4FDMA

Crystallization and 3d structure elucidation of thermostable l2 lipase from thermophilic locally isolated bacillus sp. l2.
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
378
structure length
378
Chain Sequence
APIVLLHGFTGWGREEMFGFKYWGGVRGDIEQWLNDNGYRTYTLAVGPLSSNWDRACEAYAQLVGGTVDYGAAHAAKHGHARFGRTYPGLLPELKRGGRIHIIAHSQGGQTARMLVSLLENGSQEEREYAKAHNVSLSPLFEGGHHFVLSVTTIATPHDGTTLVNMVDFTDRFFDLQKAVLEAAAVASNVPYTSQVYDFKLDQWGLRRQPGESFDHYFERLKRSPVWTSTDTARYDLSVSGAEKLNQWVQASPNTYYLSFSTERTYRGALTGNHYPELGMNAFSAVVCAPFLGSYRNPTLGIDDRWLENDGIVNTVSMNGPKRGSSDRIVPYDGTLKKGVWNDMGTYNVDHLEIIGVDPNPSFDIRAFYLRLAEQLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermostable lipase
publication title 3D Structure Elucidation of Thermostable L2 Lipase from Thermophilic Bacillus sp. L2.
pubmed doi rcsb
source organism Bacillus sp. l2
total genus 153
structure length 378
sequence length 378
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2012-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4fdmA00
4BVJA 1ZD4A 3DLTA 1CUHA 1SCIA 1L7AA 4C4YA 1XZJA 5D7BA 2PX6A 4DTCA 4GECA 2WJ6A 4AX4A 1KU6A 1S8OA 1XZAA 1HBJA 4CIAA 1VZ2A 1GT6A 2OAEA 4UBMA 4N8SA 3WL7A 3WK9A 2JGKA 1T2NA 1MX9A 4PV7A 4DMHA 2GYVA 5SYMA 3HZOA 1H2ZA 4GW3A 5HK9A 1Q0ZA 1CUSA 2HRQA 3ED1A 5CT4A 2C0PA 4AZ0A 4MWSA 3O95A 1DT5A 5FPQA 4QA9A 3SX4A 4BC0A 2QKYA 1DQZA 1BE0A 4EZIA 3PICA 4Y2TA 4JYPA 2V97A 4S0XA 4YASA 4G8CA 5AI4A 3WWEA 3C8HA 2D5LA 1F0PA 2JEYA 4UBNA 5CH8A 5BWBA 1YASA 1MPXA 4OD0A 1K6EA 3W06A 4G9GA 1TCAA 1ORWA 3RLIA 5AM0A 4N8DA 1UT6A 3IB3A 1CUWA 3R3UA 4LKOA 1LZLA 5JIBA 3ESBA 2PU5A 4BAZA 1EB8A 3AZQA 2HFKA 4BRSA 2O2GA 5AI0A 2PVSA 2Z3ZA 2VJCA 1WOMA 5ALZA 1ZD5A 2I3ZA 4GBGA 3CN7A 2AJDA 3FYUB 2XQIA 4UBJA 3WKBA 1YB7A 1TRHA 4E46A 5HQ3A 3UUFA 2WQZA 4E15A 1CUIA 5D3KA 3DYIA 2ACEA 2VAXA 3ZLVA 1LGYA 1LNSA 1LPSA 5HF9A 1CQZA 3A70A 2H1IA 4H7IA 5BWCA 1G66A 1FFAA 3ICVA 3PUHA 3WMRA 1MNAA 3D59A 5HCUA 3AINA 4EY5A 3FLAA 1E5TA 2BUBA 4UPDA 1C7IA 1ZGBA 3GELA 1VA5A 5JALA 1HL7A 3S8YA 3WA6A 1HDEA 4Y2JA 3WK8A 5ISMA 1XRLA 4MEAA 4NMWA 2ZSHA 3A6ZA 3QYJA 4BDTA 3WKAA 4UHHA 5AM3A 4N5HX 3G0IA 5JATA 1ZIXA 1QIEA 5E4YA 5AOCA 2X8BA 4BZWA 3MUOA 1A88A 1Y7IA 3IUQA 5A6VA 5LZ2A 4G8BA 1XZKA 1X2EA 3U0VA 2B4KA 1QIJA 3BL8A 4LIPD 1YSCA 3O4HA 1IZ7A 1CEXA 4DNPA 4B80A 1EHYA 5FP0A 3P2MA 2Y1KA 1Y37A 1YAHA 2ZJ7A 4J0CA 4NS4A 5A7HA 1PFQA 2XMBA 5CXUA 4WDQA 1DX4A 1DWOA 1LPBB 3FVRA 3LIPA 2GBGA 3R40A 3G0GA 1BROA 2ROQA 4UHFA 4AQDA 4XWGA 2XLBA 1QIDA 2CMFA 4FBMA 3H2IA 4Y2UA 3I1YA 5DTJA 2ZYHA 1EI9A 1RYYA 2AJCA 1MAAA 3B5EA 5AK5A 1G42A 3M83A 1YS1X 2ORYA 2OLEA 3B12A 3IUJA 2Z5GA 1LPAB 4ARBA 4XJVA 2OG1A 1LBTA 4A16A 5K3AA 2PSEA 4B0OA 2HFJA 5C81A 5C8ZA 3DCNA 4OB7A 3OTQA 2C58A 2PL5A 2WHRA 2Y6VA 3E1GA 4YPVA 2AXEA 1XQWA 3SWWA 4ZI5A 1MU0A 2OCGA 3GZJA 4PQEA 5AKXA 4QE3A 5LZ4A 4JH0A 3R3YA 5FDFA 2H7XA 1VZ3A 5CBKA 5HQ3B 3G9UA 4QDOA 2WTNA 4FBLA 1YB6A 1CUCA 1XZEA 7YASA 3SC2A 1R9MA 3WK7A 3KDAA 1QO7A 1G4HA 2HM7A 1N5MA 4FWBA 5AI9A 1UK9A 3KWFA 1UKCA 3AUKA 3TJMA 2ZJFA 3WK6A 3GA7A 1JKMA 4M0FA 1QONA 3WLAA 2XMZA 4C88A 5KREA 2JBWA 1W4LA 1ODSA 4AXBA 1AKNA 1EDEA 4HXGA 5CT5A 1ISPA 4UBOA 3OG9A 4OSEA 3Q0TA 3F67A 3EBLA 1E8NA 4QDTA 3I2IA 3DOHA 2C0QA 3CCBA 5ALIA 1IUOA 1MX5A 5JD6A 3C70A 5EFZA 4WFJA 5ALHA 4XIIA 2YYSA 1FJ2A 1EXWA 2VF2A 2PUJA 3WA7A 5EIEA 3C87A 1U8EA 4WY5A 5K3DA 3R3VA 2XLCA 1YA4A 1GPNA 3ANSA 3G02A 1AMNA 4B6GA 4OU4A 1QIIA 1ZICA 5AI6A 