4NBKA

Tailoring small molecules for an allosteric site on procaspase-6
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
268
structure length
256
Chain Sequence
FYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQAARGNQHDVPVIPTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-6
publication title Tailoring small molecules for an allosteric site on procaspase-6.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 256
sequence length 268
chains with identical sequence B
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2013-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nbkA00
4QUEA 1GQFA 4NBNA 3E4CA 4D3ZA 4QUHA 1I3OA 3D6MA 5IABA 4M9RA 3R6GA 4I1PA 4QUAA 1JXQA 3H13A 4DCJA 4HQ0A 2CNLA 3UO8B 5IC6A 5IASA 4IYRA 1RE1A 1RWMA 3GJRA 5IC4A 5JFTA 1BMQA 2H48A 1RHJA 3NS7A 2XYGA 2H54A 4I1RA 2H5JA 4PS0A 3V6MA 4JR2A 4EHFA 1RWXA 3KJQA 4JR1A 2C1EA 1I4OA 1QX3A 4QU0A 4JR0A 3S70A 2H5IA 4N6NA 2J32A 3GJSA 3IBCA 4PS1A 2HBRA 3QNWA 4JQYA 2K7ZA 3NKFA 5LU9A 4ZVTA 4QTYA 5H0IA 1I51A 4FGUA 2DKOA 3PCXA 2FP3A 3PD1A 4FEAA 4QUIA 4N7MA 3R7SA 2QL5A 3R6LA 4EHKA 1RWNA 2H4YA 2FQQA 2H4WA 1RHRA 3P4UA 4NOLA 5LUBA 3S8EA 4ZVSA 3V55A 5IBCA 4QTXA 5IBRA 1QTNA 1RHMA 1SHJA 5IANA 4JB8A 2QLJA 3H0EA 4HQRA 4LSZA 1NW9B 3DEIA 1SC3A 4N6OA 2XYPA 4QU5A 5IAJA 5LUAA 2Y1LA 3IBFA 5I9TA 4QU8A 4ZVRA 2QL9A 4EHAA 1SC1A 4D3YA 1RWWA 3KJFA 3K7EA 2CNOA 2J31A 2WDPA 4NBLA 4N7JA 4JJEA 1PYOA 4JQZA 2CJXA 3SIPA 4AW9A 3PD0A 4QUDA 4EJFA 3H1PA 1F1JA 1NMEA 1NMQA 1K88A 2CDRA 3NR2A 3GJQA 2J33A 3D6HA 3V4OA 2CNKA 3DEKA 2HBZA 4PRZA 3ITNA 5IAKA 4D3XA 1RWKA 2C2KA 1IBCA 4NBKA 4JJ8A 4QULA 1RHUA 3RJMA 5K20A 4QUGA 3DEJA 4DCPA 1SHLA 4N5DA 4NOKA 2XYHA 1CVRA 3KJNA 1QDUA 4ZVOA 1KMCA 3H11A 2CJYA 3R5JA 4DCOA 1GFWA 1I4EB 5IBPA 1RWVA 2HBQA 1RWPA 1PAUA 4QUJA 1M72A 2XZTA 4NOMA 2CNNA 3P45A 3GJTA 3R5KA 1K86A 4QU9A 3EDQA 1RHKA 3DEHA 5IAGA 4NOJA 2J30A 1ICEA 4ZVPA 3SIRA 2P2CA 2C2MA 2HBYA 4EHDA 3D6FA 3OD5A 4AWBA 3R7BA 4EHHA 4EHNA 3H11B 5IAEA 3EDRA 4FXOA 2H51A 3R7NA 1CP3A 5LU8A 4IEFB 4QUBA 4ZVQA 2C2ZA 2FUNB 3V6LA 2C2OA 2QL7A 2NN3C 1RWOA 5I9BA 1SC4A 3UOAB 4JJ7A 1F9EA 4N6GA 2Y0BA 4FDLA 2QLFA 4PRYA 5IARA 3V4LA 2QLBA 1NMSA 4HVAA 4AWAA 4EHLA 2AR9A 1RHQA 3V3KA 2XZDA 2H65A 4ZVUA 3BIJA
chains in the Genus database with same CATH superfamily
1C3LA 3Q6MA 2PH3A 1ZD4A 4LCEA 2VP9A 1E6MA 2QXTA 4PONA 2HRDA 5DNWA 3DBVO 4MV9A 5B4UA 2XVZA 2CDCA 1Z45A 2GM5A 3QU2A 2CV1A 1BDBA 5G1NA 1NBAA 1JHAA 1RJEA 2O5VA 2Z2YA 3CN7A 4PS0A 1T0IA 2B6NA 4BQRA 4JNCA 4OY3A 1ECGA 2G4VA 3DAPA 3QVSA 4KAXA 4MI6A 2XAAA 4Z86A 1PGJA 3ZEAA 4X66B 1QAMA 4HNRA 4JT2A 3JWPA 3WFZA 4UHCA 3NHUA 3L7JA 1ZEJA 3ELYA 4JLPA 1ENPA 1CUIA 4A27A 3FFBA 4DQDA 4EHKA 3AKCA 2ZYIA 1L5LA 1PNRA 5JO0A 3LD9A 4XM0A 2I7CA 2RH8A 2YV4A 4Q1VA 1ENYA 3PE6A 4BX0A 1Q92A 1VJTA 1GRNA 1L5QA 4V39A 2G04A 5BVGA 2VDOB 3V4VB 2IPXA 3D0OA 4ARZA 2OFOA 4LYFA 3KSUA 2QR2A 1MH9A 1N92A 3QW2A 2PZJA 1L2TA 4U9HS 1L4FA 5ERYA 5F76A 4HT3B 3ZJYA 4MJXA 1B73A 2EU8A 3OZRA 1HFWA 1XZFA 4AURA 4I9NA 4R2LA 4MHTA 1W87A 4W7HA 1FXUA 1RYBA 3ZDZB 4FQ5A 1KS9A 2YINC 5AJTA 5J63A 1ULUA 1AU9A 3MJDA 1PK8A 4P84A 1JDNA 5EE5B 4ASUA 1QVWA 5CIYA 3N8DA 5KMGB 2FMIA 1A5BB 2DWOA 4LJ7A 5EIFA 1RJ9A 2HB6A 1QKJA 2VJLA 2I0FA 4DM3A 5A5DA 4D9IA 2FK8A 4DRZA 3SXUA 3QPVA 1I3NA 1I1HA 2GKSA 1XUOA 1QYWA 1YB7A 3H9CA 4WNYA 4C14A 1MOZA 3L6DA 4JP8A 2O57A 4P0TA 2ZTLA 4K81B 3NYIA 3ZV6A 3AJDA 2R6CA 2X58A 1N6HA 2A33A 5E6RA 5K05A 4N0PA 3D4BA 2Q07A 3BBLA 3GGPA 3QEMA 3F74A 2VK4A 3QLVC 4CE6A 2ZBGA 2HLHA 3KB8A 1YCHA 2W6ZA 3DFZA 3E3AA 3E9EA 1O5TA 2H2IA 2PJDA 4IUYA 5G0UA 1FVFA 1PHPA 1RJFA 3OQJA 2I8CA 4K8OA 1B41A 1ZJYA 2C2MA 1IXZA 1XF9A 2ZAOA 4NU8X 2AX3A 4PR3A 4YJ2B 5DFAA 3TNYA 2IZZA 3ZWNA 1VL5A 2OE2A 4DF3A 1VSTA 5F78A 3R7NA 5JNRA 1HDIA 3NEJA 2QVLA 2XODA 3CA8A 3LJKA 2XNCA 4PYQA 1PFKA 5ITZB 3E03A 1NBIA 3BVPA 2MMCA 3SE0A 2NUAA 1I32A 4PNEA 1LPAB 1YDHA 1ZRHA 1CHDA 3MUNA 2FJUA 5DEIA 3ROTA 3C85A 4J3NA 2F9MA 3ZU3A 1E1DA 1OI7A 4H6VA 2AN1A 1YT5A 2NAPA 3V4FA 3GLIA 5DYTA 1KKMA 3STTA 2W2OA 2JARA 2WU0A 1ZM7A 4CG1A 3C1OA 3L0PA 1O94D 3KLPX 3OUZA 3NETA 4IVQA 2XD4A 4JLKA 1M1YB 1EZ4A 2FOXA 2QAGB 3BF7A 3LRXA 4OYHA 3NAMA 1M8PA 1W1UA 1XQXA 3OCZA 4GR4A 3WJ7A 1UPBA 1QG4A 3LL7A 3PDWA 4JWTA 2IHJA 1PD1A 2XB4A 3E2PA 4W9RA 4XPZA 5EUBA 1F7UA 3EXEB 4F72A 4YONB 2WPDA 4O2BB 4M6WB 1HE8B 4A82A 2X6QA 1OXBB 5LIRA 3CB2A 2CDNA 3ELUA 1GGMA 1X86B 2ZBQA 5H3HA 2QP3A 5CT5A 2R1TA 3AJ8A 1QUEA 2CF5A 2PDAA 3B3QA 4S2UA 1TUGA 1JFRA 4U8GA 1Q7BA 1PS0A 4X44A 1PLJA 1TKRA 1C2TA 4EYKA 1YB2A 3KQWA 3B8HA 5DRTA 4QJ5A 2D1RA 3RFUA 1B16A 2I7VA 1E9VA 4IRMA 3DCIA 1OC4A 1OVMA 4L6IA 3AWDA 3VO9A 4YRBA 6REQB 3VGPA 1J23A 2GCIA 1UK7A 2F90A 1I0ZA 4LXUA 5J9FA 1AXEA 2WW8A 4AZTA 4EVIA 3KKLA 2XA1A 3FNGA 4B09A 1ES9A 2RONA 5ALDA 5TPZA 3DDOA 4KH1A 1K6MA 1Z3CA 3AUSA 3ZDDA 3AU9A 1KAOA 4CLOB 4CM8A 1K7SN 3L79A 3OQIA 3IJEB 1QXSA 4MJ7A 2Y6VA 1KDRA 1LBHA 1PJLA 1SURA 1T2NA 1YVUA 3K73O 4KAAA 4MRPA 3U7QA 1Y7LA 3BRQA 5JDIC 3W9SA 1UC4B 5LNK6 5GJCA 2GI4A 3ENWA 1B8OA 1GUFA 4CQJA 4UUBA 3C43A 3ITKA 2BV3A 3AVYA 1GPNA 3IPYA 3SOZA 3VOTA 3AINA 3E6AA 3OICA 3UAWA 4CFYA 4DIKA 3UFBA 