NWPA 2BGRA 1VE9A 3G9QA 5ALOA 2G1AA 5I3CA 1H6DA 4G4GA 5ES3A 5ES4B 2YINC 1YDFA 1PNQA 2BRUC 1UPFA 1Z6AA 2AYZA 1P39A 2CW5A 1IXKA 1MO4A 3D64A 4ZEVA 1U8ZA 1RLTA 4WZBB 5ICCA 4V1CA 1KJYA 2AQHA 3TBKA 2GVDC 5JCZA 3C5CA 2V6MA 2VQ6A 2F43B 1MG0A 2XVZA 4WMLA 3CMCO 3T95A 1NKSA 4NIMA 1N5DA 1YR9A 3ENZA 4LV5B 3IBFA 4NLLA 3O2NA 3WFJA 1B3BA 1NTOA 4LBZA 5IDVA 4EY6A 3TH5A 4IJWA 4YJ2F 1OROA 3FFBA 4RGQA 1ANKA 3P96A 4EHDA 3FZGA 4OP2A 4PPYA 4P4SA 2Q5IA 1L7BA 3LXRA 1YIOA 3I2IA 4TT3A 1J21A 4JSTA 1LQTA 1XDWA 4S35A 2HF8A 5CX1B 1D2GA 1LF5A 1XI2A 1FA9A 4IQ0A 4N8SA 1QTQA 4NYJQ 1QR2A 2PH5A 1G5IA 3PF9A 3RT7A 1N77A 4M76B 2VRCA 3A6LA 4L4SA 1PFKA 4TL9A 4MUFA 1IG3A 3NLLA 4RLHA 4KKXB 2WR8A 2JATA 5A03A 2WINI 4MRRA 4CT5A 1T2VA 2NV2B 4CEHA 4J3JA 1XUOA 3FRIA 1W1UA 4A1FA 2X3UA 2J85A 1TA0A 1NBIA 2AJ8A 4ID3A 3REGA 2BLLA 5C7LO 1ZMTA 4FX2A 3K8QA 3A0UA 2FPUA 2VJMB 5I7FA 2F8MA 5JMPA 1R0CA 1T8TA 3UT6A 5L4NA 1YZQA 4PX3A 1YU6A 2IE0A 1SIWA 2YWBA 1GNQA 3KETA 3JD0A 2NVWA 4QTXA 1WIWA 1Z88A 1ZCFA 1WMEA 4CTOA 3ZWXA 2B35A 4K6CA 5BV2P 1DXOA 4QBGB 3EVDA 4G1BA 1CJVC 1WKVA 3OLZA 1O9GA 2HWWA 5F1KA 4YRBA 5GINE 2Y93A 2AN3A 2W98A 1WX1A 3DWGA 2WA2A 3G6WA 3GP3A 2OLKA 2PZMA 1JA1A 2EQ5A 2QRMA 3V5NA 3KB6A 2OEPA 2CWDA 3HM2A 1JG2A 3OAAA 1ZY2A 2QYTA 2E55A 2YV1A 2B0CA 3IP3A 1XNJA 3KXPA 3VTZA 3CZ4A 3DV0B 1NUAA 1WEHA 2OORC 1JTFA 3ZD9A 4BGUA 4HN2A 4RCVA 1OAAA 1W35A 2HMYB 3GMSA 1YMUA 3KFVA 1JR3A 1QFXA 1QDLB 1KY2A 3FF1A 4EUHA 2YJ5A 2WMOB 5KWJA 2L17A 4MKGA 4GVLA 3RHFA 3VJRA 3VNVA 3PRHA 1GRNA 4Q5IA 2G83A 3M6MD 4KOEC 1N8NA 2IX9A 2ZSJA 3H5WA 3HUEA 1RZRA 2IQ5A 2AI3A 3HCAA 2DJ5A 3A4NA 2JIMA 2WILA 2Q1UA 2HX1A 3IVGA 3F2VA 5KYUA 3A3PA 3SVTA 4C06A 2FPGA 1QB7A 5BN3A 4JI6B 5LN1A 4ZHQF 3BXFA 3G0HA 4YRSA 5IULC 3A6FA 3GEMA 3UHPA 1IQUA 1EFTA 1SUBA 1AB5A 1QGZA 2HHJA 3CW9A 3JZMA 4R81A 5AJVB 2CVZA 