3GJ0A

Crystal structure of human rangdp
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
207
structure length
207
Chain Sequence
SAAQGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Crystallographic and Biochemical Analysis of the Ran-binding Zinc Finger Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 67
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gj0A00
2QM7A 2HT1A 3BB4A 2QQ0A 3BFVA 3AKYA 1NVVR 5JI3E 4A1FA 4UKDA 3EW9A 1E2IA 3MUFA 1ZIPA 4IFEA 4WIAA 3KQLA 3LW7A 1KI2A 1KO7A 2UKDA 3I3SR 1RRGA 1VCIA 4KSCA 4QJ5A 5FOWA 1HUQA 3QXSA 2ZRBA 3CR8A 5B2ZA 1Z2CA 4HUQB 3UG7A 4UJ5A 4WXRA 2ZI4A 2GEVA 2QY9A 3DHWC 4JBYA 2GJ8A 1G16A 5CYOA 3QKTA 1FPMA 4GI7A 3EPHA 4PC1A 1OT3A 3IGFA 4NYJR 4XVRA 1GVNB 3KJIA 2KE5A 2NG1A 1G5PA 3AUXA 3HYTA 4KHZA 3OFND 1KI7A 4LBZA 1KO1A 3PR1A 3ZD7A 2QTHA 2QM8A 3VNVA 5AUPB 1GKIA 3NBZC 5FFMA 3L8ZA 4DT1B 3FMFA 3ZS9A 4U7DA 121PA 1NMZA 3OEEA 1JXMA 3BGWA 4OI4A 5IK2D 2YKGA 4HB3A 2P0EA 3B8HA 4TMXA 4LV8B 4BGDA 3ECCA 5CLLA 4W7SA 3P27A 4BECA 3LFUA 3THWB 1YZQA 2W2TA 1WMSA 2IUUA 2R6AA 4NHOA 2NQ2C 1SXJD 4Q1FA 3LWNA 2DPXA 4PZLA 2VYFA 4LCBA 4Z8XA 3VKWA 4BFTA 1VCOA 2A5GA 3WMGA 2EW1A 1T9HA 3NEYA 4Q18A 2YWEA 4PSAA 2QTFA 1UJ2A 1TQ6A 4GDFA 4JJKA 4GOKA 4US1R 5FTJA 4QOSA 5DSZA 1A1VA 1G4UR 5F2EA 5KSYA 5AUQA 5BW8A 4YMSA 2CHGA 1R8QA 1XP8A 2QAGC 4RD2A 5DNYB 1AZTA 4BFZA 2WICA 1ZMXA 3MMPA 3KQNA 1JALA 3K0FB 3ZZTA 1FL9A 3VQTA 4QFMA 1FFHA 3NWJA 1OIXA 4M53A 3AH8A 3VKHA 2DWOA 3BERA 1MRSA 4RKEA 4C0QC 3GD7A 4KFTA 4PQYA 2WWYA 5DYIA 4A82A 4NCIA 3HU2A 5IHPA 1K5DA 2FMXA 4U02A 4AURA 1OXVA 2VHUA 2XSZD 4Q4AB 1CR1A 1N0WA 3MG9A 4TLAA 2AXNA 2QQEA 2KB0A 3ZVNA 3NC0C 4Q9IA 4WBSA 5AJYA 4DLZA 4EFLA 4YXWD 3K70B 5JI2E 1BO6A 1NIPA 1T8UA 4L5BA 1KI8A 3BK7A 4AKHA 1GDDA 1E69A 2P6RA 4AI6A 2F55A 1SVWA 4NMMA 2AWNA 3VX4A 3PEUA 4JBWA 5TARA 4NH0A 3QF7A 3QQ5A 3B9QA 2V55B 2Z43A 1A82A 4DSUA 1AKYA 1Q0UA 2P6UA 3CF2A 4KFSA 4P4SA 5AK0A 1OFTA 4MRNA 5JZVA 5TV2A 3NH6A 5D3MA 2QMOA 5C18A 1YR6A 1NF3A 1SXJA 3K9GA 4Q47A 1AM4D 2YWGA 4WZ6A 5GJWC 4HDCA 2C9OA 3GEHA 1MO4A 1UBGA 1N5KA 2F3RA 1LTQA 3OIVA 2XEXA 3L8YA 2ZYVX 4EPTA 3QXXA 2G6BA 3SC3A 5DHFA 4D0GA 3GLHA 1P62B 1E9BA 4MYUA 2QGZA 1RRPA 3TQFA 1NRJB 2O8EB 4KO8A 4YMUA 2OESA 2HJGA 4DHEA 4YC7A 3K09C 4BRUA 2X2EA 1L7VC 3L0OA 3AP1A 3FHTA 3U3MA 4TYNA 4A92A 1NI3A 1G18A 4DEXA 1X3SA 3ND9A 2GXAA 3I5XA 2AD5A 3X1ZA 1LS6A 2I4IA 2RMKA 4RJLA 1G291 1L4UA 2MMGA 3RC8A 1ZVQA 4RZUA 5FTNA 1OIVA 4FMDF 3TJZA 2BEKA 2NGRA 5G3ZA 1EK0A 3FYHA 2DHRA 2XAUA 4E22A 4B74A 2ZU0C 3MRSA 2HUPA 2BV3A 2WKQA 2ZPTX 2A2ZA 2BEJA 5DE3A 3UXMA 4A2WA 2X2FA 1G3MA 3AVYA 821PA 1OH7A 2D62A 4FIDA 4C9BA 1U8AA 1OSNA 5H68A 2O8BA 2BMFA 2H57A 2OCAA 2VIIA 1E0KA 1R5OA 1QHHA 2CLSA 3D31A 4NKRA 1FTNA 4NYIR 5ELXA 1LFDB 1P2SA 4ARZB 5DYGA 5KYKA 1N6NA 4EPVA 1S1MA 4M9XA 1F3OA 4HYYA 1OV4A 1PUJA 1KK0A 2ZSFA 3EZ6A 1GKUB 4Q4JB 2YC2C 5D3QA 3JZAA 4O2LA 4Q03A 3R7WA 5JWHA 1XEFA 2P3SA 2ZE8A 3QOFA 3A1SA 2GTPA 2VF8A 2W58A 3KJHA 5DHAA 4B3BA 1G8GA 3RRMA 2G1JA 3VTKA 1WB9A 2C99A 2F43A 2QRZA 4LHVA 1FNNA 1W7AA 3OHMA 2D2EA 4HAVA 4TL6A 3PUXA 3ZQJA 4ASUD 3JVVA 2D3WA 2NZJA 1KAOA 1TNDA 1IAQA 4PSVA 1VG1A 2V6JA 3BB1A 4ESHA 3AEZA 1ZU5A 1GP2A 3B1YA 4E5UA 4F4JA 2B92A 2WWFA 1N5IA 1SVOA 1X6VA 4R9UC 4Q9JA 5EUQB 1JB1A 3UPUA 5FOUA 1TQ4A 2XX3A 1OXTA 4AC9A 4UJ3A 4ITRC 2G9NA 3VKGA 1XX6A 3V9PA 1US8A 4EUNA 2Q3MA 1BH2A 2ZRLA 2EVWX 3U6BA 4V0OA 3FVQA 1YR8A 1E2MA 5IF9A 4YMTA 3U7GA 2CLCX 4WZAE 1EG7A 2AD1A 4A2PA 4ZDKA 2PMKA 4DZZA 2WWIA 2O8CB 4TMVA 3WXMA 3IBYA 2F1HA 4KFUA 1S3SA 3K0AB 2YOFA 4HDQB 3ND8A 2FZ4A 4US0R 1AS3A 1XEXA 3P32A 4TQAA 3U7HB 2PCLA 5KNBA 2ZRMA 5HKKA 2DR3A 3HU3A 2LKCA 1R0XA 1QVRA 3QF4B 5CM9C 3T5DA 5BWMA 4RD3A 4C3ZA 3LNCA 4W5JA 2IS1A 2HCBA 2F9MA 1RYHA 3VAAA 4B34A 5JEDA 4CZ2A 5EZ6B 1DVRA 4QL3A 2GJKA 3HPQA 3QKRA 2WJGA 1W36D 4TLCA 2CMKA 5EXPA 1I2DA 4RFSB 2FSFA 1R5NA 4BZPA 2IWHA 1DPFA 4D4MA 2H8KA 3B2EA 2J87A 5TXGA 2JJ2A 3CUEF 2VP6A 2PEYA 3DPUA 2R44A 3HR7A 5C1BA 4NYIQ 1II0A 2D4HA 1Z0FA 1IY0A 2J7PD 2ZSDA 4ASUA 2HYIC 2JJ1A 3JZMA 2FNAA 4HUQA 4JLVA 4B2PA 4BLRA 1M34E 3V4RA 3BAFA 2J0SA 2IF0A 4MA4A 1E98A 1ZCBA 2F1RA 2OFXA 2VP5A 4JLBA 4C2TA 4JIMA 3PEWA 4I81A 3GJ5A 4TL9A 2WAYA 2Z83A 2F1JA 4JJZA 1W48A 1G7RA 4U00A 2FDCA 1VIAA 1EXMA 4FXPA 4DT1A 3AP2A 1FX0B 2FF7A 2MSEB 3FKSD 1T91A 5DN6A 2CDNA 2NO6A 4PHHA 5IDVA 1G1MA 4XSGA 2BBWA 3EPKA 4HI0E 3ONWA 1JR3A 4PHFA 5HCNA 4LK2A 2QE7A 3M1IA 3THWA 2VBCA 1E4VA 2GESA 2YZ2A 3GLGB 3BXZA 2ZREA 3C41J 4D0NA 1YZKA 3KQHA 3CRMA 3CNOA 1L8QA 3CRQA 3O47A 1RPZA 2GXQA 3FFBA 2QGNA 1Q12A 2P2LA 3F5FA 3T5GA 4L9WA 3H0KA 4GT1A 4A6XA 5J4KA 1NY6A 1IXZA 4LHYA 4TMZA 3LDAA 4HZUB 4A15A 1VMAA 4G5RA 4URVR 1IY1A 1M1YE 4O0MA 1FQKA 2FGKA 1Y3AA 3I92A 5E4FA 4V02A 4RD1A 2GXSA 1Z06A 4E09A 2WPDD 3T1VA 1G3QA 1IQPA 3K0FA 2BKUA 4LHZA 1Z6TA 3TAUA 4ACBA 3DDCA 2BM0A 3H84A 3NTUA 3RSLA 1P9RA 1KOFA 3GEEA 1W0JD 1T5LA 2FEOA 2EYQA 1KZGB 1DBSA 2YWFA 3K53A 1UADA 1XJ0A 4AYXA 1MABB 1E32A 4OHYA 3IUYA 3PEVA 4Q4AA 2OBLA 2F3TA 3ZQ6A 1AQUA 3UWOA 1Z6GA 2O0KA 4MKHA 3LAWA 1D2EA 4NYMR 4WXPA 4TSFD 2A30A 4IKEA 1ZINA 3CH4B 5JBQA 1GKYA 4Q7JB 2BC9A 