4NBKA

Tailoring small molecules for an allosteric site on procaspase-6
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
268
structure length
256
Chain Sequence
b'FYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQAARGNQHDVPVIPTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-6
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
publication title Tailoring small molecules for an allosteric site on procaspase-6.
pubmed doi rcsb
total genus 91
structure length 256
sequence length 268
chains with identical sequence B
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2013-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nbkA00
2H4YA 3V6MA 4N6NA 1QTNA 2Y0BA 4ZVPA 2NN3C 3SIRA 3ITNA 3KJNA 4N6GA 1NMSA 2H4WA 4EHKA 3P45A 4JJEA 3R5JA 4EHDA 4LSZA 4AW9A 3GJSA 1RWXA 4HQRA 4QUDA 2XZDA 2FQQA 4AWBA 2H5JA 1RWWA 2J32A 2J31A 2XYGA 1RHKA 1RWKA 1SC1A 2CNNA 5JFTA 1ICEA 3PD1A 4NOKA 4ZVTA 1SC4A 2H54A 4QUHA 2QLBA 5IASA 4D3XA 4PS0A 3H11B 1RWPA 3R7BA 1F9EA 5IBPA 4I1PA 3E4CA 4N7JA 1KMCA 2C2KA 3KJFA 2CDRA 4NOLA 2C2MA 2DKOA 1RWVA 4NBKA 4PRZA 2FUNB 5IC6A 5IBCA 2CNOA 1SHLA 2WDPA 3PD0A 4QU9A 2XYPA 3H0EA 2FP3A 2HBQA 3H1PA 4N7MA 3PCXA 2XYHA 1NMQA 3R7NA 4NOJA 4QUGA 5IAEA 4QTXA 4ZVSA 1RWOA 4EHAA 4EHLA 4HVAA 3EDRA 4N6OA 2Y1LA 1K86A 4QU0A 4EHHA 5K20A 2CJYA 2K7ZA 3H11A 1JXQA 1IBCA 1QX3A 5LUBA 4D3YA 1PYOA 4FGUA 4EJFA 3DEIA 3GJTA 3R6LA 1RHUA 2P2CA 3DEKA 5IARA 4FXOA 4JQZA 4N5DA 5IAJA 4I1RA 3EDQA 2CNLA 4JR0A 4HQ0A 4QTYA 1M72A 1GQFA 2C1EA 2QL9A 2H5IA 4JJ7A 2HBYA 4ZVUA 1I51A 5IAGA 4AWAA 1NMEA 2CJXA 2J30A 1I4EB 4EHNA 5LUAA 3NKFA 4D3ZA 5IBRA 2XZTA 2AR9A 3V4OA 3SIPA 4IYRA 1K88A 2H65A 4PS1A 3NS7A 4IEFB 4QU5A 3UOAB 4NBNA 5I9TA 3KJQA 1RWMA 3K7EA 3GJQA 3P4UA 4QULA 3S70A 5IC4A 4ZVOA 4JR1A 1SHJA 3D6FA 4QU8A 1RHRA 2H51A 4JB8A 5LU9A 4DCPA 3V55A 5IABA 1BMQA 3NR2A 4JJ8A 3DEHA 3DEJA 3R7SA 2C2OA 4FDLA 3OD5A 4QUAA 3V6LA 3IBFA 4M9RA 4QUBA 3QNWA 4QUEA 3D6MA 2QL5A 4DCOA 4FEAA 3H13A 5H0IA 5IAKA 1RHQA 3IBCA 2J33A 2CNKA 1RWNA 1RHMA 2H48A 4ZVRA 1NW9B 2HBRA 3V4LA 1SC3A 4QUIA 1GFWA 1QDUA 3R5KA 5IANA 4NOMA 3D6HA 4JR2A 3R6GA 4PRYA 4DCJA 4ZVQA 1RE1A 1CVRA 4EHFA 3GJRA 2QL7A 1I3OA 4QUJA 3UO8B 3V3KA 2QLFA 3S8EA 1PAUA 4JQYA 1RHJA 1I4OA 3BIJA 1CP3A 5I9BA 3RJMA 4NBLA 2QLJA 2HBZA 5LU8A 2C2ZA 1F1JA
chains in the Genus database with same CATH superfamily
2P9BA 1DBRA 3ENQA 3OU6A 4N6NA 3I37X 3O4VA 4TRNA 3V4RA 4R6WA 4S35A 1V96A 1G3IA 1Q0TA 1WD7A 1Y3IA 4REQA 3GNTA 5F7OA 4ARVA 4FIZA 4GSYA 1LI5A 2H2HA 4NZPA 1TIKA 3DHVA 3OZGA 2CSUA 2C7QA 3H05A 2QEQA 4ZHQA 2O3RA 2BVNA 2O5VA 3IEPA 3S99A 3TW0A 1J9EA 2SECE 3NIBA 4Q4DA 3RVMA 2XV1A 1DC6A 1PQPA 3G1UA 1GAXA 1Y7IA 3WBBA 4X9XA 4Y1RB 3H7IA 2QN8A 3CR3C 2GVNA 4MKHA 2WQ6A 2CLHB 1NAHA 5JDIA 3TZQA 4TUYB 1IZ9A 1SBTA 1XCJA 2OV6A 2WIGA 1M1XB 1G20A 2J1LA 2W6ZA 1FF9A 2CL5A 2VAVA 1COWD 3A1VA 4WOBA 2XZOA 4N3GA 1KIAA 4ABTA 1QO0A 2F43A 4LF7B 1U80A 4AJJA 4NE2A 1FDVA 2WE7A 1OXTA 4MKFA 1V6CA 5HKOA 1ZYUA 2X7JA 2GQ0A 3GWGA 4OI4A 2QTAA 3W06A 1CIVA 1NY5A 1SXJD 2AMLA 3EF0A 4BIMA 4D0GA 1EBFA 1G8MA 1N6LA 1G20E 1N8TA 2VTVA 2XE7A 3PU6A 4Z3DA 1SH7A 4FGSA 4YR9A 3MINB 4RPLA 5ELMA 4S2EA 1XJCA 4ETIA 2ZS7A 5BSKA 1I4DD 1EM8B 2I9PA 3MERA 1I7QB 3EVFA 4EI2A 3RD5A 2WSBA 4LX8A 4G5YA 2IH5A 4IDFA 4BV2A 2BFBB 4L8GA 2R44A 4CXMA 4RTNA 3GMTA 5HIKA 4MTCA 4CEHB 4LQLA 1M2GA 1XTJA 4NATA 3LBAA 2BDTA 3ZHRA 1NOJA 3TECE 5CNJA 2X7HA 2QTBA 3E2PA 3KUDA 4FLMA 3LY7A 1XNQB 1KI3A 2OKGA 2JGNA 2XWSA 3OM8A 4H4EA 2XRFA 2WJYA 4X6YA 3TSYA 4D3ZA 4D9MA 3ZNQA 2PSSA 4TM7A 2XT9A 2R8RA 2POQX 3M33A 4JBWA 4DQVA 3LBHA 3S1SA 3AFGA 1G2QA 1YC5A 1IIBA 2MMGA 1Z36A 2EYQA 4KU4A 2WU1A 1L5FA 2ZJ1A 4K26A 4ESEA 4JB0A 2JIPA 3FMGA 4BFXA 1AMOA 3K7EA 2H1RA 2VRNA 3JAKA 2E48A 3Q5GA 5FNVA 1WPRA 5HTKA 3BS4A 1NDQA 3NBKA 4WLUA 3GEMA 5DSTA 2IOFA 1O6CA 3HUFA 3SCZA 4AG3A 3CSDA 1QH1A 2DPYA 3GAMA 5GWXA 1EAYA 3LPMA 1BWQA 1QOQB 2D62A 2H52A 3Q7EA 3CLVA 2R1VA 3COSA 3A1FA 4V0KA 2ZXFA 3OC6A 2YY7A 4EBBA 1RC8A 1GNRA 1ZM3A 2ACEA 4XVUA 5EFOA 5I5EA 3NTLA 3GP3A 4F93B 3PJEA 3EWIA 2ZIAA 1YGYA 1CSEE 3EG9B 1V71A 3G8BA 3KQMA 5D8DA 1XAIA 4JGGA 4G4SP 3ZUGA 3T7SA 1YOBA 2CLEB 3VOAA 4RZ2A 3D5TA 2NVOA 1ZH0A 2WMDA 1GAEO 1GAQA 2IZ6A 4KN6A 4XTCS 5LCXA 2QLFA 3UAVA 1ZVJA 2F43B 1ZGBA 3BTOA 1RQ7A 2B94A 1QE0A 2H2FA 1JRLA 4KKVA 4WDRA 5TF0A 3RC2A 2FZLA 2D6FA 1JTFA 3OU2A 1N2SA 3D3JA 2E4AA 2X1LA 3MS7A 4GR5A 4EUHA 1WXWA 1SQ6A 4JB3A 1JJBA 2MOKA 3JVDA 3GJ8A 3HACA 1ZK3A 3MQ4A 1N6NA 3SIRA 4GDFA 3AF2A 3BL6A 4Q3OA 4XQ9A 3RH0A 3SF0A 3IAXA 3MGGA 2ISCA 1PO7A 3BRWA 3GLQA 3ZHZA 4E5DA 1RJEA 1BX3A 4IXDA 5FO0A 3BGVA 2BE7A 3C0KA 1REQA 1RPAA 3A4NA 4C2BA 4EHIA 2V7UA 1DC5A 2GYYA 4HLUC 4UEOA 4IOMA 3MYRA 3HXQA 2FWRA 3DOIA 3RAGA 4EX6A 3KQQA 1XTZA 4I3FA 3V32A 1O95D 1T26A 4HZUB 4MS4B 3A6DA 5AUNB 1A9ZA 2Q3EA 3EC7A 5DSXA 4RHTA 3EXAA 4IS2A 5F1PA 4MQFA 5F1KA 4BCCA 5DLQC 1GZ4A 5KNBD 1KEKA 1UZNA 3RHFA 2WUFA 1L7MA 3TCNA 1IWOA 3DCNA 1XMXA 2A58A 2J67A 3L02A 1FMFA 3WSVA 4X92A 1HNZB 4NVRA 1A1VA 2HF8A 2E21A 4JUAA 4ZOEA 3DV0B 2XUZA 4LQ4A 3H6GA 5JPCA 1UMDA 1NGSA 3W2IA 4KWEA 3AUJB 3E8XA 1QPZA 4G9GA 1R8SA 5I6DA 3MSCA 1SPBS 3JVIA 3Q2OA 1VI6A 