3GJ0A

Crystal structure of human rangdp
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
207
structure length
207
Chain Sequence
SAAQGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and Biochemical Analysis of the Ran-binding Zinc Finger Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
total genus 67
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gj0A00
1TADA 2HEIA 4XSHA 5D3QA 2C9CA 3A4MA 4QHYA 1NY6A 2CVHA 4GBMA 4MGKR 1XPRA 2Q3HA 4LCBA 4BLQA 2JLVA 2GJ8A 5HKKD 1E99A 2ZYVX 4AY2A 4QBHA 3BWDD 4CRWB 1UBFA 4HAZA 4EDHA 1SVMA 3GJ4A 2WJIA 3NC0C 1XCPA 3QPWA 3C8UA 4DZZA 4OHXA 3D6TB 4MGYR 4ZCLA 2YINC 4M9SA 3I8XA 3HYRA 1IAQA 1SVOA 2WVJA 3BERA 3R7WB 1P9RA 3QF7A 3SYKA 4E07A 3EPHA 3UIEA 3KQLA 1JJ7A 4QGFA 3RS2A 1GP2A 5JRJA 1VYUA 1MR3F 4KO8A 3RS3A 4LHXA 1TUEA 1XB2A 2ZJ5A 3DDCA 4QG7A 5F9FA 1XD2A 2AX4A 1XWIA 2QI9C 1W4BA 2WZQA 1IJEA 1JAIA 1ODFA 2Z43A 1JEEA 5G3YA 4LI0A 1EFRA 4P0TA 1W36B 4NKRA 2P5SA 3SN6A 1LY1A 1FL9A 2IYWA 1YZGA 1F3OA 4BUJA 2Z4SA 5EP4A 1P7CA 2QAJA 1FMLA 2GK7A 5TB5A 3PIRA 2JDID 2XOKA 2G88A 2IEYA 1XEFA 3OAAD 1W0KA 3CNOA 5G3ZA 4KVAA 1XXHA 2YC2C 1AQUA 5KSYA 3THYB 4PQFA 4OI0A 1KI3A 3K0CC 1EGAA 1D8TA 2ZR9A 4MGZR 2CK3A 1KAGA 4EQ6A 3QSYA 2YKGA 4C2TA 2FZLA 1CEEA 4TTRA 4NMMA 1LF5A 2GEVA 3EASA 4M1OA 2MSDB 2VHCA 5DE3A 3THOA 3I4LA 4HAVA 4HSEA 4IXMA 5TY0A 2EFGA 3VR1A 1P4SA 3PUYA 4Q21A 4RD1A 3TR5A 4JLPA 3ZYCA 4JZKA 1VG1A 1I4DD 2VEDA 4KSCA 2XZLA 3VNUA 1TQ2A 5CIWA 2GVDC 3U3KA 1QHHB 3BJIC 4M9QA 1G5TA 3BXZA 4PANA 4UJ3A 2FNAA 2PEZA 1GZSA 1OPXA 1X8JA 2FEMA 2QP4A 2ZS7A 4QFMA 5HCNA 4Q47A 1SVLA 3PQCA 3OEEA 4YQFA 1Z28A 3ZVNA 2W6JD 2WMNB 3CRQA 1UM8A 2FPKA 2ZI4A 4OK6A 4JSTA 1RPZA 1XEWY 3TKLA 3VU9B 2RGDA 1KI6B 2DPXA 2N42A 4C0AC 3BB1A 1WMSA 2WJGA 4B71A 2MMGA 3CX6A 4PAMA 2ZS8A 1W0KD 4Z54A 4B44A 1S4QA 1XMSA 3ZJYA 5JWRA 4JLBA 3CF6R 4R9UC 2ZJ2A 2XSZA 3I1FA 3MRSA 3T34A 2FSFA 1XZQA 1A1VA 4DIDA 4RZUA 1ELOA 2IF2A 2KBFA 3A6PC 4A0FA 4U5XA 4F4JA 3O8CA 3FMPB 4NE2A 3HWSA 2LKDA 2QSZA 2G1JA 3OF5A 4MH0R 2WIBA 4XWAA 4ZDWA 2ERXA 2ZSDA 1WF3A 5L3QA 4H1VA 1KK0A 2W2VA 2Q21A 4B6EA 3SNHA 1KYIA 4MKGA 3IBYA 4P33A 1M7GA 1TQ4A 2XITA 3RVBA 1L2TA 3SFVA 2JIZD 2XXAB 4IDNA 4LJ4A 4LJAA 3LD9A 1GDDA 2JLYA 3ND8A 4URZR 4PC1A 4LX0A 1XD8A 4JLNA 1YKSA 5E95A 3KJGA 4P4UA 1KMHB 4M9XA 4LHZA 3EW9A 5E7JA 1KI2A 3GJ8A 4Q1AA 5FTMA 3KQUA 2NO0A 1DAMA 5JHGB 2DR3A 2KB0A 2EFEB 3TUZC 4QM7A 5JJKA 4EAQA 2MSEB 3V00A 5HKKA 3E70C 1RYHA 4M0LA 5L3SB 4RD2A 3M1IA 3CX7A 1M8PA 2RGEA 2VQSA 4ESHA 2FH5B 3L0PA 1ZM4A 5TVKA 2AHOA 2GEUA 3UPUA 3CPHA 2AD1A 4BEBA 2DCUA 4MGIR 2ZUBA 2R2AA 5FBRB 1G8GA 1I4TD 3B7GA 2CBZA 1GKIA 3K0EA 4DSTA 5KNBA 4G5QA 1YU9A 3GCGA 4XH9B 3IBGA 1CTQA 3TQCA 4IEEA 4DCTA 5FTNA 3K09A 4B3FX 1XCGB 5E7MA 4Q18A 3MWYW 1YZTA 3BRWD 1FOEB 3CNNA 4BQSA 2FDCA 4R98A 4Q4LA 4AG5A 1CULC 2BC9A 2BJWA 1NG1A 1DO0A 2IC5A 3NIBA 1ZM9A 3SZRA 2GZDA 4BE7B 2IYUA 2J7PA 2OCAA 3IUYA 2YYZA 1NVXQ 1UAAA 1UF9A 4IOMA 2BIFA 2VPPA 1ZD8A 2H8KA 2UZ3A 3GJ3A 5B57C 1JB1A 1TQDA 4B3XA 4TT3D 4A0GA 2F1RA 2VSFA 2GBLC 1E9FA 1YR8A 3WP1B 2UZIR 3K9GA 1UKVY 4A2QA 1G9XA 2JJ2D 2WMOB 3EWAA 2BCJQ 3BFXA 1P9NA 1J7KA 4A4DA 2ORWA 4LBZA 1S1CA 4QJ5A 1AJEA 2FGJA 4DSOA 4OJQA 5FTLA 4HAWA 5L3RA 1VCMA 4QBFA 5J40A 1R5OA 2FX3A 3P27A 2ZI5A 3QBVA 1GTVA 1DO2A 5KSOA 4OK5A 1DELA 2OFXA 3DM5A 2JA1A 2WPDA 4BLSA 2XNDD 2A3RA 1G3UA 2ZS9A 2PMDA 5FOSA 3CF2A 2ZJYA 3EC2A 3QG1A 5JZVA 3X1DA 2D2FA 4KYIB 1F2UA 4L4UA 3C16C 2OBNA 2J0QA 1IN4A 2JATA 3P1JA 2ZSEA 4HZUB 4OQXA 1OXTA 1DAIA 221PA 4Q9JA 3T12A 1G6HA 4X8MA 1KO8A 3T1VA 4LDJA 3SFZA 2HV8A 4FCTA 3R8CA 1Z47A 4OK3A 4TL6A 3VFDA 3FHCB 2FSGA 1YZKA 1US8A 2ERYA 4OYHA 2WV9A 2HCBA 5JCZA 4OQLA 4AI6A 3ECCA 4EPYA 2ZSFA 4Q7MB 2WKQA 3PITA 1T3HA 2WJJA 4V0KA 3OE7A 1G16A 3Q3JB 4IVQA 2QE7D 1R0ZA 2ODNA 4JJZA 4EJSB 3A37A 5FUYA 4TLEA 3TGPA 5HPYB 3LVRE 4Q4AB 5KNCA 2JLUA 4D4LA 2IYQA 2RHDA 3NBYC 4OQMA 1JBKA 4LJYA 2BWJA 2EVWX 3IGFA 1KJZA 3NVAA 4H9GA 1ZIOA 3TSOA 2BM0A 3AVPA 4M1KA 4A6XA 2B21A 4HUQA 2BOVA 3P4XA 4ILEA 4KFRA 3GJ7A 4PPGA 1XEXA 2GESA 4QOSA 3L82B 4L9WA 5JJLA 4NCKA 1XMVA 2ODWA 3TAHA 4PHFA 3CPJB 1G4UR 1PV4A 1BMFD 4YMUA 2FPMA 4QGHA 5C4GB 2ODEA 1YJ5A 4PAQA 4GZLA 5BN3A 1A4RA 4HAUA 3RC3A 1LF0A 4IOLA 3ETLA 3AVVA 1Q21A 2CCKA 1KHTA 2AL7A 3SE0A 3LW7A 3NTUA 1OXUA 2QORA 4Q5IA 4KFUA 3KZ1E 4A1FA 3P4YA 721PA 3A36A 4X8LA 3OE7D 4HUQB 4LYFA 1CRPA 2V6JA 4YXWD 3KTAB 1ZM3A 2V8OA 3CRVA 5DN6A 3AF3A 3MG9A 521PA 1IN5A 1G8PA 1OIWA 5KUTA 1SGWA 3BORA 1U81A 2EFCB 3D8BA 2FFQA 1ZW6A 4GOKA 1NMYA 3FOZA 1E32A 3U6BA 1TF5A 4EFNA 1G64A 4ERNA 4QL3A 4UXIA 1HURA 1NIJA 1W36D 2GKSA 3AVTA 1NBME 4RY2A 5AJVB 1P5ZB 2FFAA 5IDVA 1KOFA 3OIUA 1R6BX 2G83A 4FMDF 3RS0A 1Q3HA 4D0NA 3B9PA 5BQ5A 3W6NA 2XB2A 4E09A 1G8YA 4PSAA 5G53C 1U2RA 2O8CB 1G17A 3TW8B 4LY6A 4QRHA 5FOTA 5KDDA 1AGPA 2RB4A 2R6DA 3B13B 2WWFA 2ECKA 1FPMA 1OB5A 4C3ZA 1P3JA 2OEPA 2WPDD 4HB3A 3ZS9A 4DCSA 6Q21A 1KDTA 3Q85A 3BOSA 2JLRA 3RANA 3ADDA 5JEDA 3R9WA 4CVNA 1X8LA 1E9DA 3GLHE 4M1SA 3TBKA 3K9LA 4KLNA 3SJCA 1U9IC 3B78A 2W58A 4JVLA 4US0R 5DO9A 4JVMA 1T5IA 1VECA 4YMTA 3I32A 1XXHE 3C5HA 3O8DA 4LV6A 2RKOA 3VQTA 4DCNA 1ZM7A 