1MC1A 1LNQA 3HUEA 2DWQA 4TYNA 4Y0NA 3ZBPA 4KODA 2G07A 2RJ3A 1KXZA 2ENUA 3X2SA 3L0CA 5EP2A 4QIHA 4DUYB 3AQIA 1UWCA 2AN5A 3KR9A 3MIIA 4YRQA 2FU5C 5DIFA 3R9IA 4DDVA 1ONNA 5J4KA 1WV0A 4ITUA 4XWGA 5C5DA 3TN7A 1O6GA 2LRHA 3QKWA 4OHZA 3FJOA 4EGJA 3BGVA 3SMQA 5F52A 2ZK7A 1G2PA 2BYTA 3RJ5A 2ETXA 3C98A 2BMAA 1Y34E 1MQAA 5FPSA 1DEKA 1TO2E 5K8LA 5KSZA 5AK3A 3JW8A 1DWOA 1YRQA 1AK2A 1OBCA 3HCRA 3WLEA 1FRFS 5AHRA 5AK4A 3LYHA 5ARCA 2QI9F 2V7EA 2YOHA 4OUDB 1PLKA 2HN9A 1AH2A 5T57A 3ICOA 3HRKA 4FR0A 4CTMA 3DL7A 2GHQA 2FXVA 4RFLA 1H2WA 5FA6A 3D3JA 3HJHA 3U6KA 1JLHA 4ARAA 1ZIPA 3QNUA 3GRPA 3OZGA 5DWQA 5FWXB 4WBNA 4FGZA 1U9IA 1V1MA 4LVUA 3EOZA 4CG3A 2RI6A 4KN8A 1A8IA 2C58A 4IDPA 1NQUA 1GPWB 1TK2A 1UBMS 4KX5A 4B33A 3PFGA 4ZPJA 5FUVA 5F23A 2J3IA 2C8VA 2R85A 2XZDA 1TQDA 1FFSA 2QQFA 2PKRA 2YWBA 3CNNA 2REQA 3I01A 3QE0A 3ROEA 2AXEA 3ETHA 3M1IA 4DLRA 3OJFA 1PFGA 3DKVA 3C2QA 3QIVA 3R6GA 5ALRA 2IPAB 5EVCA 3W5HA 3W8FA 3EF3A 3BRWD 1QBKC 1DBQA 1Z2DA 1PWXA 2BE7A 3O8LA 3AILA 3VZBA 4AJOA 2PMBA 4ZOBA 4PAWA 1ZOSA 3EFEA 3MJVA 8ABPA 1QGOA 4TS4A 3W8RA 4XWKA 3N6VA 1TJ3A 2VZ9A 3RSCA 4DZTA 5AM1A 2IX3A 4EFMA 2OCPA 4Y2SA 5CGQB 4YJ3A 1NSTA 2AUNA 1AS2A 1I1OA 2XWPA 3RIEA 3W2FA 3K31A 3C6MA 3P32A 1X7YB 1HY3A 1NUUA 4B85A 4X20B 5JSUA 2UUBB 5FV7A 3E9NA 4EHIA 2PGJA 1OX6A 4EAQA 1EFDN 1GTL1 4JL5A 3REQB 5ADVA 1PHRA 4ESVA 1TEXA 2AZDA 4F97A 4YHHB 2QN8A 1W19A 1JDBC 1XMXA 4TVOA 3AVTA 2Q6IA 4MHOA 1CVIA 2YFQA 4I19A 4P3KA 5FCDA 1P7YA 1XZMA 4OBWA 4AXBA 4D82A 1O6FA 4PYJA 4U0JA 1G3RA 1M1UA 3ESXA 1FK8A 2I4LA 4LVOA 5C1IA 4LXXA 4RO0A 3OIWA 3UCEA 1J42A 3PF8A 4RSHA 3NBKA 4QBHA 1EUCA 1R5JA 3L0SA 1MJGM 5BY2A 3JARA 4E22A 1SHTX 2AHOA 3DPIA 3RYIB 1NNSA 3RHSA 1LDMA 1VXOA 4QGBA 4C0SA 1NIJA 4DLVA 2F1RA 4HFRA 2ZXUA 4OGGA 4LWPA 4R7ZA 4A23A 4IMRA 4UM9B 5AW8A 5JAUA 1WU8A 3GMSA 2VBIA 3TZ6A 4GZ6A 4YUZA 3IQWA 3UGJA 4IF6A 3O8OA 3DL2A 3A3YA 5KDLA 3LIIA 2W2KA 3OKFA 4QPJC 4UOEA 5I4CA 4U6QA 3JQ6A 3VPCA 1Y81A 2LIPA 3M3PA 2N75A 3UGQA 1MW9X 4GKJB 4ERNA 2B34A 4H3VA 4HSGA 3TNFA 2G8NA 3CPJB 5HKLA 2EEPA 1Y4SA 4MWSA 2HLDA 4DLTA 3B3JA 4YRAA 3Q41A 4I55B 1D5WA 4URZR 4G26A 5CH5A 3I62A 2AI3A 4DR1B 1GVHA 1VKRA 4C4ZA 4JNKA 5BSUA 4AF7A 2ZCJA 2J5RA 4ESHA 3CG0A 1JE1A 3PXGA 1OGIA 1HE3A 2P9CA 2XWJI 3NHKA 4A73A 2BH2A 4AS3A 1AN0A 1CY8A 5FLEX 4MTCA 1M0SA 2B5WA 2NTVA 3HDQA 3MOIA 5M2QA 5LP6A 2H7XA 2UZ1B 3AEKA 4AX8A 4F1JA 1I6WA 1ZI8A 1WMSA 1JFTA 4LFCB 4B5LA 2MIIA 3Q7EA 3AF6A 1M34B 2C0CA 1R8SA 5K1ZA 3GH3A 1HTTA 2AOTB 1JEYB 1JA0A 2FPXA 1VHLA 4PAOA 3L8YA 4DR7B 3FPGA 5F1PA 2HOQA 1U11A 2GD6A 1CR4A 1LRJA 1OLXB 1SQ5A 2J45A 2LZ0A 3EXG1 5IJAA 3R3XA 5J4YA 3AMVA 1ZHOA 3ZD9A 4B8YA 3U7GA 2PZFA 3ESQA 2HCRA 2AFHE 1WE2A 3QWIA 4I4CA 4CNQA 1G21A 2I22A 2GASA 5ALQA 4CQMB 4RQUA 4YFYA 3P9KA 1P3JA 1JX6A 4KN6A 1RI3A 1C0EA 3ED5A 3U6BA 4M9SA 3DQQA 1JU3A 2EBFX 2GWRA 2Y76A 1PSDA 1OAOC 1G3MA 4QUKA 1IM8A 1U2TA 2NZUG 5DYIA 4QEDA 3ESCA 5FLXA 3K0BA 2ID8A 1BVRA 4RL4A 3U3RA 1ETHA 2I34A 4CL2A 5HZHA 2CZGA 4PIMA 4AJ9A 3I5YA 2P9ZA 4R1QA 2OT3B 1XVAA 1K8YB 3DW1X 4KAJA 3PTAA 1RQLA 2GJ8A 4RACA 3HCEA 4CLRA 1E9RA 3CRW1 1D09A 2L2QA 2ZYTX 1I6KA 1LY1A 3AZPA 2O8FB 4TS9A 1N4DA 3WZ2A 3DVLA 3HKCA 4UTRA 2YBDA 2QEQA 4QYTA 4B47A 3BSYA 4E5MA 4F2HA 1KQFA 5B2FA 2HPVA 3KSMA 2UVDA 1V4VA 1J00A 4G1MB 4YUWA 1CPYA 1XTPA 3OA2A 1T1JA 3L6UA 4GNRA 3NJ8A 4OATA 2JFWA 1OHHD 3DULA 4IMIB 1VCMA 3NTVA 3RS7A 1QJCA 5BURA 2Q3DA 2WJHA 1I80A 3D6VA 1WHTB 3NJRA 1Q16A 2RKBA 4JUDX 5ESRA 2PH1A 4NFSA 4ZYVA 1TYCA 2G70A 4CMAA 1RBQA 1A98A 3HPQA 2AQHA 4JOCA 4WOCA 1D7AA 2EQBA 2Q9CA 5KSOA 1OXKB 1H4SA 6LDHA 4RJ2A 1G3QA 1LLQA 4GPEA 3C87A 4MVJP 5JLJA 1ITZA 1AXGA 3GJQA 4Z8XA 1EVKA 2B1JA 3U4GA 1JB9A 1P9NA 2WAOA 1Z6YA 1L4HA 4R1MA 5E2AA 1E2JA 2LV8A 4QEKA 5KAMA 3PP8A 2QUZA 1IQUA 1UQUA 4HD8A 1RRCA 2LCIA 3GRAA 2Z9CA 4QVKA 3UNXA 5ALWA 1QHSA 4UEWA 4GQAA 3DB2A 4XLZA 1K89A 3RC7A 5KYUA 2PLNA 2C03A 1C0PA 1GPJA 4ZODA 2NG1A 3ICQB 5TQ0B 1FEZA 4NONA 2C9BA 4YAKA 4N54A 3BE4A 5EESA 2O3TA 2RGNC 1PAUA 1WQ1R 4DG9A 4NJEA 5C52B 4L0QA 3ZUGA 1R8JA 3FYDA 2PGOA 4K28A 4QFMA 3UBTA 1I7DA 1GR1A 3BUSA 1SXGA 3HKBB 5JC1A 4MR7B 5J2TF 4JKYA 2CB0A 1N6LA 2VHXA 3BN3A 1FYXA 2JNWA 5G3ZA 3KYIB 4L22A 1NU6A 2VSQA 3AB7A 3D3WA 3Q2KA 2NNWB 4KU4A 1XVUA 5B37A 5IAEA 3PFFA 3IELA 4EHNA 3E84A 4NCNA 3FOEC 1VHJA 2V9CA 4IQ8A 3DFFA 3A1WA 2JKVA 1W46A 3V5NA 2WZCA 4WVLA 1DBIA 1L7EA 1W44A 2BEKA 5LYJA 3SXJA 4CN9A 3U7HB 4YV0A 1VKNA 3NGMA 2FA9A 4KVFA 3W77A 2QRJA 2R8EA 3AY0A 5FV4A 4FONA 1AQ6A 1WZEA 2I6XA 5C8ZA 4D0SA 1E32A 2B8EA 3KK0A 1FDVA 2YUTA 3UO8B 2ZKIA 3Q5GA 1GQFA 1QZUA 3L4BA 4L57A 1Y0BA 1GEGA 3OJOA 1T6BY 4CU5A 5ALZA 2RJOA 1BX1A 4YRGA 3F49S 3TTTA 2I4TA 1IEXA 1QDLB 1DQSA 1W5TA 2JRCA 2XUJA 2VTBA 4MWCA 4KIGA 4E12A 1OB2A 4KXXA 2PFGA 1FFBA 4BO3A 1C1XB 2BEVB 2Y2VA 3EOBI 1NAIA 3P0IA 4KOEC 4D9NA 3SVTA 4UMVA 5ILOA 1I01A 1UEXC 4AKEA 1L4YA 1XRLA 3CRMA 1T24A 5WRFA 2O5RA 4X85A 5BMVF 3NUGA 2FPOA 3C6KA 5I7WA 3LBIA 1Y6GA 1PDOA 1DQNA 5LD2B 2IS4A 2R84A 3WHLA 2BRUC 4TT3A 16PKA 1KEPA 2YMLA 1KSJA 3V8MA 4CF3A 5EJ2A 1U0BB 3BWCA 1G5IA 5CW2A 4RJKA 5CBPB 3UPTA 8LDHA 1IUPA 1CLEA 1D2RA 1EM6A 4CF6A 2QENA 3EW9A 3MTGA 4NPAA 5JC8A 1TOAA 