3GJ0A

Crystal structure of human rangdp
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
207
structure length
207
Chain Sequence
SAAQGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and Biochemical Analysis of the Ran-binding Zinc Finger Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
total genus 67
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gj0A00
1Z3IX 4P4TA 2ORIA 3CB4A 4KODA 1A7JA 2ZANA 3IO5A 4NYJR 1Q1BA 1W0KD 3OIVA 3ZVMA 2X19A 4MRNA 2YKGA 3KUCA 5F3WB 2WWHA 4N0DA 1F2UB 3NVAA 2IUSA 3ZZTA 4D0LB 1J8YF 2IYZA 2NGRA 2ZSEA 2WWYA 2A30A 4P3YA 3ZIAD 1UKZA 4ILEA 3CX8A 3SDZA 1NY5A 2QP4A 2VHJA 2IBMA 4QJ3A 3I61A 3MJHA 3IGFA 4IDPA 3Q7QA 5HCNA 3FKSD 1KI1A 1YJ5A 2GRJA 3CNNA 1IQPA 4HUQB 1NBMA 4TTQA 5HE8A 5JWRA 1DTSA 3U7FB 2NPFA 1F5NA 3KFXA 1VYVA 3R7WB 3KQHA 1TF5A 2YNMA 4OK3A 3T61A 2ZUCA 2QBYB 2ZYVX 5M04A 2ZJYA 3SE0A 2OE2A 1XD2A 3IEUA 4Q4AB 4BQSA 2VP4A 3RAPR 2W0MA 3UWOA 4Q9IA 4LJ7A 3CX6A 2PLFA 4F93B 4ITRC 3AKEA 3IIMA 2MSDB 3QXSA 1N0VC 2VEDA 3B1VA 3OIUA 4MYUA 1G41A 4JVMA 3VKHA 4CT4B 1JECA 4DDVA 2WBLC 1RRPA 5FL7A 3CR8A 2V6IA 4N1AA 4Y0VA 3W34A 4V02A 1TUIA 3UG6A 2QP9X 1TAGA 5KPDA 3OZXA 3BFXA 4M1OA 1LB1B 1XMVA 3QPWA 4XIGS 3ZGXA 4G5OA 1SHKA 1R10A 4JBYA 2V8OA 4GZLA 4ZKEA 5JEEA 2XZOA 1NF3A 4TMKA 3A1SA 1GVNB 2WJYA 2IS2A 2REBA 5SZHB 4LPKA 3FHTA 1DPFA 1NMZA 4YONB 4AKGA 2OFXA 1A82A 1D9XA 4JJKA 4URXR 2R2AA 1TF7A 1FQJA 4TTPA 3MMPA 2FN4A 1OW3B 5KDLA 2VHUA 1RYFA 2BV3A 5DSZA 2D2FA 4C9BA 3BXZA 3NHAA 3SHFA 4AIIA 3GQBA 3U2QA 5HPYB 2WSSA 2FF7A 1KI6A 2JLRA 2ZAOA 4QGGA 3SFZA 2G88A 3OE7A 3SBEA 5TXGA 1X8LA 3GEEA 4RZ2A 2YOHA 5KSYA 4OYHA 2JJ2D 4ZCLA 2J7KA 2FU5C 4QC2A 5DE3A 4Q01A 3KQUA 2J7PA 1XEFA 2OFWA 5TDHA 4MDFA 2FGJA 1FMJA 1G7TA 5C18A 4EPXA 1S3GA 3O47A 1OSNA 1YU9A 3EPKA 3Q5EA 2BKEA 4A2QA 1M34E 4QM6A 5JI3E 4ARZB 2ZI3A 1HT1E 3QXCA 1C1YA 4LV5B 2XXAB 5LB2A 2I1VB 3QPUA 1N3BA 3ADBA 2VH5R 2IWRA 5SZKB 1DO2A 4XTCS 3M6AA 2WOOA 2W2TA 1OIVA 2Q3HA 3U60B 5G41A 4IOLA 2XNDA 4IFEA 3GMTA 3A58B 2JLVA 1V5WA 1HE8B 1OFHA 2F1IA 3AVQA 3ZD6A 1E1QA 2MSCB 4H1VA 2JCSA 5D3MB 1WE2A 5J4LA 1IY0A 2PEZA 5CITA 1KJWA 5JHHB 2C9CA 3REFA 3UPUA 1G8PA 4IW3B 3SN6A 4M1WA 1KI7A 1TTTA 1AS3A 1XD2B 4GI7A 2CBZA 3LVQE 3RWOA 3GJXC 8OHMA 5F2EA 5EXTA 4F4JA 5HKKD 2ZRBA 3DEFA 1YR6A 5KTYA 1G291 1XX6A 3CF6R 2JATA 1KI8A 1KK3A 4TQAA 2PZFA 1P7CA 4DLYA 3JZAA 1I2DA 3NBZC 2CL0X 2GVZC 5TV2A 3VNVA 1XCPA 5H1YA 3R20A 1CJUC 2GKSA 4F91B 3GLHA 5FL3A 4YXWD 2WJGA 4QHTA 4TYWA 4OBEA 1AQUA 2JASA 2VPPA 4PPQA 4WXPA 4EKDA 1VG8A 1NVUQ 1NN3A 1P2SA 4POAA 2C2HA 3U3MA 5B58C 1XBTA 1W4BA 1TEVA 4TYPA 5AUNB 5L8VA 1W36D 2RCNA 2JEOA 4Y0AA 1DS6A 1S96A 1CKEA 3QXJA 4KFSA 5DHAA 1HV8A 4TL6A 1F2TA 5KOYA 3TW8B 1UJ2A 3GCGA 3THWB 3VNUA 2ZQ5A 3BH7A 1OXXK 2P2LA 2RHDA 3IPYA 2HYDA 1L4UA 1XXHE 3T1VA 3EC1A 4GMXA 4I99A 3VR2A 1AKYA 4XD7A 1E2JA 2CDNA 3FFBA 4DT1A 4ZV4A 1JQLB 5C2JB 4DEYA 3CPJB 2A5DA 3TR0A 4R71A 4X8MA 3PEWA 4BFWA 3VQTA 2QA5A 3HP1A 3RLFA 1KI6B 1KK1A 1KY2A 2DR3A 2FPKA 2ZS9A 4BGDA 1X8JA 1IXSB 1NVXQ 5DLQC 4C7OB 4FMCF 3ADDA 3F3YA 4WBSA 4JL8A 1TX4B 3LV8A 2FEMA 1F2UA 1E79D 1OYWA 4G5RA 3BK7A 2ZYTX 5DI3A 5HE9A 3CRMA 5CK4A 4HAYA 1F3OA 5E7IA 4PXAA 3TSOA 1E0JA 4AWXA 2BKUA 3TR5A 3IEVA 4OK5A 2ZUDA 1NIPA 3B7GA 2YV5A 4A8JC 1KDRA 2J46A 1DELA 3CUEF 5HCIA 5LBIA 4BFXA 5LPNA 4Q48A 4Q4HB 5KO2A 4IVRA 1Q1QA 4PZZA 4QJ5A 3K0FA 4UKDA 5CB8A 2BJVA 2QMOA 2ZR0A 2JIZD 2WAYA 3EPLA 2DBYA 4M1TA 1H8EA 2G1KA 2I1QA 2F43A 1DO0A 1W4CA 1Z0DA 2R6DA 3HPQA 3KJGA 4NYMQ 3WMFA 2NQ2C 4B75A 1KMHB 2ZJBA 4I1UA 4PSVA 1RRGA 3A1WA 1G17A 2ZETA 1E32A 1ZNYA 2C9YA 1VTKA 3GJ3A 4BFSA 1XPUA 1ZINA 2GJSA 1E2HA 2OV2A 3MAAC 4LGMA 5A5GA 3ND8A 4DCSA 2ODNA 2OAQ1 3BB1A 4PO1A 3O8RA 3Q72A 1XU4A 1AS2A 3VKWA 3ZIAA 2JJ1A 3F8TA 4JBWA 2FFQA 4JLJA 3KDSE 3NXSA 4MKIA 1DBSA 1K5GA 5EE1A 5GJVC 2YOFA 1OT3A 3ZD7A 2RHMA 5IK2A 4IEIA 2KWIA 2ZE8A 4II7A 3MWLA 5E7JA 3ZVRA 2IYRA 3L8YA 2EFGA 1G3UA 3FFAA 3DMNA 4XH9B 4XVQA 421PA 1ESNA 2X2FA 4GBMA 1IXZA 2ZJ8A 2IC5A 1U0LA 3FOZA 2GCOB 3AUXA 1CJKC 3UMSA 2QSZA 1F48A 1R0WA 3KTAB 4BLQA 4HDQB 1G5RA 3GJ8A 4QGHA 3PFIA 2IF0A 1IHUA 1XB2A 1LTQA 2BMEA 1FFHA 5FOWA 1R0YA 2F1JA 1OPXA 3BJIC 3X2SA 2RKOA 4YDHB 3B2EA 4YDSA 1KO4A 1D9ZA 4OHXA 5DGXA 3MSXA 1LNZA 2BM0A 2QTVB 4PC7A 5JWOA 1FP6A 2D62A 1G4AE 5HKKA 4URYR 1FW6A 1PLKA 2WKRA 1UDWA 1COWD 5EXSA 4V0OA 3U44B 1ELOA 3QI2A 5DNYB 2TMKA 2XITA 2ZSBA 1JXOA 4DDWA 5FUYA 1KY3A 2VO1A 5C46F 3RSLA 3KJEA 3KB2A 4DLZA 3IBGA 1N0WA 4YXWA 4DT1B 2IL1A 4LI0A 2V1UA 4B43A 2CE7A 4EPYA 3EPJA 1VECA 1VG0B 3IBYA 1QG4A 2J0VA 4X8HA 1RPZA 1KGDA 1ZCAA 1EK0A 2OLJA 2WWXA 2OO7A 1XMSA 3RS0A 1T3HA 3PEVA 3VKGA 2R6GA 3KXLA 1DG1G 1XTSA 1YR9A 2C8VA 2DB3A 2YWGA 4Q7KA 4DLRA 4YLGA 4LRWA 2A2ZA 5J47A 2J59A 3EW9A 2F3RA 1QHHA 4RVCA 3NG1A 1J99A 4JLAA 1P9RA 5JCZA 5FI1B 1T4GA 4OI0A 2Z83A 5FOUA 3X1DA 5JECA 4IJMA 2ZU0C 2CVHA 4KFRA 4AG5A 4D4JA 4LHYA 1N6NA 4OHVA 1UKVY 2JJ2A 2Z4RA 3L8ZA 3A1TA 1AM4D 4NP6A 1R0XA 1RW4A 3ADKA 3F5FA 4C4PA 4M2LA 5D3QA 3W6NA 4F92B 3AQ4A 3SNHA 4BLSA 1Q44A 3B9PA 4JT4A 4US0R 4IVQA 2KBEA 1R6BX 1E9DA 3LO5A 2ZRMA 1N6OA 2B6HA 2ZE7A 3DM9B 2Z6VA 1JB1A 4KSCA 1NMXA 