4NBKA

Tailoring small molecules for an allosteric site on procaspase-6
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
268
structure length
256
Chain Sequence
FYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQAARGNQHDVPVIPTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-6
publication title Tailoring small molecules for an allosteric site on procaspase-6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 91
structure length 256
sequence length 268
chains with identical sequence B
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2013-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nbkA00
1PYOA 3PD0A 4JJ7A 2QLBA 5IAKA 4AWBA 1NMSA 2CNNA 3P45A 2QL7A 4EHLA 3R5JA 4QUAA 4I1RA 4EHAA 1KMCA 4EHFA 4D3YA 1K86A 3H1PA 4N7JA 1F1JA 5IAJA 2C1EA 3H11A 2CNLA 1I4OA 4IEFB 1I4EB 4QU9A 4QULA 1RHUA 4HQRA 5IC4A 1CVRA 3V3KA 3D6HA 3QNWA 3R7SA 5IC6A 4JB8A 5LUAA 1RWKA 5IARA 3SIPA 4NBNA 2C2KA 4DCJA 1RWMA 5IASA 4QUHA 3PD1A 2QLFA 4JQZA 4N6OA 2C2ZA 1K88A 1RHKA 1SHLA 3V4LA 3DEHA 1RE1A 2H4YA 4NBKA 1NMEA 3R7NA 3PCXA 1NW9B 1JXQA 2H54A 1F9EA 2XYGA 3NS7A 4JJEA 5LUBA 5K20A 4NBLA 1NMQA 4JQYA 4AWAA 3D6MA 3EDQA 4JR0A 4NOMA 3UO8B 4QU0A 4DCPA 4NOLA 3V6MA 3BIJA 2H51A 5I9TA 5IABA 1PAUA 3DEJA 4ZVOA 1I51A 3RJMA 1BMQA 4HQ0A 5IBPA 3SIRA 3IBFA 3KJQA 5IAEA 2H5IA 2CNOA 4M9RA 3P4UA 3S8EA 1RHQA 1SC1A 2QL9A 2Y0BA 2XYHA 3K7EA 3OD5A 2FUNB 2P2CA 3V55A 2CJXA 1RWPA 4ZVUA 3NKFA 4FXOA 1RWNA 3DEIA 1CP3A 3DEKA 4ZVSA 2H48A 3V4OA 4EHKA 4N5DA 4N6GA 1QDUA 2CJYA 3KJNA 1RHRA 2C2OA 5I9BA 2H65A 2J31A 4FEAA 3GJTA 4JJ8A 3R5KA 1M72A 4N6NA 2J30A 4QUIA 3R7BA 2J32A 1SC4A 2FP3A 2Y1LA 3H11B 4ZVQA 3ITNA 4D3XA 2FQQA 3R6LA 1RWVA 4FDLA 4JR1A 4QUGA 4DCOA 4PS1A 4FGUA 3GJRA 4I1PA 5IBCA 4NOJA 1RWOA 4D3ZA 2HBYA 2H5JA 5JFTA 2XZDA 3GJQA 3H13A 1I3OA 3GJSA 5IAGA 5IBRA 2WDPA 3D6FA 4EHNA 1GFWA 2QLJA 1IBCA 2XZTA 2NN3C 3H0EA 4PRYA 4PS0A 4LSZA 1RHJA 1RHMA 4ZVPA 2AR9A 4QU5A 1RWWA 4QUEA 4QU8A 3EDRA 4ZVRA 4QTYA 3IBCA 4PRZA 2CNKA 1SC3A 4N7MA 1SHJA 3V6LA 2HBZA 2J33A 4EHDA 5IANA 3E4CA 4EHHA 3UOAB 3KJFA 5LU9A 1GQFA 4AW9A 1RWXA 2QL5A 2CDRA 2DKOA 1ICEA 3R6GA 1QTNA 4HVAA 4EJFA 2K7ZA 4QUDA 3S70A 4QUBA 2HBQA 4NOKA 4ZVTA 1QX3A 4QTXA 2C2MA 5H0IA 4JR2A 4QUJA 2HBRA 2XYPA 4IYRA 5LU8A 2H4WA 3NR2A
chains in the Genus database with same CATH superfamily
5DHFA 4RKWA 2O23A 2OCIA 1RYMA 3UKJA 3U3RA 1NVTA 3GXOA 3NM4A 2XWPA 3GGDA 4PC7A 5CFOA 3L6EA 3E2PA 4XSHA 4A15A 1FTSA 2ADMA 5IPFA 4LRWA 3DXZA 4PCVA 1GUFA 1P4HA 1YJ5A 1P7YA 4BNGA 3VX4A 5HJ2A 4KLRA 1QIMA 3M70A 3OQ1A 3R4VA 1L5LA 3OPMA 4QOGA 2NIPA 3VR3D 2Z2KA 3AZQA 3OUZA 1ODKA 1E3IA 1PR2A 3WNBA 3PE3A 4D98A 4D7AA 3EISA 1E2QA 4HLDA 1WNFA 4D9GA 1SHLA 3DZCA 1XNGA 2PH1A 4UU8A 1LF5A 3BRSA 2O07A 4ZANA 1JXQA 2PFGA 1XQYA 1GQRA 1S6YA 3LQRA 1VSUA 2CVHA 3ZGXA 4DQXA 2Q3FA 4Q93A 4CCAA 1XZ8A 3GLSA 4IZOA 5H3CA 4GXQA 2ZVDA 3O8DA 4BQRA 1H6AA 2J0SA 1A27A 4HGOA 4OD0A 1PD1A 5KWJA 1GUZA 3QNMA 2KMLA 2R0QC 5GTDA 1IY8A 5K01A 4XJXA 1YRYE 1ZR4A 4AMZA 3O73A 5DHAA 1WB4A 3C5HA 3D6VA 3FETA 1G59A 1KOGA 4BP8A 2XTZA 2ZT7A 4HPXB 3W6OA 2H1RA 2CFCA 2NAFA 2PS0A 4RF2A 3QBDA 3L5KA 2O8EA 5DNCA 2PGAA 1QIFA 1TM5E 4BOYA 3GRAA 3P0IA 4FXPA 3Q8XB 3VMMA 1V7ZA 2PA0A 1D2HA 1V16B 4M7RA 2ZSFA 5CTJA 2UDPA 5KYVA 1XCMA 4KHPB 3IUYA 5AKLA 2MR5A 1RAHA 4YJ2F 3MMXA 4MAAA 2H2FA 5CT4A 1E1RA 1EZZA 1P0PA 4E22A 4EPWA 5BSFA 2BMVA 2BM8A 1XHEA 3ROTA 1PD0A 4PG8A 5KAPA 1XZQA 3I5MA 3VI3B 1CULC 4ZTBA 1NVXQ 1TT7A 4NOJA 2CLKB 2XDWA 1WPRA 1E63A 4JI7B 3CNOA 3Q3CA 2AWNA 1JIQA 1JRLA 4NSNA 2RE8A 2C9MA 2OA0A 1NY5A 4TRRA 2ZDHA 4HN2A 4EF5A 4LYHA 1DOAA 3GPCA 4MW0A 3SBEA 3SQLA 1G3MA 1GLVA 5AKJA 1W87A 4Q6WA 1D6SA 4R8LA 3VKUA 4DG8A 4EK9A 4QIHA 4TT3D 2O2GA 2GVZC 3TMAA 1PGQA 3KSZO 1T5SA 5B1SA 4JODA 1VLZA 2F6RA 2G9VA 2LDBA 4V02A 3TL6A 5F7JA 1FQKA 2KSQA 4DG5A 4HN9A 4N7MA 2QI9C 5TSDA 4Q7LA 4X61A 1MG5A 1PL7A 4HQ6A 2V7EA 3IBSA 3U39A 1AK9A 2QT0A 2XYVA 4X6YA 3SVZA 4G1FA 3EFBA 3CLSD 1VC2A 1RBZA 1I5RA 3ME5A 3QVUA 4GR5A 4MI9A 1SRRA 3DJYA 4U9UA 2FVYA 4X8OA 4RL6A 4B6FA 4MWTA 1A8IA 4BVEA 5LDDC 2RHMA 2KWIA 4GRIA 4P82A 1E61A 1X8KA 4OA8A 4OFZA 3GLFE 1IY1A 4FR5A 4P7GA 4OJYA 4IDDA 3ABRB 5KVCA 3KK0A 1YK1A 5AKXA 4CLOB 4D42A 1NPYA 1Y1KE 1G5TA 2HWYA 2O3SA 3CONA 4QUAA 1BEEA 3OQPA 2WVHA 3N2EA 2IZ6A 1N5IA 1IK6A 3G2NA 5AHXA 3Q5GA 2OCLA 2PLFA 1KZ7B 1CEEA 2NT4A 3LWBA 2C5LA 4ZU3A 4ZI7F 1E5XA 4B3JA 5ICMA 3SX0A 4RA9B 2WHQA 2NTNA 2P6MA 3V3KA 1RTKA 3CVVA 4YXWD 1MCZA 2B2NA 1C3OA 2VG8A 2HQOA 2JFQA 2QY9A 4Q7EA 3NHJA 2WV9A 4RGBA 2HREA 3D7MA 1JKMA 1Y81A 3N2IA 5HF9A 2HPHA 1EZ1A 1HTBA 3B13B 1UC5B 1C29B 1U9IC 2VDKB 1H0KA 2ZVJA 4F7WA 4BGDA 2ZRCA 3SEQA 5LQMA 1GZDA 1MOQA 2BFPA 3B7GA 1YCHA 2CNBA 2P65A 3GP5A 3ZZ1A 4UM7A 1U0NA 4X93A 4OQLA 3F6YA 3A1FA 4IIYA 4HB4A 4YFVA 2YWXA 3VYTB 1KYQA 4K6GA 3HPRA 4JYZA 1Z06A 2CXSA 3RIMA 2WJ3A 2XD9A 3BFVA 2VTBA 3CLKA 3KTAB 3QJ5A 3Q8MA 1EPUA 5IMBA 3SYMA 2W11A 2VQEB 5BSEA 1WPGA 1LV7A 2IX9A 4B6GA 1TU0A 1O6BA 1SCUA 2HJWA 4Z2AA 2G71A 2FN8A 4RVSA 1OMOA 3V4RA 1J6UA 2PX8A 3NASA 3Q3GE 1C9DB 1ZNYA 2OFXA 3GT3A 4HNHA 2HA0A 4XFJA 3TLXA 2J6BA 3GGOA 4MRSA 2WB4A 3FDFA 2IOQA 1NN1A 1AU9A 3H4TA 4QDTA 