3GJ0A

Crystal structure of human rangdp
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
207
structure length
207
Chain Sequence
SAAQGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Crystallographic and Biochemical Analysis of the Ran-binding Zinc Finger Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 67
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gj0A00
5CK4A 1M6NA 3UMFA 3CRRA 2OSBA 4TT3A 4JLBA 4RD0A 4DHEA 1A1VA 2EVWX 5KSYA 4NKRA 1T91A 4PHFA 4A15A 2ODEA 2BMFA 5BW8A 4A6XA 2IYLD 3L0PA 3OEHA 4AD8A 5BN3A 4URYR 3OE7A 4W5JA 4C0SA 1II8A 3LY5A 4KODA 3B60A 3I4LA 3UMSA 2EFCB 2VO1A 3U3JA 2WV9A 3FMFA 4Q66C 4A8JA 3MFYA 4FMBB 4DT1A 3TRFA 4V0MA 2IHBA 4OQMA 1EFHA 4TLBA 4YMSA 5M04A 5KO2A 1M7GA 2XZPA 1UF9A 5TB5A 3WY9A 1E9FA 5JMTA 2XAUA 4OHVA 5FBVB 1SXJB 1IY0A 3THWA 3CRVA 4DLVA 4Z8XA 1XFAA 1X8LA 2JLUA 4OQNA 4G3XA 4B44A 3K0CC 4WW0A 4M9SA 3CX7A 1C9KA 3VNUA 1F6BA 1HYQA 4HDOB 2ZI6A 3NBXX 4ILEA 3TLXA 1M2OB 3EZ2A 2WKRA 1G16A 1D2NA 4EJSB 2OFXA 621PA 4DB2A 2QM8A 3TUIC 2IYRA 4CRWB 1W0JD 5UKDA 3RS5A 2XTZA 2MSEB 3B1ZA 1TL7C 2JA1A 4J0QA 5FOVA 5DI3B 2GXAA 3I8XA 1SXJA 1QDEA 2V7QD 1AJEA 1IN4A 1PUIA 3G5UA 3CW2A 3RAPR 4YMWA 3DPUA 5AJXA 5JEDA 2QA5A 1Q1QA 4QBFA 1CJTC 3B2EA 1BMFA 2ZRGA 1AS0A 3RWMB 4DDWA 4YQFA 5DLQC 4DUGD 4M1YA 4EJSA 2V55B 5C4MA 3GD7A 4BFWA 3EW9A 2MMCA 2OXCA 3A36A 1MRNA 2R6FA 2GCNA 1PV4A 2BMEA 2O5VA 2QTHA 5DI3A 5B58C 1VTKA 2CK3D 4M9XA 1IJEA 2J41A 2D4HA 3LLMA 2KE5A 2ZYUX 1P7CA 4TL7A 2A7QA 3GFPA 3C14C 4GSYA 4GOJA 4Q00A 2QP4A 5LB4A 1RRCA 2O52A 3LO5A 4LRWA 1XTQA 2FSGA 2FSFA 2R6DA 1BH2A 2VHTA 4RZXA 5DHAA 4IDNA 2GF0A 1TEVA 5JSZB 3U6KA 2ZROA 4MUBA 5DHFA 3M4YA 4OL0A 2XTNA 4TSFA 4BUJA 3ZLJA 3DM9B 4JLPA 2EU8A 1RFLA 2QROA 5KYKA 2OZEA 4PSVA 4LWZA 1GKIA 1QHYA 5FL3A 3UXMA 4E03A 1EXMA 2A2ZA 1CJUC 3RDPA 2JJ2A 3AGPA 2R9VA 4OI1A 1Z8FA 2CLSA 4WOPA 1KJZA 4F4JA 1US8B 2PZFA 1TAGA 4XTCS 1KI6B 1RYHA 2J46A 2AWOA 1PLJA 3P32A 5GJVC 2PT7A 2XX3A 5FOWA 2YWGA 1CBUA 3S1AA 2XZLA 4C7OB 3AF1A 2BOVA 2PX3A 2W00A 4WA7A 3IILA 4TL9A 5FL7A 1P72A 2F55A 2OFOA 2YNMA 4A9AA 1W0KA 1IOZA 4MYUA 1G5PA 1GNQA 4U7DA 5D3QA 3FDIA 3RABA 5HR5A 4C0HA 2O8FB 2VSOA 1N2CE 4M22A 3SU8A 1KI6A 2CVFA 1O3YA 5DYIA 5JZVA 2QNRA 3A1SA 3CONA 4ZO4A 4NDZA 1SVSA 4C7OA 3TSZA 2H1LA 4OKSA 2ORWA 4URUR 3X1XA 1KO7A 1UBGA 1AN0A 1NL3A 2XNDD 4MYTA 4QOSA 4XVUA 4P31A 1NJGA 3MJHA 1WRBA 4AKEA 4RSGA 3LV8A 3HPRA 2FZLA 4I1OA 4KFUA 3PQCA 2ZXUA 3CNNA 3QPUA 4TLDA 3CRQA 4CDGA 2QM7A 5E7JA 4P3YA 2O8FA 3DM5A 3GQBA 4UQOA 2ZUCA 3WYFA 2YYZA 4P33A 2HF9A 2O8EB 5GJCA 3RS4A 1S1CA 4PXAA 5E3HA 1T3HA 2J45A 5IDVA 4QJ4A 5AK0A 4Q9HA 4AYTA 3U7GA 2X19A 2ZITA 4CEJB 4PFSA 5D3MB 2N46A 3AKYA 3CX8A 4Q4HB 5JI2E 1L7VC 2P67A 2PLFA 3ASZA 2VL7A 2HCJB 3RRZA 2OUKA 4YMTA 4AY2A 1H8EA 1P62B 1ZAKA 2H92A 2ERYA 1HTWA 2C9YA 4BEBA 4NMMA 4UXIA 1CJMA 4O25A 1UKZA 3A1WA 4CGZA 4R2HA 5H8WA 2VRWA 2F7SA 1J99A 2REOA 4PC1A 2ZREA 2O8EA 3CO5A 2WMOB 1FUUA 3QEJA 1G6HA 2CHGA 4CEJA 2ZETA 5AR1A 5D3MA 2HLDD 3KJHA 4Q4HA 1K6MA 3VR3A 3AVQA 3FVQA 4JLVA 1DG3A 1XTJA 4KCGA 4IDPA 5BXQC 3RWOA 4FXPA 1Z28A 2B6HA 4URZR 2QGNA 1TQ6A 2GRJA 2WVJA 4JLMA 4HYYA 4JVMA 3ZZUA 2QEQA 1A7JA 2GKSA 3NH6A 4KV9A 3IQWA 1UFQA 2A9KA 2QAGA 3H0KA 1OJLA 1Q44A 3AVVA 2Z4SA 2EWVA 1YZKA 4KFTA 4UNSA 3GJ8A 4BFUA 1S4QA 2IX3A 1JR3A 4OHYA 4D4MA 3HYRA 5KDLA 1ZRHA 2GJSA 3UANA 2A3RA 3SYKA 4Q7LA 3EARA 5FI1B 3X1WA 4AG5A 2GNOA 2RMKA 1GTVA 2TMKA 1E69A 1IN8A 2WZQA 4B32A 4FI3C 1XD9A 4IOKA 2W6JA 1U2RA 4G5QA 5BQ5A 1SULA 1SVLA 1RZ3A 1E2FA 3CB4A 3NXSA 5EP3A 3C15C 1P9RA 1ZNZA 2IYTA 1EWRA 1EFTA 1N25A 2ZEJA 4KBGA 2YC2C 2P2LA 4DBLC 1JXMA 1G7SA 1L8QA 2PEZA 3IUYA 4OHWA 2AN9A 2IS6A 2WHXA 1CIPA 3VMFA 2FH5B 4XWAA 1H65A 2ZUDA 3CPHA 1OHHA 5F2EA 2IYVA 4TWZA 2QBYB 3SFZA 2GJ9A 2F3TA 3SBEA 3T34A 1TTTA 4B76A 5DNYB 5DO9A 3QBTA 3CWZA 2LCFA 3LH5A 2QENA 2W83A 3EA5A 4OQLA 1IQPA 3WP0A 5JJLA 2QTVB 1KI9A 1X6VA 3WYAA 3VFDA 1P2TA 3LW7A 1K5GA 4TQUS 4M8NE 4UNPA 3CF2A 1T3LA 2CHQA 3LFUA 4LJ5A 4MKHA 3B7GA 2ZJ2A 4KO8A 4XOIA 4XWKA 4DJTA 4IOMA 1ZUNB 1A5TA 2HEIA 4DIDA 2AD1A 2QBYA 2GF9A 3QKSB 5EZ5A 4MYCA 3VHXA 4YMUA 4C4PA 1G3QA 4US0R 4FIDA 3U2QA 4ACAA 1SZPA 3VU9B 3KXKA 3JZAA 4Q4AB 1CRQA 3QF4A 4LUCA 2NOAA 2ZYVX 3KKNA 4LYJA 1VG8A 4C0LA 1KK0A 2HXSA 4TYYA 2J0QA 2R2AA 1WE2A 1XTSA 4DB4A 4C2TA 1OKKD 1A2BA 4C0JA 2OBNA 3LDAA 4KJZA 2ZJZA 2WKPA 1SVOA 4IJMA 1BS1A 4DKXA 1GG2A 1BYIA 2IL1A 5EP1A 3QNUA 1VG9B 3N2EA 2V4ZA 4NYJR 2JLWA 1FOEB 2PMDA 4M9ZA 1DS6A 4HZUB 4K81B 1EFRD 3VU9A 1ANKA 2PX0A 5A4JA 4JMPA 4IRUB 2CMKA 4G5SA 1AK2A 4Q4AA 1M74A 2B8TA 4RD3A 2QP3A 3BB1A 1G8FA 2Q0HA 3PITA 3VR6A 5TXGA 1QVAA 5H70A 5KPDA 3AGQA 1U0HC 4G5GA 1ZNYA 1W0JA 1NMZA 4KBFA 4JL8A 5LD2C 2DHRA 4QM7A 5AJVB 2GJKA 3KUCA 3AVPA 3V00A 4ZCLA 2FSHA 5FTNA 1Z29A 2D62A 1AGPA 2V7QA 1J8YF 4R9UC 1E1RD 2WJJA 1YR7A 2ZPTX 4HZUA 1VYTA 1E9BA 5JLJA 3KX2A 5FOTA 1OSNA 5KUTA 2DFLA 3KKQA 3WBKA 3MUFA 4QG7A 1M1YE 3LNCA 3FKQA 5B30A 4D0NA 3B5JA 3C5HA 1CR0A 3AF2A 3OIYA 4DUGA 1O87A 1E2JA 4MYHA 2Q9CA 3SYNA 3DKVA 4OQFA 2VHQA 1G19A 4UKDA 4ASUD 1NN1A 3RC3A 1ZC3A 1II9A 2ZQ5A 1JECA 3MWKA 5HE9A 3FHTA 1JPJA 1SHKA 3W5IA 2CDNA 