3C5WP 3HLKA 4I4CA 1B41A 1HQDA 3BE8A 2G5TA 5DYWA 3HJUA 2Y2UA 3I6ZA 5AK6A 4Q34A 2OGTA 5CXXA 4C6HA 3Q8WA 2WFLA 4H7JA 1KEZA 3BIXA 2G4LA 4GWLA 2JGFA 4U2GA 1XZIA 3EQ7A 2BCEA 5FRDA 4B9EA 1CIJA 3FLEA 1CUUA 4CCYA 3K9BA 2DHCA 4KE8A 5DJ5A 4X6UA 1WCYA 5DTIA 3RKSA 1UK6A 3ZPXA 5AICA 4OYYA 1CUGA 1CQWA 4Q3OA 4J0KA 1LPNA 1AGYA 1CLEA 4FTWA 4W63A 5T4BA 4W1RA 4CG3A 2VA9A 1AQLA 3I6YA 2HU5A 1FFCA 4K6KA 1VLQA 1R3DA 1R9NA 2WUDA 4BCDA 5FKJA 4U2CA 2OCKA 4G4GA 4AZ3A 2BAGA 4G9EA 5ALWA 2QRUA 5ALKA 1EINA 3JW8A 3ZI7A 1R1DA 3A2NA 4UBIA 3R41A 4CCWA 5K3EA 4RE6A 2CUTA 5CTAA 3YASA 2ONCA 4LXIA 2RAUA 4K6HA 3A2MA 3QBJA 4K5QA 1ACJA 3BDVA 4G8DA 5DNWA 3O9VA 4W1QA 3L1JA 3ESDA 1XZLA 5JAUA 5IVKA 4QNNA 3F8SA 4AO8A 2AJLI 3DD5A 4QDZA 2J3DA 2XQJA 3FOBA 5AOBA 5AK3A 4W1SA 4BATA 2DQYA 3WZLA 4F5ZA 1UK7A 4U2DA 2WG2A 2OGZA 4D9JA 4GEGA 1BEEA 5JAPA 1Z68A 3WK4A 1AURA 1BS9A 3KOOA 1GQSA 1XZBA 4Y9SA 4OPMA 4CIBA 3STXA 2GZSA 2QS9A 5CT8A 4DGQA 3W2TA 4UFNA 3V1MA 2WIKA 1RP1A 2OGSA 1TK3A 4L72A 3QMWA 1U65A 5DLPA 1THGA 4PSDA 4DM7A 2XB6A 4G1FA 5AM4A 1N5RA 3NWOA 5ALLA 5ALDA 3CCCA 3GUUA 3V1KA 2QZPA 5JASA 3NGMA 5KWIA 3G0CA 1UWCA 4PO3X 4UBKA 1ZOIA 1E3QA 1XQYA 2XDWA 3EF3A 4OUKX 4ZREA 2OPHA 4B82A 1ETHA 1QTIA 3L1IA 4KACA 5K3FB 3H2JA 4BVKA 1CUYA 3H18A 1JJFA 5JYCA 5ALMA 2C7BA 1ZI8A 2Y6UA 5AIBA 2WFLB 4ZGBA 3I2GA 3HYSA 1FFEA 4JEIA 2WG0A 1IUPA 4C89A 5A62A 3T52A 4DIUA 1QE3A 1K5PA 2BGNA 2XUIA 4MEBA 4H0CA 1UKAA 4Y2RA 3ANTA 1HPLA 2J4CA 1MAHA 4CCYB 2QXTA 3HRHA 5AOAA 4HXEB 5D3ZA 3PI6A 1X2BA 4H7EA 2PSHA 1WM1A 5T4FA 4I3FA 2GYWA 1QLWA 1H2XA 4IO0A 4Y2XA 5KBYA 4GI1A 3SK0A 4LYDA 4HTAA 4FLMA 1CUBA 5IVHA 2H7CA 1A8SA 5CH3A 5HK8A 3FCXA 3HC7A 2RIPA 1JFRA 1WPRA 2HL6A 3WL6A 4AN0A 4TPKA 1BCSA 5CURA 4KE9A 3EQ8A 4X90A 5ALTA 5T4EA 1GKLA 5ALOA 4Y2PA 3H04A 4GDMA 2O2IA 2JGJA 3BF8A 4Y7DA 1TKRA 4DMCA 4G5XA 3DJYA 5AIAA 1CUFA 5FUMA 1JMYA 4UUQA 3N2ZB 5LKAA 1FSSA 1D07A 1W6RA 5JADA 1F8UA 2JEZA 3ZV7A 2QOEA 1RWQA 1GKKA 5E4JA 5BV7A 1T4MA 4KR0A 2OAGA 1CUXA 2ACKA 2AJ8A 4L9AA 4ZRDA 2RHTA 3KSRA 4AN1A 1XKTA 3QPDA 1Q0RA 5AM1A 1W75A 3LCRA 2YASA 1MT3A 4AMYA 4X00A 1XRPA 2Y2VA 3D2CA 1L7QA 4EHBA 2AJBA 1UOPA 5J3JA 3H1BA 4MJ3A 4P93A 5IKXA 5LKRA 1ZI9A 1G5FA 1QTRA 1P0IA 1P0MA 4B85A 1WHSA 2B9VA 2WSLA 2XQFA 3EQ9A 4XVCA 1WPXA 2WHQA 1EB9A 3CXUA 1EK2A 3C6XA 3DQZA 4BTVA 2C5GA 3FYUC 1JI3A 3FWHA 4UFPA 5JAOA 1ZD3A 5AI5A 2WKWA 4YK7A 1LPPA 1U4NA 2O7RA 4X92A 3W9BA 3IULA 2CJPA 4UHDA 1FFBA 4QDUA 3WKDA 3DYVA 3OC0A 2FJ0A 1A8QA 1JMKC 4A5SA 3QMVA 2CZQA 1O6FA 5ALNA 2JIDA 2WUFA 3WWDA 2HU8A 3HEAA 1BN7A 3ICWA 3GROA 3H2HA 1UFOA 2XMQA 3CN9A 5ALRA 5JAHA 4L3WA 4H7FA 2BUCA 4AMZA 2PSDA 3HSSA 4QLOA 1QIHA 1CUDA 1AZWA 1R88A 2GBCA 3E0XA 5AKHA 4IH9A 2ZSIA 3S2ZA 1XRNA 2RGUA 2XUDA 2ECFA 1TQHA 1XFDA 3FSGD 2QXUA 4DNFA 2GYUA 4Q82A 4JYMA 5JD4A 2HHAA 1XRQA 3C6YA 5EIHA 5AHXA 1J2EA 2XUQA 2VJDA 1UXOA 1GPKA 3WQHA 4KE7A 4PNZA 4X97A 1CUJA 2QM0A 1GGVA 2DHDA 1C7JA 3C8DA 2VSQA 2X76A 5AO9A 3AIMA 2ES4A 4WFKA 3OM8A 2R11A 3H0CA 2R8BA 5LZ9A 1XZHA 4EBBA 3C6ZA 2XE4A 4BRZA 4OB6A 5JD5A 3NOXA 1MNQA 3O9MA 2VJBA 4U2EA 4IH1A 4HXFB 2VQ6A 2IX9A 3IUMA 2OCLA 1SCQA 4BCCA 1J1IA 4Y2QA 4Q3LA 3V48A 4EY7A 4AO6A 2W22A 3E3AA 2K2QB 5K3BA 3WL8A 2V96A 4WFIA 4N8EA 3AILA 3PFBA 5JANA 3H19A 1QIGA 2DHEA 3QMMA 2FUKA 4X71A 4GLBA 3KWJA 2EDCA 2XMGA 3W05A 3HI4A 3BWXA 3VJMA 4FDMA 2VEOA 3AZOA 3OOSA 4KYVA 1QZ3A 4H77A 2XMCA 5JZ9A 4NZZA 4QDXA 1AUOA 3AIKA 5T4HA 4HZGA 2CEKA 3D4LA 2OXEA 3H2GA 2WFMA 4RE5A 4X95A 