4MUBA 1N5LA 4A36A 4IOKA 2ATVA 5E7IA 3AKDA 4CEJA 3LXXA 1MH1A 1JBKA 2DYKA 4B35A 1Z22A 5FPYA 4AWXA 2XTNA 1CS4C 2XNDD 4KVGA 4RZXA 3VHXA 4LWZA 4G5OA 1E2JA 2YYZA 2J45A 3B60A 3BS4A 3AGQA 3BJIC 4NBSA 4NCJA 4RVCA 4R2IA 1Z07A 1U90A 2OFWA 2WOOA 2FSIA 4X8LA 5DI3A 1XCGB 3W6PA 1G6HA 4V0ME 4BFUA 3NKVA 3CF0A 4FN5A 4BLOA 5KNDA 5L3QB 4QBGB 1F2TB 1K6MA 3H4MA 4AIIA 1II9A 1AN0A 3PENA 2DFLA 2XNSA 2Z4RA 1NMYA 5KSZA 1OH8A 5L8VA 1Z47A 2HV8A 1JAIA 1WA5A 3X2SA 1KMHA 2IT1A 5J4YA 3DOFA 2C96A 2PT7A 1C4OA 2YV5A 4I1VA 1KIMA 4F7WA 3VR6A 1T0HB 4MH0R 2WPDA 4CIDA 3WP1B 2O8EA 2ASEA 1E1RA 4ILEA 2BCJQ 2W6IA 5EE0A 4QHTA 4DIDA 2QPOA 3BFXA 4PAMA 1EFCA 1JEEA 3MWLA 3LY5A 4C0HA 2ZYUX 2IYXA 3H2YA 4DCTA 2MMCA 4EFNA 2IW3A 4NZYA 3OZXA 3SBDA 1W0JA 3ADKA 3C7KA 3EWSA 4V0LA 3SEAA 2J9RA 4Q1DA 3W3ZB 5KDDA 2OLJA 3WYFA 4TZ6A 4XWAA 4LPSA 5HPYB 3RLFA 3A8TA 1Z5ZA 2ZE7A 1E6CA 3EPJA 3CZQA 5FR2A 1N6RA 4L8GA 4TSFA 3NC1C 3WP0A 1NY5A 1U9IC 1JEDA 1DAKA 2XJ4A 3LA6A 1BMFD 5AWFC 3N2EA 4IXMA 4D81A 1J8YF 3NH9A 1PZNA 3GJ7A 1FNMA 5FUVA 1BKDR 3GLFB 3DMNA 1KJYA 3EZ2A 3ZIAA 4BFYA 3C5CA 3Q8XB 1KI6A 1DAIA 3PJRA 4GMXA 1TL7C 1V5WA 3TVTA 5F98A 4ARZA 3KKQA 1GL7A 1P5ZB 3EZFA 4MGIR 1NJGA 1YZGA 3F8TA 3OF5A 3CRRA 4NYMQ 4C4PA 1I4TD 1KK1A 3W9YA 1ZNWA 5FPSA 4IVRA 3T61A 4Q4JA 2ONKA 1XPRA 3A36A 1P60A 3PIRA 2BBTA 4A2QA 3W6NA 1KDRA 2QRNA 5FBLB 3P26A 1FZQA 4RZ3A 1KSFX 2X8AA 3CWZA 4BFXA 1RIFA 4MYCA 2SHKA 2OCPA 4C7OB 5TY0A 1COWD 4CYMA 4MDEA 1N2CE 2FH5B 2JLXA 4Q9LA 4OHZA 1XCPA 1UKVY 5IT5A 1M7HA 4IOJA 3LV8A 4DLUA 1FTSA 1VHTA 1Z0AA 4O2RA 1OB5A 1P7CA 1YE8A 3QG1A 4DRZA 1TEXA 1Z29A 1ZC3A 4BPBA 3OIYA 2YJTD 2IYWA 1S3GA 3ZVMA 4QBIA 1U8YA 5DO9A 2ZSAA 1Z63A 1SHKA 3PCRB 1UPTA 2P5TB 2VTKA 2BIFA 3UMFA 1ZBDA 1YZUA 3E70C 3OAAD 1W4CA 5GJCA 2ATXA 3AV0B 4QM7A 5EE3A 4MITA 2GWHA 1G8PA 4UXHA 2O8BB 1GRRA 1QG2A 3SU8A 2Z0MA 3NHBA 4ZI2A 2O8CA 3RANA 4IHQA 4S35A 2ZUDA 2RHDA 2Z5FA 5E95A 5TB5A 1Q3HA 4LJYA 4B6FA 4C0KA 4ERNA 4LYFA 1RVDA 3K0AA 4B44A 5FL7A 1BMFA 1G7SA 1OE0A 1YHNA 2Q21A 3BIFA 3GJ4A 4A8JC 2TMKA 4Q4LA 2RGDA 5FL3A 3B1VA 1TQ2A 3R7WB 4MYHA 2OT3B 3NIBA 4JLMA 3KKPA 3TUIC 1CRQA 2ZSEA 3NEJA 1S0UA 2BOVA 4HZIA 5FBRB 2H1LA 4XVQA 4TLDA 4Z51A 1IN6A 4HAWA 1Z0JA 2IYVA 5FBQB 4KU4A 3IIJA 1Z6XA 2CCJA 1TF2A 1MOZA 1B0UA 2VO1A 1XFAA 5L3VA 3MAAC 4EJSB 4LPKA 2DFTA 4EQ6B 1NSFA 1E2FA 1WRBA 2RH5A 2B8TA 2J3EA 1P73A 2ZRFA 3KTAB 4RFSA 2XGJA 1BS1A 4IDQA 2RGCA 3TE6A 3AQ4A 4JL6A 3TH5A 1COWA 3B7GA 1NN5A 4OJQA 4RY2A 4L4UA 1A2KC 1W0KD 2OAQ1 3AKCA 4Q66C 3EIEA 5BN5A 4JLJA 1FOEB 3LVRE 3KKNA 1N25A 4JYBA 4QHYA 1S1CA 2RGXA 4ZKEA 1OLOA 4DLRA 1WE2A 3BORA 3EARA 4XIGS 5TMPA 1IXSB 4C0BA 4YMWA 1QHIA 2IYLD 3SHWA 1CXZA 3CZPA 1IM2A 3OAAA 4M22A 2B8WA 3DVLA 4LJ5A 4KV9A 5L3RA 3TVDA 3G82C 1FX0A 4LY6A 4E03A 3B1WA 3N5CA 1NN1A 4AG5A 4LX0A 3FMOB 3LQQA 4B3CA 1EFRD 2XXAB 3HYRA 1TEVA 4P3YA 4BUJA 4KVAA 3U6KA 1Q1BA 3EIHA 4D2IA 1E9CA 3UG6A 5E7MA 4M1TA 3SQWA 1DADA 3GLGA 2D2FA 3MJRA 3OEHD 1YR9A 5EJEA 2IHYA 3OIUA 2V3CC 3U61B 1Z0KA 2RGNC 4HAZA 2CNWA 3REGA 2IYUA 5CM8B 4KAXA 4LDJA 4TLBA 3WMFA 1E2PA 2OLKA 1SVLA 3ZVRA 4EIWA 2CVHA 4FW9A 2OV2A 2QBYA 5J4VA 1J70A 4A0RA 4HZUA 2WVJA 3GP8A 2UVQA 1YQTA 4LBWA 1Z0DA 1JJVA 4Q9KA 3WRXC 2WWXA 1J8MF 4QGAA 2Q0HA 2NO0A 1EFHA 2OXRA 1OB2A 1W44A 5GVRA 2FSGA 4QM6A 4P4UA 1A7JA 5FR1A 3T12A 2PX3A 3KUDA 3TRFA 2BBOA 4UXJA 4OK3A 5CDFE 1W1WA 4D25A 2B7BA 5A0FA 3ZVLA 3TGPA 2JA1A 2OBNA 2OUKA 2R65A 3ZDQA 3KKOA 2V7QD 3ICEA 1G5RA 4B32A 1IONA 4DLYA 1MABA 4GZLA 3AVVA 1VCNA 2ZAMA 4PHGA 4AY2A 1CULC 4DLWA 1NG9A 1JI0A 1AQYA 3G5UA 4G3XA 1NVXQ 4R98A 2JATA 1H8HD 3EXAA 2FU5C 4YDSA 1Z0IA 1ZD9A 1PLKA 1Z2AA 1M8PA 1N6PA 1X8LA 4LC1A 1HT1E 4DDVA 1G3RA 1HQCA 1E2QA 1Q1QA 5DH9A 4WW0A 4B3GA 4WOPA 5EP2A 3R9WA 1YRBA 4Z1MA 4CEIB 3U5ZB 4AKIA 2CE2X 2HJVA 1J90A 1ZYUA 4FMCB 1NJFA 3QNUA 3SR0A 1XCMA 2NMVA 4HUTA 4H1VA 5K8TA 1SGWA 1CJVC 2WMNB 5GJVC 4A9AA 5JWRA 3HDTA 1E79A 2QPTA 4I1SA 2AFHE 2IXGA 2OFOA 2JEOA 2FA9A 3L0PA 3MFYA 4P31A 1U98A 1E0SA 4YONB 5A5GA 1QHGA 4GRAA 4PO8A 2IYTA 3OEHA 4ZDJA 4JKYA 1W36B 4HSEA 3U44B 1ZUIA 3KB1A 5L3QA 3FOZA 1F2TA 2Q9CA 2VHCA 1T0JB 2EFCB 3WNCA 4AD8A 4Q19A 2IXEA 2QT0A 3LBHA 4G5SA 3RWOA 2ZI5A 4BLQA 1CTQA 4EPRA 1W49A 4XVUA 2ZRDA 4XH9B 1JQJC 1XB2A 4BRWA 4ZCLA 4JLPA 3RS5A 1XMSA 1NMXA 5B30A 1OPXA 2QEQA 1BIFA 2PJZA 5FH9A 5FUXA 1EFUA 1N0VC 4F4IA 3NBYC 1KO8A 4DSNA 1RC8A 1G21E 1NBME 1VHLA 2X19A 4US2R 4BEBA 2WJVA 1Z83A 1NVVQ 4Q01A 2RAPA 3TSWA 1Z6AA 1EESA 1E9FA 3OFNA 4EDHA 3QEJA 3L82B 5J4HA 4CEJB 3RWMB 4JVSB 5K8UA 1UDXA 3LD9A 2AL7A 5IK2A 5F3WB 2H92A 2I1QA 2PX0A 4Q7MB 1DO2A 4OYHA 3FFAA 3EX7C 2RB4A 3MSXA 4WA7A 1H8HA 4B75A 4LGMA 3KXKA 2WSSD 1W2GA 1DE0A 4NYJQ 4Q48A 1ANKA 5DI3B 3N70A 3GLFA 4Q7KA 1ZJ6A 1DAGA 3C5HA 3LVQE 3TKLA 4B2IA 2ZRCA 4GL2A 1OXUA 4HATA 2NO7A 4KXFB 2W83A 4OQNA 1KTVA 3ZGXA 5KHOC 2OEPA 2PLRA 1KMHB 1XU4A 2ZR9A 2VSOA 4MRSA 1X1RA 4Q1BA 5C46F 3I72A 3D7MA 4M8NE 4OJKA 2WZQA 2ZETA 2YHSA 5EE1A 4DSOA 1VCMA 3B13B 4B6EA 2CL6X 4C7OA 3FDIA 1IXRC 4N3NA 4LJ9A 4GOJA 3A4LA 1H65A 3AVQA 4Q7LA 5L3SB 1AK2A 1KI1A 4B33A 2NO1A 3C16C 4V03A 5AJXA 5J47A 1OXXK 2XSZA 4AK9A 4FWIB 4TL8A 1VYUA 3K09A 2B6HA 4MRVA 