3GJ0A

Crystal structure of human rangdp
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
207
structure length
207
Chain Sequence
SAAQGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
publication title Crystallographic and Biochemical Analysis of the Ran-binding Zinc Finger Domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gj0A00
3A4MA 5GJBA 3GJ4A 4FINA 4PO9A 1ZINA 1ZM9A 2EVWX 2W2VA 4LJYA 4NYIR 5CJPA 3DMNA 4XWAA 4LHZA 3BC1A 4MH0R 1AZTA 1XTIA 2OFWA 1QHHA 3RVBA 4PHHA 4BEJA 1IJFA 4RJLA 1IQPA 1KAOA 2FWRA 4QJ4A 1GL7A 4IKEA 5C4GB 3BGWA 3O8RA 4LSGA 2GEUA 1VCMA 1AN0A 4X8HA 3NVAA 4QHYA 4TL7A 4Q4HA 1S3GA 4HAWA 2FFQA 3B78A 3NEYA 1CJVC 1J70A 1Q3TA 5A0FA 4C0AC 3ETLA 4LHWA 1VCOA 1NG9A 2EYQA 4U7DA 2AFHE 5D3QA 3THYB 2E9SA 2QP4A 1DAFA 3WRYC 5FFMA 4NYJQ 2BEJA 3B9PA 2GEVA 4LOAA 4E5UA 4LJAA 2F43A 3PR1A 5FL7D 3SJZA 2CCKA 4DUGD 4NPHA 4L5BA 4A0RA 1RIFA 2NTYC 1GNQA 2GZAA 4O2RA 4B32A 3A1SA 4O2LA 4JLKA 3KKOA 2HJGA 4B34A 3KB1A 4NDZA 1R0YA 2GJAA 1MKYA 4IDNA 3AVVA 2DFTA 3CZQA 2IUUA 1Z6YA 1Q1EA 1I4TD 1RPZA 2IS6A 3QKSB 1W2HA 2X2EA 5KTYA 1B0UA 2DYKA 1W0KA 4MUBA 3X1ZA 4IJMA 1OW3B 4JIMA 1E79D 2F1JA 2GHIA 2VHTA 3REFA 4F38A 1KI8A 2F1HA 2BHRA 3GD7A 1F48A 4Q7LA 4PAQA 4L9WA 4V0NA 2QNRA 4PZLA 1CJTC 3D31A 4GP6A 4BFUA 1G7CA 3BXZA 4DHEA 2BJWA 3SBDA 5EP3A 1OXUA 2OM2A 2QMHA 4DEXA 2OCPA 2G0TA 3VTKA 4LCBA 5DGXA 1GAJA 5TVKA 2A5FA 1ETUA 4WVFA 3LW7A 4ZI3A 1NN1A 1G7TA 5FUXA 1MO5A 1W5SA 2UZ3A 4OI2A 5KSPA 3IPXA 2XGJA 3ZD6A 1ZUIA 2CLDX 2QY9A 3H1TA 1G5TA 1DARA 4C0JA 2AX4A 3PJRA 2UZIR 1HH4A 4JJZA 3MCAA 3UG7A 2OAQ1 3IILA 4URYR 2GXSA 4UXHA 1KGDA 4XVUA 4DVGA 4TL6A 4XOIA 4Z54A 4NYJR 2FFHA 3Q72A 4OQLA 1SHKA 2XTMA 3RYTC 3DVLA 5DHAA 4TQ9A 4L8GA 1G8FA 2NO0A 1YZGA 3RSOA 5IF9A 1ZU4A 4IEIA 1OFIA 1SVOA 1M2OB 1DAEA 5HR5A 3NDBB 1Z63A 1OLOA 4FMDB 1XU4A 5EE3A 2RGGA 3C16C 1N5LA 2PT5A 2PBRA 2XSZA 4H1UA 4YXWA 4C0QC 3NXSA 4R71A 3FB4A 3CR7A 2IS2A 4C30A 3NG1A 4XWKA 3ZJYA 3FMIA 4BFVA 3K70D 1KIMA 1KSHA 5FR1A 5CLQA 1NVUQ 2BIFA 4OJKA 5BQ5A 4AKEA 5J4VA 1JR6A 3GJ0A 4XVRA 1WBDA 2JAQA 1PV4A 3JZAA 4TQAA 4EPXA 5CK4A 1KK2A 4BLOA 3TRFA 3GJ3A 1W4CA 4JLDA 1AGRA 2ASEA 3DOEA 3NC0C 1CXZA 3O47A 3KQUA 1QG4A 2PCLA 3KKNA 1IN6A 3OF5A 1EWQA 1E4YA 4NZYA 5DHFA 3SQWA 4I1SA 3EZ9A 3GLHB 4LPKA 3GPLA 1X3SA 4MRPA 4QNMA 3TUIC 2O0KA 3F3YA 1NN0A 1OB5A 3IIJA 1FP6A 2A5YB 4TMKA 4BWYA 3KQHA 5H8WA 1C9KA 1KI7A 1E9BA 2KB0A 3DHWC 3BB3A 3OESA 4P3YA 3CF6R 1PUJA 5J4YA 1ESNA 4PHGA 1W36D 1KJYA 4QL3A 4M9XA 4X8MA 3ZZ0A 1K5DA 1YJ5A 3U3OA 1SXJC 2CL0X 3GLHA 4C0LA 2IYXA 3KUCA 4Y0AA 1DAMA 1LS6A 4MYHA 2LCFA 3BK7A 4DSNA 3K9NA 3U44A 1UADA 4TTPA 4XIGS 3P26A 3DOFA 3QJYA 4D0NA 1OYYA 1NNEA 1JAIA 3WHKA 2QTVB 3THOA 1BMFD 1YRBA 2ANCA 2ZJ8A 4A0GA 2IYTA 3Q9LA 1YR9A 4CRWB 1VDZA 1G8HA 2D3WA 1WMSA 2H5EA 4BLQA 1KYIA 4B48A 2G1JA 2AFIE 1II0A 1G7RA 1KNQA 1Q57A 4FIDA 3K53A 3SU8A 4IXNA 1S9DA 1UBEA 1TX4B 4CEHA 2YC4C 1FP7A 4MYTA 3F5FA 5EE0A 4B44A 2YKGA 1W4BA 3I8XA 3FFBA 2O0HA 3PEUA 4ZDKA 2PEZA 2H92A 2VP9A 4MRRA 3U5ZB 1F3OA 2QG6A 1X86B 2BBOA 1LTQA 3LNCA 3IBGA 5KU1A 2E87A 3MFYA 3LAWA 3VR2A 4ESHA 5L3QB 4NYMQ 1U81A 1NSFA 4Q9KA 4KCGA 4MGYR 2HF9A 3L8ZA 1L4UA 2QMOA 4QGAA 2ZEJA 2DFNA 4IXMA 2B7BA 1JJ7A 5JCPA 4WA7A 5JS8A 1GL6A 1VTKA 3Q85A 3U7EB 2GF9A 1LS1A 3V9PA 4B43A 5BW8A 2JLXA 4C2UA 1PVOA 5F9FA 3QF7A 1A7JA 5L3QA 2Q3MA 1MO3A 4TLDA 4TYPA 1E2LA 3SQXA 2OCYC 4LRWA 1Z0FA 4OK5A 2JJ1D 2ODBA 4HAUA 2F3TA 4O0MA 4ZI2A 5FUWA 4RKFA 4AK9A 2G6BA 1JXOA 2WOJA 4KFRA 2J59A 2XXAB 3LBNA 3U2QA 4ZCMA 3HU1A 4PSVA 2EFCB 2WJGA 3DEFA 2XZOA 3R9WA 1OV4A 4AI6A 3RANA 4ZIRB 4NHOA 1DO0A 2ZR7A 4ASUD 1TNDA 3A36A 3LLMA 3PXGA 2BM1A 2QBYB 4ERNA 1EXMA 2XXAA 1KO5A 1P4SA 5HTKA 3AH8A 3K9HA 3GMTA 4L9SA 4IOJA 4TLBA 1IJEA 1XMVA 1US8A 1U0HC 1GILA 1H8ED 2ZJYA 2YVUA 3EA0A 4NMMA 4Q1FA 1FMJA 1U8AA 4KHZA 4CEJA 1CRPA 4IDQA 4LPSA 1XXHA 4B3BA 1RW4A 4I1VA 1QVRA 2XZPA 1ZCAA 2XTZA 1XTKA 1W4AA 1XZQA 2RGDA 1ZD9A 3IHWA 1ZVQA 1YRAA 4BFSA 1FTNA 4KFUA 4URZR 3W6OA 1NKTA 5AJWA 4BQSA 3AVQA 3EASA 1Q12A 1W49A 2GZDA 3W5IA 4NYMR 2W6IA 4OK3A 3EG5A 4KU4A 1JQJC 2G0NA 4DSTA 2J7PA 4IW3B 2BCGY 1XCPA 4JS0A 4TQUS 1P75A 4UJ3A 2NQ2C 2PMKA 3VR3A 2OUKA 3LY5A 2WMNB 4AKHA 5DH9A 2IL1A 5FTLA 3A1UA 1N25A 3RHFA 2XOKD 5LDDC 1K8RA 4QXAA 2XNDD 2VLIA 1Z5ZA 2GWHA 5AJYA 3PEWA 3EWAA 3H86A 1RRGA 3P4YA 2CVFA 1VKJA 4CEIA 5JJKA 2GXUA 3PITA 2NPFA 2VP5A 4G5SA 4TL8A 2ODNA 2VHQA 4ZKEA 2O8CB 5KPDA 4QGHA 821PA 1NMXA 2X1VA 1NG1A 1KK1A 1NVVQ 2FSIA 3Q3JB 4E03A 3T15A 1JJVA 4R9UC 1I2DA 4ARZB 1SGWA 2AK2A 2CXXA 4URXR 3N2EA 2QU8A 3ADDA 1ZU5A 2GETA 3SJCA 4EJSA 3I32A 3WHLA 1E96A 3A1TA 4XJXA 1HTWA 1AM4D 3ZLJA 1K6MA 2WKRA 2GZHA 1UKEA 3CF2A 2OE2A 3QPUA 3X1WA 4ARZA 1M8PA 1CS4C 3CX6A 4AYTA 1YZQA 1Z28A 2AWOA 3Q7PA 2QRNA 4AC9A 2P5TB 3ZGXA 1JI0A 3CX7A 3QNUA 3T06B 2C96A 3HYTA 3EPKA 1JR3A 1U90A 1HE8B 3DPUA 2LKCA 1AQUA 1XWIA 1W0KD 3EARA 3MWKA 2ZYWX 4ITRC 1Q21A 3NWJA 1I4LD 1ZNWA 2VP0A 4URWR 4Q9LA 5TDHA 4DZZA 4DUGA 2DCUA 4TMVA 3N5CA 1TF5A 4L4UA 5BYJA 2YWHA 4DEYA 5CB6A 1JNYA 4PPQA 4QHSA 2GJSA 1Q44A 4JVSB 4RD6A 5FOXA 3UK6A 5EE5B 2WZQA 3BE4A 2IYVA 1KJZA 2DWQA 2C98A 3NEJA 2KSQA 