5HKBA 3RK4A 3AIOA 2VAVA 4LXHA 4BBZA 3IBTA 4DNQA 3HACA 3BJMA 4B0PA 1SC9A 5HFNA 1UZAA 4UFOA 3FLBA 1OILA 2QMQA 4FNGA 1DT3A 2WIGA 5ALPA 4K6GA 1MJ5A 2WUGA 5A7FA 3QPAA 4Q05A 2HA6A 3TRDA 3FYTA 1P0PA 1IVYA 3G9ZA 1DWQA 2GBIA 4H18A 1A7UA 1IUNA 1ODTC 5C8XA 4GHWA 2QUBA 3RM3A 5HF6A 5LYYA 2WIDA 1VXRA 4F21A 2VATA 2ZYRA 5AI8A 2BFNA 5K3CA 1YS2X 1XROA 4LHEA 3G9TA 1USWA 1CRLA 1JJIA 3WWOA 3K2IA 2XUKA 2PKYX 4NVRA 4W1PA 2XUFA 4QLAA 1I6WA 2XUJA 1XZMA 5I7UA 5EI5A 1A8UA 3STYA 2PBLA 4J0JA 1IZ8A 1WHTA 4HS9A 2EEPA 3GFFA 3IURA 4BAUA 2I78A 5AKZA 2ZYIA 4QEKA 1AX9A 5H3HA 2BJHA 4E14A 4PW0A 1R4ZA 5CT9A 1XKLA 1LPMA 2BGRA 3H1AA 5BOVA 5AKIA 5ALYA 3WWCA 2BUAA 4Q1VA 4C87A 4KAFA 4FHZA 5ALJA 1W52X 2FX5A 3F97A 1Q83A 2E3JA 1TCBA 2JGLA 3KXPA 3BDIA 4L0CA 4DSAA 4BE9A 1PJAA 3QVMA 1CV2A 3V1LA 1TCCA 4MXDA 3H17A 4I19A 5A2GA 4ZV7A 2CKMA 5AKEA 2OCIA 3C6BA 2XUAA 5D6OA 5FOQA 1TIBA 4PF1A 4CI9A 4N5IX 1TAHA 1MN6A 1XZGA 1W1IA 1C4XA 3BF7A 5LZ7A 4EUSA 2WUEA 5K5EA 4X7BA 2IITA 2WJ4A 3HABA 1XRMA 1NX9A 3D5EA 1N8SA 5CRIA 2C4HA 1QFMA 3G0BA 4Y2VA 3QITA 5AK4A 1EDBA 3NUZA 2WTMA 3K6KA 2X5XA 3D2BA 5EHZA 3WIBA 2Z8XA 3ESAA 4H7HA 1ORVA 2LIPA 4LYEA 1ZGCA 4GXNA 3DL7A 5AKYA 3V1NA 6YASA 3W9UA 3O4JA 5ALFA 4BP9A 2WHPA 4PSUA 2XMRA 2HA0A 5LIPA 5AH0A 2VJAA 4B9AA 1GXSA 3DKRA 3VXKA 2CB9A 1QIMA 5HF5A 3PUIA 4AO7A 1CR6A 4MYSA 3AJAA 1U2EA 3VISA 1EK1A 1ZJ4A 4IH4A 4FKBA 4M0EA 1E66A 2XUOA 4MWTA 2XUHA 3STUA 1H2WA 2XI4A 2YXPX 1K8QA 4WY8A 1XQXA 2FJPA 4DMFA 1Q84A 1QGED 5ALQA 2C5FA 3AZPA 4CFSA 2H7YA 1FFDA 3IVMA 3STVA 3I2JA 4DYHA 1BN6A 3FCYA 4QZVA 2QUAA 2YH2A 3L1HA 5A7GA 1CUEA 1ZJ5A 1VE6A 2HA4A 3VVMA 4B7ZA 4KJXA 3G7NA 4E11A 1EDDA 5C7YA 2O2HA 1HLGA 4BAGA 4OCZA 1W76A 1DTEA 1EX9A 2QVBA 4BP8A 1GQRA 2JF0A 1BRTA 3G8YA 4B83A 1P0QA 4G4IA 2ZYSA 3GBSA 3G0DA 5E4TA 3W04A 1BEZA 2PSFA 4F0JA 2RONA 3DNMA 3AFIA 1M33A 3N0TA 4ITVA 4V2IA 4JNCA 4DMKA 4U2FA 4QWMA 2PPLA 5HKAA 2WU3A 1DU4A 1F6WA 5AKGA 3FVTA 5DNVA 4HAIA 3JWEA 4DSZA 5IH7A 4UHBA 2WILA 1CUVA 5CW2A 5FV4A 3O0DA 1YAJA 4BTLA 1LBSA 2WIFA 4UHCA 1QOZA 4X94A 5LZ8A 2HRRA 1UK8A 2HA3A 3F98A 4HVTA 4BC1A 5F4ZA 1CPYA 4HRYA 5CMLA 3WWPA 4J0HA 4X93A 5JZBA 2IIVA 1JJBA 4H7KA 4JUIA 4LXGA 3PF9A 2HDWA 5AM2A 2D0DA 1EH5A 1MTZA 2G63A 2ZVDA 3QM1A 1MX1A 5C8VA 3R3XA 3H2KA 5EGNA 3PDCA 2B61A 1EVEA 1E89A 3KD2A 4BDSA 3VVLA 3ILSA 4BCBA 1ODCA 2WHPB 5FXMA 4BYMA 2W6CX 4ZV9A 1DX6A 4KAJA 3V9AA 4INZA 4KRYA 4X3CA 3FNBA 3STWA 2VT6A 1B6GA 4DLNA 1F0NA 3D0KA 2XT0A 2VTVA 5DYYA 4CG1A 2HADA 4WCVA 4ARAA 4HRXA 5FLKA 4XX1A 3WL5A 3DL4A 2JGMA 1CUZA 2PU7A 1J06A 2OQIA 2ZJ6A 2O7VA 1R50A 3D2AA 1H22A 3T4UA 3ZWQA 1E8DA 5ALUA 2VT7A 1QIKA 2J4FA 2PM8A 1NU6A 4Y2SA 4B81A 3VKFA 1WB6A 5JZSA 3QZUA 1WB4A 3IIIA 3WYDA 3O4IA 4C4ZA 5AKJA 1QO9A 3DS8A 3WI7A 4PSCA 1XRRA 4M0MA 4AB1A 1VXOA 3RARA 1JT2A 1UOQA 2OQVA 1CUAA 1SCKA 1THTA 5HFAA 3I28A 2WIJA 4EY4A 2P8SA 4Z49A 2JGIA 4X91A 2XUPA 4WJLA 5A71A 5I8PA 1BU8A 4OB8A 5LZ5A 3F96A 4YX9A 2HU7A 1AC5A 1ZI6A 2GZRA 1XZFA 5ALXA 5HZGA 4P08A 4FMPA 1KU0A 4J3JA 2WLSA 4X6YA 3PE6A 1LPOA 1O6GA 5AKLA 1VE7A 3FAKA 3R3ZA 4OYLA 2EDAA 5AKKA 1JU3A 3R3WA 4EA6A 4H7DA 5EHXA 2DSNA 1VOTA 5I9IA 4P92A 1BCRA 5AP9A 3F9CA 4KE6A 3DKKA 4BZZA 2XQKA 4X85A 3LP5A 4FFWA 4BVLA 4X6XA 4W9RA 2XMDA 4J7AA 3ZLTA 5AJHA 1QIFA 4EY6A 3X3HA 4Y2YA 2I03A 5DWDA 3IA2A 3MUNA 1YR2A 4EY8A 2RI6A 4P9NA 2UZ0A 1PV1A 4KRXA 1YA8A 4J0DA 2DR0A 3QH4A 1Y7HA 4ZXFA 2DQZA 4J0GA 4QWWA 5ALGA 3U1TA 3I2FA 4FLEA 4J0IA 1E8MA 1UKBA 2G5PA 5ALSA 3WJ2A 