5J23A

Crystal structure of nadph-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with 2'-phospho-adp-ribose
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
318
structure length
318
Chain Sequence
RPRILVPGKINPRVLERLPEMFETVRIERADAALVTADMRDVSGIAVSGKLPVPLMDAFPSLEIVANFGVGYDGVDVSRAAARGIVVTNTPDVLTEEVADTAIGLLLNTLRLLPQAEQWLRQGRWVREGAFPLSPLSLRGRTVGLFGLGRIGLAIARRLEAFGVSIAYHTRTPREGLGFTYHPTLVGMAEAVDTLIVIVPGTASTLKAVNADVLSALGPKGVLINVGRGSTVDEAALVTALQNGTIAGAGLDVFENEPNVPEALLSFPNVSLLPHVASASVVTRNAMSDLVVDNLKAWFSTGEALTPVAETPFRRRAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-hydroxyacid dehydrogenase
publication title Structural, Biochemical, and Evolutionary Characterizations of Glyoxylate/Hydroxypyruvate Reductases Show Their Division into Two Distinct Subfamilies.
pubmed doi rcsb
source organism Rhizobium meliloti (strain 1021)
molecule tags Oxidoreductase
total genus 101
structure length 318
sequence length 318
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5j23A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5j23A01
3EW7A 4BKUA 3BXXA 2GRAA 1W8DA 1NR7A 4QT0A 3V2UA 4BO5A 3PP8A 4CMAA 1KVRA 1LQUA 5DULA 4OYRA 3GGGA 1P1JA 1OAAA 5ICSA 2O23A 4YCAA 3OEWA 3RFTA 2Y1EA 1DFGA 4YJHA 4CM5A 5KTKA 1AN9A 1FDWA 2FOIA 3MCVA 5KKAA 4BMVA 1TT7A 1R0LA 3TFQA 4D44A 3LC1O 4CM9D 3CXRA 2HMWA 1ADBA 4RLSA 1SNYA 4D3FA 4NHEA 4BGEA 3AOGA 4ONEA 4J4BA 5KJ1A 1AUPA 1KVTA 3ZV6A 4FD3A 5G2OA 3EY4A 3VDQA 1GD1O 2Q99A 2GUGA 1I36A 2JJYA 4L74A 1AXGA 1I2BA 4TKLA 1ZXLA 1ZEMA 4OQZA 5I7EA 1T2CA 4CR6A 5HTOA 3LF2A 4MIOA 3Q1LA 4O0LA 1OOEA 1U9JA 3WG9A 2DUUA 1TLTA 2E37A 3F9IA 3FPCA 4FW8A 3CSDA 4PG7A 1EUCA 2IXAA 5F5LA 1MFPA 1JAYA 2BGLA 4NNJA 3UAGA 3DHEA 1V6AA 4OIMA 5G0WA 3VZSA 3LQFA 1ZFNA 4C7JA 4FOSA 3LT4A 1FMCA 2FY8A 1V9LA 2VRBA 3KB6A 4IPTA 4S3MA 1DSSG 2HCTA 4WNCA 1FDVA 3FPLA 3K31A 2HK8A 2FP4A 4PLCA 4UUMA 1B2LA 3ZWCA 1E3SA 3KYDB 4CJXA 3JYOA 3QJ5A 1ISIA 3QVSA 4KDEA 4IJKA 3C7CB 3VKVA 3OHSX 3PI7A 4D0RA 2CF6A 2IZZA 3QSGA 1IULA 2PKQO 1IUKA 2WE8A 5ENVA 3A9WA 1M66A 4JK3A 3QWBA 5KJCA 4WLVA 4CM9A 2X23A 2JCXA 2PFGA 1PL7A 2EERA 4ALNA 4W9NC 2BHLA 1QLJA 1ZBQA 3PDUA 1DHTA 1NWCA 1EDZA 1XQ1A 1GZ3A 2SCUA 5I9NA 4O6VA 1U4SA 4IJWA 2P2SA 4JX8A 2PGDA 3IKTA 3K9QO 2WM3A 3K92A 4PG6A 4FR5A 4GVXA 4BO9A 3DZKA 2O7QA 4XDYA 5JFOA 3OM9A 5EJ2A 5C37A 3KYDA 4XB2A 4WLUA 3RWBA 5IZCC 1PZFA 3QHAA 2PGJA 3MTGA 1ADCA 4JP2A 4OMUA 4JBHA 4K1LA 3RUDA 1E3LA 4HADA 4ND2A 3K2BA 4BS9A 1Y5RA 4I5FA 4WGGA 3JCZA 5EQFA 3D7LA 3P2YA 4J1QA 4PLWA 3NRCA 3V2GA 4DMMA 4DMLA 4DWVA 1IZ9A 1VJ1A 2NU8A 2NACA 1JKFA 1Q0QA 1RM3A 1N92A 4J0EA 2NUAA 3WJAA 4Q3BA 1GV1A 4MIEA 4RQUA 4TRJA 2XXJA 3JQ6A 5IAAA 4AICA 1GV0A 1TB4A 1JWAB 3KSDO 2G1UA 3K6JA 5JMPA 3ZU4A 2DBVO 3NEPX 3NGXA 4WPGA 3U4DA 1I10A 4MKZA 2X86A 5IFLA 1JAXA 3DOOA 3W4KA 5HBRA 1XA0A 5JY6A 5K6AA 4GBJA 1HYGA 3RBXA 1QORA 5KVCA 1SCUA 2PTGA 2YUTA 3DBLB 3JQFA 5K9ZA 2NV6A 2GASA 5JYEA 4E5PA 1PWZA 3GGOA 4I5EA 5A04A 2C29D 2FPPA 1Y8QB 4R01A 2I5PO 3C1TA 4Z6KA 1XSEA 1O5IA 4IMRA 4CMEA 1A27A 4MJLA 4AJ4A 3JD3A 3UUWA 2ZQZA 4XQ9A 5CG1A 5HS6A 3PLRA 4TQGA 4IGEA 1ZSVA 3EZLA 4XCVA 3CUKA 4E12A 4N5LA 2Y68A 4QX6A 4YPOA 1ZMOA 4TSKA 4LISA 1ZSNA 4U7WA 4R5MA 5AOVA 3TJRA 4XD2A 5G4LA 1ZSYA 4B4OA 1YO6A 1JWBB 5F1KA 2A4KA 3U5TA 1B8UA 2CSUA 3R3JA 3AOEA 1VL0A 3DBLA 4HY3A 5KJEA 4BUCA 2HK7A 1H9BA 4M86A 4XGKA 1PR3A 2GN9A 4HP8A 4BNXA 1NBOA 1XCBA 2DPGA 3INGA 4BO2A 4R68A 3W1VA 1Y8QA 1LDGA 4O59O 3L4SO 2IEDA 5TS3A 2NM0A 1NM5A 1H6BA 3EGOA 4AJNA 3H5AA 1S6YA 3H9GA 1MLDA 1QKIA 1I2ZA 2RHRA 3LSYA 2AE1A 1IY8A 1PEDA 2ZYDA 2NVBA 4OOEA 4KUEA 1LBEA 2ZATA 4D46A 1J4AA 4TWRA 4EUEA 4K28A 1LDBA 1U1IA 5G0VA 4DL9A 1PJQA 2R6JA 3S2EA 3KXDA 1YB1A 3H9QA 4YA6A 4Y98A 1P31A 1B16A 1UXHA 4UEOA 4BGUA 3EUWA 3QRWA 1I0ZA 5AXAA 3OETA 4N7RA 4XEHA 5KJFA 1JA9A 4CM3A 2EP7A 3G17A 2IYOA 4FFOA 3QWAA 2I67A 1JVSA 2HQ1A 3DAPA 3QP9A 3OMLA 3DB2A 3GFGA 1UDAA 5H82A 2Q50A 5H81A 1GEGA 3NGLA 1GL3A 5C7OO 2G0TA 1P1FA 3DOJA 4BVAA 3SJUA 1NPTO 2JFHA 2HKIA 4FFMA 4NIMA 3FHLA 4GKVA 4XKJA 4HFJA 1PJ4A 4LRSB 3A06A 3HFGA 1J5PA 1VLLA 3GVIA 1NASA 4ZJUA 3LYLA 1FDSA 3ENNA 3PGJA 4LMPA 4N5MA 3RROA 2UAGA 1QV7A 4L0QA 3NT4A 1PQUA 3V1TC 2Q3EA 4YXFA 1NXQA 2XPCA 3N74A 4GI2A 4J6FA 4BIIA 4K6FA 3B20A 1YS4A 4H7PA 4RF5A 3S2GA 3EK2A 3GG9A 3ZI0A 3ZWMA 5TT0A 4BNUA 4IDAA 4D42A 3C8MA 2JL1A 3T7EA 2B5WA 2X22A 3RBZA 1QMGA 3V2HA 4DQUA 2B83A 1GPJA 4GH5A 4MVJA 4Q3EA 4BNNA 2OUIA 1EK5A 3MJ4A 1LA2A 4KP7A 2CUKA 1YH3A 1XKQA 2POQX 3DOCA 3GDOA 3S2FA 1P3DA 2D5CA 3RC7A 2W98A 4D3DA 2HMTA 4EITA 1N5DA 4EJ0A 3T7CA 3K8ZA 4GGPA 5KWEA 3H2SA 3JQDA 3PLNA 2P5UA 2J5QA 4MKRA 4DBZA 2EHDA 2CVQA 5A3VA 1PS9A 2CNBA 1R15A 3VVCA 1QYDA 3PHIA 4R3WA 4CV2A 4OGWA 3KOUA 1UAYA 1VJ0A 3L9XA 4RPGA 4CM7A 4EI2A 5T57A 2NADA 4LCEA 4MP8A 1FJHA 2D5AA 1WPQA 2BFPA 1HXHA 2J3IA 4J0FA 3JYLA 3GN1A 4BNFA 5JAIA 1TA4A 5JDIC 3IAHA 2O3JA 4IQ8A 3DQPA 1EMDA 3S8MA 1O6ZA 4OSPA 1SC6A 4I08A 1WAMA 3ZWYA 1PGOA 3HADA 1QP8A 2B37A 1EFLA 3VDRA 3ZNPA 9LDTA 3FR7A 5GZ6A 3Q2KA 4KQWA 1ZK4A 1RM4A 4XQCA 4CV1A 2J5RA 1LRKA 4OH1A 5I7VA 2HJRA 3UFXA 3OA0A 3DMTA 3FWNA 1HDOA 3PK0A 2BMAA 1GYPA 2R00C 1MB4A 3QVTA 3WGHA 2NTJA 1ADGA 3DL2A 3ONDA 4KTVE 1KOLA 