1G291 4CEHB 2CK3A 4TYPA 2C98A 1P9NA 2R44A 2ZRCA 4KYUA 1WQ1R 3DDCA 3OFND 2IWRA 4DDTA 1P2SA 1DARA 1U8YA 2F1RA 1ONBA 2WJGA 4DEXA 1G21E 4XSHA 2IWHA 1JNYA 1TEXA 2F1IA 2FF7A 2X2FA 2DWOA 2IS2A 3H86A 3CNOA 2EYUA 3AF3A 2VLIA 3IKJA 1YZQA 3BERA 1YZGA 3T15A 3EZ6A 1KTVA 4ABYA 2ATVA 1G8GA 1HV8A 1OYYA 3LLUA 4BRWA 4ARZA 1GL6A 5AWFC 2Z4RA 5C18A 3I73A 4DCTA 1MO3A 1XF9A 2H17A 3TIFA 5LD2B 5ELXA 3CR8A 4RD6A 1R0YA 2IT1A 3SJAA 4XH9B 4IEEA 4B71A 2BIFA 2NO9A 3FMPB 2JLXA 2QL6A 3SHFA 1P60A 3BXZA 2YWEA 3IPXA 2KJQA 1SXJE 1W46A 2XOKA 3K8YA 3QPWA 4FCVA 2EQBA 2OXRA 4ACBA 5HZHA 3Q5EA 1FP6A 4HUTA 1WCV1 1E0SA 1G4AE 5BWMA 1IY2A 3QUSA 2XEXA 4BZXA 1IXRC 4DVGA 3R20A 4UNRA 1DAHA 3HP1A 3BH0A 3P4YA 1U94A 1IY1A 3TE6A 1E0AA 3HPQA 2AXPA 3CPJB 3O8RA 1KK2A 1NNEA 1KK3A 1N6NA 4HI0E 1XZPA 1Z5ZA 5IHPA 3SI7A 1RJ9B 3TK1A 5F3WB 3FGNA 3NH9A 4TTPA 3W90A 4DEYA 1ZM4A 3EZ9A 3R7WB 2KWIA 1J8MF 4DZZA 2ZJ8A 4KYIB 2XITA 2P3SA 5JS8A 4G1UC 2XNDA 1YZNA 4LJYA 2ZIAA 2W2VA 3HYTA 1W5TA 2IYYA 4HB4A 1PUJA 4PANA 4Q03A 4A82A 4O3MA 1D2MA 3WXMA 2ZRHA 4LHWA 1LS1A 3T1OA 2B7CA 1VYVA 2IYXA 2B8WA 2LKDA 1RJ9A 4NYIQ 4BLOA 2ZE6A 1E9SA 4GRAA 4Q7KA 3CH5A 4Q1AA 3SNHA 3FFBA 1W0KD 4DLXA 4RZ2A 3AUYA 3GJ5A 5CYOA 5AUPB 1G3IA 4AIIA 1TX4B 5EE1A 4AWXA 3UG6A 4XSGA 2F6RA 2QUZA 3EA0A 1VDZA 4B3DA 2NQ2C 3VNVA 3OHMA 1UDXA 3IBYA 2J0UB 2J3EA 1GKUB 2ZVPX 2W58A 4PZYA 4IDQA 3E1SA 3AP1A 3MRSA 1P6XA 4M53A 3MSXA 4PQYA 1N0VC 2B7BA 3SHWA 1Q12A 4W9MC 1RRFA 1P2UA 1CJVC 1KY2A 1DOAA 4L15A 1G9XA 2HLDA 1JJ7A 5DYGA 1TUEA 1XDBA 3E5HA 3NKVA 3PUXA 4Q1CA 3C41J 1N5IA 2G1KA 3GEEA 2GK6A 1WF3A 2WWFA 2JLRA 3NG1A 4TMVA 1W2HA 2K5UA 3RVBA 4ZCIA 3O47A 2GVDC 2ZS9A 4NCJA 5L3QB 2XJ4A 2JAQA 1NY5A 5KSOA 1QVRA 1SKYE 4IFEA 3SE0A 2OO7A 3EASA 1QRAA 3WMEA 1OH8A 3WP1B 2BKEA 2ZR7A 1OXXK 2RHMA 4Y0AA 5GJWC 5GJBA 3CM0A 3EZ7A 3ONWA 2IS1A 1W49A 4D81A 4TQ9A 4TZ6A 1Y3AA 4O0MA 4EPWA 3IIJA 1WA5A 2J59A 3I3SR 4JYBA 4MGYR 2WSMA 1N5JA 2QPTA 1QG2A 2CLDX 2CL6X 3K9LA 4QHTA 2FV8A 4TN1A 1Z63A 1JEDA 3H2YA 4QNMA 1NVXQ 3SEAA 5L3QA 3U3KA 1JI0A 2DCUA 3DEFA 1R6BX 3QKRB 1RKBA 4HLDA 2OLKA 4NCHA 3FMOB 1U9IC 4WIAA 4A8JC 4F92B 1FQKA 3B82A 4Y0VA 4AKGA 4V0LA 1Z6TA 1HY3A 1G1MA 3T06B 3BK7A 5HZKA 4R7ZA 4MRPA 1NLYA 1IM2A 4V0KA 4QRHA 5JECA 1ZNXA 1R0ZA 3IEVA 1XJQA 4Q01A 2RGBA 2RGNA 2VPPA 3THXA 4QC2A 3WBJA 2NO1A 2IC5A 2MSDB 5KDOA 3GLGE 2ZI9A 4YDHB 1E1QA 1RRGA 2JEOA 3DZDA 4JLJA 5KNDA 3LXXA 3EX7C 2QRNA 3B78A 4RD1A 1E9AA 2DPXA 3EPKA 2IYWA 3EG5A 4LHYA 4M21A 4DCNA 4PC2A 2Q3FA 2YVUA 1JEEA 1XB2A 2WWIA 2AFIE 3FKSD 4FMCF 1JR3E 4S2EA 2WWWA 4CIDA 2N1BA 3CUEF 3K0AB 1OKKA 2GDJA 3Q8XB 4ZPXA 1OXTA 5KDDA 3VKGA 1ZU4A 1KI8A 1R0XA 5CB6A 3I5YA 1EFCA 4A8JB 3PV0A 4DT1B 4GL2A 1D6JA 1GRRA 1Z06A 1EFRA 4TTQA 5CM9C 2CE7A 2QQEA 1P61B 1W36D 3TSOA 1KDRA 4ZCMA 3KL4A 2NIPA 3WHLA 3SQXA 4OHXA 2RAPA 2VP2A 3V4FA 1Q57A 3GJ4A 1E9EA 3K0AA 3Q7PA 3THWB 4LJ7A 3I61A 2PJRA 3FB4A 1W4BA 4DLTA 1OIXA 1Q1EA 2ZI3A 3ZQ6A 5K8UA 5C4GB 2XGJA 1CR1A 2CLCX 1ESNA 4R98A 3ZIAD 1YVDA 1E1RA 3ND9A 1U9IA 4PZLA 2YINC 4D6PA 1MR3F 5KTYA 3IPYA 4XJXA 4PPQA 3KKOA 2P0EA 1Z08A 2EW1A 4P0TA 1ZJ6A 3L8YA 4PAOA 1ZM3A 1P5ZB 2JJ1D 4GZLA 4QBIA 1OW3B 1KY3A 2ZM5A 4ZDIA 1KI1A 3CX6A 1RVDA 3LWNA 2H5EA 2IXGA 5KSPA 4DCUA 4LJ8A 2J1LA 2E87A 3ZVMA 2FJUA 4ASUA 1NN5A 4GT1A 1JALA 2EYQA 1NG1A 1DAKA 4OK6A 4XWOA 4DLRA 2ZJ5A 3W6OA 3TUZC 4OHZA 4LJ6A 1ZCAA 1MV5A 3BORA 3MJRA 3OFNA 4IXMA 4ZKDA 3WYGA 4B33A 1MT0A 1S8FA 4MGIR 3PEVA 4C9BA 1PLKA 1R4AA 3KFXA 2ECKA 2Q9AA 2XB2A 1W47A 4HAVA 2REBA 1IN7A 3F5FA 3D8BA 4B43A 1EWQA 3MGCA 5E4FA 5FI0B 1P9WA 4I1VA 2PMKA 5K8IA 1XP8A 1NG9A 3PUWA 4IXNA 1Z0AA 4A2QA 2FGJA 1J90A 4EAQA 4BLSA 3P26A 2WWYA 2PL3A 3VR1A 2FN4A 4K46A 2C77A 3U3RA 2ZSFA 2WAXA 5BYKA 3IQXA 1AKEA 5JJIA 3AUXA 4MDEA 1XCPA 4F93B 3OEED 3I32A 2ZE5A 3BH6A 2NPIA 4PC7A 3TQFA 1GUAA 1VIYA 4Q02A 2P6NA 2V9PA 2VSXA 4A4DA 4EPRA 3RRMA 1TMKA 2FX3A 3AVWA 1G6OA 3RC8A 1E2NA 3DOFA 2BMDA 1KDTA 4EPYA 4DSUA 1NN3A 4L8GA 2Q3MA 2QZ4A 4FMDB 1ELOA 3N5CA 3S1AB 3OIVA 1GWNA 1UM8A 2Q6TA 2IYQA 1E2MA 1YR8A 3ECCA 4YMVA 1E98A 1PLLA 1ZU5A 1KHTA 2GAAA 1R0WA 2GESA 3CRW1 4RD4A 3UIEA 4LC0A 2GA8A 2WTUA 3FFAA 3U7FB 2IUSA 1MOZA 3QKUA 3ZZTA 1SVWA 5G40A 4B3BA 1W5SA 1P2VA 3AVYA 1HE8B 2FFAA 2RB4A 4QXAA 2XOKD 3EPJA 4PAMA 1SKYB 3EIEA 3A4MA 4W7SA 5JWRA 3U6BA 1XEWY 3TMKA 1OXUA 4IKEA 2OESA 1GZSA 3CIOA 4D25A 2YZ2A 5CYPA 1NVWQ 4M2LA 3UKDA 4DXAA 2QAGC 2GETA 4TMTA 1Q20A 1U90A 4PO1A 4V02A 3ZH9B 4R2IA 4LYHA 4D4LA 1E32A 5FOSA 4GDFA 1S9DA 4QHYA 1UADA 2ZYTX 3B1XA 2PZGA 4PX9A 1XPUA 2JLVA 2IW3A 1KMHA 221PA 4CF7A 1E2HA 2A5YB 4HB0A 5B57C 3SYLA 3WHKA 2RGDA 1LW7A 1QG4A 3OF5A 4JSYA 5FTKA 2H57A 2HYIC 3IBGA 1NF3A 3REFA 3OESA 4H9GA 2R6CA 3PCRB 4BFYA 4BFTA 1A82A 3U60B 3ZD6A 2FG5A 4IDHA 5L3SB 3AVTA 1ZNWA 3K9NA 3HU3A 5BN4A 1FQJA 1G3MA 1B0UA 3P1JA 1OH7A 4L4UA 1XTIA 1I4DD 2BJVA 1Z0FA 2QU8A 1NBMD 5FUXA 5G3ZA 5JRJA 4K8OA 3MG9A 3CBQA 3UWOA 1OH6A 1CLUA 3AVUA 1SKQA 4H1UA 5CK5A 4MQBA 2AWNA 1FTNA 4GNKA 3L0OA 4QGAA 2ZSAA 3GLGB 2JGNA 3DL0A 5TMPA 2D3WA 4BRUA 1TU4A 1W36C 2OV2A 1NMYA 4M0LA 4HUQB 1HT1E 3AVXA 5L3SA 4YDSA 3X2SA 2RGAA 821PA 2GZHA 2BM1A 3I5XA 1EGAA 4DC9A 1SVIA 2QAGB 