5G41A 5LD2C 1F5NA 1OH6A 4JKYA 3TK1A 1Y3AA 4TN1A 3TRFA 4LYJA 4EPXA 1TU3A 4LJ9A 5HE8A 3KQHA 2BBSA 3MGCA 4Z1MD 3TVDA 4PSKA 1RRFA 1J8MF 2F43B 3RS4A 1G291 2ZQ5A 4J0QA 2O0HA 4PPFA 2OBMA 2WWYA 3H84A 3A58B 4IFEA 1NN3A 2QL6A 4B3GA 2JDIA 3RC8A 2AXPA 3RLFA 4XD7D 1G7CA 2AXNA 2XAUA 1FX0B 2V9PA 5KPJA 1KNXA 2IXGA 3BC1A 1JXMA 4PSVA 2BKEA 2BMEA 4RFSA 4D4KA 1QHYA 1ZC4A 1S8FA 4JS0A 4W5WA 3WMEA 1E2NA 1W2GA 4XVRA 2QM7A 3QOFA 2FA9A 3E1SA 1GRNA 1XD9A 5C4MA 1KZGB 2FEOA 1N6NA 4DB2A 5BWMA 3Q5DA 3RDPA 1Z3IX 2YC4C 2OSBA 2IUSA 2ZI3A 2P2LA 1YR9A 2ZRDA 4Q7JB 4W5JA 4Q4HA 1SHZA 3SYNA 4C0LA 4ZO4A 2F6RA 1G3QA 4C30A 4M1YA 4MKHA 4DWJA 2C98A 1TQ6A 3REGA 4O3MA 3PUWA 2ZU0C 5JRZA 3C7KA 4ZCMA 1WP9A 5KSPA 3THXB 1ZINA 2PBRA 4NZYA 2CLCX 1FNNA 3LX5A 1OW3B 4K46A 3KB1A 4DLYA 2IUTA 5CYOA 3SEAA 1IXZA 2DWQA 2YJTD 4TMWA 3HR7A 4JLKA 5LPNA 2YOFA 1F2TB 3QF4A 1RJ9A 1LFDB 3MUFA 4O2RA 1EFTA 2PLFA 1ZJ6A 2WWIA 1QHGA 4JBYA 4ZDKA 1P61B 1Q44A 5DI9A 1T0HB 3VTKA 2OESA 1XPUA 2ZETA 4Q9LA 2IUUA 3DOEA 1DE0A 1P60A 2JLSA 3OIWA 1ZNZA 5HZHA 2BJVA 1GIAA 3CZPA 3FGNA 3LQQA 2D06A 4I1VA 1JECA 3EARA 3B60A 3LVQE 3AF2A 3WBJA 2O52A 2YWHA 2YOGA 2A5GA 2WWWA 4Q19A 4P4SB 3REFA 1KK3A 1CF4A 1E2PA 5EXSA 2BEKA 3LBNA 1E1RD 1HT1E 4DJTA 4KITB 2XSZD 5L3SA 1OT3A 2H18A 2O0JA 3TSWA 4DLXA 1UEJA 2E9SA 1Z0JA 4GNKA 2CLDX 2ZREA 2F1HA 1ZC3A 5LB2A 4PQRA 4XD7A 3LLMA 2ZJOA 3LY5A 3AF4A 1T5LA 4C0KA 2W0SA 2AFIE 2B92A 4WAUA 3GFPA 1OJLA 4M21A 3QKTA 5FL7D 1KDRA 3GEEA 3U5ZB 2EFDB 4G5GA 4RCZA 5AUPB 2VIIA 3ZD7A 3QNUA 3IO5A 2W6JA 4JSYA 5CJPA 4ASUD 4QBIA 1KI8A 2OXCA 4KBFA 3CF0A 2REOA 3TSZA 4JBXA 4EFMA 3ZGXA 3CPEA 1CJTC 1W0JA 2PX3A 4ZDJA 1GL7A 1ZM2A 4HATA 3EPKA 1P2VA 3DKVA 1RIFA 3GFOA 4P4SA 3F5FA 2FOLA 5E3HA 1IJFA 2G9NA 4ZI2A 1H8HD 2ONKA 3IIJA 4JVNA 5JFGA 1S96A 1N5IA 4I1UA 4E5UA 3EX7C 1Q20A 5EUQB 1GNQA 4DCVA 1D9XA 4F93B 3EA0A 1KKMA 1XP8A 2C03A 4PO1A 1ZIPA 3MMPA 4QNMA 3U3MA 5EE5B 3UG7A 2DYKA 1U9IA 2IL1A 1A2KC 3KUDA 1AIPA 1K6MA 1OV4A 2NPIA 3OFNA 2J7PD 3U61B 3PEVA 1GAJA 3I3SR 1V43A 2ZE6A 2PCLA 1SXJB 1ZAKA 3EIQA 4HUTA 4DSNA 4OQNA 4WZ6A 1OH5A 1ZMXA 1AS3A 1J70A 1ZD1A 2QMOA 3Q72A 2GA8A 1OH8A 1MKYA 1SVKA 1CJUC 4AWXA 1MOZA 3I92A 4DXAA 4ITRC 2VP6A 1EFRD 3H86A 1NLFA 2GHIA 2P0EA 2ZYTX 2CVFA 1U0HC 1NRJB 4JLDA 4UNNA 1XXHB 1X86B 2D4HA 4ZIRB 3H4MA 2EFHB 5FBWB 1BMFA 1AKYA 1F2UB 2HUPA 2REBA 3GLHB 1VMAA 5AWFC 4DLZA 1B23P 1OXXK 1NN0A 4CZ2A 4QM6A 2N46A 4RD6A 2A30A 3FMFA 3HU1A 5DN6D 1V5WA 4XVQA 1CR1A 1JQJC 2RGBA 2ZRHA 4CF7A 3U60B 3KUCA 3LXRA 4YXWA 3SJAA 4LBYA 1OFIA 2BMFA 4XSGA 4LPKA 1GL9B 3B85A 5HCIA 2ZRMA 1AS2A 1F2TA 2D3WA 3KFXA 3QF4B 3QPUA 1SKQA 3DHWC 4Q03A 1SXJD 4IFBA 3THWA 3MCAA 2RH5A 5FPKA 1ZCAA 2Q9BA 1J8YF 3ADCA 3K70C 3IQXA 4N1AA 1Z0AA 2JEOA 3A1UA 2XTZA 3VX3A 3GLGA 1ZUIA 2OT3B 4B6FA 3L0OA 4NL4H 4UKDA 3PVSA 1ZP6A 3NDBB 1W4RA 4GI7A 3PG5A 2FN4A 2JLXA 2QT0A 1I4LD 3ZS8A 3W5IA 3WYGA 3DO6A 2QU8A 1IY2A 3QVVA 5TMPA 3UG6A 2ZAOA 2XX3A 1K5DA 5IK2A 1XX6A 1ZNWA 2GCPA 1KK2A 2ORVA 2GXUA 3GJ6A 4Q4JA 1UKEA 3IKJA 5FBLB 3WYFA 1E2HA 1LV7A 2IHBA 1M1YE 1CRQA 3QEJA 1B0UA 2IS6A 3V9PA 1TPZA 3SDZA 4QBGB 3DVLA 2Z6VA 1OLOA 3V4FA 4OHYA 3L0IB 2O8CA 2AKYA 3HYTA 4A8JB 2E87A 3Q8XB 1W5TA 2C8VA 2ZRKA 4OQFA 2EYQA 1XTKA 1YHNA 2HYDA 3H2YA 5FOUA 1R4AA 2B6HA 2PEYA 5DI3A 5DI3B 1J99A 2OZEA 3OEED 3S1AB 2ODBA 1D6JA 4ARZB 2ZITA 4QGAA 4AYTA 1XRJA 3ZQ6A 5HZKA 4DEXA 1IN7A 1DAEA 4AD8A 2RAPA 2GXAA 5KO2A 3AUYA 1GNPA 4KYUA 5FBVB 3U4QA 2VF7A 3JZAA 4KSBA 1D2NA 1LNZA 2WOJA 2ZVPX 4JL8A 1J90A 2KI5A 4FWIB 2GXSA 4Q01A 1OE0A 5TXGA 4U00A 3EIEA 1E79A 1UEIA 4JLVA 3IEUA 1WXQA 5FL3A 3QEOA 2O8BB 4G1UC 5H8WA 2DB3A 4LJ6A 5BYKA 3ONWA 1TUIA 3FFAA 3HU2A 4ZDIA 3HP1A 2XOKD 4FWTA 1KNQA 1SXJC 4IXNA 2GRJA 3BE4A 4TYPA 2QPTA 3SU8A 3UWOA 2O8FB 2VF8A 3ZZ0A 4B34A 2ANBA 3TNFA 2HLDA 1IHUA 4HB0A 4AKGA 2YWGA 1ZD9A 2ZYUX 2GWHA 3CWQA 4LK2A 3A8TA 1A2BA 3THWB 1IXRC 5FH9A 3EG5A 1KKLA 4LJ7A 2EWWA 2B8WA 1Z0FA 3KQKA 5J4VA 3FTQA 2IT1A 3B1WA 3H0KA 3GLGB 2YHSA 4V02A 3A1TA 3ZZUA 4DDUA 1KI1A 2QENA 2YVUA 3NBFA 2O5VA 2PT5A 5JJIA 1KY2A 1Y63A 1PJRA 3I5XA 3T1OA 2VTKA 1W44A 2DY1A 3ASYA 2OAP1 2CL0X 3THXA 4RD4A 3C15C 5J4LA 1FP7A 2VA8A 3PR1A 4D4JA 1QHHA 4LPSA 2JLZA 1E2DA 1MABA 5A0FA 4EJSA 3WHKA 3PCRB 2O0KA 4Q9IA 4XOIA 4PZYA 1HE1C 2J59A 3VR6A 1E9EA 4MUBA 1DAFA 4M1MA 4C0SA 2XTNA 4ON9A 2QAGB 2AD5A 2V7QA 4LJ5A 1Z6GA 3F3YA 4DT1A 5KOYA 5DYGA 4LGMA 5C1BA 3GLHA 4UNQA 1SXJE 5FOWA 4EQ6B 3W3AA 1NMZA 2GDJA 4URYR 1JI0A 3KKOA 4N0EA 1MO6A 4FMDB 2HXSA 4LBWA 2QGNA 1W5SA 1KIMA 1FQKA 1NVWQ 1NBMD 1ZNXA 2VYFA 2GEDA 3O47A 3GLIE 1EFCA 2WAYA 3U44B 1Z5ZA 2V1UA 1Z6YA 2HT6A 1T91A 3WRYC 4GSYA 3U7HB 4XIGS 1LS6A 2IXEA 1J2JA 5FI0B 1II8A 1HE8B 2XZOA 3U3JA 1RVDA 1TEVA 2QPOA 5FOXA 4EPVA 3AVWA 3DM9B 3RRYA 4MYTA 2OO7A 2X1VA 4RZ2A 2C9YA 4HB4A 1DVRA 4LZZA 2W0MA 4LJ8A 3WHLA 3IQWA 4LV8B 4D0LB 1GWNA 1KSFX 1R8QA 4DC9A 1QVRA 1KI7A 3K9HA 2ZE5A 4FMCB 2R8RA 2HYIC 3NH9A 1Q22A 1Z63A 2WJYA 1QF9A 1KMHA 1X1SA 2PL3A 5FPYA 4IOJA 4AURA 3LH5A 1Z6XA 3QKRB 4US1R 1EFUA 5GJBA 3AKCA 4B75A 3PJRA 4JVSB 1QHNA 1UJ2A 2BMJA 5EE9A 3TR0A 2YOHA 5ELXA 2GAAA 2WWXA 4C2UA 3W6OA 2V1XA 1E98A 1HYQA 2DFKB 2DFTA 1P62B 