1QFSA 1H2YA 3ESCA 5AM5A 4DNOA 2WU4A 2WJ3A 1X70A 3A2LA 4C4XA 3IUNA 2XQGA 2HA5A 1XLVA 1K63A 2RHWA 2QJWA 1XZDA 3JYHA 4FOLA 2QT9A 4G4JA 5IVIA 4O08A 1EVQA 1IMJA 4OU5A 4B84A 1GPLA 2Q0XA 2Z3WA 4RNCA 5DNUA 5LLSA 2V98A 1YCDA 2WM2A 2BKLA 3G9XA 3ZLUA 2V9ZA 5FPPA 1XLUA 1K4YA 3I1IA 2NW6A 4RGYA 4TGLA 1DQYA 5ALEA 3UUEA 4EB0A 2XUGA 3M3DA 2XMSA 2H9YA 4KEAA 4J03A 3C45A 2B20A 3IDAA 5DYTA 3M81A 3TEJA 3VJKA 3UMJA 1VJ5A 3DOIA 5SYNA 1J07A 3O4GA 5K3FA 3DDUA 1NU8A 1UOOA 1JU4A 1GZ7A 5CH5A 3HXKA 2DCMA 4KAAA 2PUHA 3I6MA 1H23A 5EHNA 3TGLA 2HA2A 3C43A 4UBLA 1OCEA 3I2KA 2GBFA 1HKHA 1SOMA 2HIHA 3WKCA 3WKEA 4U2BA 1WB5A 3PFCA 3FBWA 4F60A 1EA5A 1N1MA 4ROTA 1DINA 2Z8ZA 3BJRA 1CFJA 1ZD2P 2PSJA 1CVLA 1OXMA 5ALVA 2I3DA 3FSGA 3EIOA 4Q3KA 2J3QA 1LLFA 4CG2A 5ESRA 3LLCA 2DFPA 4IQ4A 5IVDA 3M82A 3OURA 3WYNA 3PF8A 1VKHA 3STTA 2QJRA 2JGEA 3D7RA 3FYUA 3OPMA 5EHQA 3DEAA 2QR5A 3BXPA 3D3NA 5EIAA 3E4DA 4A23A 3MGAA 5KWJA 1XLWA 3R0VA 1L7RA 3LS2A 3BIWA 4MQLA 4FNMA 1LZKA 4H35A 4K2AA 4FLFA 5HF8A 2QTBA 1XZCA 4IHAA 2WG1A 5E2IA 4ETWA 3WJ1A 5JARA 3VJLA 3C5VA 3LIIA 4TVKA 3WZMA 1MO2A 1ZIYA 4FFVA 3WK5A 4MQMA 5YASA 3WIOA 4WDRA 2WFZA 3I2HA 1XQVA 3QPCA 3B3QA 5LP1A 4C01A 4BB0A 2HA7A 1DWPA 5CT6A 4UHEA 4BE4A 1ACLA 3VDXA 1VA4A 1SFRA 3MVEA 1QJ4A 2CBGA 4MYDA 4ZWNA 4RPCA
chains in the Genus database with same CATH superfamily
3TOXA 2IVFA 2XXAB 1EUZA 1JFLA 2I3GA 1L7AA 3CB2A 4RFSB 4C0HA 3TK1A 3GJ8A 4EAAA 4JB2A 1RI4A 4U7FA 2A94A 3K9GA 1UDRA 4N18A 3H6GA 4CYMA 5I8ZA 3VHRA 2FR1A 2SKCA 4AX4A 1OAKA 3SIXA 3UJ9A 1S8OA 3FSJX 4GMDA 4NMXB 1KZ7B 2HT1A 4AVYA 2WTXA 2X5NA 4LXTA 4QOEA 1BA3A 1RJWA 1R0XA 2Q9BA 3AB3A 3ZCVA 5F2NA 2OAEA 4N8SA 3W2FA 1VPVA 1ABFA 3JZIA 2Q62A 5FHQA 3ZK7A 4IM7A 4KO4S 4D45A 4C4OA 3FR7A 1YDEA 2HNAA 1T2NA 5CYOA 5TMDA 5JDIC 1MB3A 1QP0A 2UDPA 1JR6A 1YRHA 3KR0A 4LV6A 3LY8A 4UD6A 1EP1B 4G5HA 3PQ6A 3W5CA 1YBFA 3COJA 1EVIA 2EQBA 1S2LA 3PTZA 2VZ8A 4B3XA 1LC0A 3AF0A 4H1HA 2UVPB 5C32A 1U0NA 5EJ9A 2QGFA 4J90A 1ZXLA 1Z5UA 4KSBA 1B0ZA 5CFRA 4RFVA 1ZUWA 1G5IA 1K5GA 3A0RB 1C5KA 2ST1A 4GKBA 4H1UA 2RGCA 1SUEA 2GJ8A 3L05A 2AC7A 3DHNA 3L41A 3KYJB 3KZCA 4JNKA 2EFGA 1CUSA 4FHGA 3DVLA 4JI7B 2CXHA 2JARA 4LZNA 3WGTA 4S1WA 4IQGA 3V00A 2CSUA 4W5OA 1PR1A 2YJTD 3FVVA 3CVVA 3ED1A 1G8GA 3K0HA 2Y1FA 5FO0A 3C5EA 5JQGF 1JG3A 3DVQX 5DI3B 3IH5A 1YK0A 3AERA 5IP5A 1E59A 1EQAA 3CB4A 2EGGA 4IW3B 4AXXA 3IEVA 4MWDA 3BE5A 3U09A 1IEQA 1V16B 1VJTA 2E4YA 3F3MA 2I7DA 3RVKA 1EFCA 3CRQA 3EZ7A 3U3XA 2OTCA 2W37A 2JGRA 1F14A 4LF6B 1ZD9A 3SX4A 1Z36A 3OQJA 2J59A 4IWYA 4DV3B 1FEZA 3H4MA 3GDGA 4DGSA 4C7OB 4NX2A 2JH8A 2YIJA 4Y6RA 3AKCA 4MS3A 1BE0A 4DE5A 1NAIA 4R5HA 4AG5A 3A1TA 3Q9NA 4JJIA 3VHXA 3GIWA 3QU9A 1PDOA 4JYPA 4L8YA 4MQFA 4QL3A 4P35A 5BWLA 1GSIA 4BMNA 4K81B 1E62A 2XVYA 4M0DA 1ZS9A 3WHKA 4HSGA 1FLVA 2O8FA 3NHFA 4N3CA 1TK9A 2D0OB 1KHTA 2HJSA 2JAOA 2EARA 3C8HA 3IVRA 2H51A 1ZH6A 1DC3A 2V7TA 3D8RA 3JQEA 4I9HA 1T9GR 2EZ8A 1K7YA 3S8EA 3EFOA 2MJLA 3GMTA 4GSLA 3JQ8B 4M36A 4ZVNA 1G2QA 1AMUA 4PZEA 4AJ2A 1JH9A 2R6JA 4PG6A 2FJUA 2ZRBA 3FMFA 3DAHA 4PAQA 2Q6TA 4CQMB 2YIDA 4GXQA 2JHCA 2NAFA 3SZUA 4QX6A 1NONA 1MCZA 1P1FA 3JQ7B 4EB6B 2H52A 1NZFA 4JLPA 4DABA 5LD2B 3OBIA 1ML3A 5DLDA 5JAMA 1TCAA 1YL5A 2QROA 3L4BC 4OLFA 4OG2A 4ZI2A 5AM0A 2OAP1 4FM9A 1U0LA 2YV5A 1N1GA 1YRYE 1IK6A 3IQEA 3Q72A 3LPLA 4LKOA 1JDTA 3LPNA 3BRQA 1L7VC 1TEHA 4MUNA 5CD9A 5G0WA 5JIBA 3ESBA 1R0ZA 2OCAA 2PU5A 4L8LA 1CP2A 4F8YA 1KKLA 3AZQA 1A69A 4C0WA 3PNPA 