1RYZA 2JI9A 1YGPA 2R4UA 3P9ZA 5K7SA 2XDQB 1U7ZA 4MV6A 5FA8A 5HK8A 1Y82A 3AP1A 3CG0A 3A6EA 2A0XA 1CYEA 4ZOLF 4YREA 2ZCUA 1VECA 3GEHA 4CLRB 1JKFA 4E09A 5AVWA 1XDUA 4YJFA 4RK7A 1QNFA 1R0XA 3NXKA 4EPYA 4K9LA 1R18A 3VA7A 1EDDA 3M4YA 1ONPA 2TYSB 2BW0A 3N7UA 2FZ5A 2DSNA 1N0UA 2XGMA 1Z0ZA 1U4SA 2XQIA 1TCVA 3FPKA 2COEA 3LVFO 4C9BA 3PNPA 1RSZA 2BI4A 4BVAA 1O77A 4K81B 2UVQA 1VPEA 2OHFA 3L7YA 3NASA 1XMSA 3RS2A 2I6TA 5EVCA 3TBKA 4DEYA 4GR9A 4YR7A 4L8YA 4DMKA 4UVDA 2ENUA 3DTYA 3ZCRA 2QVLA 3JVUA 1E9CA 2QD3A 2I6UA 4UDOA 4XM1A 4LHZA 2V4MA 3PA8A 1ENPA 4KQ6A 4L9WA 3T1QA 3ZHXA 1W5AA 4W99A 1ETHA 4E07A 4GECA 4AX8A 4HO1X 1DCMA 2P9TA 2VUSA 1IPEA 3P9CA 2LDXA 1Z2NX 2XTMA 3R2JA 1KOGA 2CLLB 3G8CA 4HKTA 5FQOA 4QHYA 1HE2A 1GQQA 1ZCJA 3KYCA 3IULA 1GPDG 1O94D 4DMCA 4JA0A 1Z33A 1D4AA 2O9JA 4DV2B 2VN8A 4PU0A 2GCIA 2PZLA 1XTPA 3R8CA 1NUAA 1E2HA 4LG1A 4DTCA 1MNQA 3VR5D 2Q7OE 4YBZA 5A0TA 1MFZA 4EHFA 4IICA 3AUYA 3K05A 2QMQA 4RK4A 3ZUPA 2Y1WA 1MO4A 5M2QA 4Q34A 3D5EA 1KKLA 1TA0A 4X7PA 1HI9A 3OA0A 2OT3B 1I4OA 5JS2A 1TNDA 5FCDA 4E31A 2AHOA 2NUPB 2QT9A 5HM6A 3TRJA 5EKSA 1QJCA 4HH3C 4BASA 1Y8AA 1LTHR 2H4YA 3KKOA 4BZXA 3AR7A 2NYVA 4PE5B 2OCLA 3VU9B 1M66A 1E2DA 4PANA 3RSZA 3PPIA 1OASA 1DCTA 1ZRHA 4KDRA 1RFLA 1UUFA 5EJFA 1Z08A 2IHJA 3V46A 4QYTA 4DQ0A 1LPBB 1P91A 4YT2A 2WWYA 5CB6A 1KAHA 2G7MC 1ZOLA 2NLOA 1V6SA 2C77A 4BATA 1N34B 2WSSD 4QJBA 3GZ4A 2IPLA 1TTTA 5K6RA 4L08A 3K72B 4URZR 4YP7A 4YO7A 3R0JA 1ZC4A 5TQ2A 2X13A 3HBLA 4LVUA 2FGJA 2APJA 2V55B 3PDIB 3IUJA 4GPBA 4LSGA 5BR8B 4ZO4A 2VBGA 2XWJI 1I13A 3UHPA 1EX9A 4Z2AA 4YQZA 1KHTA 5H4GA 4ASUD 1C3LA 3I5UA 2C3MA 3QENA 4JLDA 4OJQA 5KAMA 4AVYA 4WLEA 2VNJA 1SCUA 4DDUA 2XIJA 2X5NA 2X9QA 1ZCZA 1EG2A 2RCNA 3PI7A 4LZZA 1XTRA 5HIMA 2R6HA 4QPPA 4Z0TA 1G5TA 3AB7A 4OYLA 1YNSA 5AHRA 4DWVA 3DZIA 1N5LA 3AHGA 1YF3A 2IHKA 4R8LA 5CFNA 1ZHHA 5ILQA 1YA6A 1NQVA 4HNHA 3AGQA 5FTLA 3W7AA 1QE5A 2JS7A 3CLSD 2ZIEA 4UDXX 3HXPA 4DBZA 4DFDA 3PIDA 5JHGB 3FHTA 5D3KA 1I3LA 5EUBA 1KEEA 3SDZA 5IJZA 4MS1B 4L4RA 4EG6A 1RHUA 2C9OA 4FFVA 5I9IA 4OLJA 1Z5NA 2OMEA 2M2IA 2AV6A 3EPPA 4L75A 2CV0A 2IH2A 3IELA 3CY6A 1E79D 3O73A 4JOCA 3KYDA 1W49A 1QF9A 1UBGA 1CZOA 4FGZA 3TFQA 2IYRA 4JDPA 3KQKA 2E6KA 2AQ8A 4M1KA 5E4JA 3WK6A 1SCAA 2FN8A 4DSTA 4RZIA 2RGUA 4J76A 1GPBA 4OMCA 4HLQB 4X85A 1KSGA 3HI6A 2X3FA 3SQNA 3IVCA 3UOAB 3W3AH 1US8B 4E2FA 4CF7A 1JH9A 5EJ7A 4LJKA 2IU4A 3LKVA 3T52A 1XQVA 2JEZA 2XITA 4K9PA 4ER3A 4BGDA 1IAQA 4M1YA 4RV5A 2GB4A 1A04A 5AK3A 1PGPA 1ULUA 5AKHA 3LCUA 4BLRA 4DLLA 5KVVA 5TMBA 1OLXB 1ARZA 2C78A 2NXCA 4JU8A 3TJRA 3W2GA 4M89A 5EIOA 3UPUA 3AVYA 2RKBA 4G89A 4B8ZA 2ZS9A 5BR4A 1CKEA 2RG1A 4R84A 3RS7A 5C5EA 1L5SA 1SXIA 1G0NA 1PR0A 2HQRA 5DT2A 5EMKA 4RTSA 4DTIA 2BGGA 3HK2A 4EKGA 1DBWA 1QAMA 1FPQA 3EXFB 3TLJA 2VBCA 4NLLA 3M3DA 4QYSA 4LIPD 3VPXA 4JYCA 1LSJA 4M9CA 5D86A 5AW4A 5FEMA 1VG9B 2QGNA 1SVKA 2D5IA 3O4FA 4IJMA 3OD5A 1MA3A 3E9EA 4R1NA 5EC8A 1XTQA 3E9QA 3QF4A 1RD4A 1D7OA 1RU3A 3E61A 1T91A 1YACA 2CNWA 1PZEA 5EMMA 1L8OA 3A4YA 3KFLA 2WYIA 1GTMA 3RW9A 1KI9A 1CY7A 1V3VA 3DXZA 3C6XA 2BI7A 3H3FA 2Z2KA 4BNZA 3SLGA 5HBGA 1FTYA 1DNPA 4XIGS 4E5MA 3CRW1 4H7EA 3PC2A 3URKA 3ZWCA 2I2AA 3D0QA 5LM3A 3CB4A 1TQ4A 2RI1A 4G2NA 1QDLB 3O9MA 2G71A 5IKPA 4YQEA 3H5WA 1RE0A 1C0PA 4IFTA 2ZRMA 3AF1A 4D57A 3UUFA 3BFPA 1X3SA 5K3FA 4LGYA 1V5EA 3PXEA 5DM2A 5C4MA 1VGQA 1HNWB 5BMOA 1PEAA 1OB5A 2WTUA 1G5HA 1VC2A 4OXYA 4P7BA 1UJ2A 4QPDA 3P5BA 1LJUA 2Y1XA 3RDPA 1UPXA 3U62A 1EB9A 3K09C 3OEWA 1XYGA 4Q4HB 4UU0A 3B1ZA 4JUFA 3IUBA 1ZH2A 2MJLA 4ILEA 1RCUA 4QJ4A 5K05A 4AY6A 1JJFA 1IEQA 4TYYA 4LGMA 2FUNB 4ND7A 3Q11A 2ZUEA 2CXTA 3LWDA 3L4BA 1YQDA 4L76A 4AX4A 4BVLA 2ZJOA 2GF9A 5JJ5A 2Y1CA 1AURA 5F4BA 1ZWLA 1W0KA 5SYNA 3I0NA 1S2OA 3HDTA 2V65A 2ZBDA 3TZLA 3VSCA 4MUHA 3CLUD 2H92A 2J7PA 2Z5GA 3OEYA 4GS5A 3FM9A 3UHOA 2PIAA 4D9EA 1P7YA 4LJYA 2NT3A 1KE1A 3VAAA 4JELA 4C4RA 4CKEB 4PCVA 2R751 3T1OA 4MLPA 1T8SA 3OLYA 4BDSA 1ACMA 2IEAA 3ROMA 1E0DA 1PKEA 4I08A 3W9SA 2O8EA 2VF4X 4KJXA 3BEOA 3FOWA 4RGVA 3KETA 1A98A 1BW9B 3NHYA 3CSUA 1Q0PA 4AK9A 1KI6A 3GCXA 4CTKA 4EKDA 3RNLA 3THYB 2OESA 4PWZA 5CW1A 3O4RA 1FL9A 2IPXA 3IV7A 3QV2A 3QYAA 3UW3A 2C5FA 2ZK7A 3ZX4A 5CDHA 1IBKB 3TLEA 3OOYA 2A1UB 1IY9A 5G1PA 4E0BA 1N6HA 5H3CA 5MFZA 2NTEA 1LV8A 5FADA 2PLRA 3RIEA 1NMYA 1AN0A 1OFVA 3C3PA 5A9TA 4JI1B 5GZ3A 1PW7A 3VTZA 1JDUA 4BECA 5CGQB 4URWR 5KCZA 2P6RA 2QE6A 4PC3A 4TOIA 4NZNA 4YRBA 3WDMA 3U39A 4JKOA 2AW3A 4C4YA 5LU9A 3DL0A 3EUEA 1BMQA 5CRIA 3RYFA 1S1CA 4PW0A 2CF6A 1W6RA 3ISJA 1QZZA 3CKYA 2WM3A 4BGUA 3ZG6A 1UP6A 3FFWA 4R9VA 5ABPA 5DTIA 5EJ4A 3ZU6A 3F9RA 1FFYA 2AQIA 1GGVA 4M37A 1HZJA 1Y6FA 1SUCA 3ED1A 4OKNA 1G19A 2VT2A 1IY1A 4TL7A 1Z8DA 2XF2A 4A2CA 3ANMA 5JU6A 3H8SA 1C9YA 4P36A 2Z8YA 2M1XA 5TLSA 4LE1A 1H2AS 3ILYA 3SBXA 4CEIA 2YYZA 4KQFA 1OLOA 1A2QA 2QTWB 1C1DB 4DAOA 2WMOB 1LNSA 2WU4A 1FX0B 4IZIA 4L4YA 2BUBA 3PNQA 5LLSA 3O21A 1KZ4A 2I67A 3O4HA 2LCIA 4QBTA 4NFLA 3CR7A 4YRNA 3H1AA 3RRNA 4PVCA 1NE7A 5KO2A 4BFSA 1GTZA 2IHTA 4M4SA 3WGKA 2VPZA 4ZTUB 1J8YF 1QB7A 5I7AA 4YUWA 2VH2A 5TPWA 4PYJA 4W7HA 4P5EA 1UBTS 4Q21A 5AW5A 2OCIA 3YASA 3CRRA 5FJIA 5F23A 2D7DA 4F8JA 