4DLUA 4TLDA 3BH0A 3ND9A 4Q48A 1M7BA 3OEHD 1OFTA 3CRMA 4W5HA 3SJZA 4EFLA 1LTQA 3CZQA 4RZ3A 4TYQA 3V4RA 2Q3FA 3ZVMA 1Z08A 5FTKA 1EWQA 1E2GA 2FSIA 1TAGA 3K0FB 4OHVA 4KBGA 3T1QA 1ZU5A 2NQ2C 1OFUX 3FWYA 3NEJA 2IYLD 1YZUA 4NYIQ 1CIPA 4V0ME 4F92B 4PHGA 3RYTC 3QQ5A 3QXCA 4N3NA 2CJWB 4ARZA 2CJWA 4DSUA 3O8RA 4UNSA 2NO7A 4TYWA 4WW0A 4FN5A 3QG5A 2QZ4A 5DISB 2GVZC 1N2CE 1O87A 4LV5B 4BFTA 3LAWA 4D26A 1NJGA 2R62A 2OCPA 4RCYA 3BFKA 1AS0A 4AYXA 1T4GA 3IIKA 3T35A 1IN8A 4ZPXA 1JR3D 2I1VB 4B47A 1OYWA 4US2R 5EE0A 4DBLC 2VP9A 3GEHA 4TSFD 3DEFA 1RRPA 4FCWA 4L8GA 1C9KA 5J4KA 3L0SA 1FW6A 2A7QA 4X8OA 2QMHA 3K53A 5EJEA 1RE0A 3B5JA 2QROA 4IDPA 1YZLA 1DBSA 1T0JB 4P31A 4BLOA 3IHLA 1COWD 3VMFA 2ZI9A 4PC2A 1Z2CA 1H65A 2W83A 4R2HA 4BPBA 2J5XA 1NL3A 1XTQA 5BYJA 4ZV4A 4M4SA 4F4CA 2QP9X 1ZU4A 1Z83A 4M2LA 4HZIA 3FMOB 3MSXA 1Z07A 1TEXA 3RRMA 3FHTA 3M4YA 2NZJA 2KSQA 2C78A 2G3YA 2PCJA 4L5BA 1XU4A 4II7A 2XEXA 5DHFA 1KSGA 1QHSA 4L9SA 3CH4B 2W00A 2LWIA 4LWZA 2I4IA 4TMKA 3LO5A 3QVUA 4PXAA 1AKEA 4RKEA 2NO6A 2J1LA 5EP3A 2FF7A 5CDFE 1FTSA 2HLDD 4EPTA 2QMEA 2P65A 4UNPA 3H1TA 4B3BA 4NU0A 3A4LA 1JR3A 3K0CA 4GL2A 1GITA 3A1VA 3UKDA 2QTHA 3EPLA 4NTZA 3WXMA 4BWYA 2V54A 2WSSA 4HDQB 3LBHA 4B35A 4CYMA 2C77A 1II0A 1R8SA 2JAQA 4Q7KA 1CKEA 4PC7A 4RFSB 2ZRPA 4UQOA 3SQWA 1FNMA 5AUQA 1SULA 5JI2E 821PA 2RGNC 1FX0A 3GEIA 1A7JA 4M22A 1NI3A 1S1MA 2XJ9A 2G1KA 4IW3B 3CONA 3VAAA 1E79D 2GTPA 2G77B 4TLCA 3HJNA 3R7WA 4DKXA 1U90A 1XJCA 5H1YA 3BS4A 4C0BA 1L4UA 5CJ2A 1E0KA 3LXXA 3B1XA 4TLBA 4JMPA 2DFNA 2YV5A 3TLXA 1GG2A 2IA5A 4DDVA 3T06B 4MYCA 2OV2A 1WA5A 4B32A 3JVVA 1VG0B 4OHZA 4FW9A 1G7TA 4YDSA 5JCPA 4MYUA 1RFLA 3QUSA 3WMFA 1VDZA 1E3MA 4KHZA 2CDNA 5EE1A 4CT4B 2VL7A 1DARA 2CMKA 1E2EA 5EP2A 1IXSB 3N70A 2FV8A 1LVGA 2XNDA 1GM5A 5EXPA 2ZM5A 2W6IA 1X6VA 1CJVC 1T3LA 1E6CA 1KJYA 1DEKA 2NO1A 1BKDR 4H1UA 3VR3A 5IF9A 4PQYA 1UDXA 2FMXA 2Z5FA 4PR0A 1G5RA 4NDZA 4G5RA 4U02A 1W4CA 4DHEA 3Q9LA 1AGRA 3SJBA 2GILA 1PLKA 3I73A 1YRAA 4KFTA 3CIOA 1WB9A 1MH1A 1E0AA 2J7KA 5K8LA 3UATA 3K0FA 1E2FA 2J87A 3FYHA 4PAOA 5CLLA 1F48A 2A5YB 3L8ZA 5F9HA 1IBRA 1N5LA 1SVWA 1T6NA 4IVRA 2MMCA 2LCFA 2OLJA 2OXRA 4D2IA 2JASA 3ZH9B 1W2HA 3TW4A 4WZAE 2WSMA 3K70D 1NP6A 3BD9A 2ZRFA 2IX3A 4JL6A 4HDOB 1Z2AA 1M6NA 2AWOA 1E94E 1NIPA 2ZRCA 3K0SA 2DWOA 3GJXC 4CDGA 1QHXA 1XJQA 2QNRA 2VHTA 1GRRA 2ZSAA 1XTSA 2ATVA 2QSYA 3B82A 5BXQC 5C2JB 4QHSA 2YWEA 2IYSA 1EESA 4JL5A 1M34E 4JKIA 5EQTA 1BS1A 2JLQA 2ZUCA 1MO3A 2GNOA 3QE0A 1SVIA 4BECA 3HR8A 2Q0HA 4A8JA 5EZ6B 3TQFA 1N25A 1BYIA 5JS7A 2JCSA 1GKUB 1S0UA 2VO1A 3AF1A 5CK5A 4YMWA 2E1RA 2REXB 1DAHA 4TQ9A 1KTVA 5SZKB 4IDHA 1E4YA 5JEEA 1UKZA 2HJGA 1CU1A 3AVXA 2OILA 2ZUDA 3K0AB 5M04A 2HF8A 4MUAA 1ZNYA 3W6PA 2YWFA 3AP2A 4TMXA 2NTYC 4GMXA 5BW8A 4RVCA 1CJKC 5TARA 3RS7A 2QE7A 3KQNA 2BV3A 1N6OA 5GADl 3PEYA 4TYYA 1HTWA 2H92A 2N1BA 4MRSA 2CE2X 4IHQA 3WRXC 3L43A 4YC7A 2IYYA 1VCIA 4CEHB 1CR0A 2VRWA 4IOKA 4P3YA 2QQ0A 4D0GA 1GNRA 2XB4A 4G01B 4KJZA 1Q1ZA 1Z0IA 5FI1B 3TAUA 4NYMQ 3SC3A 4URUR 4C0HA 2OAQ1 4OI4A 1OH7A 4GPTA 1U8ZA 5JWHA 1HA3A 1VCOA 3KJIA 1MABB 3KDSE 2JJ1D 3ZIAA 4RFVA 5FBQB 2V4ZA 3VU9A 2FWRA 1HT2E 4D4MA 2WWHA 1E1QA 3ZDQA 4POAA 3PEUA 4E03A 3NWJA 4MA4A 1SHKA 3QIAA 5JECA 3ICEA 4D25A 1W0JD 3LX8A 4NBSA 3D7MA 1G18A 1H8HA 4LRWA 1P6XA 2CL6X 3PENA 4CEJA 4I1OA 3PUXA 1P2TA 4HAYA 1XFAA 4NYIR 4C0QC 4MKFA 5BN5A 2IBMA 4TL9A 1Q3TA 5K8TA 1RYFA 3QKRA 1AM4D 1L7VC 3EWSA 2CNWA 1QRAA 2QTVB 1OHHD 3B2EA 4M8NE 3NEYA 3KKPA 4Z8XA 4U7DA 1KAOA 4BFWA 1IM2A 1A5TA 1IONA 1E96A 3A4NA 5FUWA 3SR0A 3TE6A 4B43A 2CCJA 3U44A 1D5CA 2FZ4A 3IHWA 2XNSA 3D3QA 4HLDA 4IDOA 3W5JA 3G0HA 1FMJA 2OFWA 4I4LA 1JJVA 1E1RA 4C9BA 2ZRAA 3AF0A 4OBEA 2C96A 5FPSA 1E9BA 3SI7A 3K8YA 5CM9C 4KVGA 1F60A 1QHIA 3DZ8A 1KI4A 1L8QA 2BMDA 1S9DA 3RWMB 3ASZA 2ZAMA 1Q12A 2A78A 4GMDA 3RRNA 2WBLC 4JIMA 5B30A 3AVYA 4QC2A 3P26A 4TQAA 1IY0A 2P5TB 4NYJR 1TTTA 4K81B 3LLUA 3F8TA 2J9RA 2IYRA 3IPYA 1KO5A 2VH5R 4D82A 1G3RA 3DZDA 4EJSC 3U4QB 3U7FB 3LFUA 2J0VA 2VHUA 4YONB 5H68A 2KBEA 5AR1A 4Q1EA 2WKPA 5EUMA 3PUVA 4HLQB 2V7QD 1U8AA 4JT4A 1SZPA 4IEIA 1KDOA 4O25A 3VKHA 2ZPTX 1IY1A 4A2WA 2FSHA 3QXHA 4F38A 4E22A 1LS1A 2YNMA 4DDWA 2H17A 1T8TA 2B8TA 4PO8A 1SQ5A 4RKFA 4KAXA 5DLQC 1XD2B 4NYMR 2J41A 1OB2A 3KXIA 1JAHA 4AKIA 3PUZA 2X2FA 3T61A 2ZRIA 1G4AE 2IYVA 3UANA 2JGNA 1KZ7B 1Z6TA 4GOJA 3OIYA 3NHBA 2RMKA 4P4TA 4V0LA 1QDEA 1PUIA 2UKDA 3K0AA 3MWLA 1EK0A 2D74A 1Z29A 1BOFA 5A4JA 1XF9A 2BDTA 1ZCBA 4UJ5A 2VBCA 2IYTA 1N6PA 4Q4AA 1E9RA 5E4FA 1P2SA 3FKQA 4BFYA 4QKQA 1FQJA 1OXSC 1AA9A 3JZMA 4JYBA 2VSOA 2NMVA 1OKKA 5JLJA 2R65A 2WICA 1US8B 5EXXA 3ICQB 1FZQA 4YLGA 4JLOA 2J0UB 1BYUA 1DPFA 4I81A 4OHWA 2PZFA 1GSIA 3AVUA 5B58C 4Z1MA 1G3MA 1G8HA 5AUNB 4PTLA 2WOOA 3KB2A 1HQCA 3HPRA 2NOAA 3OFND 1U99A 4MRVA 3MJHA 3IIMA 4NP6A 2XJ4A 1N0VC 1GOTA 2K5UA 2ZI6A 2ZU6A 4LBVA 1T3SA 4ACAA 4HEJA 1XDBA 5B64A 1N5KA 3EIHA 3ADBA 2QY9A 3TMKA 3K09C 2ZRGA 4Z8YA 1OFHA 3CRW1 4OI2A 3AM1A 3NC1C 1CXZA 3KTAA 1KSJA 1VYVA 2BKUA 4DUGD 4NCNA 5LDDC 4B33A 5FOVA 1NSTA 4ZIRA 2IEZA 2ZROA 3EXAA 2CXXA 4WOPA 3W90A 1CR4A 2O8EB 2IWHA 5AJYA 1DOAA 3WNBA 2C9OA 