3DEYX 3RVLA 3ABQB 3GD7A 2ZJAA 5DDIP 1J8MF 1JVBA 3IQXA 5IDWA 2YHIA 3K30A 3TM5A 1RAHA 1WZCA 4D9CA 2Q5QA 1MX3A 1L5YA 4WBNA 1S2OA 4ND6A 4K05A 5IULC 2PZLA 3IHKA 3V1TC 3KO8A 4R1SA 1EP2B 3NJRA 5DB4A 3K0SA 3EGIA 2AJDA 3DWFA 4UBJA 1KQNA 5IFKA 1JQDA 1XAGA 1GLVA 2CNOA 2GM5A 3Q4GA 5BQ5A 1UJMA 4UUPA 3GLGB 1IIRA 1NXXA 4DOMA 1KI6A 1JNXX 2FSIA 1DBPA 3E5MA 4QBKA 3E1SA 4UEWA 4U4AA 6Q21A 2QRVA 2VP5A 2I2XB 3DYIA 2GX6A 1CE8A 1XMOB 4PG5A 3K9NA 1TADA 4U7TB 4V0ME 4A8JB 5BV0A 13PKA 3ON5A 3HI6A 4MA0A 4BEJA 3R20A 5ENVA 4HQLA 2C5HA 4IJUA 1IJBA 1YVEI 1LPSA 4NMHA 3NV7A 5ECDA 3UH1A 5HF9A 2PLRA 1IBRA 2LIVA 4H7IA 3LYHA 2GNPA 4JX9A 3P4YA 1ONSA 3N2NA 2P2GA 3DCJA 2DM6A 3B1FA 3VC1A 1UBFA 1OYYA 1W5AA 3EYWA 3HV0A 1AA9A 3OCVA 4OK6A 3W3AD 3PVCA 1R6VA 2CVQA 3EBOA 4M1QA 3ZV6A 4HUTA 3S1SA 1H4QA 4EUNA 1BXGA 1PP4A 3AUJB 4POAA 1XCMA 1JIKA 4FEYA 1J1ZA 1IAQA 4ALKA 3SSNA 3D81A 3T12A 5A04A 2LW7A 2X0NA 5FBLB 4ZQBA 2O8BA 1KO4A 5F2KA 2B82A 5A5VA 5ER6A 2Z09A 4NE7A 3CVOA 1CRWG 4LJSA 3L0OA 4P5EA 3O0TA 1PUJA 2WINI 4O6VA 4L6CA 3LHIA 2QI9F 5B3JC 3JARB 4B4OA 1VLMA 5I7HA 3G13A 2OWEA 4YRFA 2JH9A 1SU7A 2GJ4A 3RVJA 4HNVA 3DD1A 5A3QA 5LXTB 5AQEA 3AVWA 1SH7A 4JQOA 1U5CA 3WYBA 2F17A 4ZCSA 2DE0X 1ICIA 4LVOA 2FLKA 5IASA 2QG4A 2GJSA 2JJYA 1Z2NX 2PNFA 1OX4A 3ITEA 3O8DA 3RRYA 4DHWA 1Y3AA 2OWDA 2CNBA 3S8YA 3IEMA 2V65A 4LY6A 4CR8A 2O2CA 1L5RA 3WA6A 3SKXA 4B3RB 3AEKB 1T8YA 4C4PA 1RPZA 2EWVA 1Y9JA 1KVSA 3JQBC 3RGWS 1O94A 1Q7EA 2F1IA 1BDHA 3U3MA 4LHYA 1XD2A 2D7CA 2Y77A 3CR7A 4TMVA 4BFLA 4NMWA 1IBKB 4BQFA 3SKVA 1PHPA 3A6ZA 2I8AA 2P2YA 4DTIA 5D6NA 5IWCA 4HUQA 3ZCQA 2D5BA 1C1XA 3DKPA 4W5NA 4BEWA 4F9GA 4FE4A 5ITZB 1SKMA 1E3MA 3MTIA 1K3FA 5KTTA 4UC0A 1ZIXA 1QIEA 5E4YA 1WCIB 2W6JD 2BR3A 3L7NA 5AOCA 2QZZA 3EH2A 3GLTA 1JALA 2X8BA 3TNFA 4RHUA 5D3MA 4FKMA 3COYA 1Z6PA 1DOZA 4NV1A 3IUQA 5A6VA 1P4HA 5LZ2A 3H8JA 5DH9A 1L4YA 3IR6A 2W5UA 1X2EA 4F92B 3K0CC 3BBPA 5BUQA 3CUTA 4RXUA 4DCUA 2P6NA 2Z58A 2YMLA 1E0AA 3PKIA 1HC7A 2P35A 4B80A 2NP6A 3DE3X 4B71A 4JX8A 4DA7A 1VBNA 4PLYA 4ZK2A 5K8JB 2Y8EA 5BXQC 5E2AA 4AZVA 3B3JA 2C3MA 3FOCA 4L78A 3ZUGA 1H0RA 4N3BA 1IEWA 1KRXA 3PWZA 3UXHA 1BMFD 2V4MA 4PSVA 2BFEA 4FT2A 4KR2A 3V4SA 1INLA 4A2QA 3AVTA 3VR4H 1DKRA 2VP0A 2Y3IA 3FXAA 1EYZA 3SZRA 1PT5A 1Y8RB 5A9SA 5HRCA 2F64A 3VX4A 1J39A 4KGZA 3SQNA 5A5FA 2ORIA 1UMKA 3ONVA 4KIWA 2HF9A 5CNIA 1H2BA 5CXUA 1ZUNA 2BGTA 1GNTA 3FCCA 4NJEB 1D0SA 1Z16A 4BEVA 5M2QA 2A5GA 3JQ9C 4ZEMA 1LPBB 4L76A 4CM3A 1KI8A 1RPNA 1SZJG 1JA9A 3LDHA 4FOPA 4UVEA 4CQMD 4WCFB 2ROQA 2XWQA 4KWEA 1J49A 1L4GA 3E84A 1SB8A 4L95C 4XWGA 5T3UA 4URWR 1YA6A 2BGLA 5B58C 1C3OA 2A78A 2XLBA 3LK6A 3EXEA 4QUAA 2HZBA 5EE0A 4LOIA 3W8RA 1N5OX 5TJHA 2WWVD 1E3DA 2JIOA 4JSTA 5A02A 1SXJA 4QOSA 4AUNA 1E9EA 3A14A 4QHYA 4XIYA 2J6HA 2WTEA 2BM9A 2Z2JA 2P9QA 4HVLA 3I9FA 1JQ5A 1RYYA 1JAYA 4ABTA 3ZDDA 2C7GA 2EG9A 4Q00A 2A57A 1VBKA 1J90A 1RFGE 3DBVO 1COWA 1G42A 1G2IA 2PFGA 1GRRA 3LQ2A 3D4IA 2A2ZA 5FA8A 3B12A 4DV7B 1QNLA 2Z5GA 3M49A 4R41A 2P27A 1BWRA 3HG7A 2GXQA 1QGDA 3WVNA 4XJVA 3C0KA 2PYIA 4ID9A 3SDZA 3MRVA 3GLHB 2FPXA 5I4CA 4IP0A 5K3AA 1QUEA 2VXCA 1VL8A 5CDGA 5IT0A 2FCRA 2PKQO 4N0PA 1E6LA 2OHXA 5F78A 3B51X 1YF3A 1W9MA 3FPAA 3CWZA 2GBPA 2HHJA 3KIPA 4R0MA 2ZJ4A 4UTVA 1KYXA 1P3JA 3SS9X 3WBJA 3JTMA 3RRBA 4NAVA 4IMRA 4NRDA 3CLTC 5B2ZA 3NHLA 1MQ8B 1KR5A 3LSTA 4OJYA 2P5YA 2QUZA 2ZI6A 4WOKA 5AHRA 4EITA 2AXEA 1NUPA 1XQWA 4QT4A 2QQEA 5C9ZA 3SWWA 1II0A 3KLMX 4KI7A 1FX0B 3VPFA 