1WCYA 3RK0A 1SBTA 3ASUA 3GQVA 3H6KA 1WU7A 3TOXA 3LVRE 3CH4B 5JY6A 2ZU6A 1JSCA 2HDNB 1A7KA 2XSZA 3F5FA 2BFBB 3H6HA 3N87A 4CQLA 2EF1A 2B94A 4KPGA 1R5NA 4BBZA 4P6VF 3TPCA 3EQ6A 4HOYA 3I83A 1YQTA 2HU2A 4WX2B 5JSYA 4KFCA 4IDAA 1XF9A 1TM1E 1DOZA 2GARA 3RS5A 2Q6IA 1CY1A 4YLEA 2H9IA 4QM7A 1L7NA 4O4HF 1O54A 1Y37A 2FSSA 3MJRA 4G5YA 2NVOA 4RVGA 3KPWA 2FZLA 2QL9A 4UZFA 3A9TA 2Q7XA 3IESA 3UBTA 2D0DA 3U7QA 5JHHB 2V5VA 3U0BA 3HI6A 3UANA 3SJZA 3V2IA 4RJLA 1XYYA 3H4VA 1UPUA 2QLBA 2OB1A 3GJ3A 2CYAA 2F8TA 1CEYA 2GZMA 3U3DA 1NQWA 1BMFA 3EMKA 3VVBA 2JAXA 2C0CA 4K0RA 1VLMA 4RS4A 4HDSA 4IJKA 1IK6A 2FWJA 3EGIA 3K30A 5JJKA 1UWKA 2A9KA 2MJLA 1FFCA 5DRTA 3ONDA 2GK6A 2WMYA 3A3YA 4M1SA 4P98A 4QYWA 3T4PA 3W1EA 2PUAA 2DPYA 1BDJA 1KY4A 1NC1A 2QE7D 1A8SA 2AMVA 4B2PA 4BTVA 1C7FA 1EB9A 2FPMA 2ZEJA 3QWHA 1ULBA 2C99A 2MMGA 3D7SA 3NJ8A 2PLRA 1MDFA 4LISA 3DXZA 1B0UA 2WFLA 1E0KA 3GMTA 1QE5A 1EE9A 4OA8A 3AEYA 3ZW7A 4BNTA 4G4IA 4FC6A 3UIEA 2D00A 1L7MA 3ZJVA 1EQUA 4LK2A 5DM1A 3W9YA 2ZTMA 5NULA 3H99A 3QOYA 5D5PA 2MU1A 3PGVA 3UMSA 1GU1A 3P2YA 3T7AA 3VU1A 2VSQA 4NEGA 4DSZA 2NP6A 2XDQA 2XADA 1YVUA 2IA5A 5F7ZA 1BDMA 5KO2A 1P62B 2CFRA 2IHYA 2HCFA 3CF2A 1MH9A 2ZB8A 5KJ6A 5MHTA 3RSOA 4MUKA 3AF4A 3KTOA 3F98A 3CG4A 2PUJA 1MVLA 5CM9C 2RJ3A 3H83A 1QMPA 3IAUA 4HDNB 1YBAA 3HP7A 5FEMA 1Z06A 3S27A 4DA4A 1HKHA 1WU8A 3KOZA 2UVQA 3BFPA 4C5AA 4RIFA 4NMLA 3E53A 5D7BA 5F51A 4AUMA 3FLMA 4NDAA 3T1QA 1XGKA 4FQ8A 2CF5A 2HGZA 2XNKA 4X00A 5B1DA 5LIRA 1LBIA 4KNVA 1Y1QA 1SBYA 2FEWB 2OTCA 3D2AA 4GC9A 4YDRA 4LNAA 4BZZA 2I8AA 2JGKA 3JVIA 1I5OA 3FCYA 3R0QA 4U3JB 5D3ZA 3V32A 2L69A 2FGKA 1D4FA 1TJ5A 2A57A 3KKLA 1JEOA 1CUDA 1JV2B 3Q41A 3OLYA 5KQPA 1Y8ZA 1OVGA 3F5DA 4QDUA 3VBCA 2A58A 3TLZA 2ZS8A 2WWIA 4U5XA 2P9JA 2EHJA 5JAUA 2O2ZA 2TSYB 3ICWA 4JBYA 3EWIA 2PGOA 1YOVA 4HTFA 