3BRWD 3P4XA 4JYBA 4M1YA 4UXIA 1FZQA 721PA 4AURA 2B92A 1DAEA 2BEKA 3DKVA 3QE0A 3U4QA 3SQWA 3MFYA 2GXQA 2CLDX 3FKSA 4IKEA 1GL9B 1ZYUA 2G1JA 3LBNA 1ZNXA 5G53C 2FV8A 1QVRA 3SZRA 4Q9KA 1MO6A 3QEOA 3LXXA 4B48A 4MRVA 2XX3A 3KKPA 2FPMA 3LH5A 4M0LA 4W9MC 1MABA 3CRVA 3AB3A 1NKSA 1KSFX 3PUVA 2KB0A 2EFHB 1E96A 1CJVC 1W5SA 2VSOA 2GK7A 3N5CA 4GOXA 2ZXUA 3IHLA 5FPHA 4DIEA 4XSHA 1VG9B 1HURA 4QRHA 4BEBA 1Z6TA 3C8UA 1W7AA 1UF9A 2GESA 5KSOA 1JR3E 4WZ6A 3H1TA 1NJFA 1KO8A 1E9RA 1W5TA 5GJWC 5FUXA 4DUGD 3ICQB 1U9IC 3QKTA 3V4RA 1KZGB 3A4LA 2J9RA 2QORA 3PENA 4WXRA 3U3KA 3T1TA 2IS4A 2AX4A 1XPRA 2OHFA 5C1BA 3B82A 1O87A 1G16A 2V54A 4A36A 5JZVA 3B1YA 4O0MA 2HF8A 1IJEA 3HU2A 4US1R 4PQRA 3OEEA 5JJIA 5B64A 3T15A 5KPJA 2CJWB 5JBQA 3WBJA 1U81A 3WYGA 4DXAA 2R65A 1Q57A 2OCAA 4HAZA 4RCYA 1CLUA 1G3QA 1OXSC 4S35A 5JFGA 4Q7MB 3GLGB 3BH6A 1Z22A 2QMEA 4RY2A 2Q9CA 4M1SA 1M2OB 1NVVQ 4A0GA 2O8EA 1TQ2A 2H92A 2CL6X 2GF0A 4B34A 3VTKA 3RANA 3TAUA 2QRZA 1S2MA 3OAAA 5CYOA 3MLEA 4HUQA 1HA3A 4W5HA 1QDEA 1YZLA 2G6BA 1SXJE 2NZ8A 5JLJA 3CX7A 4LSGA 2H57A 3KZ1E 2H8KA 3PV0A 3TVDA 4Q4HA 5J4HA 3Q9LA 2C78A 3AGPA 1XEWY 3CPHA 2B8TA 3Q8XB 4MITA 3U6BA 3UKDA 2GAOA 4ON9A 4QM7A 1N6RA 4MYHA 3QG5A 2F43B 1X1SA 4HUTA 2F7SA 1TU3A 2GWHA 1GKYA 5JSZB 2QP3A 4QHYA 3I62A 1II0A 3K0AB 5SZIA 2F1RA 3BAFA 2FSIA 4GOJA 3X1WA 5J4KA 4HZUB 4QBGB 5GJCA 4Q4JB 1N6PA 1IJFA 4JLNA 3I73A 1WB9A 3JVVA 3PIRA 4JBXA 3WNDA 3CZPA 4NONA 2VP2A 4LJAA 4DCNA 2QMUA 4HAUA 1CP2A 2FPLA 3SS8A 1E9SA 4WIAA 1VCNA 1W36B 4DCUA 1QBKC 1SVIA 4Q5IA 2QM8A 4TL8A 4Q7JB 2OEPA 1XNJA 2XTNA 4Q03A 2FZLA 1ZC4A 3SFVA 3QG1A 5A0FA 4DLVA 1GSIA 4TLAA 4A8JB 2GXSA 3W8RA 4RKEA 3HU1A 4CGZA 5DISB 3KTAA 1P62B 3L0OA 4JJZA 1WXQA 3WP0A 1CTQA 2BMFA 5K8LA 2PBRA 3PUXA 1YKSA 1YQTA 1II8B 3N70A 2ODEA 4NH0A 3WHLA 1TQ4A 3IHWA 2ZRDA 3E5HA 4F4IA 2AXPA 2NMVA 3X1XA 2PLRA 1F2TB 5FBWB 5FBLB 4ZI2A 4B74A 2IA5A 2WSMA 4G01B 4HAXA 5CK5A 3EZ6A 1G8GA 1SXJB 2WJHA 2H18A 2CVFA 1LS6A 5LB4A 3GEHA 4Q1FA 1TU4A 4GSYA 4B32A 1YZQA 3MWJA 2WJIA 1R4AA 3AGQA 4P33A 3PEYA 2H16A 3GFOA 4C3ZA 3KKNA 3NBFA 4JLDA 3MUFA 4PC1A 1IN7A 4A0FA 4KI0A 2J3EA 2GK6A 5BN5A 3KQNA 1Z0JA 1YR8A 2IF2A 4M4SA 3GLIE 4FWTA 2YHSA 3I5XA 3SBDA 4ZCIA 4N0EA 1QHYA 2GJ9A 5FOVA 2DPXA 4JS0A 4JVNA 2R6CA 1KTVA 3M4YA 4B35A 2ATVA 1G1MA 1Y3AA 2N42A 2RGAA 1GNQA 1P9NA 3KQKA 5FTLA 3H0KA 1NN0A 3ETLA 1Q0UA 1VHTA 2PCJA 4F38A 2J87A 4D80A 1KDPA 2CMKA 1PZNA 1E4YA 221PA 3QENA 4HZIA 1I4TD 2W58A 4D0NA 1R5BA 1J90A 4ZIRA 1NVVR 3FYHA 4TT3D 2Q9BA 2VLIA 3Q85A 4KHZA 4HI0E 2G0TA 2WTUA 3RRMA 5DN6A 3T5DA 4TQ9A 4XD7D 3TK1A 5H8WA 2ONJA 2ZJ5A 4PSAA 1P3JA 2QZ4A 3KXIA 4GOKA 5HR5A 3PUYA 4UXHA 1Z2CA 1X6VA 4C0QC 3NDPA 2O8FA 4AC9A 4DLUA 4QNRA 3SHWA 4LHZA 1E2KA 1PUJA 5EUQB 1GWNA 1WQ1R 3GJ4A 2YYZA 4ZDIA 1JEEA 1DAHA 4JSYA 2W83A 3OEED 4IXNA 3IQXA 4JKYA 3TAHA 5CB6A 4ZPXA 2YC4C 3I32A 2FWRA 5L3QB 4CEJB 1CU1A 4B3GA 4RFSB 3R8CA 3G82C 1DAMA 3J81k 3I72A 4Q02A 2VP6A 4B3XA 1E2NA 3U3RA 2R44A 4LYFA 4AKIA 1MOZA 1E2LA 4UQOA 2GNOA 3THYB 3I3SR 4BECA 3FTQA 1WF3A 3ZLJA 3EZ9A 1U94A 2O8CA 3PCRB 4LWZA 1OE0A 2ZSDA 5F9FA 1R0ZA 4A6PA 4MDEA 1CIPA 2ZS8A 4KYUA 1FNMA 1JPNA 2ZRAA 2QT0A 4MA4A 4OQNA 3UG7A 4HAVA 1NRJB 2QPOA 4JZKA 2ZM5A 2MSEB 4BEJA 2DWQA 3AVOA 2VP5A 2KE5A 1QHXA 4BASA 621PA 1YZGA 1KKLA 2OILA 4JT2A 4IHQA 1OH8A 3PQCA 2FFHA 5AWFC 1P6XA 4E22A 3D8BA 4L16A 5EE0A 5BYJA 3ZYCA 4TSFD 5C4GB 1F6BA 1AGRA 4A8JA 4A6XA 2X2EA 4TYYA 3ASZA 3RYTC 2VQSA 4D6PA 4QGFA 1US8A 5ANRB 3DMDA 4M21A 1P61B 2QAGC 5FTNA 1U8ZA 4G5QA 1DAGA 2RGEA 1OV4A 2OESA 1JXMA 1OH6A 2ZI5A 2ASEA 1EFTA 2JGNA 1MO5A 2BHRA 4DB4A 1UBGA 4JL5A 1DAKA 3SYNA 1A1VA 3AVXA 3CF0A 3EWAA 2KJQA 4TMVA 1TUEA 2BCJQ 1AGPA 3NC1C 5KSPA 3D6TB 3MD0A 1CXZA 2GCNA 1WMSA 1Z2AA 5IHPA 2A5YB 3EWSA 1YZNA 1KO1A 1AZTA 2B8WA 4DVGA 4AKEA 2PMDA 1G8YA 2PL3A 4M9QA 1AZSC 4L4UA 3GLGE 3T06B 1NKTA 4XJXA 5BYKA 3C16C 2QAGA 2HYIC 1GTVA 4DBLC 1U0JA 3LQQA 3EZ2A 3BOSA 3LNCA 2QMHA 4OQXA 3X1YA 1XEXA 1OHHD 3AF1A 4EJSB 5AJVB 3UMFA 2V7QD 3K9HA 4DSTA 3R8FA 1ZMXA 2VTKA 2ZJAA 1NLZA 1RC8A 3AKCA 3AM1A 1QHHB 2A3RA 2BIFA 5E95A 4CIDA 3LW7A 1W36C 3SR0A 1JR6A 3SYKA 4URWR 4JLMA 2Q3FA 2J45A 5HZHA 3O8DA 1G21E 3MWYW 5KU1A 4C0JA 4F7WA 3FB4A 3NC0C 5G40A 4J0QA 5JWHA 4DCVA 4EUNA 3R7WA 3CRQA 4PO8A 4LYAA 1EG7A 4TMZA 5FL7D 5KDDA 2D2EA 2CCJA 2YWFA 4Q1AA 4RD1A 2OM2A 4NYJQ 5JCPA 1UAAA 4PSKA 2WKPA 4TMWA 3CRW1 4B2IA 2ZJOA 1E98A 2E87A 4GRAA 4HATA 5L3QA 5BN4A 1FMLA 3ZS9A 2GETA 4WOPA 5FPTA 4OHZA 3RS2A 4I4LA 4G3XA 3A37A 2FSFA 3P20A 4OK6A 4B76A 5J4YA 5KNBA 3AP1A 4JYCA 2N1BA 4M53A 2GDJA 2NOAA 5CIQA 3RWMB 4NZYA 1JAHA 2VRWA 2YWEA 4G5SA 4NPHA 5CIWA 1KSHA 1CULC 1HTWA 3HR8A 3NIBA 1WBBA 5JJKA 1KHTA 1AIPA 4MKFA 3Q5DA 1NP6A 3CWZA 3KKOA 4WA7A 4F4CA 1VDZA 2HXSA 5F9HA 4XWKA 3KKQA 2PJRA 2WOJA 3ZH9B 4L9SA 1II9A 1N5IA 1XCMA 1HY3A 4IOJA 4QBFA 1G5TA 4QBIA 2UVQA 2QL6A 4EPTA 3BC1A 3CO5A 2RMKA 2VF7A 1FX0B 2AXNA 3T35A 2XTZA 2OBNA 2ZEJA 3M1IA 2JDID 4KCGA 4EPRA 1EWQA 2JA1A 4MGIR 2VF8A 3GJ5A 1Z28A 2BJWA 4WW0A 1XTQA 4KJZA 1J70A 3U3OA 2FNAA 5FFMA 2SHKA 3O8BA 2BMDA 1BOFA 4V0NA 1IAQA 4Q18A 2L0XA 4C2TA 4OL0A 3K09A 2LKDA 3T34A 2H17A 2KI5A 