4K86A 1OSNA 1M2VB 2VLIA 2YVKA 4BVEA 1A8QA 1TCAA 4IQGA 3OE7A 4KKXB 3LQ4A 4NBLA 2B1QA 2JLSA 3RC3A 4QRHA 1WBDA 2KBFA 4TSRA 5ECWA 3TIIA 4LHSA 1J7JA 2ZSAA 3PSAA 4UNQA 2P3LA 4ZI7F 3P4YA 1TT7A 2Q5FA 5CNJA 3BWBA 3D7LA 4ZU3A 3A05A 2V6FA 2W8BB 3BXEA 3D6HA 2HO5A 2EHDA 2BDTA 3MQ2A 4YRNA 5GM1A 3A6HA 1FSFA 1J2EA 1ZQ1A 1E9CA 1FLDA 1IHUA 2JIQA 2XCOA 3L9XA 3M4XA 5EJ8A 2IYZA 1DZIA 1NP7A 4R9NA 2O59A 4J7UA 3BFJA 1ZJWA 1BHO1 5DBHX 2BCGY 1Z6TA 4Q3CA 1OGJA 1AQUA 4E94A 1Q0TA 4P3PA 1NVUQ 1PQYA 3ET4A 4Y7DA 3PT9A 4RTKA 4M1ZA 3AKEA 1EUZA 1IY0A 3NVDA 4EH1A 1IXYA 1P45A 3O8DA 1GXSA 5REQB 4DOMA 4XVRA 3BDIA 2A57A 3AR6A 5BQ5A 3SX2A 1ABFA 3WRYC 3IB3A 2X5JO 4X95A 4MVJG 1F14A 4ZAZA 2QRVB 3GUCA 2G9UA 2YRFA 1RI5A 2NAFA 3L7YA 4FR2A 4MLCA 4N0DA 4RHEA 1ZK4A 5DPMA 3C3CA 2J9XB 3P9SA 1W73A 3NIDB 4HMQA 4PF1A 4DB2A 3ENZA 1G38A 1QIIA 1ZD2P 2QZ9A 2Z1DA 3KFVA 1RZVA 4IGAA 3GEHA 2ZE5A 1P29A 3CZMA 3L41A 1E7QA 4L5CA 1JSZA 5LYYA 1CV2A 1RXWA 2EGGA 1XALA 5JD6A 5EUCA 4QUBA 2OHVA 3C8DA 3E22B 3KYCA 4WL0A 4PGGA 2J3KA 5E1DA 2V7BA 4J6EA 1JJ7A 2XNDD 4B3XA 4YRCA 4N48A 4V3CA 3VPXA 1F06A 1G4AE 1VKZA 1N6RA 3I9V6 3HNOA 4BN5A 3TJZA 2QLFA 1TI7A 3RRJA 3SI7A 1PLLA 1BGXT 2FEMA 4EBFA 5TQ2B 1NKTA 2PD3A 3ORFA 1TM3E 1QK4A 4ME6A 4Q9JA 2QR3A 1K6EA 2JEOA 3LQ2A 4L6CA 4N18A 2FNAA 1B6SA 2H65A 1N7IA 1S2OA 2XZLA 4NI5A 4MINA 3AERA 4MVJH 4WN3A 1DCKA 5EE3A 3PZRA 1CUAA 1JB1A 4DRXA 1TEZA 1A9XB 1GPUA 2CXOA 4OK6A 3UA4A 1H4QA 1MTOA 1Z0DA 3PICA 4Z0PA 2NVUA 1UR5A 3ETCA 3CEJA 3QMVA 4D74A 1F12A 4U5XA 3EIHA 5GZ1A 4HC4A 4RORA 2B7LA 4E7OA 4AZ0B 3AR3A 5I7OA 3BOSA 1XAGA 1ZKMA 1T3GA 4ER6A 3DZKA 1GNQA 4UDNA 2H2DA 2AJ8A 2OFWA 2WMYA 3FB4A 3AUKA 1OZGA 2AZTA 1FP4B 4N39A 1YS7A 1CD5A 2AWNA 1GTRA 2A35A 2IDZA 3DM5A 1FDTA 1FC0A 2CL5A 3O2SB 2V6MA 3UENA 3WB0A 5KTKA 4I4TF 1KYQA 4LN1A 4LXGA 1DCMA 4WFQA 2I80A 5M34A 3NKVA 5IDWA 2VZEA 5BUQA 2XCLA 3VSBA 3THWB 4YXWD 3FYCA 3LY5A 3BMNA 3BD7A 3ZWWA 3TXXA 3PNOA 4ZI2A 1TAUA 1OOEA 2O2JA 4K6MA 3C3EA 1P1IA 2KSQA 3D5TA 1IBMB 4OHBA 4JQZA 4EBBA 2EC5A 3UJ6A 4H6XA 3UT0A 4RVFA 4IFBA 5B7NA 3KHKA 4FS3A 1I94B 4KMSA 3ROKA 3CH7A 2I66A 2FWMX 4Z2AA 3NANA 3KAKA 5DM4A 1KNQA 2WYOA 4E5KA 2RDMA 4QDUA 3OX3A 4NVRA 5SZJA 4C0JA 5EKTA 3RYFA 3JATA 1I7PA 3V3TA 5I9SA 2ZVDA 3F2IA 1OXVA 3E9MA 1BHSA 2FDXA 1JKFA 2WSMA 5IH3A 3ND6A 1E0AA 3KKMA 3U40A 2K7FA 1XAIA 3KTAB 2GEFA 1G5RA 1ZX1A 1OYOA 1GITA 2DUMA 3LDUA 4F2PA 5BUCA 2Z6UA 1HSOA 4MB0A 4NMMA 3B82A 5AKJA 1XDDA 1QZXA 1W85A 2QN7A 2DLNA 3HB9A 1EJ0A 5DT9A 1WXXA 3D8BA 3ED1A 3GLHE 1N2ZA 3NYRA 3IXLA 3AM3A 2I2XB 2DBVO 1X7ZB 3AL3A 3DMYA 1P1BA 5HQ3A 3WNQA 4D96A 5J47A 5DZSA 2MYUA 5ANRB 4BLQA 1EDDA 4D4LA 3ZE9A 5A3SA 2YXNA 4JLBA 1X15A 4TV8B 2CFSA 1UC5B 2CY0A 1HWYA 1U94A 3G79A 4BXOB 1LPPA 1WVGA 2GLTA 1R9GA 5T7BA 1NW6A 1X7XA 2WWFA 1I5OA 3TQQA 1ZVJA 1N0UA 2IBMA 4YRZA 3QLUA 1DU4A 1BXZA 2GPTA 3JQ8B 4Q7JB 1AS0A 4DPKA 5A4FS 3KQUA 3S2EA 1TM7E 1I2AA 1WVIA 1SUSA 3D0KA 2DULA 1FQOA 4WACA 1WKVA 4G07A 1G6KA 5AKYA 4JUBA 5DN6A 4Q4JA 2GVDC 4PC1A 1JZTA 2OSBA 3C3BA 1A4XA 4YTEA 3TFOA 4UHDA 2LGJA 2FQWA 1TYZA 5GADl 2BT4A 2WIFA 5K0FA 3Q5DA 2YJTD 1QMPA 3SLRA 1SH7A 3FFWA 1RWMA 1XF1A 4DPMA 4IKEA 4PLWA 1RHJA 3WIUA 5BXYA 1XROA 3QVGA 1ZAYA 3BEOA 4PRKA 4FFRA 2XMDA 2PD4A 1QO0A 3M6WA 5EPOA 3KRTA 5ESDA 1V1RA 3EZYA 3HXOA 4TXHA 1TCCA 4MQ4A 3LSTA 1AKMA 5L8VA 2HLPA 3LDGA 1P18A 4QWMA 4RDHA 5AYVA 1KSFX 4D81A 3TM4A 2Y93A 5JNTA 4CFZA 3FAZA 4YO8A 1MB2A 1B74A 2X0FA 1HG0A 4DB4A 4R8LA 4X0EA 1QRTA 1Z39A 1TW3A 2ORED 2YWXA 3P27A 3ID6C 3QKRA 4OGKA 3K1TA 4DJEC 1LH0A 2IOFA 2QTTA 2NUTA 2V6BA 3MUOA 1XC7A 3VPGA 3TGLA 1DEOA 2X2EA 4AKGA 1J49A 2SKEA 1ODIA 1JFVA 5LBTA 3WKEA 5JAPA 1P5RA 3GRVA 1WG8A 3X1DA 3STUA 5EMJA 3W0LB 5KNDD 3IR7A 1O03A 4EEZA 2R79A 4LQCA 3OTOB 4UNRA 4NCKA 4WT7A 2IE0A 3EVFA 4UTVA 1VBMA 1VE3A 1M2NA 2KPOA 3C3DA 1M0WA 5IKOA 5MF6A 5FULA 1JR3A 1U3WA 1ZWLA 3W6NA 1QLWA 4OHFA 5IFLA 3LCVB 5IAKA 2FRDC 3HBLA 4R16A 2EJUA 4IFIA 3WKCA 5KQRA 1ZR2A 5F12A 3QM1A 4K8RB 5FT9A 3DPSA 5B5SA 3G7NA 2GYYA 1D8TA 2YOGA 2SKCA 4C07A 3FPCA 3H9GA 1G5QA 3QE3A 3C0KA 1U80A 4QGSA 1IRIA 3JD4A 1J0EA 4YMIA 4AF6A 3GLFA 1W35A 2YC4C 3DE2X 1ZITA 1HBJA 2DERA 2HBQA 2XW6A 5AVSA 3UC5A 1TW2A 3H17A 1IZ7A 1HEIA 1Y8AA 3HWWA 2ROQA 3OCYA 4R2KA 5ALGA 5TS2A 3FSEA 2D2EA 4MAAA 4KE6A 2FX5A 3U09A 4B73A 5AM2A 3F3MA 3S1LA 4X61A 5IVIA 1JBEA 3TSWA 5L7YA 1SPXA 1DL5A 5JIBA 3A1SA 3NM4A 1FZQA 4ZCPA 1VP3A 1QC5A 2ZQYA 2YXPX 2VWQA 1BG6A 3DDUA 3QLVA 5DTIA 5CFRA 4TZ0A 4WDQA 3MMSA 3FVVA 4CMJA 2HHCA 3QNMA 1V3QE 4G4SO 1L7PA 4UD6A 3WGHA 3BILA 1ORWA 3UG7A 1EWTA 3SEQA 3IAM6 4P5PA 5CB8A 2P69A 2M98A 3OC0A 1R3UA 2I4RA 1QZZA 4KXVA 5GOTA 3EXFA 4F21A 5L3QA 2GT1A 2QT9A 2JD0A 3IKLA 3D1VA 3TZHA 3NHYA 3OLQA 3ORQA 3U7RA 4TVSA 2R8OA 2XWBF 5JCJA 3ZE1B 4OB7A 1Y5LA 2JZOA 4WXPA 5CVDA 5H81A 3RVRA 3W6PA 1MEEA 3DNMA 3P4XA 1N5DA 2PHZA 3IGFA 4ZVTA 1Z2EA 4NNJA 2QMYA 2Y8EA 2XKKA 3HO1A 3BXOA 4Q16A 1PV4A 3E0XA 3C7KA 2BONA 4MUMA 4OQEA 2OBXA 5CA0A 1JDSA 3BFKA 3K9CA 1UMCB 1Z62A 3S3TA 3SQXA 3W3ZB 2JKYA 4DARA 3FKSA 3CCFA 5EMNA 3C7CB 1QIKA 4K9QA 3N2GB 3NWEA 4Y9SA 3KLNA 4JI0B 2GK6A 5FA8A 2ORIA 4FXPA 2YNMD 4WA7A 4H77A 1KU0A 1P0QA 2AMJA 5AKXA 4Y67A 4PEVA 