4MLCA 5CBPB 5LP6C 3FHTA 5G41A 2OCGA 2R2AA 3OPYA 5KCMA 3EGOA 2Q1SA 2Y99A 1P60A 3LP8A 2C29D 4JJ4A 4Q4HB 4R1LA 3OCCA 3TZ6A 1F7UA 3HFJA 3HU3A 2KI5A 4FFPA 4QXQA 3NTVA 4R8MA 3A05A 5K0TA 2IHVA 2PZAA 4TSRA 2XB9A 2RBGA 4J4HA 1N2CE 3OUZA 4ARZA 3G9UA 1PR6A 2FPLA 3ZHQA 3M5CA 3IQGX 3E05A 1Y1LA 4RAOA 4O4LB 4FCVA 3ZQKA 2PS3A 2MYNA 1ZMXA 3WO1A 1XHEA 4EECA 4WZBB 4LWZA 1SBNE 3BN3A 3AEQA 4L1KA 4OJQA 2J0QA 3SC2A 1FSPA 2BFFA 1R9MA 1Z4NA 4OAQA 4YUVA 3IHLA 1NUSA 3NVMB 4LJ6A 3WK7A 4ZZIA 1BDBA 3FPSA 1UWLA 2CB0A 1C7RA 1HYBA 2I8CA 3D8NA 3EMDA 2IYXA 4HAXA 4HNQA 4ZAFA 2B1QA 3IDZA 4PO9A 1J8DA 2JAQA 2AWOA 1AF4A 1QO7A 2OV3A 3GVPA 4HEJA 3P9IA 5JMPA 1VIDA 5T6BA 5HIIA 2ODEA 4KDFA 1OXSC 4MKIA 1TVEA 2F1HA 2QTMA 3KWFA 3HL0A 4C3UA 1X9GA 3A06A 3TJMA 3LX4A 4XDYA 1J42A 5SY6A 1TVKA 1JKMA 4NJMB 1DTSA 2DWOA 2P3QA 1I6LA 4TOIA 4YT5A 2GPTA 4EJSA 3ASUA 3T7IA 5I3ZA 1IMOA 2AZDA 2PQ0A 3JVDA 1X14A 2WV9A 5ELLA 3EMVA 1BDIA 5DF1A 2NVBA 3QYAA 4OFZA 1ISPA 4M54A 3B6JA 4P4NA 4NU8X 3HN7A 3LCCA 2XD9A 5JU6A 3I9LA 3HU1A 3B1WA 1AV7A 2X4IA 1PK9A 2I33A 4ZOLF 2FI1A 4RJKA 1E8NA 3JYQA 4OP1A 2KB0A 5DHQA 5J2UB 3ZE0B 4EL5A 1YHZA 1XTIA 4PM4A 3IA7A 4K1LA 4P8RA 3EARA 1E6EA 2XT6A 5CB6A 1DZ3A 1SIOA 1TQ6A 1WSAA 2QUIA 2C0QA 3BRWA 3CUWA 2EIXA 4LC1A 4JOSA 4RCYA 4PLWA 4RELA 5KVQA 3R7AA 3DAPA 1C41A 4XEHA 4MO2A 3E2PA 1IUOA 1QBGA 4K9LA 2GA8A 2GK3A 3M5DA 5K4AA 3VVBA 1NI4B 1SZDA 1M2OA 3PNQA 3I45A 1SD2A 5EWJB 1TFUA 2NU6B 3SFVA 2GHTA 1UPXA 4LEIA 2JG3A 5JNSA 1FJGB 4TUYB 3W7VA 4Z7JA 3OIYA 2RG7A 5EWLB 1NWHA 3AUFA 3D2LA 2BBTA 2V7BA 1RE1A 3ROMA 3UIEA 3HUEA 4ND7A 3O3CA 3WFZA 2QSYA 3NIGB 2HUPA 4G0PA 4MYTA 5HA5A 1VLVA 3TDMA 3UMCA 3D02A 3M4XA 4K9DA 3VO1A 3K6SB 3UMVA 1EXWA 2ZU0C 3OM9A 1G55A 1GU7A 4YQEA 2Q5HA 5LMCA 1OT5A 1QH0A 3PSAA 1JKIA 5GWXA 1GNLA 1G1MA 4QNMA 4YAGA 3AVYA 1C4KA 4WY5A 1L7OA 1UM9A 2BMFA 2ZBEA 3L0ZA 4KMOA 1U81A 2XLCA 4WLUA 1YA4A 2VBGA 5H4GA 3KSZO 2IU0A 1MEJA 3ZX5A 3MW8A 4ED9A 1ID8A 2C1XA 4BHTA 4ES6A 3NP9A 1I7SB 2H8KA 2ZSKA 4K03A 1JHMA 3GV0A 5CR9A 2EFYA 4BASA 4DLPA 2P65A 2CLEB 2LNDA 1FB5A 1G8PA 3QA9A 3U56A 1QRSA 4B3MB 3L7BA 3DUFA 4D8WA 4PNEA 1ZSVA 2Z56A 5CIWA 3F71A 5ES3A 1T4CA 2GF0A 4RKFA 1HDZA 5DE3A 2MCFA 4EBFA 2FUNB 4NOLA 4ZCMA 2DKFA 3H1TA 4CLRA 4KR9A 2LZ0A 3GB9A 3DW1X 2C2KA 4URVR 3GEGA 4TV8A 5K6AC 2FE4A 1BA2A 3DA8A 4KFUA 1Y7LA 3QVLA 1T9HA 3EVAA 1RQ2A 5DYWA 5KYXA 5KYWA 5FA5A 5EJIA 2JVKA 4EHNA 1SM4A 3DDHA 1O97C 4LHVA 3ZY4A 1Z6QA 4NBWA 4WZAA 2I5PO 2I71A 3DULA 4LDRA 4EF6A 1KJ8A 1Z0IA 1TE2A 4OXKA 1T8TA 1WIWA 5CXXA 5EUMA 4CIXA 3Q8WA 2FQYA 1KRWA 4H7JA 3P9PA 1WKCA 3EB9A 2GPJA 4KO8A 2HPAA 2A30A 3WAGA 3OAAA 3T5CA 3BIXA 2CWDA 2YWRA 4GDFA 2NQTA 1PAUA 5FBZA 3VPGA 3PYLA 4TLMB 2X0RA 2VZ9A 3KQUA 3PQDA 4HVCA 4OHMA 5FRDA 4G85A 5H1YA 2FPWA 2G67A 4ZC8A 1CIJA 4H2DA 3MOSA 2OO7A 1FS5A 2P0AA 3ANLA 2FPKA 2C57A 1E9DA 1CW2B 1CUUA 4M9QA 2ZDHA 4CCYA 5E1BA 5BOSB 3ZDAA 1NW9B 1O95D 4GLOA 2D2FA 1DAHA 1I8TA 4D3DA 4RHTA 1J0BA 4JC0A 1XHFA 4MCJA 1NRXA 1HKUA 3ML1A 4KE8A 5DJ5A 1UBNA 3EXFA 1VI5A 4X6UA 5G0TA 4CF3A 2P79A 4TKMA 4DANA 2BZ1A 2Y1LA 1JB9A 3TB4A 1P4JA 1L7XA 4LN1A 3EN0A 5HFJA 1JDBB 3ZGOA 1KFEB 1GRCA 3ZBUA 3L4JA 1V26A 1CY0A 2ZYDA 4LYHA 4B6FA 2OO5A 1DTWB 1KNQA 4MZDA 1PD0A 1S8FA 2Q9UA 1Z5WA 1ENYA 3AM3A 4OYYA 1RI3A 2KM1A 1QNFA 1YRLA 5I01A 1X7WA 4J0KA 1I1NA 3ETLA 4LRSB 4MRRA 3RBAA 4DRXB 3QEAZ 2YN2A 1CLEA 1BGXT 3A9RA 1J25A 4ACAA 3KVRA 2Y05A 3GT3A 4FTWA 5H7XA 1JAHA 3QPWA 3CZRA 1ZN7A 5DM4A 1ZMRA 1G19A 1MQSA 