5K8LA 1NBME 3BS4A 1BO6A 2ERXA 1ZM7A 2VA8A 3AQ4A 4NYMR 4Q19A 3SS8A 3ZVNA 2FMXA 3ZVRA 3NHBA 1W1WA 2OT3B 5TDHA 2OM2A 3QXCA 4LYFA 3UK6A 1RC8A 5HKKD 3GLGA 3GJ3A 4M1TA 4ESHA 3PUZA 4Z51A 3PVSA 2I4IA 5J47A 1QHHA 5EXPA 5JI3E 4HUQA 2RCNA 3U3MA 2BHRA 3BE4A 5FTLA 4AC9A 1UEJA 2AXNA 3KDSE 5FPTA 2OCYC 5SZKB 1DO2A 1JPNA 5EUMA 2KB0A 4A1FA 4NBSA 3W8NA 3M0EA 2NPFA 3L2OB 4LGMA 3I62A 4Q9JA 3W6PA 3B1VA 5FBQB 2QORA 5G41A 1XD2B 3L8ZA 4JKIA 4NYMQ 3GP8A 2W0SA 1E2IA 4A36A 4XVRA 4ZIRA 3R9XA 2HT6A 3ADCA 2AL7A 3K70D 1CR4A 3NTUA 4AURA 1J7KA 1XWIA 3W3ZB 4EFLA 3THYB 3QQ5A 4HSEA 2JATA 4DLYA 1F3OA 4FD2A 1W36B 3VTKA 3BC1A 1KJYA 3CKLA 2VP4A 1EFUA 2FFBA 4F91B 3BFVA 1OIWA 3QPVA 3SJZA 4RZUA 3FKSA 3QE0A 4EFMA 4GMDA 4NE2A 5JJKA 2IYSA 2WSSD 3U44A 3UATA 1XD2A 4GPTA 1FTSA 1WBBA 5A0FA 3T1QA 2GJAA 2VTKA 1YU9A 1KAOA 4RJLA 1VECA 1XMJA 5JEEA 3EXAA 2A5JA 3A6PC 4Q9IA 3THYA 2F3RA 3QF4B 2QSZA 2RGXA 1I2MA 4QBGB 3ZVLA 4S35A 4JYCA 3K1JA 1TNDA 4LX0A 1E2DA 1XEFA 3QXHA 2NGRA 4JLAA 1UKEA 2GVZC 4JS0A 4MDFA 3W8RA 1E1QD 1UDWA 2IUTA 2IUUA 3KTAB 2V8OA 2WJYA 1OLOA 1XMVA 2EFGA 2ODBA 2ZSBA 3KB1A 5EP2A 3ETLA 5EXSA 1UKYA 2D7DA 3LAWA 3NHAA 4LZZA 1FMJA 4JBXA 4LV8B 1KDPA 5CIWA 3CF6R 3ZIAA 1T9HA 1HA3A 1KO4A 2X8AA 4IVQA 4DSOA 4G5RA 5LPNA 2YJTD 2AK2A 1JBKA 5EE0A 4MGKR 2BC9A 1G18A 3DZ8A 3PFIA 4WVFA 5SZIA 3FMIA 1TF5A 3FOZA 4MITA 2JJ1A 1OPXA 1L4UA 3OAAD 3P20A 3KTAA 4LY6A 1LV7A 4OI4A 4G01B 2IXFA 2J9RA 4M1WA 1JAHA 3AH8A 2GTPA 4CW7A 3GFTA 3LQRA 4LC1A 4HAWA 1VYUA 1OYWA 2EFHB 4IW3B 3TKLA 1ESMA 5DISB 1Z0KA 3D6TB 3A1VA 4C0AC 2P6RA 1PJRA 2FGKA 4QJ3A 1OT3A 1WXQA 2FFQA 2CXXA 521PA 1QZXA 1DAEA 1F48A 2B21A 4I4LA 4DSTA 4PC6A 4I99A 2Z43A 2DWQA 3QVUA 4ZI2A 1YR6A 2GEUA 4NPHA 3EAQA 4OI0A 4BLRA 1MO6A 4FW9A 4PC3A 2RGCA 4HLCA 2VHUA 1D2EA 3DVLA 1HUQA 3KQKA 2GXUA 2CJWB 1T8TA 2JASA 4UNNA 1OB2A 5DI9A 2IA5A 4E22A 5E7MA 3SR0A 421PA 1E6CA 4HB3A 1C4OA 3B1YA 3QIAA 3KXIA 3LX8A 4NYJQ 1VMAA 1IXZA 1FP7A 2R8RA 4JLKA 3GPLA 5FOXA 3SJBA 3QEOA 1CP2A 1NY6A 1WDTA 2YOGA 4R71A 3SBDA 3AM1A 2NO0A 1GITA 1ZVQA 3W3AA 1ZP6A 4P4UA 1Q21A 2J0VA 3IHLA 3P27A 3TNFA 4Q4LA 3ZD7A 4PHHA 3OEEA 4PQRA 4QJ5A 4LBWA 2FEMA 4IVPA 4ARZB 4JLDA 2DB3A 4ON9A 1CEEA 1YZUA 1VCMA 4TMKA 1RYFA 1VCIA 4KFRA 2CJWA 4JIMA 4US1R 1I4LD 2G6BA 1Z6YA 2FE4A 4P4SB 1E2PA 2QN6A 1G7TA 4EPVA 2F43B 1JXOA 2I1VB 5L3VA 3CRMA 3A1TA 2OCBA 1E2GA 3QG1A 1OF1A 3BFKA 3C5CA 4WXRA 2DFKB 2ZE8A 3I72A 3QBVA 1CRPA 2BMJA 2FNAA 2P6UA 4Z1MD 1X1SA 4DWJA 3T61A 1GNPA 2QT1A 3QXXA 2AR7A 1IBRA 1J2JA 1Z0JA 4NH0A 4HDCA 5F9FA 4Q4JA 4PQFA 5JFGA 1KO5A 1XJCA 4HLUC 4UNQA 2GHIA 4P4SA 5FR2A 2JLQA 2F43A 2W6ID 1IONA 1NRJB 3AF4A 4KXFB 1ZM9A 1AIPA 2XXAA 1DPFA 2AD5A 1VHLA 2XB4A 4QGHA 4NONA 2OFWA 3PG5A 4PZZA 1G3UA 1IJFA 2FPLA 4B47A 2XTMA 6Q21A 3O8DA 4X8LA 1ODFA 2RHDA 4PPNA 3T5DA 1VCNA 4LSGA 1Z07A 3IEUA 1OXVA 1GL9B 4EPXA 2DR3A 2FZ4A 2QI9C 2HXYA 1G41A 1RW4A 4NCNA 5JHHB 3HU1A 4B2IA 4BFZA 2F1JA 4AKIA 2IK8A 2O0JA 1GFIA 3FPAA 1L2TA 1W48A 2NMVA 5EJEA 2BVNA 4OYHA 1Z83A 3L43A 1FFHA 5EUQB 2R6AA 3GMTA 3RSLA 1XZQA 4HB2A 3UMRA 2PBRA 4AK9A 4DLSA 1MO4A 1KGDA 1T3SA 1E94E 5KHOC 4CVNA 4A0FA 4XIGS 1Z22A 3QXSA 2A5DA 2GBLC 1R5NA 2AK3A 4NCIA 3DO6A 4JKYA 4WAUA 5H68A 3PR1A 1T5IA 2Q21A 1N6KA 2ZJYA 3MMPA 4Q7JB 4URVR 5F98A 3CF0A 3ICEA 1NBMA 1YRBA 2HV8A 1ZIOA 1F5NA 1E0KA 2IHYA 2Q3HA 1AZSC 4IVRA 3J81k 5CIQA 5KOYA 3MLEA 1AGRA 2VH5R 5AUNB 2O8BB 4W5WA 2G3YA 2ANCA 2RGNC 5FUVA 1S3GA 1ZW6A 1II0A 1VPLA 4A6PA 1FNNA 4C0KA 3DHWC 4DIEA 1U99A 1R10A 3CZQA 3X1YA 1KSFX 5L3RA 2G0NA 3K0EA 1DVRA 1F60A 4MH0R 4PHGA 5TVKA 4YXWA 2RH5A 3WNCA 3A37A 3B1WA 2V1XA 8OHMA 1DAFA 3KKPA 4HLUA 2VYFA 1KYIA 2ZU6A 2QMEA 5KSZA 1E99A 4JJKA 4LBZA 4TLAA 5HKKA 2ZRLA 2O8BA 3U61B 2VHJA 4Q9LA 4GOXA 3FHCB 1E2KA 1JAIA 1G5RA 2GILA 2AHOA 2E1RA 3KQNA 3QSYA 4TMXA 2GXSA 3R9WA 2QP9X 2IEZA 3LBHA 4LPKA 1AS3A 1KNQA 2HUPA 3IIMA 1I2DA 1FMLA 2QGZA 3ADKA 1XNJA 1Q22A 1COWD 2V3CC 2FFHA 4GBMA 3O8BA 3TAUA 2N42A 2Z6VA 4LHVA 3HR8A 4KI0A 3PEYA 2ZRJA 5B64A 1A2KC 5FPKA 4URXR 1SGWA 4UJ5A 4BGDA 1D8TA 3AKEA 1XU4A 3K09C 4B6EA 2A78A 1KI4A 4WBSA 2CCGA 5FBLB 1TQ4A 1N0UA 2ZU0C 3IDQA 1KDOA 2O0KA 4QHSA 4FWTA 2VBCA 2G88A 2PEYA 4TMZA 3THXB 4E5UA 4CZ2A 1PVOA 3PEUA 1P4SA 3C7KA 1KAGA 1X86B 2W2TA 1XCGB 4KVGA 4O2RA 2G83A 1E79D 2GBLA 2WIBA 2WAYA 3DOEA 3LW8A 4RCZA 3GLIE 4TZ0A 2WSSA 4JT4A 4MRNA 4F38A 4PTLA 3KQLA 1FPMA 3Q85A 4Q1FA 5J4LA 1YQTA 4JVSB 1H8HD 5C46F 2GCOB 1YE8A 1T0HB 3BH7A 5CJ2A 2VEDA 2F9MA 2OHFA 4LBYA 3NDPA 2UZ3A 3NIBA 4BECA 1TQ2A 1LS6A 1UAAA 2RKOA 2YOFA 1E9DA 1JQJC 3F0TA 3KJEA 1MH1A 1KO1A 1XTKA 4D4KA 721PA 3O8CA 3GJ6A 5HTKA 3TSWA 3QI2A 3VKWA 1S0UA 2GJ8A 1W4CA 3PUVA 4Q1BA 5HE8A 4CT4B 2XZOA 4LBVA 2D2EA 1YRAA 3F8TA 2ATXA 2PCLA 3IIKA 1QHNA 4PSAA 2C95A 5ANRB 2ZI7A 3TAHA 1M7BA 2ZS7A 2CE2X 5DN6A 2GCOA 5JCPA 2VP5A 3WMGA 1QHGA 5AUOB 3LVRE 1IHUA 1XD8A 1OB5A 1Z2AA 1XMSA 2F1HA 1SVKA 4ITRC 4EIWA 1T0JB 4CEIA 4Q9KA 1NI3A 4QFMA 2BWJA 3GEHA 2Z83A 4A2PA 4A0HA 3R8CA 2ZRPA 4LHXA 3A1UA 3ZS8A 5CB8A 3OAAA 3V9PA 4JL5A 4F7WA 1GRQA 4POAA 3T12A 1XMIA 4JVNA 1N6RA 2DY1A 2FPMA 4A0RA 4RKFA 5TARA 3DKPA 4TLCA 3SJCA 3SDZA 1AKYA 4Q21A 4MGZR 1S96A 1Y63A 