3GJ0A

Crystal structure of human rangdp
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
207
structure length
207
Chain Sequence
SAAQGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and Biochemical Analysis of the Ran-binding Zinc Finger Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
total genus 67
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gj0A00
4IDOA 1FQKA 1TF5A 5JWOA 3BFXA 2O5VA 2PT5A 2FZ4A 2N1BA 4DDTA 3BS4A 1Z6TA 2EU8A 1PUJA 3BIFA 2IYQA 5EE0A 1XEXA 2DWQA 3AGQA 5CIQA 5BQ5A 1X86B 3CX7A 3E5HA 4MUAA 5KNDA 3BE4A 4K81B 1UBEA 1E2FA 1JXMA 2WWYA 4TTPA 2CL7X 1P9RA 2P2LA 2V8OA 1NF3A 3AF2A 3B1XA 5JS8A 4JLJA 3LY5A 2QP9X 2YKGA 2R9VA 3C16C 2XXAA 1XXHE 5JZVA 5C4GB 3DEFA 1E2LA 2ZU0C 3BGWA 1IJEA 3DOEA 2RHMA 4EJSC 2VF7A 3GLFB 5TMPA 3THOA 1KZ7B 4RZXA 3AP3A 1IJFA 2BM0A 5KPJA 2JLYA 4JVLA 2HDNB 1U8AA 2FSGA 5D3MA 1RRCA 4L8GA 3CRW1 1GM5A 5K8TA 1Z08A 4HAXA 1JAIA 2DHRA 4D4KA 1SHZA 4MRVA 5BN3A 4F93B 1Z6XA 2P6NA 3MWKA 1Z07A 2FSIA 3M4YA 1GVNB 4A8JC 4OHYA 1DADA 3MWYW 1GL7A 1OFUX 4Q1CA 4HB3A 1VDZA 2AXPA 1KSGA 3OHMA 4A8JB 2ANCA 1VKJA 3BD9A 4LYAA 5FI0B 4KSCA 5AUOB 2V7QD 4ZCIA 3TW8B 3M1IA 2YZ2A 1NI3A 1AIPA 2Q0HA 4BLQA 3KTAA 2VLIA 2VRWA 1T5IA 4MRPA 3W6NA 2J0SA 1T4GA 3LO5A 2WHXA 4M1OA 1RRGA 4V0KA 1VHTA 2JA1A 3ZZ0A 2GJ9A 5K8IA 3K9GA 1F2UB 1N6PA 3EIHA 1RIFA 5AWFC 4B2LA 3MLEA 1E1RA 2CLDX 4ARZB 4MKFA 4E22A 2O0KA 3LWNA 4TYYA 4LV6A 4PXAA 2O0JA 4BZQA 4EFNA 4RKEA 3SQWA 4MYCA 4A92A 2G1JA 2WBLC 3FKSD 1Q0UA 2PT7A 3QIAA 1NLFA 4XWKA 2JLVA 5JCPA 2KB0A 2VP4A 2GF9A 4D4JA 1N6RA 4V0NA 1W48A 2ZEJA 3T34A 5E3HA 4OYHA 1X8KA 3PEWA 4M1SA 4IXMA 1MO4A 2AKYA 3L0SA 2EWVA 2BIFA 3ECCA 4UNSA 4URUR 1II8A 5LBIA 3FGNA 4DSNA 4PSVA 2WKRA 3B9QA 1N6HA 4J0QA 5EP1A 3ZGXA 5J40A 2F3TA 2GILA 3ZLJA 2D62A 4DCTA 2QBYA 3PUXA 1AZTA 2GXUA 2WJYA 3D6TB 1WRBA 1LF0A 1E9BA 2WPDA 3M6AA 3QEJA 4BZPA 1RW4A 1SZPA 1F2TB 2KBEA 1OH8A 4BE7B 1OW3B 4RZ3A 5KPDA 2PZFA 1DO0A 4C0SA 1DAKA 1XB2A 2NO7A 4PC7A 2C98A 2RGXA 4B76A 4PX9A 2A78A 2FV8A 5J5CA 5KNCA 3GLHE 1I4DD 4RD3A 1PUIA 2F1IA 2GCPA 4TWZA 2XJ4A 3SR0A 1ZBDA 3GMTA 1BOFA 1NNEA 2JJ1D 3F3YA 1E2QA 3ZJYA 4X8MA 5GJVC 2ORWA 4A0GA 1U99A 1D8TA 4Q4HB 4EPWA 2YWFA 4Q19A 4TT3A 1II0A 4PC3A 4DHEA 3LXRA 3QVVA 4GT1A 4PO8A 2DWOA 4ITRC 3CR7A 4TMWA 4XWAA 1TQ6A 4XWOA 4A4DA 4DLVA 3UPUA 4B32A 1JQLB 2WOJA 1KDRA 1YZUA 2F9LA 1VCIA 3THXB 3AVVA 4Q00A 2YYZA 4Q02A 2IYSA 1QHNA 3C14C 3FHCB 3KJIA 3QENA 4LRWA 4P4UA 4RVCA 4LHVA 3FMPB 2WSMA 3SBDA 4JLDA 1Z47A 2CMKA 3L0OA 4PPGA 1G6OA 2ANBA 2F43B 4QHTA 2HCBA 1QG4A 3MFYA 1A1VA 4FMBB 1KDPA 3CZQA 2Q3HA 1Q20A 4JLKA 4KFRA 4ZI2A 1A82A 2FMXA 2GCNA 1P60A 2WWWA 4LDJA 4F4IA 4FCWA 4HLDA 1S3GA 1RPZA 3GFOA 5CITA 3BB3A 3REFA 4M0LA 3VR1A 1S1MA 1KHTA 1CS4C 2JASA 3T1OA 2C96A 2J5XA 3AV0B 3K09C 5H70A 5JWRA 2AD1A 2BCJQ 2D2EA 1KI4A 1E2KA 2QENA 1Z2AA 2VSXA 3IBGA 4M2LA 4P4SA 4LBVA 1UADA 1P9WA 1ZU5A 4P4SB 4LCBA 3U2QA 3UMRA 3VU9B 2ATVA 2GK6A 3THYB 2ZUCA 3MCAA 1Z0KA 1IQPA 4M4SA 2ZJAA 3UG7A 2GEUA 1E79A 2CLSA 3R8CA 3EPJA 4Q1DA 4IEIA 5GADl 3HU2A 4OI0A 3HWSA 2A5JA 1NRJB 3ZQ6A 3OIYA 4Q4JA 2FG5A 3Q9LA 4LWZA 3LW8A 221PA 4XOIA 4HZIA 3QXXA 3VHLB 1XD2A 1UPTA 4IOMA 5FTKA 3P4YA 2ZPTX 5TB5A 2G0NA 3H4MA 5JWHA 1N0UA 4TQUS 4JLNA 1ZM4A 4GZLA 3FMOB 4WXPA 1BYUA 1EWRA 1OT3A 4RFSB 3WHLA 1D2MA 4PSAA 3CPEA 4LJ8A 4Q4AA 4IOKA 1FP6A 4EFLA 4PSKA 2O8FB 4YDSA 5FR2A 3W6PA 1M74A 1VECA 1YVDA 2ZSAA 1KNQA 1M8PA 3QBTA 1EFCA 5P21A 3TQCA 1XMJA 2JLQA 3FWYA 1CRPA 2WWFA 1YR7A 1HTWA 4IXNA 3W6OA 1Z29A 2OUKA 1E0JA 4AYWA 4ZDKA 2BJWA 2W2XA 5DHFA 5BN4A 3ZD6A 4YMSA 3ZH9B 3AF4A 2JDIA 1GG2A 1XJQA 3FKQA 3AP1A 3O47A 1W2HA 3EW9A 1W2GA 1P6XA 5ANRB 5HPYB 2LKCA 3MUFA 3FPAA 3NH9A 2BBWA 4DLSA 3CKLA 3LNCA 1VG9B 2GESA 4URWR 3KKPA 3U3OA 4RFSA 4JVSB 1XDBA 1YKSA 2OCBA 2BC9A 3FTQA 5DI3B 2JJ2D 3R7WB 3WMGA 1AA9A 3MJRA 4KFSA 4PQRA 4C0HA 5FPHA 2F1RA 2ZRAA 5FR1A 3QUSA 4OI4A 4JYCA 4DLXA 3GFTA 4JIMA 4NPHA 3DOFA 3UANA 2IS1A 4PAMA 1J8MF 1ZUHA 2GA8A 1GILA 4G5QA 3U3MA 4NP6A 3FMIA 2A2ZA 1PLLA 1DBSA 2L0XA 2XEXA 3JVUA 1AGRA 1IN7A 5L3VA 1E6CA 1TADA 3LD9A 3NBZC 4LJ5A 1OFTA 1UBCA 4Q4LA 4KCGA 5CM8B 2JAQA 2OLKA 4BFTA 1Q1BA 5IK2D 4X8HA 2VP6A 4DIDA 1TAGA 1JXOA 2PZGA 4B43A 3X1XA 4C0LA 1E9CA 1XFAA 2BMJA 2KSQA 2F1HA 3NG1A 5JI3E 3Q8XB 4BQSA 4JVMA 1WF3A 1QHXA 3GLIA 4MGZR 1W36C 2MSEB 2CJWA 2IA5A 2CHGA 1XMSA 3JZMA 1ZD8A 3NTUA 2QM8A 4NBSA 4QC2A 5AJVB 4Z8XA 3I61A 4ZKEA 4KLZA 3GLGE 1ZW6A 4C2TA 1LS6A 3KKNA 3ETLA 4RSGA 4DSTA 2C95A 3HU3A 4BGDA 2ZRGA 1H8HD 3FDIA 1ZNZA 4B44A 1IN8A 4G01B 2OAQ1 3I92A 1OKKD 3CBQA 3EIQA 2BDTA 2PEYA 3F5FA 2ZE6A 2ZTSA 4CF7A 4X8OA 4G5OA 5M04A 4DJTA 3MAAC 3DPUA 4MKGA 5A0FA 3K0FB 5EXPA 2X2EA 4MRRA 1L8QA 3Q3JB 4AWXA 3SN6A 2J9RA 4PAOA 2QSYA 5JSZB 2C9OA 4U5XA 2JLWA 3P32A 1P61B 3ND8A 2QZ4A 3QXCA 1GNQA 3KKMA 1EXMA 1WCV1 1ZD9A 1FOEB 1O3YA 4GPTA 3V9PA 1UFQA 4OHZA 2R44A 2VP5A 4DXAA 2CLCX 1VYTA 3VU9A 4IFBA 4BRUA 2FA9A 3BH6A 4US2R 2WPDD 5J4HA 3TR5A 4ASUA 2GZDA 2WM9B 4JBXA 2NZJA 1E98A 4P32A 4CT4B 4HAWA 3FE2A 4U00A 4P31A 3QF4B 2NG1A 3UWKA 5AUNB 2PJRA 1GZSA 3QXSA 4YXWD 4ZIRA 1NVUQ 3I73A 4JT2A 4D6PA 5DE3A 3K70D 4WZAE 1M2OB 5LD2B 