4PXSA 3W5UA 2J9RA 1DT5A 1PW5A 5J58A 4MPJA 1C7ZA 4LV6A 4WWHA 3S1AA 4B83A 1I51A 3KHTA 3KB1A 4RY8A 1AA6A 3UGKA 1G17A 1R4ZA 4IIDA 1VIAA 3Q9SA 1BDHA 1X1DA 3VDMA 3DNPA 4BO4A 1L8AA 1D2MA 1YOBA 4GT1A 3R6TA 4Q9KA 2P40A 1VSVA 1F20A 2ZRBA 2BTQA 4BJ5A 4S12A 4EYEA 1KOGA 4KLAA 5ALIA 2GA8A 2IHUA 4LXIA 1N77A 1T3ZA 4IDBA 1NF2A 3C6QA 1OLSA 4YV2A 3QX3A 3FPBA 3DYBA 5B1IA 3UV3A 1L4EA 4LJ4A 2WDPA 3H65A 2VK2A 3I92A 4BJ3A 1M6VB 2PX4A 2AFHB 1E2PA 5EG5A 2W2MA 4ZZ2A 4URYR 2I8AA 2PJUA 4P7KA 5JBIA 3G2OA 5JATA 1I9CA 1B3RA 2Z9BA 1NATA 2XOEA 1HORA 1XPJA 1Z36A 2I03A 2QE7A 5AK6A 2ZJBA 4C4TA 1DXHA 2F48A 2G25A 1Z5WA 4NU5A 4PLVA 4CWAA 5JNWA 2OXCA 4I4LA 1LB1B 3QG5A 4UTXA 2CLEB 1ZVVA 4PHCA 2H3EA 4BVBA 4ZIRA 5JDIA 2HT1A 1XEXB 3DZIA 4JBWA 1XEAA 5HZMA 3NZEA 2ZTSA 5F4BA 3SYKA 3TLGB 1A97A 5JHHB 4PPQA 1PJRA 1ZM3A 1KDZA 1JUDA 3CZQA 4TGLA 4BIIA 2Q6KA 4N41A 2V7VA 1FPQA 1KEWA 1VJ1A 4KLRA 4TMKA 3DZ8A 3K09C 5GGXA 3DZJA 5J4HA 1LVUA 3Q10A 2ZYVX 1PJSA 1FJXA 3PEUA 2V7QD 4I50A 1TADA 5K6AC 2XJ4A 1KPHA 4U2CA 1IN7A 3OE1A 1IB6A 3UJCA 3CLTC 2G9VA 4D97A 2YXLA 3FMPB 2PSEA 5BR7A 1KOFA 5BN4B 3RREA 2VJPA 1OVGA 2I2AA 1W25A 3QBDA 2HV8A 3IJ5A 3L6BA 3H3XA 3KELA 4DWVA 4MIYA 2AUTA 4R51A 3AW9A 3OP4A 4XLTA 4GI7A 4C30A 3VAZA 3I0ZA 4D92A 4LJ9A 1WQ4A 2D4AA 3IULA 4YIHA 4QARA 2FSFA 4ZQEA 4KACA 3OCCA 2SHKA 5D01A 3LF2A 3WHIA 3DL0A 1U0RA 1J07A 2JF0A 3OURA 3QMPA 4Y6LA 3D4LA 2ZR9A 2G1JA 3CW2A 4MXDA 2Z2JA 4D26A 5I5EA 1CQJA 4MS1A 5LN1A 3AI1A 1S7CA 4NATA 2OD7A 4PNZA 2E4UA 1E4VA 2EL9A 2NZVG 4UUQA 4C88A 4BKRA 4DLBA 4YMGA 1BN7A 3I72A 2Q8NA 3H05A 3QPWA 1SBQA 3R24A 4Y2JA 3EXHB 2P2DA 3KVNA 2CXPA 5BUSA 3T1QA 4MDHA 3A14A 1OYYA 2BM0A 2I3GA 3E3NA 3HJAA 3RC1A 4EB3A 4KLNA 2OC9A 3IBGA 1NL3A 4WKGA 3WGGA 1YRAA 4MWOA 4A0QA 4Y9RA 4TTJA 2OCDA 2O8CA 1UL1X 2VF2A 2YC2C 5KSPA 5B57C 5FX2A 4NAVA 1C7QA 4UASA 2FMKA 1FTQA 4TL6A 4C1BA 3PLAE 1GCOA 1CJTC 4ND5A 1UPAA 4JFAA 3GG2A 4XSVA 3GJSA 4KYUA 2QD2A 4KGDA 4FQ7A 1NVBA 2FPGA 5SICE 4KIFA 4O59O 3ZK9A 4RDXA 1P1RA 1DINA 1GCIA 1N1GA 2BKAA 2MHCA 1J0CA 2RGEA 3BB3A 4Y3UA 4AULA 3CO5A 3GAFA 2EJVA 3BQNB 4WECA 5IXYA 2OHGA 2FHPA 3FBWA 5A7GA 1CZUA 1QJ4A 2GDZA 2V7XA 3GGGA 2RHWA 2BHSA 4H1VA 4BVLA 4CHGA 3CLKA 5JUWA 1KQGA 1NW9B 4LJYA 4LTDA 3X1ZA 1B43A 3OJWA 4M89A 4B6EA 4BNFA 5I6DA 3CTMA 3H9EO 3S2SA 3WLHA 4TQ9A 3OIDA 2HY7A 4W5OA 2YOFA 3NWPA 2GKGA 2JCGA 5AJZA 4EI9A 4OBBA 4EFDA 2VYVD 5DGHA 1CR1A 2WT8A 3FZYA 1DTWB 3GLIE 4BEJA 4CW7A 4KXFB 3CXRA 1GAJA 5EUQB 5B55A 4CQLA 1I10A 5E7MA 4AQDA 2Y1CA 2LVBA 2XNKA 3ZDXB 2XE4A 1H69A 2VCEA 5IMSA 4GECA 1Z4PX 4NAUA 4F56A 4DLZA 1SXJA 2XXJA 4D9EA 5HA5A 2G77B 1DX4A 4LZZA 2V58A 2RMKA 3S5UA 5IHPA 1ISIA 5JI3E 1HT2E 3IEPA 4RZHA 3KXDA 1SUBA 1L8OA 1L7XA 2JGEA 4OSEA 1WF3A 3PXCX 5COAA 5IKXA 3D2CA 4Y2HA 4LQ4A 1D6NA 4QA9A 4MUBA 4ZCLA 3UWMA 4F7DA 5IG2A 1EA7A 4MQLA 1EVYA 2CNDA 3NLLA 4XQGA 5EJFA 1T4CB 4B2PA 3CUYA 1FYFA 4HUQA 2OAEA 4ANFA 4OK3A 4CI0B 1H9CA 5HFAA 2A0WA 3WL3A 3PEVA 2DH6A 2LP4Y 3GRUA 2I8LA 3IKVA 3MQ4A 3Q15C 3PC6A 5CPFA 3T35A 4ARSA 5JNUA 5LZ9A 5EZQA 2FW6A 2MOKA 4LRYA 4U7DA 2CMKA 2F1KA 4P0PB 2YICA 2EP7A 4JUCA 3K2QA 3HDTA 3SICE 5EIEA 2FFAA 4QO7A 2DQSA 3HLTA 4ER3A 1OZHA 4R1UA 3ZKWB 1U4OA 2Y9MB 1UK6A 2FK7A 1JG1A 3K96A 3QU7A 5KU7A 1BQ4A 1JVNA 1YTLA 5KYWA 2P11A 5LA6B 1CJCA 1BVYF 2JAQA 1BHQ1 1WDTA 4PWZA 2ZPTX 2C7VA 2AJCA 3NEYA 4FZ5A 4PZLA 1RXSA 3PC8C 1K3UB 2OD2A 3TECE 3FTNA 4DR6B 1FFXB 1KL7A 3ORYA 5BRNA 1XVLA 2ZYRA 3EVGA 3GN1A 3V4LA 3CV3A 4FJ2A 4OJNA 4BB6A 2RE8A 4KNVA 4HAOA 4EHLA 1IXKA 1E5LA 5DTMA 4M4SA 3RS4A 3MTJA 4RBNA 1EBUA 2JFNA 2VR1A 2WFLA 4AJPA 1GTG1 1A4IA 4M9RA 5EWLA 4ZHSA 2HL6A 5FO0A 3SYNA 2LDXA 1IJFA 4C0XA 1Q83A 3RVJA 2M1XA 2PRJA 3TTUA 1RYMA 5DT2A 3VDRA 1R8QA 2WIJA 2YS6A 1P7PA 2XHZA 3GRYA 2FWNA 4B3IA 2MSCB 1NMYA 2SICE 4CKBA 1CK4A 3IA2A 1XZAA 2FAXA 3V2IA 3R9WA 1NJ1A 2ZTMA 3PYLA 5K9ZA 1NXVA 2C99A 3VC2A 1LK0A 3G13A 1OAOA 2Q45A 5FPPA 2RHGB 4U2KA 4FKMA 2Q5QA 3E9ZA 3KSAC 1W94A 4JX9A 2JI4A 3A70A 1BJKA 2ODQA 2QBYB 1F5SA 1ESDA 1W0KD 2BGNA 4KN9S 4TWRA 2VYFA 3ZWDA 3NAQA 1Y1LA 3BK7A 1SK9A 1J6UA 1WR8A 3BL5A 3I09A 4JLOA 5HE9A 3TRHA 4ZI7B 1WA5A 4YASA 1QYVA 3CSUA 1E6UA 4G5YA 4QE3A 1T5BA 4FYHA 4H7JA 2PMCA 1QGYA 1VL6A 4F06A 1WB6A 4WUTA 4RF4A 4REOA 2TYSB 3EHDA 4IYJA 4TMFA 1MX3A 4JJKA 4Y2RA 1U0EA 3H1EA 1IU9A 2DFKB 1WM1A 1ZJJA 3E9CA 3LT5A 4MVXA 3MWKA 2V7TA 1LRKA 5EL0A 5TQJA 4WJZA 1UMDB 3FPHA 3HMQA 2JA1A 3TSYA 3X2FA 1T36A 3QFHA 4RKQA 3B89A 3T34A 3GCDA 3CZ9A 4OP2A 4BZXA 1KH3A 1NSFA 1W5SA 4OXYA 4K2HA 3I39X 3ZYCA 4F96A 2WP8J 4D4HA 3QVJA 3DP7A 4L2IB 2D5CA 4FFOA 1P4JA 1O3YA 4AZ3B 2AEMA 1UKVY 5BOSA 4EJSB 3N70A 3W3AA 5IBQA 4ECAA 2H7VA 2LXNA 3NV7A 1UPUA 1GUZA 3SEFA 2XEDA 4OX9Y 1E3SA 4OLAA 3PFWO 4G25A 5FEUA 1TZJA 4F4JA 3LNCA 1SU6A 1BDMA 2ATIA 4XFDA 3ZZMA 4DDTA 1MO6A 4NSNA 5KNBH 3QYAA 5C8XA 4RKWA 2OGZA 4TRMA 4W1PA 2IKQA 1IOZA 2GBIA 4K9OA 1MJGA 4M3NA 3T3HA 4HYTA 5LBUA 1E1KA 4HLCA 4MPRA 3ZDYB 4PYOA 5EP4A 2CK3A 2ZJ6A 2RGNA 4MPPA 4PHHA 3UVEA 3KKZA 4BTEA 1AQNA 1DBSA 2X15A 1OZFA 4MW1A 1DOZA 1AJEA 1V47A 2GOYA 5DCYA 2BFEB 5LIPA 1VCNA 4DSUA 4RKRA 5GAJA 1XFAA 2ZSBA 1NFFA 3B12A 5JZSA 2UVQA 4WADA 2IHTA 4P80A 4ZAXA 5IYZB 1SIOA 1JI0A 