4KLZA 5TV2A 3EPLA 2HCBA 1KNXA 5EQTA 1MABA 5LBIA 3B8HA 4FWIB 4GP6A 4KFSA 3BOSA 4YLGA 1NSTA 3LVQE 4DCVA 3KQHA 1GL7A 4B75A 4FN5A 1GOTA 3VR2A 3GJXC 2IBMA 2H16A 2C9CA 4UJ3A 2WWHA 1PZNA 1FNMA 5FFMA 3W6NA 3K09A 2WPDD 1X1RA 2AFHE 4Q18A 3U5ZB 1XTRA 4TYWA 4PO8A 1TF7A 1OIVA 4B35A 5CITA 3IHWA 4ZI3A 4V0OA 1DAIA 2WKQA 4A2WA 1L4YA 3RRYA 2O8CA 2FOLA 2YWHA 1NVUQ 4ZDKA 1R8SA 2RGEA 1Q0UA 4I1UA 3GLFB 4M1SA 1KJWA 4YC7A 3MD0A 5CDFA 4EQ6B 4QM6A 2ZYWX 1Z47A 2ZRBA 3KJIA 4OK3A 1MRSA 4LJ4A 1G64A 2HJVA 1GSIA 3CR7A 1D9ZA 5KU1A 1IAQA 1N6OA 4IOJA 3KZ1E 2NO7A 2G1JA 4Q1EA 5HCNA 3KB2A 4NP6A 4JBWA 2ZRAA 1QBKC 1Z6XA 2R65A 1E2LA 2JDID 1JR6A 2VF7A 5FTMA 2IEYA 3H1TA 3GLFA 2ZSDA 1RE0A 3RANA 4MKFA 4MUAA 3JVVA 3Q9LA 5FTJA 4EQ6A 2BCGY 4PSKA 4XVQA 3EC2A 4M1MA 4M1OA 3RYTC 1G8YA 2BCJQ 1E2QA 4OJKA 1JQLB 1G5TA 1OFUX 1NLZA 1DG1G 1ZD9A 2QT0A 4JLOA 4Z1MA 1QHIA 2ZTSA 1KO8A 2G0TA 1W44A 4TL8A 5C1BA 1Q3TA 4DDUA 1Z6GA 3GLHE 5AJZA 1UKVY 1V5WA 1B23P 3W9YA 1HH4A 2BDTA 2ZRIA 3BD9A 3ASYA 3WRYC 2WWXA 2ZAOA 3LD9A 1ZM2A 4QKQA 4DSNA 3V4RA 4OJQA 1TADA 3WMFA 1CTQA 1DBSA 1KZGB 4NCKA 1FW6A 2W6IA 2FSIA 1ZC4A 4I81A 1DEKA 5JCZA 3GCGA 2RGGA 4IDOA 5GVSA 1U8ZA 2CL0X 3VR5A 5IK2D 1S3SA 3UWKA 4N3NA 2YKGA 5KPJA 4XD7D 4GFDA 3H4MA 2ZJAA 2WOJA 2FWRA 1HQYE 1T5LA 4C0QC 4BE7B 4JBYA 3TVDA 2PT5A 2VQSA 3U7HB 4D0LB 2F9LA 3QJYA 2HF8A 5AJWA 4YONB 3OIWA 1A4RA 2IYUA 4DLZA 2GEVA 1KI3A 4B3GA 2D2FA 1GRNA 3U4QB 1OXSC 3KQUA 3WNDA 2CEAA 2I1QA 2NO6A 3W5JA 4QBHA 4TTRA 3I92A 4KSBA 3HWSA 3T35A 4DLWA 3TW8B 1N5KA 3ZGXA 3KXLA 1DE0A 5AJYA 2J5XA 2CNWA 2D7CA 1Q1BA 4G0NA 2ZJOA 1XEXB 1XCMA 2D06A 1KMHB 3BAFA 2BKUA 2GK7A 1ZUIA 3K0FB 2OAP1 2E9SA 4Q48A 1XX6A 1TPZA 2GCPA 4LV6A 1R5BA 3W34A 4EDHA 3U4QA 2BJWA 1F2TB 3R8FA 1LF5A 2OBMA 3AB3A 2NTYC 3AP2A 3L0IB 4HAUA 1U0LA 2VP9A 2WBLC 2LKCA 4RY2A 1SVMA 3P4XA 4HEJA 3CLVA 3UG7A 2H18A 2XNSA 2J7KA 3FHOA 1JJVA 4KHZA 1NLFA 3EZFA 1NIJA 3QG5A 1XPRA 4RFVA 5G53C 2FU5C 4PPFA 3U7EB 4D4JA 1XEXA 4D82A 5JSZA 4L5BA 3ZS9A 2ANBA 3K0CA 5FBWB 5J4HA 3AV0B 5JBQA 3LA6A 2X1VA 3K0FA 4GZMA 2BEJA 2ZRDA 4MKIA 5BN5A 4II7A 4TYQA 1F2TA 3JZMA 5KNCA 1UPTA 3ND8A 2G9NA 1ZUHA 2HDNB 2J7PD 2ZRMA 3SZRA 3LQQA 5IT5A 3GLIB 1KK1A 1M34E 1U81A 1YHNA 1QHXA 5IF9A 2DWPA 3B13B 4G5OA 2SHKA 4D2IA 5K8TA 1LF0A 1M7HA 3VHLB 1S2MA 1UJ2A 1P73A 1US8A 3EWSA 1EX6A 3BB4A 4LYAA 2I3BA 3BB3A 1WB9A 1DTSA 4BPBA 4RCYA 1M8PA 2GAOA 1Z0DA 2HJGA 4TL6A 1NVVR 1KZ7B 4W5HA 4X8OA 1TU3A 2NZJA 1COWA 3GJ7A 4KSCA 3T1VA 3IO5A 5JWHA 5HPYB 4ZKEA 3PEWA 3MWJA 5EXTA 3GLIA 3AKDA 1QHHB 2CCKA 1U0JA 4AYXA 2QY9A 3QKTA 5C2JB 3NBYC 1BKDR 2O0HA 1IXSB 5F9HA 4TQAA 3WRXC 2W2XA 3SN6A 4YXWD 4QGGA 2FDCA 1YZTA 3LX5A 4U00A 2BBSA 4U02A 2IXEA 3QENA 1ZMXA 2C03A 3Q3JB 3REGA 3NBFA 1GILA 3TH5A 1E79A 2JCSA 3A58B 1IN6A 2VIIA 4ZIRB 4M9QA 5DH9A 2BBOA 1NVVQ 2YV5A 2A5FA 4KAXA 2JIZD 2QSYA 2LWIA 1H8HA 4MA4A 1V43A 1AQUA 4M1KA 2YC4C 4JL6A 4MRRA 3DMNA 1YJ5A 5GADl 2JLZA 3B85A 1EK0A 2ZR9A 4B6FA 4DRZA 3HDTA 4C0BA 3D7MA 1E9CA 1ZCBA 3B9QA 3U44B 1YR9A 4P32A 2PLRA 2OCPA 3NBZC 4B2PA 3AP3A 2VF8A 1E3MA 2ORVA 2YHSA 2HT1A 1G17A 5IRCD 2JLYA 3PJRA 4BASA 3PUYA 1E4VA 3NC1C 2FA9A 3L82B 2OBLA 1FX0B 3BWDD 3TW4A 3K9GA 4KLNA 2REXB 2BEKA 5SZHB 3IGFA 3QOFA 4B48A 3THOA 3T1TA 3VQTA 2DYKA 2VSFA 1MKYA 1TQDA 4RFSB 4PPGA 1XJ0A 2ZANA 3Q5DA 4QNRA 5EZ6B 4N0EA 1SHZA 2PCJA 4C30A 2P65A 4O2LA 4B3CA 1DELA 1Z2CA 1NN0A 1OFIA 1G7RA 2QE7D 3K9HA 2GEDA 1BIFA 3MWYW 5FUYA 5AUQA 4X8MA 2ZR0A 2NZ8A 1NJFA 2BM0A 1LB1B 2AX4A 1QF9A 5H1YA 1FX0A 1X8JA 2ZRNA 5DGXA 1XXHE 2C2HA 3EIHA 1VCOA 2B92A 5SZJA 1WP9A 1MO5A 4FMCB 4KU4A 3X1DA 2DFTA 2ZAMA 1SQ5A 3BRWD 3RNLA 4RFSA 4LK2A 4IEIA 4URWR 2WPDA 3CPEA 4LDJA 4PAQA 3RHFA 1N3BA 2WIAA 3H84A 4PHTA 1P3JA 4FCWA 4WZBE 1RRPA 4BLPA 3Q72A 1HE1C 5DN6D 3UPUA 2CHVA 1W2GA 4KITB 2C99A 2KBEA 3AEZA 2OLJA 1E4YA 3BJIC 3GLHB 3C16C 1X3SA 2OAQ1 1DO0A 1OFTA 1Q3HA 1G4UR 1HQCA 5JHGB 3I1FA 2QG6A 1XRJA 4BFVA 1N6HA 3FYHA 4HDQB 4OQXA 4B3FX 5J4KA 1XBTA 1KOFA 1AA9A 4AI6A 4IFBA 1WBDA 1TF2A 5KNBA 1F2UB 2C5LA 5A5GA 4BWYA 3N70A 5CJPA 4HATA 2EWWA 1G3RA 2JJ8A 4LHZA 2KSQA 2XSZD 2ODWA 4A0GA 5E7IA 3N2IA 2JDIA 4HAYA 3QY0A 2EFEB 4IOLA 3GLHA 5DIFA 2WWGA 5EP4A 4ERNA 1OE0A 4C2UA 3GEIA 4BZQA 1KI2A 121PA 1W7AA 1VHTA 5EE5B 1W4AA 4Q5IA 1R2QA 2P5SA 2R62A 4ZDJA 1F2UA 4DDVA 3OZXA 3QKSA 4B74A 3NDBB 2KI5A 3RS3A 3B9PA 3NVAA 4JJZA 1EESA 3EC1A 3OIUA 4F4CA 4Q1DA 4AG6A 2VP0A 4HAZA 3M1IA 1W4RA 1R7RA 4NL4H 1GNRA 2ORIA 4OK5A 3OEHD 1KSJA 4OI2A 3RSOA 3FTQA 3NEYA 3ZQJA 4EFNA 3OE7D 2ZJBA 5JWOA 1ETUA 1GM5A 1N6IA 4NZYA 2QPOA 3X1ZA 4Z8YA 4BFXA 3KFVA 4L9SA 4GMXA 4FINA 1G8PA 5IK2A 4US2R 2ONKA 1FUKA 1QHSA 5L8VA 4Q4JB 3SFVA 3K53A 1KSHA 4UXJA 5FH9A 3AF0A 4XD7A 1GKYA 1JB1A 2ONJA 2X2EA 2A30A 5CDFE 5J4VA 2UVQA 2Z0MA 2ZVQX 3ZDQA 4NTZA 1AQYA 3QXJA 4HZIA 2C96A 1UBEA 1R8QA 3BGWA 2XXAB 3CNLA 4LI0A 2ZRFA 3G82C 2GWHA 4B34A 5E95A 4JVLA 2V54A 3PXGA 3ZJYA 4GOKA 1XPOA 2OEPA 5FPSA 2PH1A 2QMOA 1NMXA 4V0ME 2ZUBA 3LXRA 5FBRB 2A5GA 1N6PA 2QQ0A 5BYJA 4GI7A 3GLFE 2QMUA 1LVGA 4BZPA 2FPKA 1CULC 1CR2A 2NG1A 4OBEA 2P5TB 3NEJA 5CLLA 2ZRKA 1SXJD 3E2IA 1GAJA 2UKDA 4N0DA 4LOAA 4RZ3A 5FR1A 1E2EA 3HU2A 1C1YA 3HJNA 