3DC2A 3ITKA 4B4UA 3U09A 3K70D 4RBNA 4UQPA 1WU7A 1Z6ZA 4H7DA 5I51A 2C5AA 4JL8A 4Q1FA 2ZTVA 4WESB 3JQ6A 2JHPA 1FSSA 2XBLA 4PLHA 3TZKA 3OLZA 4QA9A 4ZRDA 1KDYA 3ZEAA 1EUCB 4W82A 3CZQA 2WFLB 6REQB 4AJPA 3SSAA 5LDHA 3OTQA 3ADDA 4HRAA 5H3HA 5H80A 4IRXA 1PNTA 2DERA 5A04A 4CKYA 2EL9A 3MWGA 4E2XA 1JMVA 4XX1A 2DOKA 4I1OA 4P7FA 5EKUA 5BVGA 4LOJA 1H2ZA 2CUKA 5EUQB 4E51A 1QOPB 3DW3X 4A6EA 3QNUA 3C3KA 3CYFA 2GPTA 2QRZA 4KIGA 1DELA 4ZVNA 2NU7B 3ZBQA 3DXFA 3IA2A 1AZWA 3II6X 3AXTA 1EG7A 3CEHA 1Z4MA 2IXEA 1OLUA 3R20A 2QT0A 2J9FA 4IL5A 1KQPA 4GXNA 2CKMA 3R1IA 1ZMOA 4B3IA 4YALA 3SM3A 4GKVA 2PBFA 3JYQA 3SHOA 1SJ9A 5KWJA 3UGJA 1OV6A 5ALDA 4GGMX 5K0BA 4YAWA 1OYVA 2FEKA 3R7WB 3ZGLA 2LXNA 2HQSA 1XQ1A 1UKVY 2H5IA 1MB9A 3UAGA 2IOYA 4KO4S 1K68A 1PFKA 2BIFA 4B4VA 2VAMA 5ER6A 1VLVA 4RFLA 5BW8A 1CQXA 3TEMA 2UUCB 3F74A 3U7GA 4MCJA 4RWEA 2CLMB 5CFZA 1J2RA 3NRCA 4U2CA 3TLGA 3KUKA 1LDGA 3WSWA 4H6PA 1BGXT 2DB3A 3QVOA 2PO5A 4JDUA 5F51A 4LJ7A 4NABA 4O2AA 4JJZA 2FCRA 1WOYA 5D01A 4J1SA 2GDZA 5LBIA 2KS6A 1P2VA 4B80A 3O83A 2Z6AA 4Z54A 3UBTA 1EHCA 2ADFA 5EJ6A 2WYHA 1J2EA 1V1MB 3OKAA 5LZ8A 1II0A 3QYJA 4I36A 2GAIA 3LS2A 1C7IA 3HG7A 1RHMA 2H48A 3M6FA 3MLEA 3P1JA 4C78A 4FZ3A 1Y9AA 3JD1A 5EZSA 3QV1A 1T0BA 2O8BB 3A6GA 1B00A 3PYMA 5CLLA 5LIRA 1Y4DE 3QKTA 1OD6A 1ZOSA 3AZQA 1Y8RB 3IP6A 1ZMXA 1H1LA 3IKLA 3K6SA 3BRQA 3P9IA 2W2LA 1E1RA 4MR8A 1SUDA 1UJ5A 2Q5JA 4L0MA 1CVIA 2Q46A 3SZOA 4ZMRA 3OJEA 5MGNA 2V3CC 3FGNA 5KVSA 3WQSB 1ZFNA 3GFRA 4N5HX 4B7XA 5AQ1A 3ICPA 1N7GA 3GFFA 3GJ5A 4DREA 4HBGA 2OCBA 3C1AA 3H84A 5GTDA 2EF0A 3LA6A 2A86A 3ITNA 2B20A 5ITZB 1BXRA 3NKLA 1N92A 4D4JA 4GPD1 2ZETA 4FGJA 4TTVA 2W2OA 4BQOA 4EO7A 4YLEA 3PXGA 3OQBA 1TW3A 4YYEA 3FUCA 3NHWA 2BBTA 5JLAA 4LE0A 3OQJA 2G7ZA 1DO0A 1TEXA 4JN6B 4JWKA 2CFTA 2JPDA 3SJAA 3MNFA 3HV2A 5M29A 4Z4QA 1PT7A 1RMYA 4P7JA 3LL7A 5DBOA 5GV8A 1KI7A 2QLMA 3F46A 5LZ5A 3GQBA 1JIUA 4G9BA 2QMHA 1VCMA 4R0VA 2UKDA 2Z1NA 1K8XB 5J4HA 4QGAA 4KGDA 4LBWA 2FWIA 2XKJE 4LV5B 2PDAA 1NVEA 5MHTA 5DTRA 1XQYA 2OD9A 5J58A 3DZFA 4HOYA 1JFVA 3WYEA 3QP9A 4EATA 1BO6A 3ZWDA 1KR2A 2HPAA 2X8JA 4HWTA 1XCBA 3CX3A 2AK2A 4QSMA 1TUBA 3LVRE 4P22A 1R6AA 1QR6A 3FTNA 1U0HC 1IG0A 2REOA 5C8DA 1EFDN 1VJ1A 1ZC3A 3QVVA 4D4LA 4KR6A 3KZNA 1FZTA 3KUCA 4U8HA 1TPZA 3HA2A 3EBLA 3UMCA 4UHJA 5JATA 2GPAA 4UHCA 2OBFA 1DJNA 2ZRQA 4FNMA 4ZPJA 4DL9A 5A5EA 3HYLA 4LX0A 2I8LA 3L9XA 2PL3A 3UJ9A 1WXHA 4C0QC 2CEKA 3KUUA 4IGFA 3GDOA 4YJ2B 3MJFA 4MYCA 1VMEA 2H6EA 1BDHA 3W4JA 4AWXA 3N2IA 4Q03A 5EYPA 1BX1A 4GX0A 4RFSA 1DV1A 4LEIA 1MJ5A 3KP1A 4TKZA 5DNVA 1YI1A 4X6LA 4BQSA 2M6RA 4V0SA 5E3IA 3VNBA 2Q0XA 4R01A 5IEJA 1BNCA 4JP3A 2XI4A 5KOJA 4F04A 3D3WB 4DVJA 5BOVA 4XEHA 4H4CA 2ZUWA 1J4AA 3O4JA 3P0RA 3M9XA 2PU5A 1JIIA 3NEAA 4BXOA 1JV2B 3ZNOA 1DQRA 1C1YA 1K7EB 2E89A 2QMUA 1S1MA 2YV5A 1P7WA 2A8YA 2FB9A 2ZRPA 3LT5A 3OLQA 4XGIA 4CM4B 1J2YA 1TRKA 2X1MA 1XMVA 3DE7X 4R1TA 4Q9KA 3VC2A 4Z51A 2YXDA 1M1YA 3K16A 1E3TA 2QRKA 1M73E 4AI6A 1GN8A 1MCZA 3C3CA 3RFUA 1PIWA 3QEJA 4D4MA 3R9XB 1O3YA 4J2HA 4NQRA 1AA6A 3V8QA 1GPLA 1W5BA 1Z74A 1UPTA 4RSGA 5BSTA 1IOVA 1KTVA 2RGAA 4HDSB 4DSAA 1OUMA 3PE4A 1XALA 4PRKA 2CBGA 1RNLA 3CC8A 5KWIA 2Q21A 1Z6AA 3IE0A 2H8KA 2PZMA 1MXHA 1OBCA 3G02A 1RJ9B 3QW2A 4R8KA 1PJ3A 4ARSA 3VR4H 4AL4A 1SN7A 3T95A 3C8UA 3TR6A 3TDNA 1L5KA 4LCJA 1JNXX 4Y6GB 1R4NB 1QS0B 2P9JA 2PKQO 4G0VA 1QPGA 5AJUA 3RC8A 1N2JA 2JRLA 5EZYA 5G3ZA 3AEQA 3IEMA 5JI2E 3IE1A 3H04A 3TZBA 2WPNA 2P4QA 2RGGA 1B0PA 2TECE 5AIAA 2WY2D 3H9BA 3SHVA 4A03A 1VLLA 2VK1A 2O0KA 3T94A 2IXTA 3JZIA 4HLCA 4NE9A 5GPBA 3WWZA 4OH7A 1EDEA 4UHEA 4BMVA 2OV8A 3N6VA 3MFYA 1D3AA 2RK6A 6YASA 2IK8A 3FTQA 2QJOA 4LHXA 4X1KA 2ZYAA 4W1SA 2I2DA 4I55A 5D6OA 1I1NA 3W5HA 5JNSA 1FFXA 4FM9A 2ZYIA 1HM5A 2PUDA 3PTLA 2O6LA 1O54A 2FPGB 2JGKA 3EHDA 3BIWA 1SD2A 2VJYA 1PQYA 1Z8FA 3KKMA 1YDFA 3A32A 2B6NA 2E4ZA 3JQCA 2XGSA 1P9NA 1EUDA 4ZO8A 1NVFA 5ENZA 2NG1A 3B2EA 3VYUB 1NYRA 4J16C 3D1LA 2HYIC 1OU4A 2VYND 5M7EA 3WYFA 3UHJA 4EHAA 2RI0A 4C7BA 3UVEA 4KYVA 3HR8A 4G0UA 2Y1LA 1AHHA 1CD5A 2GTHA 4AS3A 3PFWO 4KE8A 4TQGA 1A9RA 2WG2A 1T0UA 3CXRA 4YA6A 4ZCTA 3E3LA 4WDQA 1EIZA 3KQVA 4CEIB 3RQSA 4GE0A 5K6AC 2UYYA 4JLNA 4PC7A 1AV7A 1O5IA 1YVRA 3K9NA 1CY4A 3I8XA 2I33A 3PGLA 4RIIA 5DGXA 4DG9A 2V6JA 1ZITA 2JGEA 5DO9A 1ENYA 3H5OA 3KLNA 2CT8A 1RXWA 2HPHA 4KRGA 4J16A 2HZBA 1IQ0A 2OWDA 5DV9A 4ZT5A 3ZZNA 4Z7NB 3H1FA 3AVWA 1N3LA 1WW2A 4O4JF 3DTTA 3WV5A 3A1SA 1FQJA 1H4VB 1C50A 1Z8NA 2VP6A 1WLSA 4NMXB 4UOQA 2R0QC 4BAGA 4KKXB 5LKAA 2A9VA 2CXOA 4PYLA 1LFAA 1TVMA 2VSFA 2P5YA 4MV4A 4AY3A 4B73A 1V8BA 3HB1A 1YUMA 4DV5B 2Q99A 1Y9ZA 1HPLA 1LVGA 1M8FA 1R12A 1IDOA 2HT6A 4OHRA 4TQ9A 3BKWA 4I4NA 3BM5A 5D3MA 5ALXA 2FRDC 3D8TA 4F1WA 2NZYA 5H0IA 3CZMA 3EK2A 4IQ0A 3SVZA 1VI2A 4MDHA 4WN9A 2FU5C 5TRTA 3T5AA 1KF0A 3H2BA 4AURA 3JQ7A 2DFNA 4D41A 5AW1A 3A6ZA 1ZZEA 2GF0A 4BZQA 2Q62A 1GLNA 3AI1A 4ARUA 1YZGA 2DJIA 4CE6A 3CLHA 3L8YA 4BVBA 3CPSA 5C34B 1DSSG 2ZRHA 4EQZA 4B31A 1CQWA 4E3ZA 4PSCA 5ERYA 1P2TA 4HB0A 3JRXA 3ER8A 4X44A 3CUYA 3WLSA 3RARA 4H08A 3GP8A 2OYCA 1D0IA 1YAHA 1E4EA 1XHEA 4BNYA 1T9CA 3HKEA 1HUQA 4CETA 3RBAA 3V48A 2IP4A 3LLMA 3WC4A 2DQSA 