2OO7A 3DDCA 3GAAA 3QU4A 4OUKX 1EAYA 3TOSA 1H22A 5GZ3A 1E2GA 1MHPA 1CY0A 4Q03A 4Q0MA 3DAGA 3RI3A 5J4VA 1D2HA 1KRWA 2PKQO 4YH1A 2ZP1A 3BJEA 1UBSB 4OBXA 2NUPA 3ETLA 3HDYA 3IQXA 2ATEA 3EFOB 2ZUWA 2FMFA 3GJXC 1RXUA 4Y8VA 1XLWA 2EOAA 3ECCA 2PTGA 2CWWA 3WL5A 2R66A 2W9XA 3O3MB 5FA5A 1F51E 3SD7A 3K0AA 1MFZA 1S3GA 1Q44A 4XCXA 1WTAA 3K30A 1OX5A 4BBAA 3DMHA 2H9YA 3T5DA 3PKIA 1YR1A 4YXFA 2CBZA 5CCXA 1X7GA 3DCJA 3FBGA 4QFCA 2BM9A 3RHTA 1DVRA 2MTBA 1U28C 1JALA 1XZHA 4R1OA 4WLNA 4WZ6A 1NY6A 5DKFA 2JIZD 4R69A 4MRMB 5FADA 2VH1A 4I4TB 4HLUC 5I7VA 3IUYA 1VECA 2P9YA 1I2DA 4MARA 4LSWA 1Z29A 3IJPA 2OYRA 3MF4A 3UTDA 3W9YA 2C1EA 2ZI4A 3DP9A 3EBOA 5F33A 5KX5A 1BYUA 1YZ3A 2J7PD 1C29B 2R62A 3IVXA 3M7IA 5E6UB 1O9HA 1NW7A 2J32A 3ZS8A 4WINA 5AW3A 1Y9DA 5BSEA 2ERYA 3E5HA 4R2XA 2VYQA 1E64A 2FEXA 2X13A 2YJNA 1PZXA 2PM8A 2XTMA 4D6YA 1VIVA 2GPBA 3U31A 3GLHB 1JKMA 5LUBA 5BN5B 5PGMA 1XZPA 4BZZA 2G5PA 4R5HA 1MIOB 2XWQA 4RTLA 1CDDA 2GZ2A 1OYWA 8ATCA 1T0BA 3I2YX 2FPWA 4G9EA 2O20A 1RPTA 3VHXA 1ONOA 2BRUA 3QVTA 4AWXA 3O31A 5I9LA 1O5IA 2PE5A 1ZVQA 4EI7A 2EW8A 1BC5A 4BO5A 4TWIA 3L1UA 1N8NA 4Z4CA 1UBFA 1CE8A 1QV9A 5E9WA 5HGJA 6GPBA 3U4QB 1YR6A 3R0IA 2NZYA 1G21E 3I3OA 2Y1KA 3K70D 4ZQGA 2Z8YM 1SJ9A 2PL3A 3EYAA 3QOWA 3BJIC 4LMBA 2X0EA 5CFOA 2AEFA 3AUYA 4E88A 3O1JC 4XX1A 4URWR 4X24A 1HM5A 3A3KA 4HXFB 5HNKA 5HRUA 4BUCA 4N5IX 2NUBA 5J5VA 1C7JA 4U9IS 2GSWA 3BIOA 3KS9A 2RH5A 4HKTA 3Q6NA 4FI3C 4K0RA 4UBLA 2Q0QA 3RJZA 4DCPA 3R7WA 5AESA 3RFVA 3EGDA 3EVDA 3K6SA 2ZITA 3WL4A 4QGFA 1E1CA 4FOPA 4RSMA 5FI1B 3BIXA 4CLXA 4LJRA 1EFVB 4HMOA 1J8QA 5BQXA 5AJWA 3O3NB 4PZYA 4N4AA 3TVTA 2O7NA 3G8DA 3N0VA 3NXKA 3W6ZA 2GQ0A 4D6PA 1P1JA 5A9RA 3FI9A 5LQUA 5GINE 2ZWVA 1B1CA 4YEDA 4KFTA 1PZGA 2WD8A 3L0YA 4HNUA 2WM3A 3K8OE 1QIJA 2MR5A 2LCQA 4R98A 2WRZA 2GPSA 4G1UC 4MS3A 1G64A 5JEEA 1WXGA 1Z8NA 5CX1A 4AMUA 3C97A 5EHQA 3F5DA 3WRYA 3WSWA 4A0HA 2FF5A 4Y1RB 1CDEA 3LNTA 3OD5A 4PAQA 2Y92A 4PGFA 1XPOA 2O8DB 4HR7A 5HFJA 3CKKA 3N8KA 5DHAA 1L5MA 3LRTA 2UZ4A 3ELWA 4QSHA 3V34A 4MO2A 2PS0A 5T4BA 1SCJA 3FZEA 2WHQA 1A7JA 2XEXA 1SQGA 3QFSA 4TL8A 1Y8ZA 2IP2A 1Y9AA 1RQNA 3RRFA 4F4IA 4KBYA 4LY6A 3DKRA 5EFOA 1V8PA 4AMVA 3C3XA 4CCWA 1NLZA 4JJ7A 3T54A 4DC0A 2GD0A 4RWZA 3RFFA 3WIOA 3S99A 2BFAA 3AR4A 3LA8A 1GP2A 4L9RA 2YMMA 4DREA 3G0CA 4FOSA 2LKDA 2R6HA 1RXCA 4U2EA 3GP5A 4M22A 4NYMQ 1ZNXA 1TJNA 1VIMA 3Q72A 2EDAA 4BKPA 4DUGA 2PUFA 3AL0C 2G83A 3GIWA 3U5ZB 1MA0A 3I58A 5IEBA 1SUEA 1YR2A 4WE3A 4IV5A 3DFUA 1DAGA 2EKBA 3QEAZ 2FPRA 4ZV7A 1EUDB 4YCAA 3V2HA 4D1YA 3M33A 3VR4H 2X41A 1I4OA 1IQRA 3KWMA 1VIDA 5HIMA 1HLDA 1NBEA 2VJAA 5ALFA 4CEJA 2NQ2C 5LZ2A 1GY8A 5JSZA 2I6GA 5IVDA 2E82A 3N7UA 1AUVA 5DXFA 1ZK2A 3V8VA 4DILA 1D3AA 4Y0AA 3SC4A 3K70B 1YUNA 4E14A 2WWWA 3PVZA 3QK7A 1CX9B 5DIZA 5DYGA 3MS4A 4JYCA 4LQDA 4D56A 1L5GB 1JWLA 1NYTA 4OYLA 1ZD1A 1RAIA 5EIBC 3TJMA 4DLXA 4Y0VA 4QXRA 3D8RA 2HA3A 3OY2A 4PGAA 2CV2A 4XDYA 2D3TA 3TW4A 2H2HA 3KXPA 3RUDA 3BZWA 4JV5B 3QVXA 4LF5B 1SRQA 4ZGWA 5AXAA 2CT8A 5HXAA 3L7AA 3FWNA 5DWDA 3L8MA 4RM2A 5TC4A 3UEOA 2ZM5A 2CCJA 4HEHA 1FJGB 2JAUA 3BT7A 3FHTA 1W5FA 3JWHA 2O3JA 5KOHA 2FOLA 2CDRA 2J9FA 2X5NA 4F5EA 5GONB 1U9YA 5KWEA 1SA0B 2ADMA 4G86A 5CT9A 4F6CA 4AY6A 1DARA 1ZUNA 3ZWKA 1GCGA 1ODKA 4I5IA 1X1CA 5HS4A 2UXDB 5FTMA 2QZ4A 3BGWA 3JQEA 3N53A 3IOYA 4OP3A 2CJFA 2GSDA 2J3DA 2QX9A 2ZYHA 4IS2A 1MC8A 3RJMA 4E21A 4KE9A 1MQ8B 1GUDA 4ASUD 3ZIDA 2WKSA 3NTRA 4PINA 1NJ6A 4HS9A 1ANKA 3FDJA 5DHUA 1XZEA 5EIWA 3WE7A 4KWCA 4HQOA 1T4BA 4RF2A 4BNDB 4X6UA 1QHGA 3DB1A 2B1GA 4Q9NA 2VPQA 3SMVA 3O91A 4RX1A 3HJTA 1CUWA 2GM3A 2C4UA 2F62A 3BTUA 3TB6A 1SUDA 3P45A 2JGDB 1DOHA 2O7QA 1QQ5A 3G7UA 4JBLA 4E4YA 2PG3A 1C2YA 2YIJA 1K8RA 4LTMA 4EUKA 1T6NA 4IXMA 3MYRA 2O2HA 3T3OA 4RFVA 3G9ZA 4TTQA 1RLMA 5THKA 2TECE 2FLKA 1LQTA 4OREX 4UDXX 1DBPA 3W9BA 5HUHA 2DFLA 2BGRA 5TVKA 4QT0A 1UBJS 1SZPA 4RZ2A 1IAVA 3W8DA 4LHZA 3R4VA 4H0CA 4R01A 2IV2X 2F3UA 4CIYA 1D4AA 1L4LA 3QBJA 3AM5A 1IEWA 3P9QA 2Q3MA 3HUFA 2JCXA 1IWOA 4RIFA 3UJAA 4B35A 1LLFA 1UKEA 1UXOA 3KZNA 4KPGA 3NBXX 4ARZB 4GDFA 1XZIA 3OU6A 3E4DA 5BPFA 1L7AA 1TO1E 3SYLA 2XZOA 4PTZA 2EQAA 3NHJA 4RSRA 4JEHA 1Q3KA 3ROGA 4JA0A 3WXMA 1KAMA 3ADOA 2P27A 1B8UA 4L8LA 3TD2A 1KZ4A 4HBZA 5EMMA 1QU3A 1R0YA 1OLUB 1XTVA 2IXDA 3GVIA 4NYMR 3PXEA 4RLFA 4R3WA 1TT5B 1E6WA 2UZ0A 5I5GA 1CY7A 2CXHA 2SKDA 4KMRA 2E48A 2ZDHA 1A9PA 1JA1A 3FFAA 2PAAA 1Y80A 4UMFA 4M86A 4V0NA 3SHWA 3NS7A 3UMGA 4CF4A 3KR1A 3LP6A 3U9SA 4MKGA 5LQDA 2YYSA 5CYFA 1W75A 2AVNA 1MJHA 3EG5A 3WRXC 5JJKA 1J06A 5H4GA 1B6GA 3ZJTA 1GUAA 5JJIA 3ZHXA 4RS3A 3G0IA 2QVBA 1J8YF 2IYSA 1G8AA 3P96A 2VQEB 4F1WA 4H4CA 1NVKA 2AOWA 4IW3B 4X84A 2OK8A 3B53X 3EZFA 5ALJA 5KYKA 4AY2A 1T8RA 2WPDD 2XUQA 4PPNA 3LZDA 4QUIA 1HQDA 1UPCA 4C5CA 1HFEL 2C5GA 2OR3A 3OWOA 3PHLA 4FZRA 4JSTA 3WYNA 5BVGB 1J25A 1HL3A 2XMBA 5F35A 1EZZA 2H1FA 2BLLA 2RI0A 4DXDA 3AUFA 4TYQA 3B85A 2GJAA 2XA9A 1F6DA 2EV9A 4B3CA 4OA5A 5B36A 2H1WA 1E2UA 4L5AA 1PNOA 1A50B 1NHGA 4UUAA 1JVBA 2XYPA 5EYPA 1HUQA 2JFVA 4R1NA 1E2HA 4CF7A 4V1CA 3W8EA 4V0KA 4Q21A 5I7EA 1Q15A 3FG9A 2Y2UA 3P2YA 1NVVQ 1A72A 2Y99A 3B3AA 2JFQA 3R77A 5P21A 4OQZA 1PYDA 