4N0EA 5G3YA 3Q85A 2ZI6A 4ESVA 2WJIA 3SN6A 2BCGY 3IILA 5FOTA 4YXWA 1IOZA 1HURA 1E9EA 2D7CA 1Q20A 3K9NA 1JNYA 2ZEJA 1NKSA 1GSIA 2C03A 1XMVA 3U3RA 4XWOA 2IEYA 1A5TA 3TUJC 4QHSA 4ACAA 4KI0A 1KI6B 3EASA 1F2UB 1U8ZA 1QDEA 4XTRA 1R2QA 1W4AA 5KDLA 4LC0A 2IC5A 4KSBA 2CEAA 4CW7A 2ZM5A 4DB4A 5EE9A 3AVUA 3IIKA 2IYZA 2V1XA 4MRRA 2ZIAA 3CRVA 3BBPA 4JSTA 3KFXA 1C9KA 1CIPA 5TVKA 2EFGA 4PANA 5J5CA 1LF5A 4KLZA 5CB6A 4D26A 1RYFA 2XB2A 2ORWA 4Q1CA 3GFPA 5GJBA 1OKKD 2H17A 2QAJA 2J46A 1SVSA 2A5FA 1UBCA 2HF8A 3U3OA 1ESNA 1XTJA 1KKLA 4BFWA 3UWKA 4MDFA 2E9SA 4Q02A 5JJLA 2ZJBA 5CLQA 1UAAA 4D4LA 2QP3A 2RGAA 1G6OA 3GQBA 3RAPR 4B73A 1MO3A 3U60B 1GNRA 4URUR 4EJSA 2BJVA 4DB2A 4EQ6A 2IBMA 1R5BA 2V54A 2OE2A 2WBLC 2YOGA 4OQLA 2VL7A 4MGYR 1HEIA 4X8HA 4Y0AA 5EZ5A 3KTAA 5LB4A 1DG3A 1ZD1A 2BMDA 3QXCA 2OO7A 2J7KA 3BH0A 1H8ED 1ZC4A 3U7FB 3OESA 3PUZA 2JLZA 3WHLA 3N2IA 2ZRGA 2GKSA 2KSQA 3LX8A 4FCTA 3IEVA 1N0UA 1RE0A 2GK6A 4D82A 4Q4HB 1BYUA 1MT0A 2HLDD 2J0UB 1JPNA 1M6NA 3PUVA 2VHTA 2Q3FA 1XMIA 4AYWA 3RVBA 3GJ3A 4ZCMA 3DKVA 4YLGA 5AR1A 2VP2A 2CK3D 5KPDA 1LV7A 4IFBA 3TK1A 4B76A 5C2JB 1YVDA 5KSOA 4OKSA 2QMEA 4PXAA 4WVFA 1AGRA 1W47A 2EFEB 1G64A 1GNQA 5AJWA 1NBMD 5UKDA 2ZJYA 3R8FA 4DC9A 2XXAA 2IX3A 3TIFA 2ZJAA 4A8JB 1R10A 3GLIE 5CJ2A 2V9PA 3K9HA 3I4LA 1R0YA 4IVQA 2IHBA 1N6IA 4HLUC 4I99A 3CNNA 2JLUA 3PEYA 2ZYTX 3DZ8A 4JT4A 1XD2B 3GFTA 3WYGA 1E2HA 1HV8A 4GSYA 4HLDA 4QRHA 2HEIA 4DDTA 2AFIE 1GOTA 3FGNA 4Q9HA 1EWQA 2AKYA 2GILA 1S8FA 2ZU6A 3A6PC 1HA3A 4UNRA 2FSHA 1ZIOA 2ZRJA 1VYTA 2EQBA 8OHMA 2R6DA 3L0SA 1KMQA 5G41A 4URXR 2XOKD 2CXXA 4P4TA 1P4SA 3K8YA 1G3IA 5KTYA 1DELA 2HXSA 3SFZA 4XJXA 1KNQA 4PTLA 3TW4A 2QZ4A 3TNFA 2J59A 1T6NA 1TF7A 2GVDC 3U7EB 5HE8A 4FI3C 1G17A 4KFRA 2HLDA 2VRWA 4IOLA 3AKEA 5KNCA 1DOAA 4OBEA 3KXLA 3W5IA 2J0VA 3IPXA 1SHZA 2O52A 2ODNA 3CNLA 2AXPA 2CK3A 4HDOB 4WZBE 1GUAA 4LYJA 2DB3A 5FUYA 1PV4A 2IK8A 1JR6A 1TF5A 4CEIA 2ZJOA 1TX4B 2EFDB 3C14C 5AUOB 1XTSA 1OXSC 4MKFA 3X1YA 1KYIA 2QBYB 4DCVA 2QSYA 4TQ9A 3Q9LA 421PA 4M1WA 4HB2A 3BD9A 3AB3A 2WHXA 3Q7QA 4C0JA 3FB4A 1DG1G 1ZM7A 5HCIA 2B21A 1GIAA 2IF2A 1D9ZA 4HAYA 1YJ5A 2W00A 3A37A 4GOXA 3U44A 4JLOA 4IDNA 1M74A 3I8XA 2BVNA 4DUGD 4TMKA 1VYVA 2X1VA 4JLNA 4C0SA 3QG5A 1TPZA 1P72A 3NBFA 3RC3A 3T35A 2O8FB 3IQWA 2J7PA 1XPUA 4QXAA 1UM8A 1HQYE 1YU9A 2ZJ8A 1SQ5A 4CEHB 3BRWD 2Q3HA 4DDWA 3AF2A 3WNBA 1UBFA 2C95A 4DKXA 1M7BA 4NU0A 2WJJA 1LF0A 1GM5A 2X77A 4W5HA 1D8TA 2H16A 2ZJZA 5FOSA 2IYYA 1VTKA 2ZRPA 2YVUA 3W8NA 1T8TA 1ZCAA 2QSZA 1AGPA 3LRPA 4Z54A 2BMJA 4NL4H 2EU8A 1KK2A 4PC3A 4GNKA 3FKSA 4G5QA 4BFVA 5JMTA 1KY2A 5G53C 3C4JA 5K8IA 3QE0A 4M2LA 4LJAA 2VLIA 3R9IA 1LNZA 4NE2A 4P33A 4C0LA 1U0LA 2GRJA 3B1XA 1E2KA 5LB2A 4JS0A 2BKEA 2PMDA 3W34A 3AF0A 1TAGA 5CIQA 4TYWA 3CBQA 1NP6A 3AP3A 3CPHA 2PCJA 4HEJA 3J81k 2JLSA 3I1FA 1UKZA 2AHOA 1G9XA 4OQMA 3BOSA 4BFSA 5C4GB 3SZRA 2G1KA 2ZJ2A 5CK5A 1G8HA 4XTCS 2JCSA 4M21A 2E87A 2QAGB 4PR0A 1MO5A 4K8OA 1WP9A 6Q21A 1P9NA 4N0DA 1YR7A 2QROA 4DLVA 2JGNA 2GEUA 4BQSA 1OJLA 1G7CA 4TZ0A 3AVPA 3LW8A 1ONBA 1HY3A 2OZEA 3VR5A 1IN4A 1P6XA 4BLSA 5KU1A 1P9WA 1BYIA 521PA 1UDWA 2DFNA 2A9KA 5L3SA 2EWVA 2ZANA 1CU1A 1E4YA 5FTLA 1CF4A 4M1MA 2OSBA 1G20E 1OHHD 1ZNZA 4Q1EA 1YZNA 4F91B 2VH5R 2GAOA 1R7RA 3DMDA 4FCWA 4RD6A 4B3XA 4JVLA 3ADDA 2GJ9A 5DISB 1LY1A 4ON9A 2ODEA 3CLVA 4RCZA 1IY2A 4RD4A 1F2UA 2QI9C 1XDBA 2QORA 2Q9BA 2XNDA 3ZD6A 621PA 1U9IA 3REFA 5G40A 1FQJA 2HCJB 2ORIA 3WYAA 4NDZA 4PFSA 4DVGA 5CITA 2V6IA 3VNUA 3QI2A 1GWNA 4NPHA 4P0TA 1XPOA 1PVOA 2B7CA 4I4LA 4BASA 1ZUNB 4HAUA 1CJUC 1XTQA 1U81A 4DDUA 3EC2A 2K5UA 1J2JA 3OE7D 1XJQA 4YMVA 4QBFA 4BEJA 1K8RA 4LYAA 1ZRHA 4PSKA 3MJHA 4L16A 3LQRA 2P6NA 2J41A 2Q6TA 2C98A 1DAFA 1ODFA 3AVTA 4L9SA 3TMKA 3LO5A 4YDHB 2WIBA 1ESMA 4FMDB 3R20A 3SNHA 3M4YA 3HP1A 4MUAA 4ZI3A 4J0QA 2ZI3A 5A4JA 5K8LA 1F48A 1WCV1 2VEDA 2O0JA 3QPUA 5E3HA 3NDBB 2FFAA 2IYRA 4OQXA 4M9ZA 3SE0A 4CGZA 1B23P 2EYUA 1TU3A 4LJ7A 2I1VB 2EWWA 2XJ9A 2VQSA 1CJTC 2V8OA 4PAOA 4QNRA 1O3YA 3GPLA 4Q4HA 1XTKA 2O8DB 3H86A 1VKJA 2J0UA 4ZO4A 3RHFA 1XMJA 4B3FX 1SXJE 1P2UA 5GADl 4IDPA 1NN0A 1YZLA 3WRYC 3E5HA 4M0LA 1HT2E 4RCYA 2QUZA 4LJ4A 1OF1A 1XZQA 3PG5A 1Q3TA 4F38A 1DS6A 1NKTA 4B71A 4PC6A 3RS3A 1Z6YA 2OCYC 3GLHE 1W46A 3I5YA 1XJCA 1K5GA 3QBVA 1JXOA 2XB4A 3T1TA 2WOJA 4M1OA 4D0LB 4A8JA 5JHHB 5CYPA 1C1YA 2VP0A 3QPVA 1N6KA 2ERYA 4IOMA 3GMTA 2BMEA 5KPJA 4JLKA 1R0WA 4OI2A 1KJWA 2NTYC 3VR2A 2FEMA 1RZ3A 4IEIA 3AVXA 2GVZC 4LBYA 2W2XA 1KI9A 1D6JA 1PJRA 3VX3A 1GTVA 2H18A 2GEDA 1SZPA 1XD2A 2IUSA 1AJEA 3C8UA 4JL5A 1HYQA 5FPKA 1AZSC 3LH5A 2YC4C 4HLQB 4JVMA 1N6HA 3JVUA 5C4MA 5H70A 2GNOA 1E1QD 3F3YA 3KXIA 721PA 5JRJA 1GL6A 2GDJA 4GP6A 1SKYE 3TSZA 5JSZB 2R6FA 1UKEA 2FE4A 2R2AA 3PXGA 4P32A 4KJZA 1WDTA 1TTTA 4A6PA 2N1BA 4B43A 1F5NA 1P75A 3FE2A 3GEIA 1R8SA 2PL3A 2WWHA 5B57C 2GF0A 4X8OA 3A1UA 4U5XA 4PPQA 2ZXUA 5AJVB 3EZ9A 1GG2A 1KJZA 2PZGA 3IEUA 4QKQA 1NLFA 1EGAA 1IBRA 3OEED 3EAQA 4JT2A 1NLZA 5BYJA 3SJAA 3WHKA 4ZIRB 3TUZC 3W8RA 3W5JA 5JJKA 2OHFA 3DM5A 1SVIA 2CJWB 1XRJA 5SZHB 3U3JA 2GBLC 1CJMA 2DBYA 4ZPXA 5FBWB 4DEYA 4XSHA 2ZE5A 2QTVB 3K0CC 