1HMPA 2R47A 1CCWA 5AW5A 3A6JA 3OWHA 2ZQ5A 3C45A 3RV3A 3NJ4A 1D07A 4J3JA 2WWIA 4MUKA 4QDOA 4QRIA 2O57A 1YQEA 2Z30A 5C8VA 2AKAB 2R11A 3BDIA 1DX6A 3AEYA 3INYA 4KG7A 4YQYA 1YS2X 3I6QA 2HK9A 1G5HA 1WMAA 3A0RB 5FLYA 5INTA 1MF7A 1U7UA 1T36B 1AZSC 4OK3A 3U62A 1DFHA 1A97A 3WRYA 3O3CA 2ZTSA 1X42A 2BMEA 2O7NA 2VJQA 2XZTA 2FPPA 3L4SO 4C7MA 3MUFA 5ULLA 2F9FA 2ZIXA 3PNBA 4RY8A 5EIBD 3TBHA 1ELOA 4TQ9A 1GZ3A 1Y3BE 2CDNA 3C3BA 1TEHA 4JJ6A 1PT9A 4NK4A 2LWIA 1GSHA 4JHLA 1TEVA 1JBQA 5G2OA 4OIMA 1S9DA 3D3QA 4JB0A 4KO4S 4WXYB 2FG6C 3K9NA 2QMZA 1UJ6A 1E8MA 2R44A 3CC8A 4L8WB 4QG7A 4OHMA 3ZY4A 2QQGA 1COWD 1RRVA 4E2WA 2ZUEA 4CNBA 3SC4A 4XFKA 1G41A 2X9LA 4MR7A 1Y5IA 1HKUA 4KDCA 4JXKA 2YIDA 4UE2A 1ZNQO 3HDQA 4B9AA 5B4TA 3ND7A 3QMPA 4JL6A 1P9RA 2PS9A 2EJBA 3KL2A 4O1IA 2H4XA 3GGGA 3RKUA 4DREA 2Z6UA 5BT9A 4FHDA 5I6DA 4DWOA 2JFPA 1HQCA 4WY2A 3Q7EA 3WMEA 4BB0A 2WP0A 5FOSA 2XI4A 3I4CA 1VBFA 1TVCA 4HFJA 4FONA 4CMBA 3BWDD 4EPYA 3CX7A 3JASB 2QRKA 1BXGB 4BYGA 5IHPA 2DR2A 3JYQA 4OM7A 3AL2A 4ZPJA 1MORA 5FH9A 1L1EA 2HIGA 4QYTA 4W1RA 2DQ4A 1F8YA 1FMJA 1V6AA 3AF4A 4R81A 4X94A 3CR3C 2E82A 1XYYA 2NZJA 4M0KA 4EUEA 3QFCA 2QLFA 1HDYA 3P1JA 1EKXA 1QK4A 1R10A 2C9YA 1Y48E 3QPBA 2ZE6A 4J0KA 4Q4JA 3VU9A 2ICAA 2JJ2A 1GA1A 3MTBA 1IOVA 1V7CA 3AI7A 1N5LA 2BEUA 2V7UA 5K0JA 1Y3DE 4DGSA 1ZVMA 2YMLA 3U7QA 2GFHA 4IXDA 1L4YA 2MHCA 2XIJA 3VA7A 1P19A 2GRJA 1FFWA 3LXXA 3PUJA 4MI3A 4E5DA 3G82C 4Q12A 2R84A 2W6IA 4HDSB 1FYFA 3E82A 4MVXA 2ZUTA 1DC6A 1J9EA 3HP1A 1KJZA 3EXG2 4UZSA 4WEQA 2AF3C 1ZH0A 1TCVA 2FPLA 3MT9A 1AGYA 2MOKA 3KVYA 2IEAA 1HYQA 3O8QA 1W1WA 3H1AA 4NI5A 1VL5A 5ES3A 6Q21A 3H9CA 4LXHA 1INLA 4MWCA 4OMUA 1E3DA 1R8SA 4KUGA 3AUJB 1AVTA 2FPWA 2GCGA 5F76A 1EP9A 4B6QA 1ISRA 2FFRA 3IMKA 1HLFA 4XE5A 1A1SA 4IH9A 1W88B 4IW3B 5K09A 1LVGA 1P2FA 3AHFA 3KFVA 1YRHA 3AR5A 4LA4A 3GJTA 4DM4A 1JEYA 3SZOA 3W8RA 4DBVO 3PXGA 2J30A 4YAKA 2C5GA 2WIGA 3UJCA 2P40A 2PG3A 4F3RA 1G8KA 1H94A 5H1YA 3DFZA 3CXRA 4CIXA 4R40A 1T2UA 3SOPA 3ZV6A 2QVLA 2IGTA 3I5AA 4BNFA 1GTMA 2P4QA 2VK4A 2WJ4A 4RDHA 4RGQA 3PKZA 4W1SA 4AO8A 4ON9A 1JR3A 1FB5A 3TW8A 2JCSA 3W6ZA 4K9PA 1NMXA 3WA6A 1NU8A 1S3IA 1I32A 1J9ZA 1V3VA 2D13A 1KK3A 1EG2A 2XCRB 5AM3A 1JVBA 1ONBA 2ATXA 2UYGA 3JATA 4PYQA 1ZAYA 4A4DA 2WJHA 1FVOA 3OQNA 3COJA 1IIRA 5FAXA 2WMNB 1OV4A 4K28A 4YMVA 4OMCA 3DGFC 2GYYA 1X7YA 3K8OE 1UBEA 3PC8C 4L3VA 5JMOA 1Z2EA 1B0AA 1WD5A 2CF6A 1IBMB 2AE1A 4HI0E 3K32A 5HZKA 3VNQA 3LH5A 4MGYR 5F1PA 4BLQA 3ZWMA 4OXYA 3G2MA 2P7HA 5IJ0A 2YN4A 2EFYA 3PYLA 4JLVA 1FSSA 3R0VA 2OWDA 3Q9LA 3K0BA 2PFKA 4AECA 1RM4A 1AKUA 1Z88A 2EKZA 3QOYA 4IFEA 4CLDA 4IMJB 2WM2A 3OIFA 2VPPA 2CLIB 1QNFA 3HZOA 2VPTA 1ZDMA 1EA7A 4ZV9A 1ZY2A 3TG8A 1OJLA 2NU7B 3COYA 1CUGA 2PRZA 1FEZA 2NV6A 2IXBA 3RUHA 1RJGA 2YZNA 3M6WA 3O21A 3W5AA 2BGNA 4QEZA 1DLJA 2AG6A 2PSJA 3L05A 5EXPA 3RKSA 4TMTA 4I5DA 1JA0A 4M87A 3MLAA 3QE0A 1VTKA 2DJIA 2PK3A 4NH0A 1RXSA 3AB8A 2GVDC 1PJCA 4Y2RA 2ZK7A 3CCCA 5F35A 4Z4FA 1AQIA 3OA0A 4YROA 2QE7D 4JJGA 1BWSA 1A9OA 3LV8A 4IM7A 1WE2A 3IEXA 3MJCA 4E2XA 2AKYA 4KR2A 1D2AA 1F20A 2AQHA 1I5EA 3G2OA 2WTEA 2WR8A 4H6PA 1KO5A 1PT5A 2CNWD 4K7JA 4PFQA 4DLAA 1SBIA 3C3XA 2AR0A 1L4LA 1QORA 5K0NA 3BCSA 2CXTA 2UVQA 4H77A 1GAQA 2B0JA 3FNEA 3G1WA 4HZIA 3O4GA 3L0OA 1XPOA 1Z6YA 2QD3A 2EKDA 3NVMB 3SZUA 1S89A 1M75A 2H31A 4L0MA 1QX4A 2G9QA 3T3NA 1XROA 2DTEA 1IXRC 2PXCA 2ZS7A 4PPFA 5DW3A 4UFPA 1YC2A 4XWKA 2ZM6B 4OL0A 4CQMA 1OZGA 3DNPA 1G7RA 1NVGA 1NXQA 4HRYA 5E4JA 1OB2A 3RLIA 3ZG6A 3GH3A 1O96A 1QGED 3L18A 3COVA 1NF3A 4FXOA 3M6XA 2IDMA 5FWAA 2VUTA 4X8LA 4A8JA 4C0WA 3MAJA 3DYBA 2HB6A 3FRJA 1UINA 5EUBA 1QIDA 3BJRA 5L53A 1W94A 4YB8A 1WUJS 1EEXB 2BGJA 5A0FA 5M2QA 4JLKA 4D2IA 1WDLA 2XIQA 3L6CA 5DMHA 2JGAA 1RQLA 3C3JA 2RHCA 2X40A 3Q3JB 3HNOA 4D57A 1IY2A 1V35A 1NPDA 4FGWA 1O6GA 3H2SA 4W99A 4YJKA 3ZD9A 1ZG3A 2OHGA 5ILGA 4UXJA 3U5TA 2O5EA 1AN0A 1KWKA 1R0XA 4CI9A 3Q72A 3K9FC 4G8DA 3ILHA 2DWOA 3G9UA 1NHGA 2Z6QA 1K0FA 2FEAA 4L8GA 5LB2A 3IVGA 1VKJA 3HCOA 3LWZA 1Z0DA 4QBTA 4MIYA 1C0EA 3KFXA 2C4WA 5DSXA 2ASEA 5I4BA 4GX1A 1P2UA 5LZ4A 1GAEO 2Y4NA 3BYZA 3H8SA 1RT9A 4Z6KA 3U3JA 3D0KA 3A9SA 1DUVG 3IMFA 4Q02A 3OOWA 4BNKA 2BF7A 3DTVD 3UXHA 3EMKA 4E14A 4EZIA 2JLQA 1DQPA 1OLXB 5CRIA 2D3TA 2X76A 4INPA 4R1PA 4X64B 2GNOA 3DPUA 1R0LA 2JJYA 4HFRA 4I2VA 4LQDA 1IM2A 5JYCA 2QBYB 3D81A 4RV5A 5CGQB 1CY4A 1UJMA 4IIBA 1GJRA 1PR1A 1U11A 2ZJ4A 4OQDA 4IUDS 1ZI9A 4FT2A 5DYTA 3RTDA 2EKLA 3BE6A 3IVXA 1N3YA 3RWMB 3HZHA 2F1HA 5ELLA 4Y1GA 5D8DA 1IEWA 4RZSA 3MWYW 4XEHA 3A2KA 3HKCB 1P62B 1V11A 4DAEA 1JG4A 5KHAA 4WN9B 4E11A 3RADC 3N28A 2QRLA 2ODAA 4MVJF 3RTEA 2NVUB 4YV7A 4DXDA 1CDZA 2XUPA 1QVWA 3BWEA 2J3EA 3CNQS 3HDJA 4N8EA 5TEWA 4IZHA 4D8XA 4GSYA 2W43A 2JIPA 1FU8A 4OF4A 4RY9A 5CHEA 4PHFA 1P4SA 1P31A 1XVAA 1AE1A 1ZUWA 2DH6A 3G2LA 1ZEMA 3P2JA 4YEDA 3HVRA 2H2IA 4WBSA 4NDZA 2XR1A 4H59A 3QUTA 2AXNA 5A04A 2IYSA 4KMSA 4I3HA 3IDAA 1VGRA 2ONJA 4HAZA 3SZ3A 2YV1A 1LVHA 2BKAA 3CX4A 2JJ2D 2R3SA 4FDUA 3FGNA 2H8GA 1W0JD 2GK4A 3HA2A 3I53A 2E49A 4P9NA 4CTKA 4EW1A 4B46A 4ZDJA 4G8JA 5GAJA 3SKYA 3JZMA 4LZJA 2JLVA 2XCIA 2X6TA 2IPLA 2WD7A 2ZE5A 4CF3A 4GBJA 1QG0A 2Y66A 3KKKA 