2WINI 4V0MA 3W6OA 3DKKA 1YIAA 4CODB 3NTXA 3IRUA 2A9RA 3K0EA 1RJ9B 1EXMA 1VE6A 2Y1EA 4HGNA 1A8HA 5DTEA 4PFKA 1FA9A 5TPZD 5LKRA 3SXUB 1P4SA 3LOQA 4Y7CA 1QYCA 4Z8YA 4G41A 4BX2A 2H57A 2P3QA 2WT4A 4BMYA 2ZJ3A 2E1RA 3AETA 4PANA 2N47A 2Z30A 3LFUA 3MUEA 4L8FA 2WF9A 4ITRC 1U8XX 3HVUA 5HOQA 1Z74A 1P91A 1DKQA 4NE2A 5JY1A 4ZK2A 4OXNA 2FRDA 3M6XA 4OX9B 1YFJA 4FKZA 5EE1A 3RYHA 1RWVA 2Q4BA 2QTBA 1S2MA 1WHSB 2WVGA 3PNYA 4GKVA 4IZ6A 4E2XA 3LOUA 4NOMA 3ZD7A 1A7AA 3H8JA 5DLEA 3BCHA 1CRWG 1V4BA 1XN1A 3IR5A 4J1SA 4U0KA 1O4WA 5EXPA 3VHQA 1BE8A 3H83A 4JUAA 4MW0A 2P2CA 1KE1A 4OLBA 2Z08A 1GZ6A 4UM8B 1TKCA 1V8FA 3KUUA 3WO1A 4RCZA 2DAPA 2FFBA 2NUAB 1QP7A 4HQNA 2HCJB 1NJFA 3HZHA 5AW2A 1CLUA 1YFZA 2RKOA 1P6QA 4BRZA 1AGPA 3I9MA 5G1OA 2G06A 1CYDA 2X8JA 1RBYA 2P9GA 2VPIA 5IT4A 1XMSA 1KFKB 2R6GA 4MWZA 1XX6A 4PC6A 3GLIB 4U7HA 3KD2A 2ZIUB 3H97A 4EFKA 4H3HB 4Q7EA 4BV8A 3P9XA 4DM7A 2O2GA 4MB6A 1O7JA 2AOUA 2PMDA 4H7EA 4MV5A 5C31A 4W63A 3CH6A 2AS0A 1X8KA 2BSXA 1W93A 2YXDA 3K9FC 1RM3A 3ICWA 3IDFA 4GZMA 1DKPA 5J5AA 5BWLA 3NVMB 3GCZA 4EF4A 3Q8WA 3AGPA 1LPOA 1SIUA 4JAVC 1LJLA 4J0HA 1BDIA 2AZXA 1Y3AA 2A1IA 2IZ0A 1IZ9A 3A1UA 4C03A 5EQJB 2HHHB 4GP9A 1V11A 4DCUA 4OQ4A 4QATA 3CE9A 4L4RA 4YGXB 5L3SA 4JLVA 2MSWA 2R5NA 2ZT7A 3RVMA 1OAKA 4RWEA 3CVWA 2FE1A 3UMBA 3MPOA 1SU8A 1OTYA 2DH5A 5HIJA 3SKXA 4UAVA 3FYTA 3HO8A 4ETNA 5H9WA 4FPXA 1UMBA 3F9IA 1T5TA 2DUNA 3I1JA 1XB2A 4IGEA 3T3PB 3VC1A 5JZBA 2ECOA 1ZLYA 2NPIA 4BRSA 2W42A 2O6HA 1OXSC 4EFNA 5C81A 3S8EA 3ZWXA 4ZRDA 4AVYA 2C29D 4BYGA 3RARA 1MJFA 3F5MA 1EXNA 3DQPA 2IHYA 1KMHA 4B3MB 1OTHA 4QVIA 2W98A 4JJIA 3D5EA 2DY1A 2GD1O 3D8SA 2OTCA 3BB1A 1FNBA 2G3YA 3OQIB 4BNIA 4CM8B 4V3BA 1PV2A 5MN6A 4GOXA 2N0SA 4M1QA 3I5XA 3U7QB 3WKBA 1NVVR 1Z75A 3A4YA 4DZZA 2XF8A 3KQQA 5FUXA 1NC1A 1GOTA 1F1BA 2EIHA 4FFBA 2FB9A 3I3SR 3IE1A 4ODIA 5CJPA 5J2UF 1K08A 1SBNE 2K5UA 3GCWA 3R5TA 5IXSA 2OBBA 4KSYA 2AKEA 2PT6A 4I14A 2AMVA 3DZFA 1BKSB 3OPYA 5A71A 2O2EA 2QTZA 1C80A 3NHWA 3WJAA 3K94A 4MYCA 1R74A 4Y2PA 1WXEA 4Q3OA 4BMOB 4N7BA 1P3DA 1KFBB 2D5LA 1YMUA 2FX3A 2ODNA 3CF6R 3CPSA 3DOOA 3FN4A 3MRVA 4GM4A 5H82A 4R71A 4AM8A 1QK3A 2WHRA 1I7NA 2PRYA 1JT2A 4RESA 3IAUA 1IN6A 3OMLA 2ZRHA 4ON9A 3TD6A 2Q28A 1SUPA 1GL9B 3AH8A 4TT8A 2AJDA 1P7ZA 4G5QA 4N0QA 4ND6A 3CJQA 1IL0A 3G0GA 4YV1A 2XQKA 3P2MA 2JLWA 1XP8A 1RXIA 4P32A 2VUTA 2QRMA 4Q7KA 1XMJA 2KE5A 4GKBA 1G3UA 4O1IA 5MGNA 4CMCA 1ESCA 3K35A 3K2EA 4LJLA 1H1DA 3BA1A 4JBXA 3BCSA 1HURA 4AIIA 4EKNB 3K09A 4BKMA 4EVSA 2GHRA 2WSYB 3BPSA 3USZA 1QQ7A 3GFQA 3HNRA 3JQBC 2GN0A 5EMKA 3DAYA 3DLAA 2Y1DA 3RAJA 4PN3A 2PJRA 3QVLA 1G41A 2JHAA 4Q93A 2C2BA 3MWJA 4TKVA 2ODPA 2Z83A 2HQ1A 1Y4DE 1S4QA 2RGAA 3P9PA 3LP5A 2CSUA 4NP6A 3EYWA 2KMLA 4CM7A 1P4RA 4PCUA 1YJXA 3I2HA 2VCYA 3DE1X 2DPGA 2F59A 2GARA 4F9EA 1LC3A 3JD3A 1CT9A 1UC9A 2WT9A 1D9ZA 1JR3E 1KC1A 2WK1A 1R6TA 1INLA 2IXGA 2NXWA 3E1KA 4P33A 1APBA 4DWJA 1E0JA 3MT0A 4RHTA 5FBRB 4KE7A 4E2ZA 3ST7A 1JHDA 4HO1X 3CQ9A 4HZUB 1I0IA 1JS1X 2WIAA 3NO4A 3CH5A 2F9FA 3FDZA 5AWFC 2PD6A 4JBIA 3D6MA 2CNBA 2O8NA 2BMEA 2IIQA 2E5LB 3VYTB 3QMMA 2Z1MA 3OHPA 1GN8A 4GC5A 1XTJA 4KTVE 4RTQA 4KDRA 4C4RA 3LPLA 3U4CA 4IXWA 3CKLA 5ALNA 4YJ3B 1QFMA 1T8YA 2PEYA 2QT1A 3R5FA 4M0PA 3UMVA 4J4TA 1P9WA 2H29A 2Z5LA 4ZDKA 1V43A 1A1VA 1A5ZA 5BN1A 2WJAA 2WHPA 1P1FA 3DQZA 4Y98A 5CAEA 1LDBA 3IHKA 3CR3C 1T10A 3U7EB 3UGTA 3RHFA 3L5OA 1UM9A 5B7GA 1TM1E 2E55A 4IMJB 3BH7A 4DQ0A 2JIBA 5KDOA 5J3JA 1D7OA 1PL0A 2QG9A 3OE4A 4RPCA 4ABTA 1WCIB 1O95C 2N9UA 4MYHA 3WLKX 2A88A 1FRQA 2FW0A 2HK7A 1TTTA 4E4TA 4YAIA 2WMDA 3VISA 4BECA 2X76A 1K06A 3FVTA 4KQXA 2X9NA 4KR0A 3Q3EA 1RKBA 1FL9A 4LZNA 4OO3A 4P3YA 4UUOA 4UZFA 4B8WA 5EPUA 5AUOB 3B38A 1EUCB 3N8GA 4P0QB 2X19A 3JARB 5DP1A 2OP0A 3T15A 3K9LA 2OGTA 3V42A 1RWWA 4D3YA 1CB7A 2P4HX 3QHPA 1DO2A 1E7SA 1F6WA 4TTSA 2BFBA 3WLRA 3OJ0A 4LY9A 4UZEA 3HK2A 1OZ0A 2GN2A 2WAYA 1SQ0A 4LNUA 1P74A 1G9SA 1UBHS 1O6BA 5JALA 2C1XA 4QGAA 3O8OB 4WCFB 3KPJA 4Y2TA 1KMIY 3H5TA 3X1KA 1DQZA 3LO5A 2CVPA 2PGDA 4IR7A 2ON6A 4AYWA 2GPNA 3FMIA 1I24A 2PS3A 3QA3E 3AY6A 5ENDA 3LC1O 3CWCA 3PDIB 2DHDA 2C2KA 3KR0A 4B81A 1LVGA 2ZANA 3EVAA 1Z6XA 1DHTA 3MINA 3PJEA 3QG1A 2R3SA 1E3LA 2RAPA 4TTVA 3TUJC 4DQLA 2VSNA 1UBUS 3N74A 4Q66C 3KV3O 5M3BA 3M3HA 2YCBA 3LLUA 4LYDA 3PYMA 4HDCA 3VMFA 2GZ1A 1X3SA 4G0WA 1RRPA 1Z56C 2L19A 1OBHA 2GXUA 2XGGA 5F1KA 3RK4A 2EDCA 4EP1A 3DUWA 1CEYA 3N07A 2PEZA 3AEKB 1NPYA 3L8HA 4IQFA 1SVIA 3FHCB 3TW0A 3UAVA 1XOIA 4FKBA 1IBLB 1N9GA 3H9UA 4XQCA 4BAGA 1DJQA 5EXEA 3UKDA 1NRJB 2WYWA 3R2JA 1TAQA 4L8GA 4UD2A 3DOHA 3CNBA 5LWHA 1LV7A 2HDNB 4OOEA 2UYGA 5I9NA 3RH0A 3RKRA 4GYKA 1CP3A 1DKUA 1FPMA 2XTJA 2FCAA 1PZHA 4RZXA 2ZUDA 3ISTA 2BDUA 1WX1A 1X7HA 1OYVA 2DLDA 2AVDA 4X3PA 2XMRA 1G6Q1 2ZXEA 5ALXA 3LX6A 2NGRA 1G21B 3OTIA 1GSAA 2X6TA 3VPAA 2D5BA 4DL9A 4RC9A 4Z4FA 2H4HA 5JW6A 2H1OA 1C4WA 4TVBA 3T9FA 4NPHA 2GILA 3RKSA 2FDCA 3AHJA 3V3KA 3LQRA 2GZSA 4N7JA 2NV2B 4FHDA 4MITA 3GNSA 4NU6A 3PC8A 3VKWA 3NMUF 2R8PA 3WFJA 4MV7A 3T9BA 5LQMA 3BX1A 3F7OA 1KVQA 4FYJA 3RABA 1E1RA 3ZW8A 4EX6A 1ODSA 1U4SA 2B9VA 3TNJA 4TTAA 2R8XA 3MN1A 4KJZA 4CLRB 1AHNA 2R8YA 2WBLC 3HXLA 3DWGA 