5HTKA 1RW4A 1UFQA 2OXCA 4PPGA 3GFOA 3K0SA 2AX4A 2BM1A 4URYR 3WNDA 1XXHE 4NCHA 4CT4B 2GHIA 1JECA 3SOPA 3QKSB 3V00A 1FMJA 3FMIA 2PEZA 5IRCD 1R4AA 4PHTA 1GNPA 2JIZD 3B5JA 3OIWA 2FJUA 3PUWA 1PLJA 2RGNA 3LXRA 1P2VA 4KYIB 1KO4A 4JBXA 2R6CA 2C2HA 2PT5A 3EA0A 3FTQA 1D2MA 3K0EA 3X1WA 5JHGB 3NBXX 1I2MA 1JAHA 4TMTA 5EQTA 4LV6A 4A0FA 1MO6A 2D7DA 1RKBA 2DFKB 1MR3F 3M6AA 4JVNA 2O8FA 4QBHA 4KODA 1W0KA 1UBEA 1FP7A 1ZNXA 2ZS7A 1DO0A 3O8BA 5FI0B 4DLSA 1E2DA 1T3HA 1YRAA 4JLDA 1E1QA 3CKLA 3W6OA 4V0MA 4CEHA 2J0QA 4PPNA 3I73A 4Y0VA 4HB0A 4MRPA 3TBKA 2WJYA 1Q1ZA 3K1JA 3RABA 3CO5A 2YOHA 2NPIA 4K46A 1CKEA 4URWR 2GZDA 3BFKA 2QP4A 2ZS9A 2ODBA 4TQUS 1XZPA 5BN3A 4G0NA 1MRNA 4HAXA 2VPPA 3LBIA 2QN6A 4PQFA 2IUTA 3Q3JB 3AF4A 1G4AE 1XF9A 3SFVA 1OFUX 4AG6A 1EFRA 3IO5A 3PUYA 2MSDB 2VHQA 3RSOA 1OYWA 3VR1A 4NTZA 4LUCA 4D4KA 1Z08A 5DI9A 1GL9B 1CBUA 2GCOB 4JL8A 1OW3B 1Q21A 2CBZA 5CK4A 3RS7A 4DBLC 1GRQA 3CR7A 2GCPA 2GK7A 4TTRA 2JJ8A 4UNNA 2Y8EA 4BWYA 1UKYA 2G77B 3NXSA 4R7ZA 2XITA 5P21A 3S1AB 1XD9A 2BWJA 1E3MA 2GXUA 1OFHA 2ZYWX 4FCVA 3E1SA 4M4SA 1E9SA 2F6RA 3A58B 3FWYA 2QAGA 4GZMA 2AR7A 2JIZA 2PZEA 2QMHA 3CONA 1E2LA 3ASYA 1XTIA 3QVUA 4OHXA 3CF6R 5JLJA 3L43A 1YZTA 5KDOA 4YQFA 1J7KA 1DAHA 3KZ1E 5SZKB 2OG2A 2GZHA 3RRYA 1VG0B 1E9DA 2FFHA 1U0JA 2ANBA 3ZZ0A 2P5SA 4RZ2A 3EPLA 1UF9A 1O87A 1ZM3A 4URZR 1JR3E 2V7QA 4R2HA 3AVWA 3THYB 3U3KA 2CCKA 3SQXA 2REBA 2WAXA 2HT6A 1T4GA 3TSOA 3W90A 3ZS8A 2Q9AA 1ZAKA 2JASA 3AGPA 1KSHA 5ANRB 4C2UA 1QZXA 3H1TA 1EX7A 1AA9A 1R6BX 1M2OB 2CL7X 1G7TA 2MSCB 3FHCB 3VFDA 5FBVB 2HDNB 5EP4A 4GBMA 5KO2A 2ZUCA 4IJMA 1HH4A 1KNXA 2QP9X 1RJ9B 2ZRNA 2IYQA 1ZM2A 2DWQA 4LRWA 2QNRA 2W2VA 2OAP1 4D6PA 4LHXA 4DXAA 1SXJC 2VA8A 3D6TB 3THXB 1II8B 4OHVA 4EAQA 3QENA 1GRNA 5FI1B 2ZUBA 3T1QA 1IN5A 1YKSA 2YWHA 2FPMA 4OK6A 4NCNA 5F9HA 1U0HC 2YNMA 1UEIA 4C30A 1L2TA 5EXXA 3BE4A 3VU9B 5EP3A 1Q22A 2NOAA 1DAEA 3CM0A 2Z4SA 1IJFA 3IPYA 1U2RA 4GMDA 4H1UA 2LWIA 4TTPA 4HB4A 5EXTA 2N42A 4L15A 2QL6A 1D5CA 5HZKA 2ZAOA 1TU4A 4ZV4A 4II7A 2UZIR 1CRPA 1OIWA 2F9LA 3LX5A 4KYUA 2BJWA 2QPAA 4GFDA 2WMOB 1MKYA 5JFGA 4EPWA 3VR4A 1GAJA 2R62A 3NG1A 4PO1A 1U94A 2E1RA 5E7JA 5BXQC 3SI7A 2A5JA 3HWSA 3T1OA 3M0EA 2O8DA 1TADA 4UNQA 2ZITA 2QENA 2QU8A 3WMEA 3V4FA 5FOXA 5BYKA 3QKUA 3X1XA 1DAMA 4GP7A 5LPNA 4N1AA 2WJHA 2WKPA 4AKEA 4BLPA 1RFLA 1ZNYA 3VHLB 4LI0A 3QIAA 1HE8B 1DEKA 1PLLA 1GFIA 1KGDA 3UKDA 5HE9A 3UMRA 1NN3A 3AF3A 1NNEA 3ASZA 3MCAA 2WSSA 5FTMA 3TR0A 4D4JA 5LD2C 2C9CA 1IN8A 1EX6A 3I32A 4H9GA 2IYSA 5J4LA 4HLCA 4I1OA 1T5IA 1PUIA 2GF9A 1GZSA 3CH5A 4DCUA 5JCZA 3DZDA 4KBGA 5HKKD 1J99A 221PA 5BQ5A 1CLUA 2GZAA 2XZPA 4AYTA 4UNPA 2XTZA 4POAA 3F0TA 5DLQC 2WV9A 5EP1A 2L0XA 1VG9B 1S9HA 2CL0X 3QJYA 4KLNA 1R0ZA 3ETLA 3LBNA 4EPYA 3SYLA 1ETUA 2XZLA 1S9DA 2AWOA 4WAUA 1ZW6A 3A1VA 1S96A 2XTMA 4EJSC 3KX2A 3T06B 3KJEA 3ADCA 2ECKA 3KFVA 2JJ2D 4OHWA 4OI0A 1G41A 2QG6A 3QUSA 3GLIB 2NO9A 5CJPA 1JQLB 1NVUQ 3IHWA 1N5JA 1WXQA 1XXHA 2CVFA 2JJ1D 4TLEA 4ZKDA 5JSZA 3LLMA 2I3BA 5SZJA 3U4QA 3AM1A 1CJKC 1CP2A 2UZ3A 2ONJA 2BDTA 2FFBA 1Y63A 5JWOA 2GJSA 1KDPA 2ZI7A 1RRCA 2OBMA 2C5LA 3CPJB 3G0HA 2IL1A 2V1UA 2JLYA 2H7VA 1F60A 2FFQA 1FMLA 4JKIA 1X8KA 3FMPB 2ANCA 3AF1A 3A4NA 4XD7D 4MGKR 4CVNA 1WBDA 3IKJA 4IW3B 4TL7A 3EIQA 3LLUA 4LYHA 1TUEA 1QHNA 5CDFA 5DN6D 4ZIRA 3R9XA 2KI5A 3EWAA 4LZZA 2W0MA 1KZ7B 2CJWA 4JSYA 3SBEA 3UANA 4NCKA 3NHAA 1JR3D 4DSTA 3GJ6A 2QE7D 1XD8A 4RFVA 1QG4A 3VR3A 4QGFA 2H5EA 1KI3A 2PZFA 3THOA 1AS2A 3QKSA 5LDDC 4JLAA 4TYYA 2ZQ5A 1OKKA 3IQXA 3RS4A 5AJZA 3Q72A 3CIOA 3L0IB 2PBRA 1DARA 4IRUB 1Q57A 2VP9A 1E0JA 2RHMA 4G1UC 2GA8A 2NPFA 2ZS8A 4HLUA 4TT3D 5H8WA 1S4QA 3A4MA 4BZXA 3BB3A 3NVAA 1OH5A 1TUIA 3C15C 4B48A 4FMBB 5EUMA 2FV8A 4B2LA 1N6LA 4G01B 4EPXA 2D06A 4A0GA 1H8EA 2REOA 4LJ6A 4PZYA 1ZM9A 2R8RA 1GILA 3A1WA 3CB4A 4IVPA 2ZR7A 2DWPA 4O25A 2WM9B 2VP4A 4TYQA 2A5YB 5FPTA 2VHJA 4W5WA 2OM2A 1CR4A 4QGHA 1E94E 1JJ7A 4DLXA 3SHFA 1ZD8A 4JMPA 5SZIA 3ICQB 1T3LA 3RS2A 4GPTA 3O8CA 3RDPA 3RS0A 4IEEA 3K70D 1X86B 3FKQA 2A3RA 1G19A 1Q44A 3RRZA 1Q1EA 2O0HA 1W4RA 4XD7A 4EFMA 1XNJA 2Z6VA 2C77A 1N6OA 3AVOA 1NBMA 2JLRA 2OCBA 2KBEA 3QXJA 3QY0A 1E2GA 3A1TA 5F9FA 2R6GA 4TWZA 4CT5A 5B64A 1LVGA 3T15A 3TW8B 4UXIA 1NSTA 4DLTA 4V0KA 3RRNA 3MWKA 2GCOA 3P4XA 1Z28A 3ZYCA 4AKGA 1KKMA 2GAAA 4Q5IA 1ZUHA 3S1AA 3MLEA 1T3SA 3SDZA 2ODWA 3BWDD 2AK2A 3TLXA 2J1LA 2ZJ5A 1G5TA 3W3AA 1W36C 5FPHA 4FD2A 3B78A 3IO3A 1SULA 3T34A 2ZI9A 1KK3A 4FMCF 3RYTC 2ZE6A 3O8DA 4F92B 3KB2A 1VIYA 2G0NA 4TN1A 1FUKA 2RGBA 4TT3A 2WKRA 3QEOA 4CF7A 1P2TA 3HU1A 2FPKA 5KUTA 4IDHA 1E1RD 2W6ID 1KSJA 1BOFA 4I1UA 1ZU4A 2XOKA 4A4DA 3ADBA 2BHRA 4MKGA 1WBBA 3SJZA 3HR8A 1QHSA 4Z8YA 4LV5B 3O8RA 3KUCA 1P61B 2WSMA 1E9AA 4R71A 3THYA 3CRW1 2RKOA 1SKQA 1ZP6A 1OFIA 1LS1A 3K70C 1P3JA 1W4BA 3GLGE 1CEEA 2FGJA 1KO5A 3UMSA 5TDHA 1CR2A 3PVSA 5B58C 4ABYA 2LCFA 3SJBA 1LW7A 4OQFA 4LBVA 1G8FA 1N3BA 2ERXA 3X1DA 1RJ9A 2J5XA 2QA5A 2RGGA 3ZIAD 4A0HA 1UEJA 2G83A 2ZRHA 3K9LA 4LHWA 3THXA 1II8A 3PFIA 2GETA 1HE1C 3QSYA 2ZR0A 2ZRKA 3BH6A 3VU9A 5H1YA 2WWWA 4M1KA 5KOYA 2WIAA 4DIEA 4BLTA 2RCNA 2ZROA 4DUGA 1EWRA 3P1JA 3KQUA 