5TARA 2R65A 1SVOA 3GJ7A 2EFEB 1DE0A 2ZJYA 2O8CA 3PG5A 4OI2A 1HQYE 4FN5A 4LYJA 3KJHA 1R4AA 2ZI7A 1RZ3A 1IN6A 4ZV4A 4K8OA 4F4JA 5AJYA 3LXXA 3I8SA 2YINC 1Z6GA 1JEEA 1W0JA 2XNSA 2ZROA 4I1UA 3AF1A 4XD7A 3CM0A 2PLRA 3AVOA 3SNHA 1W4CA 2WMNB 4GMXA 2ONKA 4CEHA 4BEBA 4C0JA 4UNPA 3U3JA 2EFCB 2WWXA 3U44A 4Z51A 4V03A 2AL7A 4D25A 2IBMA 4UXIA 5J4LA 3MRSA 3PEVA 4CYMA 2ZRFA 5FL3A 2VSFA 1LS1A 5TDHA 2W00A 2CXXA 4DCNA 4TYNA 2DBYA 4UKDA 3RABA 3KFXA 4P3YA 4ARZA 4TTQA 1B0UA 3DM9B 3UKDA 2QGZA 1JPNA 2GK7A 3L43A 1U8ZA 4Y0VA 2NO6A 3PUWA 2RB4A 4TLEA 1W0KD 1U9IC 3CF0A 4OQMA 2GNOA 1EFRA 4D4MA 3AVPA 1EWQA 2J7KA 1TQ2A 1UEIA 5EP4A 2C77A 4LYHA 2XTNA 1G8GA 2IYRA 5G53C 3UWOA 5HZHA 2IW3A 1EESA 4JLOA 2EYQA 2DYKA 3C5CA 2J0VA 1XTSA 3WRYC 3N2EA 4ILEA 2OLJA 5FBVB 1FX0A 1M6NA 2F6RA 1VIYA 4M1TA 1E99A 1KJWA 1PV4A 4ESHA 4EQ6B 4Q7KA 4XSHA 3RC3A 3BBPA 3DO6A 5EQTA 3I5YA 2I4IA 1G8PA 3AF3A 4G5SA 2DR3A 2W83A 3F0TA 2P5TB 2QMHA 3A1TA 3NEJA 1IXRC 5FI1B 1WDTA 1YZTA 1VHLA 1A2KC 1T3HA 1S9DA 4LJ4A 4NYIR 3KL4A 1OLOA 1SXJB 4Z1MD 1AK2A 3MSXA 2HF8A 3K0CC 5FPYA 4HAVA 3QEOA 2G9NA 1COWA 2HJGA 2OFWA 1BS1A 3AKCA 3T61A 4L16A 4JS0A 3U7EB 1EGAA 4HUQB 4HLUA 1I2MA 2JLZA 3S1AA 1PLJA 5F9HA 3LBNA 2P65A 4IDQA 2OBNA 5BW8A 1DTSA 1WBDA 4JYBA 3RS2A 5IT5A 4OK6A 4FIDA 1NLYA 1ZUIA 2E87A 1OE0A 1J90A 1T5LA 2GWHA 3KFVA 4KFUA 3WMEA 5IK2A 3T1QA 3RWMB 1HE1C 4XVQA 3ZQJA 5AJZA 1GSIA 5JRJA 4M1KA 4GOXA 1JEDA 2ZRNA 4QL3A 2W58A 2QI9C 3LX8A 2Z0MA 1TU3A 1DELA 3T06B 2GXAA 1FW6A 3B60A 3KUCA 4BFSA 4GNKA 4KLNA 2XZOA 3T5GA 1N6NA 1NBMA 2BV3A 2DCUA 2PX3A 2WOOA 4S35A 5CK4A 4ZDWA 4A2QA 5J4KA 2EFHB 1ANKA 4QGGA 3TUZC 3VTKA 1E9RA 3P1JA 1KO1A 1G1MA 3K0EA 4I4LA 3UMSA 1XTJA 1QVRA 2FWRA 3SJAA 2FN4A 2ZS7A 3NC1C 4P4TA 4EPXA 2O8FA 1GRRA 3NVAA 5EZ5A 2YWEA 1KJYA 3CRVA 3LFUA 3R9WA 2P5SA 2O52A 3T12A 1N5JA 1D2EA 1R0WA 3KB2A 1S8FA 2O0HA 1UDWA 4Z8YA 3DMNA 1YZQA 1GKYA 2ZR7A 2VHJA 3R7WA 2CNWA 2I3BA 3IIKA 3EAQA 1XMIA 2Q3MA 3GJXC 2VHUA 3ZVLA 1UKYA 4Q4JB 4HZUB 1KI2A 2IXEA 4QJ5A 4EDHA 1P62B 4D81A 2WVJA 2YOHA 3RYTC 3ZS8A 4DCSA 721PA 1IOZA 2NQ2C 1VG1A 4EUNA 3B85A 1KK0A 2XJ9A 1AKYA 4AKIA 2QQ0A 1OXSC 2F7SA 3OESA 3H0KA 3HYRA 5G41A 4YQFA 1T6NA 4US0R 1E9FA 1JI0A 2CNWD 3IQXA 1VCOA 1BMFA 1CBUA 5FUWA 4NYJQ 1G3QA 2J3EA 3PUVA 4DEXA 1QHHB 1AM4D 3ADCA 4GDFA 5FPKA 1LNZA 5EE1A 1LY1A 2ZRBA 1G21E 2GEVA 2OSBA 3SHFA 1KSHA 4QKQA 2ZXUA 3KJGA 2ORIA 2P67A 4DIEA 4HDCA 1CJTC 4OK5A 3QKSB 1N3BA 4IVQA 5DLQC 3SS8A 3TE6A 4O0MA 1IY2A 2NZ8A 2OXRA 3E70C 3OIUA 4IVRA 3K0SA 1YQTA 2QPOA 2ZSEA 3RHFA 3PEYA 1G7CA 4C0KA 3W5IA 4IDNA 3ZDQA 4XVRA 2ZRDA 2BHRA 4GFDA 4LX0A 1KI7A 4QBIA 2OT3B 4PANA 1SKYB 5FTNA 5KO2A 1K8RA 5EE5B 5SZKB 1XCGB 4ZPXA 2JJ1A 5GVRA 1XZPA 3VX4A 4CDGA 5FOUA 4MDFA 4Z1MA 2GZAA 5DIFA 2ZE5A 2YVUA 1LV7A 4FMDB 4RZ2A 1WQ1R 2IL1A 3QKUA 4MUBA 1YRBA 3TUIC 4AG6A 621PA 1XPOA 1ZM2A 2KBFA 3L8ZA 4B2PA 2MSCB 3BH7A 1ZIOA 2Z4RA 3ZZUA 2QL6A 1NVWQ 1CJVC 1KZGB 3I1FA 4B71A 2YJTD 3IPYA 2BBTA 4D2IA 1FTNA 1JALA 5A4JA 3LRPA 1U90A 4W9MC 4UJ5A 1P5ZB 2ZRPA 2FOLA 4NYMQ 3L0PA 2G83A 3CNLA 5JHHB 4PZLA 5LB4A 1NP6A 3U60B 4HSEA 1P2UA 2IYUA 2ZSBA 2P6UA 1V5WA 1XX6A 4B47A 2V9PA 2PJZA 5GJBA 1DAGA 3WMFA 3AQ4A 3IHWA 3VHXA 3DZDA 4MQBA 5FBLB 4POAA 2W6JA 4HLQB 2XB2A 2PMKA 3IGFA 4NHOA 4TYPA 3REGA 4V0MA 5FOXA 1XCPA 3KKQA 2MMGA 5AJWA 3D3QA 2F43A 1IN5A 1UBFA 2EQBA 2VSOA 3AP2A 3S1AB 2IUSA 2DB3A 1UBGA 5H1YA 4MA4A 1E96A 3O8BA 3TSOA 4A6XA 5KSOA 3THWB 3WNCA 4JLPA 3CWQA 3M0EA 1ONBA 4CEJB 4US1R 3K70B 1EFRD 1Z2CA 2TMKA 3EG5A 3V4FA 4D4LA 1JB1A 4BLTA 1E9AA 1LTQA 5FUXA 2OXCA 2RGBA 4ZO4A 4Q7MB 4Q48A 4Q9JA 4KU4A 1KYIA 2WSSD 2BEJA 2CCJA 2ZU6A 3NKVA 4PZZA 3VX3A 2GXSA 1QG2A 2FPLA 3IEVA 1YHNA 1ZU4A 5CB6A 3LLMA 2EW1A 3RSLA 2V4ZA 3KB1A 4CEHB 4M53A 1KJZA 4YC7A 4AKEA 4JLAA 4URXR 5F3WB 2Z5FA 1ESNA 3DKPA 1J99A 1YR9A 3K1JA 4F92B 2AXNA 4OK3A 1ZRHA 2ODBA 1T3LA 2W0SA 4M9ZA 1R8QA 2YOFA 3FHOA 5FBQB 2A9KA 1LVGA 1QHIA 4TMTA 3PV0A 2VA8A 1KKMA 2ZRHA 2GETA 2XOKA 4YXWA 1XRJA 4YMUA 1NSTA 4LUCA 3LVRE 1AJEA 1S9HA 3FFAA 3NIBA 4L15A 4DLZA 2ZI3A 1YZGA 2DFTA 2IHBA 3P20A 2FGJA 4BFYA 4DCVA 1P2VA 4TLAA 3ZZTA 1FNNA 3X1ZA 2BKEA 2PL3A 1E2DA 3A1VA 2HF9A 3BAFA 3C15C 2C9YA 4QRHA 4B2IA 2FFHA 2C99A 1XNJA 2NTYC 1E9DA 2A5GA 2RGGA 3QBVA 2VBCA 3SJZA 3FFBA 4HLUC 3SYNA 3VAAA 4DSOA 5FTMA 4M9SA 4AURA 1JR3E 1W49A 1TL7C 5FBWB 2VPPA 4W5WA 5AR1A 3EZFA 4Q1FA 4AYTA 2BM1A 5HCIA 4BFZA 4ZI3A 8OHMA 1WE2A 3R8FA 1F2UA 1Z3IX 3QNUA 2IEYA 1NG1A 1VTKA 3VNUA 1J8YF 1W5TA 2NO9A 4JL8A 4Q9LA 4BFXA 3E2IA 3EC2A 4NCNA 4C7OA 3A37A 3RS3A 3QXJA 1ZNXA 3ADBA 2WTUA 3TKLA 4KSBA 3WHKA 3TQFA 4B35A 4K46A 5FOTA 2RMKA 1FMJA 4L9WA 4CIDA 2ZIAA 2ZM5A 2GKSA 5K8UA 3Q72A 3BORA 3GQBA 4BPBA 4BFVA 2REXB 3W3ZB 5CB8A 2E1RA 3X1YA 2OFXA 4PC6A 4C3ZA 1RC8A 1IAQA 2WZQA 4RD0A 3EX7C 2BMEA 4LV8B 5CM9C 2WIAA 2CCGA 3OEHA 2FFBA 4HYYA 4LBWA 3QPVA 4MYUA 4GP7A 3B5JA 3TVTA 4BLOA 1DEKA 3RS7A 5LD2C 2DWPA 3DHWC 2IWRA 3DL0A 1EK0A 3TRFA 5C4MA 3HDTA 4ERNA 3K9NA 3KQHA 2E9SA 5AUQA 2QA5A 4M1WA 2BCGY 1NIPA 4GOJA 1F48A 1HT2E 1BYIA 2V3CC 2R62A 1GP2A 4TYQA 4Q9IA 2BOVA 4QM7A 4B6FA 1E1QA 1HY3A 3D8BA 1YRAA 5DO9A 3CR8A 3MWLA 3CX8A 2H5EA 2FFAA 