3VC7A 3HDHA 4TMFA 1MGOA 2HK9A 4R1UA 4BV8A 1LC0A 2WYVA 3RKRA 3VZPA 2PGLA 4BKQA 3UOGA 4QECA 4C4OA 5BQFA 4XRRA 2WTBA 1VSVA 2V6MA 2OOSA 1B14A 4GKBA 3ICCA 5TSDA 3F46A 1CIVA 4JQCA 3K2EA 3M6IA 5JAMA 4XGNA 3MTJA 5DBFA 3ON5A 4BNVA 3GOHA 3JYPA 1UZNA 1C1DB 3Q6IA 3PRJA 2D1YA 4WOJA 1OBFO 3RSHA 1DRWA 1H94A 4RORA 4FPXA 1V3TA 4UULA 1YB5A 2A9FA 1ENOA 1T1RA 2EKPA 1V3UA 4JROA 3PYXA 4P4GA 3E9MA 1WXDA 4WLOA 2EJVA 3D1LA 4OKIA 4WLFA 4EDFA 1VKOA 1T2EA 2CF5A 3KHUA 3F5QA 5TF4A 1O94A 2W90A 4LVUA 5T8KC 2WEKA 2P4QA 1U3TA 2VYVD 4Q3NA 2G76A 4BNJA 1HWYA 1M2WA 3B1KA 1AE1A 4RPKA 2VHXA 1CYDA 4K26A 2OXIA 1GZ4A 2NQTA 4MVJG 1ZK0A 4IJUA 5L7YA 4Z0PA 2PWZA 2Y0CA 3HB5X 2IEBA 3ZWPA 1N1EA 1GY8A 2BELA 3PVZA 3BA1A 5EINA 3GHHA 1UJMA 3WXBA 3SJ7A 3GAFA 3IC5A 4K6CA 1D1SA 4W99A 2GCGA 1C1DA 5DBIA 1B8PA 4MVJI 3BMCB 4YR9A 3U09A 3AY6A 3BTOA 3G49A 5T64A 1LI4A 3LT1A 4BO0A 3H9JA 1TT5B 3AU9A 3D64A 3H9EO 3WMWA 4NBUA 2VNAA 1EUDA 2C7VA 3WYCA 2I65A 1CQJA 4NJOA 4AJKA 1R0SA 1PGQA 2X6TA 3DAGA 1NVGA 4E2WA 4CMKA 1Q7BA 3ZHBA 2Q1TA 3EYWA 4BKRA 4KMSA 1P9LA 1O8CA 1NWHA 4YQYA 2GNAA 4N5NA 1LUAA 2I6TA 4RZHA 5T6BA 3F1KA 1ZUD1 2GN8A 1R12A 4E2XA 1QYCA 4JBIA 3ADPA 4KOAA 3ADOA 1CQIA 4Y8VA 3SBOA 4ILKA 4JN6B 2YFHA 3ZNQA 5TIIA 3IL2A 4OXYA 2B69A 5JY1A 2GGSA 1NP3A 1E7YA 1PWXA 1JKJA 1HTBA 3ZV4A 3RAJA 4HKTA 3SLGA 4XR4A 4GMFA 3VPGA 2VYVA 4RVUA 4WCDA 1M6WA 2QZZA 3H5NA 3WQSB 2C7GA 1J49A 3VKUA 4BMNA 1PZEA 2C0CA 4XYGA 1EDOA 3BMCA 1A4IA 1ZK2A 2IZ0A 1TT5A 2EW8A 3BTUA 3WDSA 3GNSA 2WYWA 3OFSA 3RBVA 3IJPA 3V1YA 3MJCA 3HNPA 3ZDFA 3WOHA 3IMFA 4QSMA 2CMDA 1GYRA 4B7CA 4CUJA 2W4QA 3DWFA 1MA0A 2AE2A 1ISHA 2PZJA 3D3WB 4M54A 1KY4A 4ZU3A 2F1KA 3CMMA 3E18A 3NV9A 3ZU3A 3DEYX 1W4ZA 1LDMA 1WZEA 1U3VA 5CFZA 2YHUA 1GUFA 3ONEA 4IIUA 4R69A 1U2DA 3OJ0A 4PZEA 1T26A 3A28A 1HL3A 4OO3A 4YWJA 2GZ1A 5CDGA 3F47A 5I9LA 1HETA 1MV8A 3R3SA 4EJMA 1HSZA 4GPD1 2WWRA 4HX5A 3Q0EA 1N9GB 1OC4A 2O3RA 3JQAD 3VZRA 5A05A 2GZ2A 2X5OA 1U28A 1X0XA 3QV1A 3S55A 4HXYA 4J2HA 4W82A 4DRYA 5F21A 4UVHA 1LQTA 2VUSA 7ADHA 3F4LA 4X54A 3INTA 1DPGA 3L0DA 2E48A 4S1VA 1Y1PA 2ZK7A 3L77A 3SVTA 3GGPA 1YBMA 1CETA 3JQAB 2Q4BA 1KVSA 2PD6A 3LVFO 1FDTA 4MINA 1B3RA 4IZIA 1Z82A 3WFIA 3JD0A 4NK5A 3D3WA 1YVEI 2JD0A 3ASVA 3I6IA 1LJ8A 3F6YA 1UXIA 3NTRA 2AHRA 3GQVA 1ZH8A 4J7UA 2OP0A 3I3OA 3OIFA 1A7KA 1DO8A 4PVDA 2Y05A 4NFHA 3LT0A 3CTMA 1ONPA 1E1KA 3O8QB 3DTYA 4NBRA 4R4JA 4J9VA 1R37A 2FSVA 3TOXA 4NBVA 5CAEA 4AJJA 3KM0A 5L7TA 4M89A 4DQXA 1HE4A 1N9GA 4PLPA 5JMWA 2TMDA 3MJSA 1P45A 3AWDA 1U3UA 1YBAA 1F8GA 3HQ4O 4PG5A 3UCXA 2X9GA 4IQ0A 1DDOA 1ZO8A 1CJCA 4A03A 1DFIA 5DP2A 4ALJA 2RIRA 3JQCA 1NR1A 3OJOA 1P74A 4IUYA 4A26A 3EC7A 5THQA 1XYGA 2P9EA 2VHZA 4D3SA 1B0AA 3JQAA 3PWZA 1I3KA 2DM6A 3TZHA 2VZ9A 3O38A 4OSOA 5ITWA 1HLDA 1IOLA 2Q45A 3KEQA 1Z7BA 2O4CA 1T24A 1WLYA 1TXGA 1N7HA 1U5CA 1MXFA 4MVJH 2VHWA 1PQPA 3R1IA 4LSMA 3WTCA 1J6UA 2FPGA 1ZXBA 1U5AA 2YW9A 4ALLA 5IN4A 2VNSA 2FR8A 3BTSA 2DLDA 3JQEA 3O8QA 3WWYA 3AY3A 3ZGYA 1A9ZA 2VN8A 1I3MA 2Q2VA 5DBGA 1YQXA 4AJLA 4AJOA 5L4SA 2UUPA 5COQA 4MO2A 5FFFA 4CLOB 4KTTE 1SPXA 3KO8A 3AM5A 3ROKA 4R51A 5AYVA 1I5RA 4FFPA 1LDNA 2OHXA 4BNWA 3IS3A 5DN9A 4O63O 3TF5A 1DHRA 1UZLA 1IHYA 3A1NA 1YQDA 4IMPA 1D8AA 5L51A 2VHYA 2ZJ0A 4L75A 1RM5A 2YDXA 5KNLA 2Y1DA 2W8ZA 3GY0A 4URFA 2H9IA 2GD1O 1DIGA 1E1LA 1DIRA 4YAEA 4Z3DA 2R2GA 4E4YA 1SB8A 5BSHA 3QVWA 3BHMA 3ANLA 1GQQA 2AEJA 3DZBA 3AFNA 1M6HA 2Y0EA 1UDBA 4PLFA 4E13A 5IJZA 4NJMB 4GLLA 5CHEA 1FF9A 1KEVA 3GZNB 1PJCA 2BGKA 4D7AA 4BGIA 3ZWOA 1ADFA 1Q0LA 3OQ6A 1XELA 5L45A 1ZNQO 1O0SA 1N2SA 3D0OA 5B4TA 4WASA 1U7TA 4NFSA 3OQBA 4FGWA 2G5CA 3RUHA 1GU7A 1TI7A 2ZCVA 3VPFA 4PGFA 2Q1WA 2EKLA 4YYZA 2PD4A 3ITDA 5FI5A 3CEAA 5TJ9A 4CLOA 3E48A 4U5QA 5A5FA 4BNGA 5AXCA 5JAZA 1E7SA 1DC3A 3KUXA 1BGVA 3OIDA 4CM4B 4XYLA 1YONA 2FMUA 3HDJA 1MXHA 4L8VA 1HSOA 4DPKA 5KOIA 1IPEA 2BFOA 2PY6A 4E5MA 5BNTA 1NVTA 2AEMA 2HU2A 2Y1GA 2NTNA 3DO5A 3X2FA 2AQ8A 2FR1A 4LMRA 1GQ2A 4CODB 3FF4A 5JCJD 1OZAA 3VPXA 1U2GA 5DT9A 2ZCUA 1E7QA 4PFJA 4WLNA 2ZB4A 1EK6A 1BVUA 2PD3A 4J49A 2YV2A 3D4PA 1G1AA 5ICMA 1H5QA 2OMEA 3ITKA 4NJMA 3E03A 4CMCA 4AFNA 3GZNA 1Y9AA 1V3VA 2C5EA 3MOIA 4H16A 4UUOA 1Q0HA 3ZNNA 1U4OA 5TX7A 1HDRA 1ZVMA 4BHTA 1Y8RB 1O89A 2HMSA 1BHSA 1I3LA 2VYND 2OGUA 3DZJA 2B4RO 5BSFA 4GSLA 5JO9A 3E1KA 4WEQA 5CEFA 2Y67A 4PRKA 4A7PA 3GA0A 2J6IA 3WGQA 3L6EA 3D3EA 4OHUA 5JO0A 3I1JA 1HDGO 3VPHA 2AA3A 2B4QA 3BMQB 3NYWA 2VQ3A 3MZ0A 4FGSA 4HNHA 4NG5A 4CM4A 3W8FA 2OBYA 2LDXA 1ZZEA 3KTDA 3E5RA 2QX7A 1R6DA 2XF8A 5DP1A 4D41A 4R1SA 5BT9A 2VUUA 2V6GA 3U3XA 4BOYA 1BWSA 4E21A 1BDBA 3B1JA 2BF7A 2ZTUA 4Q3AA 3PDJA 3QWIA 4YRBA 2EKQA 4CM8B 3ZHXA 1DJNA 2Y1CA 3ORFA 4HNGA 1LNQA 4E30A 1DAPA 5JXWA 1LRJA 2YDYA 1R4MB 3LT2A 1VL8A 4B79A 2UYYA 3JQBA 1HDXA 1Y7TA 3KV3O 5H83A 5JCJA 1Y8RA 1F0YA 4ZGWA 1ENZA 3TZKA 4J4TA 4OJNA 2B5VA 3S2IA 1SZJG 3OA2A 4WOKA 2VHVA 3JQ9A 4YRAA 3NT2A 3RFVA 4GLOA 4RPJA 3I9LA 4NK4A 2QYSA 1PJBA 5DOZA 5HRUA 3BMQA 3WS7A 1X0VA 4MOWA 3NAQA 1NHGA 5KVSA 1UZMA 1YB4A 4KWHA 4QEDA 3ZHYA 2GN4A 4OM8A 2VYNA 5G4KB 5IZ4A 1SEPA 1YWGO 5L53A 1XEAA 4JGBA 3HZZA 4XJTA 3FBTA 1HKUA 3WNVA 3ZU5A 4MDHA 4UVEA 1ULUA 4XIYA 1DC6A 3UH1A 1LLQA 3GPIA 3OH8A 3PYLA 3ZWBA 4NFYA 4A0SA 7MDHA 