1CBUA 4GMFA 1LU9A 2W6ID 1F3LA 3BAZA 3CUYA 3DDZX 4GOKA 1MV5A 4JBWA 2UV8A 5G0UA 1R8XA 3A1WA 4H3SA 4YR9A 3T5PA 4RHUA 2EBFX 3ETLA 4JC4A 1DTWA 4RENA 3S8EA 4G5GA 4M22A 3ZY6A 5DF1A 2PAFA 1NQVA 3GA0A 2HLHA 3DW3X 3W2GA 3BFXA 2E21A 4Y6RA 5DNVA 4YRKA 5HKBA 3VPGA 2C78A 5FFMA 4IKPA 1K68A 3TRDA 2VSNA 4MINA 5LXTB 3T1HB 3MGGA 1B1CA 3MWEB 1X1RA 2CJPA 4UD2A 3R7BA 1SQ6A 1HT1E 1M1YB 4FYMA 4YYZA 2NO0A 4GMDA 4ZI2A 2JH9A 2QM7A 2J9RA 4LZAA 2H00A 2JL1A 3N86A 1EE9A 3A06A 3BJMA 3B78A 3HR4A 4KGVA 2ZJOA 4X1OA 3STTA 4BX2A 3Q12A 4MDEA 2X7HA 2QTCA 3RPEA 1E2EA 4ZKEA 2R2AA 3OCCA 5EY5B 4RE6A 5F7OA 3RT1A 1ZRHA 5HJEA 3RC8A 2XZDA 3F4LA 4BV3A 2C59A 1EE2A 3IIMA 2E0IA 1ND6A 1P9OA 4N5MA 3TTYA 1YA4A 2QM3A 2W4MA 1TEXA 2Y9PB 4R0MA 5FPYA 3VR1A 1I6MA 1A7KA 4QHSA 5IVDA 4I08A 4Q3NA 2B9VA 4DLRA 2IHYA 3UIEA 4YCLA 2Y67A 2ADFA 2V4MA 3E1SA 4W82A 4HD8A 1ID1A 1ES9A 3NKLA 3R0ZA 4J2OA 4W6QA 5ADUS 4TQGA 3FZQA 16PKA 4P0PB 1WUTA 1A8UA 2A1IA 2JB9A 4Q4DA 4RWEA 4DVGA 4F92B 3LL7A 2BZSA 1YIDA 1PS0A 2ZOSA 3FJ1A 1SG0A 3N07A 1PP4A 3AG6A 1I0IA 5BMVB 5BXYA 5FOVA 4N3NA 1UEXC 3D4PA 3E1KA 3GYBA 1IOWA 3KAKA 4NY1A 1KP9A 3KCQA 5LA6B 5TC4A 1JWLA 2CHEA 3GLVA 3CH6A 1MFZA 1M1YE 3JTEA 2HQSA 3ZUGA 1ISGA 1MQAA 3G2KA 3U44B 2WNIA 5DOZA 4DQKA 1N6PA 5ALTA 1DBWA 3H4VA 3LXRA 1XZHA 4E51A 1V16A 2D1FA 3M6LA 3GRPA 5E7QA 2JAUA 3L06A 2HI0A 4LDJA 1ODTC 1DCKA 2CY0A 1M6VB 1V39A 3TJRA 4RORA 5HRAA 1P7WA 1XB2A 3PXXA 1HNWB 3S29A 2CT8A 4PCLA 2W37A 3I2FA 5JPDA 1RKQA 3KHTA 4L28A 1N7HA 5CB4A 1NBEA 3G8AA 4R2LA 1DUSA 3GLFA 2IUFA 2ZUFA 4OI2A 3HG7A 1PDVA 1PIWA 2QTRA 4S1WA 3WMWA 4NS1A 1U9YA 1QTRA 3H19A 2A0KA 3OPQA 4WJKB 4F9TA 1SUIA 2JJQA 2MINB 4X7MA 2RGRA 4RZHA 2H4ZA 2VA8A 4BNWA 3MLBA 4RLQA 1KH2A 3L8FA 4NICA 4U9IS 1LF0A 2XUGA 1GN8A 2FCAA 1ST3A 3LUKA 4GNRA 2O52A 1DJNA 1K8ZB 3UYKA 3VQTA 4C01A 5DM60 3GAZA 2FWBA 5E1OA 3IUSA 5G41A 3WLHA 2JHGA 4HEQA 5CH5A 3K0SA 1FDOA 2XVMA 3G3EA 1NBWB 4GX0A 4K46A 1J4AA 1Y8CA 5GMOA 4D74A 3FI0A 4FE4A 2Q1SA 2EJVA 3QELB 2FHSA 3WLRA 1HYHA 2C3YA 3P2MA 3NDPA 3INGA 3WQHA 1R0RE 1KZ1A 4LJ6A 1XZFA 3FPCA 2FV8A 3UUGA 1NJ6A 2IL1A 1XNQB 2PKWA 1EVZA 4G0PA 3ID6C 1PK9A 1NASA 2FWIA 3PRJA 1Z38A 3M82A 1G4HA 3TF5A 4GI7A 2GBGA 3QU4A 3JWIA 3FJOA 1BE8A 1WB6A 2PEZA 3PR3A 5ALGA 4Q3KA 4Q1CA 1AUXA 1ADBA 1JMYA 2FPUA 1PR6A 3CLUC 1OU4A 4FEAA 2ZSKA 2CFOA 2Z08A 4PQEA 4Q1BA 5AVRA 1CT9A 2PZMA 1UZNA 3ASUA 1NE2A 5DASA 4CLOA 4LV5B 5LJIA 4FB5A 4UARA 2IHJA 3IGFA 3VZCA 1RKVA 5LQAA 3IAFA 3CZ4A 1H3NA 3LTNC 2IYVA 3AFNA 1QF9A 1PS8A 1WUYA 1MX5A 2QTNA 4WAUA 1U9IA 3PGKA 1J5PA 4M1QA 2BPOA 4WA7A 5JFTA 4RA9A 4YV1A 5F2EA 4MWEA 1PVVA 1Z15A 3QFHA 2V1XA 3D6FA 3NYIA 5I9IA 3M6AA 4IY1A 3B9QA 1U4NA 2C8JA 2QVZX 2H3HA 1J20A 1GQYA 3R9XB 5EZYB 3C6YA 4AX8A 1JHVA 3RH0A 2KE5A 2ZCVA 3E7WA 3MERA 1CUDA 1SG6A 2PSSA 1XZMA 3KWMA 3TKLA 4F7DA 1NW6A 3VDMA 1JHYA 2P9FA 3FCSB 1KETA 4MQFB 3X43A 4EGSA 1C3EA 1ODIA 1SCKA 5JECA 1K8XB 5EJ9A 3VPSA 1ZK3A 3M5WA 3OIYA 2IYFA 5AT1A 3KJFA 1OFIA 5H70A 3D6JA 3RE1A 1Z5GA 4PLTA 4ZA2A 3KV3O 3KTAA 2P4EA 3FFAA 3REQB 1Y1RA 2J87A 1YTUA 3JYOA 4KYVA 1XLWA 3V1UA 4ETWA 3GU3A 2O2HA 5IVHA 3I9FA 4MEBA 4CIAA 2UUAB 1P5HA 3A1SA 3L1KA 3OHPA 2ZR8A 5H0IA 1Z82A 4EB8A 5DKFA 2FN4A 4G56A 1CY7A 1W30A 1P8AA 4MKGA 4Z4CA 3BC1A 3AVTA 5D51S 5EIOA 4UDNA 2MSDB 1Y7PA 4D82A 4NF2A 3DCJA 3I9OA 3VX3A 2LNDA 3RS4A 3R76A 2DR3A 1NNSA 4XR4A 4PTLA 3RSFA 1VL8A 2H92A 2IDKA 2P91A 1HYBA 1ZJZA 3A6KA 1X1BA 5DLEA 4D3YA 4IQ0A 2IY7A 1VE5A 1JJBA 1VJ0A 1YDHA 3RS3A 5GIOE 4ER0A 5I9SA 3LHFA 4I5FA 2FPOA 4EQZA 1BX1A 3SLGA 1IHDA 2PRYA 5FNVB 1RC0A 1T13A 1T4CB 2HJSA 1BKDR 4RQTA 2C54A 3U4DA 5B7GA 4CM9D 3T7AA 4D99A 2ACWA 3EOZA 1EIZA 1GV0A 2X3UA 1T36A 1FJHA 1IK4A 5D6OA 1TLLA 2Q9AA 1X92A 2P8SA 4A73A 1U98A 1W44A 2CLLB 1SMKA 2JDIA 1VIDA 1SQ0A 4WBNB 5F1OA 2YQZA 3DAYA 5A9RA 5CA1B 1USVA 3QWHA 2Q2QA 1ADGA 3D6MA 4M2LA 4P86A 5TE9A 4HAVA 3B1YA 1N33B 4QU0A 4GD3Q 4AS1A 3VNAA 1V5FA 2A5LA 3EQ2A 1MRSA 2IQIA 4IH1A 1L5QA 4D0GA 2Q7DA 3S7TA 1OZFA 4GP7A 2JGFA 1W0KA 2QL6A 4P35A 4Q19A 4PX9A 1ZCZA 4TRMA 2Q6KA 4P3YA 4ZOCA 3D4IA 2DWCA 4FMDF 3LZDA 4HVCA 2X7JA 2VSXA 2IGBA 2YBDA 1GQSA 5G4LA 2HNKA 3OIVA 3OFND 5DYIA 3TS1A 5CW2A 3T95A 1CUCA 1ILWA 1I1QB 1MD9A 1E7SA 3VHQA 1EP3B 3AI1A 1E6WA 3AKZA 2VF7A 1XV5A 4IXTA 4PPQA 4LZZA 4UMEA 3CIFA 1QYWA 5GPBA 2ZYIA 1B41A 1M72A 2OZEA 4X54A 4WW0A 4DMFA 1PJAA 2GETA 3WDLA 3N5KA 3PQ3A 4NYIR 2YJGA 1CEQA 5CCEA 2FZWA 2XE6A 4EO4A 4BFXA 3CRMA 1JQ5A 4CT0A 5K7SA 2IIBA 4HR7A 1JN0A 2Y1KA 4IDGA 1PEAA 1BXGA 3D1JA 3F5QA 4IZIA 2VHVA 4LTDA 3KUXA 4EJ2A 1UFQA 4WFIA 1RM3A 3AF0A 1ESZA 3E4DA 2HHCA 4Q9IA 1CX9B 2QOEA 3QTTA 4J1TA 4B4DA 3AQIA 5ECWA 5H80A 4BX3A 1NRJB 4XM1A 1CZUA 1IYZA 3VRHA 2P9GA 1Y6RA 1T9DA 2VPIA 2QMQA 4JBNA 4BNHA 4CM1A 1MOZA 4BWYA 1AZLA 4CCWA 1EB8A 1N7JA 4ZALA 1G3RA 3SBOA 5ADHA 3CVUA 3S4YA 3RT9A 1PNOA 4IFTA 3NUGA 4BO1A 3KETA 4XYEA 3D3JA 1OD6A 1MVOA 3AG5A 1X7GA 5BO5A 3WMFA 1OAAA 2QR3A 4I1UA 4HDSA 5CB6A 1LJ8A 1SG9A 2PIDA 1JHRA 3GFSA 1L7DA 2PZKA 3M6FA 5JAMA 1IC6A 1FMLA 3GNTA 3KWFA 5JNTA 3BD8A 4BFLA 2ZYDA 4GOMD 3G1UA 5AR1A 2BEVB 4ATNA 4RKQA 5AD1A 4ALKA 4D4IA 4AYTA 4RJTA 4RZ2A 1M2FA 5FWDA 4XCQA 1IUPA 2IYEA 2PD3A 4A5SA 2RC6A 1Z0JA 