4B33A 3MG9A 3V4RA 5CDFE 5EP3A 5JMTA 1E2MA 3WYGA 1H65A 1OKKA 1A4RA 1JNYA 1XTQA 2ZUDA 1OH5A 5KSPA 2RGCA 2FEMA 4BEJA 3EZ7A 2QT0A 3K0AB 4B3XA 2CL6X 4FD2A 5KHOC 4LC0A 1G16A 1AS0A 3GEEA 3P27A 1KNXA 1QF9A 3QPWA 5G3YA 4KFTA 4LHXA 1C9KA 4AY2A 3BFVA 4TSFD 1N6LA 4HZUA 4LBYA 3WYFA 2PLFA 4PTLA 2HUPA 1OFHA 1OXVA 4LI0A 3U3RA 2HLDA 5B64A 4LY6A 1SVLA 1SVIA 2V54A 1HEIA 1ODFA 1S2MA 2GBLA 3BB1A 3BWDD 2OZEA 1ZCAA 3Q5DA 1W4AA 2B21A 2O8DA 1Z6AA 3G5UA 5KDDA 5B2ZA 3NDBB 1U0JA 1EX7A 1W0KA 2IWHA 4XIGS 2D74A 2WJJA 1QVAA 4B75A 4H1VA 2ZJOA 1K5GA 3LVQE 4GP6A 1Q3HA 4BFUA 4LJ6A 4YDHB 4MDEA 1Z22A 3K70C 2CHQA 1KK1A 3B1WA 3ICEA 1N5IA 3PQCA 2ASEA 3SJBA 2I1QA 2JLXA 5FFMA 2ECKA 2WV9A 3X2SA 4EPVA 4EJSA 1E1RD 1US8A 3OEED 3A58B 3QKRB 3TMKA 4QNMA 2YC2C 3HU1A 4TL6A 4RD2A 4P0TA 1L2TA 3W8NA 2C03A 4DT1A 4DC9A 3LH5A 2ODEA 3QY0A 3X1WA 1C4OA 2DFNA 3MGCA 2AN9A 4I1OA 2Q6TA 3DKVA 5C46F 1U8YA 5CK5A 5DH9A 2WAYA 4KAXA 4JZKA 5EUQB 2WJIA 4NH0A 2XGJA 2N42A 2BMFA 1M7BA 2QPTA 2ZYUX 1CXZA 1P73A 2J59A 5SZHB 4ZIRB 1KSFX 4KV9A 2JEOA 4A9AA 3BFKA 2ZI6A 2CL0X 5K8LA 3KZ1E 1HA3A 2QMUA 4KHZA 2NGRA 1CR4A 2AWOA 2CDNA 2QSZA 4ZDIA 5KU1A 3TK1A 3LV8A 2ZANA 2IYVA 1DARA 3GLHB 3GLHA 5KSZA 1SXJC 2G6BA 4PHHA 3CPJB 1TEXA 4KBGA 1JJVA 1WXQA 2ORVA 3NDPA 1RVDA 4IDHA 4RY2A 2J1LA 3JVVA 2PBRA 5JECA 1XF9A 1F3OA 4LC1A 4Q18A 2NMVA 3UATA 3PEUA 2XTZA 821PA 1N5LA 2O8EA 1CF4A 4DDWA 4F91B 4U7DA 3DMDA 3UK6A 3KXIA 3QQ5A 3SE0A 1VYVA 4QJ3A 4B3GA 1KO4A 3CNOA 1I4LD 4TLCA 2IF2A 2VHQA 3NC0C 2D06A 4M9XA 4PHFA 2ZI4A 3BK7A 3RRNA 3R9IA 4B3DA 4CRWB 5CIWA 2QTFA 3IO5A 4M9QA 2ZJZA 3ASYA 3TSWA 1OXUA 2R6GA 3G82C 3PVSA 1US8B 4O25A 3B7GA 1IY1A 2FSFA 2EVWX 4UXJA 2EFDB 2OM2A 1AN0A 4LPSA 1W5SA 2LCFA 3WXMA 3LLUA 1T9HA 3TAHA 2IS4A 2V6IA 3EA5A 3FYHA 1Q21A 1RFLA 1KMHB 3SYKA 2VP0A 2XAUA 4R9UC 3B8HA 1CR1A 1E69A 4DLRA 3UG6A 2NPFA 3PFIA 2GXQA 1IM2A 1R5NA 2H1LA 3R9XA 4MKHA 2JATA 4G0NA 1J7KA 1G3IA 5EP2A 1X3SA 2ZJBA 4HDOB 4KO8A 4CW7A 4DLWA 1EFTA 1JPJA 3EPKA 5FUYA 2G77B 1F2TA 4LPKA 3QG5A 1JBKA 4CEJA 4FCTA 4N3NA 2SHKA 1DG3A 3K8YA 4WIAA 2BWJA 3VQTA 2RH5A 2ZJ5A 1KTVA 2GHIA 3DDCA 4GRAA 1AQUA 1II9A 2IX3A 2WMOB 1R5BA 3B9PA 2QNRA 4Q21A 4PFSA 4BECA 1T3SA 3WYAA 2IS2A 5L3SB 5KTYA 2J0UA 3EZ2A 4LHYA 1KIMA 4LOAA 3AM1A 4RZUA 2D7CA 4URZR 1G4UR 1ZC4A 4A8JA 1OHHA 1ZUNB 1KDTA 2WWGA 2IXFA 4HI0E 2JGNA 4O2RA 3GJ0A 3KX2A 3PIRA 3SEAA 5B30A 1TX4B 4LHWA 4MGKR 2BKUA 2BVNA 1CR0A 2YNMA 1G41A 2ZYWX 3AF0A 4UNQA 1B23P 2IYLD 1XXHA 2AX4A 1KGDA 4AIIA 1FUKA 4JSTA 1RJ9A 2B8WA 2ODNA 3OEEA 2ERXA 5HR5A 3DVLA 4CVNA 5DN6D 2H92A 3OFNA 1KI6A 3LBHA 4OQLA 3LQQA 1AKEA 2IK8A 1ZMXA 2ZREA 4RCYA 2XX3A 1MOZA 2W2VA 2FSHA 4Q4AB 5FOWA 3A1WA 521PA 4B3CA 5FTLA 121PA 4PC2A 2OEPA 1P4SA 2VHCA 3GJ3A 1SVMA 4RCZA 5DI9A 4DKXA 4BFWA 1G8FA 1JJ7A 3ADKA 1TPZA 4LHZA 4HUTA 5DISB 2QUZA 1G7SA 1FTSA 2QRNA 1RYFA 1NMZA 1Q12A 3HPQA 3IIMA 1XJCA 5KNBA 2R6FA 3AVXA 4A0FA 3FKSA 3TAUA 2JDID 2R2AA 4D26A 1ZINA 3D31A 1LB1B 4KYUA 2ZITA 3EASA 1L4UA 2D3WA 3CO5A 3TW4A 2RGNC 3A4LA 4WXRA 1R6BX 2G1KA 2WIBA 3I4LA 4OHVA 5B58C 2RGEA 4YONB 4DUGA 1U98A 2J87A 4DEYA 2J46A 1NKTA 4DLTA 3THXA 1N6KA 2UZ3A 4Q1AA 1UEJA 4PZYA 4YMVA 5HCNA 1BO6A 1TF7A 2ZS9A 1KDOA 1Z0FA 3R20A 1EFUA 2H16A 2ODWA 4XSGA 4LV5B 2OCPA 1II8B 1YR8A 1KI1A 2ZAMA 4TMVA 3RS5A 3FOZA 5EE3A 1X1SA 5F9FA 2IT1A 3Q5EA 4TTRA 4BWYA 2MSDB 1E0AA 1TU4A 4P33A 3GLIE 3W9YA 4YLGA 3U5ZB 4IRUB 4Q01A 3T5DA 1S4QA 2F9MA 1MO3A 3VKWA 3BJIC 1OJLA 3B1ZA 1J70A 4Q9KA 4MRSA 1QZXA 2AWNA 5JS7A 1KOFA 2OESA 1XEWY 3B82A 1CKEA 4OQFA 2QU8A 4C7OB 3O8DA 4QBHA 4QHSA 2HCJB 1AQYA 5L3QA 1CR2A 1N6IA 2B7CA 2GZHA 1W47A 2H8KA 4MITA 1G17A 4LJAA 5FOVA 1MABB 3TR0A 3TVDA 2BBOA 3G0HA 2QAGA 2WSSA 5BXQC 3QVUA 2QP3A 1ESMA 1OXTA 4DWJA 1QBKC 2BMDA 2XTMA 3EARA 5L8VA 1Z83A 2WKQA 2VQSA 4DB4A 2JJ2A 2OV2A 3HYTA 1G3MA 3HR8A 5E7MA 2AK2A 4Q03A 2P6RA 3ADDA 3SOPA 1RJ9B 1GL9B 5GJWC 3TIFA 4TSFA 4C30A 3BRWD 1RRPA 3U7GA 1AGPA 1KI3A 2JCSA 1TTTA 3SQXA 1HYQA 2IHYA 1WA5A 3AEZA 4PPQA 4RD1A 2BBSA 4AYXA 2X77A 1R2QA 1SXJD 4H9GA 1JECA 2JJ8A 4G5RA 3CH5A 1HT1E 4DZZA 1E0SA 5L3QB 2PCJA 1H8EA 2VF8A 1KSJA 1E2HA 1Y63A 3CB4A 1EFHA 1UKEA 2H17A 2CVHA 3AUYA 3HR7A 3I72A 3ZYCA 4CEIA 4PO1A 2OCAA 3MJHA 3WNBA 1ETUA 2QEQA 1Q1ZA 2DFLA 4MGYR 3P4XA 4ASUD 3P26A 1U2RA 4OI1A 2OBLA 3V00A 3AVUA 5JJKA 1IN4A 1T8TA 2MMCA 1TQDA 2B8TA 3GFPA 4XJXA 1XEFA 4TL9A 5CYPA 1YR6A 5KDLA 3C7KA 1VMAA 2HT6A 2ZJ2A 3QF4A 4URYR 1DG1G 1E2PA 1MH1A 1YZKA 3Q85A 2FPMA 1A5TA 1PZNA 5JFGA 1XD2B 1I2DA 3WRXC 1G19A 1Z0AA 1ZM3A 1R10A 2C8VA 3AUXA 3CZPA 3GLIB 2NPIA 1R7RA 4GMDA 3B1VA 3PUYA 2J0QA 3RSOA 1LF5A 2ZYTX 2QGNA 1X1RA 4PC1A 2WJGA 4M1YA 2O8DB 4TQ9A 2ZAOA 3GJ6A 3SC3A 4B3BA 1GUAA 3ICQB 4KBFA 4WAUA 4MYHA 4BZXA 5E7IA 1E94E 1E4VA 3K9LA 1D9ZA 3WP1B 4BASA 3IPXA 4N0EA 3H1TA 2C2HA 2CK3A 4JL5A 3QSYA 3UIEA 1J2JA 1RYHA 1CJKC 3SJCA 4GI7A 1ZM7A 4ESVA 5HE8A 3QG1A 2AD5A 1G291 2UZIR 1JR6A 3IILA 4QXAA 5JSZA 3DZ8A 3HP1A 1GFIA 4C0AC 5ELXA 4FXPA 3W3AA 1VG8A 4OKSA 1PVOA 3AH8A 2PZEA 3E1SA 4C4PA 3L0IB 1UDXA 1C1YA 3WNDA 1QHGA 1K6MA 4JLMA 1OV4A 4C2UA 1GRQA 1Z8FA 2JLUA 2QTHA 1GAJA 2XSZA 1ZM9A 4L4UA 4JLBA 2O8CB 2FJUA 2J0UB 1CRQA 2WKPA 