1WBDA 3CX8A 1RRGA 5J47A 3LWNA 3IEVA 3FVQA 1CJMA 2DHRA 3FHOA 4BZPA 2GETA 4ZI3A 4NONA 1Z0DA 2PJRA 3VNVA 1ZRHA 5P21A 3W9YA 1JR6A 2DWPA 3BH6A 2OCYC 4B2PA 5KDOA 2IW3A 3M6AA 1W4AA 3RABA 3SS8A 3AKDA 5C46F 5EP1A 1N6LA 1M7HA 5KSZA 2IYXA 1G20E 2QN6A 4XTCS 1P9WA 3KKNA 4V0OA 3VX4A 1UDWA 3DOFA 2JJ1A 5F98A 2UVQA 4A82A 1DAKA 4EKDA 1N3BA 2ONJA 2X8AA 4TL8A 3UK6A 5GVSA 2OBLA 1E4VA 1WE2A 1W49A 2BM1A 4KXFB 5D3MA 5E7IA 1E69A 3GLIA 2ZR0A 3GFTA 1ESMA 4Q02A 2Z83A 5FR2A 1NLZA 3OIVA 3VR4A 1WQ1R 1CP2A 1OKKD 4LOAA 1E0SA 4C0JA 5JHHB 5DIFA 1E9AA 4M53A 3TIFA 1YE8A 3E2IA 3WNDA 4AYWA 1IQPA 2WTUA 1Q57A 3OESA 1CS4C 1X8KA 4JJKA 2D7CA 3AB3A 1N0UA 1YRBA 5EZ5A 2HF9A 5LBIA 1HEIA 4ESVA 3ZLJA 4MDFA 1P2UA 1MRSA 2PX0A 5TV2A 2P6UA 2X2EA 4HDCA 4UXHA 1AZSC 1VG9B 2DBYA 3NG1A 3TUIC 5CB6A 1RW4A 4BZXA 1DS6A 1XEWX 2RGNA 2QMUA 1C4OA 2WKRA 4HAXA 2P3SA 3MJRA 5C18A 2J0SA 3BAFA 3X1XA 2VP0A 4BRWA 3AEZA 1GRQA 4N0DA 4DEYA 5HR5A 3A1SA 2TMKA 2C04A 3CWZA 5GJWC 3CUEF 2GJKA 2V6IA 1N6KA 4S35A 1DADA 5G40A 3BH7A 4WXRA 1L4YA 1R0WA 2WWGA 4JLJA 3R20A 2F9MA 2GF9A 4DVGA 3AV0B 1UKYA 5HTKA 5SZJA 2R6FA 2I3BA 3KX2A 2CCGA 3M0EA 3T5DA 4C4PA 2WAXA 2O8FA 2R9VA 1E0JA 3U2QA 1H8EA 3ZVLA 3HU3A 4OKSA 1ZUHA 2BBWA 4MYHA 2PH1A 3CR7A 4R2IA 3RAPR 3UWKA 3I72A 2R6GA 1I2DA 1U98A 2EQBA 1ZBDA 1D9ZA 3AP1A 3DKPA 2AFHE 4FMCF 1EG7A 5DYIA 1E2LA 1UBGA 3N2EA 4LHVA 4DLVA 1R10A 1G21E 3RWOA 4EIWA 2EYUA 2I1QA 5CM8B 1NNEA 2GCOB 4DLWA 2GCOA 2BBOA 2DFLA 2EU8A 3VR5A 4BASA 4I1SA 1NN5A 1DAGA 3W3ZB 1OHHA 3GLFA 3AVOA 2KJQA 2QEQA 4M1TA 4B74A 1AK2A 2PZGA 1TU4A 4BZQA 3SQXA 4Q1FA 5EE3A 3B6EA 5TDHA 2J46A 4UXJA 3NDPA 4RSGA 3PXGA 2IXFA 3RRZA 1UBEA 4DB4A 2OUKA 5ANRB 4NYJQ 3QKSB 3ZD6A 1O3YA 2CE7A 2ZE8A 4WVFA 3G5UA 3EZ9A 4ASUA 4BFUA 4TT3A 1E9SA 3LDAA 2GZAA 4DRZA 2ZJ8A 1KO4A 1PLJA 1QBKC 1Z22A 4GT1A 4KLZA 2Z4RA 3D31A 3THYA 4JBWA 4PC6A 4EPRA 1ONBA 4DUGA 2WM9B 2PMKA 2ATXA 4PHTA 2QP3A 1MRNA 1II8B 3AGPA 4I99A 1IN6A 1SKYB 3GJ0A 2ZJAA 2ANCA 2XXAA 4WIAA 1E2KA 3X2SA 4BRUA 4OL0A 5KPDA 1EX6A 3CLVA 5JWOA 4HB2A 4WA7A 5IK2D 2GCNA 3BFVA 1FTNA 2GF0A 2NPFA 2IS4A 2IHYA 4MDEA 4YDHB 3KXLA 4KCGA 5D3MB 4LC0A 2OFOA 2XTMA 4RJLA 2BCGY 1PLLA 4V03A 3AKYA 3I5YA 1HQYE 4YMVA 1N6HA 4PZZA 2ZEJA 4QJ4A 4XWKA 2JLWA 3QI2A 5AJZA 1T9HA 2B7CA 3WMGA 4XVUA 4RD0A 4LC1A 4NCJA 4C7OB 1UADA 2IK8A 5AJXA 5EXTA 2R44A 2RGXA 2QQEA 4MKIA 4DLRA 4TMZA 1NN1A 4F91B 1VIYA 2O8DB 5H70A 3G82C 1W7AA 1S9HA 4PC3A 1Q1QA 1KO1A 4KV9A 8OHMA 1OSNA 2ZJBA 1XMIA 1SXJA 2HJVA 2PZEA 4JLMA 5DSZA 2GJSA 5GJCA 4G5OA 1PVOA 4CEJB 2H7VA 1X1RA 3C41J 3LRPA 4GP7A 3B8HA 1E2JA 3MAAC 2QM8A 4TMVA 1P75A 4QGGA 3FKSD 1YZNA 5IHPA 3Q7PA 3AQ4A 2GBLA 1U0JA 1N0WA 2WHXA 1DG3A 2LKCA 1NJFA 1TX4B 4Y0AA 3QJYA 4FI3C 5FUVA 4CW7A 2GAOA 2JIZA 4HYYA 1LB1B 2OG2A 3FFBA 2ZRNA 4Q4HB 3SHFA 1XMJA 3FMIA 4V0NA 2F3TA 1Q1EA 3CW2A 4R7ZA 3I62A 1E9CA 1NY5A 3ADKA 4DLSA 3ZQJA 2H5EA 4TYNA 4ACBA 1YR6A 4URVR 1QG2A 4ZKEA 2FJUA 2GK6A 4Q9KA 4WXPA 2O8EA 2FG5A 3NBZC 4FCVA 4KI0A 3ZZTA 1WBBA 4FD2A 5KNDA 4GP6A 4G0NA 4BGDA 4BFVA 5L8VA 4BLPA 5J4YA 4A36A 1GILA 3GMTA 2GJAA 2OLKA 2QPAA 3BB4A 3CH5A 4A92A 4NH0A 1JPNA 3KKQA 1NVVQ 4B2LA 3P20A 4TLAA 3W34A 2OM2A 3QENA 4LYHA 4AKEA 4Q66C 1ZYUA 2ZVQX 3KFVA 3TUJC 4IRUB 4PPNA 1MV5A 3DL0A 3Q5EA 1E2MA 3C5CA 1XEXB 1VHTA 1Z06A 1QZXA 2KE5A 3GLFB 4G3XA 3J81k 5F3WB 2EW1A 5FUXA 2F55A 2NZ8A 1ZUNB 3GJ5A 1TL7C 3JVUA 1MT0A 4CIDA 2GZHA 4CEHA 5JS8A 3CB4A 3UMRA 4Z51A 5BN4A 2RHMA 5KYKA 2IS1A 4Q1CA 1GL6A 2RGCA 2C95A 4GZMA 2A5FA 1TF7A 1FP6A 2J3EA 1ZVQA 4TQUS 2C2HA 2KWIA 2QGZA 1C1YA 3CNLA 2EWVA 5DGXA 4O2LA 1VG8A 5FL7A 4BFZA 4B76A 5KU1A 4IJMA 1WDTA 4B3DA 4W7SA 4CEIA 2BVNA 2RCNA 2CHGA 2X19A 2W2XA 2ZRLA 4BLTA 4EUNA 3Q7QA 1HUQA 3U7GA 3TH5A 1KI9A 1HV8A 1U8YA 4TTPA 4K8OA 2VHQA 1UFQA 3EZ7A 3GQBA 3BK7A 2IWRA 1Z6AA 1KGDA 1QG4A 1ESNA 1OF1A 421PA 1CLUA 5GVRA 4XJXA 3CM0A 5F2EA 5UKDA 5JI3E 2CK3D 2IS2A 1DTSA 1U0LA 2BEJA 3NBXX 4G5SA 2GXQA 1M2OB 4M1WA 1R7RA 4M9ZA 1EX7A 4Q4JB 3K9NA 2Q9AA 1WCV1 4Q1DA 3DMDA 4XTRA 3K70B 2WSSD 4Q00A 1VTKA 2Q9CA 3VKGA 1RJ9B 3SBEA 4D80A 3KXKA 2Q3MA 3LA6A 2A5JA 3RNLA 4Q7LA 5DH9A 3VHXA 3BBPA 1S2MA 1G19A 2CLSA 3O8BA 3P32A 3X1YA 3WY9A 3NKVA 4ZKDA 3RSLA 2XGJA 3MWJA 1S3SA 3EA5A 4KU4A 4C7OA 2OE2A 2RGAA 5J5CA 1A82A 3PV0A 3RS5A 2P6RA 4BEJA 3CR8A 2AWNA 3LNCA 1G7SA 1BO6A 1QVAA 2FFHA 3B1YA 3U3OA 4LUCA 1NLYA 2QTFA 1G5PA 1MO4A 1P72A 2ORIA 3KJEA 3MD0A 1W36C 1RZ3A 1SVSA 5IT5A 1R0XA 5L3VA 2ZANA 4PX9A 4TSFA 3BB3A 2P6NA 1RRCA 1NVVR 1SKYE 1FUKA 1XTIA 2H57A 3QY0A 4FIDA 2XZPA 1OYYA 4O0MA 1KDPA 1Q0UA 4IDQA 3FKSA 4HLCA 1S3GA 2O8DA 1R5NA 4DDTA 1JNYA 2RGGA 4BLRA 3RSOA 2NIPA 3LBIA 4LYAA 4A9AA 2QA5A 2CL7X 1E2IA 4XWOA 3BIFA 1AZTA 3I61A 3AH8A 3NH6A 4MRNA 3WBKA 4TMTA 4TTQA 1JQLB 3FDIA 1NKTA 4BFXA 1I2MA 1W48A 3OZXA 4A0HA 2VSXA 2D7DA 4HI0E 2WIAA 4KFSA 1W46A 3OEHA 2AN9A 5K8IA 2G0NA 1RC8A 2WJVA 5JSZB 1KSHA 1U94A 2QBYA 1VYTA 2D2EA 2HT1A 2BHRA 2VHJA 1XBTA 3NHAA 4ABYA 3GPLA 1FFHA 3GP8A 4GOXA 4NPHA 2ZIAA 4UNRA 1II9A 1VKJA 4AK9A 1D2EA 1TF2A 4NCHA 4FMBB 4YMSA 5AK0A 1BIFA 2NGRA 4HZUA 4DCUA 2P67A 3N2IA 4W9MC 2ZRBA 1T8UA 3MWKA 1CBUA 2CNWD 3TVTA 3L8YA 4HLUA 3B9QA 4JYCA 5FR1A 2NG1A 