2HCJB 5G40A 3ZVMA 4C2TA 1ZNYA 3WP1B 4TYNA 5FH9A 1FNMA 5DE3A 3B1YA 5EP2A 1N6NA 2NMVA 2JLYA 2A30A 5JHHB 1ANKA 3QPWA 4RZXA 1E79A 2ORWA 4QBHA 1B23P 1Z6GA 2K5UA 2ERYA 4A6PA 4A0FA 4Q4JA 4PXAA 1F60A 5FPSA 3FMPB 4CIDA 2BBSA 4GI7A 1SXJE 4GSYA 4X8OA 5CM9C 1VG1A 3THXB 5C2JB 4C7OB 3NBYC 3T5GA 5EJEA 4D4MA 2ZE7A 2P6RA 3GEEA 4DWJA 2J0UB 2CL6X 5GJWC 2ZRCA 1AK2A 2KWIA 5DO9A 1RYFA 2XSZD 2Z43A 1HQYE 1EX6A 4YXWD 4C0KA 2PX0A 2BMJA 1OJLA 4DCSA 2JASA 3TKLA 2NZ8A 4MKFA 3W3ZB 4EQ6B 1UFQA 3ZS8A 3THXA 1GVNB 1SVWA 1FQKA 2ZANA 3TLXA 3WNDA 4AYXA 4LV6A 2H7VA 3IQWA 4MRVA 1DO2A 1NBMD 1VHLA 2IHYA 1IXZA 4JL5A 3K70B 3AVWA 1G5PA 2FE4A 3GJ5A 4Z8YA 3TUJC 4TMTA 5AUNB 4JLAA 1A1VA 1LNZA 3LVRE 1ZC3A 1GL9B 3FMFA 1FMLA 2C5LA 1NBME 2QSZA 1Q1ZA 1EFRA 5CDFA 1FPMA 5CLLA 4JYCA 4DDWA 4ZV4A 2WPDA 4PZZA 2WWWA 3QPVA 4LYFA 4O25A 1XEFA 3BH0A 3LH5A 3MLEA 4MGKR 4BZXA 1IN7A 5AUQA 2WWXA 1E94E 1MO6A 1E1RA 3ZZTA 4B2LA 2GBLA 2CE2X 1KZ7B 1TQ6A 2QAGC 5B58C 721PA 2JDIA 1PZNA 4M9ZA 3ZQJA 1VYTA 5FTJA 1Z29A 2F9MA 1KI6B 4GP7A 3SEAA 1W36B 3LRPA 4K46A 1U9IC 3GLFE 1F2TB 1T3HA 2PLFA 1OKKD 4D82A 3OIVA 4Y0VA 2J87A 2RGNA 2IW3A 1ZRHA 1E0KA 3T1QA 1C4OA 2Q6TA 5HE8A 4NCHA 4TN1A 4G5GA 3VR6A 5E3HA 3U61B 2Z4RA 4MUAA 3IQXA 2XJ9A 4IDPA 4Z1MD 2BDTA 2JLSA 3CRRA 2JATA 2FEOA 1F2TA 1TADA 1KMHB 3IHLA 4PPGA 3SS8A 4JT2A 1EGAA 1P62B 4PX9A 4LJ7A 1VYUA 3TMKA 2J9RA 5K8TA 3CNNA 4R7ZA 5FOTA 4A8JB 2IYQA 4M9SA 4UQOA 2XEXA 4LBZA 4Q01A 2O8BA 1HURA 3RRZA 3OE7A 1AS0A 5FBVB 1E99A 1MR3F 2HUPA 2H8KA 1NN5A 2ZYVX 3K0SA 2FSFA 1ZMXA 5LD2B 4WXRA 5F98A 2TMKA 4P4UA 2EFGA 4KLNA 4V0ME 1GRQA 4DDVA 4LY6A 3CH5A 4RFVA 3B5JA 2HV8A 4X8LA 3W6PA 1OXTA 4DLRA 4EPWA 4C9BA 5KNDA 1FOEB 3AGQA 1CULC 1XTRA 3AKEA 4HAXA 2C9CA 2GNOA 4HLQB 4ABYA 3PFIA 3ZYCA 1NF3A 4TMXA 4CT5A 4OQNA 1CR4A 1S8FA 4A4DA 5C1BA 2ONKA 2C8VA 4MYUA 2IYYA 4G01B 1Z0AA 3F0TA 3T1TA 4JBYA 3M4YA 3BS4A 3TW8B 2J0SA 1EESA 2B92A 2BM0A 2HXYA 4M1SA 3N70A 3SYKA 4CT4B 1FFHA 5CIWA 1NJFA 2CEAA 5FPKA 1FUUA 4BLRA 1YR8A 3EXAA 1GWNA 3CKLA 4BLTA 3OFNA 3IIKA 5B30A 1IY0A 2IS4A 4LHVA 4ACAA 2FGKA 4M9QA 2YOFA 1G1MA 1XMJA 4KYIB 1Z2AA 5EE9A 1OHHD 1YE8A 4C0BA 2IWHA 3W90A 2OILA 1N6PA 3Q5DA 4PSKA 1P9NA 1Z08A 1NLZA 2JJ1A 4IOKA 2VP6A 2OEPA 2H57A 4ZO4A 3HYRA 3C4JA 4W9MC 2CJWA 1R2QA 4M1YA 3T1OA 3UATA 4PQYA 1R7RA 5JWOA 4M1WA 1XD2A 1M7GA 5G53C 1M7HA 2V7QA 1QZXA 1E2FA 1P2TA 1N6OA 3V4FA 3BH7A 4IOLA 4ASUA 3PIRA 3AP1A 2V6IA 1XXHE 4EPRA 1CIPA 5GJCA 3IO5A 2FOLA 2FDCA 5FUYA 1G291 1X8JA 3AVYA 5DI3B 2IXFA 1TUIA 4AY2A 1R0WA 2W6ID 2ZRIA 3CBQA 3NBZC 4IDHA 3PEYA 1XTJA 5LB2A 2QP9X 1G18A 4DLVA 4CGZA 2O8EA 5KDLA 2BC9A 1E32A 3WYFA 1H8EA 4CF7A 2IF0A 3I73A 1QHHB 4WZBE 4CZ2A 2EWVA 2Q0HA 2QORA 5J5CA 2P3SA 1T0HB 5F2EA 3NKVA 1EK0A 5SZKB 5DI3A 2PMDA 1IOZA 5B57C 4AKIA 2C03A 2DR3A 4QG7A 4M1MA 4RSGA 3FYHA 2KBEA 4Q4HB 5JI2E 2BCJQ 2DFLA 5AJZA 3LX8A 3ZH9B 2I4IA 3CF0A 5FPYA 5K8LA 1DAKA 1UDXA 1UBCA 1W4RA 4PC6A 2GXAA 2DWPA 4IOMA 2XB2A 1DE0A 1CP2A 3KKPA 1UF9A 4RZ2A 3X1YA 1Z0JA 2QAJA 3TH5A 1J7KA 2GJ8A 2V1XA 1JQLB 3KJGA 2G1KA 3GFOA 2XOKA 3MWYW 3SYLA 2XNDA 3VR5A 2BMDA 2P67A 2F43B 3UANA 4GMDA 2HLDD 2HF8A 1KI4A 4XSGA 1VCIA 4LJ8A 4FMDF 4P4TA 3FOZA 3P1JA 5E4FA 1JBKA 2PX3A 3GJXC 3R9XA 2J0QA 4OK6A 3OEHA 1KY2A 4JYBA 4PTLA 1JR3D 2VHCA 1II9A 1DG1G 1NJGA 3DMDA 3T61A 1HV8A 3PUVA 2OESA 4HLUC 5EXSA 1R8SA 3UWOA 4QJ3A 1ZD8A 1N2CE 2GEDA 3B6EA 3I1FA 4DLSA 1E9CA 5JJLA 2QI9C 1JR3E 3C15C 4Q7MB 3GJ6A 5KYKA 2A9KA 4JVNA 5AJVB 1KKLA 1OH7A 4GT1A 4D25A 4IEEA 2OV2A 1E4VA 1C1YA 1T3SA 3LBIA 2ZU6A 1J99A 1G8PA 1ZNXA 2ZI9A 2DPXA 3KTAA 3SDZA 4B73A 5GVSA 3QXXA 1XJQA 5F9HA 4OJQA 4RD1A 4LGMA 2QE7D 1KO7A 2Y8EA 2ZE8A 1YQTA 1VECA 1R10A 2J3EA 4PPNA 2W0MA 1G19A 2JLUA 2IYWA 4GOKA 2WM9B 4B76A 4NE2A 4U02A 3VNUA 3BD9A 3AKYA 4KITB 4HAZA 4ZDWA 4G3XA 4NCJA 3ZQ6A 2O0JA 4Z8XA 4HZIA 5FPTA 2FEMA 4U5XA 4C0HA 3QSYA 5IHPA 2EYUA 1GIAA 4WOPA 2Q3HA 2WJYA 1AS2A 2VF8A 3FKQA 3G82C 4V0OA 2YWEA 3K09C 3KFVA 1CR1A 4B2PA 4EPYA 2ZRAA 3B2EA 3EZFA 1NVXQ 4L15A 5IK2A 1E3MA 5C4MA 4QNRA 1SXJA 3EIQA 1N6LA 3QBTA 4F4IA 1QHGA 3MJHA 3QBVA 4IDOA 5CJ2A 5JWHA 3ZDQA 2R6GA 2FG5A 3W34A 5KDOA 5TY0A 3ADCA 2D74A 2GAAA 3QY0A 3LBHA 4QC2A 1X8LA 2NO1A 3V00A 1NIPA 1KNXA 1LY1A 1FL9A 1Z3IX 1PLJA 4IVPA 4IHQA 1J8MF 2P2LA 2V4ZA 1EFRD 4JVLA 4KFTA 5KSZA 3QXCA 2P0EA 4QHTA 1Z6AA 3T5DA 5JI3E 2EU8A 3TW4A 2O5VA 2V9PA 2WIAA 1AKYA 2WPDD 4BZQA 4LUCA 2FPMA 1U2RA 2WWYA 3DDCA 2BBWA 2BWJA 2GCPA 2GK7A 2FH5B 1E2EA 1JPNA 5CDFE 3NTUA 3RAPR 2OBMA 1IBRA 1UBFA 4QJ5A 1AJEA 4PO8A 2J41A 2LKDA 1E1RD 5LBIA 3E70C 2ZI6A 1BKDR 1NBMA 2C78A 2JDID 1DEKA 3ZVRA 2XZLA 2IHBA 1W2GA 3VMFA 3KB2A 2QSYA 2AWNA 4BRUA 3QKRB 1WDTA 3UMSA 1UPTA 2QPAA 2OXRA 3E5HA 5EXPA 5L3SA 1R8QA 1MH1A 2J45A 2VRWA 3KQKA 4GMXA 5FR2A 1R5NA 4KFSA 4MDEA 2FX3A 3LDAA 4BEBA 3GEIA 4TTQA 3OIYA 1HQCA 5SZIA 1G7SA 4DLTA 1S0UA 2OLJA 1XPRA 2FPKA 2ATXA 4PC7A 2QQ0A 3U44B 3QKRA 1ELOA 1ZM3A 3ICQB 3TSZA 3VKGA 4G0NA 2GK6A 1EFHA 3DL0A 2R8RA 3GLFA 1FQJA 3A37A 4GPTA 3O8BA 1DPFA 1GUAA 4GFDA 1GZSA 1CRQA 2W58A 2XAUA 2WICA 3MUFA 1NLYA 3RS4A 2N42A 3PUXA 4CEHB 1F2UA 1OKKA 3OE7D 4F93B 5DNYB 1HYQA 4HUQA 4DC9A 5TB5A 4ZDJA 1E2IA 