4ZN6A 1QG6A 1NAHA 4D0SA 4J9UE 4CM8A 4WCFC 2DTEA 4RCVA 3EVTA 4AJPA 3TWOA 2DVMA 5L4NA 2D59A 1PIWA 1R4MA 1G0OA 3CE6A 1ZK1A 1ISJA 2YJZA 1IPFA 1GTMA 1YE3A 3WGYA 1E7WA 1ONOA 1V8BA 5ILOA 4E5KA 5A02A 1HDYA 2CDCA 3OP4A 1W0CA 3B6ZA 1Z75A 4J7XA 4KUGA 3PJDA 2AQKA 4II3A 3BYZA 4MIYA 1WW8A 1C1XB 3AUAA 1I01A 5KIAA 4YJFB 1HRDA 4XQEA 2IE0A 1KVQA 1VJTA 3D5QA 1X13A 4HBGA 1DRUA 2VZ8A 1SAYA 4Z9YA 4BKOA 3RD5A 5DNAA 4MVJD 4UVIA 2Q49A 2AEFA 1P1IA 2ET6A 4YACA 4GX0A 3PFWO 5LC1A 4R41A 4B3HA 1K6JA 4TZTA 1U8FO 5G4KA 3E6AA 1F12A 3MEQA 2HSDA 4IZHA 3ROMA 1SOWA 3VH3A 3L07A 2EF1A 2X1HA 3GVPA 3M2TA 3EZYA 1SO8A 1E3EA 2I99A 1V0JA 3HDQA 5ENDA 4A27A 2ZJ1A 3U4CA 2CY0A 4ITUA 4J16A 2CVZA 4OOFA 2Y99A 3MWDB 3WQQA 4JP3A 1I2CA 4XQGA 1WMBA 2YHIB 1MP0A 1P1RA 3I5MA 1NYTA 1UUFA 4INAA 5U1PA 1XGKA 4BNTA 3L6OO 1RM0A 4KWIA 1PJLA 1C1XA 1HDCA 3GVXA 4YJFA 2QHXA 5FWNA 1YDWA 4GL4A 3RIHA 1ZW1A 3ZNOA 1PGJA 5CDYA 2HDHA 3GEDA 3TSCA 3ZCXA 1IE3A 3RC2A 1YXMA 4Q9NA 4YJDA 2V65A 1D7OA 2UVDA 5I7SA 2GLXA 4F6LA 4ESOA 5I8WA 2CDAA 4CMGA 4XIJA 1KEPA 3U4IA 5JDCC 5L40A 1HEUA 1SOVA 1I24A 5DCYA 5IF3A 4ZQEA 3I83A 2BI7A 4P22A 3GMSA 4TVOA 4LCJA 4YJGB 4PLTA 4W9NA 2ZTLA 1HZJA 3IP1A 3FRJA 2FPIA 3JD1A 3TPCA 1GQYA 1VRWA 4IXTA 4PLGA 5MGBA 2WJPA 4JJGA 4NR0A 5C7IO 1LRLA 3W4JA 3L4BC 3DXFA 4IS3A 3VTFA 1PTJA 3DZFA 2PR2A 2YV3A 4H3VA 4HFRA 5CPBA 5DCWA 3RUFA 2RH4A 2YHIA 4BKPA 2D3TA 5CP8A 4LSWA 4OL9A 1M67A 3DHNA 4L4SA 3ZN2A 5IG2A 4B3JA 1LC3A 3JD4A 1PJ2A 1VM6A 1P33A 4YAIA 3TZ6A 4LW8A 1GPDG 3H4VA 1DIBA 5JBIA 1XIVA 3MWEB 5CEEA 5IZCA 1B3BA 3RFXA 1OI7A 2VRCA 1RYEA 3AU8A 4Y67A 4E0BA 2P9GA 1EFKA 3RUEA 4AVYA 1F17A 2QW8A 2E82A 3TZQA 3GZ4A 1G0NA 4RDIA 3C24A 3EAGA 3HSKA 1T25A 2PNFA 1A72A 1LDEA 2HMUA 1ML3A 4WK6A 5BSGA 4CMBA 2NLOA 2DQ4A 1KEWA 2ILTA 2Q2WA 1KC1A 4MPDA 3DTTA 4MP3A 2CZCA 1LSUA 2Y1FA 3W4IA 1BW9B 3RUCA 4FS3A 3F1LA 4YJGA 1A5ZA 1QLHA 1YOVB 3T4EA 4OAQA 3R6DA 4CM1A 2JAPA 3NDRA 2O50A 3GF4A 5CDUA 2BFAA 4MKXA 2TMGA 3K30A 1OFGA 5TLSA 1YQGA 3PYMA 1RKXA 2OORA 2D8AA 5F3RA 2HMVA 3EDMA 4J7CA 3FR8A 2AQIA 1I8TA 3ICPA 4DYVA 4CPDA 2O7SA 5A5EA 2YQ4A 3GRKA 3P2OA 2ZB8A 5F1OA 5COBA 4CQLB 4YDRA 3AW9A 1MFZA 3GK3A 4NZ9A 2PLAA 2Z1MA 4I1IA 3G3EA 3WGTA 1KEUA 3AUUA 3WB9A 4P4NA 4B8ZA 1BRMA 4AG3A 2BLLA 2X4GA 5IDQA 4Z9XA 2X9NA 4LVCA 2IRWA 2ZB7A 3GVCA 2Z1NA 3LC7O 2JFGA 5ER9A 4BV9A 2QRLA 3W6UA 2Y66A 1XU7A 1MC5A 2IXBA 1X1TA 1S7CA 2PH3A 2EJWA 3WGOA 2E49A 2NVWA 3CPSA 3VH2A 2QZ9A 3KETA 3PIDA 1OC2A 1C3VA 1HT0A 1EVIA 1KS9A 4JXKA 4N18A 4NH4A 1C0IA 4Q3CA 5AXDA 5G0SA 2I66A 4BO6A 4IQGA 4E6PA 2YQ5A 1YOVA 4M87A 4PCVA 2AXQA 1MG0A 1PGNA 4YAJA 4OQYA 2BKAA 3IUPA 4HWKA 4DPMA 2I3AA 2E6UX 2G17A 2VCYA 2C20A 3G0OA 1VE9A 1ARZA 3PIIA 3VH4A 4MVJM 4YT4A 2X0IA 2J5KA 2DFDA 2Q46A 1IB6A 4FFRA 6ADHA 1QYXA 4A5OA 1YBVA 3GR6A 3QIVA 3RJ5A 1E1NA 5U9CA 4BMSA 4RVFA 5EL0A 4CQLA 3GVHA 4TZKA 2D0IA 4GQAA 3U49A 4ALIA 1BG6A 4UEJA 3E5MA 2JHGA 2JCYA 4FC7A 1PX0A 4CUZA 3A14A 5B4VA 2AQHA 2PV7A 3I9JA 1ENPA 3OIGA 4HUJA 1NPYA 5F5NA 1P0FA 3OJFA 4QQRA 1WP4A 4BNYA 3I9KA 3PJFA 4G65A 4RVSA 4J4HA 4C7KA 1P0CA 1B15A 1N1GA 4YTEA 3UCFA 1NPDA 5C5IA 1QYWA 3ETDA 2W2KB 3WGGA 3H8VA 4IINA 4BO1A 4IGFA 2RH8A 5L9AA 5COAA 3S1LA 2V6FA 3PJGA 1JDJA 2VWHA 3V5NA 1YL7A 2X0RA 4W4TA 2DUWA 3OF2A 3WFJA 3HG7A 4CR7A 4ZHSA 1PGPA 2QIOA 3C3XA 3RJ9A 2AMFA 3ASUA 4KQXA 5BNFA 5DZSA 3I23A 4B4VA 5HM8A 2XAAA 4QFCA 1ZK3A 5B4UA 3VAZA 5ER6A 1PSDA 1ZJYA 1WDMA 3TQHA 4E2YA 1VC2A 3W8EA 4MVJP 4PG8A 8LDHA 5MDHA 3DC2A 4PRLA 3BHIA 1A7AA 2DBRA 2J3HA 4R16A 3LC2O 1AXEA 4J90A 3PQFA 2NTVA 3EMKA 4RPHA 4WECA 1A71A 1GUZA 2CVOA 2J3KA 4EW6A 2JCVA 2O48X 1E7RA 3KSUA 2BH9A 3NT5A 4CLRB 1JW9B 1HE5A 2WE7A 4YEDA 4BNKA 3KZVA 4Z9FA 2W2KA 2DBZA 5A9TA 1MX3A 1D4FA 1E6EA 5JYDA 1PR9A 3GHYA 1MC4A 4ZICA 4WEOA 5L3ZA 3JV7A 2X5JO 5B37A 3WLEA 3BHJA 3GEMA 2CFCA 1CF2O 4F46A 1JKIA 4XR9A 1L1FA 3QA9A 3G79A 4HV4A 4EUFA 1KBZA 4GX2A 2PKQP 1ENYA 1SMKA 5A9SB 1GR0A 5LCXA 4ZQFA 4R9SA 3BMOB 3FD8A 5CEJA 4CV0A 3O4RA 1ORRA 1EBFA 2DAPA 4PLVA 1NNUA 5THKA 4A10A 2FN7A 2OBNA 3RU7A 4PG4A 4TVBA 2ZKLA 4KDFA 2FZWA 4DLAA 2V6BA 1O9BA 3B70A 2PZKA 4UVDA 1JU9A 1DXYA 1NAIA 3K96A 4EEZA 1GZ6A 3AM4A 2PK3A 3A4VA 4Z0TA 4CLRA 3OBBA 1L7EA 2EGGA 4AJEA 4KUHA 3PQEA 3H7AA 3GT0A 2EGHA 1EUZA 4QXMA 3M1AA 3LDHA 3OJEA 4M1QA 1Z6ZA 4XZ3A 2UUOA 3ABIA 4E5NA 4Y6RA 3LK7A 3N58A 3NTOA 2JD1A 3GRPA 2Q1SA 5EPOA 3QLJA 3ROQA 4GX5A 3ETEA 2EP5A 1EVYA 2XXBA 1EBUA 1Z45A 5HS4A 1PS8A 3VTZA 3JQ7B 2FR0A 5A9SA 3UKOA 3ZWWA 5KVVA 3H3FA 3BMOA 1ISGA 3PEFA 5CG2A 1EZ4A 4DTIA 1VPDA 1DLJA 4IXWA 2DT5A 5JDIA 4GMGA 3CMCO 4BNHA 2Q4EA 5GY7A 2NNLD 1BVRA 1EEHA 2VWPA 4YT8A 4ZRMA 5K6AC 2P4HX 1X1EA 5JPIA 3TNLA 1UAGA 2JKVA 3GUYA 4RF3A 4N54A 3PWKA 3JQFC 1XG5A 5A06A 3IKVA 4M49A 4J91A 4ZVVA 3IDSA 4PLHA 1H0KA 5CDSA 2C54A 3BMNB 1DEHA 2HUNA 3AUSA 1BMDA 2R00A 2EXXA 3D4NA 4YAKA 4UUNA 2EWMA 4DIBA 5K0ZA 3CIFA 4CMEC 4CMIB 3DAFA 3U0BA 2YY7A 3ZHZA 2C2XA 1LU9A 1H93A 3KYBA 1ULSA 2GYYA 3IP3A 5EIOA 4DXHA 4E2ZA 3WQRA 4B7UA 3RVDA 4R3NA 4RQTA 1SBYA 3WGIA 4WKGA 3JQ7A 3D5TA 1PQWA 3P19A 2RCYA 3INRA 3VVBA 3HB4X 4I9UA 2Q2QA 3WR5A 4BNLA 3CH6A 4J3FA 3ZH2A 2DC1A 1IHXA 1MG5A 3PHHA 3QVOA 5JLAA 3CKYA 1UP4A 3GH3A 3OQ1A 2BD0A 3FCOA 3QW2A 3D4OA 3E9QA 4CLEA 4I5GA 