1Z8FA 4QJ3A 4LHWA 3OHMA 4MITA 1AQYA 4PO9A 5CK4A 2PJZA 3K1JA 1VHLA 2ZYWX 1PUJA 1R5BA 2C99A 3E5HA 3QXXA 3QKSA 1BH2A 5KDLA 3TJZA 2W2TA 4KODA 1XTRA 1JALA 5FFMA 2HCJB 4PZLA 3R9IA 1WRBA 3A1WA 1FUUA 4AG6A 1G3IA 1GKYA 5CITA 5L3QB 3ZIAD 3R8FA 4Y0VA 4R71A 4QHTA 2F1IA 1NKSA 3EPJA 3BGWA 5IRCD 3GLFE 2QAGC 5KTYA 3CO5A 4RZXA 3SBDA 5DHAA 2F9LA 1HY3A 1M74A 3F0TA 3W8NA 3T1TA 1NBMA 2PLRA 4URXR 3DPUA 3FPAA 4A8JC 3AGQA 1E1QD 2NO9A 121PA 3PEWA 2O8BA 1LW7A 2L0XA 5KHOC 1N6IA 1RKBA 5LB4A 3U6KA 1VIAA 1KK1A 2QUZA 4NCIA 2VP4A 3QBTA 5FPTA 3AP3A 3U7EB 3LW8A 3QXSA 2FFBA 2OHFA 5HE9A 5SZIA 4B3CA 4QNRA 2VP5A 1YZQA 4MQBA 3AKEA 2R6CA 3EZ2A 2D62A 4V0MA 2FPLA 1G8FA 4S2EA 5CDFA 2PT7A 1GUAA 4GRAA 3LV8A 4JT2A 4F4IA 4JLAA 3B1ZA 1NVUQ 1XJ0A 1JR3E 4AC9A 2X77A 3U3RA 4FXPA 1KY3A 1Z0KA 1VCNA 1H8ED 1YR7A 5K8UA 4F7WA 2Y8EA 4MRRA 4TWZA 3SHWA 1G7RA 4A15A 3UXMA 2ZRJA 5DNYB 2Z0MA 1PZNA 1VPLA 3GLGE 3IO3A 4PFSA 1EFHA 2H16A 2MSCB 4GDFA 3QPVA 2B7BA 3X1ZA 1DG1G 2FE4A 2V55B 1TNDA 3N5CA 2H1LA 1JPJA 1KO7A 2V3CC 5FTJA 3EAQA 4WBSA 3VHLB 3DMNA 2FGKA 4GFDA 2AR7A 1CR2A 2SHKA 4FINA 3GD7A 1COWA 1N5JA 4QXAA 1JXOA 2IF0A 3KJHA 4TL7A 3WP0A 1AN0A 3IPXA 3C14C 1UBCA 2ZE7A 3AVQA 2F1JA 5JBQA 1G41A 2F43A 4LHYA 4TZ6A 3VR2A 3C4JA 1YQTA 2HXYA 3IILA 5JMTA 4TZ0A 3KKMA 2G6BA 2QG6A 4IKEA 1XNJA 5SZHB 4DLTA 5AUOB 3WYAA 4Q1BA 2ASEA 4P32A 4PPQA 2WJHA 3CBQA 1N6RA 4NHOA 1F6BA 2AKAB 3SYLA 2G0TA 5FPHA 1HH4A 2HDNB 2R6AA 4WZBE 4RD3A 1NG9A 5JSZA 2QBYB 2QAGA 3PFIA 3FE2A 2ZXUA 1G1MA 4BFSA 1XCMA 1OXVA 1YVDA 1D2MA 5CIQA 3GLIB 2YZ2A 2ZSBA 4IVPA 1GFIA 1TMKA 1K8RA 1E2QA 4Q9HA 1OIVA 3EZFA 4B48A 1KI6A 2A9KA 1X3SA 2ZJZA 3W8RA 2OCBA 1XTJA 3RHFA 3T15A 3QKUA 1Q1BA 3SOPA 2F7SA 3CRRA 4X8HA 2VP2A 4URWR 4L16A 3CKLA 2AK2A 2QRZA 4D6PA 1IOZA 2CHQA 3MLEA 2W6ID 3KL4A 1K5GA 1R0YA 5LD2B 1R2QA 3VKWA 5B2ZA 3FB4A 3UMFA 3I8SA 1MO5A 2C5LA 3IDQA 3ZVRA 5GJVC 2J0UA 3L2OB 2QT1A 2JJ8A 2QRNA 3UMSA 2JJ2A 4DT1B 3HPQA 5CB8A 4OJKA 4D81A 2ZTSA 4CEIB 2ZR7A 1NSFA 5CYPA 3WNCA 2VLIA 2ZI7A 4OI1A 1P73A 1UPTA 1ETUA 4A2PA 3X1WA 3NXSA 3OAAA 4HLUC 5AJWA 4B2IA 4CT5A 3QXJA 2AK3A 621PA 2A5DA 4DIEA 1KJWA 3LQRA 1JEDA 1NMXA 1G6OA 3EZ6A 5A5GA 2GJ9A 2FU5C 1KMQA 2A2ZA 4B73A 1GVNB 3B1VA 4L15A 4EPWA 1EXMA 3MFYA 4AIIA 4AKHA 1W1WA 2Q6TA 3EC1A 2J45A 4CGZA 4MRPA 2F3RA 1XZPA 1XPOA 1ANKA 5CLQA 1W47A 3R9XA 1NF3A 2CHVA 4A0RA 2BBTA 1EWRA 2IYZA 2CEAA 1OIXA 4PHHA 4A6PA 4LSGA 4ZCIA 3AUXA 5J4HA 3T5GA 3S1AA 3HDTA
chains in the Genus database with same CATH superfamily
4XSHA 2H54A 3AESB 2C9CA 3A4MA 3M5PA 3HSSA 3K2BA 1I0IA 2W6QA 2G67A 4KVZA 4RYDA 4E33A 4GBMA 3U16A 2GJ8A 1E99A 1OGIA 2VF5X 4PS0A 2NXJA 4QBHA 2XH8A 3WJ7A 3OQIA 2FSPA 1UBFA 4CRWB 4EDHA 4AY2A 1ULHA 2UDPA 5CG1A 5DSXA 1F7UA 1SVMA 1LBQA 1N3LA 2Y05A 3JY6A 4YAFA 2QOEA 3VZPA 3G5LA 4D9IA 1KTIA 2XUGA 1EUZA 1JR4A 1UBLS 1KFBB 4ICIA 1HETA 1YKFA 4ZCPA 2CDAA 3WKEA 2VNKA 2GO1A 1TYBE 3NO4A 5IEJA 4L1KA 4O4LA 3PC2A 1YK0A 4YDQA 1JJ7A 3EXFA 4E4YA 3VH1A 3MMXA 1H2FA 3G1UA 1NXWA 5JRJA 3I9LA 1MR3F 4KO8A 2PLAA 2ZUSA 4P7GA 4E2WA 4LHXA 1C8LA 1TUEA 3NHPA 4N5IX 2IU0A 5ILGA 3DDCA 3EWIA 4K9MA 1QS0B 2H5IA 1Q19A 1W4BA 3HCRA 4FLFA 5JAOA 4KFCA 3MF4A 1RAIA 4UCFA 1QIHA 3ZH2A 1R4NB 1GUFA 3FOEC 4FE4A 3S4YA 2C58A 3SE7A 3SN6A 5CM2Z 5TT0A 1W581 4BXOA 5J58A 4L75A 4S2UA 1EUCB 2SKDA 1A9XA 1DI0A 1IRXA 1M1NA 4IIVA 1JHDA 4MV9A 1B3RA 4PZPA 4AP9A 3U81A 2I78A 1ZGCA 1OLXA 3SLKA 2PS0A 2VJBA 1C5KA 4PRYA 1RCTE 3RUPA 1XEFA 3DTVA 3HCFA 3QHQA 4G81A 3SEFA 4E3ZA 4DR6B 4PWYA 2BRUC 5KSYA 3CEPB 4PQFA 3DQQA 3KAKA 3KQTA 3J7AC 1B2RA 1KI3A 1EGAA 3K0CC 1D8TA 2EL9A 2ZR9A 2CK3A 2EJWA 2ZT7A 3BXEA 4N0PA 4RS4A 1KJ9A 4EMTA 1AKUA 1JA9A 3A9SA 3QSYA 5E1MA 4C2TA 3EZYA 4IH9A 4TTRA 1LF5A 1CEEA 1LPAB 2VNHA 4R2LA 4XRGA 1YB2A 2XWBF 4XX1A 3NS7A 1A9YA 3E82A 2VHCA 2ATEA 1JSZA 4K6CA 2X8BA 3C7AA 3KHSA 3B89A 5L40A 1JYSA 4IXMA 1H6DA 1NV8A 2EFGA 2W4MA 2WA1A 4KWCA 1ZVJA 3RKUA 4RD1A 3VR1A 3T4EA 4YRPA 3H99A 3PXBA 3LK6A 4JLPA 2A0UA 2XNHA 1I4DD 4KSCA 3OHPA 3ZWMA 3VNUA 5CIWA 2GVDC 2HF7A 4BQFA 2YW2A 1GNVA 3NTVA 5KSPA 3SMVA 2ZS7A 2QP4A 1WS6A 2NVOA 3T99A 3MAGA 4XXHA 3PPYA 1SVLA 4QXMA 2VCEA 2V6BA 2YYSA 4MVJA 1YS4A 2HXGA 3V4ZA 3ZVNA 4B3MB 4GZ6A 2FPKA 4JSTA 3ID6C 3QBDA 2X1MA 1FQOA 4UHEA 5E38A 2AN3A 2EJUA 3VU9B 1Y9JA 4QYMA 3HH8A 4P38A 4CMGA 3KKKA 1WMSA 2WJGA 4LYYA 4B71A 5FYQA 4AY5A 3LM8A 5BWOA 4IO0A 4PAMA 1IE3A 2ZS8A 1KZYC 4Z54A 4L72A 4OUDB 4JLBA 4TXJA 4BTEA 4H60A 4H1HA 3J7TA 5J5AA 5ECYA 1NAHA 2ZJ2A 1R6AA 5FWNA 2ZKIA 3MRSA 5K51A 1HE2A 1PN3A 2VXOA 3WSTA 3FSGD 1DDOA 1M2JA 4RZUA 2Q4OA 3AOGA 2IF2A 4H08A 3UICA 5JBNA 3LPLA 3M1LA 5DNWA 1CJCA 4Y1RA 4ONEA 2PUHA 2QW1A 3U3XA 1RHMA 3WGOA 1NE7A 3OF5A 3PF8A 3WGMA 4QBTA 3NBMA 2ZSDA 1U28A 1WF3A 1O2DA 1PDWA 4MUYA 5EVCA 3R9XB 4B6EA 2FPRA 4WVLA 1CR6A 2YL2A 3CC8A 2I6GA 2O2ZA 4P33A 4F9TA 1M7GA 3ABOB 2R4QA 3BQMB 4PLVA 3HBJA 3IHTA 4BNWA 4DUYB 1L2TA 1ZI6A 3SFVA 2VRCD 4JEMA 4RKRA 5DF1A 1KS2A 3KR9A 4IUBS 3HB9A 1BKYA 1ZIDA 1M34B 3PNYA 4WMLA 5B7NA 2ZCUA 3HGQA 3GNLA 3ZGNA 4PNEA 1ATZA 1GLNA 1KDYA 1SC9A 3F78A 1QORA 1XMQB 4F06A 5CCEA 5FTMA 1DAMA 3UWSA 5K3CA 4EAQA 5PGMA 4E1BA 2BKVA 1N7GA 4OA8A 1AQNA 