1R0WA 1HLFA 4GBMA 4RZ3A 1QX3A 2Y71A 3K5PA 3LZCA 1S89A 1C3VA 4F9FA 3HKCB 3SDZA 1KF0A 4C0AC 1QP8A 1EAMA 2B36A 4UKDA 3N2KA 2PKEA 5H70A 3RNLA 5GVSA 3EWAA 2AE1A 3G2NA 5K0TA 1JEAA 3K2IA 3GAMA 3ELDA 5H0IA 1Z16A 3BA6A 1Z17A 1U8AA 4HJXA 3IUJA 2PSHA 3NDIA 1WDWB 1QGDA 1RCFA 4BX3A 4BTVA 4GBED 3H8WA 1GNVA 3BB4A 3KYJB 3E7FA 4XJTA 1I4TD 1QFZA 2XB8A 4J07A 4L9WA 1H3EA 2FP4A 2QI9C 3DLPX 1S01A 2OESA 4IO0A 4MIOA 2TMYA 2RGXA 4UEQA 3QEKA 2A1TS 4TT3D 1GA1A 1FMFA 3KIPA 3QTTA 4ZO6A 1DFHA 5SZHB 4WSOA 2VOEA 5IN4A 3KFXA 2ZM6B 2ODAA 1CF4A 2PGIA 3ZBTA 3GYBA 2IPMA 2VVTA 1G7SA 3A9SA 3EK2A 3KG2A 3UA3A 4AY3A 2RGWA 3ZDBA 2X9GA 3VPBA 4RGYA 2ZAMA 5GGYA 2B61A 3OE7D 2VRWA 3EDCA 3TRFA 4OQQA 4IDEA 5D8DA 2O3SA 3GVXA 1X7DA 5AW9A 5KYUB 1W2WB 4B0PA 5TRTA 1R27A 5LZ5A 1Q20A 3RBZA 1KJNA 3W78A 4GMKA 4WNAA 4N65A 1ACJA 4I6EA 3I2GA 4NJEB 3PCTA 1OFTA 1C3EA 2AG1A 3FTQA 1ZSVA 3MJHA 4RHFA 5B2EA 4U2BA 2JVJA 4H31A 5JCXA 3CVXA 3E05A 1M8FA 5CD9A 3TAUA 2GAJA 5KYNA 3SR3A 2WP0A 2JIDA 5EAIA 2VDKB 1CDOA 2ZJAA 4KMMA 3X43A 3T7AA 4ALMA 3G17A 1B7GO 3D3WB 3HR7A 3I04A 2UYYA 2A5FA 3QE4A 1SCKA 4MPDA 4P5DA 3F8TA 4PU0A 5EA2A 1EM8A 2GRJA 1SVSA 4MGIR 1QQBA 2WVAA 2IP1A 3O90A 4UFPA 1P9RA 1ORRA 3P9YA 4BP1A 1SHZA 4LZJA 4BMDA 1NRWA 1AKTA 2CXTA 5LYJB 2FWJA 3FUTA 3TVYA 1YJQA 3EXEA 5JMOA 2QZZA 4AJ4A 1CUJA 4X54A 3VYSB 1C9YA 3EH2A 1XD8A 3SSOA 3N76A 4O2RA 2QV7A 1FXWA 2XVMA 3O74A 4IFEA 4Z9BA 4D0RA 1NMSA 4BN0A 3CT4A 4K46A 3L4EA 5HF5A 2B4QA 1AT1A 4ZMBA 2RK4A 5LJIA 4RD4A 1AV7A 2JAHA 2WUDA 1MJ5A 4IZHA 4BMCA 3LXUX 4AO7A 1XGKA 1E4OA 4JJAA 4IX9A 2PLFA 2ZIGA 1RLJA 2GM9A 2DF8A 3C45A 3G68A 2G88A 3ZV5A 4C7JA 4AIRA 3KSBC 3LPDA 1ML3A 5AHKA 1J22A 4K7JA 1XCLA 1B00A 3KZMA 3ABQB 1J2JA 4OB6A 1N1MA 1PR4A 1U28A 2IXBA 4GYWA 5AXBA 1M6HA 1WCV1 3M6FA 1QYXA 1UOQA 1WXHA 2FMUA 3GARA 3JSAA 1FSSA 4HLUA 4QDJA 5E7IA 4CLOA 1LTHR 4BNZA 3OQNA 3M6MD 4B6RA 4KJXA 1UWVA 3GEIA 1O0SA 3W9UA 4BQSA 2WNHA 4TV9F 3T9CA 1RC8A 4AC9A 4I3FA 4B46A 2R00C 2YWHA 2BBTA 5A0FA 3IAEA 4C4YA 4BP9A 4MAMA 1AMOA 1C81A 1CXZA 3WDSA 4IHJF 4JBYA 2C5SA 3TQFA 1JAYA 2Z3WA 2CHFA 3WWPA 1Z38A 2HWYA 5HIKA 1PFUA 2R97A 2AGVA 3KDSE 5C5EA 1FX0A 1BCRA 1NMZA 1UFKA 1T0JB 5I9TA 3ZU6A 2G0TA 3H5VA 4GWGA 4EMBA 3KJFA 2E85A 4GXRA 4FNAA 4DLSA 4HX9A 5B3AA 1MB3A 4JI8B 2MINA 1EUQA 3E15A 1SOWA 1R4AA 4B74A 2J3LA 5KKNB 1ECLA 3CF2A 3PUWA 2HA0A 2XDQA 1X1EA 4IDAA 3HBJA 5FKJA 4AK9A 4BV3A 3V80A 3MD9A 1XJCA 4LG1A 5T4EA 1JQDA 3E7WA 3MLEA 4HAXA 1GL7A 3FVWA 5T6BA 1KNXA 1E9SA 3TB4A 3ANYB 2B35A 5GJBA 2N1BA 5IAOA 1Y48E 2JIMA 2QTLA 2UUPA 4NRDA 4EB8A 2DWPA 1EXWA 2X2FA 2I6QA 4WBXC 2CJYA 3TIVA 2JJ2A 5ALLA 4D57A 2GVZC 4MRAA 3E81A 1WOMA 4OUDA 1YB6A 2IOFK 2VPWA 1PFVA 1IBKB 1C1DA 3RIMA 5B58C 5KS2A 5TJHA 3TG2A 3AGQA 3QENA 3KTDA 2GFHA 3DFIA 5CVEA 2ZETA 2C57A 1MEJA 3WLFA 4QFBA 4BPBA 2HJRA 2P7IA 4H17A 4PGMA 4PSDA 5FI3A 1E8NA 3K9QO 4FBMA 1KOLA 4BGVA 4LGMA 3ZY2A 2Q9AA 2Y0PA 4JC5A 4P58A 4Q3BA 2AA3A 1L5OA 1F8GA 5K4GA 1XNRB 1QU2A 5AKGA 3MGCA 4LXYA 3EGOA 3X0DA 3PJGA 3HJBA 3GXBA 1H8HA 5EVJA 3X1YA 2ZSFA 3LT1A 4LRSB 4A6PA 4ZCIA 2I2BA 5IZ4A 4WKPA 4YBRA 1Q77A 3G5TA 4O2AA 4F84A 5FJJA 2IPNA 3CUVA 3DMDA 1KYZA 2K2QB 2BEJA 3MAAC 5FI5A 421PA 3WIEA 4HDSA 1N1DA 3THOA 1QR6A 2ZIVB 3CW9A 1J0XO 2P4QA 3CZ5A 1LX6A 4D46A 4DMFA 2Y0BA 5KVVA 3KCNA 3L7LA 2OFPA 5JG7A 3W6UA 4DRXB 4RF3A 2EJWA 1A71A 4JGIA 1RAEA 2OZVA 3MRXA 6NULA 4LCJA 5HKBA 3DJYA 4WMLA 1EDZA 1X7YA 3DONA 4JXZA 4BO9A 5TMBA 2V6JA 2J6HA 1YASA 3BS4A 1A5SB 3KT6A 2EFDB 5JISA 1TRKA 2ZKLA 3B1XA 3T7KA 1NF3A 5KQLA 4BV9A 3SYRA 3I30X 5I9IA 3TQIA 1L6IA 2HJGA 1PG2A 1M2KA 2BGUA 1MT0A 2DUWA 2PQ2A 3SLKA 5DN6D 1XTTA 4PXAA 1V1JA 4FFSA 4KQIA 3PFCA 5FOUA 1AF4A 2FY8A 2XE7A 3MWYW 4M38A 3NDPA 4U2DA 5AW5A 1F2TB 3GY0A 4F38A 2KI5A 1V3VA 2W6IA 3FFXA 2DRIA 2I99A 3TMYA 4O3FA 4YA6A 3LDFA 2LIVA 3ZCTA 2ZJYA 3RUEA 1PP4A 2PR2A 2V6GA 1QO0D 3L18A 2X42A 1PW7A 1UPXA 4ZCMA 4YDQA 1E2NA 1QTNA 1Y33E 2W83A 5DM1A 3ZTWA 1KAQA 4NQZA 1QPBA 4RIEA 5KTOA 3BMNB 3L84A 2AG5A 4HYQA 4NULA 4UUNA 3YASA 1R0RE 4FFNA 4IJ5A 4BE9A 1H5NA 4Z3KA 2J9YB 4DVJA 5JECA 1LBSA 3M1LA 5JS8A 3LTEA 1FW8A 3MWEA 2X4LA 5EQFA 3Q8LA 4GQBA 1YE8A 2OCKA 2CL6X 3K7EA 1VHQA 5EIHA 4YWHA 1EWRA 4XDGA 3PQ2A 2GJKA 3BTSA 2GZAA 4JJEA 1XE3A 2ORYA 4BLRA 4DIEA 1TMYA 4I55A 3GH1A 5KSYA 3D7NA 2AV6A 3NR2A 3IODA 4MVJA 1UANA 2IF0A 2P0AA 5IDQA 3SNHA 4C2AA 1OF1A 4BEWA 1T8SA 5BQFA 2FWPA 1IJKA 1OPRA 3JATB 3RYFB 3EZ2A 5ICSA 3WLTA 4OSOA 2WB4A 2WMNB 4MW6A 3A3NA 4FMBB 2UZ1A 4L4SA 5E3IA 1K2VN 2NO5A 1OBVA 2WDZA 1YFKA 5DBGA 4OJTA 4EM6A 1M34A 5LDHA 1CUBA 1ZUIA 1JR3D 1RAAA 3TOZA 4MV0A 1KH2A 4EENA 1N7HA 3QIAA 1ML4A 1QHXA 2AC2A 2WHEA 1YKSA 2E6KA 3KUXA 2HWKA 3PGVA 5GZ6A 3PF9A 1OWPA 4P35A 3EDYA 3EGIA 4HN4B 3AONB 1FFEA 3T3GA 1FSPA 4J3JA 1AKVA 1AY0A 1T91A 4AMYA 4XSHA 3TL2A 2VF5X 1DAOA 1BXKA 1ESZA 1HMYA 4B87A 4C0LA 5A5FA 5HQ3B 4LK2A 2WWTA 1M9NA 2H59A 2V4MA 3R3WA 3FI0A 1GARA 3T3NA 4XUCA 2VDWA 2CJWA 3OOJA 3LRPA 4RD1A 4WRRA 5I7UA 1GGNA 1KS2A 1K7EB 1JXOA 2V59A 2B99A 2A1UA 4CQMA 4BATA 2BMWA 3DBRA 4EG0A 1KARA 1UP4A 2J67A 2G63A 1X7XB 2JZNA 2FSSA 4HN2A 2JKZA 5AVJA 4EVQA 2OG1A 5BWNA 1SHUX 2A3RA 5BSFA 3JVDA 3KKEA 3QWFA 4OKSA 2EIXA 2X9VA 