4IHJB 1M2HA 1YCDA 2Q7XA 2ZRNA 3EW9A 2PU5A 1TZMA 5BV8A 1ZGCA 1UXHA 3FHJA 4AMGA 3E3AA 2HCBA 1YKSA 4LQ4A 3ZE1B 3S2YA 3KWJA 4EZEA 1HV8A 2HPAA 4WLOA 1KR2A 1W88A 2Y1DA 4BNYA 1MO6A 4D6PA 1PEKE 2ILTA 5E2AA 2FMHA 5EYPA 3KZXA 5HVNA 3JAMA 1UKZA 2V7VA 1BIFA 3O0TA 1I7QB 3D8TA 2I71A 4D9JA 5A62A 1C0KA 2O19A 4HQOA 5AVZA 2D1QA 5JVDF 5MHTA 2ZQYA 4YCSA 1X0VA 1LPBB 1Z6TA 3IQEA 5KYYB 1HY3A 1SUAA 3KEGA 4G5YA 1E0DA 2PT9A 2W00A 2VHZA 1TF7A 3NUZA 5KU7A 2GCNA 3OLZA 2NW6A 5FJIA 3CPEA 3PC8A 2QUJA 1W75A 2VC2B 3P9KA 1UK6A 1GL3A 4B3DA 3VPAA 1S7GA 1L7RA 2IUEA 3QUCA 3DYVA 4X90A 1Q12A 2QD5A 2H7VA 2FMXA 1X7ZB 3QJYA 5IEBA 4YJ3F 4BZZA 1PWXA 2XW6A 3I9NA 3QI2A 5BPFA 4LCBA 4NDAA 1G8PA 5JD4A 4DJJA 5JOQA 4FINA 3VR4H 1J0AA 4YCAA 3BGWA 4JBXA 1GL7A 1D1TA 4AN4A 1MIHA 4F4HA 3C15C 3C6XA 1SFRA 1ZGHA 3GLKA 4GOLD 1NE7A 1DV1A 4EG4A 3K71B 4F3TA 2JLZA 4KK4A 3ZDBA 5TPZD 4MHTA 3AVYA 2KHZA 1U2RA 1NUTA 1NQTA 1QFYA 1BOOA 2MIIA 2YUIA 4FBMA 4P93A 1XNRB 5DBHX 3VU0A 5IAAA 4YT2A 1JG1A 1KPIA 5L6MB 4MW7A 3NWBA 3L1UA 1SKQA 3QLEA 4BO4A 4JI4B 4JLMA 3G2HA 1T26A 4UPVA 4MLZA 1P29A 4W1QA 5DXFA 2XE7A 1LPMA 2NU7A 4BO0A 1EUYA 1GQ2A 4DQUA 2VJAA 4OHRA 3UCFA 2A9RA 4OQXA 5I48A 2DB3A 3A1NA 4BQQA 1XL1A 3A25A 2OILA 4KJZA 4LVUA 3OICA 3ZDAA 1YE3A 3W9BA 2JFNA 4I5GA 4EEXA 3SF8A 3FZEA 4EJSB 3RYFA 2REOA 2VYND 4KE6A 3GFGA 4MLCA 2OUKA 1ISHA 4EY6A 3SSMA 4GPAA 2V6MA 2G8LA 3I2GA 1O95A 1T0JB 4U7HA 1KSGA 1NVDA 2Q4RA 4OXXA 3S2IA 5C80A 4OB6A 1LQUA 1C7QA 2BY4A 3Q85A 1NVWQ 3IXLA 4OJQA 4YUWA 1U7DA 3GCDA 4LDNA 4XIIA 2WVAA 3CEAA 3KB6A 3P5BA 3C74A 5IXJA 4UQLA 3PRHA 4FYIA 4C5BA 1A5TA 4EJSC 4OHBA 3U37A 1ZITA 2J9FB 2WJZB 4PRZA 1PT6A 4QECA 3WFIA 4DC0A 1Z8NA 1VKZA 4YO8A 4EHBA 3MOSA 4GAEA 1J2TA 1GGMA 2PZEA 3FTNA 3LW8A 3BD7A 3KJEA 2QJOA 1Q7CA 2WJGA 5CK4A 4BECA 5BV0A 5MF6A 3T52A 1V7PC 3OIWA 3QW4B 2J3HA 3Q7IA 3U09A 1ZWLA 3H2IA 3G5LA 3ZGNA 1QH9A 5LYJB 3DDUA 2RSLA 1VCOA 5ALHA 4B79A 3OQJA 4ESOA 2AMYA 4R16A 2WSBA 1DB3A 3WO1A 2FW0A 1RSZA 3OI7A 1IEXA 1QYVA 4L02A 4NZYA 2FZVA 4OAQA 4U5QA 1H2XA 2BHNA 1MPTA 1UODA 1OUMA 2MWMA 2Q4EA 1NMSA 4UUQA 4Y1RB 4YAOA 4CFYA 2AYXA 3TNYA 1ZGGA 1UKYA 2GEVA 1AHNA 1KAMA 5IUKC 1TO1E 2OUIA 1H85A 1UBTS 5EVCA 5KTMA 3MWKA 2JGLA 1DQRA 3MT0A 3USCS 1NLUA 4I4TB 5T4HA 3T1OA 3USZA 2FSHA 5KTTA 4DV6B 1M2VB 1C3VA 5TJHA 1RMTA 3L79A 1QAQA 1V48A 5ALUA 2NUAA 4TN1A 1A7UA 1T0PA 4Y2UA 1V25A 4F3NA 9ATCA 1UPTA 4P38A 1SEPA 3A1UA 3FYDA 2Y68A 4F3KA 4IQ8A 2E4ZA 3MLEA 3MS4A 1X19A 3RRYA 2O5CA 1MZVA 1PUIA 1RD4A 4PVCA 4U2EA 2BGTA 4DYVA 5ETJA 1R0SA 3PDIB 5C53B 3D6NB 4YUXA 2Q3BA 2CMFA 3DHVA 1AB6A 5A7GA 3VOSA 2B8NA 2QTVB 4Z99A 4ZYLA 3GQBB 4Q37A 3LM8A 5C3UA 2LCQA 3CVWA 3UAXA 1YHZA 1S8AA 1ZW6A 1USWA 2IYYA 2P77A 2WTXA 1BCSB 1UXIA 3IKMB 5EWLA 3JQQA 1EWVA 2E87A 3WLLA 3QX9A 2GJ4A 3F98A 1CR1A 3KTDA 2QBYA 1BJTA 1ML4A 3PPXA 4LNAA 1B42A 1SKYE 3V8QA 3P9CA 2ZE8A 2K2QB 2J48A 5LMZA 1E2BA 2P6PA 1HA3A 1M8GA 3ANSA 4TPKA 4M9SA 3T7CA 3ZXIA 3HKCA 3LGAA 2V7BA 4OGFA 2R6R1 4L72A 1CF9A 1PLJA 1T5OA 3HYRA 5H4HA 4WN9A 5DM4A 2XNHA 3LFTA 1YO6A 2AN9A 2NVUA 4I99A 4YRZA 1LX6A 3AHGA 1SVKA 4MULA 3OJCA 1RIIA 3M81A 2Q5HA 3HRHA 1OA0A 4DJ5X 4RZQA 1XA4A 5K05A 1N6RA 2OORA 2OWEA 4AXBA 2GVNA 5AKHA 3EGDB 3UMBA 4LYYA 3SQNA 3ZJTA 3WNZA 5JD5A 1PLKA 3DYIA 2YWCA 2PWYA 1L8LA 2PR2A 4UBNA 4ARAA 2RI1A 3LHIA 1OC4A 5KDOA 3LO8A 1K7FB 2G6BA 1GNRA 5J5CA 1OXBB 2QU8A 3IUJA 4RZIA 1K98A 1FF9A 2R751 2C2WA 3FFWA 3F8SA 3BEDA 3SZRA 1YB4A 2QTMA 4BQFA 4EFDA 1UBGA 1A9QA 5ENZA 4MRMB 4XLLA 4DCUA 4OP2A 5DWDA 2PT6A 2JS7A 4LK3A 1C14A 1ZXLA 4R9RA 1Y37A 1C50A 4A26A 4XJSA 2PBRA 5IXYA 4MEAA 4AJNA 3L40A 1XHFA 2CKMA 5M7EA 1YGPA 4A2CA 2C94A 5AW2A 3MINA 4BKMA 3NI2A 5JEEA 5JJBA 3BREA 4KAFA 4YVFA 2Q5FA 2I1VB 3O92A 2EG9A 1CHDA 3OZFA 3O4FA 2XYPA 4HBZA 3K5HA 1T5BA 1P1JA 3ULKA 1W48A 2Y8EA 4CF4A 5AO9A 2YJ4A 3TEJA 5LXTA 2V5VA 1AO0A 2PU7A 3MWEA 4BVKA 3JQRA 4FD2A 4EKIA 1UJCA 4A8PA 2A33A 2B30A 5ALZA 1M1YA 3VSCA 3DM9B 3WG9A 1L0BA 1UC4B 3I8SA 3M89A 1FOEB 1DUIA 2C9OA 3PUHA 4JUDX 5L3RA 2IS4A 2HFKA 4WCFB 1JEQB 3ZIDA 2AGVA 3WHLA 4PLYA 1TAQA 3NNDA 4Z1MA 1WB5A 9GPBA 2H1IA 2BHSA 1JE0A 1PBTA 4NCJA 4OCZA 4XPZA 1UPXA 4YIKA 2OO5C 4GEGA 4N18A 2HT1A 1OWLA 1KI6B 1FS4A 2O3RA 2C2ZA 2O2EA 4FYHA 3GLUA 5DCWA 4EY4A 3OFJA 1BE1A 1RRFA 2VXOA 1MXFA 2W5UA 4MEJA 1QE5A 1KE1A 1TO2E 2D1YA 4P4SA 4GKJB 1G3IA 1O94C 1KNXA 5DT2A 3CT6A 4X1IB 3K96A 4O0LA 3UMFA 3UJHA 3WGKA 3QGMA 2G06A 5EWJB 3N9IA 1MQ8B 2ZAGA 1LLQA 1OX6A 1VI2A 3JD2A 1X9IA 1M3SA 1P1BA 2R7MA 4JEUA 2Z5FA 3K70B 1JHMA 2HK6A 2M2IA 5A3QA 3DUFB 5F7XA 4CUKA 1RJDA 4OYLA 4XQ9A 1E64A 3HPQA 3T9CA 4DLZA 1KDYA 3Q2KA 4G01B 3FHLA 3SBXA 1LW6E 4NV1A 5BMVA 4FWTA 3F5FA 3PNOA 5LA6A 2Q9UA 1ACMA 4JB3A 4JUBA 3ZX5A 5CA0F 5B2EA 3FJYA 3TSAA 1TVKB 5EL0A 1UDWA 1UPBA 2JD1A 3U44A 1HK7A 2X0NA 3K70C 1KRWA 5TGTA 2IFTA 5EMJA 5CEFA 3UN1A 4KSYA 2R7NA 1WVIA 5LNK1 1YQWA 3C1AA 4EUFA 1ECLA 7GPBA 1M6VA 4R3UC 4EOGA 5A5VA 1SU6A 4Y0NA 5JANA 3PFHA 2JCYA 2YZ7A 3G7SA 3RYCB 3OQVA 5HTOA 3GH1A 4EPXA 3RSQA 2IHBA 4AY4A 4C6SA 5C5IA 1WV0A 1WP9A 3X1KA 2HJGA 1J2YA 2JLYA 1Z5OA 3I2HA 2MINA 4KXYA 2XDQB 3V8BA 1RPAA 3OZ7A 1UIMA 1IBCA 4JKYA 4N01A 1XN1A 2A2ZA 2AN4A 4QAQA 4YAFA 1O95D 