1Z63A 5C2JB 4NKRA 3C4JA 1TUEA 3VR2A 5B57C 3GPLA 2OCYC 1MR3F 2IYTA 1GNPA 4ACBA 3GLFA 2XZPA 4R2IA 2GCOA 1X8JA 2C5LA 4KVAA 3GCGA 2Z6VA 1D2NA 2QBYB 1P72A 2P0EA 3AKEA 5D3MB 1XXHB 3H86A 4RD4A 1NN1A 4UQOA 1GWNA 4AG5A 1MO6A 1IXZA 4TMXA 1UKZA 5FBRB 4NCIA 2RGNA 1KAOA 2V6JA 3C5HA 3TBKA 3NHBA 4I99A 1DAEA 3GP8A 6Q21A 1CLUA 3PENA 3D7MA 4R7ZA 4KITB 3SYLA 1E2JA 4KI0A 4I1SA 4LYFA 2ERYA 5J47A 3LBIA 3U7HB 2ZRCA 1GTVA 4DB2A 4AD8A 1FUUA 4GBMA 4HEJA 1G64A 2RGAA 1N2CE 2VO1A 2ZETA 4N0DA 2F1JA 2Q3FA 2ZJ8A 4V02A 1IXSB 1MKYA 3TNFA 4Q1EA 1OH7A 2HT1A 4JBWA 1T8UA 1MRSA 1SVKA 1EG7A 2R8RA 5CJ2A 1P2SA 2QMEA 3AVYA 2YWHA 1Q1EA 3J81k 1W7AA 4TYWA 2OILA 2QAGC 1MABA 4JKYA 1D6JA 4D0GA 2OG2A 2D7DA 1N0WA 1XTRA 4V0OA 4CZ2A 4HUQA 2R6AA 1JQJC 3OIVA 2EYUA 3EWSA 1EX6A 2QAJA 3I32A 1E79D 1NBME 1P75A 1A7JA 5TY0A 2QPAA 1FFHA 3QKRA 5BYJA 1TEVA 3EA0A 3KXKA 1RE0A 3IKJA 4TL7A 3RVBA 4EIWA 5EE9A 3IDQA 1OIWA 4MGIR 3OZXA 4TLBA 4XTRA 2XB4A 4E09A 1G6HA 5J4VA 4F4CA 4AI6A 2VL7A 2GEDA 4HB2A 3N2IA 3TSZA 2JLSA 2X8AA 5JEEA 5JBQA 3CPHA 1W4BA 3U3KA 2J7PD 1T0JB 3PJRA 1OHHD 1HUQA 3KKOA 1CP2A 1TF2A 1W44A 1HE8B 1OYYA 3AB3A 3C8UA 5CLQA 1XPUA 3IIJA 5GJCA 2FF7A 3RRMA 1G5PA 2QRZA 2Z43A 2IYZA 2K5UA 3ZVRA 4QM6A 1T0HB 1DO2A 1TMKA 4H1UA 1VPLA 4MH0R 4EPTA 4MYTA 4Q9HA 4PHGA 3U6BA 4WOPA 3FMFA 4TL8A 5HE9A 1CTQA 4FMCB 1F5NA 4X8LA 1E0KA 1HV8A 3CX6A 4B74A 5LPNA 1NY6A 4A6PA 2CHVA 3OFND 5JI2E 3K0CA 1M7GA 3AVQA 2JIZD 1E4YA 1CJUC 1YE8A 4F7WA 3CW2A 3IUYA 3KXLA 4BRWA 1ZC3A 1ZNWA 2YV5A 4TMKA 4TT3D 2RKOA 4NCKA 4JMPA 3U4QB 1IY0A 4RKFA 3FVQA 1VCNA 2HXYA 2Q9AA 2Z83A 4IOJA 1AZSC 2ZVQX 4IKEA 3VKGA 4B3FX 4ZCLA 1SQ5A 5GVSA 1E3MA 2PEZA 1R5OA 3RS0A 2FEOA 2ZYVX 2A3RA 2VTKA 3RRYA 2CVFA 3PUZA 4OHWA 3B1YA 2GF0A 3RANA 4Q66C 2ZE8A 4IEEA 1AS2A 4D0LB 5DGXA 1KI6B 2QM7A 5KSYA 1NSFA 4EPRA 3GLGB 1JAHA 2JLRA 3AKYA 3ND9A 2ZS8A 4U02A 4YMWA 2QP4A 2ZRJA 2NO1A 2DPXA 2P3SA 3NBFA 2IUUA 1W1WA 4QG7A 4DVGA 3EXAA 2ONJA 1SKQA 1YJ5A 5EXTA 2GJSA 2AFIE 2B6HA 3IBYA 5DYGA 4MRNA 4KODA 1HURA 3X1DA 1XJ0A 1Z5ZA 3QE0A 2ZR9A 1OH6A 4O3MA 5E95A 1JR3D 4ZKDA 2WAXA 4IW3B 2N46A 3WY9A 2CE2X 5JCZA 2Q9BA 2V7QA 4TZ6A 1FNMA 3CLVA 2KE5A 1Z28A 4M21A 1OSNA 4TN1A 1SVSA 3SHWA 5G40A 1N5KA 4PO9A 1E2NA 1SXJE 4XVUA 2F3RA 3GJ8A 4B48A 4Q47A 4BLRA 2IYYA 1KY2A 1H8HA 4D80A 2DFKB 1NVXQ 2V1UA 1U81A 2RGDA 4E03A 1KMQA 1G3UA 3QJYA 5AJXA 1G8HA 5BN5A 4OJQA 3SFZA 2GAAA 1QHHA 2QAGB 4HAYA 4MKIA 3RAPR 3SI7A 4OBEA 3B13B 2EWWA 3ASZA 4B6EA 5LDDC 4DRZA 1GOTA 2X1VA 5CYOA 1NJGA 2VYFA 2KI5A 3BC1A 1E32A 1GDDA 3BH0A 4C0BA 4QOSA 3U44B 2WJVA 5G3ZA 4FWIB 4IVPA 1VG0B 4FMDF 3ZS9A 3NBYC 3CWZA 4Q7JB 1UJ2A 2J41A 1XD8A 3L82B 4FINA 4IHQA 4NCJA 4ON9A 1D5CA 5DHAA 4M8NE 1PJRA 1KI9A 1VCMA 1S1CA 2OE2A 1Y3AA 1VYUA 4ABYA 4Z54A 5FTJA 4E07A 1DAFA 1S96A 4II7A 5IDVA 4FW9A 5EXXA 5FOSA 1G8YA 1KY3A 1G7TA 4JJKA 1OPXA 1V43A 1IHUA 2GAOA 1S3SA 3BOSA 3H84A 1XBTA 1KK2A 1QHYA 1YZLA 5EUMA 3QXHA 1GKIA 1SXJA 4RJLA 1GRNA 4M22A 3IHLA 3VFDA 4TZ0A 3RC8A 2BEKA 1M34E 2GBLC 2G3YA 2GJAA 2HLDD 2F55A 1U9IA 4LK2A 1H8ED 4DLUA 2ZRMA 5FL7A 4ZCMA 3LDAA 3LA6A 1ELOA 4IJMA 2FPKA 3U6KA 1NVVQ 2ZSDA 3A1SA 2B7BA 4A2WA 1QRAA 3I5XA 3PR1A 2VHTA 4IFEA 3SBEA 1OFIA 1OB2A 2UKDA 1K5DA 3QF7A 2G88A 1Q22A 2ZSFA 4HB4A 3THWA 2CE7A 5TVKA 2FH5B 1Q1QA 3CF6R 1E2EA 1GL6A 2LKDA 2RHDA 1G20E 3WBJA 1X8LA 2X19A 3T1TA 3GLGA 1HH4A 3OAAD 1R0YA 2PX0A 3VR3A 2ZI5A 2UVQA 2NOAA 2Q9CA 3LQRA 2WJHA 4PPFA 2YHSA 4A0HA 4UNRA 2VP9A 5L3SA 1WB9A 2AHOA 3KTAB 1UF9A 4DT1B 2A5YB 4RFVA 4BLSA 3K0AA 4NE2A 2QY9A 3QKSA 2GVZC 1DVRA 3C41J 3GJ5A 2ZQ5A 1NY5A 2ZUBA 1DS6A 1Q44A 2Y8EA 1HQCA 2C9CA 1DAIA 1G18A 2W0MA 3N5CA 3W34A 4B73A 2REBA 2VIIA 4JKIA 2C04A 2W6JD 1YU9A 1MRNA 1MT0A 3FB4A 4NCHA 4Q4HA 4QFMA 5C18A 1NIJA 3MD0A 1KO7A 3VKHA 4G3XA 1NL3A 4D0NA 2GRJA 2O8BB 4LSGA 5F2EA 5HKKD 3SDZA 4JL6A 1OXXK 2CJWB 5DSZA 1SHKA 4AKHA 2C78A 2H7VA 1XTIA 3GD7A 1TUIA 3IEUA 4I1VA 3PCRB 5A5GA 4A2PA 1SULA 4EKDA 1QHSA 1OIXA 1KMHA 4YMTA 1XP8A 2FGKA 2LWIA 3NHAA 1G9XA 4LJYA 2FZLA 4R98A 5BYKA 3KQUA 4FMCF 3VNVA 2JIZA 4QBFA 2ZRIA 1XEWX 4GOKA 5UKDA 1M1YE 2HYDA 2EFGA 3A8TA 1GITA 2ZR0A 5DN6A 4PPNA 2QN6A 4NYIQ 3MMPA 4QBGB 5CJPA 1NBMD 3LX5A 3T15A 2CK3D 5L3RA 2XNDA 3O8CA 4WZBE 1E9SA 3GJ4A 3U61B 1G4AE 3SFVA 5JJIA 1L7VC 3KUDA 2OO7A 1N0VC 2YC4C 4WZ6A 4S2EA 1P9NA 1TQ4A 1NN0A 4QGHA 3IO3A 2IS6A 4UNNA 3VMFA 2PMDA 1E2IA 3KJEA 4HAZA 4EPYA 5EXSA 1P3JA 2VH5R 2GDJA 1P7CA 3PXGA 3EPLA 2J7PA 4KXFB 4NU0A 5AK0A 1AS3A 3L8YA 4OL0A 2YOGA 1P2TA 2AKAB 3F8TA 1KKLA 2XSZD 3QPUA 4PR0A 3VR5A 5FH9A 4Y0AA 2X2FA 1OB5A 4HDQB 3PITA 4AKGA 1ZIPA 2V1XA 1BH2A 1W36B 2IUTA 2B92A 1BKDR 4NYMR 2WICA 4XH9B 3A4NA 3NWJA 2A5DA 3Q7PA 1T91A 1XTKA 2RAPA 2A7QA 4DUGD 1MV5A 4FWTA 3EZ9A 2WWIA 4JT4A 2KJQA 1U0HC 2REOA 1FX0B 2IC5A 5H68A 4KJZA 1TNDA 2NO0A 5J4YA 1Z6YA 1ZCBA 4LGMA 2HYIC 3K0FA 1D9XA 3UMFA 4EQ6A 5CLLA 4DBLC 1CIPA 4NL4H 3HPRA 5D3QA 1NLZA 1DAHA 3RWOA 4A15A 1QDEA 5KDOA 5DI3A 5HTKA 1XEXB 2HV8A 4DDUA 1FMLA 1WP9A 1G7RA 4R2HA 4TMZA 1Z0JA 1Q3TA 3TLXA 1ZD1A 5BWMA 5DYIA 5HZKA 4EAQA 2VP2A 4DSUA 3KQKA 2QQEA 2O8EB 4BUJA 5JLJA 3A36A 2YWGA 1LFDB 1N6OA 4NTZA 4Q7LA 2HEIA 2IYXA 3GEHA 3B6EA 1KI8A 