4Z8YA 3NH9A 1Z6XA 2QN6A 1E2FA 1Q12A 4CT5A 3GLGA 3Q7PA 4A15A 2V1XA 1OH7A 3KJIA 1SVSA 4RD2A 4BUJA 5KHOC 1MO4A 2UZ3A 3W3AA 2VHCA 4R2IA 3I4LA 1JAIA 3ZQ6A 3K53A 3PJRA 4ZIRB 5L3RA 5DHFA 1ZM3A 2C5LA 3I1FA 5J4VA 1E9EA 1S8FA 3TQFA 3G0HA 1RRFA 1G3RA 1XMJA 1E9BA 2N46A 2ZRIA 4QOSA 1N5KA 3K9GA 2D4HA 1U8AA 3MG9A 3EAQA 4Q21A 2XB2A 1OHHA 1DE0A 1R2QA 4Q00A 1JBKA 4A0HA 3GLFB 1U0HC 1PUIA 4NTZA 3HYTA 3NTUA 3QF4B 1Z0AA 1D8TA 5JRJA 2VBCA 5GJBA 2D7DA 2DHRA 2P67A 3N2EA 1ESMA 2QE7D 3AUYA 1Z06A 3KKMA 3LLUA 4U5XA 2VL7A 4ABYA 4CEJA 4OI4A 4AYTA 5TY0A 4HZUA 4TLCA 1RIFA 2WJJA 4NMMA 1TADA 4EFLA 3IKJA 4L9WA 4PZYA 4XWAA 2HEIA 3HR7A 2G77B 3G5UA 1XCGB 1XTJA 4KITB 3U6KA 4LHWA 2H7VA 2Q0HA 1S4QA 1H65A 4NYIR 3AVUA 1MV5A 1RYHA 4PAQA 1AK2A 2ZVQX 1JR3D 4FCWA 1EX6A 3B60A 3CF2A 3W8NA 1JQJC 1T5IA 3OEHD 4JSTA 1HQCA 1U98A 3CNOA 2IW3A 1L4YA 4OJQA 3UK6A 2VP9A 4HEJA 2C03A 5BW8A 4GT1A 5E7MA 2LKCA 4OQMA 3RS4A 1AN0A 4BFYA 4LK2A 5JHGB 2WIBA 4HLCA 3R9WA 1JPJA 2WSSD 2R9VA 1OKKD 2O5VA 1D5CA 2CCGA 2ZRJA 1M1YE 3OE7D 5G3YA 2HCJB 2EYQA 2ZI7A 4G0NA 1US8B 1ZU4A 1TPZA 2GF9A 2ZI6A 3U7EB 3FVQA 1Q21A 2QGZA 4MUAA 2BWJA 4DLWA 4RZUA 5KSZA 5DI9A 1HYQA 2QQ0A 1E69A 4L15A 3FE2A 3FGNA 3K0CA 3QY0A 3WY9A 3THWA 3ZVLA 5DIFA 2HDNB 3EA0A 2RAPA 5TMPA 2A9KA 4Q1BA 3DZDA 2ZSAA 1SKQA 2QT1A 1M7GA 3P32A 3QXXA 1VKJA 2BBOA 1CR4A 1T91A 3DVLA 1OB2A 3NBYC 2IYVA 3Q3JB 3FWYA 5EE3A 2JLSA 1Z08A 3LXRA 4URVR 1JALA 1QHIA 2WMOB 3SEAA 2A5FA 4DIDA 1P2TA 3MRSA 1OIWA 5GADl 3PVSA 4KYIB 1ZUIA 1CR2A 2BOVA 2ZRLA 5EZ5A 2QI9C 4EJSA 1ZBDA 2ZI4A 5HTKA 3VMFA 4DSOA 4KFUA 1YRBA 3GPLA 5HZKA 2QPAA 4LBYA 3T1OA 4JLBA 5CLQA 4NBSA 1GRRA 3QXHA 4NCHA 2WHXA 4NE2A 1NVWQ 1X1RA 4M1MA 1D2NA 5E3HA 4TLEA 3GP8A 2OZEA 1RJ9B 5ELXA 3PEUA 2ZE5A 4BLTA 4OQLA 4D81A 3K0SA 1E4VA 4W7SA 1SVLA 1E1RD 5CDFE 2O8FB 2G83A 2ZITA 3WXMA 3TUJC 3RC8A 3MJRA 3NWJA 3THOA 4Q4JA 5IK2D 2VIIA 2ZRKA 4G1UC 4TLBA 1U9IA 1XD8A 4GP6A 1GL7A 2VP0A 3IIKA 4H9GA 1KMHA 4O3MA 1UBFA 3EXAA 4N3NA 3U5ZB 2EW1A 3AP3A 4UNQA 4ZI3A 3TQCA 4O2RA 5CM8B 5G3ZA 1I4LD 4DJTA 2GEUA 3A4NA 3LX8A 4JLVA 1P72A 3P1JA 2WPDA 4E09A 2QE7A 2FZ4A 1WRBA 5KDOA 3AVTA 4QNMA 2IEYA 1E0AA 4DLSA 5FOSA 4MYCA 2D3WA 2PMKA 3IPXA 4PC3A 3TMKA 2IEZA 3VR1A 5J5CA 4HSEA 4JLOA 1RZ3A 4TTRA 2NO6A 4W5JA 1KNXA 4AD8A 1HE1C 2DWOA 1VHLA 4WZBE 4PFSA 3CNLA 4MRSA 3CZQA 4GFDA 3X1ZA 5BXQC 4PC6A 2NG1A 1X8KA 4I1VA 4MQBA 5BQ5A 4BZPA 1G9XA 3QKUA 2F55A 2OCPA 1HH4A 2PX3A 1OH5A 1UM8A 2J1LA 3W5IA 4KBGA 2ZRHA 3AVVA 521PA 1RFLA 3CLVA 2P3SA 4U00A 4Q1DA 2LCFA 1G3MA 1A5TA 3B1ZA 1Q1EA 1E2DA 1RVDA 1UADA 2B7BA 4RSGA 1P60A 5L3SA 3VR6A 3BERA 1FTNA 2QQEA 5IF9A 2P6RA 4V03A 3A8TA 4DRZA 4JMPA 3E1SA 4ERNA 1N5JA 1N25A 4V0ME 3LA6A 3ZQJA 4RD0A 1XTIA 4M9SA 4MGKR 1VIAA 1PLLA 4NU0A 1OXUA 3K9NA 1PVOA 4LUCA 2J0UB 2CNWD 1FOEB 1SXJC 3H84A 3LY5A 4KBFA 1RRCA 3DKPA 1EFRA 1GNRA 2AR7A 4DSUA 1UBCA 2ODBA 1QZXA 1ZUNB 4KXFB 4X8OA 2H5EA 2KBFA 2AFHE 4BRWA 1ZCBA 1I2MA 4MYTA 3RS5A 1IY2A 2VYFA 4TL9A 1R7RA 4NHOA 4NDZA 3EIQA 4BE7B 4GDFA 2HT1A 2MMGA 2XTMA 1FTSA 1R5NA 5FTMA 4LBVA 1JI0A 4RD4A 1MKYA 5K8TA 3CM0A 4BZQA 4U7DA 1ONBA 1KOFA 1OFUX 2RGDA 2FGKA 1M6NA 2ZRGA 1T8TA 4V0LA 4KLNA 5D3MA 3B6EA 1S1CA 4TN1A 2ZYUX 3CPEA 2CK3D 1VYUA 2V4ZA 1TEXA 2A78A 3P4YA 1D6JA 3RVBA 3CONA 4S2EA 1ZIPA 2AN9A 2XXAA 1E9FA 1UDXA 3QOFA 2GEVA 1E2MA 3I8SA 1XJCA 2IXEA 3HPRA 3LRPA 3SC3A 1VCOA 3BFKA 5B30A 1Q3HA 1E2PA 3FDIA 2NIPA 2WVJA 3OIYA 2XSZA 4C0AC 3RABA 1KYIA 3RNLA 4D4MA 4AK9A 3DOFA 5EZ6B 1PLJA 4IDNA 3U4QB 3TNFA 2R6FA 2GZDA 4JKIA 1CRPA 2ZR9A 4LPSA 4PPFA 1WP9A 3OFNA 4BLRA 3NEYA 5GVSA 3TE6A 4P32A 2BBWA 3IQWA 5CM9C 3TH5A 1FUUA 2FX3A 1E94E 2I4IA 2QAJA 3RS3A 1G7RA 3BS4A 2ZAMA 1IY1A 2WIAA 1GRQA 1B23P 4AI6A 3AF4A 4ASUD 3AKYA 4WAUA 2QNRA 1XD9A 1FPMA 2C77A 4FMBB 4DSNA 1N6IA 5AUQA 3I92A 3FMFA 2YWHA 2ZYWX 1RE0A 3EZ7A 2YZ2A 1ZIOA 2EU8A 2OBLA 2H1LA 3WNCA 5EJEA 4YQFA 4ZDWA 2BVNA 5FTKA 3B85A 2IHBA 5TB5A 2Q6TA 2PCLA 4TL7A 2WWFA 2PJZA 4IDHA 2ONKA 2W6JA 4ACAA 3PG5A 5CJ2A 1EFHA 4TZ0A 3WYFA 3B1XA 5B57C 3ADCA 4QKQA 1EGAA 2RGBA 1II8A 3GLHE 2HCBA 2V9PA 2BC9A 3QNUA 3JVUA 4R98A 3QBTA 1FL9A 3TUIC 2GAAA 1KJYA 1TF2A 1Y63A 1ZUHA 1VYTA 1XEXB 5LD2C 2RGNC 4Q9JA 2CNWA 3W5JA 3FMOB 1UEJA 3NH6A 1C4OA 4EQ6A 1CJTC 1KAGA 1YHNA 4DC9A 2BBTA 3R9IA 2DFLA 4DCTA 3C5CA 4PO9A 4ESVA 3VHLB 1LFDB 1OFTA 2ERYA 1GRNA 1QF9A 2WJVA 2WKQA 3RRZA 3DHWC 1GITA 1J8MF 1Q20A 4HB3A 2CLCX 3A4MA 2P5TB 5C4MA 4NL4H 1GUAA 3SJAA 2ZJ2A 4C7OA 3KUDA 1T3LA 1DARA 2DFTA 4DEXA 4B3FX 3E70C 5AUPB 3AF0A 5JSZA 1W48A 3K0AA 1T8UA 4AYXA 3IIJA 2G9NA 2V55B 4LX0A 3DM5A 3OHMA 1R8QA 1YZKA 2P65A 1KIMA 1DAFA 3PITA 4DZZA 1NNEA 2X1VA 4IDOA 3WYAA 1GZSA 2JLZA 1WBDA 2NZJA 2ZJZA 3QVVA 1W49A 2F3TA 2QBYA 1LF5A 2ZR7A 3GJ7A 3N2IA 2CHVA 5FBRB 2QEQA 3VHXA 2WICA 4AG6A 2YINC 4XOIA 4US2R 1NMYA 2JJ8A 4Q4LA 2CHQA 4TWZA 4M1KA 3BORA 1MABB 4HDOB 2CEAA 2XSZD 2GCOA 3GJ0A 4OHWA 1S1MA 4EPVA 3RRNA 4Q19A 2C96A 3NKVA 1GDDA 4K46A 4D4LA 5AUOB 1W2HA 3BFVA 1FX0A 3CIOA 1YR7A 3P26A 3KQLA 4Q7LA 4BLPA 2O8CB 2GTPA 3REGA 1L2TA 4HAWA 2W6ID 4PHTA 4WVFA 3BB3A 1ZM9A 2GBLA 1CEEA 4JIMA 2PH1A 2WPDD 3RS7A 3EZFA 1SXJD 3PR1A 1LF0A 2GBLC 1ZVQA 3H4MA 4PPGA 