2XOXA 2AG8A 2EEZA 3E82A 3BIOA 3JYNA 3PHJA 3FI9A 3OICA 4M55A 3AOEC 1LSJA 2QRJA 4XYMA 2NQ8A 2Y0DA 3IQDB 4WJZA 1UXJA 2VT2A 5I9MA 3TFOA 2H63A 1UP7A 3DZGA 4E3ZA 3FTNA 4W7HA 4CL8A 1Y81A 4XYBA 1DC4A 1Q1NA 3AI2A 2X7HA 3GG2A 3C85A 3PHGA 4IDDA 4BB5A 2X5KO 3BMNA 3IOYA 1X14A 2QQ5A 3NJ4A 4MP6A 4BQRA 5GZ1A 5T8KA 4EEXA 2EG9A 1E1MA 2C82A 2ZB3A 2ZTVA 1VL6A 5T67A 4LRTB 1JVBA 1Y5MA 2C07A 3ZWVA 5HWSA 1TVEA 4FJ1A 4LGVA 1GCOA 4R1NA 1D1TA 4CMIA 3F4BA 4DBVO 3IJRA 3L9WA 4U6SA 4H15A 3LU1A 2DFVA 1UH5A 1AHHA 3KRTA 2O3SA 4YBZA 5DF1A 4Z0HO 4JCOA 1F06A 3HHPA 4J2OA 3QE3A 4MVJF 3WIDA 2YYYA 2IZ1A 1IL0A 5IXYA 4DPLA 3ZV3A 3V8BA 1I3NA 3QVXA 4J1NA 3U9LA 1NX6A 4ND5A 4E5YA 3NKLA 3ROPA 1P1HA 3FBGA 3X2EA 3WTBA 4PZDA 2E4AA 1H6AA 5CPFA 4ZQBA 3KBOA 1KERA 3EHEA 1MUUA 4XRGA 4EYEA 2HAEA 5DCUA 3G1TA 4RJTA 1E7MA 1FXSA 2OL4A 4QO7A 5FF9A 4II2A 2GSDA 3WX0A 2GDZA 3RC1A 5IN5A 3PFFA 3RKUA 3SX2A 2O2SA 4CMHA 1NFRA 1FDUA 3JQ8B 4FJ0A 3DHYA 4XA8A 2YV1A 1PL6A 3I9OA 3RQSA 3TL3A 4OXNA 3BTVA 4W7IA 4TKMA 2GR9A 3O03A 3EVNA 1PZGA 3K73O 4RVDA 1E92A 1T2AA 2I76A 4RGBA 4ZA2A 3H9UA 1VI2A 3UGKA 4RLHA 4YQZA 1PZHA 3C7AA 4M8SA 1UDCA 1O95A 2RAFA 3JTMA 5KKCA 1UXGA 3H3JA 9LDBA 4UVGA 1D3AA 4F45A 2NVUB 4CUKA 2PH5A 3PHLA 1PS0A 1GFSA 4BO7A 3GNTA 1PL8A 5F1PA 4FOOA 3R0IA 2NU9A 1GDHA 3DBRB 1DBVO 1NTOA 4CLDA 4BQPA 5FYDA 2P91A 3FTPA 1HF3A 4I5DA 1RJWA 3WICA 1W6UA 3WYBA 2Z95A 4BO3A 4ID9A 4QUKA 4CMJA 4DC1A 1RPNA 1R4NB 4DIFA 4ND1A 4FN4A 2NU6A 4L4RA 3KSZO 2AG5A 4A73A 1SB9A 3H65A 3MOGA 1K6XA 3HE3A 3JQ8A 2J3JA 1ISFA 3WBFA 3ZWXA 3JD2A 2O2YA 4W6ZA 1JLLA 4Q39A 2I9PA 2BRUA 3UN1A 4ROSA 4XX0A 3ZU2A 4RF2A 4XDZA 1JTVA 1U7HA 3JQGB 4ALKA 4PN3A 1Z7EA 5L4LA 3DR3A 3GC6A 1A4UA 1G6KA 1I30A 1PJTA 4UUPA 1DLIA 1L7DA 4U0KA 2A92A 2GZ3A 2VOJA 3C1OA 5IDWA 3VZQA 4UEKA 3CZMA 1LEHA 2D2IA 2NVUA 4NDNE 1I33A 2B36A 4PZCA 1TEHA 2V7PA 3GFBA 4ND4A 3TOZA 4AJ2A 3F5SA 3LLSA 1H9AA 2B4TO 3WJ7A 1LSOA 1BDMA 5ADHA 2QG4A 1ZKMA 1DFHA 3DBRA 1PJSA 3PJEA 4WNIA 4IDCA 3GNQA 4FIZA 3RI3A 4AJ1A 1IYZA 3GPDG 3KEOA 3DFZA 2WD8A 1CERA 1R4NA 3ZW8A 3TL2A 4RL6A 1HYEA 4TROA 3ANMA 3LZ6A 1E5LA 1UP6A 3JSAA 4D45A 3RC9A 3Q2IA 3DMTC 1XR3A 2Z5LA 3F3SA 3JQGA 1DC5A 1Q7CA 2LDBA 5L7WA 4P4LA 4ZQHA 4J1TA 1EVJA 3JYQA 3O9ZA 3ZW9A 3HDYA 2GERA 3OECA 4DVJA 4F6CA 5JNLA 4B4UA 3WYEA 3I52A 1E5QA 1HE3A 1WDLA 2DTXA 4DGSA 5I7FA 3UHAA 2VWQA 4BO4A 1GADO 4IDEA 4NU6A 3AFMA 4B8WA 2HRBA 1SEVA 1LTHR 3KYCB 1B26A 4RZIA 2C5AA 1CRWG 3L6DA 1T4BA 1UR5A 2GF2A 5GZ3A 2Y1OA 3AM3A 1H2HA 3GEGA 4PLYA 3UF0A 3P5SA 2PA3A 4GGOA 3V1UA 3ZZNA 5TRTA 1LLDA 3UXYA 4YT2A 1E6UA 3WNQA 4GWGA 4TRRA 2G82A 2ZQYA 3AY7A 3HUDA 3ZWNA 5EMHA 3G1UA 1C0LA 3I9MA 3I4FA 3QWHA 5TJHA 2O4UX 1T2FA 2DTDA 2WMDA 5BNIA 3M1LA 3H6KA 4Q3DA 3C1AA 3I6QA 5A9RA 3ZWAA 8ADHA 4G2NA 4BNMA 3GN2A 1E3WB 3HN7A 2DU8A 1A9YA 2BFMA 4NBTA 2FWMX 5U4QA 3HFSA 4LN1A 1EE2A 1T1SA 5J23A 4JJFA 1QV6A 1Y9EA 1M75A 4GSKA 3KYCA 4O5OA 4XYEA 4IBOA 4UREA 4ALMA 4ZRNA 1NVMB 5JC1A 2BGMA 3H5RA 2B35A 4CM6A 3OSUA 2VRCD 3QQPA 4UAGA 1GAEO 2FRDA 4WE3A 4EBFA 2H6EA 4FFNA 4G81A 4OKNA 4F3YA 3AJRA 2Q1UA 3DZIA 4TRNA 4NI5A 1PU2A 1E3IA 1AHIA 1NHWA 3LLVA 1F14A 3M2PA 3GUCA 3Q9NA 4IDGA 3IUSA 4BGVA 4Y6SA 1LDYA 1C0PA 1P44A 4XJSA 1GCUA 5KJ6A 1XHLA 5CDTA 3DDNA 3PXXA 3VOSA 1FK8A 1E3WA 1YL6A 4RVGA 1ZIDA 5JC8A 4NQZA 4AJIA 3RCBA 2WD7B 5DDIP 5G0TA 4GX1A 3B1FA 1RYDA 5LDHA 4NU5A 1NQOA 4WUVA 4IDFA 1UXKA 4DIOA 1XU9A 1K89A 1Z73A 5EQDA 2DBQA 3U62A 4DREA 1LLUA 4B3IA 3CINA 4I9NA 3N7UA 1Q2XA 4D79A 4YT5A 1R16A 4G5HA 5FI3A 3TDKA 3NDJA 5B12A 4RO0A 1N8KA 1Z74A 1KY5A 3SLKA 2GPTA 2X8LA 2ZIZA 5EN4A 3AK4A 3I9NA 2EV9A 1ISMA 1NQTA 3UW3A 5BR7A 3GMDA 4R1TA 5C7LO 4RDHA 2P5YA 1I32A 4A2CA 2RHCA 1Y6JA 1XWFA 2WDZA 3FN4A 2C2YA 5HA5A 2WD7A 4JLWA 2EW2A 2X0NA 3DFUA 1H6CA 4EJ6A 4PIVA 4FQ8A 5BSEA 4BNIA 4CR8A 3RUAA 4FJ2A 2JD2A 2VTDA 2NSDA 4J1SA 5JE8A 1IZ0A 5JW6A 2O3QA 1U3WA 2OFPA 4HFNA 4BB6A 5AXBA 2ZYGA 3OEYA 2X0JA 5TGDA 4CLHA 1XQ6A 4FCCA 2B0JA 4GVLA 1KC3A 4J43A 5EESA 2AW5A 2I3GA 4FBGA 4NMHA 4YB8A 3O26A 1F8FA 3P7MA 2VWGA 4MVJE 4QTZA 2GN6A 1LX6A 3PZBA 2VOEA 2X58A 4AL4A 1NFFA 3WLFA 4WCFB 3WIEA 4LK3A 1ONNA 3STHA 4YVFA 4D43A 3NJ8A 4NBWA 4RVHA 4XGIA 2CD9A 4B7XA 3HN2A 4KZPA 2OO5A 4JBGA 4JIGA 5ILGA 4AJHA 3Q9UA 4DQVA 2BI8A 4IDBA 4IY1A 2PKRA 5B1YA 1JN0A 2UDPA 4EGFA 3IIEA 1QYVA 2NU7A 4R54A 1E3JA 3NX4A 4JJIA 4IJVA 5ES3A 1T2DA 5DOVA 1ZMTA 1LLCA 3WBBA 3PGXA 1BW9A 1H2BA 3W8DA 1CDOA 3RUIA 4DLBA 2ZTMA 3ANNA 4RPLA 4RF4A 3SXPA 3CZRA 3UVEA 3NDIA 2A94A 1XDWA 4L73A 4ZQGA 1VKNA 4P38A 1HZZA 4CL3A 1K3TA 2C59A 1X7DA 2ZYAA 4DYDA 1Q7GA 1BXKA 1X15A 3GAZA 3U4HA 2IDZA 3K5PA 3UICA 3WMXA 1BXGB 2PZMA 1H6DA 4L76A 2EIHA 2J8ZA 4GAEA 3LF1A 1BTOA 1QXSA 2DKNA 1GEEA 4WCFA 1P1KA 3KVOA 4Z3KA 1WMAA 1DIHA 2VUTA 2JHFA 5A03A 1CWUA 1B7GO 1YDEA 4CQMD 4YAGA 1U8XX 3NUGA 1J0XO 1E0DA 1DOHA 5A1TA 2PZLA 1ID1A 5IDXA 5KVQA 3ETGA 1YL5A 3FNGA 1KETA 3DBHB 4PLZA 1X7GA 1NQAO 3Q3CA 1BSVA 1QR6A 3TRIA 1EVZA 1RWBA 3SEFA 3WGZA 4CQMB 2D4AA 5LDGA 1K6IA 1WZIA 5G0UA 4FC6A 1R0KA 3TN7A 3MJEA 1AGNA 2W2LD 4DUPA 4ND3A 2JFFA 3SC4A 5KCZA 1LXCA 4PVCA 5IXSA 3PWSA 4TRMA 5JS6A 1DIAA 2A35A 3RU9A 1HE2A 1BXGA 1HYHA 2QRKA 4NPCA 4JNKA 4B4WA 1V35A 1VSUA 3Q11A 5ITVA 3HWRA 1ZCJA 3FWZA 3GDGA 5TNXA 3I4CA 