1BIFA 2H18A 4R71A 1W36D 4HLCA 2GCOB 1KO8A 1R8SA 4QGAA 3GLFE 1R0ZA 4C0QC 1Q57A 2V55B 1G5TA 4Q5IA 3CF2A 5H8WA 1NVVR 4ACAA 2CCKA 1ZP6A 3I3SR 4ZDJA 2FFQA 2OAP1 3NBXX 4RD6A 1M7HA 2GJKA 3OAAA 4LJ7A 2GTPA 1XCMA 2OFOA 1U0LA 3THYA 421PA 4TQAA 5CDFA 1Z06A 1E9EA 3RDPA 4L9SA 3HJNA 5LB2A 2QMOA 5KOYA 3TJZA 2AR7A 1O87A 4GL2A 5EJEA 4EFMA 1CJMA 1X6VA 5SZIA 1W0JD 2J45A 3I8XA 2A5FA 3NEYA 1GKUB 5JHGB 1FL9A 3A6PC 1FPMA 3T35A 2R6CA 1KK3A 2W6ID 3LAWA 2G0TA 3CONA 3SU8A 2DY1A 1OYWA 1Z0IA 1XPRA 2GVDC 3N70A 3BB4A 1F6BA 4LJ9A 1ZNYA 4PQYA 1WBBA 3I62A 4GZMA 1ZYUA 1S0UA 4OQNA 3L2OB 2Z4SA 1VIAA 1NG9A 4WA7A 5AUPB 1G5RA 1NMYA 2KWIA 4OQXA 1CEEA 1LW7A 4OJKA 4PQFA 4UJ3A 3CRMA 1UAAA 4NZYA 4D82A 4HB0A 3ZVNA 1ZAKA 4NMMA 4I81A 4A1FA 5KUTA 2QG6A 3RS4A 2O8BA 2QROA 1L4YA 2W6IA 4W7SA 4IDPA 4OHXA 1MO5A 1SGWA 2FX3A 2ZI9A 1CU1A 5JEDA 4KYIB 3U4QA 1W46A 1ZVQA 4WVFA 3VR4A 2WWHA 3KQNA 4BLPA 3FHTA 3UXMA 4HAUA 1CULC 2D2FA 4QGFA 4G1UC 3CH4B 3EZ6A 1OF1A 4JBYA 4E5UA 1JR3A 4AK9A 2IYWA 3EIEA 2FDCA 3O8RA 3A1UA 3BERA 4NDZA 1FZQA 4DDVA 2CBZA 3K9HA 1XU4A 2ATXA 2ZE7A 1FQJA 3EWAA 2ZRLA 1ZJ6A 3TH5A 4GSYA 4M1MA 4CT5A 4NYJR 3KQLA 2R6DA 3GEIA 5IF9A 4G5GA 3SZRA 2QORA 2XITA 2OBMA 1DOAA 3B2EA 2BJVA 4QHYA 1A2BA 3AVWA 1NJFA 1Z0DA 4AC9A 3ONWA 5F98A 2VEDA 3DM5A 1UKVY 3ZIAA 4URVR 5SZJA 1GIAA 3LW7A 4IOLA 1I4TD 1KAGA 5KYKA 2HXSA 1E2GA 1IBRA 4A82A 2D4HA 3T1VA 4JSYA 2A30A 3CRRA 1NN3A 3AKDA 1XWIA 3ZD7A 4W5HA 3RNLA 2I1VB 4JVNA 1KO5A 3QI2A 3H2YA 2ZVPX 3AGPA 2IF0A 3W90A 5TV2A 2CEAA 3B78A 2XOKD 2IXGA 2XNDD 5E4FA 1XD9A 1SVWA 1F60A 2QE7A 3ZIAD 3K09A 1OIVA 3OEHD 5E7JA 1NKSA 5JRZA 5IRCD 3OE7D 3RRZA 3MWJA 1PLKA 2QT1A 4LBZA 2IEZA 4QNRA 3TUJC 3W8RA 4B34A 4F38A 3BXZA 3CIOA 2AK3A 4UXHA 4FI3C 3RLFA 4LZZA 3NH6A 3OIWA 3EPHA 2FE4A 4W5JA 4XTCS 5EZ6B 2XZLA 4N1AA 2FU5C 4CGZA 2QTVB 4TLDA 3W5JA 4CEIB 2Q21A 4NONA 4PHTA 4O2LA 1BMFD 1E1QD 1XZQA 2QE7D 2AFHE 2HJVA 5HKKA 1NMXA 3AVTA 2PH1A 5FPSA 1DAMA 4C9BA 4Q1BA 1U94A 3QKTA 3ZVMA 3EC1A 5DNYB 1UM8A 4QJ4A 2OHFA 4V0ME 3OE7A 1COWD 4KVGA 1GNRA 3Q7QA 4EJSB 1RRFA 1DPFA 5FUVA 3KDSE 4HATA 4XD7D 1R0XA 1SKYE 2W2TA 3TGPA 4DCUA 1RKBA 3JZAA 4PAQA 2XXAB 4JLVA 3CNNA 3WBKA 3NXSA 5TXGA 1NN5A 1N25A 3A4MA 3K53A 5IHPA 2GJ8A 1XMVA 3IQWA 5FL7D 4WW0A 3QOFA 5FPTA 3WP0A 3OF5A 1YZNA 4FCVA 5C1BA 1W4RA 4A36A 1G3RA 3VR6A 1FP7A 4WBSA 3CRQA 4JJZA 5JJLA 3U7FB 2FNAA 1WMSA 2PCLA 2RCNA 2NIPA 1IONA 2ZRKA 2H57A 4L5BA 4V0LA 4DLYA 4A0RA 3CUEF
chains in the Genus database with same CATH superfamily
2C61A 3DV0B 1PL7A 1U7WA 2VPXA 4MI1A 3BFXA 2O5VA 2FZ4A 2N1BA 2X6RA 5DTMA 3PJGA 2E1PA 2AXQA 4NZPA 1VBKA 3CUKA 3HWWA 5EE0A 3U9SA 1XEXA 2MHCA 4LNAA 5IDYA 4EUHA 1SCIA 2JGJA 2YL2A 1UK6A 3E5HA 5KNDA 3BE4A 5ALLA 2F4VB 1UANA 5KEIA 1ML4A 6CHYA 4UCXA 3O8OB 4FDVA 2FUG6 1RMQA 1RKQA 3R09A 2X6TA 3G7SA 1VSQA 2R9VA 3CA8A 3HCRA 3R2JA 2EQ5A 2Z8ZA 2G4VA 4N65A 1E2LA 1B8OA 2I5PO 1IJEA 1UC4B 2R6ZA 1L7RA 1MO2A 3GLFB 5ALSA 2ZQZA 2JJYA 4Y2HA 2JLYA 2AKEA 1IJFA 2BM0A 4BBAA 4FHEA 4BMOB 5F78A 2HDNB 5ICEA 1QDLB 1SG9A 4AY5A 1JQAA 3NJRA 2Z2IA 3HYNA 3FJYA 4HAXA 6PFKA 2DHRA 5FAKA 4D4KA 1IC6A 4MRVA 2PTGA 3AINA 5FRDA 3ZDCA 1Z6XA 1FUYB 3F7OA 2P6NA 4ZRDA 1JA1A 1QC5A 1B8UA 1BX3A 1C30A 1YU6A 2XVXA 1N34B 4ZV9A 4BTVA 4QEDA 1CY0A 4CN9A 4HB3A 4C01A 2MR6A 4LY0A 5FADA 1MP0A 3BD9A 4LYAA 5AM0A 1T0PA 5FI0B 3SJUA 2Z9DA 5J5AA 4HWGA 2PA0A 5DCWA 3D59A 2GKOA 3FZYA 5IWAB 2HZBA 2A9QA 4TXNA 4KE6A 4K9NA 1OBFO 3D8NA 4FYYA 1AKNA 1T5IA 1L4GA 2VPQA 1NOKA 1J0EA 3HMQA 2BYTA 2JKVA 2IE0A 3BMOB 1DQNA 4I6GA 4M1OA 4V0KA 3SKVA 2XH8A 2JIOA 5JNSA 1DEXA 5K8IA 1S2DA 5AT1A 4A23A 2ENUA 4RHEA 1N6PA 2WG1A 3MOGA 4N49A 3R74A 3Q88A 3A7DA 1E1RA 2O1SA 3IFSA 4RDIA 3O9MA 4R1LA 3SXUA 4LV6A 4PXAA 4HCJA 1R4MA 4BZQA 2EKDA 4BE9A 1NLFA 2QTWB 5JCPA 4NBTA 2KB0A 1CUFA 1PD1A 3OFSA 2GF9A 5AVVA 4MCJA 5KJFA 1YS9A 2VYNA 1NM5C 4WT7A 4Y1EA 3UWMA 3C6MA 2BIFA 2P4HX 1II8A 2XI4A 2NXJA 3CT6A 3A9RA 5KNCD 5KOHB 3CVYA 4OUDA 1JAXA 5ICFA 4NBUA 5EP1A 4YJKA 4JOCA 2VYVD 3ZLJA 4F45A 2D62A 3ODGA 4DCTA 3N3BC 1OTYA 1E20A 2B20A 4GYWA 2GXUA 3B7PA 5DWDA 2NO4A 2FPUA 1EJ6A 4DPLA 2FK7A 1Z8DA 1XYYA 1BMTA 1B14A 1YVUA 3PNQA 2AVNA 3J80A 1WZEA 2LNDA 3FPSA 3HUEA 4FDLA 1P5FA 4HPXB 4BZPA 1RW4A 3GRCA 2KBEA 3O84A 5EJMA 5CEEA 1YULA 3BICA 4B6GA 4N5LA 4GX0A 2NO7A 3DFFA 5T3UA 1WMDA 5IXYA 5LQDA 1P29A 1J56A 4A91A 4J7UA 2HEGA 2RGXA 3HA2A 4F1KA 4AW9A 1U65A 2PGIA 2H2FA 2FV8A 3EY9A 3GXOA 2UYHA 3GLHE 3LU1A 2BM9A 1QTQA 1KAEA 3P7MA 5FOQA 5AI6A 3ASUA 1FU7A 3NONA 1SPXA 3SR0A 5DLEA 2ZTVA 3U17A 4QFCA 2OM6A 4MKZA 3IP9A 4FT2A 2A0UA 3UAOA 1BOFA 5IM4F 2WFLA 1C2YA 2LW7A 4JT9A 5IJAA 1E92A 3FOCA 3OZUA 4KWEA 4LA4A 1O5IA 2ORWA 2C7PA 4Z2AA 1ADJA 3P2EA 3OM9A 3B3GA 3IEMA 1X0VA 2PBLA 1WSWA 4MP8A 2JGDB 2H1HA 5AXCA 2D13A 4CLOA 3L8DA 2BGRA 5KYUB 1WB6A 4V1CA 4LX8A 5EMKA 3VO2A 1UEXC 1VHDA 1CQJB 2JA2A 1QCZA 3OP4A 4ITRC 3CR7A 4MJ3A 5CXXA 5F2OA 1KPGA 1RM0A 3DUFA 3IULA 3M49A 4DLVA 4B32A 2WOJA 2CFRA 4FLEA 1H2ZA 1KDRA 1IVNA 4BUCA 4RF4A 2H08A 2VBIA 1NMSA 2YYZA 4I5IA 4KREA 3AM4A 3U16A 2IYSA 1QHNA 4LRWA 4QPDA 4RVCA 5I01A 4LHVA 3F3KA 3FMPB 2H1RA 3ICPA 1C7EA 2CMKA 3OJCA 3RREA 3DXXA 2BP7B 