3E70C 2R00C 3CQ9A 3KZOA 1BXRA 4M0LA 4RD2A 4IMRA 5HOEA 4BZZA 3UA4A 2NTVA 3IE2A 4FUQA 3WLPA 2ZXFA 2SNIE 4RVGA 5CYFA 3IKTA 1WVIA 1ZM4A 1DJOA 1JU3A 3B2QA 3IJPA 3IR5A 3CPHA 1L5HB 1M1UA 3FY4A 4MGIR 1O9HA 1ORHA 1QGUB 1SHJA 3E03A 4B8ZA 4BYGA 4DYVA 5FUMA 2CXSA 1UT5A 5KNBA 3GEGA 4G5QA 3UTCA 2CV2A 4MV3A 3BZUA 1CTQA 1S2OA 4I55F 3TQCA 5DMXA 4DL9A 2YQZA 1KQPA 2J08A 2Z3WA 4NFLA 4TRMA 3HADA 1MD9A 1N2CB 3HE3A 3EEIA 4WKPA 3TLGB 1YZTA 5C35A 1LW6E 2ZB8A 3SIWA 3QFSA 2YJNA 3U7JA 3ZJ5A 5DV9A 4DSAA 3OA0A 3SZRA 3O6VA 2R66A 2GZDA 1L6RA 3ACDA 1Z5UA 3W7VA 3ZPXA 3G5MA 2GEJA 2OCAA 2XMRA 4FDLA 1SQSA 2R00A 2Q2WA 4LFCB 1UAAA 1PR6A 3EUFA 4YLEA 3TMYA 2HU5A 2VPPA 2JHAA 4MNTA 4UD2A 1ZD8A 2H8KA 2UZ3A 3K1ZA 3MBOA 4GOMD 1F9EA 3HLKA 5B57C 2NYAA 3G23A 5K03A 2VSFA 1AMOA 2EIHA 3HGMA 1I2CA 4KQ1A 2PKEA 4EUEA 1W29A 1JTVA 2H7XA 2R6ZA 3WP1B 1JKJA 1A7AA 1URPA 3B38A 2FPUA 1D6NA 3LVFO 2XYHA 1G9XA 1E8NA 4FZRA 1I7SB 3O8LA 1XTZA 2BCJQ 1C1XB 2BHTA 3F6EX 5J43A 1J7KA 3D02A 2IDJA 1QFXA 4M88A 4Z9AA 1ISMA 3F5SA 4X92A 1P81A 2R79A 5TJ9A 5FFFA 2WV7A 5L3RA 2GZSA 3QYPA 1TOAA 1MENA 4QBFA 1R5OA 4P08A 1QKKA 2LV8A 3IBCA 2V7EA 3JASA 1FLAA 4WOBA 3B7WA 1FYXA 4RE5A 4AT1A 1EAYA 1Y4SA 3GYBA 1KPGA 2GLUA 4P93A 3ZGVA 4EI8A 1W8DA 1X38A 2ZJYA 5L4NA 3QG1A 3NMUF 2LDXA 4D41A 1P44A 1MC8A 4DCCA 3CF4A 1LXCA 2C7GA 3C16C 2JATA 2ZSEA 2H9AA 1DQRA 1ODLA 2R85A 3F9RA 2A58A 4Q9JA 3SFZA 3S7ZA 1N57A 5D00A 3O03A 5LL6P 4YAOA 4C78A 4HQ6A 3DVAA 4IH4A 4ZEVA 1Z68A 2V58A 3BD6A 5BUZA 4OYHA 2ERYA 2ODQA 4P5DA 1FVXA 5JCZA 3UMMA 5I9BA 3ECCA 3LZDA 1PWEA 1VPEA 2ORED 3VVLA 4KGZA 2WKQA 4FE7A 4Q3DA 1K5PA 1WMBA 2WJJA 2ZBFA 2P78A 5JDIA 2O7QA 3OE7A 1Y4AE 2AZXA 5IEBA 2QE7D 1F8XA 2ODNA 2O7VA 3SZLA 2WNHA 3N7AA 4Q4AB 1SJ9A 2IYQA 2RHDA 3NBYC 3WV4A 1QH8A 1JBKA 2E49A 4LJYA 3NKLA 1SZDA 3DHNA 2PNFA 4CI0B 2GD6A 1KJZA 3PTZA 3LDFA 1UPCA 2QXTA 2PDAA 2BM0A 5IUNC 2P1ZA 3KO8A 2EBWA 4HUQA 3N7UA 1CP3A 1EU1A 1LLQA 3HGTA 1WB6A 4ILEA 3PCXA 4YQEA 2EKZA 3S2ZA 3TPCA 2IY9A 2FFRA 1XEXA 4QOSA 4L9WA 3PXDA 3V5NA 1PV1A 1XMVA 4LXUA 1Q2XA 3E4DA 2HA3A 4Z7JA 1AE1A 1PV4A 1BMFD 2IPMA 3O8OB 5C4GB 3TBHA 2ODEA 5KX5A 4U7DA 3NVMB 1TXGA 3D1VA 3W2EA 1HL3A 1BCSA 1H0KA 2VPTA 1OGYA 3ZBQA 4E15A 1KOGA 1SIUA 4MIOA 1Y4ZA 4IOLA 4JUDX 2P4HX 4K9KA 4W9RA 1SELA 4XIYA 4XLZA 1P7ZA 2QIPA 5ITZB 3QEKA 1Q21A 3NGMA 4MUMA 4P36A 4RJJA 2VJPA 4BNHA 3C3CA 3SE0A 3LW7A 4Q5IA 1C4XA 2Z2ZA 4B4OA 3DXYA 5ULLA 4UM9D 3QY9A 4WNYA 3P4YA 3Q7IA 4N39A 1HQKA 3M7IA 2V6JA 2EFJA 2YYYA 4OVKA 3DBLA 3I04M 2PE5A 3OD1A 2WNSA 1F2VA 1YZFA 2V8OA 4CKCA 2VJQA 1GYQA 1PEDA 4PNHA 5DN6A 1NXSA 1CQJB 4O5OA 1J2TA 1QFYA 3WJ2A 1M10A 4ZANA 1JHQA 3JQQA 3NPMA 4QRDA 5KUTA 3BORA 5F78A 1K6XA 1KAQA 2FFQA 4JXKA 3WLAA 4KQ2A 1NMYA 3FOZA 1E32A 3VU3A 3KCNA 1IDOA 1JU4A 1M8KA 3K94A 3QV1A 3A28A 2PUWA 2ZT5A 1WXDA 5JS2A 1F4VA 3K4QA 5DM60 5D7NA 1I94B 1HURA 1G6KA 2IEAA 5HWSA 1YDGA 3KM0A 5HBGA 5AKKA 2GKSA 1W36D 5COQA 2PMFA 3DDZX 4WT7A 5AJVB 3H05A 1IQUA 1DDGA 3MYRA 4UMVA 3JPYA 5K05A 1R6BX 3OZIA 4FMDF 2H7CA 4LOHA 3RS0A 3WGJA 1THZA 1Q6ZA 1XR3A 4AZ0B 2CYBA 1QAOA 1O94D 2I8AA 1TFUA 1MG5A 2ODTX 3B9PA 5BQ5A 3W6NA 3N87A 1PKEA 4PSAA 1XKXA 1U2RA 4I50F 3FPGA 2XB2A 2Q28A 4ENSA 4HL6A 2WWFA 1OB5A 1BFDA 2B1IA 2WT4A 4H3VA 1MPTA 2OEPA 2WPDD 1W9MA 2A3NA 1AC5A 5T8KA 1UUFA 2YJ5A 2QUBA 1VI6A 4X60A 4YDRA 3RANA 3U0BA 1ZD3A 5KKCA 3F6SA 2KX7A 3JWHA 1ZMRA 2JIMA 4NJEA 1U2EA 1U9IC 1PI3A 3AINA 4US0R 3PNPA 5JD5A 1PK7A 1VECA 4WLOA 5EWLA 2XAAA 3I32A 4EG0A 3W79A 5DLEA 3TX6A 4DCNA 3V32A 2ZJ6A 2RKOA 1QQ6A 2PMEA 5FUQA 3MHTA 2WLSA 3R7FA 1ZM7A 3QELA 4MHSA 5LD2C 1UXOA 1V1MB 1AUPA 5DK6A 1E64A 3VU8A 1U7TA 3O4RA 4RDIA 3TRFA 3Q7EA 4LYJA 4EPXA 4LJ9A 1A5AB 3I28A 5L51A 3KQHA 1FFWA 3QFRA 4YMLA 2H0RA 4IJUA 3L02A 4JYPA 1IZYA 1J8MF 3NWBA 2ZB4A 2ZQ5A 3QNWA 5CFPA 2UVPA 4C7XA 4LOLA 3VTAA 3AX6A 4XGIA 3VUEA 4DG8A 3DVAB 4YBRA 1PWHA 2Z5LA 5KYXA 4FGSA 1WETA 1QZUA 1NN3A 2QL6A 2R3SA 4IFEA 5DASA 3S6JA 1ADJA 4FDAA 1YA6A 3RC8A 1XDUA 1YS7A 1QIDA 2ZIZA 5JC1A 4INZA 1FX0B 4UREA 1CUEA 1KNXA 2X9GA 2ZATA 3BC1A 3HN2A 3PNSA 1VHWA 1NYQA 1PZEA 4ZU6X 3RC1A 4RXUA 5DCLA 1E5XA 1KQGA 3E9MA 2I7VA 2BKEA 3T3IA 4QDTA 5KPJA 1HLPA 5BNWA 2RI6A 1ZC4A 1S8FA 1XZLA 1NBAA 2JFWA 2VSNA 1I7PA 3DZGA 4BVGA 2NSYA 2FF5A 2JI8A 1E2NA 5LU8A 1W2GA 1PBTA 5EJFA 1NW9B 1ENPA 3PHLA 3ZW8A 2VYCA 2FA9A 2QXYA 3E1SA 5CVVA 5FJJA 3TSAA 3VC2A 3E5NA 3Q5DA 2YC4C 2G4LA 3TSZA 2RIRA 3T54A 5B1YA 3C6ZA 2PA0A 3OC6A 1X39A 2XMQA 5KIAA 3QNMA 3FGZA 4DA7A 2PR2A 5CCXA 4MKHA 1HFEL 3E3AA 4Y30A 3OLXA 5H82A 2ZU0C 1BDHA 1J9ZA 3MOIA 4P22A 3VR4H 5LR6A 1RTTA 5ALFA 1WP9A 4GX5A 2WU1A 1ZINA 1E8MA 2PBRA 3GCXA 2CLCX 3PHIA 1TI7A 1U1IA 2JEZA 3Q10A 2IBSA 4YREA 3T7EA 1FFAA 4ENQA 2GTIA 1GUBA 2DWQA 4ETIA 4TMWA 5E9JA 2UXDB 1QGOA 4FHGA 5EJ8A 3HR7A 1Z2OX 4JLKA 1K89A 3QQPA 1C9JA 3FPCA 3V6MA 1NBOA 1V4BA 4O2RA 3D2BA 2O2XA 1E3JA 1Z36A 2FEAA 1ZJ6A 4DRXB 4JBYA 4DPMA 1P61B 2J5RA 2WR8A 4R1TA 1XPUA 3AI7A 3L01A 1FJHA 1TYDE 1DE0A 2WB2A 2I8CA 1HE3A 2G9UA 5JXHA 1GG8A 2CEKA 3HI4A 3OIDA 1PZGA 1VJRA 1R3UA 3CNHA 4B3HA 1YDMA 1GZ7A 1GGNA 3WBJA 1VL0A 2YOGA 1JFFB 1SPBS 4YBZA 4QUGA 4JI5B 3TIVA 1REQB 1QU2A 4G1CA 