4ARIA 1TJYA 4G25A 3EEOA 1JLHA 3AH8A 4I1SA 4IDEA 5BN1A 5D8DA 3T3HA 2Q2WA 3QV1A 4OHYA 1DIRA 1L8AA 4KW7A 3VSCA 4DQUA 5B55A 1SXHA 1G5RA 3EEFA 4HLCA 4L8GA 1OD6A 2IV3A 3Q8MA 1XPOA 4D82A 5A0TA 2GK6A 2HOQA 5HIMA 1PWZA 1R9NA 2MMCA 4FMDB 5D2CA 2VPZA 1JA0A 1BRMA 1MJGM 5TPWA 4BCDA 4DHEA 1H2RS 1PU2A 2QYHA 5LMZA 3NCHA 4JEUA 4G4GA 3QUCA 2PX4A 1RXCA 3HWSA 4F2HA 3V4RA 4FNOA 1GILA 5EG5A 4Z54A 4EKNB 1AQUA 1YDGA 2C2BA 4TN5A 3TRKA 2C9MA 1SQ5A 1XJ5A 3BK1A 3MMSA 2CCJA 2PUVA 3T1OA 5EJ5A 2DR2A 1YVDA 1H66A 4MQ4A 2VWPA 3KJIA 5AVVA 4MUIA 1WETA 4BVGA 1Q11A 4WHMA 1NBWB 1QHEA 3Q3HA 1RSZA 1TUBB 1RHUA 1RWVA 2VUSA 1SC3A 3O8OA 4D0NA 2AXQA 5J4HA 1KTVA 4U9UA 4R51A 4UNRA 5LJIA 2Y0CA 1E58A 1BE8A 3QVVA 1P5FA 3K09C 3KAQA 4FYXA 3RS8A 1T2EA 1WLYA 3FJYA 4J3FA 4YQYA 4PG4A 1ACJA 2JHAA 5G0SA 7AT1A 4RZ3A 4PG8A 2DMRA 5C5IA 1J5XA 5FNZA 1KBZA 2IHYA 4W1QA 3L1JA 5C51B 2O7QA 3GAZA 1GTMA 1O5IA 2E4VA 2Y0BA 4TLBA 2ZTUA 3GDHA 4A1OA 4AJPA 3RYIA 4C0JA 4P3KA 3ZYZA 3TECE 4KQEA 2GPNA 4QNNA 3RYHB 3USES 1F4VA 2AJLI 1ZAYA 4QDZA 1EGQA 2J3DA 4R01A 3TQOA 5B1YA 5A6SB 2FZEA 1KPIA 5AK3A 1YL6A 4F5ZA 2HMAA 4IICA 2AN3A 4BMZA 2QPLA 1J2UA 4KFTA 3UHJA 1JHPA 1R6AA 3EUFA 4ZO4A 1NM5A 3ZE2B 3BFKA 1TT7A 4KYTA 5TF0A 2JFPA 1ZD8A 4ZCLA 4YCDA 1C1DA 2WG2A 3LV8A 4HHEA 5DOZA 1XEWX 4BO8A 4D44A 4QQKA 1MOQA 1ULTA 1O96B 4NNJA 4QUBA 2Z4TA 4GEGA 3IQFA 2ZEJA 4G26A 4UCFA 3OZEA 4I1PA 1KOJA 1OFVA 4GE0A 3KOMA 4KVZA 1AURA 3L9XA 2HXYA 1L5OA 1YUMA 2GPWA 5AW6A 3D3EA 3L06A 1UJ4A 3G49A 2C2GA 1DAIA 4C08A 3DLAA 5F64A 3JQGA 4OPMA 4LF5B 1IN4A 3A36A 4PSAA 3S7TA 4L50A 1KZ1A 3PNKA 4YAOA 3P45A 3MCWA 4DGQA 3MWKA 4I5FA 4MQUA 3T3IA 3NG1A 1JG6A 1KKMA 1MXHA 1OI2A 3GGSA 5LCXA 2VDWB 3B70A 2OGSA 2VK8A 4FX2A 2FQ1A 1OFTA 2I6XA 4II7A 1HEIA 5FYDA 1JXOA 5K99A 1MHTA 5JCJD 2RHHA 1ZQ9A 2WD9A 4HRVA 5KYUB 4IIJF 4PGMA 4UZSA 4EO4A 1MOPA 4PSDA 4BKQA 2ZE6A 5E7MA 1W34A 4DM7A 2XB6A 2FPPB 4IIDA 2Y93A 5AM4A 2OV2A 2AUNA 1JIVA 3W4IA 3C97A 3FTNA 3CCCA 2NZXA 3GUUA 5TGDA 2ZE8A 5NLLA 2GD0A 3K9FC 2IHNA 1RQNA 4WKGA 1TZKA 4E5SA 2ZBUA 2EL7A 4M8IA 5KDOA 1QX4A 3RVQA 1JDPA 2W0SA 1IG0A 5IU6A 1ZCFA 1X8JA 2NAPA 3OEYA 4HH1A 1E3QA 2BISA 4I50A 4FDAA 3RS9A 2BCJQ 1IHDA 4B5KA 1XQYA 2IK8A 2ARKA 2XDWA 2CD9A 5FFNA 2EGUA 4OKNA 2V6GA 5ADUS 5F7XA 2ZS7A 1ZQ1A 4LSGA 1UIRA 3ND9A 2OLKA 4PAWA 4V1CB 2R66A 3ONDA 3EDOA 1XDBA 1NVGA 1GNSA 5CK5A 3UNXA 1E3LA 5A4MS 5DX0A 1OH8A 3H2JA 1MRZA 5TGTA 2D0PB 1E79A 3THYB 1E1CB 3UW1A 2RGYA 1SBTA 4UXHA 1GGJA 1M7HA 4XUEA 1RBQA 3C3AA 2C7BA 1ZI8A 5ALMA 3ADDA 2M9MA 3LY9A 3ZWNA 4ZGBA 1UPFA 3LD9A 5ILOA 1Z7BA 2C4NA 4Q6WA 3A4VA 2FR8C 3JAKB 4IIVA 2GPSA 4KN6A 1Q7BA 3H8SA 3KTAA 1KJ9A 2VYND 3OWOA 4LQ4A 5EZYB 1O9HA 4UJ3A 3TSYA 3KALA 5JOQA 4QM6A 4UTOA 4TYNA 3JWJA 1K5PA 2P69A 3BB3A 1A1VA 3SE7A 1MV8A 1CQIB 1XEXA 3JQ6A 3PNMA 2F59A 3OFKA 4K7JA 4DC0A 5KKNB 4QTUB 1XR3A 3ANTA 4F3YA 4QM7A 3TG8A 1QQAA 5JDCC 1J20A 1FRVA 2GWHA 3KZMA 4L4UA 2WWWA 4HXEB 2O54A 1T4GA 3VPAA 2Z2YA 3W3AH 1EUCA 3QOWA 1K8XB 1AN9A 4NE2A 1HZJA 5T4FA 5A4AA 3PR1A 4I3FA 4M1KA 3S2IA 3U62A 3AQIA 1G8FA 2G8LA 2GLUA 3ZLBA 3CZQA 3MGCA 3RAFC 3IQDB 1CF4A 4LZAA 3NGXA 3LCUA 4LYDA 3R09A 4FPXA 4GR5A 2F9LA 2Q3FA 3AHJA 4H3SA 3ZZ1A 3T1HB 5ED0A 4AF7A 1HE1C 4PG7A 2TECE 4TQGA 2CT8A 2H7CA 3H7IA 2O3TA 5DHFA 1ISGA 4AUKA 5A06A 4WKCA 1E4EA 4FFBB 1Q7RA 2CMDA 5HK8A 4AJ1A 3TBFA 3H5WA 3M33A 1RM5A 4NOMA 1G63A 1L1FA 4GPIB 3FCXA 4PC1A 4B7UA 5CB4A 3TG2A 1XL0A 4EUEA 4NATA 3HKCB 1QHGA 4JP3A 2RIPA 1WP4A 4CM8B 1WPRA 