4DWJA 5DIFA 2HF9A 1IJEA 1KDTA 4CRWB 4PC7A 2JLWA 4PQRA 1KDOA 4UQOA 3QVVA 3MWYW 1G3UA 4NONA 1SVKA 3CPEA 3QXHA 1VG8A 3IDQA 4MQBA 5FTKA 5BN4A 4O3MA 2ZTSA 4QG7A 4C0AC 5AUNB 4F4CA 2FN4A 3WBJA 4MKIA 3R8CA 3E2IA 1NG1A 3Q5DA 4KBFA 1NVWQ 1XWIA 3B85A 2F1IA 4TYPA 3UIEA 5LBIA 4QNMA 2QT1A 5FUWA 3B6EA 4Q21A 2IS6A 3GJ0A 3P4YA 4W9MC 1LB1B 1F6BA 1I4DD 4ZDIA 1GITA 2FG5A 3RNLA 2JDID 2C78A 4K81B 3B9PA 5M04A 1Z8FA 1W5SA 2CCGA 1QRAA 1A4RA 3CX7A 1AIPA 1E96A 3DL0A 3IIMA 4IXNA 4Q1AA 2IXFA 3B82A 1W5TA 3CX8A 1E9RA 1TQDA 2FZLA 4P4SB 4PPFA 1SVMA 5FL7D 5HZHA 2C9YA 1D9XA 4G5GA 5D3MB 2CE7A 3KDSE 1QF9A 1SXJB 1W2HA 2C04A 4QGGA 1IHUA 1JPJA 2ZRIA 2PH1A 5JRZA 3I62A 2W0SA 1M7GA 4OI1A 2KJQA 2DY1A 3PV0A 3PQCA 3WBKA 4M9QA 4S2EA 2REXB 1ZM4A 2OILA 3L2OB 2IWRA 1A2BA 4QJ4A 1Z3IX 1I4LD 1QBKC 5JS8A 5JS7A 2ZVQX 4M9SA 3GLHB 4PX9A 5CB8A 3BC1A 1EFTA 2A7QA 3NDPA 3WY9A 4ZDWA 5JJIA 4LSGA 2PLFA 5FOVA 4OK5A 3GLIA 1E0AA 1XTRA 1L4YA 3SJCA 1OYYA 1OHHA 2P65A 3D8BA 3ZH9B 3GLFE 2CHQA 2AK3A 4RD0A 2VSXA 3FPAA 3PITA 3QPWA 4RSGA 4B3DA 3HJNA 4TTQA 5JECA 1RRFA 3UATA 1KSGA 4DJTA 4JZKA 2PJRA 2GJAA 3DEFA 1FW6A 1D2NA 2EFHB 4FINA 4LOAA 1SKYB 3TR5A 2RGEA 4KITB 3MGCA 5KSPA 2IA5A 2P67A 4PAQA 5GVSA 5JCPA 1FP6A 3SYNA 1AKEA 1VECA 2LKDA 2JDIA 1QHHB 2W6JD 5LD2B 5JEEA 2ORVA 2HXYA 4B47A 1KY3A 3B1ZA 4XWKA 3UK6A 1QVAA 4UNSA 4ZCIA 1CR0A 2AKAB 2IEZA 2G88A 3DKPA 2IS2A 2C8VA 2F7SA 4DCSA 4XOIA 2CHVA 1KHTA 4Q00A 3OE7A 2CNWD 3EG5A 1XEWY 1KAGA 1X1SA 3GJXC 3I61A 1NLYA 4E07A 3Q5EA 3ZLJA 2YINC 4LJ8A 2N46A 3U2QA 1XBTA 3QF4A 2F43B 3IBGA 2HYDA 2FX3A 3SS8A 4PO9A 3EC1A 3P20A 3SYKA 3CW2A 1E2NA 5HR5A 3ZJYA 2KBFA 5J40A 2ZSBA 4NP6A 1XXHB 3CX6A 2NZ8A 3VMFA 4D80A 3U4QB 2JLVA 4PZZA 4FWTA 3GCGA 1V43A 2BBSA 2A5DA 3KJGA 4JYCA 4V0NA 5EXSA 4QC2A 4BE7B 2IS4A 1DTSA 2DCUA 4PC2A 2CLDX 1HTWA 3CWQA 1E2EA 4RKFA 1US8B 2XZOA 4F93B 3DM9B 4OL0A 3DO6A 3IHLA 3KL4A 4IDOA 4CDGA 2WTUA 1TMKA 2AN9A 3KQKA 4MYTA 2R9VA 3KKMA 2FPLA 1NL3A 3GJ8A 3QBTA 2JLQA 1MV5A 2V4ZA 1KI4A 3I8SA 4M1YA 2QMUA 3TAHA 1ELOA 1QHYA 5EE5B 2A78A 1IN7A 1FUUA 1VPLA 1WF3A 1WQ1R 4TMWA 1G8YA 1VDZA 2GCNA 3Q7PA 5CIWA 3MWJA 5DGXA 1XEXB 2ZRAA 2NIPA 4EKDA 4Z1MD 2VSFA 4DCNA 2G0TA 3DOEA 1NIJA 3TQCA 4MGZR 3EZ7A 2GBLA 1X8JA 1S2MA 3EA5A 3FHOA 2WWGA 2FWRA 3K0CA 2O5VA 3D3QA 2W6JA 3MD0A 4QJ3A 2FOLA 2G3YA 2VF7A 2JAQA 3AUYA 3ZZUA 1XEWX 4M1SA 1E79D 3BH7A 1QHXA 4BZQA 1U99A 2ZVPX 3HPRA 1AS0A 2D74A 4X8MA 1OH6A 4KCGA 2KWIA 1E99A 3QKRB
chains in the Genus database with same CATH superfamily
2OXFA 1PTKA 5KCMA 1XZBA 3PGXA 2E7ZA 1O0BA 2PSEA 1H4VB 3ZPXA 1BXRB 3EPPA 4UKDA 3MUFA 3WDKA 1PJCA 4PLFA 3EVAA 2G0AA 3N7AA 3ZCPA 4MCHA 4AZSA 1N2SA 5CA1B 1SXQA 2FWIA 2KYRA 5A5DA 3GNTA 3DV0B 3LW7A 1YAHA 3V1KA 3WSVA 2UKDA 3GLUA 5KJ1A 4KSCA 5FOWA 1BOOA 1Y1KE 2ZRBA 1XNQB 3CR8A 3GGOA 1C3OA 4HUQB 5CLIA 4PVDA 3UICA 3TB6A 2CLFB 3JQGB 1SO8A 4R40A 2NV0A 2ONZA 2QLMA 4K1XA 4DIMA 4DBVO 3IGFA 4MJLA 1A8QA 1VJ1A 3K94A 3KJIA 1G5PA 1WPRA 2IHKA 3OFND 3FROA 2ETXA 3FUUA 4RPGA 1KO1A 5CFRA 5C35A 2BSAA 4BJ3A 1GKIA 4QDOA 1G21B 4U7DA 121PA 1NUTA 2OD7A 3E22B 4BFLA 3HDVA 4RXMA 1I0ZA 3NIWA 2GDZA 4XDZA 4WJKB 5DBIA 2YVKA 2YZMA 1YTUA 3D0KA 1EMDA 4M0EA 3H1FA 3IJPA 4NNOA 5CLLA 3TZHA 2IV7A 5A3VA 3VNQA 3AIMA 1KZ1A 2ZIEA 4G89A 3QM1A 4MVJD 2EKQA 3PUJA 5B4TA 4Q1FA 1ESEA 1GPAA 2BFAA 4YJ2A 2XCRB 1W0CA 2H9YA 5C5DA 5JSUA 5BSVA 1RTKA 4F3NA 3PNBA 4W5RA 1ZKMA 4INJA 5EA2A 4IGIA 3NEYA 2CLEB 1R37A 1C4XA 4PSAA 3TSCA 1A9YA 1IZ0A 1UJ2A 4GOKA 1XTTA 2VHWA 3DHVA 1DL5A 4QOSA 1A1VA 1L5QA 2AI2A 2B5OA 4M7WA 3TKYA 3CZ9A 1ZOSA 1PCXA 3W5SA 1NVGA 2P9TA 4OHUA 5JH7F 5DNYB 2WICA 1SD1A 1ZMXA 3KM0A 5EMJA 3K0FB 1Z56C 5K8CA 1YQWA 4OLFA 4XJSA 1Z5GA 2RGRA 1FL9A 1ZQ1A 4DNOA 4QFMA 4E6EA 4UFNA 3NWJA 1W59A 2DWOA 3R0VA 3ME5A 5DM2A 4UM7A 1H5QA 4C0QC 5JFTA 1UAGA 4ZOLB 5M5BA 1R9GA 5TEVA 5CMLA 5SYNA 1J5EB 4KDCA 2XYQA 2I99A 1AC5A 1JQDA 1K5DA 1LLQA 4JGGA 4RLHA 5KYTA 4I4CA 2XE6A 3LZ6A 4Q4AB 5CT6A 4ESOA 5JPDA 2B0JA 3LOPA 4WSOA 2QQEA 1JQBA 1SCUA 2KB0A 2XA2A 5I7WA 5JNUA 2E1PA 4TX1A 4Q9IA 2R84A 4CCWA 4GKKB 1S8OA 5AJYA 5K3DA 4DLZA 4DCGA 2IYNA 1VLMA 3K70B 2VTBA 4O29A 2H1VA 3K4QA 3FJ1A 2EF0A 2BEWA 1OQAA 1F2DA 3BK7A 4FD3A 3FDZA 4L5BA 7REQA 4YIHA 2VAXA 1UT5A 4JMLA 4CLHA 2MT9A 4MQEA 2H54A 4NMMA 1W5BA 3VX4A 3CNHA 1H23A 2WD8A 3PEUA 1MPXA 4JBWA 1UOPA 5TARA 1QGYA 3G1TA 5F3DA 4XCXA 3QF7A 1P6QA 4O6VA 3B9QA 4EEXA 2GJ4A 4P7GA 1YXMA 4GX0A 4DSUA 1AG9A 1D0IA 1DXYA 4DREA 5JZVA 4KFSA 1OFTA 3CKKA 4MRNA 3IAM1 5TV2A 3WLNA 3IT0A 2EJCA 2VDNB 2V7TA 2HK6A 4LF5B 3K9GA 2WT8A 2C4WA 1HSOA 2P0AA 4KO1S 5JAOA 4HDCA 1H22A 2C9OA 1N5KA 1FSGA 3P8ZA 2C9MA 2I9PA 3QHQA 2D1FA 4DNPA 4O2BB 1EZ4A 2F3RA 2IHJA 4U7FA 2UUBB 1X0XA 1SXHA 5LNK1 5AQEA 1QP7A 3KYBA 1AQLA 2P4UA 5HFNA 2FEAA 1FS6A 3R6TA 3ZDEA 1J1UA 4BTVA 4D0GA 1EK5A 2KMLA 2QTAA 1XV5A 4PQEA 4ZWNA 1E9BA 4M76B 2QGZA 3ENWA 1RRPA 1Y3BE 2J4CA 1NRJB 4KO8A 1BEZA 1M1UA 4UC0A 1Z7EA 1UFVA 1KY4A 1YVUA 2BDEA 3DEIA 4N49A 3URKA 2MTBA 4NX2A 4DNXA 1SR8A 2VKTA 3ERCA 1ZOIA 1PQYA 2FQXA 2X2EA 3AP1A 1GADO 3GIWA 3RVLA 4A92A 5H59A 2QT9A 4BPRA 1Z17A 3QEAZ 3REOA 1H5NA 1UEXC 3X1ZA 3TL3A 4PWYA 3QMPA 1BHSA 4QASA 