2GXUA 4ASUA 1U2RA 4DUGA 4DHEA 4Q9LA 1PJRA 1P75A 2QU8A 4CZ2A 1NSTA 1NN5A 2C95A 4B2PA 4TQUS 4QHSA 2YJTD 2QM7A 3BBPA 5AK0A 1IM2A 4B33A 4FCVA 4V0KA 3LLMA 2ZSFA 2IWHA 3LWNA 2AK3A 4FCTA 1YZUA 2GZHA 3QPVA 3TSWA 1CBUA 1UBEA 3EG5A 4B47A 3OESA 4E03A 1QVAA 4EJSC 2FE4A 1M7BA 1W44A 3DPUA 1W4RA 1E2QA 3C4JA 1AJEA 1A2KC 2EFEB 4GP7A 2EFDB 6Q21A 2HT6A 2RB4A 5JEDA 3V00A 1G8FA 2EVWX 1SVMA 2HV8A 1IN4A 3GLFA 2ATXA 4A2WA 3ND9A 3LBIA 3THXB 1L7VC 3C14C 1HT2E 2OUKA 1OB5A 3BB4A 3K8YA 1NN1A 4LY6A 3BGWA 1JJ7A 4QG7A 3S1AB 4KFTA 2ZS7A 3I8XA 2JAQA 5GVRA 3B78A 5CDFA 4CEHA 1VG1A 4P31A 1E79A 1T5LA 2GJKA 1KZ7B 2J5XA 2W2VA 2QTFA 4AY2A 4ZCMA 1S3SA 4LJ6A 1Z8FA 3FMIA 1IONA 1SHZA 1ZNZA 5DI3B 2JLYA 4KLZA 3FHOA 3KX2A 3L0IB 3QIAA 4TMTA 1LV7A 2OCYC 3QKRB 1P4SA 4P0TA 1AKEA 4Z1MA 3O8CA 5FR2A 5DYIA 1W0KA 1Z5ZA 4TYQA 5SZJA 2ZU6A 4LJYA 2DFNA 2IYUA 1BIFA 1EFCA 4LYJA 5JI2E 1KJZA 4MRPA 1VCMA 3UWKA 1KI3A 3DOEA 1O3YA 2W2XA 1G64A 4OI2A 2QG6A 1YRAA 1Z6GA 2WAXA 4GMDA 4FINA 1IN5A 2Q9AA 5FPSA 3QVUA 5B2ZA 1P2UA 4C30A 1X86B 1SVOA 3TVTA 2CK3A 5TVKA 4AYWA 2AWNA 1ZP6A 2GVDC 1KDOA 2CXXA 3ZVNA 4TYNA 5FR1A 2ZUBA 4XVRA 2XNDD 1NJGA 1QHNA 2PEYA 4CF7A 4LCBA 2NO9A 3V9PA 4KAXA 1B0UA 4L5BA 2HUPA 1Z29A 4BRUA 2C99A 1KAOA 1W0JD 2NTYC 1GIAA 2W00A 4HDCA 2WM9B 2CLSA 1W1WA 5EP2A 2WV9A 2O0KA 3WBKA 1XJ0A 2ODWA 5LD2B 4URUR 4MH0R 5L3SB 1LY1A 1GNPA 1NLYA 2F9MA 4WZAE 4QGAA 2F9LA 1XXHB 3SJZA 5TARA 2B21A 2ZI9A 4EIWA 3E2IA 1K6MA 2AHOA 4HLUA 1LS1A 2P6UA 1QG2A 1SVWA 4B3BA 2J0UA 1UEIA 1Z6YA 4YMVA 1W4AA 1E3MA 1NLFA 3KXKA 4LHVA 2OCBA 4IOKA 4HYYA 1E9CA 1KDTA 5FPYA 4PAOA 4URZR 1GM5A 1NIJA 4NKRA 1COWA 1MRNA 2QAGB 2W6IA 1U90A 3TIFA 4B3DA 1N6HA 1ZC3A 4PHHA 4UNPA 1OXVA 4CVNA 3TBKA 4DKXA 3LX5A 4FN5A 1HEIA 2OSBA 4MGZR 4TT3A 4ZDKA 1JEDA 2W6JD 3ONWA 1E0KA 2MMCA 1KI2A 5K8IA 5H68A 1G5PA 5J40A 1Q3TA 1H8HA 1G7CA 1MR3F 2HLDD 3T5GA 4BWYA 1Z63A 5KUTA 5EE5B 1BH2A 1T0JB 2IX3A 4C0BA 4GPTA 1K5DA 1XF9A 2A5GA 4IOMA 4IRUB 1JR3A 3KB1A 5EUMA 2ZIAA 1EFRD 1X3SA 3OEHA 3OF5A 3S1AA 1N6LA 2BM1A 5L3VA 3BH0A 2HJGA 2EQBA 2RGCA 5EXPA 1IN6A 3BWDD 4RZ3A 3C41J 3TSZA 2CE2X 1P73A 3R9XA 1XP8A 2J7PD 2XNSA 2GHIA 4E07A 3LD9A 4PX9A 1XMIA 2WMNB 3QQ5A 4D25A 2QY9A 3WRXC 4KO8A 1AA9A 1NI3A 2E1RA 4I81A 3W3ZB 4PC2A 5IRCD 1UPTA 2ANCA 1EX7A 2FH5B 3BIFA 5BN3A 1BS1A 3LQRA 1E2EA 2QRNA 1NBME 2V6JA 2DFKB 3C15C 1XTKA 4R9UC 4OQFA 1F60A 2XAUA 1VCIA 3NBXX 5KYKA 4L8GA 4HLDA 4NYIQ 1BO6A 2ZREA 3SI7A 4Z8XA 1ZJ6A 3VX3A 1NG9A 1XPOA 4XWOA 4D0GA 4QL3A 4LJ4A 4YMTA 2YC2C 4ESHA 2FSGA 1BMFA 2GEDA 3IILA 1MT0A 2REOA 3L82B 3DO6A 1AQYA 2FG5A 4KV9A 1WA5A 3D3QA 5FOXA 4A9AA 3QSYA 1UKYA 1XZPA 4B3CA 2QSYA 1E2GA 1W46A 3HWSA 3T1QA 3GLIB 4GNKA 1E99A 2PT5A 1CS4C 3GEIA 5EP4A 2JJ1D 4OI1A 3W6OA 3AF3A 2A5JA 1G18A 2V7QA 3U7GA 3A36A 3QBVA 3DL0A 2GZAA 4B71A 2AD1A 2HJVA 2YVUA 4LV8B 4D26A 3AV0B 2JLQA 1MO3A 5CYPA 1CRQA 1Q22A 2RGNA 2RGXA 3TJZA 1OYYA 4JL6A 4H1UA 4KSBA 1XEWX 3MGCA 2A7QA 4MKHA 1MRSA 4IVPA 5A4JA 5FOTA 1XTRA 4KU4A 3BD9A 4EFMA 3B8HA 2NPIA 4GZMA 4LBWA 2XGJA 2IYTA 1XFAA 1S0UA 2ZRNA 4OHYA 1Z0KA 2F1HA 1W0JA 2FFAA 4MUBA 4DWJA 2OFOA 1VIYA 1OF1A 3CBQA 3ECCA 3RRYA 1ODFA 1NBMD 1IN8A 1CR1A 1W2GA 3RC3A 4FWIB 5H70A 1KI9A 3RHFA 1Z0FA 2PX0A 1SKYE 3B5JA 4LYHA 121PA 1YE8A 4PHGA 5AJWA 4YC7A 4Z51A 4UJ5A 4IXMA 4XTRA 1SGWA 5K8UA 3DZ8A 4LJ8A 4C2UA 4Q1CA 1DEKA 1Q1ZA 3EC2A 3LDAA 1TQDA 4O2LA 2ZRPA 2FEOA 3D7MA 4LZZA 1NSFA 2Z4SA 2Z0MA 4PTLA 4B44A 4X8LA 3SJCA 3OAAD 4YMUA 4RD6A 2CCKA 2OT3B 1N5LA 1IOZA 2P0EA 4KVAA 2JLUA 3HU3A 4M9XA 2OBMA 1GG2A 3P27A 1QHSA 2IUTA 2IYQA 1P5ZB 2QGNA 3KL4A 4DDUA 4IFBA 1S9HA 5P21A 4ARZA 2IYWA 4CEIA 1RJ9A 3THYA 3ZDQA 4IDQA 2P5SA 4PPNA 2AKAB 4FMDF 4YMWA 4PR0A 2BCGY 2QTHA 1EXMA 2VSFA 3EX7C 5EP1A 1UFQA 2JDIA 3TRFA 3QKSA 4I1SA 2ZROA 4HLQB 4I1OA 3EA5A 2X77A 1EFUA 1WDTA 1XRJA 1BYIA 4DLTA 3OIWA 2XOKA 3B1WA 5JS8A 3TKLA 3TGPA 1EWRA 3AVYA 3QJYA 3AH8A 4Q4AA 1KO5A 3IDQA 1V43A 4RZXA 2VA8A 3CWQA 4UNRA 5FUWA 1OXTA 2LWIA 4NYMR 3D31A 3ZZ0A 4LOAA 2HF9A 3U7HB 2NO0A 2O8BA 2FJUA 3CH4B 1T6NA 4RCZA 4TMXA 3EARA 2IS1A 3EASA 1P2VA 2JIZA 4UJ3A 4LC1A 2FFBA 5AR1A 4CRWB 3FKQA 2DYKA 3MWKA 1XJQA 4BFTA 2IT1A 3PUZA 1T9HA 4NCNA 1Z6AA 3SJBA 2ERXA 1L8QA 4PAMA 2QPTA 3K70C 2WWGA 4NCJA 4ACBA 1XWIA 3A6PC 4A0RA 1BMFD 3ZS8A 3U44A 1GL6A 1ZNWA 1VMAA 4B6EA 4C0LA 2VHQA 1OJLA 3AEZA 3L0SA 2AD5A 2EYUA 4D2IA 1DOAA 1ZD8A 2VSXA 5EP3A 1D2EA 1TMKA 1AS0A 1NL3A 2Z5FA 2YOGA 4RKFA 4TLDA 1Z0IA 3ASYA 1TL7C 4U02A 3SYLA 3L0PA 4CYMA 1DVRA 4BLOA 4RD3A 3U61B 5JJLA 4MKGA 1GFIA 3KJHA 1Z83A 2AFIE 5AJYA 5JMTA 3U3JA 1ANKA 1GKIA 2HXYA 3GD7A 2O0HA 1N6KA 3WMEA 1SXJA 2DCUA 3NEJA 3ICEA 4BPBA 3VU9A 2EFCB 1ZM4A 1K8RA 4JVLA 3K0CC 4JVSB 4YMSA 4FMDB 3TLXA 4B6FA 4B73A 2RH5A 2CJWA 4JLKA 4FIDA 3V4FA 2ANBA 1CF4A 1DADA 1HQYE 2XB4A 4XSGA 3GLFE 2AWOA 5DO9A 2GA8A 4DDTA 1JNYA 2AK2A 2Z43A 5EQTA 1VPLA 4PHFA 4BFZA 2GXAA 3TUZC 1G8HA 2FSHA 3BE4A 5KNDA 3KFVA 4CEHB 2OXCA 3SOPA 1R8SA 4G5GA 4AKHA 1GILA 1ZW6A 1KK0A 3AF2A 3NHBA 4HB2A 1DG3A 3CR7A 3K1JA 3LAWA 3VFDA 4FD2A 3OFND 4ZO4A 1E0SA 5EE9A 2IYLD 1KK2A 1G20E 1OKKA 1ETUA 1M7HA 2QROA 3QKRA 2ZPTX 4A4DA 5DN6D 2BBSA 3W6PA 4XVUA 5FUVA 2B7CA 1KKMA 