2IYZA 4BZPA 5JMTA 2ZRHA 4M4SA 4Z1MA 1OIWA 3GLIA 4KSBA 3RRNA 4TYWA 4FCTA 2J46A 1SZPA 2IF2A 4RFSB 2B8TA 5DN6A 1RJ9A 5LPNA 1S2MA 1GKIA 4FWIB 2WKQA 3A8TA 6Q21A 3VQTA 1GM5A 2QP3A 1ZC4A 1WCV1 2IK8A 3QE0A 1OIXA 2W83A 2D2FA 3WMGA 1J8YF 2G88A 1T0JB 3I5YA 4V0MA 2V6JA 1XZPA 8OHMA 4RFSA 1IY1A 3QG5A 5ELXA 4FMCB 1R4AA 2BV3A 2CVHA 4BFWA 2P65A 4DIDA 5GADl 4DXAA 4DDTA 5JBQA 1M1YE 3WBJA 2JLQA 2GCOA 2AD1A 3OFND 1ZAKA 2ERXA 4TLCA 2H18A 1WF3A 2ONJA 4LJ6A 1G6OA 3CUEF 2OFOA 5G3YA 3U60B 2JIZD 5P21A 1OF1A 1ZUNB 1O87A 2VF7A 1KK0A 4D4JA 3GQBA 2RHDA 3PUZA 4LDJA 4M1TA 5EXTA 4BUJA 5DSZA 4TT3A 2C04A 2EFHB 4TZ0A 4A9AA 1Z0KA 3JVVA 2QT1A 2ZM5A 5CIQA 4XTRA 2RAPA 2V7QD 5KNBA 1SVSA 4MRNA 3CNOA 1US8B 2WAXA 2VPPA 4CEJB 2RGAA 1KSGA 1X1RA 5CK5A 4MGZR 1XXHB 3PEVA 4D0LB 3QXJA 1OIVA 1EFUA 1OHHA 2F7SA 1D5CA 4N0EA 2FFAA 1EWRA 2OCAA 1OYWA 1U8YA 2FJUA 5DLQC 3J81k 4V0KA 3C8UA 2EW1A 2VP4A 3ZIAD 2ATVA 3QOFA 4NP6A 2GILA 2KE5A 5AR1A 4Q9JA 1DAHA 1RYHA 2PL3A 3HDTA 4DSOA 2VL7A 1SULA 3BH6A 3T12A 5JSZB 1YU9A 4UXJA 3TBKA 4XD7A 3W9YA 1P6XA 3U4QA 1S96A 4CEIB 5AUPB 2FSHA 4TTRA 1EG7A 1G41A 2KBFA 3ASZA 3A4LA 1N5KA 3C5CA 4K81B 1OE0A 1NSTA 2DWOA 3T1VA 1Z06A 4TZ6A 1E9DA 1GITA 3IBYA 4LBVA 4DCTA 3M0EA 3PCRB 3MMPA 1KO8A 4I99A 5JSZA 2BKEA 2CNWD 5DYGA 4US2R 2IXGA 4NCNA 5DISB 1Z2CA 4YMUA 5JECA 3GFPA 2ZRPA 3LV8A 3VR4A 1RRCA 1QG2A 3FHCB 4E07A 3EA5A 4EJSB 4DLZA 2BKUA 1JEEA 2PH1A 1OSNA 3B9QA 3L43A 3BOSA 4YDHB 3SFZA 4DBLC 2ZJOA 3CONA 4I4LA 1IXSB 1JB1A 3OEHD 3O8CA 3D7MA 1G3MA 1H65A 1OT3A 2Q9BA 2C9YA 1VIAA 2WMOB 5H68A 2QPOA 4NTZA 4A36A 1OH6A 3B13B 2ZRNA 1N5IA 4M1OA 2X2FA 2IEYA 4Q9IA 3KZ1E 4C3ZA 3AP2A 3K0AB 3GFTA 2ZJZA 4OHYA 1M6NA 2HLDA 2QT0A 4JBXA 2REXB 2R6AA 1COWA 3WMEA 4AURA 4BFYA 2AR7A 3B8HA 2HJVA 2ZRDA 4CYMA 4Q00A 2EWWA 2VH5R 2ZUCA 4DKXA 4N1AA 2IC5A 4YONB 3FHTA 1FZQA 1S9HA 5JFGA 3K0AA 2WKPA 3I3SR 3LVQE 2F1IA 1DTSA 1ONBA 2MSCB 1TU4A 3A58B 2W6JA 1J90A 3CB4A 4QRHA 4M22A 4V0LA 2IS1A 1QVAA 1ESMA 1QRAA 3O8DA 2O52A 3TSWA 5BN5A 4Q4JB 4FMBB 4EFMA 1VG8A 2CHVA 4IRUB 3AKDA 2JA1A 4LJ4A 1L8QA 2QE7A 1SKYE 3TR5A 5IK2D 2ZI7A 2H1LA 1SXJD 1PJRA 1L4YA 1E2GA 1P2UA 3AF0A 3K8YA 4IVQA 4MKHA 5BN4A 1KI2A 1QHXA 4B75A 2YNMA 3U6BA 3LXRA 4HB3A 1U9IA 2OZEA 4WZAE 2NO6A 3BJIC 3RRMA 2HT1A 3WYAA 1P9RA 3ZS9A 4HDOB 4M53A 4P0TA 4HLCA 4A82A 1XEWX 5G41A 1PLLA 2YOHA 3TVTA 2ZRLA 3CPEA 3GLGE 1SVIA 1CR0A 2WVJA 4RKEA 1II8A 2J0VA 4B35A 4EAQA 4LV5B 3HPQA 2MSDB 1S1MA 4TMWA 2CHGA 4EPVA 4A2WA 1P9WA 1KO4A 1XEWY 2ZUBA 4JLVA 4I1UA 3W8NA 2YJTD 3TQFA 2D62A 4YLGA 1LF5A 4LI0A 3MAAC 4OQFA 2EFEB 4JLMA 1TF7A 2FNAA 5E7IA 4J0QA 2ZETA 1GKUB 1MT0A 4RCYA 3VHLB 5E7JA 2REBA 4B2IA 1EFCA 1G3UA 4DLWA 3OEEA 1GNRA 1P3JA 4F4CA 1U8ZA 4LBWA 1T8TA 2QQEA 1MO4A 1ZJ6A 1ZYUA 1Q1QA 1N3BA 3MG9A 2ZQ5A 3WNBA 4OHVA 3SZRA 1L7VC 4Q47A 2AHOA 3H4MA 3BBPA 3WXMA 5CB8A 3U6KA 2IA5A 4TSFA 3TJZA 3QF4A 3NBXX 3GJ8A 2ZSFA 3BERA 2QUZA 4EUNA 2FSGA 2CCJA 5JCZA 2PJZA 3U7FB 2DHRA 2G83A 5IT5A 4LK2A 1G6HA 4HLDA 4NCIA 2ECKA 1TEVA 1SHZA 3M6AA 1ZM7A 2PCJA 2HYIC 4FW9A 2ODEA 5FBLB 3FGNA 3REGA 4GBMA 3KQNA 3VKWA 2A5GA 3TIFA 3VNVA 4RZUA 2B6HA 1QHYA 2MMGA 4DT1A 1GNPA 4DIEA 2W2TA 4PAOA 4D26A 3VKHA 3AF2A 1TUEA 3KFXA 2ANBA 1CF4A 2A78A 4W5JA 4G5OA 5DN6D 3QXHA 2AKAB 2XX3A 1G17A 1NMZA 1G4UR 1IN4A 4PC1A 2GRJA 3GLIE 3TGPA 3KXLA 4BPBA 2RGXA 2NG1A 4D80A 2N46A 4UXIA 2GDJA 4KLZA 2IWRA 4P4SB 4Q1DA 2RGBA 2FF7A 5EUQB 4S35A 3ZZUA 2BEKA 5SZJA 2LWIA 2R62A 1W0JA 4FCVA 4MITA 3NBFA 2IBMA 2ODWA 4Q4AA 4WIAA 1GG2A 1E9AA 1VG0B 2WJIA 4P4SA 4G1UC 1KAGA 4A1FA 1VG9B 2CK3A 3K0FB 3HR8A 4PHTA 2FV8A 3FDIA 1E2NA 2C2HA 3AGPA 4Q1EA 3QIAA 1XP8A 2VHJA 2AXPA 3PENA 3A4NA 2VBCA 4FI3C 3GJ7A 2Z5FA 4B71A 3HR7A 1WQ1R 3OAAD 1KI3A 5CM8B 3IPYA 4M0LA 4A2QA 4LYHA 4V03A 2NIPA 3K0FA 1BIFA 4TT3D 2VQSA 2YOGA 4KBGA 2FGJA 4MKGA 4Q03A 3RWOA 3CZPA 2J1LA 2BJVA 1N0UA 2IUSA 2JJ8A 3PQCA 1T91A 1T5IA 3PUYA 3K70C 2G77B 2X77A 1J2JA 2CJWB 3CRQA 1G21E 1AIPA 1XD2B 1Z8FA 4Q1BA 2ZI4A 5KUTA 4A0HA 1TPZA 2QRZA 1L2TA 4LX0A 4B3CA 4LJ9A 2QTHA 1SQ5A 1YHNA 4PC2A 2CL7X 2JIZA 3SJAA 4GNKA 1KMQA 2IYUA 5BN3A 3BRWD 2JGNA 4S2EA 3U3KA 4PQRA 3KJIA 5J4KA 3OHMA 2H16A 4JSYA 4G5QA 2ZSDA 3TAUA 1G8YA 1P61B 2OBLA 1G64A 1TMKA 5J4HA 4UNSA 3CH4B 2EQBA 2UVQA 3I92A 1UKYA 2O8EB 3EWSA 5HPYB 1X6VA 4B6FA 4BASA 1H8HD 2QPTA 1DOAA 2RGNC 1CJKC 3WNCA 4CW7A 2PZEA 1XEXA 3DM9B 2RH5A 3FPAA 1G20E 2IYRA 3CR8A 3KJEA 3LXXA 4OBEA 5LB4A 5EP1A 1W36C 2A5DA 4E09A 4XD7D 2E1RA 5HKKA 3CX8A 4CDGA 3QG1A 3B85A 3SJBA 3QEJA 2GCNA 3C5HA 1JALA 1TU3A 2HEIA 2G3YA 1UKVY 1KO1A 4HZUA 4TL9A 1IHUA 2VTKA 4KSCA 1XBTA 5C18A 2O8FB 3E1SA 2G9NA 1TQ4A 4PSAA 1OXXK 4JBWA 5L3VA 3ZIAA 1FX0B 2PZFA 3TUZC 1Y3AA 3NDPA 4M21A 2ZR0A 1OXVA 2OO7A 1AA9A 3SN6A 2H17A 1UDWA 4OI4A 2R2AA 1S4QA 2FZLA 1EFTA 1KDPA 1T6NA 1E9SA 2ZRMA 1T3LA 2WSMA 3W3AA 1JECA 2QENA 3X1DA 1WB9A 1PLKA 1F6BA 2IT1A 2O8FA 5BWMA 3U3JA 1RE0A 3FE2A 1HEIA 4A8JC 1FX0A 5D3MA 1D2MA 1DS6A 2JJ2D 1KHTA 4E22A 4A15A 1Q22A 1IN5A 4HAVA 1UEIA 4Q02A 3RC8A 2ZYTX 3LD9A 3D3QA 4ACBA 4R2HA 4PHFA 5AJXA 4D4LA 4EDHA 1NN3A 4JKIA 2Z4SA 5J47A 5KHOC 1TEXA 3EX7C 4YMWA 2WWIA 4PQFA 5LD2C 4ON9A 2Q21A 3QXSA 1W7AA 