1E2PA 1WDKA 4D8XA 5EXSA 5IAEA 4Q82A 4BZWA 2BEKA 3LBNA 1A0OA 1WWKA 4YP7A 3HCCA 2YN2A 1ZRMA 5BORA 3Q9NA 5K3DA 4DJTA 1U1FA 3IOMA 1OT3A 2BKLA 2H18A 3ZLVA 4DLXA 5K0SA 2CLDX 3BZBA 5EIHA 5LB2A 5EY5B 1JWBB 4N7BA 4N7JA 2V7PA 2MCFA 1CUVA 4UPEA 2IEDA 4W9NC 1N8NA 1LBEA 1M2GA 1VRVA 2W0SA 4AN0A 3FYDA 3GCZA 2XMBA 4RZSA 5JNWA 3N2YA 3RFUA 3PL1A 4QJBA 3FVVA 2EFDB 5AUPB 3U5ZB 5IKOA 4GPIB 1U0FA 5KVAA 3QNUA 1YU6A 5CJPA 5ENZA 1P3Y1 4ASUD 1KI8A 2OXCA 5IP5A 4UU7A 5DTEA 4EFMA 4IZIA 4P7JA 1RXEA 4UTXA 1CJTC 1PZHA 2JFYA 3B3FA 4C43A 2PX3A 3UC9A 4E21A 3QX3A 2VKQA 4O2AB 2EOAA 5DNCA 5IFKA 1H1TA 4DAOA 1P2VA 1SCJA 3DKVA 4RHFA 3ZCTA 1RHRA 1TJ5A 1WMAA 2P5YA 4RVHA 5TPWA 4LYEA 5M29A 4L08A 1REQA 3F5FA 3FZYA 1SBHA 4F2HA 5IDWA 1UBOS 1NC3A 1IJFA 3A11A 4LCJA 4RVNA 4XW2A 5JFGA 4FFBB 4DMCA 2QK4A 3TSCA 5C8YF 4X1OA 1QB8A 2BKAA 1BXRB 3WGHA 3WICA 2IEIA 4DCVA 1JBEA 4F93B 4QNMA 1XP8A 2VDUE 2OXFA 3DGFC 2GTHA 1WABA 3RVSA 1H2WA 2FMUA 2Y0BA 3I9OA 4JN6B 2P6PA 1PQ4A 3DV0A 4IJVA 3D8HA 2X22A 1FSSA 4W1RA 4AO8A 2NPIA 1RE1A 3PEEA 2J7PD 2GJ4A 1UINA 4R3NA 3PEVA 2ZAYA 4L76A 3HY3A 3I01A 2PCLA 1ZAKA 2QF7A 3P5BA 1SU6A 3NM5A 1ZIYA 2E18A 3RC7A 4PYMA 3BCRA 1KFKB 3U7QB 1NV9A 1IB0A 1ZMXA 2BGNA 4ND8B 3A6DA 4DCMA 1N1DA 1CSEE 3G85A 3HI6A 1BGVA 1QYDA 3HRIA 4F4UA 1SVKA 1PTJA 2Q5JA 4R6XA 4YCDA 5EXDA 4GR9A 4RL6A 4HGNA 4AWXA 5ARCA 1D1QA 5JVDB 1FNBA 2ZIWB 3KYBA 4MV7A 3D3WB 2VP6A 1EFRD 4QUBA 4R8KA 3QUQA 4UHCA 4CTKA 3A6FA 3H86A 4ZOLF 5K0LA 3JSAA 2GHIA 5C7YA 3MELA 1G8AA 3E3LA 4M87A 5A9TA 1TCAA 1U0HC 2IEGA 1NXTA 2ZT6A 3PXAA 4JLDA 3RK0A 1XXHB 3WOHA 2ZXEA 1ZH8A 4GI3A 1JG1A 5LDHA 2HUPA 2PJDA 5AWFC 5B3KA 5FNVB 3STVA 4FS3A 4DLAA 5HQJA 2O3SA 2OKCA 4CZ2A 2H52A 4RF2A 2N46A 5EN4A 4CF7A 1HDEA 2BDUA 1PR1A 2RGBA 1L7DA 5KREA 3KQPA 3LFTA 3FH0A 4ALNA 1R4MB 4D02A 5AW9A 1Z4OA 3RF7A 2FUEA 2BMFA 5HCIA 2YXLA 4QYSA 3B85A 3QV2A 3D54D 1JA0A 2QTWB 2ZRMA 3TOSA 2W11A 4RHYA 1F2TA 1P0PA 1TA0A 3OP4A 3QPUA 1LPNA 1ZQ1A 2D5AA 2I3DA 3MT7A 2FR1A 3H1FA 3Q40A 5DPMA 1JV2B 5AI9A 5C1DA 3COSA 4EKIA 2J67A 4TS1A 1NM5A 4CG2A 5FPKA 5IF3A 2LCQA 2NU8B 3DNMA 3RAFC 2PQ6A 1B6GA 2CZGA 2LIVA 2HADA 1J8YF 1GDHA 1LH0A 5NULA 3ANLA 3J81A 4GYWA 4GOOD 1QTRA 5I5GA 4WZBA 2C7VA 3I2IA 4YTEA 2ISSD 3PHJA 2TECE 3VX3A 4WOJA 1ZDMA 3JQEA 3UUWA 5C8ZA 3R7SA 3L0OA 4NL4H 4RJTA 3ENZA 4UKDA 5BW6B 3PVSA 1XQ1A 4M0MA 4HNTA 5EMHA 3KK0A 4IDFA 4AF7A 1RZRA 4JJ6A 1TM5E 5JQGA 3DO6A 1CQWA 3MAJA 1M6HA 2PD4A 3UG6A 2VHEA 2ZAOA 2FKAA 3LKZA 3W0LB 3EIWA 5DWVA 1T9BA 2BSAA 2OHOA 5I7AA 1ZNWA 4UEJA 2Z5VA 5EIBD 5LQDA 1UKEA 3JQ8A 1JEQA 3F6YA 3IKJA 1VE6A 3QXGA 4YY3B 4CLRB 1E2HA 2OV3A 1LV7A 2K2QB 3GN1A 4RULA 3A3PA 3PNLA 3KOOA 4DEVA 4H31A 1B0UA 3R4VA 3QLUA 4XPZA 3DOIA 3V9PA 1TPZA 2IS6A 3SDZA 4QBGB 2I65A 3NQ41 1OLOA 3MUOA 5TRTA 1DG9A 3EVGA 2RBGA 2AC2A 2AKYA 3H8VA 3HYTA 1X77A 5K3FB 3RAGA 4DNPA 5HKOA 4LZNA 1W5TA 5KYXB 2OK7A 5LIPA 4J43A 5HUJA 3UBTA 4QOEA 3WTCA 1XTKA 2AG8A 1DQPA 1KPIA 1R16A 1C7ZA 1R4AA 2GF2A 2PEYA 5DI3A 1J99A 3VBCA 1PJ3A 1VL5A 2X4DA 3C0KA 3UZUA 4ARZB 1VPTA 3WIUA 1JKIA 4RANA 1HPLA 2EZ8A 3VOAA 4AYTA 2D5IA 1OXKB 1XRJA 3RU9A 2BF4A 2P2DA 2Z6QA 2QTAA 1K5HA 2AFIA 5GGYA 1KYWA 1ZN2A 2AQIA 4YGYA 1DEHA 3RT9A 3AUYA 4J9UE 1GNPA 5CR9A 2DJ5A 1C50A 2CHUA 3CRNA 5TPWB 1G59A 4ZOCA 1WLSA 1J90A 3LZ6A 2GXSA 3ZWNA 5LQJA 4DA0A 3VO1A 4ZHQB 3C5EA 3V3TA 1PP4A 4IUDS 1OI7A 1AV6A 4EECA 1NF8A 3A4VA 5JAHA 3RHSA 3KHTA 3IEUA 4IDAA 3QEOA 3KEFA 3WKDA 5AIAA 1EK6A 4LJ6A 5BYKA 2C7BA 4NS4A 1RZRD 3NOXA 4FWTA 1KC3A 3HP1A 1RSZA 1P29A 4OA5A 4I4TB 1F4LA 2GM3A 1VJ0A 3SSAA 4HYTA 4IXNA 4TYPA 3BE4A 4PNPA 4RL4A 3C3DA 4DV5B 2B20A 3D7RA 2VF8A 4CTOA 1AZWA 1B7GO 5DM2A 1HZZC 4IJ5A 4QDJA 2HLDA 5E2IA 5F2KA 3RG8A 4DMMA 1LZLA 4C3UA 2AMYA 1JHZA 4DQDA 1EVKA 2ZYUX 2EP7A 4DNQA 1A9QA 1DIHA 2C5EA 1CQXA 4LK2A 4EL0A 1A2BA 2DEUA 3H5RA 3MSCA 1IXRC 3LTEA 3R5XA 4LDPA 1HRKA 2Y67A 2A33A 1GGJA 4EP1A 1HO3A 2XUHA 1FK8A 3LSYA 1EQUA 1KKLA 2RAFA 3R09A 3AERA 1Z0FA 3KVNA 3KQKA 3FTQA 3SOZA 4OFWA 1U5AA 4I6EA 1NVEA 4D9EA 5BR8B 1M73E 2O14A 1SHLA 3R1IA 2MOKA 2RHCA 2CLFB 2QENA 1Y8RA 2G40A 4C4XA 5EGSA 1DJNA 3A3KA 2NU7A 4NCAA 1SUPA 5JJIA 3FFXA 1XE3A 1KY2A 1Y63A 4N5DA 1RJWA 3T1OA 4Q34A 2RHTA 2A9FA 2VTKA 4BL5A 2PUAA 1XLVA 4BIMA 2X40A 2P8SA 2NUTA 2HA0A 4RD4A 5J4LA 2FPPB 3V2IA 4K3VA 3WGTA 1X1CA 4N3GA 4PR3A 2JLZA 5FAXA 1E2DA 1MABA 4KR0A 4FFNA 3UVEA 3PCRB 4Q9IA 2VXCA 4XOIA 4KDRA 1HE1C 2GM9A 2J59A 2O2EA 4RKWA 5ALYA 4ER7A 4ENUA 4ENPA 5LJLA 4EO9A 3U26A 2BRUA 4LA4A 1DAFA 4M1MA 4WHMA 5IVIA 1VFNA 4R41A 2AD5A 3NFRA 4IUCS 3JQ7A 2OA0A 2CD7A 4FS8A 3F3YA 2NUPA 4IQGA 3PQEA 3W5UA 1HBJA 1O0SA 2IEBA 4MW5A 3E3OA 3HY6A 5DYGA 3ZGOA 5HJ7A 5KMGA 4GUDA 5AQ1A 1H3NA 4Z4IA 3OFSA 4YJDA 5DTMA 3E5RA 1UXIA 4CQMA 2R2GA 3QPBA 5HVNA 3ZR4B 2QMYA 3F4KA 2I2WA 4FLMA 3HHEA 3VOTA 4URYR 2CMFA 2EBHX 4XOUA 1VLHA 4JBHA 2K7FA 4BVEA 2A1UA 4GLJA 3OJXA 4RKYA 1L7OA 3QFFA 1LRKA 3L40A 4UULA 1ZD4A 1ZNXA 4RKQA 2VYFA 2GEDA 3O47A 3DVSX 1Z5ZA 5HCUA 2V1UA 1RI2A 2VBGA 1VJTA 2I7CA 5A7HA 1M0WA 5JQGF 4GXRA 5LBUA 3M89A 3MERA 4NICA 3L7IA 4XIGS 1LS6A 4B8WA 1GPKA 2YRXA 3TTXA 4LF4B 4RPGA 1YA4A 2XZOA 1V41E 1WXWA 5CB4B 1EVQA 3A9UA 1F6WA 