4I4TA 3B85A 1E69A 4MVJP 1KQGA 3SBOA 2V9PA 2G76A 3PNYA 1FDOA 1PZNA 2W0SA 4PLWA 3VO1A 2W2KA 2QUZA 2ZRDA 5JPCA 4E51A 2YXBA 1ZCBA 5LQAA 5FR1A 4P4NA 3OWXA 5K8TA 1XYGA 4ZYZA 4G5GA 4CM9D 4UHDA 4QQFA 3AOEC 3QBTA 5HYVA 4FDMA 3Q5DA 2JVKA 4ER5A 2IOFK 2Y2UA 4KWHA 3NIFB 2GYVA 4X97A 4IILA 5A5FA 4NAHA 4V2UA 5A6SA 1K8XB 2J6BA 3FLEA 3IMGA 1EZZA 4EWLA 4X65B 5CCXA 1ZD3A 4JXZA 5KOYA 1R3UA 2WF7A 1N2GA 3QY0A 3NVMB 4JELA 4MQUA 2VOEA 3BHNA 3SX0A 4CN9A 3NONA 4KUEA 3AVWA 3OY7A 3I34X 1TIKA 4BC1A 3B5JA 2O5EA 2GERA 4I3HA 2PMEA 2P78A 2R25B 4ZD6A 5CH5A 6ADHA 1KBQA 3C3PA 3S55A 3PUJA 4LZNA 4YRLA 2FEKA 2GF9A 1JDBC 1SOWA 1VJCA 2XZTA 3HVRA 3BFXA 4L27A 1ISGA 4PLHA 2RGDA 2B8NA 1YVPA 4WKGA 4CEJA 2N1BA 2YHIA 1VA4A 4DBZA 1V1MA 2WU0A 3GN1A 4ZQIA 1N7GA 2YYZA 5K3SA 2GM3A 4UFNA 2JGNA 2SECE 4G4SO 1VPDA 4XCVA 2UVPA 4QAQA 1D2AA 3U48A 1YCDA 3T1NA 4OHKA 4ZOCA 4Q3CA 4AYXA 2M6RA 1JHXA 2IBMA 3L0ZA 1DC7A 3RVDA 1BYUA 3BDAA 2VJAA 4KI7A 3CIFA 3FG9A 4A6DA 3U61B 4JUIA 1HE5A 4H4DA 1BROA 1STOA 1E63A 3BJRA 3I42A 3M4XA 3QVGB 4IUBS 5D86A 2QX6A 4Y6RA 1M72A 2BKXA 2H54A 4G0YA 5I7OA 4OX9Y 4MA0A 2EQBA 1V8DA 2BSAA 3FRHA 2OM2A 3K8OE 4NSNA 3OFKA 4ND5A 5H9VA 1RRCA 2ZWAA 2J5BA 3WIEA 4ZAGA 4Z0NA 3T94A 3PX3A 4MS1A 4JC4A 1JZTA 4ZQHA 1ZQ1A 2KLHA 2OILA 3JD3A 4Q9HA 2QSJA 4KIUA 1UKEA 1Z5PA 2I34A 4C0SA 5CFLA 1XZDA 1NM5A 1TFRA 2CUKA 2Z9CA 5H70A 1JSRA 3JZIA 4AF6A 1ENOA 1H9CA 3WGZA 1HRDA 4KR6A 3AV0B 5E6UA 2MSEB 4BN4A 4KWCA 1XN1A 4KR3A 3DMYA 4HLCA 4CLOB 2BTEA 4KZKA 1XPRA 5FOXA 1SCUA 3A1WA 4RKYA 2IY8A 2ZJAA 5T57A 4IPTA 4G5QA 1BJRE 1CE8B 4ZMRA 1X87A 3A06A 3D43A 4JVLA 3GJRA 4S1TA 4OJKA 1B41A 1SD5A 4EUNA 4RK5A 4OXRA 2FQWA 3Q8XB 4DQUA 4D45A 2VI5A 2YFQA 2AOXA 1U90A 3ANYB 3MEQA 3OEHA 3IUNA 2Q3MA 4CVNA 2QTZA 5EXXA 3R0VA 3BTSA 2PH1A 3K73O 1MZVA 2C92A 5JW6A 2WHQA 3BYZA 4ZO7A 1OFIA 1IEWA 