2CNWA 3K09A 4K8OA 1IONA 1QDEA 3AVUA 1Z0DA 3I8SA 1Z07A 3RS5A 4ZCIA 3OZXA 1Z22A 2P6UA 4PO1A 1COWD 3VU9B 3AKCA 421PA 1XMIA 3MWLA 2XITA 2CDNA 5DIFA 4NCKA 3SNHA 5A4JA 3SE0A 1WE2A 1XTSA 3FKSD 4Q1CA 1XPOA 2RGCA 3IEUA 2ZRBA 4NH0A 4TYYA 3SHFA 4BFZA 3KTAB 1CLUA 2ZS7A 5ANRB 4ZPXA 2VHUA 2W6JD 1AZSC 1Z6XA 3VU9A 2ZRGA 2F55A 1CKEA 2V8OA 3NH6A 2YINC 5KSYA 3T35A 3A1WA 2ZAOA 3MSXA 4PC3A 5AUOB 1BS1A 4NKRA 3AV0B 2I1VB 2JEOA 1XNJA 2QGNA 4MGIR 4BFTA 3QQ5A 4D6PA 3ND9A 2ZUDA 3TQCA 3K0CC 1XB2A 2A5JA 2ZS8A 5J4LA 3THWB 1CEEA 1YZNA 1V5WA 3AP3A 4RCZA 2F9LA 3LWNA 4Q18A 4DCNA 1U0LA 1QF9A 1P2VA 1SKYB 2D2EA 3FVQA 4RD4A 4AG5A 1T5LA 1W5TA 1GKYA 1NP6A 3RNLA 5JEDA 3THYA 1UKZA 2R6DA 4ILEA 4B33A 3SYNA 4D2IA 3SI7A 3C41J 3GEHA 1YZTA 3QI2A 5JJIA 3KKQA 1Y63A 3H2YA 2HXSA 3HJNA 2J5XA 3THWA 1RVDA 1SXJB 3AF3A 3NH9A 2N1BA 2ZPTX 4O3MA 2C9OA 1QBKC 3KX2A 4MA4A 4RY2A 1ZW6A 3MWJA 3GLGB 4JJKA 4NU0A 4RD0A 5FUVA 4KVAA 4HB0A 3MGCA 2A7QA 4LWZA 4JL6A 1SVMA 1XPUA 2R65A 2V1UA 4H1VA 4NONA 3JVUA 4IVRA 1X8KA 2FU5C 3K9GA 2KJQA 4BE7B 3L2OB 5K8UA 1LVGA 3QUSA 5K8IA 2XNSA 4RVCA 3TNFA 3QKSA 4B74A 3GLGA 1EX7A 1R0ZA 2OLKA 2I1QA 2ZREA 4GOJA 2C95A 3TVDA 3NHBA 2ZE6A 3IGFA 1MRSA 3L0OA 5EXXA 1WBBA 4YMSA 4D4KA 4YMTA 3OEED 2QL6A 4TMZA 1P2SA 4EKDA 1U94A 4Q9HA 1T4GA 1S3SA 3E2IA 1VCNA 2OAP1 4FMCF 3UPUA 3WMFA 3WP0A 2AXNA 1R5OA 3TE6A 1P7CA 3PG5A 1UAAA 2ZI3A 5L3SB 3W6NA 2QN6A 5A5GA 4A2PA 3HPRA 1UJ2A 1KOFA 2W0SA 2A2ZA 4F4JA 4TSFD 2YYZA 2OXCA 2QM7A 3EZ2A 3WYGA 2FA9A 4RD3A 2D4HA 3QKTA 1N6HA 4XSHA 4KBFA 3M1IA 4M8NE 1E2JA 3P4XA 4AKGA 3PVSA 1UM8A 3KL4A 5EE1A 1FNNA 2ZJAA 4EIWA 3B60A 3D8BA 1XMSA 3GLFB 1IXRC 2WTUA 1KSFX 1MOZA 1NY6A 1G3IA 1ZUHA 4KYUA 3Q5EA 4AD8A 3UWKA 2CMKA 1AGPA 5FOSA 521PA 2AK3A 4TYQA 4MQBA 2R6FA 5FL3A 1CBUA 2GJKA 2QTFA 2JLRA 5HCIA 4JMPA 3VFDA 3KXIA 1F2UB 3LA6A 1D2EA 1TF2A 3I4LA 1N6KA 3P27A 1KJWA 3QEOA 4HI0E 3AF4A 2OFXA 4R98A 2SHKA 2FFBA 4HUQB 4D81A 5KO2A 4PR0A 4B3XA 5L8VA 3CPJB 4JLNA 4DCVA 2W00A 4OYHA 1OB2A 3OIUA 1XJ0A 3GLIB 1FW6A 3OIWA 1JEDA 2X8AA 2W2XA 2WSSA 3DM5A 1RJ9B 1KDOA 3DZ8A 3KDSE 3TK1A 2ZI5A 3G5UA 4P33A 4Q5IA 2Z6VA 4UNPA 4XH9B 1D2NA 1ZIOA 2X19A 1T8UA 3X2SA 1W0JD 4UNNA 3KJHA 1R0XA 3QVUA 3D6TB 1KY3A 2GKSA 1XD9A 1AKEA 2Q9AA 5FTMA 4R2IA 4HAYA 3EW9A 1E2HA 1XDBA 2D7DA 4URVR 1SKQA 2RMKA 4PAMA 3ICEA 5FTNA 4NL4H 2CK3D 1JAHA 4QKQA 4OI1A 3AUYA 5L3RA 5TV2A 2BVNA 5E95A 5TXGA 3I5XA 2NO7A 2QGZA 4B3DA 3RS2A 1NI3A 2CLCX 1MV5A 2GCOB 2REOA 2WJVA 3RS3A 3EIHA 3CRW1 3MJRA 5G3ZA 3R7WB 5J40A 1A2KC 4V02A 2WWHA 3BFXA 3LQQA 4RZ3A 4YC7A 5SZHB 4IFEA 4LHXA 2AKYA 1GRNA 2VSFA 4OHXA 4P31A 3R8CA 2WHXA 5TARA 3KUDA 2PT7A 3ADKA 2IUTA 2J7KA 3R7WA 3U7HB 4GOXA 3X1XA 3UMFA 1A82A 5HZHA 4EPTA 1NVWQ 3B1XA 4LYAA 4BECA 2VO1A 4EFLA 2OG2A 4C0SA 3OAAA 4JLPA 3SFVA 1E69A 1G8GA 5KDDA 5AWFC 5JLJA 1FTSA 2ZU0C 2OT3B 3R8FA 4FN5A 3B1WA 4DRZA 3S1AB 1RZ3A 2ZROA 3CNLA 4EFNA 1TTTA 3VAAA 2R44A 4MDFA 2GXQA 3EPJA 3WBKA 2P5SA 1U0JA 2XTNA 3EZ7A 4I81A 5DI9A 3WRXC 3HP1A 3DKVA 4HUTA 3RWMB 5HKKD 3UG6A 4QOSA 4N0DA 4JLJA 2WJJA 3RDPA 1TQ2A 1DAIA 1DELA 1Q20A 2ZE5A 4P32A 3CIOA 4KVGA 3NHAA 3IEVA 3S1AA 2F6RA 2NPIA 4JSTA 3B7GA 1CR2A 3U4QB 2YC2C 4QGGA 4DSUA 4KV9A 2QROA 1IAQA 2RB4A 1R6BX 2F3RA 1BOFA 1AS3A 1YZUA 1QHIA 2B8WA 4QM6A 5EZ5A 1H8HA 3DO6A 2V3CC 1G4AE 1NKSA 1YVDA 1E0JA 4GRAA 5GJVC 4DLYA 3EPLA 5EP4A 2R6CA 4UKDA 1W46A 4A6XA 1KSJA 5JWRA 1E1QA 1OFHA 3IUYA 3NIBA 2ZSBA 1GOTA 2CBZA 4TLEA 1FUKA 4CVNA 3HU3A 4FWTA 4B3GA 1W44A 5AK0A 4ZIRA 2ZITA 1TL7C 1N6IA 4WBSA 3U3MA 5E7MA 2A3RA 5HCNA 2WWFA 4WAUA 2QBYA 3MRSA 5B2ZA 2CHQA 1LW7A 5JHGB 3UIEA 4WW0A 3K9LA 3AUXA 1N0WA 2B7CA 1HUQA 4DLXA 4F91B 1KDRA 121PA 2WJHA 3ZVNA 1HT2E 2JLWA 3CRVA 1DAGA 4FCWA 2GA8A 1D6JA 2HCBA 3GP8A 5EQTA 621PA 3I72A 1XD8A 2JJ2A 4ZDIA 3AVXA 1TQDA 1XFAA 2FN4A 5IRCD 3RRYA 4B3FX 1XX6A 4DB2A 1A2BA 2DY1A 1SVKA 1CJMA 3RLFA 2OCBA 4POAA 3CLVA 2PLRA 2EFDB 3FHOA 4II7A 1KI1A 1RRPA 2BMFA 2ZJ2A 5F3WB 4I1OA 2AN9A 2F1RA 2QZ4A 1X1SA 4YDSA 1U98A 1HY3A 3I62A 2HDNB 3EPHA 2WOOA 2BOVA 2DBYA 1Z0IA 4US1R 4ZKDA 3KQLA 3QENA 1GRRA 1XTQA 2QMEA 2GESA 4KJZA 3G0HA 5GVRA 3ONWA 3L0PA 1Z47A 2ZYUX 1SVLA 3GCGA 1G9XA 3FKSA 1D8TA 3HWSA 4LYJA 4Z51A 5B64A 3IKJA 4HEJA 1WRBA 1P5ZB 2ZRFA 4PZYA 4QBGB 3CWZA 3L82B 2YV5A 1N0VC 3LW8A 4PPFA 2O8CA 3VR1A 3C7KA 2QAGB 4QGFA 1LF0A 1IY2A 2IXEA 4KXFB 1E9RA 3I61A 1BYIA 2RGEA 3SHWA 2ZRKA 1HT1E 1IM2A 4PFSA 4Q7KA 1BO6A 3EC1A 3L0SA 3UMRA 4LV8B 2JLZA 1WA5A 2JCSA 2UKDA 3UKDA 3ZD7A 4Q1AA 1CTQA 3B1VA 1E2KA 4AIIA 2L0XA 2QAGA 3AF1A 5FI0B 2HT6A 5FL7A 4DDUA 4NBSA 1R5BA 2YWFA 2Z83A 2ZS9A 2ZVQX 4OL0A 1F5NA 2WAYA 3EIEA 3K0EA 1BH2A 4HB2A 2QMUA 1II8B 1ZBDA 3MD0A 2AL7A 3RABA 5BXQC 4QBIA 2FZ4A 3AM1A 3SC3A 2C99A 2OBNA 3P20A 5FBRB 3ECCA 2R9VA 3T34A 1P72A 2HYDA 4GL2A 2VEDA 5BYKA 2BMEA 3AVTA 5H70A 2QM8A 4UNQA 1A4RA 3ASYA 2IX3A 1XCGB 4KI0A 4JZKA 4HDQB 1KZGB 3FFAA 1JXMA 3UXMA 4BRWA 1OH5A 4A92A 4H9GA 4GZMA 4GDFA 5TMPA 2MSEB 2NOAA 4LC0A 5CYPA 2VP2A 4IFBA 4US0R 4W5WA 4F7WA 1ZM4A 1I4DD 4Q48A 3BIFA 3AQ4A 1Q3HA 2NZJA 4QM7A 3CRMA 1YKSA 4HDCA 1NVVR 1ZP6A 4BLSA 3BFVA 4MYCA 1I2MA 1RRFA 1M7BA 3U3RA 3F8TA 1RKBA 5UKDA 1GTVA 2IEZA 