3FETA 3MWDA 1SXPA 2C59A 1QK3A 1C41A 2C8JA 3IJ5A 4MYDA 1GITA 4MV3A 4XD2A 1T5OA 1TJNA 2PJUA 1CS4C 3EWSA 3JSAA 4UMEA 3PD1A 1H3NA 4RMNA 5DNCA 4NXNB 3EW9A 4Q4HA 1IVSA 2RGNA 1XZFA 4OOEA 5TJHA 3W34A 3VZQA 3OCJA 4DWWA 1CUXA 1ECLA 2E5LB 1VG0B 3MTQA 5CCBA 1R0SA 4ITUA 4RZ3A 4X64B 1W36D 1U6JA 2VNAA 3PR3A 2Q49A 4P98A 5J2UB 1L5NA 1XPOA 5D5PA 5YASA 2KJQA 1KFJB 2F6RA 1IXKA 3ZOKA 1JKMA 4OM8A 3OFKA 2WOJA 2BLNA 1SVSA 2ZE6A 5A5GA 5JISA 1U8XX 1NBEA 2C0QA 3E7WA 3HY4A 1A0OA 2WOOA 2CHEA 3FOAA 3OHSX 4MJ3A 4NPHA 4ZC1A 2LZ0A 4BS9A 2OXRA 3G0OA 3IAS1 3M5WA 3JZFA 3GD7A 1ZD3A 13PKA 3ZJYA 1L7VC 3CH6A 3SC6A 2WAXA 3L5KA 1AZTA 3PYXA 4GLOA 2G9VA 2GLXA 1YS6A 3BWMA 3WP0A 1NF2A 4ZQHA 3SVTA 2HF9A 3WWEA 1PZGA 3ICEA 3OE1A 3PXUA 3KZXA 4FNOA 4GMXA 2XAUA 2HEIA 3ORHA 4JNCA 3K8YA 1FTGA 1I33A 2BSQA 1PNQA 3BJEA 3UGTA 5GMOA 4MIKA 3ABZA 1ISSA 2YNMA 2DGDA 3CZ5A 2O3QA 3OT1B 4HH1A 4UTRA 1PZXA 4J4HA 4YDSA 3KFXA 4MYRA 5KJFA 5DTQA 1T2FA 1QCCA 4K6HA 3FKQA 5JJBA 1USWA 1JYEA 1L7QA 4D74A 1P1CA 1HDIA 4L7VA 3MCWA 4D9HA 4N3NA 5AM4A 1EQAA 4LDZA 3C1OA 4LN1A 2OGSA 5EZ6B 2NX2A 3VVBA 2Q5QA 4A8JB 3RKSA 3WHLA 2WI8A 1Y4ZA 2KSQA 1AF7A 1EFVB 2D0PB 4GNKA 5F7XA 2J0VA 4NYIQ 3WFJA 3T3PB 2XNKA 5AW0A 2Y2UA 4J0JA 4S1TA 2JIZD 2IU6A 5DKFA 2F1OA 1K7XB 2YVQA 2GCPA 2GETA 2W43A 3GB9A 4BOYA 1A9OA 1E7WA 2PLNA 1DZ3A 1MA0A 2DBVO 3AR9A 4A73A 2VDJA 5AW6A 3H13A 2NTNA 2XADA 3GWZA 3QVLA 1W1UA 2VHEA 1RWNA 3V4LA 5EHNA 2O7NA 1NUPA 1K7SN 3BSYA 2RAPA 3R9WA 4WBXC 4Z99A 4EI9A 1FDUA 3JQAA 1ZDMA 2ZBEA 1F8UA 1UK6A 4FN4A 4NK4A 1Q3HA 1JLRA 2IZOA 3WGUA 4DM3A 3NEJA 1BS2A 4RANA 1SQGA 2GBLC 4GBJA 4WE3A 4N0DA 3WA7A 1Q95A 2UUPA 3TVDA 5LKRA 3HU5A 1Z88A 2R7NA 3LUFA 1VHQA 2KLBA 1QCDA 2GAOA 2YUTA 3HCCA 4YEDA 4B83A 4ZOCA 4DRXB 1Q0RA 1DPGA 3HDGA 3TBHA 2VUTA 3FW1A 2VJQA 4PCAA 2V98A 2JAUA 4EM6A 2QXTA 2PQ6A 3JAWB 4I55F 2FMKA 3NYRA 1NR5A 1EP2B 2D8AA 5D3ZA 5FLEX 1SCUB 1X7ZB 4KN5A 3B3GA 3RT7A 2IYQA 2VCEA 2BFAA 3BL8A 3NB0A 2VDOB 3EEQA 4K9DA 1EFPA 3A4IA 1O6BA 3LCVB 2QTNA 4PSKA 3I09A 1YZUA 3HR7A 3RTEA 3IERA 2O3TA 1E5LA 3IC5A 4JSYA 3ZDFA 1N32B 3GPDG 4BZWA 1NDUA 3V8VA 2AMVA 1PNVA 1ID1A 1KYVA 2PZFA 4I4LA 2ID9A 5GZ1A 1YKFA 4TV9B 4CDGA 4C21A 3CG4A 1JKXA 3EC1A 2IE8A 2ZB7A 2CXSA 2C2MA 1KNXA 3KFVA 3L79A 1UMCB 4WUTA 3VTKA 5JSYA 1BTOA 2GNAA 1UPUA 3J7AC 1G4AE 2QUKA 3QLEA 2HF7A 2PD3A 4G1CA 5JAQA 2MYUA 2P5SA 3HRKA 1YQXA 4N4AA 3N5KA 4PQRA 4UTVA 3AIMA 4RDIA 2OBLA 3IHKA 4GH5A 5LFAA 4ZTBA 4Q4AB 2I5PO 1IZ7A 5ITSA 4DUYB 5FP0A 3DL7A 1FUIA 1ZNYA 2JFOA 2ZITA 1Q44A 1CJSA 4Y2GA 2C3PA 3I4LA 5B58C 1T6NA 1B23P 4D25A 4XUCA 1NLMA 2WAAA 1HFKA 1KKMA 3EOZA 3FVRA 3F4KA 3ZCQA 4ZI2A 3SM9A 4B6EA 4J6FA 3R6LA 3HSKA 3UUEA 2V7WA 1VCHA 2PTHA 2Y1FA 3FHOA 3JASA 4MRPA 4R1UA 4BX0A 4BLSA 4DARA 4JKIA 1C9MA 4YAEA 2A5GA 2G6BA 5C1DA 1K6EA 3PS9A 1XZMA 3E0QA 2W58A 4OKSA 4RTOA 3OWXA 2Q2WA 1P6XA 2D1QA 5C3UA 1H3EA 4XQ0A 4W7SA 4B7CA 4G01B 1MX3A 1RZRA 1VIMA 1QHHA 5LP6A 1GCAA 5JJLA 2NTJA 3OX2A 4L3OA 5AW9A 3RUEA 2PY6A 3ABQB 1G66A 3NVAA 2JLSA 2UUBB 2YDXA 2A1TS 5AI4A 1GM5A 1FX1A 4DXDA 2OHVA 4KUHA 5HF9A 3IQWA 1PD0A 1CVLA 1V47A 1X1SA 2AD5A 4BZPA 1SIUA 4RCYA 4ZALA 1A82A 4XM0A 3QWHA 3G79A 4JLPA 2I80A 4X1KB 5ALHA 1V8ZA 2VAWA 3EFOA 2D1SA 1M2HA 1VLMA 3E3OA 5B4UA 2FG7C 4D6YA 3C87A 2Y76A 4KPYA 2I0FA 4GF5A 5GOZA 3IAAA 4LRTB 1ULBA 1Y9JA 4OVKA 2BT4A 2DTXA 4WK2B 1AA9A 2GMWA 1UEJA 4BO8A 5CA0F 1LTQA 1EESA 4L4XA 2A4KA 3J7TA 3EQZA 3L0OA 3IR6A 4HDNA 4PGAA 4IGEA 4RSRA 3WLLA 3ZVLA 1OGIA 3I04A 4K6KA 1MAUA 1ISHA 4TRJA 4XVRA 4M1ZA 5D2CA 3CWQA 5JQGA 2HK9A 1NRIA 2PS3A 3U5TA 1IQRA 2F2TA 2X58A 3TSOA 1NI4B 5LB4A 2OM2A 3A14A 2NU8B 4FU0A 2YKGA 4L15A 1E4YA 3LCMA 1W93A 2UZ0A 2ODBA 2XVMA 4RHXA 3AHCA 1Q17A 1UP7A 3OC0A 1D9ZA 2HZ7A 3C1TA 5P21A 4B4DA 1WUJS 2J7KA 3GAAA 1YK1A 1DB3A 4GPTA 4Q3BA 4RABA 2A5DA 2ZIUB 4CLEA 2GBGA 2Q6VA 2O52A 2NXWA 2LKCA 4IP0A 4MUKA 4PLWA 3NVKI 1KDRA 3LUKA 2CE2X 1Z4QA 1DKLA 1N5RA 1ZRMA 4CHGA 1QBKC 1VRCA 3QIVA 4LECA 3U7FB 1R0ZA 4XX0A 1CQIB 3F98A 4E6PA 4C76A 2FY8A 3DOCA 4LRUA 4CGZA 3ZZ0A 1L5HB 2J48A 1EVEA 1DIHA 3S0JA 2EFYA 5GV7A 2EKBA 1NUUA 1GFZA 1CXZA 3G5LA 4EAAA 2Y9MB 2ZW9A 2A9FA 2ZWAA 1YZVA 2JD1A 2F8MA 3GDHA 3QXXA 4PIPA 5KYWA 2KQUA 4HGPA 3U9TA 4QRIA 4YAOA 3KKLA 2QX6A 2F8SA 5KVCA 3M9WA 5KREA 1IVYA 2YWEA 3ELDA 4M7RA 5CVUA 5HFAA 4P3KA 2UZ1B 4QU9A 3ZDRA 2Z3ZA 3NWJA 1QP8A 2QL6A 2JZCA 1LF5A 3U4AA 2DQKA 3ZHUA 3TG2A 5SYAA 2VJBA 4KOAA 1KU6A 2O5EA 2ZSUA 4RVFA 3KDSE 5CA1F 3MMPA 1PTJA 2FFRA 3UTDA 4MQ6A 4KNVA 3ENKA 1OYWA 1A7KA 2DUWA 2AKAB 4RHEA 3VHXA 2WTXA 2EQBA 2HHJA 3I9V6 5C18A 4MGIR 2OXEA 4YJ2A 1L4GA 2WTBA 3C3MA 3WS7A 1EVIA 3PT9A 3NORA 4R9UC 3N0TA 2FN7A 3VKHA 3GFOA 2HIHA 1LLDA 2GVZC 1N2CA 2QQFA 3A6LA 1NP7A 3QH4A 4M38A 3RVPA 1ISPA 4X90A 3TNLA 4D8WA 5KNCD 1AKNA 1XROA 2FTKE 3LRPA 1JHOA 5K01A 3N8NA 4F5YA 1CJUC 1HV8A 4JLAA 4TRMA 3EPLA 1WUTA 2GBLA 4AQDA 4DLNA 3AUKA 4BNNA 2WKSA 4EUSA 1UJNA 2YW2A 2UXBB 3B70A 3L4BC 2KWIA 1OE0A 2W5UA 4LBZA 3PQFA 3Q9NA 4LNAA 3RUPA 1XLTC 3HDJA 1KJWA 3N1UA 3SQDA 4EEKA 1UANA 5AKYA 5L3SB 5A9SA 4RTKA 1E9BA 3EGEA 1NXWA 3O1IC 3E35A 2XMDA 3KWMA 3DKIA 5C81A 1R5OA 3V7UA 5IVDA 3GK3A 4GC9A 2AEFA 3O47A 4E94A 4QD3A 1U8CB 5FO1A 4IG9A 3T34A 