2MSCB 1U98A 4F4IA 4CEHA 4AKHA 4Z54A 1BMFD 1N0WA 4CYMA 3GFOA 3MWLA 5J40A 1EG7A 5CLQA 3PIRA 1CU1A 2MMGA 2QRZA 3D31A 4FMDF 1YKSA 4Q7MB 3TVTA 3ADDA 3L0SA 2PJZA 3TJZA 3ZYCA 4D0GA 2DBYA 3WNBA 2J0SA 1FZQA 5J5CA 4BLTA 2JLSA 1CS4C 1HT2E 2AKYA 5JRZA 1EX7A 2VHCA 4WZ6A 2ODNA 5GVRA 3SOPA 3TQCA 4ZV4A 3K70C 3CH4B 1KSGA 1J70A 2UZIR 3RS0A 2J7PA 2CNWD 1Z6AA 5B2ZA 4X8HA 3M6AA 1K8RA 2DFNA 1X8KA 1ZD1A 1BOFA 3NWJA 4MRVA 4NYIR 4D80A 4RKEA 4IHQA 4Q47A 1CF4A 1KI7A 1I4TD 3E70C 4RVCA 3BBPA 4TSFD 2V6JA 3A8TA 4D26A 1HURA 2YWFA 4PR0A 3AVOA 2X77A 4ESVA 4CT5A 1RIFA 3G0HA 1N6LA 2CCJA 1GP2A 2EFDB 3LBNA 3NC0C 2JJ2D 1P75A 4TLEA 4LCBA 2IF2A 3TGPA 3ICQB 3BIFA 2ZE7A 2OCAA 2ZI5A 1T6NA 1GDDA 5J4YA 4LJAA 5JS7A 3BFXA 2IYZA 1VIAA 5FUWA 1Q1ZA 2R6GA 4U5XA 4ZDWA 3FWYA 5LDDC 1LY1A 1S1MA 2L0XA 4WZAE 1E9RA 1GIAA 5FOUA 5FL7D 3VKHA 1AZTA 3EIQA 5DE3A 2WMNB 4GP7A 3R7WA 3CZPA 3K0SA 3TR0A 5LB2A 1K5DA 2Y8EA 3C4JA 4RD2A 3VX4A 2Z5FA 2GXQA 1KKMA 4A92A 3K70B 1N5LA 4QL3A 2JIZA 4JSTA 5CM8B 4B2LA 1CJKC 4DLUA 4KVAA 4TYNA 4LJ9A 4C3ZA 3LBIA 1ZINA 1XXHB 3T5GA 4AYWA 1YZLA 3MAAC 3JVUA 1NSFA 1Z0IA 2H8KA 1OH5A 3CWQA 3R9IA 1TUIA 1KMQA 2FEOA 4JZKA 1S9HA 3A4LA 2V1UA 2CVHA 2XJ9A 3TBKA 2O8DB 3I8SA 3KUDA 4FCTA 1OV4A 3U3OA 1Z3IX 3FE2A 3VR4A 4UXHA 5FPYA 2J0UA 4MKGA 1CXZA 4P4TA 5HCIA 4EUNA 1XEWX 1KKLA 3TR5A 4H1VA 1UEIA 3VAAA 1XXHA 4BFSA 2BV3A 4HAXA 2C78A 2QTFA 2IS4A 1H8ED 2GZAA 2ZSEA 4N1AA 2BBTA 1UBCA 3VX3A 4BEJA 4LPSA 2WM9B 1D9XA 1G7CA 4EKDA 2H7VA 2W0MA 3B6EA 4B3XA 2O8DA 1LNZA 4HLQB 4E07A 1BYUA 2QE7A 5G3YA 1LFDB 2WJHA 3SQWA 5TY0A 1G8HA 1VG1A 2KBFA 2CBZA 1NKTA 1FL9A 2GZDA 2OG2A 4EPTA 1UBFA 3HR7A 1T4GA 4CEIB 4NU0A 4DCSA 2C9OA 2HYDA 4MRSA 4I1SA 3RS7A 5P21A 3TUJC 1DADA 1KIMA 1U8AA 1E96A 1GVNB 2ZI4A 3GJ0A 4WXPA 5EXXA 1VKJA 1MABB 1IN5A 2OILA 1RPZA 3DMDA 2ASEA 2J87A 4NHOA 3D3QA 4JT2A 1WMSA 2QMHA 1NKSA 1ZIPA 2IF0A 3MCAA 3QKRA 2QAJA 3ADBA 4E09A 1JR3D 1NIPA 4V03A 4QGFA 4BLQA 2AKAB 2WJVA 3IO3A 5DSZA 1D5CA 5EE9A 4L9WA 2G77B 1DAMA 3F3YA 4M4SA 1HEIA 3KKMA 5EE3A 4B73A 3SC3A 4L16A 3KJGA 2V6IA 3A4NA 1ZBDA 4JLNA 3AKCA 2WJIA 2O8CB 1ZYUA 1VG0B 1G20E 2W6JD 1R5OA 1LTQA 3Q7QA 2BBWA 2VP6A 2XSZA 1T8UA 1SXJC 2Q9BA 4TT3D 3QF7A 1E0JA 2OE2A 3RRNA 2WICA 3C8UA 2C04A 4LV5B 4BQSA 3LRPA 3EPHA 1AS2A 2ZS8A 4PO9A 5FPHA 1OHHD 3EWAA 3RS2A 1OFHA 2D74A 2WOOA 3QVVA 4V0NA 1ZD8A 4EJSC 1NP6A 3PENA 1AM4D 1II8B 2PZEA 2YOHA 1DAGA 2C8VA 2CL7X 3RLFA 3ZZ0A 4TMWA 1CKEA 2QPAA 4XTRA
chains in the Genus database with same CATH superfamily
2Z4TA 2WYHA 4JWTA 2TMDA 1YULA 4PLZA 2V7GA 1VIVA 4HPJB 2QVBA 1RLMA 4JLBA 4O3FA 3E7XA 4RD0A 2ZJ7A 3HO1A 3HTXA 1SA0A 3K8QA 1MORA 2CFIA 3TRHA 3IP9A 1WV0A 3T0IA 3WK4A 2RHOA 4CUZA 2IYLD 3ECAA 4FYWA 1GG9A 1JQBA 1KWKA 2REQA 1T5OA 2OCIA 4WH0A 1QWSA 4UPVA 3RFXA 3PPYA 5TS3A 5BN3A 3PSHA 2D0IA 4W5JA 4C0SA 1ZK1A 4TKZA 1QYDA 5ALWA 1PFGA 1GVHA 2EFCB 4G1MB 1R27A 2QTBA 4I6GA 4IIDA 4NFYA 2WV9A 4ZT7A 5K0NA 3U3JA 1NMEA 1CJCA 1QRUA 4WACA 1PWZA 2A5LA 3MCVA 4JHLA 4EMTA 1EVYA 2Q50A 3V6MA 3QVJA 4DILA 4EW2A 1JYFA 3KQMA 2CDCA 4KUHA 4V0MA 1SMKA 2OV1A 3ESCA 3I5UA 2IHBA 3Q15C 4DQLA 2CXSA 3K5IA 2Q5QA 3PGXA 3O75A 4TKUB 1C1XB 1M7GA 2Y2VA 4JU9A 3WDMA 5TB5A 2OCLA 3GVIA 3I9JA 3DYIA 3RUIA 3OWXA 1BDBA 4OHVA 2QRMA 5FBVB 1SXJB 1SCDA 4BO1A 4PVDA 4EK9A 3JQRA 4AZ0B 4D9MA 2YVKA 4G3XA 3K0CC 4HGPA 4TVKA 3QTTA 4MQ6A 4B5LA 1C3VA 4JOQA 1E3DA 4X3CA 3HXTA 2ZIVB 4RHXA 3BT7A 3EZ2A 2WKRA 4ZZ3A 4EJSB 4ZTUB 3KLBA 1CD5A 4UUPA 4WI1A 5LKRA 4QAQA 4TKUA 1O94D 4KO4S 1C1XA 3TUIC 4CRWB 3FOFC 1M8FA 1W0JD 3OTIA 2ORYA 3OA0A 4JQZA 5ETJA 2XTZA 2JA1A 5DI3B 3LPDA 1SXJA 2V7QD 2BFFB 1LX6A 3AHJA 3WHPA 3V8BA 5B12A 2IH4A 2EX0A 3G5UA 4BO8A 2O7VA 2DUJA 4YMWA 4AZ0A 3A3KA 5A7FA 4ES6A 5AJXA 1JLKA 2QA5A 4QQ8A 4H7HA 4MVCA 4X64B 1CJTC 2KLBA 1L5VA 1L5HB 4RMIA 3UUEA 5EZQA 4Z4HA 1ZH4A 4DDWA 1CUJA 3V32A 5LM3A 3J80A 3U1BA 3E9QA 1C0KA 4M1YA 3ZTTA 3H4IA 5IDYA 4EJSA 1EP9A 3A9UA 3L07A 2BY4A 1QFXA 2NUAB 1NOJA 3CNQS 2ZIZA 2MMCA 4ZZ2A 4BV3A 1PV4A 4G4SO 3A9RA 2BMEA 4Q7EA 5DI3A 1GQRA 4ZAWA 1VTKA 4ECEA 1A3CA 1ECGA 2BFFA 2XUHA 2YY7A 3O82A 4DVJA 1IJEA 2D4HA 2V45A 1CQJB 3ES9A 3TNLA 2ZP1A 1JU4A 4R3WA 3AL0C 4J49A 4BQNA 4EI8A 2I76A 3JRWA 1XKLA 2QZ9A 4KXXA 4Z3OA 4YO7A 1L5HA 3LO5A 5EERA 3DF9A 4E46A 4IF4A 2WYWA 1BH2A 3ZCRA 2WF8A 2XYHA 4IDNA 1TEVA 1FTGA 3IVXA 4MUBA 1V1RB 1JS1X 1NQAO 5HIIA 5JSQA 4KXYA 1OA1A 1PFUA 2XTNA 3DEJA 4FIZA 4NDNE 1PEAA 1PYOA 4JNKA 4TSFA 1YZ3A 4JLPA 3U39A 5HS4A 5LUAA 1F7VA 3UAWA 4RTMA 1Y3FE 2SICE 2HWWA 3BX1A 2VA9A 3E6AA 1PK7A 1CQJA 1E1MA 1GKIA 2QLFA 4QD3A 4BO2A 3H75A 1J0BA 3HLTA 3RDPA 1JI3A 4DW8A 1VE3A 5LUBA 1Z8FA 4HQKA 2FKNA 3GXBA 3VM6A 4F45A 2BGLA 4CMGA 4I4CA 2Q2QA 1RXWA 4IZOA 1Z4QA 4IZHA 1OX4B 4YRIA 3JQAD 4BJ5A 3P32A 1PLJA 3ONNA 3IXMA 2G7ZA 2GEBA 5FOWA 1CBUA 2G76A 1RHUA 1V1RA 4BNZA 4ETIA 1WZUA 3DVSX 5TPWB 1A8IA 3DG9A 3AF1A 7GPBA 2W00A 3NDIA 1XA4A 4J03A 5IEJA 3H99A 5E8RA 3RPEA 4LF6B 4BP8A 4TL9A 3INYA 3MBIA 5F76A 2X6RA 1YHYA 2GTHA 5JC1A 2QD3A 2YNMA 5DHRA 1IC6A 1FFEA 1YUBA 1CZLA 3RAJA 3V33A 2FUKA 1TW3A 1NVTA 3UJHA 2QIOA 5L4LA 2VR1A 3QU9A 1N2CE 5BQPA 2O8BB 4U7HA 1OX4A 3DMTA 3R3JA 1TYCA 3U4IA 