2QYTA 5A4DA 5AQ1A 4ZD6A 2HLPA 2WYUA 4R9RA 4RV9A 5AVOA 6LDHA 5JSFA 5T5QA 4CV3A 4QFDA 3DBHA 3DMYA 4EUHA 1HDZA 1P77A 4K9DA 3T4XA 1YKFA 5EERA 2P9CA 4FB5A 3ENKA 5JAQA 2HJSA 4U6QA 1LSSA 2O3TA 4CQMA 5GMOA 1WVGA 4OXKA 2CDBA 3PTZA 1ZJZA 3DBVO 4O1MA 1QSGA 4E31A 1EQUA 3ZV5A 1R66A 2VT3A 3W6ZA 5JDCA 4XB1A 1YGYA 2DPHA 3H2ZA 1E77A 1WNTA 5IDYA 4IS2A 2OP1A 4FFLA 4P8RA 2YFQA 1DAOA 1PJ3A 2GO1A 4BL5A 1GUYA 3FNEA 4R5HA 1WWKA 2HO5A 2JAHA 2W2LA 4U8GA 3L4BA 4FDAA 5TT1A 5JCXA 4Y9DA 3BAZA 3QWFA 1ZEJA 4DA9A 2H5LA 1B8VA 2Y93A 3MJTA 4U0JA 1K2WA 2VTEA 1K0UA 1OMOA 1W73A 4XWYA 1X7HA 3AI1A 1GYQA 1E6WA 2FZEA 3TZCA 2RBEA 3FNHA 4FSHA 4DLLA 2IYPA 4IM7A 3VHRA 1DJQA 1NQ5A 4GWKA 1YJQA 2NWQA 2O3UA 4Y6PA 1KYQA 5TC4A 3PPIA 4IIVA 3DONA 4EZBA 3FNFA 3ULKA 2WSBA 1DRVA 4I8XA 4I9HA 1HLPA 3AUTA 1NFQA 4CLXA 4E33A 4BO8A 3QY9A 1C14A 2X9VA 5FEUA 3KLPX 5C3MA 1N7GA 3AI3A 2IODA 3WWZA 3PZRA 1CEQA 1C0KA 4L4XA 1JQBA 2F00A 3ONFA 3FSRA 3WSVA 1KIFA 1WDKA 2UV8A 3HJAA 2VZ0A 3WSWA 1EQ2A 3COSA 1EE9A 4HFMA 4YJHB 3KLMX 1T4DA 3RASA 1DB3A 3JQBC 3E8XA 1K5HA 4QO8A 3GLQA 5I8ZA 2OZPA 1YRLA 2FSSA 1KVUA 3DZHA 3C7DB 1M76A 4DC0A 3PQDA 3E9NA 1QRRA 3SC6A 2HRZA 2YZ7A 1XLTA 5L95A 2P68A 3JQ9C 4L9RA 3UCEA 3VPSA 2FHSA 5TQVA 1BXZA 3VH1A 2H1SA 4E32A 3NTQA 3OJLA 3MJVA 5A3JA 4BNZA 1YJ8A 3ST7A 3BZUA 4YRDA 4WLEA 3GDFA
chains in the Genus database with same CATH superfamily
3G9ZA 1P2UA 5HSGA 1MHTA 2X1MA 5D1HA 7ABPA 1GRVA 5CXUA 4QT0A 1OI2A 2J9GA 3NEAA 3PP8A 1YCDA 4QQKA 4EMBA 2LVBA 3BXFA 1L5SA 4OFZA 3B6KA 2EX0A 1ORVA 3R8CA 4OYRA 5JJBA 4YN3A 3GGGA 1M6NA 2FG7C 2HPZA 2BTQA 2O23A 3TW6A 3ZK9A 1Z4JA 1QVAA 1C8KA 2Y1EA 1ZX1A 1U6IA 3QY0A 3DWGA 5CRIA 1FDWA 2G4LA 3ESDA 3VXKA 4BMVA 1TKRA 1TT7A 2M6KA 1F0KA 3TFQA 4ZZ3A 4C2TA 5FHRA 1TLFA 3KAJA 3N8NA 1YKGA 4AN0A 1KARA 1JILA 2A58A 4D44A 1OBOA 4BRUA 5HRAA 1DBSA 3EDRA 3JZAA 2FP4B 2HMWA 3CXRA 4QSHA 1FYDA 3X1MA 2XWPA 3E05A 1AGRA 3K6KA 2GSWA 1FSPA 2W00A 3FVRA 3UATA 3W7BA 1XTKA 1H2RS 3AOGA 3L8YA 4JOCA 5JR3A 4JYMA 1P4GA 3ZV6A 1L9XA 4EELA 5MN4A 4URYR 3PR1A 4DKXA 3LHFA 2WIFA 5EIXA 1JVNA 2F1OA 2HV8A 1KEZA 5DHQA 1W7AA 3I8XA 4HZUB 3X1JA 5FWXB 1GPYA 4IFBA 5LBIA 1RZVA 3NUQA 4YDHB 1UEXC 1KF0A 3NM4A 5J9FA 4TV8B 1C50A 1I2BA 4TKLA 5FWDA 3A1TA 3AFIA 3AJ8A 4GLBA 4RD2A 5ECDA 3V33A 1H3EA 5CBKA 1YZUA 1YRYE 1MJNA 3BC1A 2XQIA 4M9ZA 5FBLB 4D9FA 4ARZA 1H0SA 1JEYA 2BMDA 2ZROA 3UT6A 3WG9A 1VCNA 4F6RB 3E9ZA 4HLDA 3FPCA 1TIPA 2NO7A 2ZPTX 2GK3A 4FW8A 4O2AA 5AIAA 3E3AA 1Z7YA 4YCCA 2SCUB 4J16C 3MXOA 1CJUC 2RI0A 1V6AA 3OU6A 4NULA 4TKUB 4CDMA 2PBFA 3U1BA 5TQ2B 4FOSA 3WO1A 4UBMA 2FY8A 2JZOA 4X71A 2B8NA 1EFDN 2YRXA 4ETIA 5LLTA 4WFKA 1QVZA 3LHIA 4YQEA 5IAGA 2XZDA 1DAKA 1T36A 5TPWA 2VJOA 2JI6A 1U8UA 4FCTA 1EFCA 3EIFA 1B2LA 3MTEA 4UUMA 4DFDA 1U0TA 4MUAA 3MQ2A 4K81B 3A6ZA 1HO3A 4Z4EA 1FNCA 1TJ3A 3JYOA 3E4DA 4OHYA 1S4MA 2WAMA 2C42A 1PJAA 3AHEA 3OIUA 5EJ9A 1TRHA 4C4ZA 3VKVA 1N78A 3F7NA 2ONKA 2VJMB 1EDDA 1EVKA 3DQQA 3W3AA 4KQGA 4YPFA 1N2CB 4JUDX 1WQ1R 2VK1A 1F48A 3A9WA 3PVCA 2OXFA 4CKXA 2NU8B 3L6RA 1X1RA 4W7SA 3RABA 3IDZA 4HGRA 1TW2A 5A6SB 1UAAA 2ZYVX 2CXNA 2XUPA 4KLNA 4DRXA 4BWYA 2FX3A 1SXHA 4ALNA 2BHLA 2XZPA 1B6GA 1J42A 1E9EA 2IFTA 2FCAA 3N28A 1DHTA 4P3YA 4V0QA 3QXSA 5BQXA 4TQAA 3KKNA 4BVLA 2R751 3AF0A 4O29A 1P0PA 1FVXA 2CWWA 2NZJA 1U4SA 2XGMA 1XTJA 3EEOA 1M1YE 3REGA 1Z18A 5JALA 4BBPA 2IE8A 3IKTA 3QHQA 3K9QO 4H7EA 3K92A 3LZCA 1YAHA 5IVIA 3CUTA 4F12A 3ZI4A 2O7QA 2HSEA 5FI1B 5IWCA 3ZG6A 4DJAA 4WZAB 3OM9A 1EFRA 1H85A 2D1QA 2VT7A 3GAAA 4OU5A 1QRUA 1OYOA 3CB2A 3VPBA 3EJWA 3K0AA 1O58A 3GP8A 3K32A 3K1JA 1TM3E 2XDAA 4XUCA 1ADCA 1G20A 4C6TA 5F52A 1GNPA 1Q17A 1XEFA 4HADA 4N7BA 3FCXA 4BS9A 1G8YA 1Y5RA 2ZUUA 3NBAA 3R3UA 4WGGA 4DWVA 4LDPA 4YONB 4DMMA 4DMLA 2QROA 1M1UA 3IR5A 3ZQJA 3GJRA 1SXQA 4WQMA 1ECLA 2NACA 1KI8A 3DCJA 3KQMA 3RS5A 1N92A 2VPYA 3KOZA 3WJAA 1NW8A 1PRYA 4Z49A 4MIEA 4DNPA 3B3JA 2XXJA 4TRJA 1XMIA 2NZ2A 4GE0A 4BUJA 3KSDO 1MZPA 5IK2D 5JMPA 1HLGA 4A8TA 3ZU4A 1IXSB 3EVCA 1QH9A 3Q3EA 4F2HA 3NEPX 3NGXA 4X1YA 1NJ8A 2JIPA 2MCFA 3RFFA 2X86A 2O8BB 1E2JA 2OCXA 1J06A 3TKLA 4A15A 5E1DA 4IOKA 5K6AA 1ZNYA 1HYGA 3PBKA 1COZA 1Z7WA 3H17A 4C07A 2DH5A 2OZKA 3I5XA 4F97A 4G5YA 4MA0A 1S89A 1RZRD 2HHAA 4ZIRA 1R6TA 3I76A 2FUEA 1NJGA 5CJPA 5A04A 5IT5A 1SCNE 4CT4B 1CUJA 2C29D 4O4JB 1Y8QB 1WABA 3OU7A 4JENA 1QHSA 3G8DA 4AMBA 4Q0MA 1XSEA 2J6CA 3U3ZA 3AEUA 3VR0A 5AHKA 2I4MA 1UQTA 3A05A 4TM7A 2VF7A 2WUGA 1A27A 1U9CA 5BYJA 1QV9A 2YIMA 4UD6A 3ZE0B 3MHPA 1AMOA 4JB3A 1JZTA 3PUYA 3IXQA 1OH5A 2I29A 2NZVG 4P4SA 5KYUA 1K06A 1UBOS 3NV7A 5HS6A 5CIYA 1L8XA 1T3HA 3CC8A 1JDUA 1YCFA 3G23A 4YHHB 3JATB 1ZZGA 2FW9A 2XUFA 1Z8DA 1ZQ1A 4R83A 4RTMA 2XVXA 2ZSEA 3GLGE 1VFPA 3EFOA 4ZI5A 2VF2A 4FOTA 4FB4A 1K8XB 4JLJA 3H5TA 1XXHB 2HWWA 3QUQA 5K3FB 3G1WA 3ZXUB 1KTIA 4R5MA 3C5HA 1XO1A 5E9AA 1U7OA 1VRCA 1YO6A 2V7XA 5K3BA 5ETJA 5F73A 1MX5A 3OPVA 1B8UA 3OTGA 4ASUA 3L6UA 1M2NA 3UJ7A 4CIXA 5E6SB 3DBLA 2MDTA 2NZYA 1BE6A 4CKBB 2I8LA 5CFQA 3C6ZA 4BUCA 2IEZA 2AZ4A 3EPLA 1UFVA 1TW3A 1KJNA 3K2IA 1MEEA 3L1IA 1Q15A 1L5YA 4BNXA 4E6EA 1ZAYA 4Z9BA 3O73A 1WY5A 3W1VA 4MXDA 1GG8A 2FXIA 3KD2A 2VJYA 2H57A 1RHRA 1DZ3A 2O8CA 1N5IA 3EGOA 4HB4A 3DD5A 4LWQA 3H4TA 3GO4A 