1WCV1 3UANA 4C0HA 2OXRA 4KVGA 2Y8EA 4CEIB 3WRYC 4Q66C 3CKLA 1H8HD 2HLDA 1BYUA 2C98A 4D4KA 2PZGA 4FMCB 3HJNA 4GL2A 3WNBA 1A4RA 2D7CA 3CH5A 4V0MA 1QHGA 2OLKA 3W9YA 4FW9A 2G3YA 4LBZA 4UNNA 5JRZA 2FA9A 1OFIA 4RJLA 4C0SA 4K8OA 1E6CA 1KSGA 2UZIR 3AP2A 4DB2A 3A1VA 2FDCA 1SQ5A 3K9LA 4UNSA 1U99A 3VR3A 3H2YA 4P4SB 4PANA 2KSQA 4BFUA 4P4UA 3LFUA 4NCIA 5EXXA 2O8DB 2O8BB 3MCAA 2Q3MA 2G0NA 2I3BA 4Z1MD 4Z54A 2GILA 2NO7A 1N0UA 4Q47A 1KNQA 3DDCA 5IT5A 1SZPA 2X8AA 4LC0A 2ORWA 2O0JA 2P6NA 3GLHB 3HYRA 4MGYR 4QXAA 4HLUC 3GLIA 4QJ4A 1QRAA 4E5UA 1G4UR 2IHYA 3TW4A 1D2MA 2REXB 1XXHA 2XJ4A 2XEXA 3IO3A 2IUUA 1FNNA 1Z47A 5AJXA 4JLPA 4TSFA 1FQKA 2OAP1 4M8NE 4PQYA 3WMGA 4A1FA 4LDJA 2ORVA 1C9KA 1OLOA 2XOKD 4Q1EA 3PUWA 4ZDJA 4R2HA 3NDBB 2C04A 2ECKA 4BFVA 4HB0A 2IXFA 5E4FA 3AVWA 1MH1A 3I5YA 3EIEA 4EDHA 3ZZUA 2DY1A 4MRRA 1N2CE 2JLXA 1ZD1A 2W0SA 3GJ6A 3L43A 3RSOA 1ZU5A 2E9SA 4LJ9A 4B2LA 2O8EB 3B13B 3THXA 2CHGA 2BDTA 2V3CC 2K5UA 4LJ5A 4M9ZA 2J0SA 5LDDC 3M0EA 1E2IA 4DLXA 4A82A 3EIHA 4QBHA 3AKDA 3VU9B 4FXPA 3QF7A 2PT7A 2AL7A 4LV6A 2J41A 1H8ED 1P9WA 2IYXA 1SVKA 1NY6A 1YVDA 3PXGA 1HUQA 1M8PA 1E1RA 1KSJA 2FMXA 3EPHA 1G6HA 3L2OB 1M74A 2OG2A 2R62A 2ZRFA 5FTJA 1ZM2A 1W47A 821PA 2AKYA 3AVPA 3HDTA 3LBHA 3VX4A 2ZRCA 2IK8A 2ZTSA 1KMQA 3RDPA 1GOTA 1CR0A 1XZQA 5DH9A 4A2PA 3CRRA 1Z07A 2WWWA 5BWMA 1RKBA 4BZXA 1IXRC 1E9AA 1GP2A 2R6AA 3K0FB 3K70B 2IYSA 4M22A 1XDBA 2CL7X 4K81B 3IUYA 3QKSB 3UMRA 4PQFA 1EESA 1T0HB 2DWPA 2IXGA 2XJ9A 3QF4A 4Q9HA 1CJMA 4RFSA 2WWIA 3CW2A 3LVRE 1BKDR 5AJZA 4A92A 4EPWA 3FMPB 3ZJYA 4NCKA 1T3SA 2XZPA 1LVGA 3JZMA 4OKSA 4EFNA 3C5HA 2ZE6A 2Q21A 3FHCB 4RFVA 4R7ZA 3B9QA 2F6RA 4OJKA 3SU8A 2RGGA 3UATA 3UXMA 1KO7A 2FOLA 3FPAA 5DYGA 1TQ6A 2XZLA 2NO1A 2JLWA 5CLLA 1R5OA 1NG1A 4LHXA 3T12A 1G7SA 2WZQA 4P4SA 3LW8A 4CW7A 1UKEA 3WP1B 3WHKA 4CDGA 5UKDA 4C0KA 2O8DA 5CJPA 2IYYA 2C9OA 2GCPA 2GJAA 2QUZA 2D74A 3C7KA 3H86A 4ZKDA 1DAIA 2IS6A 1ZRHA 1J2JA 1FUKA 5FI0B 3VR4A 4UXJA 5JS7A 1J7KA 1PV4A 1ZM7A 5FBVB 3VAAA 2EWVA 2PZEA 4D82A 2ZVPX 4O25A 1S9DA 4IEEA 5FBQB 3SQXA 2BMJA 1LW7A 3QEJA 1ZAKA 3UIEA 4QFMA 2GJ8A 1TNDA 2UKDA 4EAQA 4PZLA 3F0TA 5KNCA 1JJVA 2D06A 3QUSA 1GAJA 1I4DD 3GFPA 1U8YA 1KI4A 4W5WA 3K0EA 1GKUB 1A2BA 2R8RA 1SKYB 3GFTA 4FI3C 5FH9A 5F98A 4HB4A 3K70D 1G3IA 1ZD9A 2O52A 3A1UA 1G19A 3K09C 3VR5A 1FP7A 3W90A 4EQ6B 5FPKA 1YZTA 1IBRA 2EWWA 2BEJA 1SULA 2QENA 2VHTA 5IDVA 4TZ6A 2J0QA 1OIXA 1E1QD 1G6OA
chains in the Genus database with same CATH superfamily
1Z3IX 4L3OA 1INLA 4P4TA 4I1PA 3UO8B 4LDRA 3T95A 1A7JA 1TO2E 2YJ5A 2B5WA 3PNVA 4G1EB 1Q7RA 3ED1A 3H99A 4XUGB 5C7YA 2J32A 5BV0A 2QB5A 2X19A 3ZVMA 4ZV9A 2C1EA 2FZGA 2L19A 3KUCA 3N28A 3QUBA 3QUQA 4GL4A 1W73A 4GXTA 5EAIA 3ZHVA 3FTFA 3CNEA 2P4HX 1VJTA 4ZVTA 4I8DA 3R9XB 3G2IA 3E2PA 5M5BA 5FWAA 3CH7A 1CHDA 2XMGA 2JGEA 1RC0A 3NV9A 5MN5A 1CE8A 2HU2A 4JLSA 4CUKA 1NY5A 3L7JA 3BJMA 1M1UA 3JVEA 3STYA 1UWLA 1B4DA 3STUA 3Q9SA 4YRGA 4IM7A 3B6MA 3IGFA 5HCNA 4U3JA 3FKSD 1KI1A 3BD6A 3O2SB 5HUQA 4DNXA 5LOVF 1DTSA 3ZNNA 3BQ9A 3WMRA 4P7KA 4U9UA 2CW5A 1S7GA 3KFXA 5HUJA 3R7WB 4YYZA 3JQFA 1U0SY 3T61A 2ZUCA 4J1QA 1PEKE 4LJSA 3O9VA 5TT1A 3SE0A 3A6KA 4LA4A 1BA3A 2OE2A 3LIIA 1VQ1A 4WKNA 4D56A 4JXXA 3IURA 3QQPA 2AR0A 1T9BA 2O2DA 4JEIA 1LBIA 1YGYA 2QPLA 2WIJA 1PJ4A 2AJ8A 2PLFA 3CX6A 3QKWA 4NH4A 1KFCB 1NWHA 1Q0PA 2HZBA 1U5CA 2F4VB 4UU1A 1ZR4A 3AKEA 3PLNA 4B4VA 5FUQA 1TYBE 2ABWA 1XRNA 1TTHA 2R68A 2VEDA 1RACA 3EAGA 4EI8A 4GSLA 2XBMA 4QDUA 3FNHA 1TZKA 2R47A 4N49A 4PG7A 1QGDA 3UGQA 1KU0A 4FHGA 3WFJA 1RRPA 5E6UB 3QMWA 1WCIA 4HH3C 4AZVA 4XVCA 5JC1A 2V6IA 1UMBA 4BNMA 2F59A 3I2FA 2OB2A 4IIUA 2A4KA 4KGDA 4Y0VA 3X2EA 1EA7A 1W5EA 2RH4A 3N2GB 4KQHA 5JNVA 1S01A 3KEMA 4Q3KA 5CLIA 4DGSA 3OZXA 5CFZA 5H59A 4KACA 2VZ0A 4X60A 3QPWA 1XMVA 4DMGA 5BY2A 1B2LA 3HR4A 1IBMB 1TQHA 1VP3A 4BAGA 2V8OA 4GZLA 4MPRA 2WSLA 1U8UA 4ZKEA 2PPVA 5GIPE 1FQWA 4Y67A 4UM7A 4JQYA 1NAHA 2QE6A 5I9BA 2IS2A 4LPKA 5ALXA 1DPFA 3HN7A 3FHTA 1SK9A 1UCFA 2HL6A 4OMUA 1ORVA 4AKGA 3A7DA 1XIVA 1WAMA 1ZH0A 1D9XA 2R96A 4WZBA 1NJ2A 5CA0A 3M33A 1HT3A 2PL9A 2R2AA 2BFNA 4CKWA 3F4BA 1Y98A 2W6MA 1PO7A 2QG4A 3MERA 4G0UA 3EIXA 3EQ9A 1U2GA 1S5PA 3IUBA 5KDLA 4CDNA 3JQBC 2YWBA 4C9BA 2D2FA 2YRXA 4IUYA 1BFUA 5CU7A 4ZHQF 1AUXA 3H4TA 4L4YA 3HFSA 5IJAA 4LY9A 5DNUA 3JWGA 3IXLA 3SX2A 2MYUA 1QCCA 1EU1A 3I05A 4BS9A 2WSSA 2FF7A 1ZHHA 3I9KA 4IKOA 3ID6C 5A5EA 2PAAA 3UHOA 3AINA 1Q0TA 3K94A 5BORA 1X8LA 3ESZA 3WGJA 3JXEA 4U1RA 1K68A 4OYHA 4ZCLA 3PDJA 1XXLA 3V8PA 2FEPA 3ZEAA 1X7DA 5BWNA 4Y8VA 3BD8A 2GA9A 1SOWA 4IZOA 4ALIA 3KQUA 4AJHA 1Y8RB 3LWBA 5B5SA 3I6YA 5I9TA 2B99A 2WK1A 5C18A 4G9BA 4L28A 1S3GA 2PGIA 3BRSA 1H2HA 4WGGA 3ZQKA 1N78A 3GHYA 1XRSB 3JATA 4EG3A 2I7CA 2OWEA 4ARZB 2ZI3A 1HT1E 4UU7A 1C1YA 2IXDA 3QTBA 5K0CA 3L3BA 3E3OA 3ZU3A 2HPVA 4RTQA 2VH5R 3LK6A 5BSFA 1ZGHA 2P68A 2W22A 1FDVA 3T9DA 3KV3O 4EGQA 3V1MA 4ETWA 4MJLA 3I04M 3C43A 3I30X 4HY3A 3WGKA 2W2TA 4U39A 3NRJA 3FPHA 3P2IA 4MS3B 1Y80A 4O2AB 3S2IA 5JAMA 1EVKA 4J8PA 2XNDA 4K9NA 2HU7A 3OOYA 4Y6GB 5LLDA 3A58B 5L40A 2JLVA 3PI6A 1ZL2A 1CUFA 1HE8B 1JAXA 3KT3A 5ULLA 3M2TA 2JD0A 