3U7FB 2BMJA 1YE3A 2JH3A 1YB1A 4MUJA 1POWA 3UHAA 5K0JA 2RHJA 3R3SA 5JYEA 1XVTA 1S7GA 4Q4AA 3UOAB 1TAGA 1B0PA 2LD4A 1YRYE 5AT1A 1XYYA 4Q4JB 1IJEA 3P2KA 2F67A 2QB5A 3SJCA 2ZJ5A 4WAUA 4OMFG 4GXNA 3HXQA 1GKLA 2BMVA 5IWCA 3Q6IA 3NX4A 4L4ZA 5J1TB 2XVXA 5KTPA 4GXTA 2QD3A 3NHRA 3BJZA 1MH1A 3F7NA 4AN1A 1BGWA 3A10A 4RQTA 3ABRB 3FPKA 1VFPA 1OROA 2QX7A 5JCJD 1TM4E 1V1RB 5ALHA 4KO3S 4C6SA 2PT7A 4B44A 1IDOA 1NI3A 2XYGA 4G0XA 2ERXA 3OQMA 1ACMA 1NPTO 3OVMA 2WVHA 4FCTA 2C2HA 1P5JA 5KPJA 1C5KA 3AM4A 2HCFA 2DPLA 3FXAA 4PG7A 4O4LA 1WPXA 3HL0A 1ISPA 1T5OA 3BK1A 4LX0A 4MCHA 4WFKA 1CY2A 3RS2A 2WQZA 4B3JA 4BBZA 3CINA 3E5NA 3PFKA 4QTYA 2AE2A 2R87A 3BIFA 3FKSD 5DM0A 5FYDA 5J2UB 3TM5A 2EXXA 3WRXA 3QUQA 5IT0A 4BLTA 3H5NA 4AYTA 4EJSC 2NUTB 2RIRA 2V96A 3BORA 3L46A 4ZTUB 1B23P 4C7KA 1A27A 3RT9A 4RQBA 5L40A 1K5DA 5DK4A 5C46F 1T0UA 2R1ZA 3I8SA 4GICA 1SUWA 3OLYA 1KMQA 1H65A 1YCFA 3FOBA 3JU3A 5KTMA 2JLAA 4YCMA 1VPEA 4JFRA 2G0AA 5F9FA 3NV9A 1YQDA 3L4JA 1RADA 2FUG1 2ISQA 2XKJE 1A2KC 3MIZA 1WD7A 1RM0A 3LKDA 2J3QA 3AFNA 3CF0A 2BMDA 1JHRA 2JGFA 1MZVA 2ZE8A 3FWKA 4TLMB 4J8PA 3A37A 4TSKA 1ULSA 3KWLA 4UVEA 4KV9A 3HCNA 1NI5A 2MYNA 1SKYE 1RRMA 3OSZA 3KZXA 4IL5A 1MN6A 2OXFA 4BNLA 4IX1A 2E5FA 1HE4A 5IVPA 1JR6A 3AR7A 2IH4A 5KTTA 1IMOA 1K97A 1YZVA 3HKBA 4MR7A 1ODLA 1RBZA 2ZRDA 3AVQA 3LC7O 2XQJA 3TZQA 3UXHA 4IINA 2QSJA 2PX3A 4IIHA 1AZSC 1UPFA 4G24A 4F91B 3TGPA 1LBQA 2QE7D 1H0KA 1P5HA 3OIYA 4LC0A 2HZBA 1WQ3A 1LPMA 3TAXA 3HGQA 1G1MA 1XL1A 5E6SA 2FEWB 1BWSA 2SBTA 4NZNA 1WDMA 3W1EA 4JYAB 1M72A 1OXXK 1VCOA 2DOKA 5E1OA 1T5DX 4JUFA 1QC5B 3FOCA 1KYXA 4YLEA 3ZQJA 4ZCRA 5KOJB 3QF4A 4L08A 1H93A 2XTAA 1NX9A 2YWCA 1TIKA 2ZRJA 5DBEX 1GYRA 1UZLA 2EFJA 3LU1A 4EUEA 2KW5A 3EB9A 4D79A 4BE7B 4D25A 1SMKA 2CKMA 1WETA 1XI2A 2PZBA 1ATZA 2BFOA 3F1KA 3G8CA 3W2TA 1MENA 4HXGA 5CK5A 4JELA 1TLLA 5JSFA 2EZUA 1F0YA 2FG7C 3EXFB 1E9DA 5GV8A 3UHJA 3WGMA 3IHWA 2VZ0A 3U17A 3J81A 1VCIA 4EA6A 3ZPXA 1B93A 3NEPX 1YI0A 1YGYA 3RBXA 5K3AA 5FOQA 1T1IA 1X9HA 2D7CA 1R4NB 3IP8A 4HH3C 5DVZA 2W2LA 3UXMA 1VLHA 2PY6A 3WYEA 1C1XA 1Q0LA 2A4KA 1F9EA 1U5AA 2BEVA 2YW9A 3KEFA 4Q05A 5LLSA 4CDMA 5ABPA 4A36A 2HK8A 4GL2A 2Z6VA 3A0RB 5H5JA 4U3JA 1FVOA 3STXA 5BR1A 1SQFA 1E2LA 2B8WA 4GWKA 4XD2A 4DUZB 3K1YA 3LQKA 2FW7A 2JLRA 3QV2A 4GZLA 5CA0B 4HVTA 4BLSA 3H4VA 4J75A 5B3LA 1U8CB 2ONZA 2YHAA 4WESB 1M73E 3WICA 1U99A 2GWHA 3EZ6A 4OVKA 1T6YA 1XTRA 2IOYA 1X1TA 3DGEC 2B30A 2XMQA 3NFYA 2SECE 4HDRA 2WU1A 3VZQA 2FPMA 4EY4A 2ZIAA 3F6YA 2Q0XA 3LXRA 1N3BA 5CNKA 5H1YA 4XAQA 3A7DA 2YIDA 1M2VA 2X8AA 4YB8A 3TZLA 3ZC3A 4E11A 1RPJA 5BW5A 4A0SA 2DMRA 3IT1A 3QFFA 4U7JA 3MBOA 3OAAA 5FR1A 5T4HA 2V5AA 1S1CA 2ZSEA 4W5JA 3PFNA 4KXLA 5ENVA 3V33A 2DKOA 2H85A 1RYYA 1ZCFA 3IE2A 4R3NA 2BTQB 1ZN9A 1RHRA 1M6EX 2QQ5A 1D6SA 1DHRA 9ABPA 4MGZR 1Z37A 2C1ZA 2FSIA 4GZ3A 3UW1A 3UW3A 3KZ1E 1OKKA 4EPRA 4KBFA 3N3AC 2IW1A 3J7AC 4FFWA 3TZEA 1JDVA 1D07A 1WO8A 4EFLA 5AW0A 2W48A 3MCTA 1NLYA 2BKVA 4BP3A 2VAWA 4V0RA 1E3DA 4HH0A 1EJ2A 3BXGA 1ZM9A 3S5JA 3UOWA 2OZKA 3AXTA 2WIGA 3A4VA 1E99A 4C01A 1Q21A 4MW2A 3SQDA 5F7ZA 4IGKA 2C7QA 2P2LA 4B6GA 5AP9A 5AI9A 1U2QA 3DYVA 1C8LA 2HD4A 3JQRA 3PD7A 1P1CA 5K5EA 2EHJA 2VTDA 3WK5A 3L0BA 1JQAA 4ZIRB 5HR5A 1CRQA 3NDRA 5KQPA 2J33A 1GLNA 4WFJA 3CZ4A 3EIOA 3USES 3ZW7A 3HKEB 1ORHA 5D6NA 3D6UA 3ITNA 4NBTA 4K9SA 3RUIA 4V0LA 3LQQA 1VKOA 4IQ4A 4LC9A 1NYLA 2QSZA 3COYA 2A9FA 1YC5A 4K26A 4C3OB 1UWKA 1E2FA 1DBWA 2NW6A 2PT5A 3HHPA 2COKA 4LMRA 4Y9DA 2GPYA 3I9NA 4LGCA 1KO4A 1DC6A 4LOIA 2J59A 2VAPA 5AVKA 2IEDA 2IZOA 3PC3A 3Q3GE 1RWPA 4KPUA 2IXAA 3DEYX 2YBEA 4QUJA 1SXJD 3B7PA 1KSGA 3WADA 5BUZA 1HQKA 4W99A 3N9IA 4OSPA 1XL0A 1WSAA 4HAVA 1EFAA 1GSIA 5EUMA 3NI2A 1D9XA 2FSPA 1O9BA 1RQXA 4LBVA 4CHTA 1ICEA 3LZ6A 2HDWA 2YJZA 5E9JA 3EZNA 5BRAA 4EW1A 5HMMA 4F92B 1N3YA 4A2QA 4RVDA 1M10A 1H3NA 2RHBA 4O6VA 4P2GA 3ZHVA 4DVGA 2P9QA 4DIUA 3O38A 1CQJB 1DO8A 1GQSA 4MQBA 4MS1B 3FVRA 3JQBA 4OV6B 4V0ME 3UJ9A 1UF9A 1T9HA 3RR2A 3SF0A 4IOKA 2BGJA 3MS7A 4FFLA 4I1SA 1Z7YA 4RYDA 4J1TC 2PRIA 4LAFA 4MDYA 3AF1A 2DBRA 2NSJA 4OXXA 4URVR 5A5VA 2OWDA 4NDZA 2DCMA 5BT9A 2X1LA 1P2DA 3WYAA 1NKSA 2NTNA 4IM7A 4FOLA 4Z7NB 4LX8A 2OORC 2R8ZA 3R4CA 4YALA 3D4OA 3HJRA 4DCNA 2EBHX 4OHVA 1E58A 1FLNA 2W2NA 4MQEB 5EJMA 2AYYA 4DEVA 2O8CB 1RIIA 2H4XA 4EKGA 4ES6A 2OBLA 4C2UA 3NHLA 4O8ZA 4UCFA 5FNZA 2NZJA 1ADYA 1HNNA 2I2CA 2VUIB 3HP7A 3NTQA 1KO5A 1ZH8A 5ARDA 1RQ2A 3EQ8A 3O6VA 2FPGB 1FNSA 4RMNA 4X3OA 1LLDA 2BDEA 2VPXA 3KWJA 3AG6A 1YU9A 1E6CA 3IP7A 1EMDA 3PL1A 3U3XA 1LC0A 1VHDA 3VR2A 1JT9A 1SCDA 2W11A 3HABA 5G0TA 1KBOA 1T15A 1P33A 2Z8XA 1EFPA 4KQMA 5H3CA 2IUTA 3EDMA 4JJ6A 2OPHA 3JRNA 2WU3A 3TX2A 1DKMA 2NV0A 1HA3A 4ZVSA 4E5YA 1OH8A 1EESA 1XCBA 3EAFA 4ZO9A 2JAOA 1LRLA 3SDBA 3VDQA 4OF4A 4XPIA 3PTLA 3O84A 2Z3ZA 4G3XA 4WY8A 5AJXA 1JR2A 1JDBB 1A9YA 1JHQA 1O95A 2QMUA 3IV7A 4P4NA 2REXB 4XJXA 2C0QA 2JFPA 5CHYA 4MI9A 3QEJA 4J1QA 4CQLB 1OC2A 2R60A 2LR0A 3U2QA 2V7UA 4V0QA 1G8JA 1PGNA 4X92A 4I5GA 4OG2A 4UEJA 1CJVC 5G0WA 3CO0S 5KJEA 2A0UA 1SO8A 3BTVA 1A2BA 4FW9A 3D64A 4AN4A 2A9JA 2PWPA 1N2IA 4J0FA 4KQKA 3VA7A 3KB2A 5KTSA 4HVLA 1KI2A 4NJMA 1X80B 2HZ7A