2WJ4A 1QKIA 2XWJI 3EIHA 1TLLA 3G5LA 3Q7QA 5EJAA 4WNAB 1X7ZB 2AE1A 4IHJB 1IMOA 2ZYDA 2R8OA 3KZXA 3WL7A 2FFRA 4RBNA 1RXEA 2CJWB 3KOWA 2Q7XA 1VHQA 1J4AA 2E5FA 2PVSA 2FJ0A 4OK5A 4TWRA 1PL0A 1X8LA 4M7RA 2WWVD 4BEWA 1PJQA 4MHSA 4Y7DA 2P3OA 4AIRA 4B2PA 4CU2A 1YB1A 4JGGA 3HKBB 3H9QA 4HWPA 4Y98A 2OFOA 3GZJA 3CX4A 2F3PA 1RQXA 2JFNA 2B4AA 3O9MA 2HXGA 3CV3A 2CKMA 4UEOA 1G291 3VX4A 1I0ZA 4HGNA 2GWRA 3OETA 4N7RA 2BBWA 2HJGA 4LGCA 5E4TA 4J0DA 4B0PA 4DQVA 5KJFA 3ISJA 2EP7A 1Z83A 4FFOA 4XPIB 2RCNA 5IM5A 2H07A 1MJFA 5LOVA 1GLNA 3OMLA 5CTAA 4FHZA 2F9MA 4EA6A 5CB4A 1MOQA 3NI2A 4MUBA 3ZGZA 5DWDA 5H82A 1WZNA 1NJ5A 3WK6A 1BFUA 3U26A 4G0QA 2ZSFA 3NGLA 4OI1A 4ZQCB 2AR0A 2G0TA 3FYDA 5CIQA 1QQAA 2W6CX 2VQ6A 4PEVA 3WIVA 3M4JA 2JFHA 2DECA 3FHLA 4HFJA 3IB6A 1T9ZA 4QTYA 2RFLA 3HFGA 5FO0A 3V7UA 1IZYA 3QVLA 2V1UA 3LA8A 1FDSA 1ZOIA 3S5UA 2UAGA 2WSLA 1SUBA 1BVHA 4Q9JA 4ZI7B 1I3CA 3Q5EA 4AP6A 4A9AA 4QFBA 1QV7A 4KR2A 3NT4A 3IAAA 1NE2A 4UJ3A 3WRXA 4ARAA 1BCSA 4YXFA 2J9RA 1BA2A 4G84A 2JLSA 3AZPA 1P9NA 3CLUC 3WYFA 1YNOA 1USVA 5ICCA 3U7IA 2JGFA 5FOXA 3VFDA 1DX6A 2FZLA 3FPBA 2GK6A 4Q93A 5D86A 2JGLA 4IDAA 3FDIA 3C8MA 5CA0A 2I1WA 2JL1A 1XK7A 1UPFA 1JDTA 1WMEA 2B5WA 3FCSB 4JP5A 4ZVTA 2UUCB 1GPJA 1J7KA 3CLTC 4GH5A 1CR2A 3MWLA 4RD3A 4EL0A 4MWGA 3VNAA 1V4NA 4QM7A 1UZAA 3DOCA 3HLYA 3L04A 1JZSA 2BN4A 4V03A 5E6UA 3CO0S 3OZEA 3HTXA 2W98A 4D3DA 1ZA1A 5IJXA 3R9WA 4LA4A 1N5DA 3EQZA 3HDTA 1L4LA 3H0EA 4O4HF 5AKGA 3H2SA 1XNRB 1XMVA 4AI6A 2P5UA 2J5QA 3T35A 2W6JD 3OSZA 4QICA 1FRZA 4KO3S 4Y6GB 3R8XA 1EXVA 4AMGA 5A3VA 1PS9A 3ZX4A 2RD2A 3VVCA 3PHIA 4CV2A 2NYVA 4P83A 4LYGA 4HG2A 2MYTA 4M46A 4I3FA 3NP9A 2NOAA 2AWNA 3H04A 1T6XA 5HR5A 1VJ0A 1W76A 1P72A 2GOYA 3A6FA 4PWYA 3LX5A 4RNCA 3H1BA 2QAIA 3I53A 1WPQA 4I2NA 1HXHA 2DSNA 4LYDA 4MW9A 2J3IA 4NZYA 4QGBA 3RS0A 1V7QA 4BNFA 1RWNA 1YQWA 1CY4A 4IQ8A 3BWYA 5BUQA 1Z0JA 1O6ZA 4OSPA 1U04A 1XZ8A 1WSDA 1QIDA 1ZCAA 1ZI9A 4AKIA 1Y82A 1WAMA 2EGUA 4FYMA 4M9CA 1EFLA 3VDRA 4W5QA 2H51A 3KFVA 3OX4A 3Q2KA 5GPBA 4YECA 3U4QB 2IH4A 4L0MA 4WA8A 2P65A 4QRIA 2QRPA 2V7VA 3DMHA 1G17A 3LBNA 4FMDF 2A5LA 2V6IA 5I7VA 1RE1A 3UFXA 1OLXB 1K5PA 2BCEA 1XLVA 3ANTA 3R6LA 3UW1A 2RG1A 4M0LA 4ESHA 1R0ZA 1EWQA 5AI6A 1NW9B 2P1RA 3QXXA 1J9GA 1FFXA 4JD5A 2NTJA 1L4BA 3PE3A 1ADGA 3DL2A 1V7CA 2P6PA 3ONDA 3LCCA 4OJKA 3V55A 1NXXA 3KKLA 1NL3A 5ALPA 1ND6A 4BWFB 2QN2A 1LC0A 5DTRA 3VZPA 5JQGB 2YRFA 4OXRA 1Z2CA 4NE7A 2XE8A 4IO0A 4LRXA 1F60A 4KXXA 1VSVA 4DJDC 3ONNA 1B14A 3ICCA 4AQ7A 4O2AF 1H1LA 5TSDA 2D00A 3BFJA 2P35A 2E1RA 3AB7A 2CL6X 3M6IA 5JAMA 1RIFA 4XGNA 4AJ9A 4FIDA 4DCPA 5DTIA 3ON5A 3PNPA 2Z9DA 3JYPA 5KTOA 2F1RA 1V71A 4FT2A 1W2WB 3NGMA 5LMUB 2C92A 1R3DA 4PGGA 2D1YA 3OZCA 3C0KA 3K6SB 4NCIA 1WDWB 2HLNA 1N2BA 4QYXA 4YJ3B 5FA5A 2O2DA 2C88A 1CZRA 2C61A 2Q9CA 1QIEA 1IXZA 3P9NA 4JZKA 5CU7A 1XMOB 1LBHA 4RSGA 4HAOA 5BWBA 1V3UA 4JROA 2V58A 5ALHA 3ABQB 3IOEA 2VXYA 3KPWA 4WERA 3W3ZB 3D1LA 2H2GA 3QU4A 3ZJTA 2H5IA 2VAXA 3R6GA 4K46A 1U8TA 1S8AA 2CF5A 4X6LA 3TQIA 2BEVA 1GOTA 1NKSA 3KE9A 4IUDS 1VBMA 4KRYA 2WEKA 4RXUA 3W34A 2IPOA 4HVLA 1OILA 1K4MA 1U3TA 4Q3NA 4ID3A 3BZBA 3SHTA 3UJAA 4BNJA 2G1AA 3W5DA 2IS1A 3FTQA 5CDFE 5BVHB 1FNDA 3PUVA 5I7AA 1O97D 2R79A 1L5FA 2PSDA 2X8BA 4MVJG 3T6KA 4IKOA 4K6GA 3SYMA 4FGUA 1NVDA 4X00A 2ECKA 4Z0PA 3ID6C 3PX3A 2Y0CA 3CSSA 1JXAA 3SXUA 4DANA 2JKYA 4NOLA 3I9V6 3ZWPA 1MABB 4PX3A 4A6DA 4C05A 2XJ4A 1V8OA 2BELA 3UNXA 1XAHA 3IVRA 5EINA 1FYXA 3CVWA 1FRNA 3ZBTA 4W99A 1D1SA 3AB8A 3BWBA 3FRIA 3SE0A 2A1UB 5LP6F 3V9PA 1LW6E 4MVJI 4GP9A 1RT9A 1TUEA 4RMGA 3BTOA 3RS3A 8GPBA 4P0PB 3AU9A 3IAM1 1YQ9A 5K03A 4DLTA 3EBOA 1NUTA 2GO7A 1EUDA 2C7VA 3RDPA 3WRVA 1CQJA 2PLFA 4S1WA 2BGGA 1R0SA 2X6TA 3WA7A 2WLSA 1YHYA 3HR8A 1Q7BA 3NOVA 3ZHBA 4CMKA 2I0FA 1ZD3A 2Q1TA 5KCMA 3B9RA 5I6DA 1Z6TA 3EYWA 3LWDA 4RMNA 2G06A 3AR3A 3VR5A 4ZO8A 4KMSA 5JFGA 1ACLA 3ZY2A 4H77A 5AJTA 1F2TA 4GZMA 5CVVA 4PZLA 1BFKA 3GXBA 3R8FA 1PFKA 1ZJ6A 2I6TA 4RZHA 2FEWB 5B30A 1TZJA 4E2XA 4HTFB 2TS1A 3KYIB 1O95C 2XF2A 1AIPA 1PNQA 1IPHA 2Z2IA 5JATA 4Y8VA 3RB8A 2RGBA 3A4TA 3BUSA 4HH3C 3SBOA 2FMFA 3EGXB 4EF4A 1MNQA 1G5HA 4QJIA 2G09A 1CUDA 4TVKA 4IW3B 4PINA 5EE0A 3RYTC 5C52B 1IAQA 3EPHA 1HTBA 1ABEA 1DAMA 4HKTA 3SLGA 3OMWA 3M33A 4M6WB 1I2AA 4W5HA 1G5PA 2A78A 4WCDA 3WHPA 2AOWA 5EXXA 3H5NA 3ZYZA 2V0CA 4CF6A 2OB1A 1VSQA 4WBXC 1MX1A 1GKKA 1PZEA 2C0CA 4EY4A 2I2BA 2R2AA 1TKCA 3BMCA 2IHBA 1A4IA 3E3OA 4E14A 2J0QA 1MO6A 3BXOA 1ZK2A 2RJNA 4GD3Q 4UZFA 2EW8A 4IH4A 1TVKB 1F2VA 3BTUA 5LQSA 4TYMA 5DMXA 3OFSA 3A58B 1A5SB 3IJPA 2H7VA 3MJCA 1WS6A 2NT3A 4MEAA 3V8QA 4RD4A 3EMBA 4LS3A 1VBNA 3SU8A 4B7CA 3QBVA 1C9MA 1JYEA 4LE1A 5H3HA 4BWGA 2AE2A 2QTHA 5JSUA 1Q0RA 3G5UA 3PT5A 4YGYA 3NV9A 1RP7A 4JY7A 3AVTA 1Z0UA 2OENG 4TKVB 2CZQA 5JSYA 4CBVA 1WZEA 3ZWMA 1U3VA 1DC8A 2RDMA 3UMGA 1HFWA 2WHPB 4ICIA 1UKBA 5DBHX 4IIUA 3U7FB 4RACA 1JIQA 2DJ5A 1FQJA 4C78A 4DA7A 2XXAB 5HQ3B 2AXEA 4CZ2A 2D5IA 1O08A 4ZAVA 4EG5A 3CLHA 4JBYA 1F4VA 4W63A 4XH9B 5CDGA 5I9LA 1HETA 1GDTA 4KGVA 2B6NA 5T4BA 5E4FA 4F5ZA 3ENWA 2F6RA 3KDPA 4LRWA 4RSRA 3R5HA 3VZRA 2AJDA 5A05A 2GZ2A 4MGEA 1KZ6A 2X5OA 3TQFA 2HA4A 3AL3A 3WDMA 3F2VA 2WJVA 3AIIA 4W82A 4EEKA 1GGHA 4DRYA 3LYUA 