1KOJA 3QLEA 4GR9A 2J33A 2JJQA 3OZDA 5DTIA 3RUIA 3ER6A 1P60A 1NFFA 4RS3A 1DX6A 3PU6A 4CGYA 2J0SA 1T1SA 1E5LA 4I1UA 3E9QA 3WLAA 3EULA 1P91A 4N0PA 4FYJA 1UKCA 1DQSA 2X58A 4ARUA 1FX0A 3B6ZA 5J9FA 1IXRC 3TX2A 4LA4A 3BXEA 4XSHA 1NPYA 2O06A 4J03A 4LRTB 3T5CA 3HRHA 1OGJA 2QWXA 4TTTS 1YR8A 3UJHA 4U5QA 4NH0A 4IQGA 3FPKA 5G3ZA 2ZWOA 4TUYF 5LP6B 2X0DA 5REQA 1FNMA 3NT2A 3R41A 4ZYYA 5GTDA 4BO6A 1A2KC 3IT0A 4I4LA 3T7IA 1DIOB 1O97D 2QTWB 2YV5A 2AD5A 4DR3B 1GGNA 1GAEO 2ODWA 3FYCA 1W9MA 3RYTC 5U4XA 1C30B 1J23A 4RFVA 1CJKC 4Z5XA 1E4OA 4K9PA 4D9BA 2K7ZA 3MTQA 1UAAA 1DGQA 2DULA 1M1YA 3F97A 3PITA 4BJ5A 1EFPA 1TKBA 2WIDA 4UCFA 1GJRA 5HDBB 2GRAA 4LYDA 1BKDR 1UXOA 2FF7A 3DE4X 4DNPA 4Q0MA 4UUQA 1USIA 3OIYA 4NKRA 4YA6A 5K0NA 1RC0A 1IHDA 4JBIA 3OZRA 2OCGA 1SKQA 2R48A 3LCVB 4ZMBA 5JMTA 4BDTA 3RC8A 2X42A 1MN6A 1P9RA 2D13A 5ELMA 2J67A 1GNSA 4PLZA 3KSDO 2VH5R 3DYVA 1NQOA 3DMRA 1HURA 4KE8A 3IDFA 4E22A 5IHPA 3WYFA 1NXVA 4RVNA 2HTEA 3VR6D 4I19A 1SCJA 2NNLD 3S2UA 4DIOA 4AROA 3S40A 2C1EA 3EB9A 2AG5A 2DY0A 2FHSA 3HZOA 3KHUA 1F1BA 5D01A 4RM2A 2ZK7A 1GYRA 2B8WA 1ISPA 4LCBA 2VF5X 3O8QA 1O0CA 4QPNA 5DM2A 3AF3A 5KX5B 1DAPA 3LUAA 3AHDA 2QLJA 3HCWA 3PRYA 2NTVA 3ISTA 4Q9LA 6Q21A 1IN6A 2D4AA 3FFXA 3PQ6A 2GTIA 1M8KA 5DHTA 1P33A 2ZYHA 1QQTA 5SY9A 5J3JA 3TKAA 1KEZA 2ACVA 1W2WB 1KBOA 5MN5A 2ETVA 3UXMA 3BMOA 1EKXA 4TSKA 3V4RA 3K8ZA 4NAUA 1PJQA 5IKEA 3EIWA 4AL4A 5JYDA 4MQEB 1X7WA 4H4EA 5EHGA 3O84A 4ZXFA 2RH5A 8GPBA 1CSEE 1H4QA 3CH5A 4ZDJA 2WJPA 5A05A 3RBAA 1EUQA 3BRCA 4D41A 4A0SA 2V4MA 1QYCA 1M7BA 3KFXA 2NO1A 2HA5A 3EWSA 5EZQA 4A3SA 1RQRA 4EI2A 1GKKA 2WFLB 1ZGBA 2GA9A 1EWRA 2MR5A 5ITVA 2XCSB 5LD2C 5F12A 3DE6X 4O0MA 1Z6XA 3FM9A 2Q6TA 4JQYA 3BSSA 4NBWA 4AY5A 4DA7A 1ZA2A 2AZMA 2OXEA 3NAGA 3C5HA 3CFYA 1GQQA 3D3WB 2R6JA 4AIIA 2JIBA 2XDQB 3EEIA 3FZYA 5BRJA