1RW4A 4B83A 4KWTA 3HXMA 4DDWA 3TR0A 4HUQA 4ERNA 4DNQA 4F93B 4M9QA 3L8GA 2GCEA 3V5NA 1OFHA 1SIUA 1T3SA 2G5TA 1TVMA 1BDIA 2ZPTX 3A1CA 4IDOA 4CPDA 4DARA 3ZX4A 5B30A 2NU8B 1RYNA 1MGOA 2J33A 2FZCA 2XMRA 3IHTA 3E4CA 4LE0A 3E70C 4N9WA 1JTEA 1QANA 3TRIA 2TS1A 1YDGA 2H18A 3GD7A 4QODA 5IYZA 3UB3A 4YT5A 3QELA 5C8DA 1XX6A 5FXMA 2P4UA 2IJGX 1Y7HA 3COZA 1E89A 2PUWA 2WYHA 2YOFA 3IJPA 3B2EA 3ZLJA 4WLUA 5C8YF 4I14A 5FBHA 2AOTB 1QYRA 2JK0A 4F4UA 3EK2A 1R9NA 3HEAA 3HBFA 2GD1O 5I7RA 1E59A 1RAIA 1Q57A 4XIFA 2I55A 3PD0A 1Z0KA 4WZAB 4M98A 4B3HA 4QPDA 4Y6LA 1BHSA 4DA9A 4MP8A 1N25A 1H69A 2F4VB 1WPQA 1QKIA 2XNJA 1CY8A 5E3IA 1VDMA 5A2GA 5I5EA 3F5MA 2IX3A 4HH0A 3TQFA 5IKMA 2FOXA 4JEMA 2G04A 1FNNA 4X3OA 2OQ2A 1DC7A 4O0MA 3KR2A 1I2AA 1QDEA 4GECA 1HI9A 4F4FA 5C4MA 3HYCA 4ZT2A 2ZIWB 3GRZA 1Z37A 4KV7A 2WHRA 1LS6A 4B85A 5AOVA 3TQOA 1XF9A 3V1YA 2IHKA 2P9ZA 4PGMA 3LY7A 4W6ZA 4X1KB 5IDXA 4WZBB 1WZEA 2YH2A 2A3NA 3OU7A 2G1KA 3FYUB 4Q9JA 3S6JA 2EP8A 1GD1O 2EQ5A 4O4LB 2C4KA 3JQPA 3ED5A 1I2MA 5KINB 4S05A 4ZEWA 1H2WA 2DQYA 3GJ3A 2AFVA 1X13A 2DFVA 2I1LA 2EXXA 3E9DA 3KUKA 1Z4QA 5EZYA 4ZZ0A 3KVOA 3LYAA 1I13A 2BL4A 3AZOA 1ZRSA 4UNSA 5E6SB 1YR6A 5DV9A 2OHJA 3A37A 1ZLXA 5TIIA 5EP2A 3PIDA 1UP4A 1CZLA 4MNTA 4JY7A 4MQFA 3BRWD 1NBME 3AH8A 3FM9A 2E4VA 4O2RA 3BWBA 4XVQA 4E5PA 5C0OE 2H0QA 4DV0B 2E18A 1GN9A 1UR5A 2QGFA 3G23A 4GI1A 4H7HA 4GGPA 2PJRA 1B74A 4KNYA 2JC3A 4E7OA 2Y0BA 3A6EA 3DOIA 3D5EA 3EASA 4WZAE 4DFDA 5BP7A 3REQA 3LSYA 4ER6A 4M1MA 5IT4A 3WWOA 2EFCB 3E7FA 2H0RA 4K9SA 3W6NA 3RHSA 4R98A 1EFUA 4CR6A 4EELA 1N5DA 4N6GA 3PK0A 4D0SA 2FN7A 4G5RA 1XAIA 2V45A 3BKWA 3CA8A 3GPBA 3OC0A 4JHXA 4D4MA 3TFOA 1J00A 1UMCB 1X2BA 1ZCJA 3AM4A 4XIJA 5IMSA 5IVKA 3CE9A 2EAUA 1GM5A 2DUWA 2Q8PA 3IDFA 4FFPA 3U6BA 3CB2A 5J5AA 2ZZMA 3TBFA 2K87A 4IIVA 2I67A 2OHIA 3LVFO 4WZBE 2ZIVB 4TZTA 5K3CA 3A9WA 3CCBA 3Q0EA 3FVRA 4KWIA 2F55A 1TUEA 1OBHA 3BFJA 4Z9XA 4D9FA 5FTLA 2J6IA 3EXG1 5CXSA 2PJZA 1LTHR 4AL4A 3THYB 3H6KA 1WCV1 3IOMA 1SU4A 4WNIA 4YN3A 1TJ4A 1T4CA 3QJGA 4P5DA 4MQMA 5BQXA 2VIIA 5EERA 5GONF 1NUAA 5HKKD 3A6DA 4TV9F 1GCAA 3ENWA 4YREA 1WZNA 3LOPA 2CVPA 3JZDA 5KQSA 3KUDA 2F1KA 3PE6A 2WMYA 1FLVA 4PSKA 5BV1A 1SCJA 2J4CA 1J25A 2QRZA 4V39A 3WBBA 4TMWA 4DN6A 4WBNA 4EY8A 5DGIA 1AMOA 4OI4A 5CA1A 1OHHD 2D5CA 3T7TA 4PF1A 4PN7A 1YUBA 2BW0A 2HLDA 2EVWX 2LD4A 2RBEA 1RCTE 4J0QA 4DWVA 1BN7A 1E94E 5DHRA 1C9KA 3QPUA 4OLJA 4LDAA 4CFZA 3PHIA 1M8JA 1T6ZA 3U3KA 4KFSA 5HFJA 3R9WA 3ETEA 2MMGA 2B6HA 5AJUA 1T4DA 3V2HA 2C7GA 3PDUA 3TMKA 1XVIA 1D2GA 2H2WA 3MYRA 4O2AB 1N7GA 3ONVA 4J75A 2YFHA 4F9GA 3L1JA 4Z0PA 3AR2A 2QN9A 5IKEA 4FDMA 3ORYA 2RK4A 3PLNA 3LF2A 1Z16A 3EE6A 2JVIA 3AM5A 2Q5JA 1N6LA 1XEWY 1PYDA 3N8IA 5JNLA 3RFUA 2GZHA 3EPLA 4LOLA 1QO0D 3P9XA 1XSEA 1W6UA 4MO9A 4Q3CA 4RHYA 1NQOA 3VC1A 4WA8A 4B35A 4YUAA 4ENSA 4WH0A 5J1SB 2ANCA 4PV7A 1DIGA 5KWIA 3L77A 1MJGM 2IC5A 2J3KA 2ODNA 4DCJA 1Z7BA 2EW8A 2Q21A 3GCXA 2ZWMA 5CNJA 3C2QA 3TQIA 2QSZA 2HGZA 5TJ9A 3UAVA 3PICA 2E2WA 3TIFA 5EMNA 4JYAB 2YS7A 4UAVA 1O57A 2RAPA 5KSZA 2CFSA 3YASA 1EFKA 2BBTA 2NTYC 3EULA 3LD9A 3LUBA 4FEYA 2XYQA 3U80A 4R2XA 3IIEA 4TN5A 4CM3A 4WJLA 2DFPA 1YC5A 5I4IA 3ZUPA 2OGWA 4LV6A 2VBFA 1BGXT 4TS9A 4EWLA 2VJBA 3RVNA 4WOKA 1LCIA 1TA0A 4C6TB 4KSCA 4DUYB 3QOXA 4TLDA 1QHGA 3R5SA 5K03A 1XJQA 5D2CA 4J3NA 5I9NA 3L7NA 4KQEA 4XPIB 4BRZA 1U28C 1ZICA 1KZHA 2D5IA 4FWIB 4IGAA 1QGUB 4IHJA 2BI4A 4Y6SA 5DJ5A 2F1JA 5HZHA 4C7BA 4FC6A 4LXQA 1GQOA 1THZA 3PUZA 4HXFB 4N41A 3OD1A 3NP9A 4AWBA 4P4LA 1U2GC 4DE5A 2DQSA 3SXPA 3KLOA 4L8VA 4KIFA 2QJWA 1KORA 3R6LA 1E1NA 4J8PA 4O2BF 4YRNA 3EC2A 5ICSA 3HL0A 3NAMA 4L0QA 3SFZA 2AHOA 3PEWA 3P32A 2RGNA 5JNRA 5CNIA 2PS1A 3V8MA 4RM3A 3I3SR 1PEYA 1CFZA 2COUA 3IULA 1JHDA 4NC9A 5KYYA 3WL3A 3NGMA 1F4LA 3M1AA 4JOSA 1IMOA 4MUXA 2QD1A 2QYHA 4ES6A 1RPNA 2MDTA 3VNSA 4EA8A 3H1FA 5F7ZA 3ZWBA 5KSYA 1DGQA 2JBWA 3V1LA 2FMIA 1J21A 4HAWA 3BHNA 3IHLA 2TRSB 1ZXBA 3MCTA 2X0DA 3TUJC 3F4KA 5EHXA 1F0KA 3JX9A 3EARA 4WRRA 1O8BA 4FX2A 1YFJA 1SBZA 2XBMA 3QSYA 1QSGA 2F1OA 5YASA 1CJKC 5TNXA 1CJCA 1NP7A 2GUGA 2P35A 3F6SA 1VHQA 2Z8YM 5LCXA 4D9EA 1NU6A 2I2CA 5BSHA 3VNUA 1E0JA 4X8HA 2QIOA 4C14A 2VT6A 3K1ZA 3EUEA 3O3OB 1VG9B 3DEAA 2X7XA 3RVSA 1SKMA 4AS3A 1PW7A 1U8UA 2C2YA 2CLEB 3E9NA 1ENPA 5JIBA 3AERB 4MV6A 5IJZA 1JE1A 2FKNA 3D8SA 4GR4A 3II6X 2WDZA 2IQ5A 2R1TB 2DBVO 2YL2A 4JVNA 1O4VA 4BMVA 4JOCA 3HI6A 3ICEA 4FNOA 3OX1A 4OSPA 2ZUSA 3IV9A 3WBKA 1CRPA 1RJFA 4B3RB 2FSFA 4N3AA 3UJAA 4ENTA 3RGWS 1NL3A 4ZN6A 1ZK2A 3G2PA 3NG1A 3PGLA 4MJ3A 5HWSA 2VJPA 3ODGA 2B4KA 2YIMA 1D6JA 2GKOA 2XJ9A 4TTSA 4ZZIA 5L4SA 4FSHA 4TMVA 5HG0A 3TTUA 4F5YA 2W6PA 1KH1A 2XHZA 5IAJA 4JYBA 3DFMA 1M66A 4S3MA 4O4JF 2X8LA 3I30X 4MRPA 1YVDA 1TTPB 4B6JA 1SKBA 1DTSA 4PZEA 5AICA 3I58A 3FIJA 1LRJA 3UOWA 3MUOA 2HA7A 1M8PA 4GKAA 1PDOA 1J06A 3ZTWA 3RUCA 2FI1A 1OLSB 4EJSA 4XI9A 3FD8A 4HYTA 1E66A 1FYXA 4OYHA 3RS7A 1R6VA 1Y3HA 3U61B 1GKKA 4HDOB 1Z8DA 3LLUA 1QIIA 5JRDS 1R9JA 4KACA 4XKJA 2PUAA 3EZ2A 2PSEA 3MVEA 3AVOA 3LPDA 4FC7A 1AGXA 4TYMA 3VSDA 5BR8B 4DM7A 2J9FA 3B1WA 3FTDA 4HGNA 4HYQA 3ROPA 4N12A 2RK6A 4MIKA 4K03A 1QKJA 3RVQA 4ID3A 5K8LA 4HBGA 1MGPA 