2CCGA 3IIMA 1WP9A 2GJ9A 2NO9A 3RSLA 2AD5A 4EJSC 2WV9A 1YR6A 1XF9A 1DADA 3B82A 3R20A 221PA 5CYOA 3QF4B 3ZVLA 3A1VA 4YQFA 5JZVA 1G5RA 3Q7QA 1XRJA 4C7OA 3QVVA 4KODA 3IO3A 1UBGA 2ZTSA 4LJ5A 5FBQB 2J0UA 1MABB 3AB3A 3KXKA 4UJ5A 1G3QA 1N5JA 4W5HA 4AYWA 2ZVPX 1W1WA 3LFUA 3DKPA 4LBYA 2NGRA 1ZCBA 1KKMA 3R9IA 3FTQA 3RS0A 3B1ZA 2DFKB 1NL3A 3TAHA 4EQ6A 2YZ2A 1YR7A 4DT1B 3SR0A 5KSOA 2MMCA 3KKMA 4AG6A 1MABA 4GZLA 2ZJ5A 4N3NA 2ZIAA 2YHSA 1VYVA 1Q0UA 2WSSD 4UNRA 2QA5A 4LHYA 1A5TA 1MRNA 1HA3A 2PJRA 3EC2A 4JVMA 4HATA 3ADBA 3CWQA 1VMAA 1P73A 2KI5A 1E98A 2WBLC 4OHZA 5KNCA 3AEZA 5FI1B 2WIBA 1ZIPA 3CM0A 5DYIA 4YMVA 1KK3A 1P60A 2Q9CA 3LQRA 1E0AA 3BORA 4QBFA 4XTCS 1S1CA 1E2PA 4OHWA 3HU2A 3BFKA 4DLUA 5FOWA 4JT4A 4OKSA 1Q1BA 3PUWA 2RHMA 4HSEA 2CLSA 3GLHE 5FBWB 4Q4AB 1NRJB 2GTPA 2RCNA 4TWZA 1G3RA 1BYUA 2ZXUA 1W47A 4F92B 3V4RA 2JLVA 5FOUA 5KPJA 3L0IB 3P32A 2OSBA 1KI6A 1YZKA 1XCMA 4FD2A 1G16A 2B21A 3JZMA 3VHXA 3TSOA 1ZM2A 1UEJA 1OFTA 2RKOA 5M04A 2VSOA 3L8YA 3FMOB 1ZD1A 5FOVA 1NLFA 2D06A 1AQYA 1DVRA 4C4PA 4HYYA 1E6CA 4DB4A 1NIJA 2ZRJA 4ESVA 3IDQA 1RC8A 2FMXA 1N6RA 4Q66C 3SBEA 3PV0A 2ZAMA 1LFDB 1XJCA 2GAOA 4Q4LA 1NY5A 2C77A 3BAFA 1KMHA 1BMFA 1TAGA 2WWGA 3WY9A 5EZ6B 1E2QA 1OFUX 4XWOA 1ODFA 1T9HA 5H1YA 1IN8A 2O8DB 1GSIA 4M1KA 4U00A 1M34E 3U7GA 1ZNZA 1KDTA 1CU1A 3BWDD 4A8JA 2YWGA 4WZ6A 5JEEA 3FWYA 4Q7JB 3W5JA 1D9XA 4URUR 1KI9A 2QEQA 2Q3FA 2VIIA 2V55B 4QFMA 5IDVA 2XB4A 4WXPA 4ZCLA 2PZGA 4JL8A 4BLPA 2GBLC 5JRZA 1YZLA 2V54A 4HB4A 4JLBA 2O8DA 1GDDA 3CW2A 2PEYA 3CO5A 4MRSA 1V43A 2OHFA 4W7SA 1XEXB 4NYIQ 1E9FA 5FPHA 3H0KA 3DZDA 2ORIA 4DJTA 2D7CA 4M2LA 5KOYA 1W48A 3VX3A 4Q19A 1WXQA 1VIYA 5JS7A 1GFIA 3BB1A 1GP2A 3W8RA 2IYLD 1E9EA 4G5RA 2ZR9A 1M74A 3LO5A 4HZUB 2O8BB 2ORVA 4BFXA 3EZ6A 4KO8A 1QHNA 4HLUA 4LZZA 5JRJA 4TLAA 1DBSA 1LB1B 4OQMA 4D0GA 3EAQA 1LV7A 1Z83A 2VA8A 2I3BA 2DB3A 4JKYA 2ZSAA 3LLUA 1E1QD 2GVZC 1D9ZA 4OI0A 4LC1A 1E2DA 4MKIA 4AWXA 3TR0A 1DG3A 2FPLA 3CPHA 3N2IA 5FTKA 1OXSC 3K1JA 3NC1C 1OH8A 2IYSA 1VHTA 3SOPA 3K0CA 5C46F 1KTVA 2GVDC 4JLOA 5CITA 2GF0A 1E0SA 5D3MB 1E2MA 5HZKA 1K5GA 3AVOA 3QKUA 3H84A 4PANA 2P6NA 1O3YA 1RFLA 2ZSEA 5HE9A 2Z0MA 3LX5A 4FXPA 1OPXA 3VX4A 2VSXA 2ZJBA 3AVPA 4KAXA 4B47A 3C14C 2VYFA 1JPJA 2J7PD 1NMYA 4B6EA 3A6PC 1U99A 2CE7A 4BGDA 4OQXA 4XVQA 1VPLA 1QHSA 3Q8XB 4L16A 3RS7A 2BBTA 2XJ4A 5EUMA 3BB4A 1Z6TA 1HE1C 4Q21A 3RC3A 4DCUA 3ND8A 1CJUC 1PUIA 4RD2A
chains in the Genus database with same CATH superfamily
3A4MA 5GJBA 2Q28A 3VOTA 3F9IA 4U7TB 1VLLA 1TYCA 2H1FA 2JIPA 4G0MA 2PKQO 2EVWX 1EVQA 3NMUF 4FOSA 4LJYA 1QGZA 1VL2A 1L5SA 3DMNA 3H5AA 3BC1A 4LHZA 4MH0R 5J2UB 1ZXLA 5JE8A 4AM8A 2B61A 3QYFA 2IITA 1CLEA 1OLXB 2FWRA 4LN1A 3KIPA 1GXSA 1M2VB 3BGWA 3QM1A 4C3OB 5K3SA 2JEZA 3QIVA 4ECEA 3J7TA 4OGFA 5C51B 1I5EA 3OC6A 1XNGA 2WFAA 3DQZA 4L5IA 1NQ5A 3NEYA 1X9GA 4BRSA 3DB2A 4K5QA 4YXFA 1CUAA 4QDOA 3ZDDA 4U7DA 5D3QA 4O5OA 1THMA 3R0ZA 2OXFA 3O6VA 3ABSB 4LWQA 3ROFA 2ATCA 4R84A 4Q3EA 5BSUA 3E81A 2JANA 1G63A 4G2NA 4LQ4A 5FFMA 4O08A 4UQPA 2EC5A 3PX7A 2GEVA 3KLMX 4E5UA 2CHFA 3LS2A 4V39A 4DMFA 5FL7D 4HDSB 3R5HA 4CMKA 3BF7A 4YIKA 5JAMA 3AQIA 2GN9A 4DQXA 3WYEA 3WKBA 4DUGD 1QQ6A 4JQSA 4NPHA 2Q4BA 4L5BA 2WMYA 3GFSA 1EFPB 4M0KA 5IABA 2Z9BA 1CEYA 1NC1A 4R8VA 1I1HA 1N2XA 1JA9A 1Q83A 1PJ3A 2I1WA 1Z25A 2Q4EA 3JQ8A 4L3VA 5IM4A 2GO1A 1DG9A 3DLBA 5I48A 4Y9RA 2RK3A 2HEGA 2DWUA 2GZSA 3AERA 3JAWA 4J43A 4B34A 1KEEB 4LE1A 1R0YA 2J3DA 4NDZA 4OHFA 2HA7A 1JBEA 3CZQA 1I7SB 5BR8B 3AKZA 2XADA 1Q1EA 3GZ4A 3AESB 4UHCA 5CDUA 3OWHA 3E3MA 3SCZA 4TVKA 3ZCVA 2P90A 2RG7A 1VKNA 3R7AA 4JIMA 5JMWA 1E79D 2GHIA 4U9IS 4QWMA 1IXKA 2BHRA 1QXSA 3K73O 1F48A 2ERCA 5JAIA 1RIIA 2JG3A 2G80A 1GPKA 2BH9A 3RYIA 3N3BC 3L5OA 4L9WA 3FTCA 1CJTC 3EGDB 1G7CA 2GGSA 5HJ2A 4RTLA 3KXPA 2O2DA 4H77A 1GPDG 3HYCA 5EP3A 3REQA 1GJRA 3R3SA 4IZIA 3SBDA 4D3XA 2OCPA 4ZD6A 4ARBA 5JJBA 1Y9ZA 2GYVA 2H4FA 4FGUA 1Y9DA 4Y3UA 4CDRA 1YRYE 4PR3A 2PUDA 2B4TO 1GAJA 1T5DX 3MTEA 3PWSA 3LW7A 2AZMA 1NN1A 4D0SA 5KSPA 1W5SA 1ATZA 1YQUA 4I08A 4WE3A 4YJGB 4GP9A 1ZUIA 2CLDX 1WETA 4R1OA 4DWWA 2PV7A 3ET4A 1KYQA 2AJCA 5FLYA 4EUSA 2VDQB 3MCAA 2Z8XA 1N2JA 4MLDA 4ND2A 1KGDA 2ZWVA 1SKMA 4NYJR 4E94A 3SVTA 1ZGHA 1VL0A 1RWOA 4ZTZB 1QNFA 1Z8HA 5ITZB 3DVLA 4DE5A 1OLUA 2EW2A 4TQ9A 5F78A 4BO4A 5IF9A 1RQNA 4BNMA 3PPVA 4YUWA 3GNTA 5GPBA 1M2OB 5T64A 3QYJA 5FCDA 1JAXA 2LIVA 3ZHQA 1OLOA 1WCIB 5B37A 2HWUA 1XU4A 5EE3A 4D9NA 2IXAA 3QFTA 4E32A 2XSZA 3AM4A 3CF4G 2CV1A 3NXSA 4JB8A 4WVLA 1WDWB 2BY4A 3H9GA 4JFRA 3ZWAA 1DC3A 3ZJYA 4BFVA 3FAKA 1P4JA 1KIMA 1J49A 1KSHA 2MR6A 3A1FA 3ESDA 3H83A 1C2TA 1NVUQ 1YO6A 2BIFA 3LA8A 4AKEA 5EVJA 3GJ0A 3ETEA 1HG1A 3P2EA 5KNCD 4XVRA 3SSNA 4DTCA 5G4KA 1CR6A 2OY0A 2I4LA 3FLMA 3GGSA 1BHSA 3N2GB 4TQAA 5CK4A 4AS3A 1E6UA 4BLOA 1XGKA 3E05A 3TCXB 4MW6A 2VCYA 1YJXA 3NQ41 5CVVA 4YRDA 5JTTA 3DEZA 4RQAA 3OOJA 4CFYA 1EWQA 3H2IA 1G8MA 2HA6A 3NT5A 1A9PA 4YRTA 3Q87B 3SQWA 5KWIA 2IX9A 2VJAA 1X14A 4B4UA 3GPLA 3OOWA 1E3LA 1AY0A 2NSYA 3ROKA 3TUIC 9LDBA 4J0JA 1MPTA 5U4XA 1XDDA 2O0KA 3GXOA 3OPYI 4K6CA 1FQOA 4G84A 4RK6A 4ZEXA 3AEQA 1FP6A 3IIJA 