1LQUA 4MVWA 4MI3A 3U3DA 3ZE9A 4A8JC 2FETA 4GI3A 4BN4A 1WP4A 5EUCA 1NG9A 1XZBA 2PH5A 1DKOA 3GVHA 4KWTA 4QUEA 4BLVA 4BU0A 4EJ2A 2OA0A 2QUJA 4LMAA 1HSZA 5COBA 4NYJR 5T5QA 2ZJ4A 3ENZA 4FP9A 4YJ2F 5B1SA 2EJBA 2PS0A 1NN3A 2GXUA 2ZVQX 3PWTA 1SQFA 1GPNA 3CIFA 3D6HA 5JCZA 4EKYA 1C0IA 1JPJA 3P9KA 3PX2A 3EYWA 7YASA 2Z3VA 1HDGO 4Y7CA 5E9AA 5TMPA 3U48A 1A4XA 5CA1A 1F2DA 1U3CA 3SC2B 1SVOA 2XTZA 2O8FA 4Z9XA 2AK3A 2NZJA 2WHPA 4GO1A 5FHRA 3WLOA 4G5OA 5CVCA 4CKEA 3BXFA 2IIQA 1KYTA 3SQXA 5E6UB 2JBAA 1Z6QA 4RZUA 4AZ0A 3IBSA 2PRSA 3ZI7A 3TX6A 5KJCA 1NNI1 2RJ3A 4DLRA 9GPBA 5KTOA 3LUDA 2YNMC 3O5AA 1WS6A 1J09A 2XD4A 5HILA 3AM5A 1FNDA 4YPFA 5HF5A 4Q47A 2EWVA 2WVJA 1BGWA 4JLMA 3TIXB 2QTZA 3X1ZA 1JJ7A 1UADA 1Y7PA 1U5CA 5EXDA 3R9KA 3CCBA 4QARA 4FYPA 2ZS8A 1YCGA 4W1PA 1U0RA 2QDXA 4RVGA 1GZDA 2QPTA 3WB1A 4B79A 3RAFC 4HN2A 3VI3B 4JJIA 3VMMA 1P74A 5AJTA 1KEZA 1DJQA 1ZSYA 5JXIA 3LSTA 4J29A 5LMUB 4V1CB 4RD0A 4ZEOA 4F12A 5B64A 5SY9A 1GU7A 3NM6B 2RHGB 2ZIWB 3M4NA 3MT8A 4O0MA 4OXNA 5E6UA 1RJFA 2DLDA 3F4BA 2C2KA 2AUMA 1Z6XA 5F9FA 3ASVA 3LDGA 5BQ3A 2RHDA 3U44B 3VJLA 1GTRA 3QXCA 3R40A 2GN6A 4PO8A 1DL5A 2PZBA 5ITVA 2L18A 3UWKA 4KQHA 1RADA 2C8KA 1Y81A 3FGZA 3HLYA 3OH8A 3LVBA 4RWZA 4ZAFA 1ZVVA 2BFOA 1Y63A 2RGNC 3LPDA 4ZK2A 2BYTA 5IEBA 1HDEA 4FFSA 1ESEA 4QFBA 4IV8A 4ZT4A 5IJ0A 4MW9A 4O4HB 1U2ZA 3NNSA 4M9QA 4IFEA 4LW8A 3PE3A 2F3TA 2GBFA 1ENZA 2JGFA 4NH0A 4DCUA 3LYHA 4YUVA 3FSGD 4O1MA 4K3VA 5ALNA 3PKIA 4MKGA 3T3EA 3V7WA 4F60A 4E2WA 4F9GA 1CV2A 1LW7A 1NF9A 3LXRA 1G17A 1R6TA 4G24A 4N5DA 4RZSA 3S2YA 3MT9A 1OFUX 3WZ2A 1P6QA 1K2WA 3FUUA 2GEJA 3DFIA 3PIRA 5LZ9A 2RH5A 1RI5A 4B3BA 4EHNA 5LWHA 1V3UA 3PHLA 5EXSA 4I50F 2HKIA 1E7QA 3PNSA 2BZ1A 1IHDA 5TV2A 4D9BA 3OZCA 2MTBA 4LXIA 2FJ0A 2ZZMA 3NIDB 4S04A 3BT7A 1M0SA 1XIVA 4NDAA 2YDYA 3DE2X 2E18A 3K1JA 3KSUA 3QUQA 2EKZA 4A15A 3W8DA 1DDIA 1IHOA 1FDOA 1E60A 1X92A 4KNWA 4QAQA 1F0PA 1VLZA 3ELBA 4MDYA 4CIYA 2JLYA 3CLTC 1P77A 1YFKA 1QHXA 3T9BA 4KNYA 3K0FA 1DX6A 4BYGA 5K0SA 4C3VA 1HO3A 3DKPA 3EVAA 4UNQA 4UVIA 2IBSA 4EG8A 4EA9A 3DDWA 1HYHA 8LDHA 2HXGA 3QVGA 1XKQA 3HB9A 5HCNA 3OKCA 4R54A 3D3NA 2JCXA 4ZQIA 4P32A 4BAUA 5CG1A 4JBGA 5PNTA 1PSZA 4R7GA 2WJWA 5IF9A 2RBEA 3VVMA 2Q41A 3ER9A 1PL6A 2W11A 3GEEA 2IWRA 1P0FA 3I23A 3AM1A 2CN1A 3NDBB 4IJ5A 2Q6OA 3LK7A 4NICA 1X8KA 4AKGA 5ALQA 3PIIA 5L7WA 2W2MA 1PGOA 2AF4C 2ILTA 1XDZA 4XIYA 2NUAA 2OHHA 3WHPA 5A03A 2C98A 2X6RA 3R0VA 1DQSA 2C92A 3G85A 1DFHA 4URXR 3L6OO 1LU9A 1NJ5A 5ALLA 1LDBA 5I8ZA 1SUAA 4MV9A 4H7HA 2FSHA 4RUKA 1L5HA 5CTJA 4LAFA 3K5HA 4KQMA 2ATXA 3N2KB 4H15A 4BIIA 2UZIR 1B93A 1R9JA 2OZPA 1U9YA 1QG6A 2ZJ0A 5F12A 5HF6A 1SU8A 4ZT6A 1ONNA 3UYKA 5J2TB 1YWGO 1PJRA 4XD7A 1WDKA 2BMDA 3GFVA 4PX2A 4RIHA 4EHBA 3E9RA 5TPZA 4J7UA 3HB0A 3HXTA 4S1WA 1ZAYA 4ZXFA 2J32A 2O2GA 3DOUA 1JIXA 4XYLA 5ALIA 2I22A 4YNBA 2WD9A 5AVKA 1KYWA 4MP6A 5JJIA 1HE5A 3S8MA 4E4RA 1CCWA 2AEMA 3AFMA 3TAUA 4CTNA 1KGDA 1UMBA 4BV3A 3C1UA 5HYVA 1G38A 3QBTA 4ENUA 4ISBA 3K35A 4KSYA 4L95C 5H4HA 5IBPA 4ATNA 4F4FA 1L7RA 2PUBA 4OXQA 2PXCA 3GFTA 5EGSA 5HK9A 4JKYA 3THOA 1QFZA 4HUQA 4RA6A 2PX5A 4CF6A 2XXBA 5BRAA 1HRDA 3QFHA 2JLQA 2RFLA 3I6QA 2BCJQ 2FXIA 3CXUA 3G9UA 3KB1A 4K46A 5DI3B 1ISGA 1L7PA 3I0ZA 4EABA 3RYIA 3S81A 4ML3A 2AQHA 4RF4A 2I8CA 2P0AA 3Q72A 2NUPA 1MO6A 2YBEA 3SS7X 4IHKA 4WOPA 4TXMA 1DKRA 1OT3A 1DIBA 3CVWA 3COJA 4NU8X 2GPSA 4JUIA 3DD1A 1AD2A 4FYKA 1OXSC 3KR2A 4TSFA 4R2KA 3DWGA 4PZZA 4UNIA 3PTZA 1DKMA 3MTJA 1JWLA 1OBHA 4GWLA 4AJHA 5FA6A 1J33A 2R60A 1GQFA 5E8JA 4LNHA 1PJCA 1S89A 4WOJA 2YWFA 2IH4A 1WPGA 1SC9A 3SYMA 2A1IA 3LBNA 1Y4SA 3KPUA 3NTQA 3SHQA 1HYGA 3F1KA 4J0CA 2ZQZA 1QV6A 2R6AA 5L7TA 1OA1A 2FHPA 1BEUB 1IXZA 1CERA 1MVLA 1ZUNB 2CJPA 4MKXA 4YB8A 1K2VN 2G76A 3KJQA 3TW8A 2AN4A 1X39A 3VZSA 3ZWOA 2DUUA 1ZM2A 5HKLA 2XMQA 1L2TA 1P0IA 1UZLA 4PTLA 1WUHS 1ONOA 2A84A 3CW9A 2RK3A 1FQOA 1UKCA 1XF1A 2H1FA 2V5AA 1E66A 2ZRGA 2FSPA 2XNJA 2QORA 3CW8X 3OEED 3I53A 1IHUA 4L4ZA 3PFIA 1GNVA 1ORRA 3WKDA 1RAAA 2R7KA 4TM8A 4V3BA 2IU3A 2FOXA 4OHYA 2J9RA 2VKTA 3F78A 1IJFA 3MJRA 4ILKA 4NMMA 2XOEA 4L1KA 1J0CA 3KAJA 5JTTA 1EUYA 1L4NA 2AOWA 2IXFA 5DM1A 3HPRA 3Q3CA 4QO8A 4ZZ2A 3HZRA 4DCNA 5BN4A 4QEZA 5BR1A 1DO8A 1CR4A 1FDSA 5B57C 4Q3EA 4DBLE 1MUUA 2AS0A 2C88A 2HADA 3FE2A 1HTWA 3MIIA 3E22A 4L5JA 3R7WA 4B3GA 1QH9A 2C0CA 2J0UB 4G1VA 1ZN7A 3AWIA 4HRYA 4CUKA 2GSDA 4H3VA 1YFJA 4HUQB 1TUEA 3E5NA 3L92A 1PAUA 4FE7A 4HPWA 3OIVA 4O59O 4TV9F 5IW8A 4B40A 4BKQA 5KU1A 1N4DA 5KDOA 2X6QA 5H83A 1T5SA 1Q7BA 3PXXA 2XQFA 3DPIA 4NI5A 4DDKA 4ETMA 4WBNF 5K8IA 2QM8A 3WRXC 1U0LA 1NYQA 2BRUC 3PFFA 1BEZA 1RQGA 4I1VA 1JTVA 3AJ8A 2Y0BA 3H1GA 5FPQA 4AUKA 3SWWA 3BMCA 4XDHA 3KVYA 3ND5A 4YCSA 3JPWA 2DCUA 3RS8A 1WZ2A 3ZY4A 1N9ZA 5F1OA 3UXMA 2VZ0A 2XQJA 5JARA 4RH0A 4US1R 4IPTA 2WHXA 4YRTA 1E7MA 5A4DA 3BQMB 1XQWA 5FWAA 1V41E 4PYKA 1T4CB 3TSAA 5HQTA 2XUGA 2VHVA 3V2IA 1ZG3A 2REQB 4M22A 4BBZA 3S2FA 3IXQA 1IN7A 1NRJB 4CKWA 2BZGA 4YO8A 1PWHA 3NHPA 4OL0A 4ZT3A 2VXOA 5EQDA 1M1NB 3LX6A 2QVBA 3WLQA 1K6IA 1T4GA 1WE2A 4RGBA 4OMDA 1ZY2A 4DG5A 4ZT2A 2BP7A 2YQ5A 3OA2A 1KNQA 2GN1A 3NNNA 4DN6A 1JVNA 3BQ9A 2JIMA 3HYCA 2EFGA 3HI4A 5T4BA 