1JEAA 3KJQA 2YZGA 1FX0B 1SZCA 2XBLA 3LC2O 5B3AA 3IQZA 4ZYVA 4Q39A 1F9AA 2JATA 4DMRA 2PZFA 2AUTA 3IMGA 4OQYA 4OI0A 2ZIZA 2EV9A 3CINA 1DCMA 3KZVA 4W7HA 5LYJA 2J5QA 4RK6A 4D6XA 4D9BA 4KLNA 3UAOA 2R5WA 2ATVA 1W85B 2ISSD 3AHJA 3KJNA 3G5UA 1JEEA 5I9BA 1XAGA 4DA6A 2WUFA 1CR4A 1Y4ZA 4HWPA 2QIPA 1YQTA 3QV2A 4R1NA 4Y1RA 2IDZA 3MEQA 5GOTA 1CB0A 1YK0A 3BQMB 1FDUA 1SWWA 1XZLA 4OXQA 4QYMA 2GS9A 1GKUB 1QR2A 6GPBA 2IH2A 3IUPA 1IOZA 1MC8A 1SZDA 3TSZA 4D3ZA 5D86A 3Q9UA 4AMYA 4MW5A 2BVNA 2HXGA 1OV6A 3NATA 3DKPA 4HNRA 3S68A 3ZI4A 2CBGA 2Y6VA 4QA9A 4BVLA 4PRKA 4FZJA 2YW9A 5JNUA 3BSSA 1I7DA 4I4TA 1WUHS 1ZIXA 2Q2NA 1YIOA 3O3NB 1IL0A 1DIOB 1XTZA 4I5IA 1ZGJA 1RHMA 4EYEA 3RAGA 3TD2A 5JSQA 1XZBA 5EXDA 4EB0A 4F71A 4E1AA 5CM9C 2IYWA 3OCUA 2BISA 4N0DA 4LSGA 3MMSA 1U5CA 5DSZA 4Q82A 4KXMA 4BN4A 5EG5A 1P2SA 2GO1A 3R44A 3RODA 3V6LA 2R8RA 4CG1A 1H6DA 1G16A 3JQ9A 2XD4A 2GSWA 4U4AA 3GI1A 3RS2A 1FNDA 3WRVA 2GARA 1K5DA 4PO3X 3PDIA 5IT5A 4UHHA 4EP1A 1KNQA 1BOFA 4M8IA 4NEHB 2QTVA 3IO5A 4OLFA 3GQBA 4RPGA 4TTVA 3T35A 1H3FA 3F7MA 5T3UA 3WI7A 1YDFA 1H2BA 5EUCA 3GF4A 3KS9A 1FFHA 1V8BA 3FVQA 4GOJA 2I22A 4BLPA 4RZUA 1BCSA 1LC0A 3GLGB 3UMYA 3L49A 1G38A 1QZZA 5CB0A 3FCAA 1QYCA 5IAKA 4OJNA 2FCRA 2TMYA 3ESDA 4MSUA 2QL7A 1Z0ZA 3UTCA 5I7AA 5TLSA 1J39A 3CRRA 2HTEA 3C3MA 3F8WA 2SCUB 1G19A 5BW4A 1N2ZA 2RHTA 1DJMA 3LT1A 4WY8A 2AI1A 1LTQA 1I4EB 2PRSA 3C98A 5KWSA 1X2EA 4FQ5A 4Z3KA 2PGNA 1N75A 1GIAA 3AGPA 4AZWA 2EATA 3LE8A 1CDDA 3ZCQA 1KQNA 1IDOA 2KW5A 4W63A 4I9HA 1X7DA 3N8GA 5HPYB 2QMEA 4K9LA 4WVLA 1L8OA 3EGDA 3T9BA 1OYVA 3UUWA 4BC0A 2YRFA 3FLBA 3FROA 3H4IA 2YWHA 2KM1A 1P0QA 3QA9A 1NNLA 3ICCA 3EEOA 3GARA 4F9FA 3B9PA 4PLVA 1FC0A 5BRAA 4LEIA 5KQRA 5K20A 3R20A 3PLAE 2JGMA 3UO8B 4HN4B 2VUSA 3I72A 4YRGA 2XQFA 2QD2A 2KLBA 1OBFO 2ZJ0A 5CGZA 3UH1A 3AOEC 1RRMA 1G6HA 3PXBA 4RM2A 1F7VA 5K6TA 5L3QB 2ZSEA 4HQ0A 4MW4A 1HNNA 4FYYA 2IYPA 4TWJA 4NJEA 4B45A 2I2WA 2VDVE 1PQYA 4COKA 1R4ZA 1TW2A 4FNMA 3F6RA 1UBNA 1T6NA 3MMNA 3KDAA 5FL7A 1AH2A 5FOXA 1DRUA 4EVSA 3X3HA 4RC9A 5FORA 1QB7A 3DZDA 4DGQA 4JWKA 3ZYCA 1U2TA 1Z2AA 3QY0A 3QEJA 3ETJA 1HBJA 5ALRA 3ZR4B 4TL9A 1KPHA 4MAMA 3PNMA 2OO5A 3K9GA 3OZIA 1ZN2A 1QAOA 4NONA 1U1EA 4C7JA 3HKEB 4WBXC 4BMCA 4PSVA 1JDBC 3UAYA 3QX8A 4I3GA 4U7WA 3H5AA 4KE9A 4KR6A 2W98A 1L5RA 2B1GA 4GQIA 4JLOA 5FUWA 5HGJA 1OJ7A 3KSMA 3DWEX 1K2WA 1JEQA 1NA5A 4WCFA 2DBZA 1JU3A 2VJYA 3Q6MA 3QHPA 3TVTA 5I45A 2X9VA 3A4MA 4CL0A 4LRUA 1V3UA 4WD3A 3I64A 5B1DA 2EZTA 3T3HA 3VC3A 2GR9A 3T38A 3VR2A 5JDCA 2RH8A 4XFDA 2JFFA 3L1IA 3IIJA 1C1YA 3P9ZA 2QX7A 3WGMA 1GSOA 2RCNA 3E22B 3WWEA 1TM1E 1H22A 2W90A 2WNSA 2VT3A 3UKOA 4ZJPA 1QZXA 3PDHA 2NQ2C 1RVDA 1K7YA 5DX0A 4X1IA 1KYWA 1VE1A 2CUZA 4OH7A 2XB6A 5EWJA 4F5EA 5I7FA 1RKBA 2GYUA 2QG9A 2N1MA 3WAJA 1ZHOA 2ZSAA 1NN0A 1SIOA 1SCNE 1WOMA 3IOCA 1CUBA 8AT1A 1SXJC 2WJJA 4NFYA 1VMDA 2HJHA 2QTFA 3O93A 5K0EA 1GP2A 3PT5A 4HNSA 2NP7A 3ZXXA 1FMTA 5FYDA 1H4TA 3SZLA 1L1FA 3BDAA 1VL1A 3IJ5A 5I8PA 2GCPA 1TUGA 4BNVA 1F2TB 3VM6A 3W7AA 4QJ3A 1GUDA 5F5NA 2AK3A 1N2HA 2AW5A 3KB1A 3NOQA 4HTFB 4V0LA 4DIUA 3EVCA 2QG4A 1V7QA 2C1EA 5KJEA 3CPJB 3DR5A 4OOFA 5GZ6A 1ZAKA 1EK0A 4DIKA 1R6UA 3QYPA 4Z54A 1V6SA 1SKAA 1WXXA 4LWPA 2SBTA 1JFVA 1MX3A 2ZQZA 2D1RA 2HMWA 3DO6A 4KQ1A 4OUKX 1UKBA 1QIEA 2GN4A 1WU8A 4LECA 4OHPA 2CB0A 3PENA 1FMCA 1CUYA 4HMPA 1KYTA 1NXWA 2UZ3A 4F4JA 3HUTA 4IRUB 1KMQA 2XDQA 1OI3A 1NDUA 1VKNA 2OGSA 5DGHA 5CITA 2IZZA 4EPRA 1ODJA 4Y2QA 3O38A 3WJ2A 4E5SA 3T06B 5EMLA 2FX3A 1N34B 2FG5A 5K99A 3GDFA 1GZ6A 1EE1A 1EAYA 2IXFA 3CR8A 3IHWA 2O1EA 2NU8A 3UGTA 5K0FA 2YKGA 1K9SA 3GFVA 3W78A 3T7RA 1L3CA 1GRRA 5H83A 1CEXA 4BZWA 2J4FA 2YVQA 3IQDB 5JC8A 2VDRB 4HFMA 2PPVA 4MQEB 1T4MA 1VB5A 2DUJA 2Q3CA 5A4JA 1HLDA 4GGOA 2ZG6A 5H7XA 4O8ZA 1VYHA 4ENWA 1VYUA 1WVGA 2VJCA 2AOTA 4LXYA 3QITA 2JCVA 1NBMA 1OXTA 1XYVA 4C03A 4H3VA 2IBTA 5CD1A 1BDJA 4HQKA 1W4RA 4OFBA 5E8RA 1HYEA 5B36A 3L7JA 4DCMA 1I3LA 4WZAA 3LMKA 3PZRA 1YDWA 1MAHA 1Q1ZA 4UD6A 2F64A 1OC2A 2IZ0A 2ZYHA 1SUPA 4UAGA 3ND5A 5AW7A 1KP3A 4ZJZA 2G8NA 3G85A 5HYVA 5L40A 4BGIA 2ZIUB 3T4PA 4RVCA 2PQ2A 3NBUA 3LQ4A 2IYLD 3N53A 1J8QA 1QO9A 1PGPA 4A03A 5FF9A 4JC8A 3MJ4A 4L4RA 7MDHA 3GJXC 4G3XA 1IN4A 4KMMA 1THTA 4NYMQ 2ZJFA 1X3LA 2JFVA 3DVRX 3AF5A 3OLQA 4X1KA 4WZBA 4RXTA 2JW5A 3FYUA 3ZHCA 4A0GA 1C8LA 4A36A 4KQJA 1ECPA 2A92A 1XCJA 3LWDA 2PMDA 2VWGA 1FYVA 1SIBE 4LFCB 3RSSA 1FSPA 4N54A 4F9EA 2GSDA 4DJEC 5JHGB 1LD3A 1GPLA 5E6SA 2IH5A 3V9PA 4D0RA 2PMFA 4WECA 1PJ2A 3N05A 2HDWA 3HWWA 4X95A 3S28A 1J5EB 4N0EA 4QGHA 5DZSA 3VPBA 4P7KA 2B8WA 1DQZA 1BD3A 2GAIA 3ROGA 3ZDRA 1JSXA 1B73A 2YY7A 2PUHA 4TQUS 4G1CA 4AKHA 2X9QA 3I6BA 4IDNA 3TE6A 1FTYA 4Q16A 1MO5A 1GG8A 3K8QA 4ZYYA 5ALXA 3QUAA 1UOOA 4UW9A 4B6SA 2DECA 3ZWOA 3IOEA 4LVNA 1GZSA 1I36A 2OBYA 4HVTA 3NV7A 4GPD1 4JCOA 5DFAA 5GOZA 1EWQA 3BZBA 1U8CB 1V6CA 2QP3A 5CJJA 1UMCA 2QAGC 2WQZA 2ZWIA 2KJQA 3E9MA 1W1UA 4UMFA 5CU7A 1RC1A 3AT1A 3T9FA 1ISFA 4EHJA 3FWZA 2RG1A 4BTVA 3MD0A 4IIGA 4N47A 3GJ5A 4YUVA 5AI9A 3DOCA 3BWCA 3FUCA 4OHKA 5J1TB 4IVRA 3O8BA 3TIXB 2HLNA 5JV5A 2CKDA 3HVHA 4IDQA 3AR4A 2V5UA 1QGZA 1UPAA 621PA 3COPA 1IM8A 3H3XA 4QFCA 1RXWA 