2Q2OA 3DEJA 3FZNA 1W34A 1C8LA 2JGDB 4BMYA 3INTA 3NBFA 2HBZA 3TFWA 4R71A 1H66A 1NVAA 1OD6A 5AJVB 5JHGB 1Y1PA 1Z6XA 3LP6A 3GJ0A 2H00A 1X2EA 5CNKA 4LE0A 5IAJA 1G7CA 4NZMA 4AO8A 2YINC 1FFBA 4D9JA 1B0UA 1XMPA 4QAQA 5I9SA 4ZVMA 2ISQA 1B3RA 2JIZA 3LW8A 5ESRA 3IURA 5IYZF 1ODJA 2FDCA 2P5SA 2LTAA 2TSYB 1DCFA 3H6GA 1LJ8A 3T1NA 2IHYA 1II9A 3CRVA 2I78A 1E3MA 4ZYWA 1ZGAA 3NHZA 4DDUA 2BKVA 2OP0A 3UMCA 2O7VA 2V0NA 5KSWB 1DO8A 4C5BA 5LQAA 2G9NA 4NFHA 3SQLA 3N0XA 1E20A 4KWTA 2FFAA 3S2YA 1HK7A 4ZEWA 1IFXA 3H8WA 4NBRA 1U0JA 2W48A 3DJYA 4J9VA 1R37A 2FSVA 4IIEA 5FULA 5CAEA 4X1KB 3KM0A 6REQA 3QEKA 4MNTA 2TMKA 2ZJOA 3OAAA 1OSNA 4PLPA 4CG1A 5JMWA 5EWMA 1T29A 1KMHB 2BC9A 4NSNA 1U3UA 3NXKA 1YBAA 4HBZA 4KBFA 5DRTA 2YUIA 3NO4A 3ESXA 1QBGA 2FFHA 4IQ0A 4JYCA 2JAQA 5IH3A 1OI3A 2C4UA 3G5MA 1CJCA 1RMQA 2ANCA 2YHAA 4KIGA 3R4VA 4QBHA 1M72A 5FR2A 3WGLA 3G8AA 1NR1A 4DR4B 4EG1A 1U2SA 2QI9F 2CYAA 3PC8C 4UBLA 3RK1A 3IQGX 4CIAA 5JECA 4D3SA 3UMYA 5LOVF 4RHUA 2MYPA 4KVGA 1TVMA 3BJRA 2P0EA 3PWZA 3P2KA 4MJXA 2QLTA 5FTKA 2CWDA 3TZHA 1MO3A 4MS1B 4LGYA 5ITWA 5JRDS 1EK1A 3JAWA 4Y6OA 3AR6A 1HRKA 4I4IA 1YR8A 2PM8A 2H1WA 2PUJA 2PDAA 3OM1A 3VZDA 5E8RA 3A9SA 4YMUA 1HH4A 1RAHA 2VCHA 3HUEA 1UBJS 3MINA 4PS0A 1OKKA 3WTCA 4AROA 5FI0B 1ULZA 2YW9A 3IVCA 3OFND 4J6EA 5EQTA 1U0OC 1JIVA 2IEYA 2Q0HA 3OEED 3PR3A 4M0PA 5T41A 3V7YA 4DW8A 3VNSA 3KALA 2DG2A 2DLDA 5LZ9A 3O8QA 2RGYA 2J31A 4BJ1A 3ZGYA 1BZYA 4DIUA 1M33A 2I2DA 2Q2VA 3MD9A 4Z5XA 1YQXA 4JI2B 4Q7JB 3GFVA 1TVCA 3ADDA 1SOAA 3PV0A 2E87A 4OQDA 1JHZA 1ORWA 3ODPA 4MO2A 4LSGA 4R7TA 4KTTE 1SPXA 2WR8A 4DLVA 2HSJA 3ROKA 1M8FA 2WHXA 2XIJA 2HA5A 2OKCA 3MRXA 2OHXA 4BNWA 3IS3A 2R1VA 1E3TA 1N4AA 2FSFA 3N2LA 1K4YA 1HYQA 4NEGA 1Q3KA 2VH2A 3O0DA 1R88A 3L3BA 4TTTS 4BNDA 3FZQA 1A3CA 3VSBA 1HNWB 2FRDC 2FN9A 2YDXA 5KNLA 3K16A 4GBMA 2GYVA 1RZUA 5FO1A 4URFA 2GD1O 3C3KA 3ACDA 4WADA 5D84A 5LKAA 4Z3DA 4JI6B 3TCNA 1M1XB 2OXEA 4H3SA 2R2GA 4E4YA 1BMFA 3K15A 2XVMA 1SB8A 3DBOB 1R18A 3DO6A 4IIFA 3FB4A 3ANLA 1JJVA 3DZBA 3PT9A 1NBIA 2IDKA 3AFNA 3IHLA 2FMHA 1H0RA 3UBMA 1UDBA 2N3ZA 4E13A 4F4JA 5IJZA 5CHEA 1FF9A 1KEVA 1U0GA 5JNRA 2BGKA 4F8EA 3A2MA 1Q0LA 2IDJA 3CISA 5IKOA 2DQSA 2NW6A 1E98A 5KSOA 4KWCA 1N2SA 3BK2A 3C3MA 3UEOA 1PW5A 2C9OA 5B4TA 4V0SA 4PAOA 2JAWA 4NFSA 1ODTC 3OQBA 2G5CA 4FLEA 3Q7RA 4DB4A 2V55B 4FUQA 2R8EA 5JXGA 3E9DA 4L22A 4PGFA 5EI5A 5EJ4A 3OM8A 5FI5A 4E94A 5TJ9A 4HDRA 5J4HA 3L79A 4RDXA 2IV2X 3NR2A 4AZWA 8AT1A 1PR5A 3LTEA 5AXCA 4FFDA 4PYNA 3PQ2A 4AX8A 1GGKA 1ZLXA 1BGVA 3C14C 3VO9A 4PANA 4XYLA 2DXIA 1QWSA 2QD2A 3UV7A 2HCBA 1NXSA 4N5IX 2BZ0A 3L93A 4MRMA 2O54A 3ND5A 4FMPA 5KOIA 3QPDA 2BFOA 4E5MA 2Q5LA 3WLIA 4IRMA 3ED1A 2Y1GA 2P4UA 4NZZA 2O2IA 2PPLA 2FR1A 2ZYWX 4C9BA 1KZ1A 1WA5A 4CODB 3K9WA 1J0CA 3IHTA 1CZOA 1WUIS 2E2WA 5DT9A 5IT0A 1IXRC 2OXCA 3OZAA 1LX7A 4PFJA 1QG2A 5REQB 4BYMA 5KSYA 4LJRA 2ZB4A 4ZCQA 1EK6A 4BXOB 3TCXB 5IJWA 2YV2A 2ZT7A 3D4PA 1G1AA 3FPHA 3UYKA 4TN1A 1KYTA 3CHYA 3ITKA 2BISA 4MIKA 4TWZA 3DE2X 3GZNA 1KFJB 5JI2E 3E7FA 5TEVA 2GZRA 1IDN1 1HDRA 2X7JA 2CDRA 1L3BA 3N8GA 4MV7A 1E79A 2FZ4A 5LVAA 4Y2PA 2FPLA 1I3LA 1GG2A 4BEVA 5LFAA 4OJTA 2B4RO 3E1KA 3EVDA 3P9ZA 2NV0A 4WEQA 1L5GB 1VYUA 4A7PA 3GA0A 2ATCA 2JI7A 2ONJA 4G25A 1H65A 2JG3A 4Y2RA 1QOZA 1MKYA 3PG5A 2VJPA 2AA3A 1PSZA 3A1SA 3AUXA 3GJ3A 3IV6A 4FZJA 4A8JB 4FGSA 2YCLA 1ZC3A 4CM4A 3PSHA 4JUBA 4N8EA 4AY5A 2LDXA 1AD2A 2B1JA 3E61A 3GU3A 2IELA 2Q5JA 3O90A 5KTMA 5LXTB 4Q7LA 3T3DA 3IAS1 5B2ZA 4AECA 3PF9A 1DMSA 1I9GA 3G5TA 1MC8A 3TW0A 5BT9A 3ZZUA 1AZWA 3NIGB 3A8TA 3U3XA 1BWSA 5GJCA 2SHKA 5GONA 4G37A 3P0FA 3TDNA 2BF7A 2GBFA 2GTPA 1TMYA 2XITA 3PEUA 4MMYB 3WGKA 2HT1A 3TSYA 2ZS8A 2JBAA 2EKQA 4ZREA 3ZHXA 5C80A 1Q11A 1GJRA 4I19A 1NJFA 2Y1CA 4ZYYA 1TYEB 1FNBA 1GSIA 4MS4B 4E30A 1UFKA 1LRJA 1SHLA 1XTBA 2CFSA 1PYGA 3KQQA 2ZBGA 4K3VA 5FBQB 1YI0A 4BBAA 2HRDA 3JQBA 5D5PA 1Y7TA 4OMDA 5JCJA 3GRZA 3BD6A 1F0YA 3BXEA 2R85A 3DNMA 1JP7A 1C1YA 2GBIA 4MZXA 2IUEA 3DE1X 3LZDA 3S2IA 1SZJG 1FU4A 3FSGD 2BZSA 3OA2A 4O4LB 2VHVA 3EAFA 1PR2A 3VGPA 1SURA 4ENRA 1PJBA 1JPJA 1TA9A 3AP2A 1PVDA 3FVVA 5KDDA 4DV2B 4LRUA 5CLJA 1AKWA 2X0EA 2BGNA 3FMVA 2WKRA 3TEJA 1RXIA 5KVSA 2WNHA 3ANSA 5LQUA 2V8BA 1KNQA 2H2FA 3TZLA 2GK4A 2JHAA 3B5IA 2ZZNA 2GN4A 3IPAA 1VKHA 2VYNA 2QMUA 4KACA 1INLA 1SEPA 3KUCA 1TZ2A 3VU9B 5CCBA 4N8DA 3I04A 4JGBA 3DYIA 3ZU5A 5BW4A 3MWJA 5EMMA 4HH1A 1SXJB 5LR6A 3DO8A 5EHNA 1DC6A 5JAHA 1LLQA 2ODWA 2RGEA 2WC1A 3OH8A 4RJKA 1L4GA 3HSYA 4BUZA 4IIDA 4A0SA 5DI9A 4MLCA 4ROTA 2PMWB 4PAMA 4BC0A 1JEYB 3L5OA 4CM8A 3TI9A 4ZJPA 4YUXA 1XALA 3V34A 4RCVA 1SBCA 4MUYA 2D59A 5B3AA 4QU8A 1RJFA 2KS6A 1ZK1A 2VBFA 1E62A 1PYDA 2HF9A 1ISJA 2YJZA 1IPFA 4KKXB 4ZPXA 5ILOA 4ZALA 4GOOD 3SCZA 3T95A 3O4GA 1S1MA 3MLAA 3ESAA 3NRJA 4J7XA 1FS5A 2NP6A 5BVGB 2HRCA 4YP0A 1PUXA 5EIBD 4II3A 4NBSA 3BYZA 5D85A 1WW8A 4YRRA 5KIAA 4QATA 4XQEA 3KFLA 4ZFNA 2G4CA 4M53A 4OK6A 1QRAA 1WXEA 3QV2A 2MJLA 4BKOA 3N2KA 3RD5A 2AFIA 4IXNA 5DNAA 2R3SA 1P4SA 2I4IA 1XTRA 4HQKA 3VM6A 3KXLA 4BQIA 3IQEA 4NCKA 1FU8A 2Q49A 1RTTA 1P1IA 1PDOA 3N76A 3H2JA 4P7FA 1ZD2P 3PFWO 3IMCA 2J3MA 4R41A 4MV1A 2Z04A 3TTUA 4B3HA 1ICIA 1FSFA 3MTIA 3SQNA 5BN3A 5JWRA 1XXHA 1U8FO 3BX1A 3LFHA 