3NC4A 1E1QA 4JBHA 5LWQA 2IYAA 1W75A 1LK5A 1Q7BA 2OM6A 3IDFA 1UXIA 2VJKA 4H1VA 4LN1A 2BHLA 4KPGA 4O5OA 1IMOA 2C9BA 1KJWA 3A25A 4V0SA 4ZANA 5JHHB 1MAUA 3QWHA 4O4JF 3REFA 3UGJA 2GPNA 2RH9B 1IDOA 2W42A 2YHUA 3IYLW 4CMIA 1GR0A 2V7UA 1JI3A 2M32A 3GJXC 5G1PA 4A23A 1P4GA 3VVMA 5EXTA 2MT9A 5HKKD 1IUNA 2VJNA 4HCJA 1MA3A 2AN3A 1YR6A 5EIBC 1FX1A 3SDSA 1OR8A 4M36A 4FLMA 5KTYA 5HRUA 3WQSB 3K71B 1KK3A 5HBGA 3HY3A 1A4XA 1T9ZA 1P7CA 3QSGA 2CYCA 1DL5A 2H00A 2GVZC 3NBZC 2QZJA 3NEAA 5TV2A 3HCOA 4LNUB 5FNVB 5HZMA 1BH6A 1MMFB 3LX4A 3CLSC 4EYQA 5DASA 4WKCA 2L2QA 4YXWD 1MT3A 2F3UA 5EKUA 1RYMA 4QHTA 3R7SA 1AQUA 2JASA 4HJRA 3G2MA 2VPPA 1JDZA 2WJWA 5JYEA 3GFRA 4S1TA 5IKPA 3I0ZA 1P2SA 4KEAA 2DBRA 5DX1A 4HS9A 5B3KA 1LDYA 1QAQA 2GWRA 3UAVA 1W36D 2YWCA 4V39A 3WWZA 1W5FA 1Z74A 5L7WA 1V9SA 1S96A 2GOYA 2CFRA 3DFFA 4Q15A 1CNMA 1F2TA 5KOYA 1EFKA 4HNUA 3THWB 3FXAA 2ZQ5A 4TLMB 4G97A 1B6TA 1JJAA 2QYOA 1OXXK 4NZ9A 1YOVB 5C3MA 4YAUA 1KJ9A 1ZX1A 1RKVA 3FCYA 2ZDQA 3IPYA 4NC9A 4AZ0B 2OYSA 4CKBA 4B6PA 1XXHE 4IDCA 4FNOA 4OB7A 4D5EA 4I99A 3OCXA 1SZDA 4HHEA 3G9XA 1E2JA 2CDNA 1FP1D 3GGDA 1TFUA 1MJNA 4DT1A 3L1JA 3O90A 5IVDA 3P0IA 1UBJS 4FDUA 4RV9A 4GKJB 1SBCA 2A5DA 2IPMA 2RBKA 3NHSA 3H6GA 3EBPA 2QA5A 1P2BA 4OYLA 3RLFA 1KY2A 5CXSA 3WLMA 4D8UA 4F5EA 2FPKA 1GGNA 3QELA 3L1VA 3Q7TA 4UCXA 5C7IO 3C97A 4FMCF 1Z26A 3AEKB 4WBSA 4TKUB 5JCJA 1TXGA 3OX2A 3V8VA 4MPDA 3WJ2A 5DU2A 4WOJA 1TX4B 3LV8A 4A26A 2FEMA 2XUFA 1OYWA 1MC8A 3KOUA 4CMJA 1L8LA 1AHHA 5HE9A 1PL7A 2V6GA 5CK4A 4ZCSA 1FLAA 2JB9A 3GARA 4HAYA 2MR6A 1F3OA 1K27A 1QZZA 2UAGA 5E7IA 5EQFA 2E2WA 1NPYA 1YWGO 4AWXA 4UQLA 2A0UA 2HLHA 2BKUA 3OZFA 4MEBA 4OYYA 4WDRA 5COBA 1IAVA 2IQ5A 1KDRA 3MTJA 4FS8A 3ETHA 1ZK2A 5HCIA 1H2XA 1U2QA 1H3NA 1TW3A 4Q48A 4QVGA 4BFXA 4BUCA 4MQ5A 4DMMA 4IVRA 4RQAA 5FQNA 1YTUA 1G66A 1P5JA 1H8EA 2WRZA 2I1QA 3EXFB 1W4CA 1WCWA 2DJIA 3A3PA 4MW2A 4TKZA 5EHNA 2PO5A 3EG9A 4I1UA 2ATIA 4MPTA 1NW6A 3A1WA 4Y6OA 1G17A 2QVZX 4WLFA 3GJ3A 1YB2A 4RMJA 3FWHA 1O6FA 1LWOA 2ODNA 2VUSA 4YNBA 3C6BA 2Y1XA 1Q7TA 1XU4A 3CVYA 3BFPA 1NPTO 3PGVA 1N9ZA 4BVGA 3GELA 3F8TA 4J0KA 1XDSA 2C42A 4JLJA 1VRVA 2FE1A 4H15A 3NXSA 1QIGA 2GEKA 1GR1A 1GA4A 4HDSB 1V35A 3FWPA 3KVVA 5A71A 3L6RA 3ZD7A 1K7YA 5IK2A 1B3BA 2PANA 5T57A 1LSJA 1ZGBA 4II7A 5E7JA 2AOTB 1YU6A 2BHTA 3L8YA 4IVNA 1SQ6A 2IP4A 3TBHA 3DMNA 4CLRA 1AK1A 1QTRA 3C6YA 4XVQA 4GBMA 1IXZA 3FUWA 2REQB 3F9RA 4NZMA 2W8BA 1U0LA 3H9UA 3QU4A 1GPUA 3SX4A 4L6CA 5DTRA 3NNSA 4RGBA 4XDZA 4H7JA 1RZUA 4RABA 1ZN9A 4K26A 1ZIDA 2QX8A 3SXPA 5EIAA 3DZGA 3RTGA 2D0OB 3BA1A 3UNXA 1GPJA 4DE5A 2NM0A 1SUCA 3M5CA 2Q6IA 4HDQB 4QGHA 2H1OA 2BRUA 4HTAA 3TTVA 1XL0A 1C4WA 2BMEA 5FPQA 4QVIA 1OPXA 2WAOA 3BJIC 5KHAA 3DF7A 4QDTA 3X2SA 1DKUA 2RKOA 4YDHB 3CBGA 3A2KA 3GZ4A 4BAUA 3WA7A 3MSXA 1LNZA 1MX1A 2BM0A 2QTVB 4PC7A 1ULUA 1G4AE 5HKKA 4URYR 3TQHA 3PHHA 3FZYA 1QZUA 4UAGA 4X85A 1M8KA 5AHKA 3K2IA 4G56A 4P53A 4WL0A 2NLOA 1WZCA 5EXSA 3U44B 3QI2A 3R5XA 4TS3A 2TMKA 1K75A 4IPTA 3RC2A 4YIKA 2ZSBA 1JXOA 2H2FA 3DBLB 2RC6A 1E4OA 4Y2HA 2VO1A 3RH0A 3W8EA 2BP7A 2D0IA 1RMTA 2GPWA 2XBUA 3RSLA 2P41A 4C1NA 2VQ3A 3KJEA 2AC2A 1L6IA 1O95C 4K6OA 4CLEA 3IBGA 5IC5A 4YXWA 4F1JA 1QQAA 1KFJB 2ODAA 2CE7A 3LECA 1C9NA 4B43A 1L5VA 1VG0B 3IBYA 2A9FA 1ECCA 1QG4A 5CVEA 3RSQA 4D9BA 2A9VA 3B6IA 4JH0A 4HGPA 5CVCA 5IJZA 4HNGA 4IQGA 2YJ4A 1XYGA 2BFEB 1ORTA 4AY4A 5ALIA 4HAIA 3B6KA 2OLJA 2FETA 3RS0A 1XMSA 2QJFA 4QULA 1KC3A 3ZE7A 4H6WA 4E5KA 2BTQA 4FE3A 4UBIA 3IAAA 3QE4A 2W4IA 4D96A 2J6CA 2X41A 2C8VA 3ZY6A 4NCXA 2DB3A 2YWGA 4TXHA 1LTHR 1PJSA 2W43A 2IEBA 2ZBDA 3OICA 4YLGA 2LCQA 3DDUA 1QH1A 1L7OA 3QUAA 4LI3X 4JI5B 2PZBA 3FRJA 1QHHA 1WCYA 1YJBA 1MW8X 3JARA 1PWYE 1C5KA 2Q2OA 5TMEA 3TIIA 4OI0A 5FOUA 3M5DA 1ZD3A 3MYYA 4X93A 4DVJA 1AMUA 1HZZA 4PBRA 5ALHA 4DDHA 1T26A 1N6NA 4I9NA 4MWSA 1EVIA 1D6MA 5H3HA 4OY3A 4LYGA 1KH3A 4JUDX 3L8ZA 3OQIA 1MX5A 1AM4D 2LVBA 1N3LA 4PCUA 1RW4A 1W8IA 3EW7A 3F5FA 2WM2A 3PDIA 3NLLA 5D3QA 4CM4A 3EXFA 2VPZA 4YV0A 2Q1TA 3B9PA 4OQPA 1E2BA 3QH4A 4MS1A 5AK6A 1MVOA 1UDBA 2I1LA 2O3SA 2P1DA 2ZRMA 4NARA 4UPDA 2IEAA 1NMXA 2XQIA 1X7ZA 3OJEA 1FZQA 3C8ZA 1N5DA 1M0EA 3AO0B 2BEKA 3HB7A 3DKVA 3QE0A 4HAOA 1P1KA 3REQA 4UC0A 1BXRA 4TMFA 2CLDX 3FKSA 5ESDA 1PJLA 1ZYUA 5G53C 1ISIA 3LBNA 1ZNXA 5CRIA 5EA2A 1U7DA 1JH8A 5D00A 4PSUA 3A9WA 1HLFA 3SZRA 3RK1A 3RIXA 4DLPA 1ZAYA 4MRVA 4RNCA 1L5HA 3ND6A 1N9GB 2AEJA 1NMEA 4MA5A 2XB6A 3ZX4A 3LH5A 3ZR4B 2F2TA 2P2GA 2POQX 3RVKA 3WGTA 3WKDA 2P78A 4DDKA 2PSJA 4IIVA 1MA0A 3Q0EA 3ZI7A 4ZVMA 1I32A 2KB0A 4JC8A 1E62A 1OYOA 1Z12A 3GCZA 4UUAA 5IASA 1B0AA 4RKQA 2C9ZA 3IHLA 2BT4A 4L6AA 5KQPA 5IXYA 4PYIA 4XSHA 2Q8PA 4QFDA 4BEBA 4QRHA 3HLTA 2IH5A 3AFHA 4QOIA 4M60A 5CVTA 2FZ5A 1R5JA 3C3DA 3D8TA 1V45E 1Y34E 3AESB 4OH1A 5CT6A 3H1TA 5D87A 3P7MA 5AW9A 5DBGA 3FD8A 1HDGO 2AOUB 1E9RA 1DZ3A 1W5TA 4GAEA 1ZD5A 2CWDA 1GZVA 1NUPA 2YR0A 4BZWA 3KSZO 3F6PA 2IDKA 1L7BA 2QORA 5TJHA 3OTOB 3FDZB 3R0VA 2CF6A 2YTZA 3SE7A 5C1BA 1E8DA 3FZQA 1O87A 3TMAA 1J0XO 3OUZA 2V54A 5DWDA 2WFLB 3RB8A 1VZ2A 2F62A 4O0MA 1JH9A 1IJEA 2EEPA 3HU2A 3H9EO 5ALUA 5ADHA 3OEEA 4L07A 5GP1A 