2VRBA 2IVFA 3ITKA 1JTVA 4TMKA 5SICE 3V48A 1A7KA 2BMWA 5H8WA 4MARA 1IYZA 3T7RA 4DREA 4DNOA 1NDUA 1KJYA 4QL3A 4M9XA 2P6PA 4X8MA 5DM2A 3ZZ0A 1I3OA 2GK3A 5JROA 4L7VA 1PQWA 2HSJA 3KHTA 4JY7A 3RKSA 1SBZA 4LDNA 4G8JA 4O02B 3RUPA 2QN7A 4M37A 1LS6A 1CK4A 1K08A 4O4IB 3HCDA 4UVHA 3U44A 5IUNC 2J30A 3WE7A 4DR3B 1UMBA 1NUHA 4TTPA 5DNDA 2IHNA 3IP7A 4KE8A 1FZTA 4IDAA 4XIJA 3TDNA 1JAIA 1Y4AE 3THOA 5HK8A 5TPZA 3RHZA 1BXZA 3ZC3A 4CRWB 3NALA 3KL2A 1WMSA 2R1UA 2BMAA 1V41E 4QTZA 1T8RA 1M34B 4EKIA 4MIEA 1Q57A 4O2BF 3RIHA 1CUYA 1GFSA 4IXNA 1OFUA 4RCVA 1UBEA 1OYOA 3A7EA 5J59A 1FP7A 1YVRA 4PINA 1EJBA 1BVRA 1XZFA 1W4BA 2I55A 1JHMA 1W2WB 5KNDD 3VOAA 3OCCA 2R6HA 2P91A 3ROXA 2XCSB 1XNRB 1Y3DE 2V96A 1YVUA 3JATA 1B8NA 1RM5A 2Y68A 4XEHA 1LTQA 1SG0A 3LNCA 2HSEA 1J25A 3N0WA 1UDBA 4DLNA 3AR9A 3IMGA 2FEXA 2I87A 3HZRA 1WU8A 3LBFA 2FZCA 2YXPX 3LAWA 3PJGA 5E0OA 3WGJA 4FZ3A 5L3QB 4INZA 1J39A 1H2YA 3IA2A 1HDCA 3ZHZA 3RT9A 2OVBA 1ID1A 2WYVA 3GU3A 3QTBA 4KCGA 4L5CA 4AJLA 4FB4A 1P7PA 2D00A 2XWQA 3L8ZA 4Z7JA 3IBCA 4MVJH 1SUPA 5BWNA 2NP6A 3V8VA 1GL6A 2XBMA 3KOWA 3U7EB 3WDKA 4B43A 1E1KA 1XTPA 4CF3A 2P68A 3ET5A 5LMNB 1K97A 2C2XA 2WV7A 2Z8ZA 4P3OA 5F9FA 2H7YA 4RHXA 1TAHA 5KQRA 5TJHA 5E8RA 1E2LA 2BR4A 3G2MA 2OCYC 5LZ4A 4UBMA 1Z0FA 2DPLA 2WTMA 2XT6A 4J0KA 2F3TA 4O0MA 1A8QA 1W4ZA 4RKFA 4GAEA 4K9SA 4OBXA 2PZJA 3HKEB 4EMUA 3LBNA 2XY4A 1VDMA 1XALA 3BGVA 3TLYA 2WY2D 2EFCB 1YK1A 2WJGA 3DEFA 5JRDS 3SQNA 1OV4A 4HADA 3NJ8A 3KYBA 5LNK6 2XGSA 3RFVA 5IEBA 5JALA 2H4XA 2ZR7A 1YKGA 2FK7A 1YRQA 1LSSA 2HSWA 4ASUD 2VDKB 4U7HA 2Q50A 3JQRA 1EFKA 4LMRA 4ERNA 3QNWA 4JJAA 2XXAA 4BNIA 1Z4OA 2E5WA 1S3FA 2PS3A 3F6CA 3LPNA 4TOIA 1KO5A 3AY0A 5T3UA 5HTKA 1PAUA 4BU0A 1M1ZA 4TSKA 4C7JA 4L9SA 3KOMA 4IOJA 4S05A 4L50A 3DAYA 1QP4A 1H8ED 1N1DA 3TGLA 4W7HA 5EPUA 4NS4A 1FYEA 4Q1FA 4TROA 4Y1RB 4KHZA 3CQ9A 3KR9A 5CXQA 2UXDB 4IDQA 2KS6A 2R00C 1WM1A 4FOPA 5ALOA 4B3BA 3LPCA 2PGNA 1XZQA 1UAGA 1ZD9A 3FI0A 5BV8A 2H0QA 4G1BA 1GQRA 1ZVQA 1EZ4A 1QQ5A 1H9AA 5CRIA 1YRAA 5B1YA 3DVAA 2F3QA 3TQRA 4XLLA 3OU7A 5EEGA 2WNSA 1NKTA 4K0RA 5AJWA 1O5TA 3DXFA 2PVSA 3OZRA 2QMQA 4EW1A 4BBJA 3A3YA 4D98A 4DRYA 2RH4A 1QIIA 4J90A 4HDNA 1DTEA 5CYFA 4DSTA 2J7PA 2BFDB 2ZSJA 4F12A 3FCSB 2XMCA 3C3MA 3UBMA 1FJHA 1UIRA 4DQKA 4JS0A 1P75A 4D9BA 2GARA 3LY5A 4Y6OA 2Q1WA 3PDWA 4ARCA 1VC2A 1NE2A 2IL1A 4ECAA 1GFZA 4MVCA 4QSMA 5LDDC 4QXAA 4YWHA 2Q8PA 2XNDD 2VLIA 2Y71A 4FR0A 4EELA 3YASA 2BHNA 2ZFUA 3GEPA 4R9RA 2GMWA 5U9CA 3ZV3A 4B4OA 5LOVF 1DIHA 1KFEB 3G9UA 1WUJS 1QGDA 3KOYA 4TL8A 3AI7A 1LRJA 2VHQA 5HBGA 1R12A 2R1TA 4ZKEA 2G8LA 2AQKA 4QGHA 5CJJA 821PA 3I5UA 2CFRA 1NG1A 1KK1A 1DINA 1JHDA 1JPUA 1RLUA 3JQ6A 4G41A 4MVJI 4E03A 3KR1A 3SJ7A 5CT9A 6GPBA 1HL3A 1EJ6A 1XRLA 2DR0A 2J07A 2QB5A 2B82A 1L4GA 2Y0CA 3AXSA 4REQB 2AK2A 4KQWA 4Y9UA 5TQJA 3SQMA 1V6CA 4URXR 4RWZA 3WIDA 3ADDA 1PJ4A 5ADUS 4EI9A 4X6XA 2QTAA 1QIMA 2XCIA 3CVUA 1AB6A 1I0ZA 4L76A 1NQWA 4BWVA 4I8IA 1HTWA 4L1KA 4NOMA 1GLGA 5GZ1A 1K6MA 1QGUA 2BE7A 3BDIA 3CF2A 3QPUA 2C4NA 2OE2A 2V58A 4I14A 2O5CA 1T1IA 3KJQA 5IWCA 4ARZA 4HS9A 4B8WA 4H1HA 4PRYA 4AYTA 2AWOA 4XGKA 2EF0A 2A7XA 2W6MA 1OASA 2PD4A 3ESQA 3W6UA 3PX2A 3CO0S 4H08A 4PE5B 3CX7A 1NOKA 3AUKA 3R0JA 2C96A 3CLHA 3JQ9A 3AINA 1EAMA 2EZTA 4FFVA 5TS2A 3EPKA 5IAOA 1U90A 3HADA 1MX9A 3DPUA 1FXWF 3TTTA 1AQUA 3MWKA 3EARA 4M8NE 5AK6A 3UJNA 2J9YB 1IJBA 1L4LA 2CBXA 1IC6A 4ZOQI 3U5TA 3KJFA 4TMVA 4L4UA 3VGPA 3K9WA 4I5FA 5CB6A 1QTRA 3EAGA 1PWEA 4QHSA 1AQLA 3PFFA 4RPLA 1CQIB 3HCOA 2HBZA 2JBAA 4G4SO 2GNPA 2X3FA 1KYXA 1C3VA 3COZA 3I01A 3ND5A 4MTLA 1UPBA 1JEOA 1Q0SA 5TQVA 2UVPA 1WEKA 1W85A 1OBHA 3BE4A 3K2EA 1C9DB 1TMOA 2IYVA 3H17A 4X3CA 2C98A 4ETNA 2HCJB 1Z17A 1FU7A 1Y1RA 3NBQA 5I7HA 2VK4A 3GJZA 4F84A 4R41A 1W5BA 5FH9A 2GUWA 1AOXA 1N6NA 3K30A 1UMDA 5EWJA 4CKWA 1X1DA 2VDOB 1VBMA 2XDQA 4WXEA 1C9YA 4QSHA 3QA3E 4A16A 1RI5A 1Z35A 3QGMA 2K5UA 2QZ9A 2AVDA 3B6KA 2ERYA 3W4KA 1V8ZA 1JQ3A 2JI7A 2YL2A 5FADA 3QHAA 2BBSA 1NTOA 1RR6A 4FKBA 1SXJE 3DEAA 5KOIA 1I3CA 4PIPA 4QULA 3THXB 2POQX 1GY8A 5EJEA 2JVJA 2RBKA 2ZE7A 3A9RA 3BA6A 4D4MA 3IKTA 2P6RA 2ZTUA 1Q5PA 4GU5A 3UCXA 5A3RA 2PUBA 1FS5A 2CLHB 4OGLA 5H02A 5BVHA 1JYSA 2F62A 1NOJA 2EJCA 3O7WA 4RHEA 2IIQA 2AOTB 4RELA 2XSZD 2Z43A 3H3XA 3GZJA 2BMJA 2VNKA 1OJLA 5D3KA 1BKSB 5IUKC 5AVYA 3PC8C 5CNMA 3TKLA 3ZS8A 2I7DA 1GVNB 1FQKA 3QFHA 3WNDA 3EZGA 1VRWA 4J0DA 1YFZA 3IT2A 4LV6A 2IQIA 4MRVA 4EGSA 1NBMD 1WABA 1XUOA 2IHYA 1F9AA 2NU9A 3IS3A 3O8QA 3QVSA 1TDJA 4H18A 4UTXA 3ZJ5A 1GTMA 1V11B 4LMPA 1G5PA 2FE4A 3SS9X 2W6CX 1JXQA 3LKBA 3ILYA 3TUJC 1PIWA 4TMTA 1PJTA 1GL9B 2XYQA 1FDRA 4L2IB 1DGQA 4RTOA 1TYDE 3G0DA 3NVDA 1EFRA 3CSUA 1FPMA 3MTQA 3PP8A 3K5PA 4G5FA 4MK4A 4UULA 1WMFA 4JYCA 5IAJA 2ZVDA 1C7EA 4A27A 2RH9B 4LYFA 1QJ4A 2J9FA 2OV6A 3HUDA 2PLAA 3LG2A 2HLHA 2X6RA 3CTPA 3T5PA 1XEFA 3LH5A 1AKRA 1LBHA 2H1IA 4H27A 1FTWA 4Y18A 5E7QA 1IN7A 1UWKA 2ZJ6A 1P6QA 3CUUA 1QH8B 3V2GA 1E1RA 1QVWA 4B2LA 3BFPA 1T4CB 2ZJ3A 3TD6A 721PA 5KYYA 5T41A 4RH3A 5I51A 1J1ZA 2ALJA 3OCJA 5A7FA 1XCOA 5ETJA 4CXMA 2F9MA 4C6HA 2P1DA 3QV1A 5KC8A 3K1ZA 2F3UA 1G42A 2PSDA 3MJCA 4JIGA 