2RMKA 1Z0ZA 4IJKA 5FUVA 1V3VA 1K6EA 4MV6A 3L4JA 2V7VA 3GVIA 5FTNA 3LUBA 2OMKA 3K1AA 4IV5A 3NPAA 2A33A 3DVSX 5G3ZA 4RUKA 4OB7A 1YJQA 2XAUA 4YP0A 4X92A 4LY3A 1NRWA 1GUBA 4B74A 2ZU0C 3WV5A 3A4VA 2HUPA 1FBNA 1UZNA 1A5SB 2O14A 3K8ZA 4OHFA 1HDOA 2WKQA 2ZPTX 4P4LA 3L1UA 2BEJA 3IELA 1BS9A 3RIMA 4A2WA 5F7XA 2C07A 2JZNA 3KYIB 2EFYA 2JGMA 4FIDA 1U8AA 5EJMA 2HGSA 4B1FA 4P7BA 5T6MA 5E4TA 4NKRA 4F8JA 3B3QA 4W9RA 5D87A 1P2SA 2Z2YA 5KYKA 1GNLA 2B4KA 3R41A 3LPLA 4WH0A 1OI2A 1S1MA 1PJ8A 4M9XA 3PQEA 4HYYA 1CZNA 1PUJA 3V1TC 2ZSFA 5CU7A 1YBMA 3WX0A 4Q4JB 3CTPA 1JRLA 3KSDO 4O2LA 2ZAYA 2ZE8A 2ZWVA 3IQIX 4UMFA 2GTPA 4J0FA 3GP3A 5DHAA 4B3BA 2G1JA 1ZISA 5CGQB 5GIPE 2QRZA 5HSGA 1FNNA 3BSWA 1ENYA 3H65A 4OKNA 1W7AA 1MAAA 3OHMA 3H6GA 4PRLA 1OOEA 1TQHA 2C2OA 5CXXA 4ALIA 3JVVA 1ORWA 1TNDA 1U5CA 2ZB4A 3BE6A 3STHA 4CIVA 2V6JA 1A76A 1SPBS 1FRVA 3NYWA 4MQMA 5BQ3A 4E5UA 5FJJA 1V16B 3BTOA 4D5GA 2WK1A 1N5IA 1X6VA 5F76A 4HDKB 3LLCA 1WUIS 1JB1A 1JKMA 3CBGA 1DFIA 4O4LB 5D1NA 2OQVA 1M6EX 4A6EA 2NNWB 3LCJA 4AO6A 4B80A 4YV1A 2XX3A 4WASA 4UJ3A 4KDRA 3GUCA 1WAMA 2WYVA 4FTWA 4ITRC 5GMOA 3V55A 1US8A 1SC6A 2C7BA 2Q3MA 1CIJA 4V0OA 1KQ3A 5LQKA 1E2MA 4W8HA 3BWCA 4LTDA 4A2PA 2PMKA 3C3XA 1PIWA 1O8CA 1UJMA 2EX4A 4A8HA 2WWIA 2O8CB 3ZWAA 2QJOA 3WXMA 3QW2A 2F1HA 3FFXA 1RAEA 3IOCA 3GI1A 4KFUA 1R4MB 3BZUA 1BEEA 3EOAI 2AN1A 3VSEA 3MJTA 2ROQA 3FYSA 3FNHA 3GCDA 3L9WA 4PS0A 4RJKA 3OCYA 3TZEA 3GAZA 1X0VA 3DF9A 3HCCA 5KNBA 1VIDA 2ZYDA 1ULTA 1I9CA 4L4RA 3U37A 5B3JC 5HKKA 4NENA 4A73A 1FLAA 4KQEA 1QVRA 5C8VA 5BWMA 2Q4EA 1JU4A 3PHLA 1C9EA 4RD3A 3LNCA 1U2TA 3RRBA 2C84A 3KRTA 2B82A 1R4NA 3MT0A 5DTEA 5LXTB 3OD1A 3OTGA 5BV8A 3QLVC 4QDXA 3EXFB 4J1NA 1BE1A 2OWEA 3FX2A 2V4MA 5CX1A 1AKWA 4GBGA 3W2IA 1BWRA 1BXZA 3QKRA 1EZ1A 4OAQA 4MVJG 3K72B 1FP2A 3CW8X 1CZHA 2B4AA 3IQFA 4BZPA 2FSFA 3MAJA 1Z62A 3VVLA 5A5VA 2ICAA 3GJRA 5CA1A 3A1FA 2VDVE 2HSJA 4WBNB 3KQTA 4HWKA 3CUEF 2ZULA 3ITEA 3HR7A 3S2EA 5KQSA 1PK7A 3DV0A 4KH0A 3I64A 4L02A 1QQBA 1II0A 3OEYA 1CDOA 1Z0FA 1IY0A 2ZSDA 1ICEA 4ZTBA 3EODA 3T3IA 5LYJF 2JJ1A 1E2UA 4JZYA 3BXOA 1T9CA 4Y2UA 2CHUA 2CXTA 2EJVA 4HUQA 2XWSA 2PRKA 1EQ2A 1FB5A 1T2CA 1M34E 3EEIA 3BAFA 4GLJA 4JLVA 2DETA 2J0SA 4MA4A 3JQGA 3DYBA 4UU8A 5C80A 2VF5X 3JD2A 3SK0A 1BQ3A 1HC7A 4AP6A 4G81A 2AC4A 4MROA 4H7IA 5C37A 2F1JA 5K05A 1BG6A 1LUAA 4U00A 5FNZA 5FWYA 3K05A 1JDVA 3MERA 3D6NB 5JD3A 3YASA 2QL9A 3NC4A 3OP1A 2IEAA 2MSEB 1CVRA 3E22A 3FKSD 3HZHA 3VR0A 2BR5A 4MS4B 1XG5A 1G1MA 1X19A 1A9QA 3N2LA 4WNCA 5K0ZA 2BBWA 2FUCA 10MHA 4C7XA 2QLJA 3ONWA 4DWWA 1JR3A 3C7TA 1CEQA 1S8AA 2ABWA 2DC1A 5HCNA 3M3DA 3V7NA 5D84A 1ZGAA 1E4VA 4LISA 4DANA 4W6QA 5TLSA 3GLGB 4UQLA 1B1AA 4QDUA 4R3NA 4ROSA 4RL4A 4EF5A 4UEKA 4MHOA 2PWZA 1DKRA 5KNDD 3CNOA 1L8QA 1QOQB 1Z6PA 2IOFA 3CRQA 5CUQA 3T5BA 2AR0A 2HR1A 2R86A 1EBBA 1O08A 4GT1A 5CFMA 1NY6A 1IXZA 2P69A 2QLFA 2B1QA 4HZUB 4WNIA 4REOA 2CD7A 2D8AA 3E4DA 2R1TB 2JIRA 1N8TA 3NBMA 2ID8A 3EGVA 2C7RA 2OGSA 3UB4A 3WKDA 1G4HA 1SUEA 1B26A 2Q5QA 3AESB 4FNOA 4F97A 1CUGA 1EFPA 1DUSA 1NPDA 1Y7TA 2WPDD 4TTTS 3BKXA 4EUEA 5IF3A 4DQVA 1IQPA 3K0FA 1NQAO 2BKUA 1Z6TA 3GWGA 3DGEC 5A4FS 3Q3HA 4RX1A 5K3EA 3H84A 1O8BA 4FKBA 2PUDA 4K28A 2AGVA 1XU7A 1ZPDA 2FN3A 4KWTA 3PXDA 3BZWA 1VFNA 4UZEA 3NP9A 1YHYA 5NLLA 1NVEA 1E1LA 1Q5PA 4YS6A 2EYQA 1KZGB 3BFJA 3K53A 4NLLA 5FNVF 1IDN1 1AU9A 2CSUA 2V3WA 1E32A 4J4HA 2ZWOA 2XT6A 3ECSA 4DXHA 4OHYA 1WVIA 4F3YA 3PEVA 1PTJA 4Q4AA 2AEMA 1AQUA 4PYIA 5EPUA 4RH3A 4KG7A 4NYMR 2OLEA 3SX0A 2W8BB 4TSFD 1Q15A 4F6RB 5ESRA 2AJDA 2Q7XA 2B4RO 3Q8WA 2PKEA 3GLKA 1KEZA 4MS3B 4BZZA 1PWYE 1H42A 4JJAA 1HZJA 2YIJA 5JBQA 4KX3A 2GD1O 1N5LA 4FP9A 6LDHA 2ATVA 5E7IA 1OMOA 5ALNA 2ATEA 1JBKA 3I9KA 1PZGA 2OVFA 5FPYA 2XTNA 1CS4C 1IPHA 2ZYGA 3GDHA 4LMRA 4G8JA 1JFTA 3KLOA 3MSCA 4BC0A 1E2JA 1BDBA 3L6RA 3EXIB 4H3KB 4P7KA 3BJIC 4NBSA 2H1OA 3PNOA 4RVCA 4B4KA 3FPHA 1KYVA 3GWZA 2WINI 5B2FA 4MOWA 6AT1A 2WOOA 2WB2A 3U19A 2EC5A 1ZITA 3GMIA 3W6PA 2PFSA 4O4HF 2IYFA 3SS9X 4V0ME 3WLRA 4BFUA 3LWBA 3VU1A 4EY3A 1Q0TA 3CF0A 4BLOA 5L3QB 1W6UA 4Y6GB 1F2TB 3B52X 1RVV1 4O2BA 1AK1A 3H4MA 1IQRA 1AN0A 3LMKA 3NV7A 3PENA 1W75A 4R68A 5L4LA 2Z4RA 2DPGA 3W1VA 1QZTA 2PGOA 1JAIA 3PVZA 3X2SA 3MOSA 3OWOA 4LIPD 4UD2A 3DOFA 4Y6OA 4AAYA 1C4OA 2YV5A 1TVEA 1ZH0A 5SV2A 1VLHA 3C43A 3HFRA 2I34A 1KJ8A 3PVCA 3VR6A 3G0CA 2BZGA 3LUAA 4BY9E 3DC7A 1PHPA 5DXJA 3AFOA 1I8TA 1E1RA 4ILEA 2BCJQ 2W6IA 5EE0A 2FUNB 2Q50A 1YJCA 1CUWA 3A1NA 2QPOA 3BFXA 4DIDA 4PAMA 5G4KB 3OM0A 1IWBB 3WWEA 1RMQA 4GXNA 1WOMA 1FU8A 2MMCA 3PHCA 4EFNA 4NZYA 3SBDA 4DMMA 2X1LA 3LC2O 2GZ1A 1X13A 5IAOA 3BDIA 1JYEA 1QO9A 1P44A 1IQUA 3C7KA 4FDMA 4YAGA 2XQFA 3VDRA 4A5OA 1WTAA 5HPYB 4FE4A 3UBTA 1GUDA 5T3YA 1QLJA 3OQVA 4TZ6A 2VZ0A 3WZMA 4E1VA 4JI6B 5JC8A 1J97A 4KQ2A 1Y7PA 1V3QE 4ECAA 3K71B 3I1JA 4FN4A 1X9HA 5AWFC 2XMQA 4UHHA 1BMFD 2PKXA 3KO8A 1DWOA 1I7NA 1LK5A 3N2EA 4YUVA 2AC2A 1FNMA 1AQIA 1BKDR 2AT1A 4D8VA 3GLFB 4ZFNA 1FXUA 1KJYA 5BSTA 3ZIAA 4HZGA 1SQSA 1K6IA 1NOJA 1V4NA 3C5CA 4ZT2A 3T7CA 3LC7O 5ALWA 4A1OA 1DAIA 1K98A 2WU8A 3FPSA 5C3MA 1OUMA 3HK2A 1H1LB 1WMFA 1WMDA 1KP9A 1ZOPA 3LKDA 