4HQRA 4N0QA 5E2AA 3TBFA 1RDFA 1UQUA 2YY5A 1NM5A 2ZSIA 4X20A 1A1VA 1L4BA 1F7UA 3HA7A 3LDGA 3OD1A 4B09A 2H1VA 1ZRMA 4KFRA 3WK5A 4HL6A 1P6QA 2BF7A 4ZI2A 5T7BA 2KLBA 4GM1A 5IF3A 4N76A 4FGJA 5BW4A 2ILVA 2YJNA 1B43A 1PVVA 2VUTA 1RPZA 1PGPA 4E88A 3JQCA 3BB3A 5CITA 2XMGA 4M0LA 3LUGA 5KX5F 4LJSA 5T57A 1SUPA 4NJOA 1KHTA 1L8XA 4Y2YA 3T1OA 2C96A 5H82A 4TX1A 1UC8A 4FD3A 2J5XA 4BCCA 2YX1A 2AD1A 3N2GA 1E59A 2IUYA 3TLJA 2HQOA 4P4SA 1P9WA 1R9MA 4P4SB 3UMRA 2RBGA 4IUBS 2VHYA 3D5EA 2ZUCA 3MCAA 3WAJA 1D2AA 1X80B 4FFWA 4J4TA 2P3QA 1IQPA 2CFIA 3FCYA 3IQDB 4M4SA 4J1TC 4X24A 3WGLA 4F06A 2H6EA 1F8FA 1CZKA 3WNQA 4FFBB 3TJRA 4OI0A 3HWSA 4G89A 3TKAA 2A5JA 3WB9A 4TRJA 3ZQ6A 3HG7A 5COAA 3C24A 3FSEA 2FG5A 4EEKA 3T4PA 3NMUF 1WLSA 2HZ7A 3WGMA 3CLHA 1NZJA 1N9GA 1PJ3A 1J07A 4YCAA 5EJFA 4JYPA 3BWCA 1NUUA 3OT5A 1JZSA 1X1QA 5JWHA 5U4QA 4JLNA 4YN3A 3BHNA 5BSVA 1J9ZA 5FBZA 3VJMA 4GLFA 3KAPA 2P5UA 5AXAA 1D2MA 3ROFA 4JJ8A 4PSAA 2EDCA 3JALA 1V37A 3CPEA 4LJ8A 2CWDA 5THQA 1GT6A 3S8MA 5IAOA 1FP6A 1W93A 5GOTA 4RPLA 1UJ6A 2E49A 1EK5A 5KQSA 2ZSAA 1X19A 1XMJA 1UFOA 4HNAB 1A7UA 2XYQA 4QFDA 1MT3A 4J1NA 4EJFA 4Y30A 5F64A 5BQPA 4B85A 4F60A 4KR2A 3EZGA 4AZTA 1EM8A 5AVTA 1JFRA 5LN1A 2OUKA 3M5PA 3OT4A 4CM7A 3PQ4A 2X14A 2ZYHA 2BJWA 1PG0A 5DHFA 1PNQA 4N8DA 4EKYA 3ZCPA 1Y1QA 2QN1A 4IYRA 4YMSA 4KXVA 2B9EA 3AF4A 2O6LA 2G6TA 3PNKA 4ARAA 2F8MA 3JAKB 3DXFA 3LC2O 1R6AA 3LZCA 1N1MA 3T7DA 4HDRA 4B7ZA 3CO0S 2QTZA 2QXUA 3CISA 4PF1A 2SKEA 3KL2A 5HPYB 2LKCA 1FSSA 5B3KA 2LD4A 2V8BA 2OCIA 2ZWIA 3CVJA 2WF9A 1XTVA 4F56A 4M98A 3ZCTA 4TOIA 3A25A 3JTEA 4YRAA 1VG9B 3CTMA 1N8SA 3PP8A 4URWR 4Z9XA 3UB3A 1NJ5A 2OCBA 1YKSA 1ZCFA 3FTQA 3O5AA 3KWLA 1OA0A 2X9NA 3C85A 3R7WB 3S29A 3TQRA 3WMGA 1AA9A 1T0BA 2ZJ3A 1L7NA 4KFSA 4G1VA 1X7WB 4LRXA 4NU6A 5HF6A 4YRLA 4C0HA 2F1RA 2ZRAA 1MVLA 3QUSA 5FR1A 4DCMA 3DOFA 1NW7A 2GO1A 1J8MF 2FPXA 1ZUHA 2GA8A 1XZJA 2GAJA 1CYDA 3KAQA 4G5QA 4KMMA 4FOSA 2DKNA 2ZUWA 1H9BA 3F7MA 5KVCA 2A2ZA 2HHAA 2FDRA 3V1UA 2XEXA 1YQQA 2L0XA 5HGJA 1VB5A 1E6CA 1TADA 2RHLA 3BA1A 3IAHA 4WPGA 3ZBQA 1OFTA 3TI7A 4WMLA 2BLNA 1L5YA 5L4NA 3CR3C 3DVSX 1BHSA 5L53A 4ROSA 1JYEA 2XA9A 4EKEA 3ZKWA 5I7EA 4BFTA 2IY8A 4RKRA 2Z2ZA 4LVCA 2R8BA 1TAGA 1GXSB 1T8YA 2PMEA 2PZGA 4JELA 3W2TA 4B43A 3X1XA 2IYFA 2J9FB 2Z8XA 1OU4A 4J0GA 2PUHA 2OVFA 4XQEA 4UHDA 1SHTX 2HJSA 3KPYA 5GAJA 5DGIA 5HTOA 2RHWA 3OX1A 4J1QA 4FGSA 2C0QA 3IX7A 3C6YA 1YNOA 4E14A 2WSLA 4ZHQB 4ZMSA 2QM8A 5AJVB 1L5SA 3BG5A 2IEGA 4DM3A 1DKRA 1DWUA 1VPVA 2CXRA 3KYCB 5D7BA 5MN5A 3GEBA 1YZ3A 4YRJA 3LC0A 3EOAI 3C48A 1VIVA 3PA6A 3UJBA 2VNSA 2VWHA 5JFOA 3O4FA 3PTAA 4B44A 3IA2A 4DLNA 4UFOA 4D3XA 3URKA 1OKKD 3EIQA 2BDTA 2DLDA 2PEYA 3LNTA 4HAOA 3BSYA 2KLHA 3PL1A 5LVAA 1GQFA 4LXQA 1MJGA 2QG9A 2LIPA 4Q3BA 4OFWA 1FSFA 5A0FA 1B26A 2JBHA 3AR9A 1L8QA 2X8JA 3WQRA 4DANA 3TQIA 3JQ8B 4CHTA 2J9RA 1TW2A 3HCWA 2C9OA 3QELA 4R41A 1DWPA 3UCXA 1J25A 4Z49A 4R05A 1NUTA 1UXIA 4MLDA 2O2IA 3T3DA 4J0FA 1EKXA 1QAQA 1GPWB 2XD9A 4M83A 2ORED 1UFQA 4MRMA 4X3OA 3V9PA 1NONA 2VP5A 2PZBA 4M89A 4QBKA 2CLCX 2BFOA 5DM2A 4YPVA 5LP6C 1BWPA 1IBKB 3FBWA 4DCOA 2FA9A 4LJLA 3EIOA 4LFCB 3WG9A 4AO8A 2L2QA 2R2GA 3BH6A 3UGKA 3C3YA 3HDGA 2H3EA 4OGWA 4ASUA 3JQPA 1V26A 2DQZA 3GT4A 4AJHA 1E98A 1VGRA 1FRNA 2QL5A 3O3NB 4UMFA 4HAWA 2HU2A 5JNVA 3M70A 3IDSA 3D5QA 2YZKA 3A1EA 3FNIA 3QF4B 4OB7A 4P31A 1TQ8A 1I5EA 4BMNA 4UAJA 1K7CA 3MXTA 3QYPA 4YXWD 3G5TA 2PUCA 3H42B 4JR0A 1IWBB 1MPXA 3I73A 4G26A 2JFXA 5DE3A 2QZZA 5JVDF 4CL3A 1M2OB 2VZ8A 4G07A 4QUIA 1U0SY 5TARA 1CZUA 2XDAA 3VSDA 1U5AA 3GJ7A 2ZJYA 1RKVA 2O8CA 4OI2A 1JL3A 3DA8A 1OX5A 3GZTB 3HJGA 2C7GA 2J4DA 3KJHA 3IT3A 4LQ4A 4MVXA 3V8BA 5C80A 4N48A 4R9SA 3L6EA 5K8VA 5FYQA 4C7KA 2YINC 3V8NA 4I1UA 1W0JA 2YY7A 1EUDA 5F1OA 1G9TA 1YVRA 1FFCA 3CM0A 2PLRA 3DCYA 4G97A 1RCTE 2I6FA 2R7AA 3FN4A 4ZHQF 4HWRA 4NABA 2N75A 1I10A 5JY6A 1W85A 2ONKA 1GA6A 1ENOA 4CEHA 1GQ2A 4BEBA 1TO1E 5A03A 4Z51A 1T6YA 3QU4A 4UXIA 3JRWA 3STVA 1NSYA 3EDYA 1NATA 2JZNA 1SA0B 3VJKA 2HIAA 5IAGA 4RS3A 2CXXA 1TD9A 4IV0A 3RABA 1T6BY 3OIDA 1RI2A 1W19A 3RVSA 1TCBA 3DMGA 3F9RA 4MV5A 5EY5B 4ZK6A 2VUIB 4MVJE 1CS0A 4BDSA 3P0IA 3UKDA 2JFWA 3GUVA 2GK7A 4OLBA 3DQPA 4KGDA 2PL9A 2O9JA 3ORFA 3PXDA 1C7ZA 2MSNA 4MPPA 4OQMA 2GNOA 2IZOA 1RRVA 3PJDA 4IIJF 4OTZA 2J7KA 2NZWA 4OM7A 2E48A 2VQ3A 4H31A 1XYGA 2Z9BA 1VGQA 4LYHA 2IYRA 1PZGA 1CZHA 4TWIA 5HZHA 4QPPA 3MYYA 1EESA 1VKRA 2W37A 4B4DA 3NW9A 2EYQA 4G5FA 3C5CA 1Z3CA 2J0VA 3ZYZA 3RSSA 1SU8A 3T94A 2PTHA 4ILEA 3EXHA 5FBVB 1POWA 1FU4A 1VIYA 1HORA 3EN0A 2XMDA 4OSEA 4ZT2A 1Z5UA 3UJPA 1F38A 1E99A 1EAYA 1MMFB 3HWRA 3PSHA 3RUEA 3U26A 1V9SA 1JG3A 4B87A 1PV4A 2YIVX 3BBPA 3NOQA 3DO6A 3IEXA 4LIPD 4NFYA 4GH5A 2I4IA 1PR9A 1YAHA 1Z4JA 2X5KO 4UHCA 5KWSA 4REOA 4Z9AA 4OAPA 1W88B 4CQMB 3U7RA 4XRGA 1QIFA 1DBIA 4BFLA 5HQTA 1IXRC 3Q7RA 5B53A 2RGWA 2XTAA 3C4VA 4DYHA 2FN3A 3AB7A 2FQ1A 2ZIZA 3MSXA 1PVDA 2DVMA 3ENKA 4UU0A 5FPYA 5HFNA 3UN1A 5H9WA 3U49A 1RQPA 1FW8A 5DX0A 1JE1A 5BV8A 1RWBA 3WMXA 4BN0A 3AY7A 3DAPA 1AUQA 1PJBA 1SCUB 3AX6A 2CVOA 2IXBA 3G0DA 4JGGA 5AH0A 4KX3A 3TM4A 5BOVA 5IZ4A 1FSPA 1Y3BE 1I3KA 