4LNAA 5G4KA 1F12A 2DLNA 2QTNA 4QYIB 3G9XA 3LUGA 5FOSA 1HR0B 3DZ8A 2EARA 4NEHB 4UM9D 3L07A 3ZJYA 2X1HA 4KK3A 1O6GA 2XMSA 1QTQA 3TIIA 4DCCA 4JDPA 2FEAA 1WR8A 4G8CA 3HDQA 1KJ8A 1UFQA 4BZPA 1GRNA 2ZJ1A 3IQWA 4CKBA 4G5SA 1S2IA 1UBEA 1P4AA 5DHUA 4H3KB 2Y99A 3MWDB 3OZUA 1YTUA 2NSYA 2CNLA 5A1TA 1I2CA 2GK7A 4XQGA 1DUSA 5KUTA 2YHIB 3JU3A 4HMQA 4INAA 3I5MA 4QUGA 4R31A 4Y2GA 4LOAA 2UUBB 2AC2A 4KWIA 4RGQA 1ZGBA 1C1XA 2L69A 1HDCA 1ZCZA 3GVXA 4R1LA 4YJFA 5DGIA 4DN6A 5H7XA 1WHSA 3RIHA 1P4RA 1NQXA 1P2BA 1XBTA 4LTMA 4X20B 2BOVA 2MIIA 1NF9A 1TQ8A 2GX6A 2XVAA 2AEEA 1A77A 2XUHA 3MGAA 3RC2A 4ETNA 3GCZA 1C7EA 1G8HA 2VJQA 3AZQA 3DKVA 4O4IB 2QSZA 3WL6A 4E1VA 5C9ZA 1QVVA 1JU3A 2GLXA 1EX7A 2BCGY 3NRBA 3ZHSA 5I8WA 3DKIA 1KEPA 2OT3B 4JLSA 1TK2A 1RSZA 3LAWA 3U4IA 4KHZA 2YWXA 1SOVA 3D59A 1L8QA 2JI4A 2PL1A 1VYVA 4BU0A 1P7PA 2BI7A 3PXEA 5DYGA 5IJ9B 1G8MA 1SZDA 1X3SA 4QXQA 1KJZA 1YCHA 2ERYA 3T38A 2LCIA 2ZTLA 5FX2A 3X1DA 3AMVA 3BE6A 2FPIA 1Q0PA 1SK9A 1HKHA 3DCIA 1RLMA 4M98A 1IEXA 3I5AA 4KNYA 3HJCA 5MGBA 4ZTUB 1KYZA 2WG2A 3R6WA 4JVLA 4MRAA 4R0NA 1STOA 3MFYA 4AZ0A 3KQHA 2PIDA 5DI3B 3L4BC 5FBVB 3DZFA 2YV3A 3HSSA 2HPHA 4XAQA 3V1KA 4O3MA 1F4PA 2VP0A 5CP8A 1EP3B 3DHNA 4L4SA 1LC3A 3P45A 4DLKA 1NBAA 2ADOA 4J0QA 4IX1A 3C98A 4P0QB 2ZAOA 2FEOA 1PJ2A 3F0TA 1VM6A 3IDOA 2Y6UA 4ND7A 5T4EA 1RMTA 3TZ6A 5JBIA 1XIVA 3QYFA 4PNEA 2HDNB 2FOLA 2GN2A 3GH1A 3RFXA 1RYEA 4E0BA 5GJVC 3RUEA 2M98A 2QTBA 4B1FA 1F17A 1JQKA 1RHQA 2E82A 2KLBA 3IB3A 3OPYI 5FCDA 5GM1A 4BLUA 3HB1A 1I1HA 3C24A 3O75A 3T61A 4JI8B 5IVDA 2PNFA 4GMKA 1A72A 2ZUTA 5BSGA 4W6QA 1NV9A 3IQXA 2NLOA 3AY0A 4HCJA 2ZSJA 4NS4A 4MR9A 2Q2WA 3I01A 4NL4H 1JHXA 4P31A 1SUCA 2W2VA 1GTL1 1A9RA 1NQUA 1Z6YA 1SC9A 3WB0A 2LXNA 2I8CA 4YJGA 3D5EA 1QLHA 2FPUA 2QYOA 3T4EA 4CM1A 4HWOA 4JHXA 4RENA 8OHMA 4EECA 4WBSA 1YFLA 2QM7A 5B2FA 2OD2A 4H7KA 1LV8A 2BFAA 1DUVG 3BFXA 1B6TA 2TMGA 2QN6A 3ZHOA 1OFGA 4KSBA 1TTQB 4JR0A 4U7DA 1N0HA 3RRFA 5F3RA 4DUGD 1I8TA 1QLWA 5AKJA 4DYVA 2FWJA 1USGA 2O7SA 2V7QD 4FNGA 3P2OA 3RS4A 1D4OA 1KO8A 1YQQA 3SSNA 4YDRA 2RKOA 4DV0B 1EIWA 4I50B 2N0SA 4D8VA 2Z1DA 1MFZA 3DSRA 3M5PA 4UFPA 1JLMA 4FI3F 2YQZA 3R0XA 2C4MA 3S8YA 3Q7SA 2HSWA 3DP7A 1KEUA 4P4NA 1HT2E 1XLTC 3EXEB 4B8ZA 4RQBA 5J2UA 4TYNA 1PTKA 4L72A 4CI0B 4DLYA 1KGSA 5E3HA 3PQ4A 5K0SA 3G5AA 5IDVA 4KX5A 2IXGA 1S7CA 3D0KA 3V00A 3K70D 2EJWA 1JLHA 2E49A 2JJ2A 2QMZA 3LQKA 5FBHA 3VH2A 3WGOA 1C3JA 4QOHA 2WJ6A 2ZBUA 3L7LA 3PIDA 1C3VA 3OZTA 4JXKA 4NH4A 4Q3CA 1ESMA 1ZIXA 4TV9A 3DOEA 2NG1A 4KVAA 4U2FA 4BO6A 2PKCA 3FI0A 4H7FA 1PGNA 4L4YA 4BE4A 1RXYA 2EBFX 3IUPA 4BMPB 2BKEA 1WG8A 2X13A 1YASA 3G0OA 1OR8A 3KR0A 3MC1A 1ARZA 4NMMA 5SYMA 1NY5A 1RBYA 2Y71A 1R9JA 3OZSA 4KXYA 3RIXA 4MTCA 3U4QA 3G8BA 1MB9A 2QJWA 3HGMA 4QXAA 4BE9A 3SYLA 1QONA 4EUNA 1IB6A 2CBXA 4JXXA 5HQ3A 4MI3A 4JLPA 5JYCA 1E1NA 4RY2A 5U9CA 3SICE 4RVFA 5J5CA 1G21E 1YZNA 2D0IA 1C7QA 5KDOA 4NLLA 3C48A 3FF1A 1KWGA 3RFUA 1BG6A 4M83A 5EP4A 1GA6A 2JHGA 4RPIA 1PX0A 1GCIA 4QBTA 2AR7A 1L5MA 3MRSA 1ENPA 4HUJA 5F5NA 1NPYA 1P0FA 1VRVA 4I99A 1WP4A 4QQRA 4G65A 4QQ8A 3UM9A 1LS1A 1KYYA 4GPIB 2X19A 4YTEA 1SY7A 2ZVJA 1N6OA 2Z4RA 5C35A 5IASA 3NDBB 4MW6A 3ETDA 5C5IA 1E6CA 2PGIA 2SECE 1V9SA 2I8AA 5GIPE 3IMEA 3R3YA 4EHLA 3AEYA 1SQFA 4Q4CA 2JLVA 5GV8A 2BIFA 5DPMA 4MZDA 3WLHA 3LOUA 2V96A 2PE5A 1J7JA 3UPUA 3RADC 5L9AA 3S1LA 4E03A 4MJ3A 3KR1A 2KX7A 1KJ9A 2P0YA 4WI1A 3SZGA 2X0RA 3V5NA 3QPAA 2PQ6A 3OF2A 3EXHB 4CR7A 1OBHA 2YZGA 4QUAA 3P94A 3P9XA 2M6SA 3TR0A 4KQXA 3LWNA 4QG3A 4IR7A 4KDRA 2NPIA 2PL3A 5DSZA 3O0TA 2DFNA 5B4UA 3AR9A 1WP9A 3H97A 1C3OB 5CD9A 1IN7A 1NA5A 3KB1A 3KD3A 5DASA 3W8EA 2CXPA 2WZQA 2ZE5A 4PG8A 8LDHA 1LI7A 3ZGOA 4JYAB 4KQ2A 4R9UC 1A7AA 2F1IA 1SVIA 1AV6A 3D3KA 4J90A 1T8WA 5EEGA 1PV1A 1NN0A 3ONVA 5D2CA 4LTDA 1CY2A 2JCVA 2X42A 3G0IA 3NT5A 3KSAC 1J70A 4ATNA 4GPEA 4YRSA 1MABA 2BJHA 2PVCA 2WE7A 4UEQA 4YEDA 3UWDA 3BE8A 4BNKA 4U8HA 2DQZA 4N4AA 5K1ZA 2ODBA 1D4FA 2CLMB 1MC4A 4IXMA 4WEOA 3JV7A 2P3LA 1FU7A 1Z6PA 5EWLB 4QDOA 3WLEA 2J45A 5M2QA 1E2MA 1ODIA 4KAFA 5AUPB 2OCKA 4B3SB 1L1FA 5T6MA 2JA2A 4FE4A 4OQXA 3HO6A 4LX0A 1Y1RA 2PNJA 4EUFA 2WF8A 3A3NA 4WK2B 4B4KA 3MLEA 1J8DA 1PEYA 4S1OA 4YHBA 4AP5A 3SSOA 2H4ZA 5JASA 1FUEA 1XZQA 1JBQA 2FPKA 2BM8A 3RC8A 3LTNC 4GMDA 3IHWA 3DTVA 3BSFA 2QLJA 1R50A 4MSUA 5IC5A 5A7FA 5JS1A 4BQRA 2DAPA 5IKXA 4RKQA 3K72B 4RMIA 2C2HA 4Q7QA 1GNSA 4UXIA 4YRCA 1FZQA 1HBJA 5HQJA 2CUZA 4CEJA 4EGAA 2IYVA 1J0EA 1M0WA 4M8IA 1C1HA 4LNUA 4ZCRA 1IOVA 2OGTA 1R64A 3G68A 4LDZA 5ARDA 1BU8A 2WIGA 2V6BA 2BYTA 2PZKA 1NYRA 1I7DA 1MT0A 1DXYA 3K96A 3EQ8A 5AKHA 2PK3A 2CXQA 4Z0TA 4DM3A 5F98A 1JFVA 1CJSA 1DKPA 2I7VA 3PQEA 3QKRB 4QXMA 2EGHA 5DGDA 3S7ZA 2XYRA 3DCNA 4M1QA 4ZAYA 3RHTA 3PE6A 4CN9A 1DNPA 2EFJA 2VBCA 1A96A 2VZLA 3VVMA 4C0BA 3ABIA 4Y6RA 3DV9A 2C84A 5FL7A 2JFOA 4N03A 1TA0A 5DN6A 3NTOA 3VTKA 3O3CA 3ZXYA 1YA6A 3GRPA 1RHKA 1TGYA 5IAOA 4GX5A 3ETEA 4IV8A 1NIJA 1SUSA 5ALJA 5B1IA 4X60A 2QT0A 1QIFA 2VXOA 1EBUA 1Z45A 2NZWA 2COKA 2XXBA 4KN8A 4OXXA 3RV4A 4JLNA 2FR0A 4JOQA 3EVBA 3N7AA 3OIWA 4BASA 5KVVA 2UYOA 5LWQA 1PR1A 1EZ4A 1VPDA 4DA0A 1G98A 4JQYA 4MKGA 3ELWA 3CMCO 3FKSD 3C1UA 1Q84A 1BROA 3H7IA 5EZSA 3IVGA 3I37X 4EY3A <