2GAFA 1OD6A 5TF4A 5F98A 1P5ZB 4PGMA 1QSGA 4MGIR 1NJGA 3OF5A 4O1IA 1GKLA 3LDHA 4C4PA 1ECLA 1I4TD 3W4IA 3W9YA 1ZNWA 5FPSA 4IVRA 2BZ0A 4Q4JA 4N39A 2CW5A 3A36A 4A23A 1XPRA 2J8ZA 3C3CA 2ADFA 3LY8A 4A2QA 4D9JA 2FRDC 3W6NA 2QI9F 1CCWA 3UHPA 3IQZA 3CUVA 3PA6A 5JQGB 2SHKA 1HDRA 4C7OB 5DLPA 1BCRB 1COWD 3I9OA 4CYMA 3F7TA 4OOFA 1JLMA 4OHZA 4KXQA 3TRJA 2D3TA 1M7HA 4IOJA 3WL7A 1PJQA 3DE6X 3LV8A 5A0TA 5IDWA 5ILGA 1TA4A 2WJ6A 3DAFA 5A9SB 1P7CA 3F4KA 3QG1A 4R3UC 1M1XB 1Z29A 1OB5A 3R5TA 3QX3A 2W98A 3OIYA 3T7EA 4O02B 4TN5A 1V16A 3ZVMA 5DO9A 1Q50A 2ZSAA 4HDKA 2R6JA 1JDNA 1SHKA 2VJDA 3PCRB 1ODKA 4JJGA 4JP8A 4O4LA 3KZNA 5DMHA 3VVMA 4ARAA 2JAHA 2VTKA 4BXOB 2BIFA 1W1IA 2X0KA 3G59A 4WLUA 4E7PA 2HHJA 3DVQX 4UATA 4DMRA 1LZLA 5REQA 4HP8A 5EE3A 5KTNA 3UHJA 2GWHA 3RVJA 3WWZA 4I5EA 1LDEA 2TMGA 1DEHA 2O8BB 1R00A 5HMLA 3WRYA 5JCJA 5PNTA 2GEKA 3SU8A 1JEAA 1YB2A 2I6TA 3NORA 5EERA 4DS3A 4ZI2A 5KNDH 2O8CA 1I1OA 1WNFA 3AEKA 3MQ4A 1OXKB 4S35A 3DAPA 3UUFA 3ZDXB 4OX9Y 4IS3A 1ZMRA 3C6ZA 4LYFA 5LQUA 3COPA 1OE0A 3P9IA 1I32A 3C6YA 3BCHA 2TMKA 3P7MA 2RGDA 1TQ2A 1Q91A 2NZXA 4XGIA 4ZAVA 3R7WB 2NYVA 4E3ZA 1NDQA 4FU0A 3TUIC 2C83A 4F60A 1NW4A 3EDOA 4IY1A 1S0UA 3TTTA 1VXRA 1I0IA 3QWIA 5IAKA 2H1LA 3SM3A 3UFXB 4EKIA 3R6LA 2YY7A 2A88A 1O6CA 3PBKA 2P30A 4HAWA 1Z0JA 4M86A 4ZC1A 3IIJA 3MPOA 5TMBA 1TF2A 1MOZA 1B0UA 3GQBB 1VBFA 3VO2A 2IZ7A 4CUKA 3EXFA 4RACA 2JA2A 2WYUA 5IDXA 2QXUA 3R23A 1PS8A 3W5UA 3LIIA 4G9EA 4Y2HA 4U2GA 3IOBA 5AM1A 1XI2A 1BEUB 2WF9A 5AIBA 1E2FA 1ORHA 4KMMA 1EVIA 4UBKA 4AJPA 2ZRFA 4D56A 2K7ZA 3DWFA 3BSFA 1BS1A 3SSAA 1Z4KA 4WBNA 2C00A 3KCQA 2RGCA 3BWBA 4JL6A 3EEBA 3TH5A 4YRLA 4FEEA 2F64A 2WI8A 3OOSA 3D2LA 2AYXA 4HGQA 4TKLA 1H93A 2OAQ1 3ND7A 1HDYA 1CQZA 4Q66C 4MCIA 4PG5A 1VI5A 3EIEA 1RNLA 1KZ9A 1V5EA 2W5UA 1SOVA 2XUDA 6YASA 3A4TA 3H5WA 3H0CA 3NMUF 1N25A 2ONYA 2RGXA 4JU8A 4QHYA 4ZKEA 2BONA 4MJ7A 1WE2A 1YBFA 3BORA 4BWFB 5TMPA 4Y3UA 3RRXA 3L7JA 1Y7IA 2QU7A 4IJ6A 4YMWA 3GARA 2WNHA 2IYLD 4P98A 1L5MA 3SHWA 1CXZA 5K3FB 3W7AA 5IMBA 1W88B 1ZJ5A 4M22A 3FYUB 4YY3B 5EG5A 4J76A 2XZDA 1RD4A 1EH5A 1JX6A 2C58A 1B74A 5FUMA 5TR9A 3RUAA 4LY6A 5DU2A 2AF3C 3K96A 1W34A 2MR5A 1CRWG 3CKMA 3CNQS 1VHWA 4ZT3A 4AG5A 1CQJB 2QYHA 2I66A 3CQ9A 3FMOB 1EFRD 1GARA 4LX0A 1L5KA 1U0BB 3I76A 4BUJA 1NPTO 1Q1BA 3EIHA 3GZTB 4D2IA 1UQRA 1E9CA 3EF0A 4ZVMA 1BWSA 5DHQA 3UG6A 4M1TA 4BN0A 3SQWA 4E12A 3SEZA 3GLGA 3AINA 4G09A 4DV6B 1WUKS 2VNKA 2YMMA 4BVLA 5AK4A 3HN6A 3MJRA 4QXOA 1YR9A 4HRAA 3U61B 1Z0KA 2C94A 4PLYA 3REGA 4OLAA 3PPIA 4ND5A 1ZJYA 4KAXA 3ICVA 4TLBA 1E2PA 1F8FA 2PQMA 4FW9A 4HNRA 3OZCA 1YR2A 2GNPA 4HZUA 1G55A 2AFVA 1RLMA 4XIYA 2SCUB 2R1TA 1WABA 2V0GA 2WDZA 5HGJA 3X44A 5INTA 4K6HA 4LBWA 1JJVA 4N3CA 2DUMA 2GYUA 3BXPA 1J8MF 3RBZA 3ROEA 3VNAA 2NO0A 2OXRA 3AESA 4GM0A 3C1AA 1RCUA 3D8NA 4QM6A 2XYVA 3IR7A 4P4UA 1A7JA 1QQ6A 5FR1A 2PX3A 3TRFA 5DGTA 5K7SA 4BRZA 5LP1A 3P4UA 2R00A 1BJRE 4OFXA 2W6PA 3GJSA 4U2BA 4D25A 2E5WA 3ZVLA 3V1NA 1ZVKA 1XRSB 4I46A 5CT5A 2OUKA 3OCXA 5CB4B 4QECA 3F9IA 2V7QD 3OZIA 4RV5A 4AS3A 4OGFA 1IONA 1PD0A 2Q45A 3P9CA 4Q16A 4DLYA 4PLGA 1PJZA 1CY8A 1PNTA 5E7QA 1DCKA 1EB9A 1A0OA 1RWWA 4KP7A 2G1PA 2OUIA 3FYDA 3HVKA 1CULC 5BN1A 1EWTA 2NO5A 2QUKA 4KMOA 1AQYA 3KHKA 1UZLA 2CC2A 3G5UA 2W8BA 4L51A 5DBHX 4F6RA 1H8HD 2JATA 3EXAA 4YDSA 1Z0IA 3MELA 1PLKA 1X8LA 4MS3A 4DUZB 3QU5A 4LC1A 3FCCA 2ZSJA 4Y1RB 3G2MA 3D7KA 3EYAA 3W6ZA 4WW0A 4K8RB 1JXQA 2PZBA 3CSUA 1RC0A 5KVQA 5IP5A 1QH0A 3ZWMA 4CMBA 1OY1A 1MU0A 1YRBA 3R9WA 1GGEA 2PLNA 3M1AA 3WYEA 4R1UA 5CCXA 2QQ5A 4QBTA 4CMEA 4N5NA 2F9FA 1J90A 4FMCB 1P4RA 2BZ1A 2FWAA 2XLCA 4YP1A 5G2OA 1PG5A 2AX3A 4HUTA 3TB4A 1O4WA 1OV6A 5GJVC 1O94C 3EXIA 1O5OA 1MJFA 2ID9A 3CIFA 3MJEA 4P4NA 4PEVA 4A9AA 1MOSA 1XTBA 2QTTA 4C4OA 1HM5A 2AFHE 2GPWA 2IXGA 2OFOA 2YNMD 3PQ5A 2H8GA 4P31A 3OD5A 4PG6A 4U7PB 4BMXA 2W4MA 4EG1A 1A7AA 4PO8A 3OEHA 1KR5A 2CHEA 2VRCD 4B3RB 4LNUB 1ZUIA 3EMKA 3KB1A 5L3QA 1EXDA 3MTQA 5LQSA 5F7JA 1F2TA 2Q9CA 4MVCA 1RXWA 2QT0A 3LBHA 5L51A 3DMHA 1W2WB 3A9SA 3GFGA 1CTQA 4BLQA 4ZTUB 1PEYA 4QQKA 4QO8A 3KZKA 1FFGA 2QD1A 1JQJC 1XB2A 3MS2A 4RZQA 3ZDCA 1P80A 2W71A 4JLPA 2A9FA 3IP6A 2R7LA 3RUHA 5AW4A 2D1QA 1OPXA 2AUMA 5JYEA 4F4IA 1Y8AA 2H7YA 3NBYC 2BP7B 1DWQA 1ORRA 4ZXPA 1NBME 4NXMB 1VHLA 2X19A 4O33A 5G4KA 3TQSA 4Q01A 1Y3CE 3HDJA 4QATA 2RAPA 1EESA 2J9XB 1XZCA 3H1GA 3GRAA 2I7VA 3OIGA 4N18A 1SOAA 2UUAB 5KKCA 1EUDA 3R44A 4BP9A 2IGBA 3HNRA 3QEJA 3OX2A 4I9FA 3RAFC 3ANSA 3OOYA 2A67A 2BTQB 3JQ9C 1V5FA 4G4SO 1UDXA 5DNUA 4JA2A 1TLFA 5LWQA 1UUFA 1Q7BA 2AL7A 1L7NA 2H92A 3EX7C 4DMKA 3FFAA 5KHLB 1DBVO 4CTMA 2HW8A 2BKAA 5HNKA 5HF6A 3CWCA 4B75A 3OZAA 4C88A 4X97A 3MOIA 4NYJQ 2E48A 4O5AA 4ES6A 2IDZA 5DI3B 2WUFA 3N70A 4HNVA 5FA6A 2Y0PA 3GLFA 4OL9A 1DAGA 2H4WA 1TE2A 1G9TA 2VJOA 2H59A 3C5HA 4XJTA 1Q0ZA 3TKLA 2EKZA 1LQUA 1R9JA 2VH1A 2ZRCA 4RYDA 3V8MA 4B2IA 1NE7A 4B45A 5ICSA 2HJRA 2NO7A 1H1LA 1M2VB 1A71A 2XXJA 2BE9A 3R3YA 4KGDA 4MV0A 3T4XA 3O4HA 5BRAA 5CA0F 3Q10A 5HUJA 4CG3A 4OQNA 1KTVA 1IOLA 1PK8A 1KMHB 1XU4A 1JG6A 2LD4A 2JLBA 2OEPA 2MYPA 2PH7A 2PLRA 3DE7X 3I05A 4YJ3F 3JPYA 5C46F 2ZUTA 