3GLFE 2IELA 3WAJA 5D5HA 1OWOA 4H4CA 5EERA 2Z8YM 3L92A 1HE3A 3EOBI 3KAKA 4EEKA 1BFKA 1T3HA 2I7XA 3IDOA 3VRHA 2B8JA 3ZHSA 4WASA 4D82A 4DM3A 5KYGA 4Y0VA 1BWSA 3J81A 4GLOA 2J87A 4TN5A 4C4SA 5TPZD 5BOVA 3USES 3T1QA 1C4OA 5L45A 4TN1A 2PH7A 2XMSA 2IUFA 3P9RA 3T38A 3IQXA 1RACA 3BPSA 1Y4UA 2JATA 4Z4QA 2CMDA 1RWKA 1TADA 3IHLA 4JB0A 4AP9A 1G8KA 1ZGJA 2GZ2A 2C3PA 2XA1A 1P62B 5E1MA 2C5FA 3TMKA 5JMOA 5K8TA 4ERXA 4H15A 2VEOA 3HJUA 5IHXA 3TSAA 1B43A 1SXGA 2IYQA 3IHTA 5DWQA 4M9SA 4UQOA 2XEXA 1X7HA 5HHTA 2FE1A 2A35A 1PG2A 3K1AB 2D0IA 3K0BA 1J5EB 2IZ1A 1MR3F 1O7JA 2HUPA 1NX6A 2R4TA 4RDCA 2ZYVX 3DZCA 1JQEA 1RMTA 5DM1A 1G4HA 3OJ0A 1ZFNA 2IIBA 4P4UA 1RYBA 2GYUA 3FYUC 4V0ME 5FYQA 4DDVA 5H3HA 4NBTA 4GG1A 4LY6A 4LS3A 3WQRA 2BGWA 3WXBA 2NN3C 4RO0A 5LU9A 4YACA 3AGQA 5C32A 4O2AB 1VCHA 2O3QA 1KEVA 1U0OC 2CWDA 2YWJA 3ABOB 3KVNA 3PFIA 4TMXA 4B9EA 4BP3A 5CAEA 2RJOA 4HAIA 4FFLA 1S8FA 4DIKA 4A4DA 4OM7A 4F9FA 1TZJA 1WJGA 2X0JA 4FUTA 2IYYA 4QUBA 2QM0A 4G01B 2CVZA 4LZLA 3BS4A 1OT5A 4TXLA 4FDTA 3TAXA 3TW8B 1BXRB 3MSCA 4ZJUA 5HJ5A 5KQGA 2J0SA 2BM0A 2Z2XA 3C5EA 3KLPX 3WGKA 4M1SA 4B31A 4XPIB 3SYKA 2JEYA 2V4UA 1NJFA 5GONB 1FUUA 5FPKA 4WT7A 5BMVA 3O93A 2EOAA 3S68A 5LXTB 1J0EA 1MXHA 3CKLA 4BLTA 2B4AA 3M5PA 2RB5A 1ADGA 3ZZMA 1IY0A 4ACAA 4CODB 3U3DA 4DYVA 1G1MA 4KYIB 1ZW1A 3KVRA 1YZYA 2C9MA 4G67A 3W90A 4YUAA 5DTJA 5HRCA 2H1HA 1JI3A 1IG0A 1W36D 1NLZA 3OLWA 4B84A 4ZO4A 5JNWA 2BPOA 2RHHA 4AKHA 2EJTA 1UWLA 2RC6A 4E15A 1R2QA 4PXSA 3UATA 1NAIA 4TLLB 3QMWA 1R7RA 3D6UA 3RYCA 3STTA 1XD2A 1M7GA 1DEOA 4X7PA 5KOJA 4WH0A 4BO6A 1UBOS 1U7ZA 1N6OA 1ZLYA 2OMKA 4LZPA 3MOGA 3BXPA 3FFXA 2OQ2A 5EESA 2ABWA 3NBAA 2MYPA 2X5NA 3ROMA 1JW9B 3PIRA 4XGQA 3CMCO 1XXHE 4BNFA 2O8NA 1CIPA 2IE0A 3NYQA 3BM5A 3IO5A 1DKLA 1I7QB 2J9ZB 1PR4A 2EBWA 3UHFA 2H9YA 4MUYA 4RKWA 2IXFA 1N8KA 1TUIA 3UJHA 4F11A 5C4IA 4C7VA 5JQGB 4Q3AA 5LB2A 4E5MA 4EHHA 1SOWA 4KQFA 4EHFA 1E32A 2D7JA 4B40A 2B20A 1JLLB 2XVYA 3WYFA 4CF7A 2C7OA 3GJSA 1QHHB 3DEHA 1OX4A 4I3GA 3GAFA 4QJIA 3VPXA 4WBNB 2Q0HA 4UMDA 4AJIA 4HQ6A 4YQZA 1L5MA 4ZYZA 4CKEA 2CZQA 5EIEA 3K5IA 2TRSB 3NKVA 1MJ5A 5DI3A 4GM1A 1A2OA 3PGMA 5HKAA 3B38A 2X1LA 1VA5A 3CR3C 4QG7A 3FYHA 1ZXXA 5DASA 2KBEA 5JI2E 5AHWA 1WV0A 3EG9B 4M7WA 4R16A 5AJZA 5EYPA 4XUCA 5FPYA 4EY7A 5LWQA 4OQZA 1DAKA 1UDXA 1UBCA 1ENPA 2FVYA 3KSMA 4PC6A 1POWA 1TCAA 4NAHA 3ETNA 5ECGC 3T94A 1CRLA 1EQUA 2NNWB 1T10A 2QTGA 2PD6A 2BT4A 3BMOA 5A0TA 3KKPA 3C8HA 4KZPA 3K4HA 4DBZA 3EDMA 1Z0JA 3V8NA 1MV8A 4QUIA 2G1KA 3GFOA 3INTA 1OMOA 1ZIYA 3HI4A 5AMXA 3CZMA 5BQPA 1B41A 1T1JA 1KVTA 3GBPA 3CEPB 1JRLA 2OV4A 4LMAA 1KI4A 1TK2A 4XSGA 2I91A 1XMQB 3IUMA 1FQWA 1A9XB 3Q15C 2IHUA 1D6NA 3NONA 1H2BA 1KU6A 3FOZA 1SCDA 1QSGA 4M38A 5JPCA 3M89A 4NZMA 3Q0IA 3R9XA 1WCYA 2J0QA 1U5CA 4GZ6A 2Q29A 4MUFA 4YT5A 2GQ0A 3S2EA 5LIRA 3T0GA 2E3JA 1Y8ZA 3AYZB 3GAMA 2BGNA 4UE3S 5ADHA 1II9A 1ISHA 1I6KA 1VLVA 1DG1G 4YI3A 3T61A 1HV8A 3PXXA 3UWOA 1R8SA 4OKIA 2YJ3A 5A9TA 2ZUTA 1N2CE 1CUBA 3I1FA 3WLJA 6ADHA 3T3PB 2Q62A 5JJLA 3J7AC 3C15C 3GCZA 2HGZA 4I8XA 4Q7MB 3HUFA 3NPMA 1VSTA 5KYKA 1KKLA 2HRDA 2VYCA 3A6DA 2YZKA 4XWYA 1MQ9A 1T3SA 4WOCA 2RC5A 4EY4A 1PQUA 1J99A 2GAFA 2ZI9A 1BS2A 1TLLA 2DPXA 4B73A 5GVSA 2V7TA 1ZIDA 3HXTA 3HP7A 3GVHA 5AM5A 1WEHA 4MA0A 1SIOA 5CURA 1RCFA 1USUA 4R8RA 2R5WA 4ZFNA 4EG7A 2IH4A 2M6SA 2QRGA 1XDWA 4NNPA 1XZLA 1KMCA 1VECA 5KS2A 4ONEA 3MRXA 4AZTA 4PPNA 1X39A 3CCFA 1FMTA 2WHRA 3LTEA 2OGZA 2TS1A 5HX7A 2PXCA 1LDMA 2GTIA 1B8PA 5I9TA 1KOJA 3BD9A 1JIQA 4GWLA 4G3XA 2QL9A 4HZIA 1PRYA 4YMHA 4NSNA 2FEMA 4TV9B 3B2NA 1W19A 2OBXA 4C0HA 3QEBZ 1GIAA 1Q7EA 4PNEA 2JK0A 1E3DA 1WDLA 3O8NA 2HJ9A 3GLTA 3FKQA 4V0OA 1DL5A 1CR1A 4OIMA 4QU8A 1FXUA 1DCFA 3EZFA 3UHJA 3HUEA 5C3MA 3WLHA 4ALIA 1SXJA 3GIDA 4IIEA 1X9HA 1HE4A 2GRUA 3ZU2A 4EJFA 3S5UA 1TKBA 4EA6A 2HMTA 1F8YA 5JWHA 5CJ2A 2WIJA 4A6DA 4NE7A 3PS9A 3IEKA 4COKA 1H69A 4G0VA 2HU5A 1EQAA 3M3PA 4UHEA 1DZIA 3E9RA 3BL6A 2J3QA 3W34A 4OLBA 1L8OA 1HBJA 2FWMX 1TW3A 4IQ0A 1DDGA 4BVJA 3GDHA 3QY0A 1P5HA 1Y7HA 1RCTE 1L7QA 3AEKA 1QE3A 3ETHA 4R2LA 2WT4A 3D3JA 3SVZA 3V00A 3L8MA 4MV8A 1CZUA 3IR7A 3R76A 3SZOA 3Q12A 1PLJA 3ZWXA 2PV0A 1EFRD 4Y30A 1P4HA 1CE8B 3QXCA 1SEVA 1AB5A 4QHTA 5AOAA 5JI3E 5KC9A 3ZG6A 5BT8A 5FFNA 3UFXB 4BGUA 3HVRA 4LUCA 4I3FA 2WWYA 3DDCA 4J6EA 4H7KA 4NICA 2GK7A 2AZ4A 3DV0B 3B12A 2ODTX 3UJ3X 2PR7A 3R3JA 3NTUA 3P2MA 2OBMA 2IRWA 2Q3EA 3CGWA 2VT2A 2J41A 1KXZA 2V98A 3K6KA 1W36C 2V7WA 1E1RD 3F6EX 1Y1SA 1AA6A 2C4UA 4GE3A 3NO4A 4ZTBA 1KMMA 4WXHA 5FNZA 4ENSA 4GGMX 2OV1A 10MHA 2IHBA 5IKEA 2NYUA 4JXKA 5E2AA 4CV2A 2O2JA 1HNXB 1WDTA 2LGJA 4GX2A 5EXPA 5BSMA 1CFZA 3A6KA 1R8QA 1ODLA 2O2IA 3MBKA 5L53A 1K7EB 3JASA 4KFSA 3WLKX 2Y1WA 1MIHA 1Z0UA 1BMQA 3ZE6A 1GN9A 1TTHA 1YL5A 4TTQA 3ICOA 4IJQA 3OIYA 1HQCA 2WNHA 5F12A 2MCFA 4DF3A 2W42A 1ZQ9A 4CTMA 1B0PA 5B1IA 2ATXA 3AYXB 4ZRMA 4PC7A 1RHKA 1Z3CA 1JZQA 3GGGA 3RROA 4KFCA 2FWIA 1X0XA 1TUBA 2HCTA 5JPDA 3CUWA 2VRNA 2H3HA 4WNYA 3GLFA 4JEUA 1JKFA 1I6LA 1D1SA 4S1PA 1FQJA 5H16A 1BCRB 2OORA 3UMGA 2DHCA 3O4JA 1IH8A 2VLBA 3TRDA 5CGQB 4QPNA 2YJZA 2BEWB 2W58A 2WICA 3O74A 1NLYA 1XZKA 