2Q7DA 3T15A 4I08A 5JBQA 3BCUA 2BHNA 3WBJA 4D57A 5M7EA 3FI0A 4P4GA 1W94A 2R65A 1Q57A 5CFQA 4HAZA 4DUZB 3WS7A 2PYZA 5JFGA 3GLGB 1Z22A 1VLZA 3KOOA 1XZFA 3OC0A 1Z5NA 1SK8A 2Q9CA 3L06A 4M1SA 4UCQA 5JG7A 1NVVQ 2VP3A 1NXTA 3N3BC 2AE2A 2H92A 3FCEA 1W5BA 2CL6X 3ITNA 4A0GA 3QE3A 4C04A 3PQEA 3DZCA 4Y6SA 3TAUA 2BAGA 4D9FA 3MLEA 4I36A 5HJ5A 2MIIA 4ER3A 2OCDA 3A31A 2G6BA 5SYMA 3ULKA 3ZI0A 5KJCA 2XT6A 4OXRA 2ZYGA 1OASA 2VJAA 4LSGA 3RBXA 5HXAA 2FSVC 2H8KA 3FOCA 3HEBA 3U9LA 2QZSA 2C78A 4G0MA 4MVYA 4BNYA 3KHKA 3TECE 2X3FA 3Q8XB 1EFVA 5CBPB 1JU3A 3TLGA 1Q84A 3FCCA 3ZJVA 5IVHA 4MYHA 1SN7A 1V11A 2YHAA 4M76B 4QX6A 3RASA 4F21A 1CZOA 2F7SA 3CZRA 5KKCA 1L4EA 1NP3A 1B42A 1GKYA 3EEFA 2QP3A 4QHYA 4AJEA 1II0A 2FRDA 1XVIA 2GO1A 3K0AB 4GOJA 1V2GA 2I33A 1ORHA 3E9CA 3DAPA 1A50B 3TO5A 1JG4A 1TKCA 2IZ7A 3ZCSA 4HZUB 4C21A 4QBGB 5J4KA 5JZBA 1BE8A 4KPFC 2EBFX 4UBLA 3NOOA 3LJKA 2G9ZA 4K3UA 3V7WA 3WK6A 1M1ZA 3KOWA 3PA6A 2HCTA 4JBXA 2QN3A 1C0KA 4NONA 4B9AA 1BZYA 5BRJA 4DCNA 4LF8B 2MYPA 2FPLA 2G28A 3EVBA 3EYWA 2XVYA 2PUTA 4MP3A 2I34A 4WXHA 4CT0A 1E9SA 1FFXB 1VCNA 1W36B 5HSGA 2JBHA 1GU7A 2BMWA 3GP5A 5SY4A 1CV2A 1E63A 3GT3A 3EEQA 3PNQA 3EZGA 4KKXB 4Q5IA 4TL8A 4V24A 3VMMA 4D9EA 1XF1A 3T4UA 1R4MB 5GINE 3C87A 1PHRA 1J22A 1M8JA 2AGVA 3R6LA 4L85A 3SFVA 5A0FA 4DR2B 4K6FA 1GSIA 5CT4A 3HO8A 4TLAA 3HYNA 5E4TA 3CMMA 3MCUA 3HU1A 4YCSA 1P62B 4AZ3A 4JJZA 3WMWA 1MGOA 1QCZA 4L8FA 7REQB 2WG1A 2Q6OA 3ZGYA 4AWAA 1IOLA 3PTAA 3LXUX 3VYUB 2A1TS 3WL5A 3LUKA 2QD2A 1YQTA 4IX9A 3KT8A 4NH0A 3CLTC 3IHWA 2FEKA 3KVOA 4ZARA 4F4IA 2PU5A 1ODJA 4LZWA 5FA6A 2IVFA 3NALA 1NR7A 1QB8A 3G23A 5AKJA 2PLRA 1F2TB 5FBWB 2G7ZA 4ZI2A 1V9LA 2IA5A 1I8TA 4OUKX 1G8GA 4ZTUB 1SXJB 2GN4A 4M55A 3AJAA 1E4EB 5A3SA 1LS6A 1DC3A 4MQMA 5CEFA 4KRXA 4BP3A 5L4SA 1OLSB 4JB8A 4ZQIA 4Y2TA 1B6GA 5TS2A 3GFOA 3NBFA 3L6UA 1J8VA 4JLDA 3MUFA 5KEIA 1ITZA 1QP4A 1P45A 2GK6A 2GS9A 3DUFB 4UREA 3UV6A 3OM9A 4ZCIA 3AONB 2GYWA 3RVMA 4QZVA 3NFRA 4RXTA 2QAIA 4YRFA 4EJ2A 2ZWPA 3L7DA 4INJA 5LC1A 4BATA 2F3QA 1JG1A 2HCFA 4JC0A 2QTTA 5LYYA 3TTUA 1G1MA 1JIJA 1Y3AA 2IPXA 2O1WA 2RGAA 4R3UC 4DNFA 4CQNA 1GNQA 1KEEB 5DTQA 8MHTA 3MJ4A 5BXYA 5J2TB 5FTLA 2XB2A 4JXJA 1UBNA 2O0LA 3QHQA 1NN0A 3ETLA 2YMQA 4R6XA 2V96A 3DFMA 2G25A 2M6KA 6REQB 3DLCA 3D3KA 2CMKA 2CNDA 2V5VA 2NXWA 4RW0A 3ZE0B 3CGGA 1ODLA 221PA 3QENA 2W58A 3F7TA 4U7WA 3C5EA 2BISA 2G07A 2GYVA 2RC5A 2VLIA 3AWIA 3HG7A 4RS4A 5B3JA 1ZIYA 1X0VA 3QVLA 4TQ9A 3TK1A 5JC8A 2CDCA 2GCGA 3ZV5A 2ONJA 1ZCZA 2IHUA 5A02A 4PSAA 1P3JA 3L49A 4GOKA 3U7QA 3PRHA 4H2DA 1Y7TA 4BQQA 4YUYA 2R11A 1ZN8A 1XQXA 4L5IA 1B8NA 3QA9A 2JZNA 3TL6A 4QNRA 3PBKA 4LHZA 4E7OA 3Q8LA 5KYWB 1PUJA 5EUQB 1Y5LA 3B12A 4NPAA 3DC2A 5EXDA 3T7SA 1J56A 1I5RA 1QPZA 1N7JA 3OEED 1VRWA 1VE6A 4GR5A 4IXNA 3GAAA 5EYPA 4DA9A 2WHYA 2H4JA 4MS1B 3FFXA 3MT9A 2VP6A 1Q91A 4TZTA 4QATA 2O7RA 2R44A 3VNRA 4A0SA 4GVPA 3WGIA 1TD9A 1VSQA 1MOZA 5EJAA 3RVNA 4CKYA 2QU7A 2JVJA 4EGSA 2JEYA 1XKTA 2CJPA 3I3SR 3FTQA 4BECA 1WF3A 3L4BA 5HKLA 3THYB 1NLUA 2WP8J 3VO9A 1P0FA 1X13A 3IP3A 3PK0A 4A6PA 3KZMA 4BWGA 2QT0A 4E6EA 2YY5A 1AZWA 1MG5A 3LKBA 2Q07A 1NPDA 2RJNA 5BQFA 2ZM5A 3FA2A 4FOOA 3HCBA 3CEAA 4RA9B 1QHXA 4N8EA 2OILA 3H97A 3KNZA 2CFCA 4FOPA 4JT2A 1EINA 1Z7BA 1MX9A 1Z62A 2AYZA 2CBGA 2RHCA 5EJGA 1F6BA 2ODPA 3HZOA 5IARA 2CMGA 1XMOB 4ZJYA 1C7JA 3O4RA 1FNSA 4P7GA 3VR5D 3ZPXA 5ALFA 1KVUA 3I9MA 4LFAB 3BTUA 3CZ5A 4QGFA 3U3XA 4BO9A 1LDMA 3DMDA 1P61B 1HE4A 2DKFA 5AT1A 2RH8A 1U8ZA 4AZ0A 5FBHA 3KHTA 7MDHA 4OM8A 2QTCA 1FK8A 3OOHA 3PX3A 2IU4A 2JKYA 4PRLA 4XEHA 5HFNA 4CODB 2ASEA 4BNVA 2D8AA 4JJ7A 4DLKA 2O9JA 5A3JA 4DB4A 2XHEA 3I2JA 3P97A 1DAKA 4M49A 3IP8A 5IP5A 4KXWA 5I7OA 1C0EA 2XMPA 3A9CA 2KJQA 4TMVA 1KYZA 2BCJQ 1AGPA 1MIOB 1TUEA 1VPVA 3PXXA 1WNFA 2G6TA 3DBLA 3MD0A 4LZNA 3W6ZA 4NFSA 1CXZA 2GCNA 1YQDA 1U9ZA 4ZA2A 2SCUB 4NE9A 4Q05A 2FPIB 2X8BA 1MOPA 3P4UA 2Y1WA 1LBSA 1YZNA 2QUBA 5LMCA 1AZTA 2B8WA 5KTOA 4DLNA 3ZE2B 2QV0A 3R5KA 2IHVA 3WV4A 1F38A 4C7MA 2ZUWA 1VBKA 2AG5A 3CE9A 4C7XA 3P2EA 2NZWA 5EMKA 3WLOA 4Q6WA 4GI3A 2JRCA 2H9YA 3VZSA 2G4VA 2IQIA 4HDMB 2QAGA 4BMZA 2JARA 1GTVA 1ZUD1 4KO3S 3WL4A 4TWAA 4MP8A 3RTBA 4PWZA 3BOSA 2FMKA 3OLVA 4OQQA 3UB4A 1K3FA 1M2JA 3X1YA 1XEXA 3TCXB 2R00C 2D0PB 2Y1FA 3AF1A 3LHDA 3LYLA 3L79A 5AJVB 4EJSB 2V7QD 1TTTA 1R4ZA 1ZMXA 2ZJAA 1IPFA 1NLZA 2WHPB 4RUKA 4F7DA 1FDOA 2BIFA 2RIRA 2HLPA 5E95A 4BB6A 4C22A 2AH5A 4I3FA 4DBZA 3HXOA 5I7SA 1F6WA 3K96A 1SU6A 3QIVA 4UUNA 1T1GA 1L8XA 1WF6A 3BQNB 4QECA 2HOQA 3FNQA 4JLMA 1IRXA 1EWKA 1NDHA 2J45A 3RFVA 3ZWWA 3K9CA 2X76A 4RVOA 4ZU6X 3NX4A 3LG2A 1XDGA 3FB4A 1K8ZB 2WG0A 2IHJA 4J0QA 2Q7OE 4BBJA 2TSYB 4TMZA 1EG7A 2Q45A 2WYVA 1P7ZA 1KE2A 1JG2A 2YWFA 4Q1AA 5ITWA 3FGOA 4MUMA 3UV7A 3DNMA 3MTEA 4QFBA 5IXJA 4NVRA 3FBGA 4LSMA 1J07A 1E98A 5TGDA 4IIEA 4PZEA 2EDCA 1IXYA 1FMLA 3HBJA 5FPTA 4OHZA 3C3YA 3HDYA 3MK31 5CDYA 2FSFA 1I2BA 4OK6A 1DV1A 3I6ZA 4R0MA 2FZKA 3A4TA 4L75A 1U2DA 5CIQA 3P2YA 4CG1A 4NZYA 5U1PA 1JAHA 5KNBH 4P34A 3OPYI 4OGFA 3AOGA 3LOUA 4G5SA 5BT9A 4R8SA 4FC6A 2RHHA 1CULC 4JOCA 2P1ZA 3RS9A 3RS8A 3I9JA 3FZNA 1QO9A 4Y9DA 2PZJA 2R8PA 1B1CA 