5BUCA 3MJVA 3Q87B 5FYDA 5K6AA 1P2DA 1Z4PX 2OHXA 4FEEA 2DPHA 1PU2A 2DMRA 1VL8A 2QNRA 2AI3A 3A1SA 4NDZA 1O1YA 2WF6A 3FSJX 2H1LA 4YRCA 5ECGC 3TSZA 4R3NA 4RK7A 2I34A 4OKSA 4R8SA 3BQNB 4XVCA 5I48A 1OZHA 1USKA 3LZ6A 4C22A 1B74A 1HG0A 1Y4UA 4MW1A 4DREA 1NW9B 5KOHB 4YRTA 2R0QC 1X1CA 1QCZA 3WL7A 2YV3A 4EHIA 1QTQA 3LY8A 2AOVA 1ZAYA 4G0YA 3EXIA 1MJGA 3C1OA 3O31A 2A67A 5E7JA 4DUPA 3DFKA 5BV8A 4IIBA 2ZUCA 1BQEA 2B8JA 1RBMA 3C3AA 3ORRA 1JBQA 2O8EB 1NE2A 1PNOA 4PXAA 2O6HA 3GHHA 5AK0A 5K6RA 3V8QA 3U7GA 2ODTX 3HGTA 3NTRA 4CEJB 2QR5A 4GPIB 2QI9F 1PFYA 4PFSA 3WLOA 2HWYA 3Q8MA 3AKYA 2PGAA 4AX4A 4J3FA 4ZVOA 5FEMA 1JKFA 4E14A 1XYVA 2I2DA 4L3WA 3RRZA 2OUKA 4YMTA 5GZ1A 1RXVA 1O6FA 4MI9A 4AY2A 1H8EA 1L7QA 1RTKA 1H85A 1P62B 1ZAKA 2Z8YA 5F77A 1MEJA 3I28A 2KLHA 2C9YA 1K88A 2VPZA 1VC2A 2VZEA 2Z2KA 3OY2A 4TSKA 1CJMA 2GAJA 5DHPA 2NYRA 1QV9A 5JPCA 5IKEA 2DKFA 4YIHA 2ESRA 3AW8A 1JB9A 3HKDB 1M76A 1J99A 1GGNA 3RT7A 5ERXA 4C01A 3QU4A 2O8EA 1ZONA 4H2DA 4AXXA 4HQNA 3WS7A 1G6HA 2CHGA 2V6FA 4IJVA 4CEJA 2HMAA 5L4NA 2ZETA 3SC2B 1TJYA 2VJBA 3F9IA 3KJHA 5FIUA 5U9CA 2O54A 1V6CA 3VR3A 1OU4A 4R9RA 3EVZA 3HZRA 1WSBA 3AR9A 4R05A 4U6NA 5ICEA 1JFFB 1M6WA 4IDPA 2X4IA 3T3MB 4BJ6A 5ALIA 3C7AA 2OK7A 4YT2A 3ZOKA 4JLMA 3SF0A 1FYDA 4TYMA 4DM7A 1Y81A 2Q3DA 1I6WA 1RQPA 2RJOA 1ISMA 2OMKA 2R7KA 3B89A 2HU8A 4MCHA 3HKDA 2D0OB 2F2TA 1M2KA 5L4SA 1OJLA 3VH2A 2DBZA 3AVVA 1R9NA 1YZKA 2O1EA 4FNGA 1NTOA 2H11A 1TM3E 4YALA 3BXEA 4S04A 1JR3A 4OHYA 2OL4A 1JHZA 4FJ0A 3IAUA 3HYRA 4JCCA 2GJSA 4QG3A 1PZEA 2VK1A 2RMKA 2TMKA 2ZXEA 4IKPA 3IURA 1D09A 1JFFA 4TTJA 1G4HA 4ZWNA 3ISVA 4IIVA 1Z4OA 2FPUA 2P7HA 4N54A 5I7WA 1CQZA 1IOLA 4IY1A 2XGMA 4X71A 1KAEA 3WV5A 1HDCA 1TIBA 3CB4A 3PP8A 5EP3A 5E6RB 1FS5A 2GPNA 4NRDA 2EKPA 3UK7A 1TK3A 1EFTA 2ZEJA 2YC2C 1M5UA 4I5IA 1JPUA 2JGFA 2PEZA 3LCVB 2X41A 2WHXA 5J1TB 2VWPA 1H65A 3NDRA 3W5BA 4UM9D 2CHUA 5F2EA 1SCAA 2IYVA 3RSQA 2QBYB 3EDOA 5IBCA 2I6UA 2GJ9A 2F3TA 5EYPB 3QU5A 3RF7A 3SBEA 3SFZA 3UICA 5DO9A 3VHXB 1JV2B 3I5AA 4U7WA 3I01M 1E9VA 2QENA 1YDMA 4KN6A 4Y2UA 2IKSA 1ZUD1 1QZUA 1OLSB 2WSBA 5JJLA 2QTVB 1X6VA 3I2FA 3ZG6A 2P3OA 1P2TA 1JVSA 3FA2A 1J0DA 5AKGA 5E6RA 4OA5A 4M8NE 1UK8A 1XRLA 5BN1A 4QT0A 5AQEA 2CHQA 4AIRA 1XZLA 3R7LA 4C3OB 5AI5A 4XWKA 2YV4A 4J2HA 1WVMA 4JC5A 4G8DA 4RVFA 5LJLA 1TFRA 4UNIA 1JR4A 3AIOA 2XVYA 3AG5A 5JD5A 2QXUA 4LW8A 4MZDA 3PCTA 3M6FA 1HWYA 2GF9A 3ADOA 2Q2VA 3GGOA 2QJTA 3QKSB 3LZCA 5EZ5A 3VHXA 3VPDA 5IJ9B 3UV7A 4C4PA 5I8WA 3RK1A 3RVDA 2F1KA 3GLTA 4E7OA 1OLSA 2JW5A 1IWOA 1GN9A 2IYAA 4WCFB 3ZCTA 2W2QA 2FK7A 1Z75A 4H7PA 2GAIA 3LFHA 4LUCA 3BILA 3PKJA 3A4VA 1BQ4A 1O8CA 1IZYA 1LQ2A 1F0PA 1N9GB 2GMWA 3QA3E 4DB4A 1JH9A 2FDRA 4Q15A 5EFOA 3FVVA 4X60A 3UT5B 3IOBA 6ADHA 4C7XA 4QUAA 2ZSJA 2ZJZA 3T5TA 4WD3A 3KT6A 4MW7A 1GG2A 3HJCA 4AZWA 4Y1GA 5KKCA 1ZRMA 1CUSA 4NYJR 5IJ9A 1FOEB 1QIFA 1EFDN 3PGKA 1OA0A 1Z2OX 1NXTA 4K81B 1EFRD 2E82A 4GICA 4WK0B 5BWCA 3ZWWA 2PX0A 3GLRA 3UK2A 4B87A 3ZDAA 4WCFA 1AK2A 1EM6A 2H1RA 1YOVB 2IIQA 3BJZA 3G9ZA 4GPBA 2QP3A 4RD3A 1YB1A 4UDYX 1PTJC 3BB1A 5LKAA 1AXRA 5DWDA 3AJRA 1N9GA 3IV9A 5H70A 2H54A 4YAFA 1ULUA 1ZGJA 3RC9A 1ZNYA 4YJ2F 1NMZA 1T1JA 3UT5A 3ZWQA 5B7GA 4Q9AA 4ALJA 5ED0A 5EFZA 2GJKA 1NR7A 1T2UA 3INNA 3G8AA 1YE3A 2EWMA 3IR7A 3OWOA 4ID3A 5ENZA 4ZCLA 1AGPA 3T5MA 5JFTA 4B6JA 1E7SA 1R0RE 3Q8LA 1YR7A 2X9NA 2ZPTX 3K0KA 3V7UA 3WYEA 3UMVA 4K9MA 1BWPA 1H4TA 5FOTA 3ZLJA 2XQGA 5A4DA 3RYIB 3MUFA 5B30A 5KYYB 1YOVA 3OG9A 4DMKA 3PTAA 2AE2A 1CR0A 4DUGA 4JB0A 1O87A 1SR8A 4I2NA 2ECQA 3OMXA 4O5AA 1PDWA 1QQTA 1OUMA 2Q9CA 3JV7A 1NYRA 3DKVA 3KJQA 3NJ4A 2J4CA 1XRRA 2VWHA 4OQFA 4RVUA 5FAXA 2R7MA 2HRBA 3MWKA 5ILGA 1JECA 1TZBA 3I05A 4M60A 1JPJA 3FHTA 4PR3A 4H7JA 3W5IA 2QW0X 5C1IA 2CK3A 4ND6A 3NETA 3V8VA 1G2PA 4X3PA 1ZJJA 5CTJA 1KHHA 3ED5A 5JR3A 4FQ5A 3DDCA 1Y4SA 3OFND 4I9HA 4N3BA 4XASA 1JIIA 2IU3A 4DDTA 2FQYA 2D59A 4CM9A 2VJPA 3WK6A 1AUQA 3SEZA 3RYIA 1CSEE 3UMGA 1G21E 4ZJUA 3B3FA 1Q7BA 3LUJA 5KYYA 1NQOA 3R5KA 3V7YA 2F1IA 5DHSA 5CIYA 3B9BA 1OT5A 5DPMA 2IS2A 3CNOA 1RWMA 3MJEA 2RARA 1JWAB 4P82A 5EOVA 1GSHA 4Q3KA 5B1IA 3GA7A 4D98A 4DWOA 3OKPA 3R7SA 1YAJA 2OOKA 3T15A 2WFLB 2TMGA 2DOKA 2BCEA 4B6PA 1OYYA 3JWGA 4IHAA 5TQ2B 4BRWA 1I5EA 1GL6A 2R8YA 4I8XA 4D6YA 2Z4RA 1N9ZA 3SK0A 3SVLA 3JQCA 1ZD2P 3DLCA 1UC4B 4IUDS 1ZCJA 1BQ3A 1O4VA 4HFNA 1MMFB 4CUKA 1X1BA 4RD6A 4UW9A 4E2YA 2LCQA 5LN1A 4BNGA 1JZSA 3IUNA 3EMKA 3RW9A 4BXOB 3PNSA 4YMIA 1ISHA 1BXKA 3FM9A 3BXZA 4TLBA 1B6RA 2KJQA 2PZAA 3ETDA 3JTMA 4FCVA 1IBSA 5DBOA 5HZHA 5LSAA 4HUTA 5JRDS 4MHSA 4JLWA 1WCV1 2WFLA 3WMRA 4AQYB 4CU2A 1U65A 2XEXA 3BPSA 4G37A 1XZIA 5TQ2A 3TXXA 4UNRA 1X7WB 2I4TA 3HP1A 1PO7A 2CYBA 3BH0A 4RANA 3ZN2A 5TIIA 4GWLA 3ROZA 3TE6A 1PT8A 3QOYA 5E9JA 2GWRA 1E0AA 1B41A 2NLOA 4S1OA 5IAKA 3C74A 3AL2A 3O8RA 1KK2A 2VYND 3JQDA 4WJKB 4EB3A 9MHTA 1NNSA 4HI0E 4EGCB 1QO0A 1WSWA 2FPPB 2FPIB 4BXOA 4KQXA 2ZTLA 4EKEA 2E18A 3QITA 1GG5A 2M6SA 3SI7A 4E1AA 5HJ2A 1YONA 2B7LA 2XE8A 3MJSA 2QN8A 2G04A 5F7OA 3ESAA 3V7FA 4DEYA 1NATA 4NS1A 2B61A 3DE2X 1J8MF 4ENSA 2XITA 3P9RA 5JS8A 1J8DA 1HFJA 2I4LA 2QVLA 3B7WA 1X7WA 3JQPA 4LJYA 