1HEUA 1PQPA 3AKEA 3HBMA 4LI3X 4LK2A 3THYA 1E6EA 1JIJA 3Q7RA 5JMWA 3ZXSA 4ZZ3A 4WFKA 1LSOA 2O8FB 4HAYA 3PJGA 2N9UA 1O58A 3INRA 1OWMA 3KQPA 5DULA 2OT3B 1L7AA 4QXQA 5FBVB 2E6UX 2W9XA 2O5RA 2G36A 4RETA 2MT9A 2FPXA 2GZSA 4ZT6A 1QWSA 4LYEA 2BJHA 1D0VA 2Z6VA 2PE5A 5A6VA 2Q5LA 4CIDA 3E0QA 4DG9A 1Y9ZA 1X7WB 2AZXA 2FSIA 3WWDA 5A71A 4DEXA 2HIHA 3PUIA 4A6EA 4ZDKA 4KWHA 3T1TA 1O77A 3K7EA 3UMCA 2GJ9A 1IOLA 1GT6A 1XTIA 4DILA 4C4ZA 4OGLA 5DN6D 2X3FA 1RWPA 5H02A 1YKGA 3PQCA 3EA0A 1NXXA 3D64A 4ZVSA 4ZVUA 5PNTA 3UGQA 4DANA 4DV7B 1A9SA 4BP1A 4CF7A 1CY6A 3I32A 3L6DA 2V7QA 4PQRA 4O2AA 1CSEE 1QLWA 3G9ZA 4OIFA 1C8VB 1CUZA 1NVMB 1JEDA 1UXKA 4RDCA 3HK2A 1Q0ZA 1XZIA 2XMBA 1MX1A 3FWHA 1MDBA 4M8KA 2OAEA 2ZRIA 3ZDDA 4KPUB 2FFJA 1M5RA 4B5KA 2IEYA 5JAOA 3BKXA 1A96A 1XCLA 3OCYA 3BTUA 5KOHB 1KH3A 1Y9EA 1DQSA 1JFRA 1J0CA 1WULS 2ZBUA 5GGYA 3NRJA 3WADA 5A5FA 3D2BA 3WA7A 3OWXA 1DC8A 1W5EA 4DA4A 1HL7A 1R18A 2O7QA 2CLFB 3JYHA 4KX5A 4G0MA 1ZSVA 4CCYB 2ZBVA 4HGZA 3HY4A 1SOVA 3I04M 3X44A 1AKYA 3AVXA 3BERA 3KQOA 3V42A 2FUG1 2W2KB 3AR8A 4FEEA 3HB4X 3W77A 1NLMA 3H5NA 1H3EA 2QW8A 2OCXA 2AXPA 1E2DA 3R0IA 4M1ZA 4F0JA 5FV7A 3GNQA 3EAGA 1NYTA 2I6TA 3L0YA 3PUYA 4CR8A 4H16A 3H16A 4TL8A 1Z6AA 3HJCA 5IT9A 1NQWA 2VTDA 4BC1A 2AFIB 2PLWA 3TXXA 1HDOA 2P6OA 3G79A 2ZTLA 3OZRA 1SOMA 1U3GA 2CC2A 2OOSA 2GDJA 1IN1A 4PPYA 4BCDA 4A16A 5FA5A 3RWOA 2C4VA 1KI1A 4FJ2A 4G0XA 2QNBA 1BWRA 2FRXA 5CFMA 4C6TA 2ZS9A 4R69A 4G5OA 4UVEA 3W05A 5JBNA 3CUKA 2W83A 3SIXA 1Q0PA 3L8DA 3KDPA 4GYKA 3UHPA 1C1XB 1JKXA 3HI4A 3LNTA 1OB5A 1CJUC 4TQAA 3ZBTA 4XPIA 1IXYA 4QUJA 2GWHA 3E81A 1QGUA 1ODLA 4MYHA 3TRJA 1QPBA 2OEPA 3RRZA 4JX9A 1U8XX 2O54A 3STYA 3AX6A 2CNNA 4IJ5A 3E5MA 4LJRA 2CDAA 3B82A 1EQAA 3BFPA 3H1PA 5HP4A 3TD6A 3M9LA 4MB6A 1YJ8A 2E4YA 3OT5A 3EUWA 4HH3C 4M38A 4JK3A 3SQOA 5F98A 2Y76A 5CYPA 2YXLA 2C2KA 2J6CA 2IODA 4FBGA 4ND1A 4UTPA 4ZK6A 3OO0A 1C4OA 2YDXA 1VE6A 4GI2A 4JQZA 2DFTA 4RPCA 4HMQA 3AP2A 4B4UA 2QLLA 2QT1A 2AFIE 4MWDA 4BJHB 3REOA 1VCMA 2Y1GA 4LRXA 1KIAA 1AV7A 3QVXA 2BGGA 1XE3A 5LUBA 4OP3A 4CETA 3ZWQA 3QLUA 3OH8A 1GLGA 2GX6A 3B5JA 3HP4A 4AG5A 4Z4GA 3CWQA 4MHSA 1WF6A 2PUDA 2A7XA 3ND6A 4L1KA 4NOMA 3VNVA 2WD8A 3PWKA 1E4EA 4AJPA 4C7VA 1URPA 4E32A 1EUDB 4WI1A 2PZLA 5G0WA 1PVOA 1YXMA 3IP5A 4DM3A 1SOAA 5B55A 1FK8A 1WW2A 1E2MA 2FW7A 3BIOA 1K2VN 2HXYA 2XYRA 3CW2A 3N3AC 1WZCA 221PA 3AERA 1WKCA 3QWAA 4MDYA 4LZPA 3D2LA 2R1TA 4AJ2A 3OURA 2FPIB 4AUEA 1H2RS 3WLJA 2AS0A 2JLWA 1GQQA 4PWYA 4GLOA 4Z7JA 3RS5A 2QN3A 3TAXA 2CUKA 3AJ9A 4PBRA 1N4DA 4Y7DA 5T57A 3WWPA 5K4HA 1NZFA 1SVIA 2OBFA 5JH7F 3LRTA 4L8LA 5EZ6B 4R7GA 1MPXA 1DAFA 2WU3A 1DKMA 4MYSA 1EA5A 4K9KA 3WBFA 3IUEA 3IE2A 3EN0A 3MTJA 1DMSA 5F5LA 1L1RA 1N2OA 4RYLA 5FT9A 1QMPA 2O3UA 4DTCA 2J8ZA 5SZIA 5AH0A 2V6IA 4TYQA 5JS1A 1N3IA 1OLSA 1KJ9A 3NXKA 4KBFA 3CRVA 1G9TA 3MPOA 3SE7A 3EVZA 4C06A 5L7TA 4IILA 1I01A 3H1GA 1NSFA 4GR9A 4QJBA 4AN0A 2P5YA 2Y92A 2PUVA 2O0JA 1W6RA 1KEUA 4PX3A 1DU4A 3UPDA 2WAXA 2HO5A 3M4YA 1A4UA 4JP3A 2CSXA 2P9JA 4N1AA 1M83A 2HWXA 2PO5A 3V8VA 2R96A 5DISB 5DGTA 5LU9A 2UYYA 1QC5B 2EHDA 3AEXA 3I28A 3KQVA 3NBZC 3O4RA 4IHKA 3TZQA 1DARA 3E5RA 2ECFA 1T3LA 3BXHA 4WXHA 1KZGB 3RBAA 3SC3A 3ZQKA 1MP0A 1TL7C 5AJVB 4ESEA 4ILEA 5E6RB 3CO5A 3L8HA 5ALDA 1UK7A 2XITA 3ANTA 2C31A 1CJTC 2COEA 4C7KA 4MGIR 3T3GA 1A0OA 1R16A 3KSRA 4Q3AA 3OZGA 1OSNA 5JNWA 1F8GA 3H5OA 1MEEA 2QZJA 4Z4IA 1YU6A 3Q7QA 3K20A 3KC2A 1OI2A 3L07A 5KJFA 1W85A 1L9XA 5C52B 1KTIA 1H1TA 1ZHFA 2GTPA 2QD4A 4DDUA 3KQHA 4EKEA 3A6PC 4BO6A 1TCUA 4WT7A 1P7ZA 2BP7A 3CZPA 1SRQA 4JMPA 4FFOA 4EMUA 1SVMA 4ZO9A 4YECA 5B1IA 1NJ5A 4DIEA 1R6TA 3UW1A 3HCFA 4M0FA 3QPCA 4KNWA 4MZDA 5GVSA 5LIPA 2BEKA 1UXGA 3AXTA 5LZ5A 2X2FA 4P34A 1WBJB 2NTEA 4AJKA 3S1SA 3PCTA 1PSWA 4BJ6A 4Z7OB 1K27A 2R8BA 2I62A 1TYBE 3NQ41 3EW7A 3V48A 3QLVC 1WXQA 3NGXA 3RUDA 4TKUB 3HP7A 1N9KA 3KXIA 3OLVA 1LSSA 1T24A 2VT7A 4OXKA 4QUKA 8MHTA 5IZCC 3MN1A 1Z36A 3EMVA 2NXEA 4BNIA 4BDSA 1L8AA 2VUIB 3AETB 4B6EA 3WQSB 2ZBQA 3SJAA 3WV5A 1Z3IX 2ACVA 1CNFA 2O14A 2VNSA 3NOXA 2FW9A 2JAQA 3FCUB 1TTHA 2C2GA 4HQLA 4RE5A 3I6ZA 2TMDA 5JCJA 5KDDA 1RWBA 1SQGA 1CRLA 5AJHA 3GEDA 3CZQA 4EG7A 5IK2D 1EWKA 2VRCA 3G2IA 4KWEA 4RPKA 2C84A 3O74A 4RPIA 5BN4B 5JG7A 3V55A 4P3OA 3WTCA 1C3XA 4HDAA 1Y1QA 3WK7A 1Z5ZA 1XTVA 2PPLA 3EIQA 3NGLA 1U0OC 4L4UA 5CVVA 4DNXA 5CB4F 2NO6A 1RPJA 4BMYA 4IMPA 4MS3A 2W2LD 2QMOA 1TAUA 2YN2A 3GFRA 2OCDA 1T0BA 2PUEA 3LECA 1AV6A 2EGUA 1ENYA 2Y93A 4IQFA 2RD2A 2VNAA 1OH7A 2VLBA 3UENA 4MUMA 1JG3A 2SCUA 4WXMA 4ZXFA 2XF8A 4L50A 3F47A 2QI9F 3LCMA 2LIVA 3AWIA 1L5GB 4E2YA 4YLYA 1H2AS 2X4LA 5EEGA 1NI4A 2ODTX 1EVKA 3NBFA 3OOJA 1EJ0A 5G0SA 2BUAA 3UPTA 4DKJA 4CMKA 2J08A 2G4CA 2GERA 2D59A 1AG9A 3E53A 1MT0A 2CMGA 1YL5A 2QLJA 4GBED 1PGNA 1F06A 3EWSA 1U8ZA 1NW3A 3PBKA 2QMHA 3X1MA 3ZIAD 3FWKA 5DCYA 5AXBA 5C18A 2BFBB 3BH0A 5AVVA 1XXLA 2VO1A 1JJ7A 1FFDA 4AKEA 3W9UA 3NDBB 1BS9A 1LQTA 1PR5A 3NW9A 1XAJA 2W0SA 4XWTA 1BO6A 1C0PA 3GEEA 5CFLA 4QX6A 1YBVA 4YRDA 1LZLA 4Z8XA 3TNLA 1N5RA 4MI1A 5L3QA 4R8KA 4CTOA 3EZ7A 1AGPA 2Y77A 4PLCA 1YE8A 2GRUA 3IP9A 1GRNA 4JC0A 4V0SA 3GGPA 3ZE2B 2BFFB 4QWWA 4ZP1A 3HU1A 3JQBC 