4ARZB 3FYCA 3K9QO 4YDHB 4KUGA 2ODEA 4EGAA 1H2HA 3KM0A 4G84A 4Z9YA 4M76B 3TQQA 3TJMA 4F84A 1K9VF 3AM3A 3HUEA 4G8BA 3L7AA 3O26A 3PQ2A 4LRQA 4X61A 3WGVA 1NONA 3K2QA 4DPMA 5JO0A 3CQ9A 2O7RA 1LB1B 1UBKS 3MZ0A 1PD1A 1Z13A 4W8OA 3WMRA 1XCGB 1O9BA 1FMJA 1GU0A 1YQ9A 3D0RA 3EISA 2GKSA 3TRFA 4GXTA 1U3UA 3RRJA 1Z6TA 1G6Q1 4XZ3A 3R8FA 1E2MA 2OILA 3NHFA 3DZBA 1OAAA 1QIMA 1QHNA 2CCJA 3HZOA 1XP5A 5JPIA 2E4VA 2QVGA 2WLTA 4J43A 1BQEA 1OFTA 4P2BA 3KQNA 2F9MA 1DXOA 3KLBA 4TN5A 2R8XA 1R00A 4HJXA 2WU3A 4MA5A 4JIGA 5AVXA 2ZSBA 4MYHA 2ZYWX 2F55A 1TVKB 3LYAA 2PKWA 2PWBA 3RBZA 1G18A 1LS1A 5L8VA 1E2BA 3NFYA 3JYPA 3O8QA 5KTKA 2C5SA 2P2DA 2PNFA 3DHWC 3H7AA 3LHDA 4HQFA 4ZD6A 4I81A 4D6XA 1H2XA 4ZREA 3AM4A 2H9YA 3IAEA 5JXJA 4UAVA 5JNTA 3WLMA 1E0AA 4Q4CA 3ET5A 1N2XA 3BCRA 4BP8A 4K6GA 5JWRA 5ULLA 4IIYA 2CE7A 1V4NA 2HMUA 1RLIA 3RVSA 5DYNA 1VHLA 2UYOA 3G9QA 4JJ8A 5B1IA 2ZJAA 5BN3A 1O9HA 4LYHA 2BFPA 1NVBA 1YRQA 1Z62A 2Y77A 3GRUA 2YZ2A 3AY3A 3DT9A 4N12A 4M9RA 4XH9B 1ZNXA 4KX3A 3BMNA 1Y6QA 2E7ZA 4NBTA 1YQEA 5I5GA 3WGQA 4X41A 1H85A 3A9WA 1S8NA 2H7CA 1YR6A 4F9EA 1D2HA 4EMBA 2GK4A 3OKPA 1X1RA 5GY7A 1IIRA 1J2TA 4NL4H 4BDTA 1QDUA 1R9MA 1TJPB 3WIEA 4C22A 4RJTA 1T5DX 5I8WA 5F21A 4CDMA 3E1KA 3N2GB 4ZVQA 1DRWA 2R4TA 2FPOA 5FR2A 3BICA 1FOEB 1VPWA 1OJ7A 4PYNA 4X8OA 1DTSA 4RJLA 2DUMA 4MPRA 1MAHA 2I7CA 1XXLA 2I1LA 2BHSA 5IMBA 1S2IA 1YVPA 1JLLB 1Y3AA 3NBQA 1ECJA 4Q0MA 3RFCA 2R47A 3OESA 1QAOA 4ALJA 2C2BA 3NX4A 5DN9A 5EQFA 1H4SA 1XAGA 3GZNA 5TT1A 1J20A 2OO7A 3CNEA 3FNQA 3HHPA 1H9CA 4OF4A 5CDTA 2I4TA 2YC4C 2XUHA 2ODPA 1J49A 5LOVB 1XZCA 2Y2VA 1W1WA 2BHLA 2YH2A 1GNSA 2D4HA 1U1GA 4HGQA 4RSHA 2Q1UA 4GAEA 3GU3A 3ORRA 1H2EA 1XZGA 1RW4A 1PHRA 3R0ZA 4II7A 2HB6A 4PSAA 1P29A 4LJ6A 4OSEA 5LOVA 2NUTA 4M1QA 4FMBB 4NAUA 3WLJA 4O4IA 1Q1QA 4RLQA 3M83A 4CM3A 5TIIA 3KNZA 4RD1A 2V97A 4CM8B 1TCAA 2LRHA 2PD6A 3EAFA 4QGGA 2DR0A 1KY5A 2VRWA 3WWDA 3IUNA 3KRTA 4JBYA 1A7AA 1QG0A 1TT7A 1XVLA 2JHCA 1QX4A 2RMKA 3DYIA 3IRUA 3MWEB 4LS3A 2EFHB 1BCSB 1R8JA 2BFNA 2VSOA 4QPJC 2GLUA 2ODWA 3QMMA 4ZAGA 3Q3JB 3PT5A 3WBJA 5KSWB 4L4SA 3PX7A 3SKYA 5BSWA 3UCFA 1EFVA 2W70A 4AKEA 3MHTA 2XA9A 3R6WA 4QFCA 1D2AA 1V43A 1VE7A 2X15A 3GA0A 3W3AD 3R3UA 4EEXA 3IRVA 1MABA 2ZB8A 4FTWA 5FEUA 5EXXA 4MUJA 1FP4B 4ZQFA 3Q1LA 3ZDCA 2QAGC 4YUYA 1IBCA 4BO0A 4KQXA 3VPHA 4Q7KA 1AK2A 1VE3A 3CBQA 2VT3A 3IPLA 4IV5A 4ZQEA 3H1TA 5F2EA 5BN5B 3B53X 2VPIA 2EGUA 5D7NA 1Q74A 3RFFA 5ALSA 1JZSA 2VLBA 4EPWA 1PR4A 3RKRA 1R4ZA 2A9OA 3GEIA 1SIBE 1Z2PX 3KTFA 4OHFA 1DBIA 5DHSA 4Z2YA 5LP6C 2GAJA 1GNLA 1TZ2A 4HXEB 2NACA 4A8TA 3RF7A 1KRXA 4R51A 3OZTA 2XCSB 2P2LA 4N39A 3BXHA 3MPUA 3QVUA 1CEQA 3T99A 4BX9A 2R8ZA 4B3RB 3OE7A 4B43A 4DQUA 1KKUA 1JJIA 4ARAA 4HMPA 1Z28A 4MJXA 1HFEL 4UMDA 1PS9A 3OZWA 4FZ5A 3PSAA 3SSNA 5FBHA 2J46A 1LBSA 4TTAA 3SJBA 3WVNA 3HCWA 3AEXA 5HIJA 4QJIA 4L3VA 1AY0A 2WIBA 3GVXA 4C6TB 2VAPA 2Z2IA 5AOBA 3C5WP 3PDWA 4OA5A 3L41A 2R3SA 5GIPE 2QGZA 5AJYA 3MGCA 1WXGA 4AQYB 1Y7TA 1OA0A 3E82A 3K0EA 4DCOA 4OHCA 5ICMA 4XLZA 1B8NA 1S2GA 2IYSA 2R2GA 4F85A 2A0FA 1T8PA 4RKWA 3QI2A 4R2XA 1GFWA 3I9MA 3ZIDA 2ZUFA 5DX1A 1Z0AA 1DLJA 3R6GA 1K63A 3FVQA 3SAJA 5KKNB 4IR7A 4XWGA 2FSGA 2IITA 3BXOA 3R3XA 5DHQA 1PR9A 5E8RA 1Q1EA 2PSEA 3GCDA 3H65A 4JJFA 4K9SA 2C9BA 2GZ2A 1SCKA 5G1NA 3TXXA 4CLOA 4CFSA 4E3WA 5KOJB 1ZR4A 3K70C 1GOTA 1N8NA 1XQXA 2NYAA 4HC4A 4EG7A 2ON6A 1DJOA 2EZUA 2BWJA 4KV7A 2P35A 5J4LA 3DCYA 3GFPA 4HGZA 4H16A 4R1QA 5B55A 1F1JA 4KPGA 4I9GA 4BP3A 4EJMA 2V7VA 3EH2A 4F45A 4O0LA 1EK1A 1Z2CA 2WM9B 4MQLA 4DJ5X 3FPEA 1TO2E 3LPAA 1OX4B 2JGLA 3O82A 5ALGA 4UOZA 2ZRLA 2R6CA 1F14A 1L7EA 1PQUA 1JA9A 1XEXB 2V6MA 3HFJA 3IVRA 4UZSA 5CDYA 2UZ4A 2ATVA 2DY1A 1WSBA 2D3TA 4KUEA 3T9AA 1K0UA 3JQRA 3P19A 5EQTA 1BDJA 2IGTA 3LRTA 3PGMA 2Z8ZA 1JQJC 2C5GA 3AETA 4Q01A 4L8FA 3SI7A 4B85A 2WZCA 2PUTA 4OQMA 5AW3A 3QEAZ 1Q7EA 1AU9A 3K2IA 2IC5A 2VHXA 2O05A 2OCPA 3JCZA 1V3QE 2R7AA 4O2BB 4NFYA 5H16A 1RXSA 4DRYA 2X8JB 5C53B 2X41A 4BUCA 4IDBA 2DPLA 3ECAA 3FPAA 1KMQA 1WW8A 3NDPA 2G67A 2ADOA 2ZTLA 3GI1A 1WBJB 2JFYA 2OCXA 4X8MA 1F60A 1N2CE 2Q2NA 4ISCA 2B1JA 1W48A 3HLTA 3ASYA 3B6MA 3P9QA 4PO3X 3WDKA 1YB1A 2OCAA 1EBBA 1Q0QA 1RM0A 2H2IA 5BRNA 4D0NA 2QQEA 3C48A 3Q4GA 4WTOA 1XXHE 3UN1A 1BMTA 2GBIA 3ZU5A 1K86A 2C2XA 2ZLBA 3FCCA 4K9OA 3WQQA 5KU7A 2WIJA 3GEPA 1RABA 4H0CA 3W6NA 3AETB 5J2UF 1TQ6A 5BQFA 2FA9A 5E9JA 3U9LA 1HYBA 1KJYA 4AJNA 2C3UA 4K86A 4LMRA 1TLLA 4DNFA 3EFBA 2ETXA 4UARA 1ZUD1 2M6SA 1BCSA 4ZVUA 1A95A 1XTSA 3ZGOA 2VYFA 2NZ2A 2YOFA 3CONA 3N6XA 1N2GA 4RNCA 1OWOA 3M6WA 3TE6A 3V80A 2B4QA 1KC1A 5JECA 3FTPA 1UZUA 4M0MA 4XTRA 4UULA 1XNJA 3A7EA 4FHZA 4IBOA 4L28A 2BFCA 1C7JA 3UOGA 4AKSA 3OF3A 5HNKA 1NJ2A 4NFHA 1F9AA 4IWYA 3PHBE 4AG6A 2JCVA 3WLFA 5IC4A 2BE9A 3MFQA 3TAHA 1RLTA 5L6MB 1YBFA 4TV8F 4M98A 2HRCA 5KDLA 2A88A 5TF4A 5LJIA 3CLUC 1ZK2A 2SKEA 3ELUA 3G8DA 3INNA 1DRJA 1TM1E 2EZ8A 1RKVA 2A0KA 2BBSA 2CFOA 2QQ0A 1R5BA 2VJDA 3CUUA 3L6DA 3M82A 4FCTA 3TKAA 1A7UA 1J24A 5KBYA 5EEHA 4LVCA 1JF8A 2II6A 4JXXA 3K32A 4U9HS 4R2JA 3RWOA 2B7CA 1TUBB 1UFRA 1ZL2A 2IOHA 3TAXA 5FD8A 1K4MA 4ENSA 1U7OA 3WWOA 1GGJA 5A5DA 4GRDA 4HYEA 2Q5FA 3CO0S 1JDNA 