4LRQA 1Z35A 1ENOA 3HDGA 3PRYA 2YZGA 4HSGA 3HJTA 5CG2A 3JQEA 3L1VA 2I7VA 2ZKLA 3H1FA 4HB4A 5AVUA 1E0DA 4O3MA 1C8VB 3H9UA 2XVMA 2B9VA 1D2MA 4YV0A 3SHOA 4DNOA 3QEBZ 3QUQA 2FPPA 1H69A 2B8WA 2FPIA 4E4RA 2G67A 3EDMA 1JEQB 3S28A 2RIPA 2XUIA 4P4GA 4M8IA 3BA6A 3OTOB 1NDQA 2ZE6A 1E9SA 1KAMA 4Q7KA 4YGYA 3DEYX 1JVBA 1W0KD 4H3KB 2HTFA 4RZ2A 4HX2A 3PUHA 1G3IA 4LYYA 1TX4B 4OAQA 2RONA 4REQB 2EJBA 3U3XA 3L6EA 3WMXA 3WJ1A 1QCDA 1UXHA 5T3UA 4XSGA 2F6RA 2QUZA 1LSOA 5BPHA 4X54A 1OAAA 2CBXA 1YZFA 1NVBA 3IKLA 1UDXA 3OHMA 3OSUA 3QE2A 3IBYA 1Q15A 2BE9A 2J0UB 4PZYA 3CUYA 3LSYA 1P0CA 3T7JA 2OM6A 5I7HA 4I9FA 1SUBA 1RI1A 3NWEA 4J8PA 3MSXA 4KIUA 4PQYA 1JEQA 2B7BA 3GZ4A 1Y6GA 2JGLA 4W9MC 2DUUA 5JZ9A 4Y6RA 1SB9A 1CJVC 4ZALA 3RQIA 4EZIA 2RE8A 4KIFA 1EX9A 4REQA 5DYGA 3DV2A 3WIEA 3NKVA 3PUXA 4LJSA 3IUJA 4Q1CA 1P80A 3K9WA 3RJ5A 1SQ0A 1N5IA 3FUCA 3VDMA 2GK6A 1WF3A 2WWFA 4CLRB 2QYSA 4K26A 1UZUA 2O2IA 1NI5A 3O47A 3KYDB 3U3DA 3EXEA 1PVDA 4LNUA 4OM7A 4LMPA 1FMTA 1D4FA 1TIPA 3LNTA 2BSAA 1JU9A 3PC8A 4OHBA 5FHQA 3UENA 5J2UB 1QVRA 3D54D 2OO7A 1D04A 1QRAA 2I6GA 2PKYX 2ADFA 3LL4A 3NFRA 4BBAA 3WWDA 1OH8A 1H2AS 3V48A 2RHMA 1DBIA 4Y0AA 4EWLA 5GJBA 5HM6A 3ONWA 2HB6A 1P6QA 1W49A 3WNZA 3ZE6A 4DIKA 1Y1SA 5AHRA 4TZ6A 1BS9A 2L42A 4N8EA 4GOOD 4L78A 1Y3AA 2CHFA 3QYJA 4EPWA 3L6UA 2PL9A 1CVIA 1EGVB 1OVMA 4TV9F 4POOA 4YRBA 5IJZA 5SV2A 3V5NA 2RH8A 4TN1A 2CL6X 1ZIDA 2ZBPA 4CI0B 2G63A 1UBTS 2XHEA 4ZTBA 4RPKA 4CODB 4CLRA 1GZVA 1UFVA 3B3AA 3CZAA 3KYDA 1X39A 1YB7A 2IY9A 4KXMA 4DYHA 3ACDA 4QVKA 1R6BX 1K8XB 3GDHA 4HLDA 4LTMA 5J2UA 1QIGA 2QMYA 2ZBFA 4D4GA 1BX1A 4NCHA 1U9IC 3GYGA 4B4DA 4O0LA 4N03A 3RJMA 3SQNA 1V3VA 1KOGA 3A7DA 1Y42X 4BV9A 1THTA 1TCCA 4AKGA 2VF5X 2X0NA 3O0DA 3IRUA 3VDNB 3H2GA 5HA5A 2COUA 4MUYA 4DAEA 5HZKA 4EA7A 5IZCA 4RLQA 4RC9A 4PX3A 3HBAA 4V0KA 4EHDA 1K08A 4R7GA 1VSTA 3DHVA 4H3SA 5IH7A 2ZQYA 1K4MA 2FF5A 5DB4A 4Q01A 4B82A 4XQ0A 2RGBA 2RGNA 4EVQA 3THXA 3L02A 2HMWA 3EWNA 4Y1FA 1ZSNA 3SEQA 3WGMA 2Q07A 3WBJA 3GLGE 2YJNA 1DQNA 4UASA 4IQGA 4EUEA 3BCRA 4L6CA 1BVYF 3B78A 4K9KA 3DKRA 1LWNA 4RD1A 5DZSA 3UWDA 2IP4A 3UKJA 4BMPB 1F9EA 2Q3JA 3Q0TA 3ZTYA 3ZIUA 1QDLB 1QYIA 4AY5A 4JMLA 2PS3A 1G55A 2Q0SA 4LWOA 1XDZA 4FN4A 1PQYA 4M21A 4UFOA 3ZVKA 3AU8A 1N7JA 3INGA 4MXDA 3WKEA 5LP6A 2WWIA 3IPRA 1IY8A 4E5NA 5J3JA 3BCUA 4WLUA 5EIWA 4D57A 4EW3A 4R01A 2UZAA 1MOQA 4NULA 4OV6B 4AMYA 1ECCA 1ENZA 2WWWA 4CIDA 3CUEF 2BTQA 1XIVA 1XU7A 4FKZA 1WAMA 2HRDA 3A6KA 4R7TA 1FSZA 3KSAC 1STOA 3ELWA 1OXTA 1PL6A 1JG4A 3DQQA 4R0VA 1N2XA 1TJ3A 1ZU4A 2DUWA 1CQIB 2HA0A 4PYRA 1EFCA 1NUHA 4Y6OA 4YRSA 4RIGA 4A8JB 1WY7A 3DE7X 1P77A 3PV0A 3IMGA 4AW9A 4GL2A 1R8JA 1GRRA 1FVHA 2AYXA 3JX9A 3KWJA 5CM9C 2CLHB 2G4CA 4JXJA 1SC3A 3CH6A 2XBMA 1N5RA 3KL4A 2NIPA 5E9WA 4NOLA 5THXA 2JGEA 4K2HA 3KKEA 3IAAA 2TECE 4G2TA 4G6ZA 4DR7B 5FX2A 3H19A 3N6VA 2HREA 5DLPA 5DGCA 5CCBA 3GJ4A 3THWB 2QQFA 4MLCA 2PJRA 4MAFA 3KOXA 4QUEA 1RWQA 1NR5A 1UPCA 2QRQA 3FB4A 3VBCA 5AJHA 1W4BA 2ZXFA 1OIXA 1Q1EA 3ZQ6A 2XGJA 5BNZA 3W1VA 3AM4A 3BJMA 2QJWA 4I50B 1CQIA 2D3TA 4KQ6A 5B7PA 2YINC 4Z9XA 1CDOA 1DBPA 1ZN8A 1TECE 4GS5A 4PPQA 4XJXA 3KKOA 2VXCA 3WQBA 1Z08A 2EW1A 2CXRA 1N2HA 4KXQA 4HYEA 4PX5A 2WJ6A 1P0MA 2JJ1D 2ZBRA 4PAOA 4QBIA 5IPFA 5MGNA 4N7BA 3SKXA 3CX6A 1ONSA 2H5EA 4LJ8A 1L6RA 2J1LA 3HCEA 2WU4A 4EYEA 5FBHA 1H3NA 2FJUA 4ZMRA 3ZVMA 1B8UA 1CQXA 1JALA 1I36A 2EYQA 2NXNA 4GT1A 4D56A 4WLOA 1NG1A 1DAKA 4DLRA 3I0NA 1PF7E 4I50A 4QBTA 4DMGA 3DOHA 1Y6JA 1D6MA 3ZDBA 1GZHB 1UXOA 2PQ0A 3U0BA 4ZKDA 5EEGA 2SECE 3NV7A 2B82A 4X97A 1NFQA 4B33A 2P1ZA 4F46A 1YS4A 4YAIA 3I0MA 4W5OA 4WCVA 3PEVA 3ELBA 1VA5A 3KFXA 4AWBA 1EWQA 4HAVA 1NP3A 1RQRA 1QPGA 2SKEA 4AL4A 4KQGA 3GLFB 5E4FA 2E4AA 2A9FA 2O4CA 4RQAA 5E9QA 2OFFA 5D85A 1TYEB 2C5HA 2A8YA 3FPBA 3IDAA 3U37A 1XZJA 4KNYA 4A2QA 4JI4B 3I09A 4O63O 3VPAA 5EWLB 1I5OA 4QARA 3VR1A 5HP4A 2FN4A 1A96A 2EP8A 2C77A 3FI0A 2WAXA 2Q3CA 5FRDA 2JJQA 4L3OA 2I5PO 4YROA 4E33A 3IQXA 4RA6B 4HN9A 3W3AD 1LKZA 2A0XA 1P18A 3OEED 2O5RA 2EHDA 3ESQA 5DIZA 1OCEA 3BH6A 4PC7A 3TQFA 1ADFA 1VJ0A 4FOOA 1J9GA 5CVEA 1MFZA 4Q02A 2P6NA 2VSXA 1S2GA 1WXEA 3CLHA 3G7NA 4DFDA 4N49A 2CLOB 1OBOA 1NA5A 2HHAA 4JY7A 1Q5PA 4L4RA 4PIVA 2HMUA 1FW8A 1TMKA 3AVWA 1TJ4A 3CSUA 3FTCA 5DXAA 3FUVA 4DSUA 4EX6A 3CZ9A 5EWLA 1NN3A 3PX7A 2Q3MA 2QD5A 2XKJE 7MDHA 4YV7A 3NI2A 3S1AB 1WQ4A 3SZMA 4TV8B 1GWNA 1ZI6A 5LZ5A 2Q6TA 4CG2A 2LP4Y 1YS2X 3HH8A 4PWZA 2JFWA 3ZD9A 4YMVA 3WO0A 1E98A 2MIIA 1PLLA 1PKXA 1XZMA 4YP0A 1KHTA 3WLTA 3SS9X 1YE5A 3E8MA 3FETA 2X4GA 5CDYA 3EN0A 1SY7A 3UIEA 2WTUA 3EIOA 3MMSA 3WAGA 2IUSA 3DAHA 3OIDA 1PQUA 3QMVA 2VLBA 3PKIA 3VNAA 3ZBUA 4UCXA 1KC1A 1W5EA 4NZ9A 4RHCA 4UPEA 1NXXA 1Q14A 3F5MA 3HA3A 5CA0B 2HKIA 3IP6A 1XAJA 5CLFA 1Z0ZA 4QSMA 2R5FA 1BE6A 1HE8B 4JLSA 3AVYA 2OVBA 1YMUA 4P34A 2WY2D 2WNHA 1TAQA 4L74A 4TV8A 4GLBA 5JWRA 4HH4A 4KRYA 3RLIA 4PG8A 1XEWY 3TBHA 3W2GA 4RW0A 1VSBA 2CB9A 4IKEA 1GZSA 2IOYA 4C03A 2YW9A 2OGTA 2HO5A 2YZ2A 1UC5B 1MEEA 5DJ5A 5EUCA 2JEYA 3U3ZA 2Y71A 3TW8A 1ZKDA 2GETA 4KVFA 2IUEA 1Q20A 2AI1A 2IYNA 4QU9A 4QREA 1AQLA 1QE3A 3E7DA 3O95A 5GV7A 5T4FA 3W0LB 1ZITA 