1NJSA 1TC2A 2IHZA 3L0SA 3FFXA 1A2KC 4FGKA 5AKEA 4ZMBA 1R6XA 2BM1A 3KT0A 1FFBA 4F4DA 3ET4A 4PGGA 1W47A 1MNAA 3UMSA 1H8EA 1AZTA 1ZK0A 2BGKA 1SELA 3GCGA 2YR0A 2CHQA 3LRPA 1S2GA 3CUEF 3HLTA 2P9HA 1DVRA 1X7XA 4YRRA 1Z3CA 3DLCA 3QU5A 2QUBA 5EMMA 5DNEA 2B82A 3ADDA 3H2HA 4X00A 3AY0A 5EC8A 4LJ9A 5G53C 4CMCA 4HT3B 2WPDD 5U9CA 2AX4A 3M6VA 2J0UA 4EPTA 3ZH9B 5F3DA 3DBHB 1O54A 1Z39A 4ITVA 1D7OA 1E99A 2I99A 3W06A 4D97A 2XYGA 1TECE 3GRFA 1MIOB 4LUCA 4RK0A 3QPDA 1SXJA 1LI7A 5EAIA 3DBOB 3E22A 2D0OB 4DHEA 4ENVA 1HFJA 3M6UA 1EX9A 1QIHA 2JANA 3I8XA 5KYWA 3H9GA 3CS3A 4YRBA 4EHIA 1BMFA 4RCVA 1PJBA 3VVLA 3TPZA 3AJAA 3PFIA 5IAEA 4F8EA 2BFWA 3HY6A 3GDGA 5EE1A 3PGXA 2XUQA 4YNBA 3LTEA 3W5CA 1EINA 1Z33A 3FDXA 4JUIA 4PLZA 1J8VA 2JHFA 3DD5A 4JENA 1CDOA 2C9BA 1SQSA 2QMUA 2BCGY 2YRWA 4CG2A 5ICEA 1DKOA 4L5IA 3W4KA 3HABA 1AC5A 4KQ2A 5KPJA 3ZQ4A 4I4CA 4N3CA 3CO0S 1JAXA 1S4MA 2ASVA 3H5IA 1T0IA 1CZOA 3ABSB 4EJ0A 1TJYA 1I9CA 2WKRA 2Q5QA 1IHYA 1JZQA 4M1EA 3CG0A 3DWIA 2D8MA 4X6UA 3H0CA 2GXQA 1PBNA 3EH2A 5FTKA 3TSCA 5CDUA 3H2GA 3SQXA 1V4NA 1C41A 3CH4B 4HTFA 4TVSA 4CEHA 2GPAA 3CTPA 1XJ0A 3RDPA 4HDNB 2C96A 4Q3BA 2HBYA 1KQGA 4QKQA 3L92A 1J97A 4L2IB 2XGGA 2V3WA 1BXZA 1FXUA 2J7PD 4PXYA 2QR2A 2Q3EA 3AY3A 1Q1QA 2K4MA 2REBA 2WLSA 3LUGA 3FZGA 3DB1A 5IH7A 2EFEB 2RHJA 3DONA 4OL9A 4WEOA 4IJ6A 2FEWB 3W7VA 4CE6A 2QZ4A 1VLHA 1ESMA 3HU3A 5F12A 5BPHA 4GT1A 1E79D 2W6NA 2GO7A 1XVLA 3TX2A 2OK8A 3KKOA 3NT2A 1ZD3A 3VJMA 4YUYA 3C87A 4G65A 2WD9A 2DVMA 2RGAA 3WLAA 1LW7A 3RHFA 4CKBB 2PHZA 1GG2A 4JITA 3E18A 3MRVA 2AL7A 4EGQA 1DJQA 1OX4B 2FJ0A 2HK8A 3I45A 4FFMA 2EYQA 1G7SA 1L5VA 3TLJA 3UHJA 3DD1A 2YHAA 1RZRD 3RRXA 3H3FA 4XGNA 3WK8A 1UPFA 1ZHHA 2HEIA 3NCHA 4MQEA 3ZDFA 9LDBA 4HWTA 5AXAA 1MAVA 4HGQA 3BSWA 3QVMA 3ZWDA 2WSSA 4C0KA 2UU9B 2VP3A 3D59A 3TI7A 3ZGYA 4G0ZA 5EHQA 3E9QA 2I1WA 5AUNB 4TV8B 1APBA 5K5EA 1U8EA 2WJVA 4Y7CA 4K88A 1SY7A 2CMHA 3JWPA 3NHZA 3AEQA 4JKOA 5BWCA 1K4YA 4J1QA 5FCDA 5JZBA 5GJCA 3GDOA 4BNMA 4MGKR 1W36B 1C8BA 1GZ4A 3PA6A 3LUFA 1R6DA 2DC1A 2QVGA 1PT7A 2EL9A 4CL8A 4IF4A 3B3JA 4KI0A 1WHTB 2ISCA 3C4JA 3CLTC 1FYWA 5KSPA 3LDGA 4NENB 2G17A 1I8TA 3DMNA 2P2LA 4V1CB 1CJVC 2D0PB 2YCBA 3ZBPA 4N6OA 3VHXB 1W8DA 1J49A 4K2HA 2D06A 2V9ZA 4C3OB 1PX0A 4DIDA 2HJ9A 4XD7D 2QF7A 3HHPA 4ND3A 4LYAA 4LQCA 3B20A 2OD7A 2ZRJA 4DWWA 3ORQA 1K08A 3JRXA 2HHAA 1Q7BA 3IEUA 3WAGA 1KBZA 1D2NA 1YFLA 2XCQA 2LCFA 4R3NA 1QE3A 1IQ0A 3U4IA 4PTZA 1XDGA 2V97A 1XQWA 3F9CA 4KDFA 5AK5A 3RU9A 5M5BA 5DB4A 1PAUA 4BP3A 3W8DA 3FLEA 1YVPA 2ET6A 2VHYA 4K9QA 1RJWA 2R6DA 1PFUA 4S24A 4LWZA 1EVEA 3OJLA 5FFFA 4FLFA 1QRDA 5JCJD 3AL0C 1KZ6A 3EXHC 4Y6QA 2ZIEA 2QAGA 5FA8A 3EFHA 4WERA 1BW9B 2AF4C 4Q24A 4DMUB 1JB1A 3CRNA 2YOGA 1DMRA 1ABBA 1H4QA 3AIKA 4GYYA 4JA0A 2XUAA 2HF7A 1JYEA 5TEVA 4US2R 3A70A 1E9FA 3LDUA 5HTKA 5JJ5A 1KSHA 2YY6A 3R3JA 4Q4HB 1H0HA 5KVSA 2GHIA 3BWXA 2G3YA 2FZEA 3A4VA 3R9XA 1RWVA 2YWGA 1HMYA 5JEDA 1G1AA 2EL7A 1J23A 1ZINA 4I50A 4BNXA 3EDYA 3I9V1 5K6AC 3PQ2A 4YALA 3DZHA 3KCNA 1OWPA 4O3FA 4QGAA 1Q22A 1NX9A 5E4TA 1VOTA 2CZGA 4ZZ1A 3QWIA 5HJ5A 4AFNA 2OHFA 3MGCA 5TQ0B 1O97C 2HJRA 1UIRA 2OV6A 3HU5A 2JLUA 4PRYA 5IKOA 1U31A 1W4ZA 1BROA 2AV6A 3UJ9A 1K8QA 2ZJ3A 3QXGA 4IKOA 3TZEA 1AMUA 2EFDB 4V24A 1YOBA 3IP1A 4UDOA 1JLLB 3KOWA 3TUZC 1RABA 5JQGF 5ED4A 2O8FA 1JS1X 3KD3A 3M4JA 3FBGA 1TQHA 4BGVA 2I7XA 2IEIA 2QTWB 3GVXA 4HC4A 4F5DA 4NV0A 4B8YA 3GFBA 4FNGA 5KYKA 4C88A 1G6KA 1Z25A 1Q17A 4JJKA 1EJ2A 4WASA 3KDSE 2NP6A 2JIZD 4ND2A 3GY0A 1X7WA 3R3VA 3L7AA 1EXNA 4JJ4A 4K9DA 3UEOA 2C3MA 2NUBA 1SBQA 4M7WA 3T12A 4AYWA 3ADOA 3JVIA 5FQNA 1F2UB 1JDPA 1K6XA 1P2DA 1SUEA 1Z7EA 3AMVA 1BVUA 1KY4A 3PGA1 5H5JA 3VC2A 5LMUB 4Y2XA 1VJCA 5A9SB 1X1SA 4Y3UA 2VDUE 3R6DA 5E3JA 4B7XA 1QLJA 1HURA 3L2OB 4GM0A 3T5MA 2OAQ1 2GJSA 4JV5B 2GMWA 1Z6ZA 3QE2A 5CURA 5ESDA 1C7RA 3E35A 1Q6ZA 5T4BA 4YX9A 4FYVA 3E7DA 2HXSA 4FZ3A 1NX6A 4LWOA 5B4VA 1REQB 3KPYA 2P90A 2O6LA 1Z5WA 4KPUA 1JEOA 1EVYA 2RARA 2X0KA 3KQMA 1FUIA 1RAAA 4HQRA 5KOHA 5KTYA 4C4SA 3QNWA 4ZO6A 1K6IA 1YVEI 5JBIA 3ZDXB 1NDQA 1MN6A 2H4HA 1GRQA 1K06A 1N8SA 4MPPA 4KR7A 3BIWA 3OU6A 3U60B 3O2JA 1L4BA 1F4VA 3F3MA 3N2YA 1NMYA 3VJLA 4FYPA 1HDGO 4CCYA 5L4NA 4IEEA 2XOKD 2MSWA 4U8GA 1U7WA 2W2KA 4JP5A 3WS7A 1FDWA 1DRKA 1AKVA 3UB4A 1NFRA 4IXWA 1HDCA 1Y7LA 4WIAA 4TYWA 4JLWA 4RCYA 1VHWA 3MRSA 1GR1A 1M54A 2VKTA 3FUXA 3PJRA 2IVZA 3RO7A 3MCWA 1J0XO 2YQ4A 3PR2B 1UFKA 3H97A 4Y1EA 3TEFA 5FDFA 3QE3A 2AFIA 1QHIA 2CXHA 2ECOA 4U00A 2GN1A 2VQ6A 1YONA 2OXRA 4WX2B 2ZROA 3UF0A 5EGSA 1AHIA 5B53A 2VQSA 2PYIA 4NNPA 4D3DA 4JEIA 1COZA 2F00A 1JVNA 1E5DA 1XRQA 4OHUA 1ZA2A 1ORVA 2G25A 5CNKA 3VISA 5HK9A 1S2OA 2Q1YA 1A71A 3U56A 1K89A 1C1XA 2AH5A 5JQWA 3EGVA 3ANLA 5DI3B 2HKIA 3ZTYA 4RVUA 1BQ4A 3CT4A 1XCBA 1Z62A 3TPCA 1Y82A 5JW6A 1JH9A 3OTIA 4FPXA 1ZRMA 3FF1A 3O8OA 5AM4A 1NJ2A 2D5AA 2PL1A 3TR6A 3ZK8A 5BWBA 3CFYA 1Z29A 1YNSA 2YXEA 4HAUA 1EESA 4K8OA 1BA3A 3RW9A 1I1NA 1QAMA 3D4LA 3GRYA 4DQVA 4II2A 3I5XA 2WG0A 2ZRQA 1X77A 3RWBA 1I0LA 1Y1TA 1ZL2A 2IYNA 4P54A 1IB6A 1U3TA 3GLQA 1I10A 4MVJP 4DRZA 1XAHA 1XMJA 2ZRAA 1R74A 2HUNA 4TM7A 1Q7TA 2XE4A 3GEGA 4C08A 5JCZA 2UUOA 3ZGLA 1ZONA 1KDOA