1U8FO 2PZAA 4FX2A 4HJRA 3ZGYA 4B4UA 1PLJA 3IMEA 1FTGA 3DC2A 5DNEA 4H3VA 5BW8A 4RVUA 5IC4A 4AY6A 2IU6A 1GGNA 1WBDA 1WCYA 1U1DA 5IT5A 4CTOA 4EX7A 2M6SA 4FIDA 1YCGA 4Q16A 3CUYA 2E87A 3VNBA 1T5LA 2Z2KA 3HB4X 4I9HA 1M1XB 3RUDA 1V6SA 3L0YA 1GYPA 5LQRA 1WBJB 4LRSB 5AVZA 4KK3A 2JHCA 3V6LA 3ZQJA 5AJZA 1GSIA 3VOBA 2A84A 2MT9A 3MA0A 2C3UA 3K20A 1UDAA 4RLQA 4V39A 5ECDA 4I5GA 1TU3A 1AN9A 1VLMA 4ZALA 1LH0A 5BNFA 4CI0B 3LPAA 2GAFA 5LYYA 3TE7A 3DF9A 4RH1A 1X9IA 2AJTA 2CXSA 1A1SA 4AF7A 3PUKA 3T5GA 1HLFA 3NWEA 2DCUA 2PX3A 5B1YA 4GE0A 1NVBA 4NPCA 1ISPA 4W5TA 2DPYA 1LU9A 2CVZA 5J1SB 1M2HA 1RBQA 2EW2A 3VTKA 1E9RA 4Y1FA 1CD5A 2P69A 2Q4EA 5BQ3A 1UT6A 4AQYB 1ZA1A 4HX5A 4KDFA 3UMSA 1G0NA 3WQSB 1XTJA 1P0MA 4NK4A 3SJAA 2FN4A 3NC1C 4UULA 2X9GA 3CMMA 5IP5A 2O8FA 1GRRA 3IJEB 1GFSA 3O3CA 4DG5A 1DIHA 1OLSA 1YFZA 3SJ7A 2O52A 1WF6A 1Z4LA 3LUCA 3UC9A 2P9YA 3WLHA 1UIRA 2R5WA 1EX1A 1DIAA 3NOVA 3T95A 3UJAA 1PAUA 1YZQA 1GKYA 2ZR7A 3GRYA 3R7WA 5KTRA 2RC6A 5B3JC 1BTOA 1OWNA 3RC7A 2XKKA 2PGJA 3N58A 1ZK3A 1MPTA 4ZO6A 2FZGA 1Q0RA 2HO5A 4I1IA 4Q4JB 2ZBPA 1A9XA 5TF0A 1PHPA 1WUIS 2WVJA 4KNVA 3IUNA 5TRTA 1HDXA 4EHDA 4MS3B 4BX3A 4EG3A 3CH7A 1C14A 3FFTA 3FGOA 2XJ9A 4GF5A 5CRIA 2FX2A 3OJFA 5HYVA 4AKIA 1P8AA 3GN2A 3NBQA 4ZXPA 5CCEA 5TIIA 1E4EA 1JIJA 3L8GA 4RACA 2BUCA 3H0KA 1H1LA 3HYRA 5G41A 4MVJM 1E1NA 1E9FA 1JI0A 2CNWD 2ZBGA 1X7HA 4LXXA 1J0AA 4D42A 1BMFA 1CBUA 2C2WA 1UMCB 4DEXA 3F7NA 4PM4A 1QHHB 1TYZA 3ADCA 3AERB 2I2BA 3AERA 2FZKA 4FQ5A 4OKIA 2ZTHA 3ND7A 1VRWA 3L6DA 5EE1A 3BJZA 1G21E 1A9ZA 2GEVA 4MROA 4QKQA 5DTJA 3I01A 4CFSA 2F90A 1QOZA 4LRUA 5EN4A 4HDCA 4G0YA 2P9BA 4OK5A 2ISQA 3JWHA 1UMBA 4IVQA 1UJMA 4WDRA 1R0BA 1KYXA 2P6OA 3NB0A 3UB2A 5MF6A 1FUIA 4IVRA 4EB6A 5K3BA 3AW8A 3Q6IA 2QPOA 1RLOA 2ZSEA 3KZMA 3LUDA 3STYA 3TCXB 4YA6A 3K1TA 1BMQA 3D6FA 3W5IA 3ET4A 3ZHTA 4PONA 4C0KA 5IUKC 4R68A 3V7FA 1LPBB 3BKXA 1F9AA 2ZRDA 3MCZA 4RSHA 2BGKA 4INZA 3LYAA 4EHIA 4F8EA 4O4IB 5KYXB 4DV0B 2I9PA 3KIPA 4QRDA 1RQNA 2FZWA 5FTNA 1AKUA 4MQFA 5B1HA 3TSYA 3U7IA 3DJYA 4BNMA 3DE0X 2JHPA 1XCGB 3I6IA 1L4MA 5KYGA 3EGEA 2YTZA 5LOVA 1XZPA 3BJEA 2I99A 2LTAA 1TYDE 3IVRA 3R23A 1JR2A 1SUIA 4B7CA 5FD8A 1GR0A 2ODAA 3I4FA 4BEWA 5JQGB 2ZE5A 4JWTA 1IPFA 3W79A 1YRQA 3I04A 4O33A 5EIAA 5HCUA 2A9RA 2A9OA 2NXEA 3NVMB 3RI3A 3HKCB 1ISMA 2B4KA 3KTDA 1RXUA 3SS7X 3N07A 3I34X 1VL1A 3A4YA 2MSCB 3BH7A 4ZZ0A 5FBHA 4Z3DA 1IXYA 1NVWQ 3QVWA 4DZTA 3I1FA 5A4IS 4TTAA 3KVOA 4BNNA 4ZOEA 1XSEA 1HTBA 2BSXA 3KPJA 1U5CA 4IYJA 4D2IA 1P0PA 4RK4A 1N2GA 2C5HA 4LTDA 3I83A 3LRPA 3R40A 1NV9A 1WLYA 3L1KA 1P5ZB 1CEXA 1SG6A 1HNWB 1NNI1 1NR5A 3OIGA 4IZHA 4LF7B 1F1JA 3CNLA 4CF6A 2B37A 2YV4A 1AUPA 1NP6A 2H0AA 2IP1A 5LQSA 3HKBA 4DOMA 1I8TA 1R64A 2AMFA 1D6SA 2PRYA 1P2UA 2RFLA 1A5BB 3E84A 3NT5A 1DDIA 1H4SA 1BA3A 3BXHA 2PJZA 4O02B 4V38A 1JEYA 3VM6A 3AQ4A 3IHWA 5I7AA 2ONYA 3QKWA 2HAEA 1V71A 2OVBA 3QA9A 2Y67A 2G07A 1N7HA 4WV3A 1K0FA 3OZCA 1NQOA 2ICAA 3GUZA 3IGFA 2P78A 2WYWA 1DX4A 3EFOB 3IAUA 4U7HA 4XWTA 2V7WA 5JV5A 4V0MA 3QEMA 5DNDA 1F20A 3KKQA 3EUAA 3NT2A 3PICA 1W59A 1Z39A 4IDEA 2EQBA 3V7NA 2P8JA 4DV7B 4Z0NA 2ALJA 4MLCA 4YRKA 1SD2A 4MYRA 4QU5A 1O4VA 2IIVA 1E3IA 2X6QA 4KQIA 2VDNB 4MA4A 3GH3A 3DTVB 3THWB 2G7ZA 3LPNA 2D0IA 5FA6A 4HVCA 4I8XA 3O92A 1MFZA 1ONBA 1SA0A 2ZXFA 3M4ZA 3HFGA 4US1R 1O94D 1P0CA 1GAWA 4CEJB 4FGUA 1J8VA 4HQFA 4BLTA 4E33A 3K31A 8ATCA 1J6UA 3K2BA 3UFBA 3HUFA 4D9IA 2OXCA 1JR4A 5IG2A 4N8EA 1VMIA 2JZCA 4CFYA 2EW8A 4KQ2A 1G4HA 1G8MA 1WUYA 2KW5A 4RA9B 4ZQFA 2D00A 1KYIA 3UJ7A 5HS6A 2J3JA 2WSSD 4JJGA 3EC7A 1QX3A 2CCJA 4I4NA 3TIGA 4MO2A 4N12A 4MPJA 3S2EA 3VX3A 3IEVA 4RWEA 1HK7A 1WCIA 1PG2A 2JFZA 1HL7A 3LLMA 5BR7A 1I7QB 3KB1A 4B3JA 1ENPA 4KKXB 1AKMA 1NE7A 3PVZA 5F3WB 4DIBA 3UJ8A 4YT8A 1U5BB 1JS1X 2AXNA 3B3JA 2HPZA 3DS8A 4XIIA 1T3LA 1L8LA 4M9ZA 5FYDA 3EODA 1FFGA 2BDEA 2CFOA 4Q6WA 4TMTA 2VA8A 3ES9A 2BGGA 3FGPA 1XK6A 1L6RA 1RC1A 2HIMA 2GETA 3H65A 4IDBA 2HBRA 4YXWA 3ZW7A 1ZR2A 3ZNQA 2UXBB 3NIBA 4MICA 3UQZA 1YZGA 3EJ6A 2IHBA 2O1WA 2FGJA 4HFJA 4JU9A 4YEDA 4DJ5X 1PR4A 2A0YA 4C4YA 1IL0A 4TLAA 2Q1UA 2X5OA 4C1NA 3X1ZA 1T34A 3L84A 4FB4A 2PL3A 3K71B 1XMOB 2H4WA 4HQNA 1XZBA 2HF9A 2LIVA 4U7GA 5DBGA 4CF4A 2Z3ZA 4DDHA 4ZV7A 3KJFA 4QYIA 5EINA 2C99A 3C97A 1XNJA 2YYAA 4RADA 4G4SO 3ZU6A 2XUZA 1X77A 3JYLA 3KR9A 3HJAA 2DHQA 3QBVA 1ID8A 2VBCA 3B1JA 1L6IA 2Q4BA 3BWEA 3C6XA 3F67A 3NGXA 1VM6A 4MA0A 4TUYA 2OO5C 1FX1A 4AWBA 4DSOA 1JR3E 2GARA 3KZKA 2PUWA 4AO7A 3OJ0A 4TKZA 4QRIA 5AR1A 3EZFA 4PCUA 5D1NA 5HCIA 2CNBA 3EXFB 1WE2A 3O3MB 3GGCA 4JY7A 5D5QA 1CUDA 5DIZA 2I65A 5FWYA 1C7IA 2Q45A 3DKKA 5DKFA 3VPFA 5BVHB 1QPGA 3NI2A 4LXYA 5FUMA 4NAVA 2IOFK 4NCNA 1UUFA 5D85A 4DGQA 4FR5A 3KSZO 4PG4A 1OBHA 5ERXA 3LQFA 3ZC3A 2PGOA 5GONF 5AIBA 3G2JA 4UDXX 3F8SA 3UJ6A 4JJAA 2GNAA 3V55A 4YRIA 4N5NA 4RTMA 3OQNA 1PWYE 2RMKA 3R9WA 3D6HA 1RYZA 3ZDZB 2GKSA 2ZM5A 3NWBA 1XA0A 4NZNA 3BORA 3OZTA 2REXB 3W3ZB 5DX8A 5IDXA 1V16B 1V3QE 3CUTA 2JI4A 4O2BF 1IAQA 5FXMA 3MMSA 4CKZA 2D59A 1SOUA 1SC6A 2BMEA 4LV8B 5CM9C 3HBNA 5DSTA 1D2RA 4FR2A 2XVZA 5DHRA 1EVKA 4HYYA 3VOTA 1PR3A 1ULTA 2O2ZA 3C74A 1LDEA 1T15A 