4GOMD 4UOQA 4D4LA 1J21A 2VJMB 4DTCA 3L8EA 3B1XA 5CA0A 4PX9A 3WLLA 1XPUA 4N48A 2UXDB 2IW3A 2V0CA 5HMLA 221PA 3P9IA 4XJSA 1AMNA 1E2HA 1EUYA 3HY3A 3SYLA 3WHKA 4QUBA 2ZIEA 1LW7A 5KVCA 1WX1A 3OZFA 5C8XA 2H2GA 5C31A 3RVPA 4C7JA 4F8YA 5HXAA 2H63A 5DM60 1GGHA 2HYIC 4KQIA 3GUZA 2P9EA 3O2JA 4DWWA 2R6CA 3BIOA 4MJLA 4WXHA 3H42B 3UWSA 2FHSA 1DWPA 2FWJA 5U1PA 4DSAA 1J24A 3R3SA 4OSOA 4TXJA 1K7CA 2FWAA 2VJMA 4YUZA 5D6OA 3ZHBA 4EPRA 5GTDA 1ZDMA 1ZR2A 1PFQA 3P1JA 1IXYA 2AJ8A 1VE6A 1Z0FA 4JQYA 3TVYA 1W73A 2FXIA 4K8OA 3PWZA 3H8SA 1GCOA 5LOVF 1VMEA 4NXNB 3UWOA 1LRLA 5C5EA 5ALQA 5DNUA 3LA8A 3AVUA 1F2VA 4BQPA 2BFCB 4X00A 5ICMA 1W35A 1FTNA 1H9BA 1GNLA 3L0OA 3O73A 4O1HA 1UKBA 2JGNA 4NOJA 3DL0A 1OGJA 2PLWA 2JAWA 2CYCA 2NSLA 4ZARA 1W36C 1I9GA 1TZCA 1HE2A 1F2DA 5FI5A 5KBYA 3FY4A 3B7PA 4L7VA 1VFPA 1Z13A 1X7XB 2JRCA 4M0LA 4RWEA 1HT1E 5BO5A 3ZGVA 3X2SA 4Q93A 2GZHA 2VSQA 3FRIA 4PLHA 2NU7A 2XIQA 3I5XA 1EGAA 4DC9A 1R6AA 1T2EA 3EMBA 5K3AA 5THKA 3BS4A 1BO6A 3SS8A 3AMVA 1T8SA 1QVZA 3AQ4A 3PCXA 2G82A 4JJAA 4YAOA 3ZVNA 1JDSA 3ZVRA 3NHBA 5CLGA 1JSZA 4QM7A 2M6KA 1XMOB 3DZHA 5TDHA 5L7WA 5HKKD 2V7TA 1H9CA 3ZCVA 4MIEA 1UKCA 1XVTA 2ZPUA 4RPLA 1UXGA 2AC2A 2DLNA 2LZ0A 3FZQA 5WRFA 2O3RA 1X7XA 2IU0A 3A9VA 5FI3A 4F06A 3G2JA 5A3JA 3CLTC 2VUUA 4RHYA 1ADYA 4AC9A 5K0GA 2FUG6 5FLEX 1TJNA 4BTVA 4GLOA 2BH2A 1JA9A 2RFLA 2OCYC 4J2OA 1K9SA 1DO2A 1SUDA 1Z56C 3WLSA 4RTQA 3VYTB 2KB0A 3ZX5A 2H31A 3T7SA 4KBYA 1RWKA 2NPFA 2CWWA 4UFPA 3VYVA 1Q2XA 1T4BA 5C7IO 2RBKA 3B1VA 4YLYA 1AUPA 3UJPA 2GT1A 1XD2B 3L8ZA 5ARDA 2W0SA 1E2IA 1EG2A 3WOHA 4A8PA 5HOEA 3KHKA 4AAYA 4YUYA 4OU5A 3H5NA 1ZN7A 2I6QA 2IU6A 3B12A 2AL7A 5GV8A 3NTUA 1XRSB 4EFLA 3W3ZB 2HK9A 3ABQB 1L5KA 1BKSB 2C82A 4OKNA 4S1WA 3B8EA 3LYUA 4HSEA 4DLYA 1F3OA 1WUIS 4FD2A 4FJ1A 4IIJB 1KFEB 3ZDEA 4YAKA 1KJYA 1SUEA 3CKLA 4O4JB 1ML4A 1V1MB 2FW8A 1C2YA 4ZOCA 8AT1A 4X62B 1ZZGA 3BFVA 3QPVA 4JXKA 3CKYA 4F6CA 3FKSA 1E1CB 2BM9A 4Z4IA 3E3NA 2IE0A 4ZZ1A 2IDJA 2RC5A 2IYSA 2HA5A 1T6XA 4JUDX 5KKNB 2IJGX 3UATA 4Y2GA 1XD2A 1Y3HA 3GA5A 3PVZA 2QVCA 3AYXB 4OXIA 2GJAA 4O29A 5BOVA 3T1QA 2G1AA 2JCBA 4KN9S 3TXAA 4MEAA 1KAOA 4INAA 1VECA 2Z5LA 5C9ZA 4ND2A 4X5OA 4Y7CA 2PQMA 5LZ8A 3EXAA 3K9QO 3AUUA 5GINE 3A6PC 4KRFA 3DYVA 4G0PA 3E9YA 4Q9IA 5IH3A 8MHTA 5DGIA 4IJQA 4KO1S 2RGXA 2XKAA 5J58A 3F3SA 4IIJA 2AUNA 4S35A 2P2YA 1E2DA 4MIYA 1AUXA 3QXHA 3R6WA 3MOGA 1UKEA 5A1TA 3W8RA 3SSOA 1E1QD 1E1CA 5KYTA 3I04A 1BGXT 2V8OA 3O5AA 5EP2A 4DIBA 1UJCA 1CZUA 2IUYA 1XKQA 4KTVE 4UULA 2FX5A 3HNRA 3RSHA 1SQFA 2FPGB 3FTNA 1IJBA 4JBXA 4BWFB 3OM0A 2VJKA 1P33A 3HADA 3QLJA 4MWOA 3STVA 5A06A 2HC9A 1KDPA 3PFBA 3UB3A 5CIWA 3CF6R 3ZIAA 4MUMA 1VHJA 2X8AA 2VQDA 2K7ZA 1Z33A 2TMYA 4MGKR 1A95A 3DZ8A 3O83A 2GHTA 5JYEA 5CAEA 3JALB 1JLSA 2Q1WA 2MDTA 4HPWA 2QW8A 5EIBC 5CFQA 3FOZA 3WDSA 4ECAA 2HK6A 2ZWPA 1OPXA 3BUSA 5JSUA 1JVNA 2WW8A 3OAAD 2BZSA 2HAEA 3D02A 1E6UA 2OBBA 1GAQA 2W48A 5CNKA 3G89A 3MJ4A 3P9ZA 1RCTE 3NIGB 4ZPJA 1P1JA 2O2CA 4OI4A 2J9RA 1EB8A 4QYTA 2KMLA 1BHSA 2GN1A 1Z45A 2YRWA 1TK9A 1USVA 3DWFA 2EIXA 3LQRA 3TPZA 4F6RA 1VYUA 2XDAA 4N82A 1WY5A 3BWCA 3HLYA 3TKLA 2BGNA 3OURA 2UZ4A 4MSUA 1PJRA 4QJ3A 3R5XA 4YACA 1OT3A 1WXQA 2ZDHA 2CXXA 5FP0A 3JALA 4PTZA 2CFCA 1QB7A 3QA9A 1SKUA 5FOSA 2DWQA 4GBGA 4DLKA 4YPFA 2HQOA 1X38A 2IV3A 1CUFA 3NGMA 3EAQA 3WKAA 3D4NA 3IP5A 5EHQA 3S70A 3ZV6A 1MO6A 1NMQA 4MWCA 4NY1A 3W2HA 2IPLA 4BLRA 4C7MA 5HJEA 4FW9A 4PC3A 3HCFA 2GJ4A 4H08A 4IHJB 4PXSA 2RGCA 5T64A 1USGA 4QT4A 2NZVG 2PSEA 5K7SA 3WK9A 2GD1O 5E1BA 1HUQA 3RK0A 3AJEA 4YRMA 5I5GA 1XZCA 2WSIA 421PA 4KX3A 4JJIA 3N2KB 1XUOA 3QIAA 3ST7A 1VMAA 1FP7A 4JLKA 1FQWA 1I13A 4NMHA 2OBXA 4UEWA 4ZRMA 2ON6A 2PX6A 3DC2A 3LMKA 1HDZA 2VCEA 2J8ZA 4R71A 4MUFA 1ZVQA 4AU1A 3ZV5A 1ZP6A 2C97A 1E2BA 2J0VA 1E8MA 1XZBA 2ID7A 5KTMA 3KR1A 4WERA 3FAZA 4ZC1A 2AMYA 2H2DA 3JD3A 1Q77A 3D0QA 4LBWA 4I14A 4YAWA 3D0OA 4JLDA 3CCBA 4ARZB 1E8DA 3E03A 4CCSA 1KWGA 1QP4A 1ID8A 5EXEA 1KDZA 3VU1A 3KSDO 4ZOBA 3IB3A 2VZ9A 5LMNB 5F78A 4J07A 3TMAA 4EB8A 3STWA 4G5HA 5CT5A 3R3WA 2GN8A 3LCJA 4J7CA 4JJ6A 1VKHA 3KOUA 3O93A 2GZSA 1G7TA 4OLJA 1JXOA 4CKYA 1Q7GA 3A1TA 4C1NA 4EG0A 1IBCA 1EUDA 5A03A 3AX6A 1O6GA 3G2IA 1E2GA 3QG1A 4R2MA 3C5CA 4WXRA 1WDMA 3ZLVA 5EHXA 2ZE8A 3I72A 1T8RA 1HOXA 4NFSA 4QUIA 1U9JA 1R6TA 1X1SA 2AV6A 2I4OA 2LRHA 3MAJA 3T61A 3WOVA 2FZWA 3NRBA 3RTDA 3UJ8A 4NH0A 3LVBA 2EG5A 3PRKE 1T9DA 2FZKA 5JDCA 4HLUC 1JJBA 1V8PA 3FSRA 3JAWB 5HIJA 4O8CA 3NHLA 4OA8A 4UBMA 4PYQA 3QVKA 3DP7A 3AZOA 5MN6A 2JLQA 4KRXA 4LCEA 2HQBA 1WETA 4RACA 5EHIA 1YACA 3RFFA 4DG9A 2PXCA 1NZDA 1DPFA 1LPPA 1VHLA 2AD5A 2P9BA 4RENA 4D8TA 2I0FA 4FT2A 2PFSA 2OFWA 3PG5A 2J30A 3N58A 4PZZA 4QOFA 4YDQA 1KBOA 3PC8C 3LP8A 6Q21A 4BN0A 5HW0A 2Y0CA 1W94A 4DMUB 1M34A 4MGHA 1GUYA 3T5DA 2JAXA 4W1SA 3JWPA 1CZNA 3B20A 4XYMA 3A2LA 1WB6A 4AJ9A 1JHMA 4RIFA 4Z2YA 5ADWA 3GFFA 3QWFA 1LPAB 4EPXA 2FWIA 1XROA 3TFOA 1TA9A 3MLBA 1VFNA 1JG6A 4IKOA 2GS9A 1X70A 2F1JA 2QV0A 5TJ9A 2O0JA 1GFIA 4XCVA 2O4UX 1W48A 1G8KA 4CG3A 5CFRA 4MMYB 5M2QA 3P0FA 3QWAA 3L43A 1N2GA 4PAWA 4S1VA 3RSLA 4B31A 3UMRA 2PBRA 1R9JA 1Y8QB 1KGDA 3ODPA 2I65A