3NM6B 3Q5DA 3AZPA 2UV8A 1VDZA 2HXSA 4RHEA 4K88A 4GRDA 1Z7GA 1XU9A 1NYRA 2M1ZA 2O3UA 3GJZA 4XWKA 3KKQA 1J0CA 1MAAA 4UMFA 3WFZA 2PJRA 2FLVA 5AQEA 3DLAA 4PWYA 3STVA 4NV0A 3VH1A 2R4TA 2JAXA 1Y1SA 4MVJP 3ZH9B 1IHYA 1TZJA 3FI9A 4BCCA 1P31A 4DA7A 4DF3A 3KUKA 2YIDA 1XCMA 2DXIA 1A8PA 1G5TA 3HJCA 4J76A 4YASA 2UVQA 2QL6A 4YRIA 3TFOA 3BC1A 3CO5A 1XROA 2RMKA 3L5KA 1EFPB 2AXNA 3ZU5A 2XTZA 3M1IA 5AI0A 1ECBA 4KCGA 4U2GA 4MGIR 5IF3A 5JXHA 3DBHB 1CUUA 1O8CA 3DHNA 1QK4A 1NR1A 3T8YA 1UZAA 1L1FA 3HC7A 4FOTA 1XTQA 4UATA 5AKIA 1J70A 1WXDA 2CLFB 3U3OA 4ZT5A 4MV8A 1SZCA 1FFEA 1SM4A 4V0NA 4ZQCB 3WKBA 4FFBA 5DHSA 1BJKA 1N2ZA 3HBMA 3OM0A 3R5JA 4HYQA 4OL0A 3ZWMA 1ZKDA 3H11B 1KETA 2OMEA 4Z8YA 3RJ5A 4W63A 1O95D 4BO4A 4D42A 2H51A 2G1PA 4N7RA 3TTSA 4OAOA 3HXMA 2QN6A 4QUGA 4CMBA 5HILA 4DMKA 3OSUA 2JGDB 3U4CA 5DMXA 2XBLA 4A15A 2V1XA 2YNMD 3O1LA 3OQPA 3VNAA 1N2SA 4YT4A 3C3KA 3L4JA 3G89A 3MWEB 3NP7A 3HVIA 1IZ0A 3PCTA 2WIFA 1UQTA 2AG0A 2DM6A 1MO4A 2UZ3A 3W3AA 3ZX5A 2VHCA 2JK0A 2ZUVA 3I4LA 1JAIA 1ZK3A 3ZQ6A 3LDFA 3FYUB 1N77A 3CNBA 5LP6C 3U16A 3TXXA 3WNZA 4QVKA 2QIPA 5J4VA 1S8FA 4U3JB 1Q6YA 4Y98A 1XMJA 2P3OA 3OD5A 1E9BA 4OU4A 5C5EA 1R18A 4QGSA 4IJ5A 3QTTA 3HFRA 4X1YB 1ISSA 2JIQA 2VQDA 3REOA 3MG9A 2R4UA 3EAQA 4QOEA 1WUJS 1R2QA 3GLFB 3IKMB 1C1DB 1MORA 2JHCA 2QLBA 3PRYA 3O93A 2MOKA 3QOYA 1RBMA 4TROA 1T10A 1VE5A 5KTTA 4R1UA 1NMQA 3CVOA 3HH8A 5JRJA 2P67A 1V9CA 1ESMA 2QE7D 3LLUA 3M34A 4U5XA 1L5NA 1ZQ9A 1ZHFA 4XDGA 2CNKA 5DHPA 3SF8A 2C0PA 3B9RA 1NW3A 4HZUA 4RKWA 3PFGA 3WWPA 2MYTA 5LNK6 4YAFA 4C01A 2B5VA 1GU1A 2IPNA 2ONCA 2WJJA 4N4AA 1RYBA 3HR7A 3VPHA 1M33A 1ZCJA 4BKUA 1QGOA 1BTOA 1QSGA 2XLCA 5DCUA 3TNJA 2O4CA 1S4QA 4O08A 4Z3DA 4MR9A 4NYIR 3TTTA 4B84A 5JUWA 1LNQA 1MV5A 2R6ZA 4A91A 3A7EA 1RYHA 1MJFA 1AK2A 4FR0A 3RUCA 2X8LA 3CR3C 4D3ZA 1JR3D 3Q2OA 2R2GA 1RQ2A 1RRKA 1V95A 4KAAA 4L3WA 5CXUA 3NUQA 1XYVA 1ZWKA 2IW3A 3KYCA 4R16A 2OBBA 3GNLA 1S2DA 5NULA 2FN7A 3UK6A 3MIZA 1Y82A 3KB6A 4JP3A 5BW8A 1FTYA 4MXDA 3DB2A 1Y9AA 1XQ1A 2Q6KA 1TC2A 2GLUA 3KPUA 2WF6A 3DMPA 4FFVA 4J1SA 1XRQA 3MQFA 3CUUA 2FG6C 3SYMA 4FGLA 1B6SA 2R9VA 3WIEA 1L1QA 2XTJA 1UK8A 5F21A 4FYIA 4WXEA 3VR2D 1O0BA 3O9ZA 2HCJB 2PYIA 2A9JA 4Y2RA 3WKAA 2GF9A 1Q21A 2PKYX 2QGZA 3I4FA 2AOUA 1JWBB 1WY7A 4KJXA 1RTKA 2PX8A 3EODA 3OM1A 2B2NA 3EEBA 5EL0A 4R8VA 5K3OA 2JK1A 5WRFA 2BWJA 1KDZA 1JFLA 3O8OB 3ICVA 2QD1A 1E69A 4FDTA 4IS3A 3O3MB 3QY0A 5EWMA 1JL3A 1E2UA 3KYDA 3UK2A 5MGBA 1EGMB 3SR4A 2FDRA 5DIFA 4CN9A 4QA9A 2HDNB 4CTNA 5F4BA 3CV3A 3DZDA 4JFRA 4WK6A 2ZSAA 3ESQA 1GN9A 3P32A 4RVDA 5CLGA 5BWBA 5B1DA 1VKJA 2BBOA 4BVAA 1T91A 3NBYC 3TS1A 3LUAA 2WR8A 13PKA 1X3LA 3Q3JB 4TKVB 2JCBA 2NUBA 3AL0C 7AT1A 2CY0A 2YV3A 1QHIA 2WMOB 1KJNA 2BL4A 1RFGE 2A5FA 4N7BA 3ZBPA 3ZWPA 4HXGA 2SNIE 4DIDA 1ECGA 4DA4A 1PI3A 3T54A 1Q7GA 3EVDA 4GKVA 4KN8A 4P2GA 4TRJA 1IBKB 3ANYB 3LPMA 2CV0A 4DJDC 3BDIA 3FLMA 4UUOA 3AEKA 1HM5A 4HQOA 4X91A 4YLYA 3W5AA 1NUAA 3GWGA 4KN9S 5ARCA 4DUYB 4PSCA 1J23A 5IYZB 4Z4GA 2UYGA 3WAKA 3T1OA 3FNIA 1Y3CE 5ARDA 4B79A 4MUYA 5LVAA 3B53X 3H7IA 4OU5A 1F0KA 3KE9A 1KZHA 2VAVA 4RFLA 3OPNA 4M1MA 4TLEA 3GI1A 1Z2NX 1TM3E 2WFMA 3PEUA 5IPFA 3ZWYA 4OQLA 3PXUA 5EINA 4D81A 3ENZA 5JATA 1E4VA 4W7SA 1E1RD 4Y2VA 2O8FB 4POOA 3GJSA 1I7QB 2ZITA 3EHEA 2CMDA 5TLSA 3OJOA 3MJRA 3NWJA 1OXBB 5LWHA 4NABA 1E5QA 1OZGA 3Q9UA 1J5PA 1O95A 1QLJA 1XZKA 1GL7A 3ILSA 3OO1A 1FLDA 4FILA 2QKYA 1I14A 1QH1B 2YWJA 3GIWA 3KKZA 2OGTA 1UDAA 4FP9A 4K86A 5FP0A 3AT1A 3IUJA 1XKXA 2GF2A 1EJBA 3IMEA 4O2RA 4QBTA 5G3ZA 3TQCA 3W79A 5K6RA 2GEUA 4C2BA 1RWQA 1GQQA 1QX4A 4MNTA 3P1JA 2FKAA 1U63A 2GN2A 3ZV4A 4RHCA 2JIRA 1T0UA 5FEMA 3R6TA 4W9RA 5JVDF 5EEGA 3O8QB 1U4NA 1V8PA 5FOSA 4DLSA 1W85A 3QNMA 4PC3A 1M2VA 2IEZA 2C2XA 2PKEA 3QLJA 4HSEA 1O4VA 4JLOA 2NUTA 2ZJ4A 1HZZC 2KW5A 3MZ0A 1X15A 1NXQA 2ACVA 1KEVA 1KNXA 2AZTA 4ZQBA 3WLHA 4CMGA 4JI1B 1AUPA 4FFWA 4DWOA 1FFYA 4KDEA 3TLZA 1GEEA 1T36A 3CNLA 1R88A 4GFDA 3JQRA 1ZMOA 2YW2A 3CY6A 4L02A 4TTIA 3VM6A 4JGGA 3DQQA 3AR9A 3QKUA 5FV7A 2I5PO 2IE8A 2OCPA 5CIYA 3AOEC 4IDFA 4O0LA 2V0CA 1DJOA 2RHJA 2J1LA 2WMDA 4IS2A 2XE4A 4KBGA 5FULA 4A8PA 1NW4A 1AD2A 2H7XA 4IFTA 3Q12A 2P35A 4U00A 2GBFA 3CA8A 5H5JA 1Y8CA 3ROEA 4F9FA 2GAJA 1ZJ4A 1SCUB 4QSMA 1PSDA 4MHSA 5I8PA 5JDCA 3IPAA 3B1ZA 2R5WA 4O4JB 2FG7C 3KWFA 3G7UA 3KBBA 3O7WA 1O8BA 1PQUA 3QPCA 3S5UA 1FTNA 3KEGA 3VR6A 5IF9A 4N8DA 2AFRA 4M99A 4AMVA 4ERNA 1YAHA 2WJAA 3BPSA 5KWEA 3T5PA 4M9SA 2R6JA 1JILA 2XTAA 1CJBA 2FW9A 2X5XA 3EMVA 4FD3A 4K6KA 1OXUA 4F12A 1QYWA 1K6IA 4ZTBA 3DZJA 1K06A 1A5BB 1NRIA 1WCXA 2J0UB 3WAJA 1R6TA 1NU6A 2CXNA 3ITDA 1SXJC 1LWNA 1Y48E 2H63A 4Q3DA 4Q4DA 5AHWA 1ZEMA 4CFYA 3HYCA 1AH2A 1N8NA 1BG6A 1K7FB 1S02A 3GGOA 1BVYF 4MCAA 1ABBA 2O0MA 2ZWOA 2HIAA 1JFFB 1QWSA 3FSEA 3Q40A 4ZMBA 2AR7A 3GAFA 2L82A 4X1KA 4YP9A 4HL6A 4JB2A 4KXFB 4HDRA 5TE9A 2H5EA 2KBFA 3FYTA 2X42A 3I1IA 1ZRNA 3OKPA 2HA2A 5AW1A 2WJPA 3L8HA 2C4MA 1N2JA 3IAS1 1RRVA 3O4GA 5EIWA 4RMIA 2XW6A 3EIQA 4BP9A 4BE7B 3H5LA 1GO2A 2MMGA 2WHPA 3PGLA 2WT4A 2MINB 1BDMA 1FTSA 4UHJA 3TCNA 2ZATA 1JI0A 3T7AA 4E14A 3FJYA 4RD4A 2G72A 1D04A 4D9IA 5K8VA 4UVI