2QD5A 3AONB 4YH1A 4JR2A 4ZT7A 1F2VA 4ZHQB 3WGYA 4QOHA 1N78A 1QGZA 1TFUA 2CYBA 1YQWA 3BH7A 4NCBA 1IUNA 3DS8A 1K5DA 4DA8A 5FB3A 5KNBH 1T1RA 1XU4A 3ZKWA 1UOQA 3O8RA 1GQYA 3IKMB 1QS0A 4LYAA 3RS4A 4ECEA 3WG9A 1D4OA 5CM2Z 1DS6A 4KPUB 2QP4A 4A0RA 1YIDA 4MX8A 2BGRA 2VNHA 2GEFA 2W4IA 3SX2A 1AS2A 1JGTA 4LOIA 2DHEA 1CNMA 2HJWA 4Q3KA 5CT4A 2Y05A 2RHHA 3FN4A 3DBLA 5L40A 3LP5A 3WIVA 3L6BA 1WM1A 3DNMA 3ND6A 1JAZA 4OREX 3RTCA 4HMOA 3EXFA 2W8ZA 4MR7A 3K0AB 2BKUA 3OQ6A 3DAOA 3QHPA 2WJHA 4JLBA 5KX5A 1CUYA 1ZGAA 4GOMD 4D42A 4OYYA 1UBUS 1FLDA 1J00A 1FYWA 3HDHA 4LYDA 4HS4A 3TLYA 1H6CA 1U5AA 2PEZA 2ZUSA 1D2GA 2QI9F 3HVUA 2IYTA 4RADA 3ZK9A 2WG0A 1HDCA 2W6IA 1OLXA 4OHZA 1NVVQ 2Q9CA 1OJLA 1R3DA 2QVZX 1ZJJA 3EVZA 2OSVA 2Q3FA 4MWBA 2ZWMA 2RBKA 3C8ZA 4XCXA 4EO4A 1BGVA 2ZJBA 1WDLA 1JFLA 1I3KA 2CLKB 2PAAA 4G07A 2Q3LA 4HB3A 4KXFB 2CNDA 3VDXA 5BYKA 2WNHA 2YZMA 1VKJA 1CNFA 3Q7PA 4FSDA 2ZJ7A 3KEQA 3ZYZA 4QTXA 3F49S 1W2GA 4U63A 3CLTD 4F7DA 1NZDA 2O0HA 5LQMA 4B3SB 1J25A 4JGBA 4BLOA 2WYOA 4NCJA 2XDYA 5K6TA 4AO6A 3U6BA 4A6XA 1NC1A 5TY0A 4TX1A 3LUJA 5KJEA 1SWVA 3NBUA 3OFND 4COOA 3SDSA 1BU5A 2ZP1A 3QYFA 2EQAA 3VR1A 3NTXA 3C70A 2I7DA 2CVPA 3K92A 2HF2A 4GSLA 1SBHA 1QWOA 5F5XA 5ADUS 3CNNA 4TRRA 4TLMB 4BQFA 4AQ7A 5AKKA 4OQNA 3HCAA 4C0BA 1T35A 2BUAA 3MJTA 3T38A 3C3DA 4MV5A 3MMZA 5FLXA 1WCV1 1V8PA 3DBHB 1FDIA 1U65A 4ZN6A 5C5DA 1VSVA 4V1CI 3MQ2A 3IBYA 2PE5A 4J7AA 2HA6A 4QBKA 3KZ1E 1F38A 3S70A 1XKXA 4YDRA 2KBEA 2ECOA 2OFFA 2YFYA 5H59A 5JO9A 2Z0MA 1UH5A 2QG6A 5LA6A 3WTCA 1IZ8A 2JJ1A 3IDOA 4AXXA 2O3SA 1NPYA 4LVOA 4MRMA 2E0IA 3NR2A 3ANSA 2NSHA 3PQDA 4DNQA 2FSFA 1E4VA 4HYYA 3SJCA 1UWKA 4D9FA 4KAJA 1JHXA 2D0OB 5A3QA 3L0DA 1G8KA 1GQOA 1NXQA 3UOWA 1RZUA 3Q2KA 4DKXA 1Q12A 4G1FA 1XVUA 4LOKA 3L7JA 5LNK1 1FYEA 2JI8A 5EEGA 5DGCA 1A4IA 1C80A 1H5UA 3WWPA 3ZLUA 5A3JA 3DLPX 3Q0IA 4C7OB 5H8WA 4U4AA 5HE8A 3VR4A 2CB9A 3WNQA 1N6OA 2R1UA 1DZIA 1WMSA 1ZCFA 2GD2A 1XYYA 1CDZA 2J07A 3MGAA 2DFVA 1VKHA 2HEGA 1TADA 1H9BA 3PNLA 2G9UA 4Q3NA 1KDZA 4DM7A 5CHEA 3O74A 1ZVKA 1W0CA 2VA8A 1FP7A 4QT4A 4D9NA 4HATA 5I45A 2QZZA 4RD6A 2BKAA 4UNPA 4E13A 5L3QA 1LC3A 2IBTA 3VJRA 4CTOA 2CHQA 3NANA 4W4TA 5BSMA 1TAHA 2IYLD 1XK7A 1KJQA 1NMSA 3I6ZA 1WCYA 4HMQA 1P60A 1P7CA 4I6GA 3W1EA 5C1OA 2DF8A 4UU8A 4M9ZA 2XCTB 1JLKA 1UZAA 2YX1A 1K8RA 4OOFA 4B71A 3GRZA 2HNBA 2K4MA 4WBNA 2AFHA 3GX1A 3QE0A 4DUGD 2I4LA 2Q4EA 1OZHA 5SZJA 1UM8A 4U00A 4NCNA 4Q9IA 3UA3A 5I7FA 2WT9A 4CODB 4WKBA 4AZ0B 5CIYA 4TL8A 4RACA 5EI5A 4NMWA 3DZHA 3RRFA 1F4VA 2V4ZA 2ZGVA 3CH4B 3M9LA 2PL5A 4X45A 4AYTA 3NYQA 2PKXA 4QBIA 1BN6A 3KQOA 4XD7D 1EA7A 3VNUA 3KR1A 1AMNA 3W5AA 1H6AA 2QR2A 2HLHA 4QLOA 4X3PA 3UAWA 1S02A 3GOHA 1X7YA 3GAZA 3CWCA 3KDPA 3R3WA 4TMYA 1U8EA 2IYWA 3S40A 3H1PA 4WZAB 3F2IA 1GL9B 3W5CA 3O3NB 4M1TA 1N1DA 3NAMA 4XWKA 3Q8LA 4HD8A 1GSIA 5G53C 5DBEX 2BCEA 3JSXA 2ZUTA 2IIVA 1ZD2P 1ZNQO 3AI7A 1W96A 3ZWKA 5LN1A 3L6UA 4LNUA 2DECA 2MSDB 4C06A 4G0OA 1IOLA 2ECPA 4DY4A 3NCHA 4MYTA 4IHJF 5FOUA 1H6BA 1ORDA 3NVDA 3PQ3A 2Q0QA 3KC2A 4NECA 2RGXA 2V6GA 4X1OA 4HDQB 4OV6B 5EJAA 1XD8A 3K0FB 3QE4A 4ZO9A 1V1JA 2O3JA 4JYZA 1X0XA 2AX4A 4KWIA 4PHTA 3GPLA 2YCBA 4AWAA 3KV1A 1IBRA 1R66A 1U9JA 3AI2A 3BXXA 5TS2A 5JBQA 5LPNA 1MB2A 2E4UA 2NO0A 3BIOA 4X93A 5J2TF 3TQTA 4EY7A 1D7AA 3GCGA 5REQA 4F8EA 4XPIA 1Y1SA 4EQ6B 2GZ3A 3DBIA 2OV3A 3NTVA 4PCUA 2A59A 2B2XA 4B74A 3RTAA 1UMBB 2Y66A 4R1LA 2FUG6 1QFSA 3A4MA 4P4UA 3ZNNA 1JB1A 3NAGA 2XSZA 1HOTA 1F1BA 4WZBB 3WNCA 3LYUA 1JDVA 1R27A 4GM1A 3OJOA 5FNZA 2O1EA 1FLVA 2ZR0A 1HWYA 5K03A 2ZE8A 1N8SA 2I76A 2BBWA 1LX7A 3I92A 3HABA 1E59A 4NZZA 2X19A 1WLYA 5FA5A 4FMDB 3RI3A 2B5VA 1JA1A 4Y9SA 1WA5A 5JJKA 3KT6A 3PL5A 3SP1A 3GLFE 2NYUA 5CXQA 2ZIVB 2JC3A 4KVGA 1J22A 3QPCA 4X54A 4WESA 2H4XA 4XPZA 3VM6A 2OHJA 1MLDA 4G4SO 4HNSA 4OJTA 1KFEB 1PU2A 5EIWA 1ULSA 3L7LA 2Q0SA 2P4UA 3D4OA 3D8SA 4QELA 1JPUA 3SOZA 3WYNA 4EPXA 4HY3A 1FFBA 3CF4G 1P7VA 3P5SA 3D7RA 4RXTA 4OGFA 1I3OA 4IMRA 1BA3A 2CC2A 1CDDA 2EAUA 1EE9A 3H19A 4H7PA 5JCXA 2BEUA 1R88A 1BRMA 2QK4A 4OFWA 1ZAKA 2O1XA 3G7UA 3KALA 4P86A 3MB5A 5AHKA 5SZKB 1MFPA 1X19A 4X1IB 3A7DA 4MINA 4RF5A 4R9NA 2ZYTX 3A2LA 3ND8A 1BXGB 4JVOA 5AESA 2VYVD 3I1JA 1XZ8A 4FDVA 2NYRA 3GFGA 3C3BA 4IIFA 4KN9S 5DH9A 1QGYA 4G8JA 4MI1A 3NPAA 2P67A 4U8GA 1HY3A 3STXA 2PVPA 4D4KA 4IIBA 4QUDA 2UYGA 1J8FA 3PNVA 3ODPA 3ZK8A 4BGIA 4DQDA 1SUPA 2AC4A 2ZYDA 1L7XA 1I2CA 5AUPB 4YIHA 2HSEA 3LUGA 1LVHA 1JDBB 4K5QA 4X94A 1U4NA 1PL0A 4IJUA 2XZPA 4KQWA 1X94A 5KOYA 2HA2A 1LFDB 2GJ4A 2ZVPX 3OX1A 4K0KB 3FLEA 3AHFA 1KGSA 1ND5A 3OLVA 4FKZA 1NBAA 2OG1A 1HBJA 4PZLA 4UAGA 3G7NA 5C31A 1DAOA 5FTNA 4J49A 1T10A 1WSWA 1T13A 2GD1O 2ZJ8A 3HVIA 3ZV7A 5EHQA 2FMIA 3KU1A 4M9UA 4PX5A 1GUYA 1T4BA 1WDWB 2G80A 1UP4A 2CNBA 2I6XA 4KSCA 3OEHA 2PUAA 3FNFA 2EJTA 3ONVA 3AH8A 4CEJA 4G0WA 3IOBA 3AFOA 1P0PA 5E2AA 5H9VA 3VAYA 1RCFA 1MC4A 3KVRA 4LK3A 1NN0A 3I6MA 3DEIA 3IQIX 4JT4A 1VMIA 3FWHA 3MRXA 1EXNA 3FR8A 3A4TA 1YCHA 1R4AA 2EW1A 2R65A 3BE6A 4ZEWA 3IPAA 2Q3MA 3FUXA 3O6VA 1SOAA 3ZS8A 2HJ9A 1BXRB 2YWHA 4C7XA 1G59A 3FZQA 3N2KA 3HCNA 1ETUA 1R64A 3E18A 3DVAB 4GE3A 4PC1A 5CLQA 2O1SA 3C4VA 4I5DA 4Q3DA 2B1IA 4FCCA 