5AI6A 2IPMA 5IULC 5BPHA 2N42A 1R64A 3C6KA 1GTG1 1XNHA 3B20A 4ID3A 4IHJA 4N47A 5IJAA 2KYRA 2B3TA 3NNDA 3EXHB 5D5QA 2UUBB 2WP0A 3AFMA 1FYWA 1SOMA 1U3FA 4GD3Q 4U1RA 4MA5A 5TJ9A 2VJNA 1GSHA 1D04A 1VB3A 5TB5A 2ZBVA 4BZPA 3NHJA 5JMTA 2ZRHA 5CCDA 4M4SA 1X3LA 3OPXA 4Z1MA 1TA0A 4KR0A 4O4HB 3RRNA 1SBQA 4FCTA 2J46A 2IF2A 4Z0NA 1RQPA 1EBUA 2HLNA 1GKIA 2FJ0A 2GKOA 3NNNA 4FWIB 5B1HA 4HRVA 3I1IA 2I3ZA 2P9TA 2VH2A 3JZDA 4HFJA 3N86A 1YCFA 1AHHA 4G09A 3JQPA 5HMLA 3FPKA 3QE0A 3UCEA 1QO0A 1IY8A 1DOZA 2D2FA 2QYOA 4UE2A 4J8PA 1CUSA 3WMGA 4LJLA 3OTGA 4F21A 4V0MA 3ZDRA 1XZPA 4AS2A 3B52X 2VDRB 3QG5A 4YT4A 2PIAA 2ADFA 1K6XA 1NXTA 2DSNA 4FMCB 1RPTA 4C4ZA 3M83A 1C4KA 2I4OA 4DIDA 4DIUA 5GADl 1WZ2A 3HG7A 4UASA 5A2QA 1XZ8A 5A3VA 1OB2A 1V47A 3LZCA 1Z7BA 2CDCA 1N2GA 3L6UA 3IIEA 4DEVA 2OZPA 2JLQA 1G8AA 3OQIA 4BN5A 2WD7A 2DT5A 2GCOA 4TZKA 1MNQA 1AUQA 2HSZA 1XIVA 3KKKA 4I4NA 2HA5A 3CUEF 2OFOA 3CLRD 4PZDA 1XN1A 2L17A 4NBKA 4BP1A 2GPWA 4D5GA 5F76A 2EDCA 1WTAA 5P21A 5HF6A 1ZUNB 1O87A 1RXUA 3DZIA 3UENA 4D4JA 1H2RS 2GH1A 2R7NA 3PUZA 3L41A 1U6IA 1DLIA 3H3JA 5DVZA 1OGIA 2GCEA 3KEGA 5DSZA 1I2CA 1MH9A 2C04A 3BBLA 5M7EA 1M54A 2QT1A 1NR5A 2J0EA 3HKDA 2ZM5A 4NECA 3LBAA 4KE6A 5KNBA 2PRKA 1ARZA 3PBKA 4MRNA 4IM7A 3AY6A 1US8B 5BNFA 1T24A 3VAYA 4C87A 2RGAA 3GRAA 1X1RA 4IHKA 1LJUA 4PLZA 4QOFA 5EHQA 5EHZA 1EQ2A 4D0LB 3VVBA 4LRQA 3IJPA 5B2FA 1EFUA 1OHHA 1J5XA 3BMCA 1D5CA 4KIGA 4CIWA 3QPAA 4Y6PA 4WNAA 4D44A 2OCAA 2FSUA 4JJ7A 3PQEA 4FFRA 4KGZA 1OYWA 2IOYA 4UFNA 5DBHX 1LBSA 2WEKA 5DLQC 3GELA 4C4AA 4K9QA 3DTVA 3Q1LA 2VP4A 3GIWA 2O2SA 5JDIC 5GWXA 4RESA 3MT0A 2B5WA 2GILA 2KE5A 5KTPA 1ACMA 3KOZA 4GOOD 2C31A 2X4LA 3HDTA 3EQ8A 5BWBA 3LHSA 8ATCA 4DAEA 1NT2A 2LVBA 3PFWO 5JSZB 3ERCA 1YU9A 2ZOSA 5JCOA 4UXJA 3TBKA 2OYCA 4XD7A 2BEUB 1P6XA 3QV2A 3ZXIA 2G9UA 3Q8KA 4C3UA 1QCYA 1S89A 1S96A 4CEIB 3ZTTA 4Q3LA 1ZK3A 5HUQA 4YBZA 3LQ4A 2PGLA 3RSQA 1DBIA 1G41A 2JPDA 1ZOPA 1XZHA 1WPGA 2VNJA 1UMCB 4N4AA 5DCUA 4K81B 5E1DA 3D7RA 3HB5X 1Z2PX 3TTWA 3V7WA 1GTJ1 1IK6A 1NSTA 2DWOA 3P0RA 4QOHA 5D86A 1D2RA 1Z06A 4G0ZA 1E9DA 1GITA 3IBYA 4LBVA 4ALLA 5FEUA 4I99A 2GI4A 2IXGA 5DISB 3BSFA 4YMUA 4R6XA 4H4EA 3GFPA 2JD1A 1YDWA 3LU1A 2BP7A 3LV8A 2E49A 3FX2A 4CHGA 2VJCA 2XYHA 3EA5A 1ZEMA 5ULLA 1AQJA 1DKUA 1TQ8A 2PH1A 1JEEA 1KFKB 2RSLA 4DLZA 1OSNA 3B9QA 3GAZA 1HDIA 1SAYA 3GT7A 1QHEA 2AXQA 5KYNA 3OQMA 1JIKA 3WKCA 2VUIB 4MUEA 4PNPA 1VHJA 3CONA 3I9NA 1ISFA 3Q7RA 1JB1A 5HF8A 3U3ZA 4N54A 1LPSA 5CCBA 4ML3A 5B1EA 5DRTA 2AMFA 4ZVOA 3BMQB 2C9YA 4ATNA 5IJ9A 1X1BA 1Q17A 2HK7A 1LDGA 4O2BA 4NTZA 4OATA 4IRMA 4NG5A 4X91A 4EW2A 4A36A 2IV7A 4BMCA 1UZLA 1HSOA 5ESWA 1T5TA 1YB6A 2IEYA 3A05A 4JP8A 4EB8A 4MUIA 5CBPB 2FG6C 4KYVA 3ZBTA 4C3ZA 3BEDA 3EF1A 4YP7A 2QT0A 4OYLA 4EB6B 4QYXA 1JAYA 2VNHA 3MTBA 1YFLA 2WP8J 3TOSA 2ZWIA 4YHBA 1TLFA 3HEAA 3O9ZA 4BFYA 3LTNC 2HJVA 5K3CA 2X8LA 5KYXB 2SNIE 3K9CA 1TVKA 4IX9A 2BUCA 3TFWA 1J2YA 2IC5A 4C4RA 5ALLA 1ZSNA 4EF6A 1APBA 2H5LA 3UMBA 2E0IA 2WKPA 3LVQE 4TSRA 4YCJA 1ONBA 1Z5OA 1Z5NA 2DKFA 2MSCB 1EJ2A 1TU4A 2XMBA 3WV4A 3RAEC 3EBOA 3W1WA 4O4JF 2ZCVA 3V1MA 1E7MA 3CLSD 2IS1A 1RXEA 1XQXA 2H4YA 4YV1A 3AETB 3OIFA 4UCXA 3OUZA 2I7CA 3HM2A 2I03A 4UPVA 1QRAA 1AQ6A 1U02A 2O52A 1ZZGA 3U7RA 4ND8A 1PTJA 1HDGO 2GPAA 3F47A 3IUBA 4Q4JB 4EK9A 4KKXB 4FS8A 4MEJA 2FZ5A 3RUFA 1YSCA 2DHDA 2W6NA 3WFIA 2AV6A 2C5HA 3SKVA 4EDFA 1L8QA 2QE7A 2VT3A 3R3HA 4MOWA 1FP2A 2PUEA 1RAHA 2OHVA 3N3AC 3DO8A 3GK3A 1SXJD 1X7XA 4QPDA 1L4YA 3L1HA 2QVCA 3X44A 4MKHA 4EHIA 1QHXA 4YQEA 2QUJA 4B75A 1J4AA 5EJ7A 1U9IA 1GCIA 1GQ2A 2DLNA 2W4MA 4NENB 3VR0A 1LLFA 1K4YA 2A0YA 3WSWA 3A3KA 3PFKA 3WYAA 5BV1A 1KR5A 1F7VA 4BYGA 1W9HA 2G4CA 4P0TA 5J3JA 1I3KA 4A82A 1RPJA 1DXQA 2BELA 2ZRLA 4MS3A 3CPEA 1W5FA 1SVIA 4UTNA 1WPQA 3KRTA 3SICE 1K63A 3AOGA 1OI4A 3RJZA 4P3PA 1DP4A 5L7YA 1GZ7A 1QFXA 1WY5A 2SCUB 3HPQA 1XZCA 2DHEA 4ES6A 1NGSA 4ZCQA 1LPNA 3MGKA 2PLWA 5K5EA 2I3GA 4XYBA 5KYUA 2GD2A 5I7EA 5DEOA 2YJTD 3TNYA 2D62A 2WD9A 1EXDA 2QRLA 1LF5A 1XTTA 4WEQA 4E7OA 4OQFA 3UA4A 3PYXA 1N2EA 4RL4A 4WKNA 1C0LA 2OK7A 2LCQA 4AN0A 1WPRA 1IBLB 1V5IA 2FNAA 3MRVA 5CW2A 2JVKA 3OQ1A 2REBA 2VDWA 4YBRA 4B2IA 2OQRA 5ARBA 2O6HA 3GEMA 4BQIA 1GNRA 1CCWA 3KD3A 4RXTA 4LBWA 4W6ZA 4Y8VA 5LA6B 2DBQA 1ZJ6A 1P3Y1 4ZAVA 5GV7A 1KFBB 2ZDHA 3DBHA 2QI9F 5BNIA 2UZ4A 4GR5A 4ZVPA 1M2KA 5TQ2A 2X0KA 2J4DA 1L5HA 3SZRA 1ZOIA 2AHOA 5DJ5A 3BBPA 3VNAA 4CV0A 1R16A 5GONF 2JIOA 5LOVA 1LLQA 2HUNA 1BOOA 1GO2A 2B1IA 3JQCA 5LXTF 4HN9A 2ZSFA 5FT9A 2QUZA 2PS1A 1T0IA 2CCJA 4DC1A 4NEGA 4IFIA 1EDDA 2QQGA 4HQKA 2C7QA 1KAEA 2G83A 1KE2A 3ZEAA 1NVFA 1BE6A 4CIBA 1G6HA 1DKNA 1QO9A 2M1ZA 3BKWA 1ZITA 1REQB 4OVKA 3M6AA 2WFLB 1D1TA 4L57A 2A94A 1IMJA 3SF0A 3KOUA 4NABA 4FW9A 2ODEA 5FBLB 2Z2ZA 3KQNA 2H1SA 1JWAB 5F1PA 4N48A 1PG5A 1GPH1 3DV2A 1ZJ5A 2A9OA 3IODA 2ZATA 1V1MA 2GR9A 1QHFA 3CUYA 2MMGA 3ETJA 3GFRA 4YQYA 3Q3HA 4U0JA 4XZ3A 3MJSA 2JHFA 1EVEA 4KMSA 5G1NA 4ZI7A 1V7PC 4JX9A 3HCWA 3VKHA 4QLAA 4QYIA 3KFXA 4WTOA 2ANBA 3CW8X 1VL1A 2A78A 3GA5A 5T4EA 3TQOA 3D8UA 1E5QA 1DX9A 3BN3A 1JHOA 3SM3A 1P80A 4Y6QA 5EIOA 3QXHA 1L5QA 4ZT6A 2XX3A 5I7OA