3S70A 1A27A 3WFJA 4BVEA 1O95C 3EGOA 4TQGA 4JI5B 1SEVA 4R9VA 2PYZA 2ZUWA 1MAVA 3NM5A 5CHYA 1FNBA 3T7AA 4B6EA 1T5HX 5JQGA 3DZBA 4EZIA 5HK8A 4C7OA 3FDIA 1BCRA 5LA6B 4N3NA 3UK1A 2Z2XA 5KEIA 3R7SA 2ZKLA 1TC1A 3IQGX 4DPMA 4QXPA 4MWBA 4Q7LA 4B7AA 5L3SB 2XQJA 1AK2A 1KI1A 4WDRA 4LAFA 5AJTA 2IU0A 5A9SA 1ESZA 3STXA 4GBED 2XGMA 4RPIA 3QTLA 2BW0A 3SJUA 3TLMA 5J47A 2HFJA 4DPKA 2XSZA 3IJRA 1VOTA 1GCIA 1MC4A 4FWIB 3O73A 3HCRA 2GUGA 1KYQA 1YDEA 1SC1A 4P54A 1FXSA 2JKZA 2B6HA 1U8EA 2XUPA 4GKBA 4BXOA 1RWNA 4J2TA 4MUNA 2WJIA 1DCFA 1QX4A 5DVZA 3DXYA 4FGZA 1E9EA 4LF8B 2NP6A 4FT2A 1BGWA 1WCXA 1JNYA 1RLTA 2ZEJA 4M7OA 4R6XA 2JHPA 5DV9A 2AUNA 1V1JA 4XWOA 1CT9A 1PU2A 1WUTA 5IVHA 3EFOA 1GGMA 1X1AA 4WLFA 4ER3A 3DFUA 1GSAA 3WKAA 4XTRA 2F8TA 4LC0A 5BUSA 1KZ4A 3PHGA 2WM2A 4IX9A 3UXYA 1Q7EA 4V0RA 4ALMA 3VXKA 2CEAA 1YRWA 3G2LA 1L1FA 4K6OA 4CW7A 2ZM5A 5E6UB 3ONNA 4UULA 2HLNA 2IYZA 1C7RA 2V1XA 3FUCA 3H5OA 4LDPA 4JSTA 3PE6A 3BQMB 2J6IA 3KFXA 1CIPA 2BHSA 4FFRA 1Y0BA 4D9EA 3PFHA 4PANA 2CNBA 5J5CA 4AJHA 1LQTA 3CJTA 4GR9A 2RB5A 2QMZA 2VXYA 4JEMA 1GT6A 5FULA 4A6DA 2ORWA 4Q1CA 4F3CA 3GFPA 4XIJA 5CTAA 4BGIA 5BYBA 1I24A 1LPMA 2GYVA 4MZXA 3ENKA 2NU8A 3UFXA 3LA8A 1KKLA 2AOUB 4MDFA 4LOIA 3U40A 2XMCA 3GLSA 3RVMA 5JAHA 2RGAA 1PZHA 3GQBA 3RAPR 4JLSA 4K3VA 3D6JA 3U60B 2OBBA 4URUR 4JJIA 3I5AA 5JFOA 4DB2A 3GAFA 1WSBA 3ZW9A 4B83A 4UDNA 1R8JA 3E7PA 2P90A 2OE2A 3EVZA 3KWLA 3OZVA 3ZLTA 2Z95A 1CHNA 3PSAA 1DGQA 1DG3A 2BMDA 4QLOA 1HR0B 1XHLA 2YZGA 3Q0IA 2X15A 3WLLA 3A3OA 3F8SA 4EX7A 5FWDA 3OESA 1SKAA 1OAAA 4G25A 1AUPA 3QE3A 3D6FA 3B5IA 2R8YA 2RDMA 3AHDA 3G2KA 4FCTA 4UE2A 1N0UA 2CVQA 2EERA 1NVAA 3PSHA 3ESBA 4Q4HB 1YHZA 1BYUA 1U3TA 2HLDD 4BFCA 5DSTA 3ICCA 3IJEB 2QUHA 3PUVA 1FJ2A 4ZVNA 1XMIA 5TNXA 4QYMA 5FWXB 2JGIA 3MIZA 3R3SA 5DGDA 2VK1A 2HSGA 4L6IA 4QXQA 5TPWB 3RVBA 4N5IX 5LU9A 5JZMA 1L3CA 1QUFA 1X14A 2OORA 3QNMA 3S5UA 2VP2A 4MLCA 4TVKA 3FMGA 1XZMA 5CPBA 1P33A 3TCNA 3FDFA 4I19A 4IFBA 4Y2PA 5K3FA 1W88A 4B76A 2DY0A 3FYUA 1YI0A 3I4FA 4G65A 1KKUA 4X6UA 5A2GA 5J9FA 2GZRA 5AKKA 4E32A 4PXAA 5FJIA 4YV7A 1W47A 1KFJB 2DHEA 3GFBA 5AJWA 4AMZA 2O3SA 3GK3A 1XE3A 3ETNA 3B7PA 5UKDA 4DV7B 4L07A 1CQJA 3R8FA 4OOEA 4ZANA 3DZFA 1QOZA 5EGSA 4EGQA 3H6KA 1XLWA 2O2JA 2D1SA 1EM6A 4NFLA 3ZJ4A 3IKVA 4OFBA 2V9PA 3KWJA 2Q07A 4PX3A 4Z0PA 2M6SA 1TXGA 2QTNA 2PDAA 5DNVA 3VPBA 4S05A 2IHBA 3KOZA 1M66A 4L28A 2JLUA 2ZYTX 3D3NA 4JT4A 1VGQA 2QX9A 3GFTA 4XYLA 1Z4OA 3DBHB 1O6FA 3VO8A 1OWOA 2SCUA 3M3HA 5IKOA 3VMMA 1XNRB 3QVMA 4X66B 4J0DA 4JWTA 5H7XA 3S7ZA 4TV9A 4D0RA 2QG4A 2ONCA 1CUEA 5JYCA 3A14A 1VLJA 1S8FA 5IUJC 4Y2XA 2RHCA 2W22A 4ZEWA 4UNRA 5B7QA 2FSHA 3KUUA 1ZIOA 3LL7A 2ZRJA 2EQBA 4ZVRA 3WLIA 4CBVA 3N2GB 2R6DA 4I3HA 1MJNA 1BA2A 4QUDA 2GAJA 4G56A 1P4SA 1XCLA 5BRJA 4D4HA 4F45A 1QCZA 2QRLA 4YRKA 3IERA 1OTYA 2J59A 1TF7A 5CG1A 2OHVA 2PUTA 5TQ0B 3G2JA 5DNCA 1Y1LA 4DJAA 4URHA 3GNLA 1TK2A 2HOQA 3AKEA 3GF4A 4OMFG 5A9TA 2RJNA 3OM8A 1JW9B 1DOAA 3DTVB 5EGNA 2X7XA 3W5IA 3MHPA 3LKBA 4LXXA 3PQDA 2IUFA 2ODNA 1T5DX 2VN8A 3MYYA 5BWCA 5FBKA 2QZSA 2AXPA 4H6VA 1UZAA 4Y1RA 1NZFA 1AUOA 1V39A 2E89A 3JYLA 1U0EA 1DBRA 1ZR2A 1NNUA 2IK8A 1EFLA 1FMTA 2YV1A 2QN7A 3PFNA 3G85A 2G07A 1RKVA 1WD7A 2I5PO 2PPVA 1P1BA 2ZJOA 3RJTA 2EFDB 4MKFA 3W04A 3X1YA 4RAOA 2QBYB 3QY9A 1FUEA 1MXFA 4TQ9A 4DCVA 1MB3A 5AW8A 1KXJA 5K4HA 4NG4A 2B98A 1E1MA 5CAEB 5C1DA 3QBEA 4KAFA 3S40A 5JSKA 2O6LA 2PUHA 1T24A 3FB4A 1DG1G 1ZM7A 2CJFA 4TS9A 2G8LA 5IAEA 1H4QA 1FCJA 2FQWA 3PDUA 1D9ZA 3KD2A 4GOXA 3LECA 4LNUA 2WYHA 4BQQA 1SHLA 3HXTA 4G1BA 2BVNA 5E2BA 2HWXA 4QULA 2D1TA 4A5SA 4DUGD 2X1VA 2R5FA 1V5GA 3N9IA 4RDHA 4C0SA 2EX1A 1CJBA 1P72A 1TPZA 4P81A 2BYTA 2B5WA 2O8FB 1PQUA 1QJ4A 4UPDA 1O6BA 1XPUA 3IEKA 4BNJA 1S7GA 1MP0A 5KYXB 4MUEA 4X84A 4EW2A 1HQYE 1LPSA 3QOWA 2ZJ8A 4CEHB 5CNIA 3PRHA 4DDWA 3KBBA 5SICE 2BP7A 4DKXA 2HADA 1E92A 4H08A 5K6RA 1VYHA 1PJ2A 2PY6A 1HYHA 2Z2JA 1D8TA 2BRUC 5EJ9A 3I3OA 2IYYA 2OY0A 1Q17A 4QVKA 2WTEA 3C1UA 3CH6A 1AZLA 1NBWB 2OAGA 2A0UA 2FWBA 2YVUA 2YY6A 3I2HA 4J0EA 1T2FA 4X9XA 4EKEA 1DMRA 1AGPA 1QTRA 4INAA 4JQOA 4LS3A 5E1OA 4AXBA 2BTQA 2X5JO 2Y0DA 4NL4H 4PC3A 1KK2A 1KMIY 4I9HA 5BSMA 1YMVA 1RQGA 4BFVA 5IM5A 3H2BA 4LXUA 2PMEA 2YJ5A 3VU3A 2I3GA 4BGEA 3VKFA 2RFLA 3IODA 3KL2A 1P7YA 1OXMA 2VLIA 4GMHA 3L7OA 4PBRA 3KPWA 1YUBA 4LFAB 4KR2A 1J0XO 3AG5A 2QRUA 4XLLA 5ED4A 5LB2A 2PANA 1E8NA 3RYFB 3DWGA 2GTIA 2YZ7A 3QK7A 5JH7B 1QVVA 3W34A 3AF0A 4M1EA 1L5RA 2IZZA 1E7QA 3R3JA 4LSMA 4TYWA 3AP3A 4ZYVA 5C5IA 1QP8A 2K2WA 3ZY6A 3I1FA 3ZHYA 4IKOA 1G9XA 1ZL2A 3BOSA 3EUFA 5HKOA 1M2VA 2G1KA 1SG0A 4ZK6A 1H6BA 4P2BA 2BI7A 3H99A 4EHJA 4V24A 2BGKA 2QAGB 5BSRA 6Q21A 1P9NA 5TT0A 3F4BA 1DDGA 1L5OA 3GVCA 3T9DA 5BWNA 2Q4TA 1URPA 3HCAA 4YROA 4HEA1 3AVPA 4F8EA 3AZOA 2QRHA 1R6UA 1HY3A 2W4IA 4R7TA 4V1CB 2OZEA 3NTXA 3HY6A 3E5RA 1WXEA 2PZJA 1N8SA 4RPLA 3P0FA 4LNHA 3ED1A 5LA6A 5A0VA 1G5HA 5TEWA 3NTQA 3AOEA 1BYIA 3R3WA 4KZKA 1UDWA 1LRJA 2A9KA 2DFNA 2R4QA 4ITUA 5L3SA 1CU1A 5EWLB 3H3XA 3I4CA 1U4OA 1Q6YA 4JP2A 5L3ZA 1XCOA 4Z9BA 1E8MA 1NBEA 3A0RB 4M1MA 4XFKA 1OHHD 3MBIA 4HN2A 4Q1EA 4XLZA 2QY6A 2E18A 2SBTA