4X7MA 2Q28A 2AZXA 4OL9A 2VT7A 4GP6A 3D5QA 1G5QA 4M8LA 3N39C 1I7PA 1W4LA 1KBZA 3HCDA 1PQWA 1UXGA 2GILA 4AMZA 5TGTA 2NZUG 1QORA 3SE0A 3DWFA 4OMUA 1Q84A 3GH3A 1WL8A 3RU9A 5DGDA 3AVQA 2VUUA 1AS3A 1SXJC 2J45A 4RVHA 1U9IC 1FU8A 1YMUA 3GF4A 3OO1A 1NJSA 2QSUA 4HS9A 3V8BA 3QJ5A 1OCEA 3ADOA 4F91B 1N0HA 4YRRA 5JCOA 1A1SA 1LZKA 4HFJA 4CFYA 2H1IA 4FDMA 2IS4A 2XJ4A 3TLKA 1HRKA 1KSHA 4HTAA 3E58A 2IV2X 3F1LA 2QAGA 1U0FA 4Y9UA 3OIWA 3FCAA 4KTTE 2IY7A 3ZHQA 3PHGA 3TTUA 1E1QD 1EVJA 2H59A 4K87A 4O2AB 1UINA 1GPWB 1MV8A 2D1YA 3UFXB 1M75A 2H16A 2RHCA 1WKVA 3KT3A 2X8LA 1K92A 3HADA 5FL7A 3MUEA 2BJVA 3JTMA 1M1NA 4Q48A 3IT3A 5JS8A 4D56A 2CL6X 3STUA 1X7WA 2YVLA 2OD7A 4BJ3A 1X86B 4CEJB 2NPFA 1M74A 3U13A 2AN9A 2WWFA 4DA9A 1HE1C 5CLHA 3CEJA 5K09A 1AUPA 1MH1A 1XJQA 1NSYA 2C2GA 2HSZA 2J85A 2R87A 2ZQYA 3DFUA 3A6FA 3Q1KA 2FEWB 4JEUA 4O02B 3AUAA 3TEJA 2PXXA 4D9GA 3HE3A 1OX5A 1S01A 1JG3A 1MRZA 2X9LA 3L93A 3HP1A 4IIDA 4DQXA 2JGIA 3PXCX 4D4GA 1HT1E 3HKCB 3KO8A 1MAWA 4LWOA 4UM9D 2X77A 3DBHA 4TL9A 5KYVA 5JY6A 5EJEA 5HZMA 1XCOA 2I3AA 1QQ7A 5HGJA 2N42A 4UAUA 4JYAB 3AVXA 1V1RB 3I6BA 4OI2A 3KBBA 3TLBA 5AD1A 2H7YA 2YMLA 3GYBA 3QY0A 4KN8A 1T25A 2DKOA 3EYAA 3FAZA 5C3MA 2X2OA 2CLCX 3VX4A 4DR2B 3IQGX 2CXNA 2MSCB 2I4NA 3M3HA 1CFJA 3N2YA 3NQ41 3PD0A 4FQ5A 4Y2TA 3VH1A 5AFSA 3U3KA 2QMYA 4D8UA 3FMOB 3EIUA 4DSZA 3SX0A 3TG8A 2ZSAA 1XWWA 5IUJC 1EK6A 5DYWA 2QTTA 5I7SA 2IXDA 3ZBTA 5F7ZA 3HJBA 4TS3A 1JG6A 4O1IA 2PX4A 4FEEA 3NM5A 4F7WA 1FJ2A 2VRCA 1TZKA 1XU9A 1NLYA 1S2DA 4Q9HA 4DIUA 1COWA 4RV4A 1S96A 3KYDB 1I5RA 1WX1A 1VE5A 1Z7GA 1HOXA 4GL4A 2J5KA 2XQVA 1M2EA 1QNLA 1W0JA 2ID4A 2VJNA 2WTEA 2I6SA 3PA6A 4P92A 3FPHA 1TDJA 2DZDA 3W3AA 4NEHB 3OBIA 1I51A 1HLFA 1L8AA 3OPYB 3SYRA 2JFZA 2ZATA 4E70A 1FFEA 1VJTA 2WWIA 1XA3A 1MO5A 3L05A 5GZ6A 3EIOA 4AF8A 4BC0A 2YIDA 2OQIA 5AQEA 4OHMA 3K4QA 2JIDA 1W30A 3WLIA 3ME5A 1MR3F 5LZ4A 2DP4E 3QLVA 3RIGA 4KFCA 1N2BA 2VDVE 3LUHA 2QW1A 4EB0A 5G4KA 5M34A 4NR0A 4WV3A 1X2EA 4OYHA 5C37A 4IM7A 1USKA 3HU3A 1WY7A 3K9BA 4JLUA 4PX9A 5K8CA 3UANA 3HSYA 4YP6A 4PR3A 5JAPA 2BMAA 2FPKA 1DMRA 2XMRA 3RRXA 1S3IA 4F4CA 1I7SB 2V7QD 2GAFA 5C80A 3UV3A 3T9DA 2RGCA 2WJGA 1NT4A 4EFKA 4UFNA 4RNDB 1VDMA 3GJXC 2VDRB 2HTFA 1GVNB 3HKCA 1N9GB 1JEYB 1QP0A 5LYYA 3K30A 4MLDA 4JBIA 1GCUA 1SQ5A 4ZMSA 4JL6A 4YASA 1PQ4A 1T0IA 1JQLB 2O3UA 1Q0SA 3JX9A 4AP9A 4Z4FA 3WRWA 1E3LA 1O8BA 1SUFA 1E99A 1M5RA 1U63A 4XLTA 4P83A 2CW5A 3QY9A 2W42A 5EL0A 4YRJA 1JKJA 5B1EA 3FGPA 3ETHA 4MUMA 4Q4JA 3I64A 2RC6A 3JQFA 1RDFA 2V8BA 5FPTA 1QR2A 4U2KA 4C4PA 5IKMA 4NG5A 1P5RA 3K9LA 4R5MA 3OQIA 3UK6A 2Q4OA 4I66A 5EHXA 1G5PA 5JTUA 2BKVA 2YHAA 2AZ4A 3MSXA 3B60A 3BILA 4NBSA 1G6KA 1QVZA 5AR1A 3VNAA 3ZH9B 1QG2A 4DWOA 1TXGA 2DG2A 2D0IA 2JKVA 1UQUA 3NHKA 4WK6A 4ZC8A 1Q7TA 2HIGA 1KK1A 3RSSA 3SS9X 2OXTA 3UAYA 4CI0B 2EJCA 4US0R 3BUSA 3O9ZA 4LYJA 2QVCA 1KE2A 3T5GA 1K5PA 5LXTA 4JI5B 4WFQA 2DM6A 3F7MA 4WLNA 4CKZA 4V1CA 1H69A 4I4TA 4ZOLA 1J39A 3V1UA 4W5TA 1R0RE 5FTJA 2DJ5A 4O5OA 2MWMA 1TC1A 4C05A 3UK1A 5HDQA 1M8KA 1NM5C 2X86A 3NIFB 2INGX 4RY9A 1KO1A 4UE6A 4F8YA 1H8HA 1SK8A 4GIBA 1B1CA 5A05A 1TF7A 3PXAA 4G85A 3WP1B 4CLHA 4WKGA 5BUCA 1E1CA 2G5TA 2VWPA 4LJ4A 4A10A 5DYIA 2P5TB 4F3NA 5LUBA 1YZFA 1L4FA 1JIVA 2A0WA 4PR0A 1SU6A 3RB8A 4ERNA 4QBFA 2JLBA 3MLAA 3LCJA 2QP3A 3K4PA 4L72A 1I4LD 5I9MA 2WFZA 3EDOA 4L8WB 3QA9A 5I4KA 1TYEB 4PG4A 2HQ1A 2C1EA 4CFZA 1F2UB 2VPWA 1KAEA 2PSJA 3IMCA 2WA1A 2ISSD 1PDOA 3D7NA 2TMDA 1W7AA 2WYUA 1MMFB 3W5BA 4X6XA 5CLIA 4CV0A 3K71B 3CISA 1XL1A 1F5SA 3CUEF 4UHFA 3ELYA 3MCUA 4NULA 3OQVA 3ZWYA 2FG6C 2XVAA 4HWGA 4INJA 1RM3A 3JQEA 4CKBB 2GYVA 4EZEA 2QX8A 3G5MA 1GDHA 1P1FA 1ZZGA 2QSJA 2WUGA 1E2PA 3QA3E 4V0MA 1C8LA 1YJ8A 4P0TA 3PRYA 2ZSKA 1DCKA 2AE2A 4BKOA 2G08A 5B1DA 2QN7A 3UUWA 3H9QA 4E32A 1ORIA 1XA4A 4HP8A 4S1NA 4YMTA 3G2NA 4OATA 5DX8A 1NPTO 4OSPA 5L3SA 2A78A 3PVSA 1P5FA 2AFRA 4LXXA 2WLSA 2AEEA 3H2SA 4L16A 5FPSA 4ZVRA 2HWYA 3HYNA 4HEHA 4I50B 2GK3A 3MOSA 5I9NA 4ZU6X 1LDYA 4ZARA 1J7JA 4BCBA 3FB4A 1AQUA 1XO1A 3C5VA 5E3HA 2UZ1A 3WXMA 4YDQA 4DMLA 2YWDA 1RVV1 3VOBA 4I2NA 1BWPA 4JENA 4RL4A 4TL6A 1FUYB 1WZCA 3UW1A 1HTBA 4PPNA 4TT3A 3WLAA 3G9XA 5C46F 3K0SA 4JYPA 5AK4A 2B2NA 1TD1A 5EJ9A 1ZINA 1K7YA 3ND7A 4NCXA 5FRDA 1KI4A 4INAA 4KE9A 4KB5A 2QSZA 5IWAB 5GJBA 2Z98A 2CWDA 1O94A 2HU2A 3NTRA 5FFMA 4EEZA 2HLDD 5B6JA 4BFYA 3H5LA 2ZJ3A 4NNPA 1QYRA 2J0EA 4FZJA 1CZRA 1PG0A 3PQ8A 5EIBC 5FUXA 3I2IA 5AKZA 4R81A 3KJZA 4KLAA 1EJBA 3NRBA 2YHSA 4ACAA 1SKYE 1KVUA 3I3SR 2JBWA 4WHMA 3DHYA 2J31A 2F1HA 1IE3A 2WZDA 3KXKA 1FXSA 4RIEA 1UFKA 5F52A 1BFDA 2Q6KA 3B38A 2Q6LA 3L7DA 3MELA 2O5RA 1H2RS 1RBZA 1KTIA 2XCIA 3RF6A 4B3DA 1T8YA 3A1WA 2IJGX 2WJVA 4WVFA 1F9EA 3OLWA 2H57A 3H5AA 1LCIA 3QVKA 4OQYA 1V26A 2AN3A 1JAHA 1YBVA 1VPDA 3DDNA 3K8OE 2X5OA 4FLEA 4DANA 5IK2D 1E2JA 1NTRA 2C04A 3R5SA 4KDFA 4Q4AA 3V00A 4GI5A 4N7BA 1X42A 3K6JA 2O2HA 1YA4A 4MNTA 3WL5A 1MPXA 2VSXA 4POOA 4YRKA 5LMNB 1K6XA 3PSHA 2AKYA 3ZZTA 3O3CA 3H4TA 5THQA 1KIMA 2N0SA 3JATA 4ZZIA 3OMWA 4P4LA 2EZTA 4X62B 3I28A 3SFVA 1Z4OA 2Q1YA 1GFIA 1M1YB 3IVMA 2D2EA 2Q2OA 4UDNA 3ZXYA 1DUSA 3ZWQA 4F6RB 5U9CA 1GRNA 2CK3A 1K7FB 3FWPA