4B46A 1IDN1 1O6BA 1BFUA 2QUKA 3DM9B 2OO7A 2ILVA 3ILYA 3RRYA 4Z4CA 2WYUA 4S1TA 1GU7A 2VZEA 4RZ2A 1DVRA 3FTPA 3WLKX 2VAVA 2W0MA 3WHLA 4YT2A 5GWXA 3IQWA 1LPPA 4R1SA 4OXNA 2JKVA 1R8QA 1RVV1 4DC9A 2ZUTA 1QVRA 1GZHB 1QRTA 2VS1A 3NH9A 4ZZ1A 1Z63A 3R5JA 2NW6A 3VPHA 1KMHA 4CIVA 4E1AA 2A4KA 3UTDA 1OBCA 4EB8A 4ZZ0A 1GZ6A 3L93A 2HDWA 4LGCA 4US1R 1EFUA 3MLAA 5F21A 5C3UA 4LRTB 4QWWA 3HJTA 2NV6A 4JP2A 1K8YB 2RGYA 4KQXA 3ZOZA 4CKWB 2GAAA 1RHUA 2EATA 2WWXA 3H2HA 3W6OA 1E7SA 1XV5A 3H2GA 1E9VA 1HYQA 2DFKB 2MDTA 3K0BA 1C80A 4CKBB 3Q2OA 3OCZA 3QOWA 3NOVA 2QN9A 3CUWA 4DLUA 5H3HA 2NXEA 3PBKA 4KGDA 4JK3A 2GAJA 4GWGA 1OFTA 2I3ZA 1L7PA 2SCUB 3V4RA 4RZ3A 3CKMA 1KAHA 1Z08A 1I14A 1Z17A 5DHSA 1WCXA 4LYDA 3GGGA 3THRA 1T2CA 3OZTA 1FCJA 1IIBA 4JX8A 2YASA 2NU9B 2B69A 3RE1A 2RHLA 3JQFA 5CPBA 1P1BA 4KN8A 4N6OA 1CIPA 1WW8A 2VK4A 4G07A 4OEHA 4U7PB 1V5IA 2OCIA 4ARZA 3O8RA 4DSUA 2CJWB 3DAHA 1X70A 4MPPA 1D4OA 2P9FA 2NO7A 4H7FA 4G0VA 1UOPA 1Z5OA 3RV3A 2DHDA 4BFTA 4D9FA 1O87A 4KXLA 2DOKA 1NJGA 3BXFA 1W2WB 2AZMA 2OCPA 2R62A 5KYGA 4A6DA 4MR7A 1M66A 1FP2A 3BFKA 4AYXA 5JQWA 2XA1A 2WUDA 3IIKA 4Q3OA 3T35A 1GT91 3ORQA 1IN8A 1XL0A 1KZHA 2I0FA 4COKA 2I1VB 4J16C 2QRHA 3EFOA 2CNNA 4NSNA 1RYMA 2QX9A 4K0KB 3BYZA 4DBLC 2JLCA 2E48A 4UFOA 2C82A 1RRPA 5BMVB 1K7FB 5J4KA 1J5EB 3L0SA 1FW6A 4RTQA 3C3BA 4BO4A 5KTKA 2D3TA 3BE5A 2E5FA 2QROA 5C8YA 2QYHA 3O1HB 1RYNA 1T0JB 3H9JA 3IHLA 4TOIA 1BWRA 1I01A 3DP9A 4BPBA 2SKCA 2D54A 1C8BA 1HL7A 3O1LA 4UUOA 5I4KA 3GRUA 2F90A 5BYJA 3VDNB 3Q88A 4M4SA 4OHBA 4F4CA 1Z83A 2Y2UA 4N7RA 5DGCA 3QX7A 4HZIA 3M4YA 1H2HA 2FZWA 1LX7A 2JAUA 4CBVA 1N7IA 4W5QA 4L5BA 1U2TA 2WT9A 1RM3A 2L18A 2WM3A 3GRFA 4KRXA 3HUEA 4J4HA 4R1MA 3W1VA 2XEXA 3T7SA 4ZZIA 3D3KA 1PX0A 3PDJA 1QHSA 4FOOA 4CMBA 4R84A 4L9SA 1FXUA 2C61A 2W00A 1O5TA 4PLWA 4LWZA 5E1BA 5B3JC 1L5YA 5LUAA 4BNYA 1P0CA 1AKEA 1L4HA 4RKEA 3RADC 5AYVA 3ME5A 3IULA 5EP3A 2ZK7A 2FF7A 1GR0A 4DM3A 1FTSA 4EPTA 4AN1A 4BVHA 2ZUFA 2QMEA 2VFAA 2P65A 4UBJA 4NU0A 1MHTA 1HSZA 3A4LA 4WERA 2NXCA 2B34A 2W6NA 4AUEA 2C31A 3K0CA 5AP9A 1MQAA 1PS0A 2WA2A 1TW3A 1BA3A 4NTZA 3AHCA 3WXMA 4B35A 1ENYA 4HDQB 1K3FA 1FW8A 1PT6A 2ZOSA 1R64A 3DV0B 1XRSB 1DBRA 1ZY2A 3DD1A 3PQ4A 4LQLA 4Q7KA 1CKEA 1G63A 3DTNA 4BBJA 2IELA 3MRTA 1JEQB 4PC7A 1TT5A 4RFSB 4U7HA 4BO1A 1ZH6A 2QX6A 2D2IA 2VDPB 3SQWA 1AUOA 4KQFA 1SULA 2NYRA 3RUAA 3TI9A 1UKAA 2JFQA 2O3QA 2Q7DA 5CNMA 3QUAA 2XWQA 3GEIA 1A7JA 5KJFA 3FCYA 4MV5A 3VO9A 3SIPA 4TUYA 5CA0F 3N3BC 3DE2X 2X9VA 1E79D 1KMCA 3BT7A 1CPYA 2GRUA 3F49S 1XCLA 3D4LA 1S2NA 2I66A 3COPA 2PS1A 4DKXA 3OMXA 4DIUA 2AQKA 4Q15A 2G0AA 4RA6A 3BS4A 1XO1A 4QXOA 1Q50A 1EAMA 1I0ZA 3WB9A 4TLLB 3G2JA 3IOBA 4DDVA 1GG2A 2CXNA 4NFYA 3RR2A 5LLDA 3T06B 1LNSA 2OV2A 1J1IA 2FSVA 5DEOA 5TQ2B 4B32A 4C4SA 3JVVA 1VG0B 5L9AA 2CMGA 5AM4A 5ERYA 5FWXA 5FHRA 3LXUX 5LMUB 1VDZA 1Y6FA 4KXMA 1JZSA 5C8XA 4D5EA 3N59A 2PL5A 2VL7A 4H6WA 4QARA 1R0BA 3RYIB 4UDYX 1N9ZA 3OOEA 1OLXB 2XNDA 5C5DA 2IX9A 5EXPA 3IP1A 1KXZA 2DKNA 2GN8A 3W3AH 1X6VA 3G2NA 2BGTA 5D2CA 5I4BA 4H1UA 4UZEA 3VR3A 2ATIA 1WEKA 3K2QA 5CT6A 3G8DA 1DRKA 2Z5FA 3D59A 4PR0A 5KYUA 3IEIA 3W1WA 4J8PA 3B3AA 1P5JA 1AGRA 1FS4A 4BX0A 1Y89A 3NM4A 4EGJA 1NI4A 4KFTA 4RHUA 5WRFA 3V46A 5A5EA 3QYJA 3P9ZA 3HBFA 5A02A 4OAPA 1WPGA 3AM3A 3R3HA 1GTMA 1EX9A 1XU7A 1ZS9A 1MDFA 1SPXA 1BCRB 1F48A 2JAOA 2WFLA 5CLLA 4IVRA 1T6NA 4RVOA 3ZHRA 2PMWB 4HRYA 5H4HA 4DR5B 3ZNPA 2Y9MB 3ZH9B 4DJJA 3TW4A 2V0CA 4WZAE 3EAFA 2I29A 1M2FA 2WSMA 3BD9A 5B12A 1R0LA 4BB5A 1H4VB 1OJ7A 2PX2A 3PFNA 4DDKA 1HEUA 3HUUA 4HDOB 1Z2AA 5C32A 5IASA 3TG8A 3C3AA 4X20B 5HOQA 1E94E 4GD3Q 2ZRCA 1VE3A 2QL7A 3LBAA 4R1PA 4LK3A 1KAMA 3HCPA 2XGMA 2FZGA 3EJ6A 3LA8A 3QA9A 1U7HA 1XJQA 2QNRA 4YP9A 1GRRA 1J0BA 4DA9A 1SK9A 3L8EA 3UQYS 5C2JB 4NOJA 1N8KA 4WUVA 3ZE2B 1M0SA 4CL0A 4HQLA 2QAIA 5JAZA 2RJNA 4KDEA 4O0LA 1DXHA 4JKIA 3EIFA 1BS1A 1GYRA 3N9IA 3V4OA 4DCOA 2VHXA 2JLQA 3C74A 3KYJB 2GNOA 4QT4A 2JGIA 1ODKA 3HR8A 4BAZA 1A04A 1J0CA 2DTXA 2R11A 2GFIA 5A0TA 2BHSA 2R1TB 3I5AA 1N25A 3I53A 1PS9A 3K0HA 3OSZA 4MPTA 3TQFA 1MHPA 2R97A 3I8OA 5BSKA 5CK5A 1XPJA 3CEHA 4TQ9A 1JR2A 5EI5A 1CNFA 3KVVA 3D4IA 3W8FA 5JEEA 1JKMA 2AJCA 5A3QA 4OUKX 4EW2A 3PQDA 4WKOA 4HDRB 3S40A 1J1UA 1ESEA 3VZRA 1KQ3A 5KVSA 3R3XA 2ZUDA 5BT8A 4LNHA 3K0AB 2JA2A 3OQHA 4RSHA 3BWXA 2Q5HA 3QX8A 4GMGA 5FIUA 4HBGA 4P8RA 1EJBA 5CFZA 2HHAA 1E7RA 1BHQ1 4JGGA 4N65A 4G5FA 3AIMA 4CM3A 3KQNA 1GGHA 2BV3A 1N6OA 2ORYA 1X1TA 1T9CA 3HJCA 1HTWA 4TYYA 4YJ3B 3K4HA 3OZGA 5A1JA 2CE2X 1M34A 5H16A 1UZAA 1CR0A 4MZDA 3ZNNA 1ZH4A 4FDTA 4LZAA 3EZXA 1GNRA 4QLOA 3V4PB 1MOPA 4WFKA 5KC8A 7AT1A 2JBAB 4REQA 4G01B 1YD7A 3ZXUB 3PFGA 3UFXB 1QKIA 4L5YA 5FI1B 5KTMA 1EVLA 2X1HA 3HZOA 3OG9A 3ZY4A 2CLLB 2Q1WA 4OI4A 1Z34A 5ER9A 4GPTA 1U8ZA 5BRAA 4AF8A 4OQEA 5JWHA 3VJMA 1V96A 1CHDA 5LQRA 1MABB 2Y1WA 3O92A 1AB6A 4E3WA 4TKVA 1EZZA 3RFXA 2WQ7A 4RPJA 2V4ZA 1JHUA 2FWRA 1CFZA 1UBKS 1T8PA 3LDUA 3BSSA 1JFLA 2QJTA 4E03A 4IWNA 3L6OO 4MA4A 4NIMA 3QIAA 1MF7A 2ISCA 1FSGA 3ZHUA 2YN4A 1KYYA 1Y1QA 3EFEA 3GBPA 3VSEA 1CETA 1PT8A 2A1UB 2I6TA 2PKYX 2ZBVA 1W30A 2LNDA 1A98A 3GVPA 3PENA 4GR4