3JQQA 2VDOB 4KXXA 5DTQA 2ENWA 5IZCA 1NHGA 3TQQA 1ECGA 3OOJA 2IWRA 2AOXA 3NO4A 3KQHA 1QKKA 3HDTA 3IDOA 3ISVA 3FTDA 2QA5A 4DARA 3QU2A 1BE1A 1I2ZA 2OCLA 1NIPA 3DFZA 1EWKA 2NXNA 5KWJA 4GI1A 1JNXX 1LKZA 2FW0A 3QFRA 4DQ0A 3ZHOA 2ZYAA 4NWIA 1RYMA 2H2IA 3CR8A 4PXSA 3CX8A 3AR3A 2WT4A 4K0RA 2VK8A 1GN8A 3SEAA 3LYUA 4GMKA 4B33A 1E1YA 4FC6A 3IKTA 1EPUA 1O9HA 2G36A 4UVIA 2PY6A 3WGYA 3UUGA 1U3WA 3WYGA 1A4RA 5I4BA 2ZUDA 3L4BA 3D8UA 4PEVA 5MGNA 1SKMA 2FEMA 2QT0A 3M2PA 1OVMA 5CB4F 2C2GA 2Q1XA 4QXPA 3GEEA 4LCJA 4WLFA 3UMMA 1JJBA 1QF9A 5DRYA 2QN3A 2VUSA 1GQRA 1XUOA 4UU8A 4AY2A 3BFVA 4WDQA 4GKKB 4KQXA 4TSRA 1N6LA 3JV7A 4JFRA 2GWRA 3M82A 2WTMA 3CURA 3KJQA 4IX9A 4YUVA 3WYFA 3FJ1A 4ZI7B 3HWX1 4F5ZA 1EX9A 1OFHA 2ECPA 1AE1A 2PSJA 4YJ2F 3FLAA 3KCQA 4YR7A 4MIYA 1QRRA 1SVLA 2V54A 1HEIA 3LHDA 3S1LA 1ND6A 2XYGA 1ODFA 3PNYA 2GZ2A 2XLCA 2W8BB 3A10A 3VDMA 3LFTA 3K6SB 5JNLA 5FI5A 1BXZA 5ALUA 1ZCAA 3Q5DA 2B21A 5JPCA 2O8DA 4TVSA 5KDDA 5B2ZA 3SX0A 2VHWA 3RSGA 2R0QC 4RPJA 1SB9A 3ELBA 1ZGBA 4XIGS 1MAAA 1ES9A 2Q3JA 1RTKA 3KVRA 4RSMA 2DU8A 3TFWA 4B75A 4S1TA 3GH1A 4H1VA 4GPBA 5IPFA 3WHPA 1K5GA 1PNTA 3ST7A 2XGSA 1QB8A 3BE6A 4GP6A 4II3A 4BFUA 4LJ6A 2VF5X 2FPPA 3TVYA 1JLHA 1SELA 3ICWA 1MZPA 1FJHA 1YI0A 4DXHA 2RK4A 3GIWA 4N3CA 3QPCA 4GWGA 2VNKA 1KAHA 4J3JA 2O23A 5K99A 3L0BA 3FCXA 5FFMA 1P0QA 1Y9EA 5CNJA 2IITA 4H7FA 1QVWA 3HZRA 1Z9BA 3FUVA 3JQ9A 5C8XA 1GFWA 3FW1A 3NT4A 5DBFA 4F2GA 1IIRA 3LCVB 2ETXA 3SQLA 3TBHA 3WQQA 1BU5A 4BQPA 1ODSA 4ETNA 1KJNA 2AFIB 2FQQA 2B1GA 2SNIE 2YC2C 4IWXA 4RIIA 3V1NA 3TLCA 3JZIA 3W8NA 3BX1A 2C03A 4AP9A 4DT1A 4DR7B 2FFRA 1QAMA 2AE2A 3BWXA 3ONDA 4ZXFA 1X80A 3MGCA 2PMWB 2P2GA 2QTTA 4AVYA 2CV2A 4PNHA 3RS8A 3S7TA 5DH9A 4U2KA 2FX5A 3RC2A 4G56A 3PYLA 4JZKA 5EUQB 4Z9FA 5IWCA 2UXDB 3QW2A 2H4ZA 2FWAA 1YTLA 1QZZA 4ZAYA 4Z9YA 4GICA 5GZ1A 1PFWA 5AW1A 1GLGA 1BXGB 1VE7A 1FA9A 3AG6A 2Z57A 3COVA 3JYPA 2JEOA 3WAKA 5CMLA 3WIBA 3BFKA 2UZ1A 2ZI6A 2CSXA 3LT1A 1ZH6A 1FXWA 1HA3A 2AYYA 2QMUA 3HYSA 4KIJA 4KHZA 4YAOA 4RENA 1CR4A 4D45A 2JKYA 2QSZA 3LK7A 3P9CA 4ZDIA 2C2YA 1UK9A 2B99A 1DARA 3EW7A 5I9TA 1AKQA 3M89A 1SXJC 4D4GA 2PO5A 4G25A 5BMVF 1KR2A 3USZA 3GFSA 4HD8A 1T26A 4BKQA 4OVKA 4CLRB 1ZGAA 3CLUC 1HBJA 3HRKA 3WLTA 4ZRMA 4LVNA 3V1KA 4RQUA 4UUPA 3GLTA 1KFBB 2J3QA 5B1EA 2VRCD 2ZIVB 3UATA 3PEUA 5K0JA 1N5LA 5KB3A 1UBNA 3CNBA 1TAUA 3A05A 2WP8J 4MUHA 5BR1A 4F91B 2O05A 5ERYA 4U7DA 1SOMA 3IJ5A 5CA0A 3QQ5A 1WY7A 4B3GA 5LJLA 3CT4A 4CM9A 4ND7A 3Q3HA 4M9XA 2C3MA 4G1EB 1Y1SA 3R9IA 1YZFA 1FXWF 2ZJZA 2IEBA 4UHFA 5BWCA 2J33A 1OXUA 3MD9A 2VQ6A 3TSWA 4M1EA 3UICA 4YR9A 3GK3A 4FZ3A 1T1IA 1QS0A 5BWNA 4QDJA 2LCFA 3WXMA 3HKDB 2ECOA 4ODIA 1XKQA 4PTYA 2C4MA 1T9HA 2QJRA 3HR4A 4HDKB 2ZM6B 3D3WB 4C3VA 1Z16A 3RBXA 2NZVG 4NLLA 1XQVA 5FTWA 3IP6A 1FYWA 2ZYRA 3WWCA 4NH4A 1CYEA 1X7YA 2F3QA 3SYKA 1H93A 3CKMA 4R9UC 3UAGA 4DLRA 1CR1A 4F3CA 3OY2A 1DWOA 3GDFA 2XVYA 4DG8A 4R8SA 3PFIA 4JXKA 1IM2A 1R5NA 2A86A 4MB6A 4LTMA 2BFEA 4CM8A 2NU6A 2H1LA 3R9XA 4MKHA 2JATA 4W8OA 2BD0A 2H07A 5EP2A 1UOOA 3ESXA 1E1MA 4DLWA 3QU7A 4CW7A 3KSAC 2UUOA 2GK3A 2NT4A 4BX9A 1EVZA 3EPKA 4LPKA 2IXAA 3WE7A 5LP1A 2KS6A 2Y4OA 3EXG2 2CJPA 3VQTA 3X43A 1QK3A 1FF9A 2DMRA 2Q8NA 4HDNB 1CRZA 1J8DA 2GHIA 3ZE0B 4GRAA 3K2IA 1F14A 2IX3A 5FEMA 4MQ6A 3EIWA 1LK0A 2Y9MB 3FLMA 3QTTA 3AV3A 4PFSA 1ONNA 2H1SA 2QMZA 1JMYA 1X7XA 1FDWA 3IQHX 4PQEA 4E70A 4LHYA 3JR3A 3IRUA 4U5QA 1U0OC 1RXEA 2D7CA 3F6SA 3H04A 4DXDA 3H2KA 4XCVA 1KXJA 3JARA 1G4UR 1ZC4A 4JSRA 3BWBA 3K5HA 2FPSA 1EK1A 4EHFA 2JGNA 4RJIA 5L6LB 1UT5A 5HRUA 4JROA 2Z30A 2X15A 3TW8A 4JBHA 2XMRA 4RVHA 4KN6A 1TKRA 3PXXA 4LYGA 2OAGA 4NMLA 2J30A 2X5XA 3WO1A 3AF0A 2INGX 2R8ZA 3HTXA 1HNZB 2JH9A 4G8CA 4LOIA 1I6LA 1KGDA 1YUNA 4CKBA 1FUKA 5FF9A 5TGTA 1DLJA 3VH3A 1RJ9A 3N0TA 2VDMB 4MV6A 3WWOA 1RHUA 2W7TA 5KHAA 4BO1A 1NMEA 2H92A 4Z0TA 1KI6A 3E22B 4OQLA 2FEKA 1B16A 2XX3A 4L57A 3VPGA 4EGAA 1B00A 3C3WA 3EF1A 2GYWA 4TWRA 4PZAA 2B1QA 5FV7A 2QKYA 4B3CA 3CGGA 2OD9A 2Q7OE 121PA 4PC2A 2DQKA 5JNRA 2VHCA 1N2EA 1SVMA 3GJ3A 3TZHA 4OU5A 1EBFA 1QGUA 1JJ7A 5FO1A 1HDCA 3RVOA 2F8LA 2XOEA 4AZ0B 2J3LA 4HUTA 3CVXA 1KJ9A 1X13A 4PYIA 5GZ3A 4MVJG 2QRNA 5FP0A 1J21A 1THGA 3HPQA 4RNDB 5IBPA 4I36A 4Z54A 3H4VA 3AVXA 4I4IA 4XX0B 4L4RA 4AROA 4B45A 2J48A 3ODPA 4D26A 4U2FA 3D31A 4JA0A 5FT9A 1LWNA 3TR6A 2AOTA 3Q4GA 5C5EA 4RTRA 2IH2A 4KRYA 2AGVA 1CB0A 1L4UA 3CO5A 3CZ5A 3A4LA 3FPHA 5CURA 4RHFA 3H9GA 2G1KA 4Y9TA 2AI2A 1Y8QA 5HF9A 1VJTA 3DEIA 1T9ZA 3NUZA 1JV2B 3PXEA 3T3GA 1P0IA 3LS2A 1SD1A 3AEKB 1UEJA 2H5IA 4P7KA 5HCNA 4YRGA 1TF7A 3MK31 1NF2A 1UM9B 4PCAA 3O93A 1Z0FA 2BFFB 1AQLA 1EFUA 1Y9ZA 3LI2A 3UBMA 4F5EA 1J1IA 4WXMA 1YR8A 4MVWA 4FM9A 3WLQA 4E2XA 4W1PA 1GD1O 3BTSA 1NRWA 3M8KA 4DJDC 3H8SA 1X1SA 1HEUA 2Z56A 3Q5EA 2P1ZA 4DR1B 4BY9E 1C80A 1TU4A 4MQEB 1Z4OA 4LYDA 4R2XA 3W9YA 2VXBA 4YLGA 3ZE1B 2GPBA 4MS3A 3S28A 3MELA 3Q7IA 1S4QA 5IC6A 5EEGA 1RZRA 1E7WA 3NHMA 2ECFA 1MO3A 4JEIA 5LU8A 1OJLA 3S99A 1KBQA 1J70A 2Z04A 1PYOA 3B1ZA 2IOFA 3F6EX 3HFSA 3HN7A 2Z1MA 1A71A 3I01M 1WKVA 1DIGA 1BA2A 2PXCA 3V1TC 1PR6A 2KX7A 4DWVA 3EGOA 4ANFA 4X9XA 4C0WA 5AI9A 3WS7