3ELYA 4FEGA 4YP7A 2C4UA 121PA 1XELA 4NE9A 1T36B 2GERA 1MRNA 2HL6A 4R1UA 2YJ5A 3ICPA 4TPKA 5DIFA 3WL6A 4AN0A 1V25A 3CUYA 3EQ8A 3OF5A 3QW4B 3HKEA 5C1OA 5AJTA 3RUIA 1Y1PA 1XMXA 2VNKA 3EASA 1AUVA 4KSYA 3FHLA 3MFQA 3VYVA 1GKLA 3B82A 3BGSA 5L40A 5KNBA 1SWWA 1ZDMA 1HLDA 3DOOA 3S99A 5KHOC 2Z8YA 3ZW9A 1OPXA 2EJVA 2Q9AA 3GRRA 5DGXA 5BSHA 4R84A 4WVLA 1ZKDA 3UWSA 4F6LA 2P5UA 2JLQA 2OV1A 3AHFA 1TKRA 5E6UB 2VKTA 3TB6A 1X9HA 1P9RA 5EE3A 5LVAA 2VQ3A 2PMFA 2L82A 1LRJA 1P72A 2OB1A 3IVXA 5AIAA 1QX3A 1CUFA 1OLUB 2GCOA 1QKKA 2ZBPA 4UUQA 1FSSA 1D07A 3C14C 1XNJA 4PLFA 1A4RA 3LO5A 1M1YB 4YECA 4YXWA 1GG8A 1XTVA 5EERA 2R751 1YS7A 3QKSA 3IC5A 3ZHZA 4RVSA 3LVBA 5JJIA 3DM5A 3DTNA 5TVGA 1L6RA 4G1VA 4TVOA 5LA6F 1GKKA 5E4JA 4KVFA 2WPNA 2Y0PA 3Q7PA 4QEZA 1ZM3A 4BJ3A 3DZIA 4EJFA 5KC9A 4MYRA 1Z5VA 4KQMA 4N6GA 1VL0A 4FYKA 4WCDA 1XJQA 5CA1B 3JQCA 4OIMA 2ACKA 4OJMX 2JD1A 3MGBA 4MARA 3EK2A 2J0UB 3EA4A 5I48A 1GV1A 1N6RA 3QWFA 4C21A 1I6MA 1VPDA 621PA 3KSRA 2GF9A 2YOFA 3UJHA 3VR5D 4D9IA 4W5TA 2QSJA 4O2LA 1OWOA 4TL7A 4R8VA 1Q0RA 5AM1A 1PNTA 4YDQA 4I4TA 3BQMB 5KS2A 1CLUA 2YASA 2O1SA 1SC6A 5H02A 1YOVB 2CZGA 1XRPA 2DWQA 2FW9A 4JSYA 3LECA 1PR5A 4B76A 1WOYA 3FDIA 3S5JA 4F3RA 1L7QA 2IKSA 3PEEA 1G4AE 1U2GC 3ROGA 1IM5A 2QDXA 5HHTA 2YFHA 3JQQA 2WF6A 1Z4IA 4D0LB 2QWXA 1P4GA 2HRZA 3EPLA 4NEQA 5G4LA 1RLUA 3OLQA 3THXB 5G1OA 3W8FA 3K0EA 4N5DA 4OBEA 5IUKC 3HCWA 3WLQA 1G5FA 3OIGA 5CB8A 2JI4A 1GCIA 3NOVA 4CLXA 5EPOA 1JHDA 2AKEA 1H0SA 1M83A 4DC9A 3HXMA 2XTAA 3CYFA 2TMYA 4BS9A 2FW0A 1GM5A 2X3FA 2C8JA 2IQIA 2PJRA 2R6FA 2F1RA 3BXEA 4Q47A 1PJ3A 2WHQA 2FZWA 2QTVA 3L93A 3NHZA 4Q93A 1FP4A 4PIMA 4RS3A 4PGGA 2H92A 1EK2A 4D46A 1R3UA 1J9GA 1DIBA 3OZIA 1J00A 2FPIB 4LOLA 1ANKA 3OOEA 2RD2A 4PC7A 1ZD3A 2C2HA 4XKJA 5AI5A 1ZITA 2XX3A 3MB8A 3Q11A 2ZVPX 3I9NA 1XG5A 4W6QA 2O7RA 3HMQA 2R8OA 2A0FA 5PGMA 1L5LA 2CJPA 4UHDA 3B6MA 1KI4A 3UJ7A 3T1QA 3OF2A 2X58A 3CNHA 5JPCA 1QE0A 3KYDB 3OC0A 3DBHA 2FJ0A 4A8JC 1FJHA 4CKWA 2B2XA 1Z38A 4GBED 2PX3A 4ASUD 2VNJA 4PIPA 4L8VA 5ALNA 4U8GA 3TLJA 4CV0A 1JVSA 4CKCA 4QGGA 3TZEA 1EZZA 4FGKA 4TQAA 3WWDA 3ZHUA 3DCYA 2ZBGA 3EDYA 3AHEA 2HU8A 1SXJE 2Z5FA 3G5UA 2EZ9A 3SC3A 5JRZA 1GADO 2GUWA 5DZSA 2PCJA 4FS3A 4RVUA 1N25A 4Z3KA 4F3TA 3H2HA 1WDTA 3F3KA 2WDZA 2R00C 1JEQA 1UBMS 4HDMA 3VDQA 1O6ZA 1VJ0A 2GB4A 3Q5DA 4L3WA 3PVZA 2Q2NA 4ER5A 2W6ID 4O3FA 4RL4A 3AP3A 3MUFA 4PX3A 3UF0A 4UE2A 4ZIRB 1MA0A 2WZQA 5GAJA 5AHWA 3QX8A 4LCBA 5EY5B 3TVDA 4UQLA 5J2TB 4QLOA 1UC4B 2ZRCA 5BN5B 2CCGA 4XI9A 3TRIA 2PZMA 4WXRA 4UNNA 1SVUA 3AYXB 5HDBB 2GBCA 2P9EA 1YR1A 3E0XA 2PKWA 4GYKA 1KQ3A 4TLCA 2PGAA 2PRSA 1HOXA 2AXNA 2ZSIA 4ZN6A 2FFJA 5I3CA 3GLQA 4PCUA 4GGOA 1ZBDA 2GTPA 2OXCA 2RGUA 3H9EO 2ECFA 2IXDA 3Q3IA 2BZGA 3JVUA 3AQ4A 1ECCA 5K01A 4CN8A 3FJ1A 3OQIB 2WD8A 5CLJA 2IOQA 4DNFA 3M6LA 1H9CA 4RLFA 4MYUA 3E27A 4DM4A 1V8OA 3BMOA 2CLMB 1GZDA 2HRDA 2YJZA 3ABZA 3EBPA 3HBNA 3IOCA 1H94A 4WLNA 1K4MA 3GA5A 4L9SA 3ZJ5A 4OXNA 5C35A 3HVRA 1RM3A 4LTDA 2H1FA 3C6YA 5FTJA 3L8EA 5EIHA 4DR3B 2XRZA 1F7VA 3H9UA 2VDQB 2A5YB 4XXHA 1U2DC 1I7NA 1UXOA 3PT9A 4PZYA 3W6ZA 4CKZA 2Q7OE 4HF7A 5EJFA 4PNZA 2ASVA 1BX1A 1WW8A 4PHFA 3S2GA 1GTG1 2AOWA 3E6AA 3QG5A 4EG4A 4FNAA 1WSWA 1C7JA 3OI7A 3QVUA 3USZA 3U6BA 2F9FA 1IM8A 2Q1UA 2Q5IA 4RSGA 4C0AC 2JDIA 4O2AA 3D1LA 3PGJA 1ECJA 2A9PA 1G5PA 1YE5A 5IT9A 1JRLA 1OROA 1E5DA 2FHPA 2AKAB 2Y1WA 1BH2A 3PHBE 4WFKA 1RXSA 5H8WA 2RHRA 3RFVA 2AZXA 3LF1A 2R8BA 1M76A 4DZRA 1XZHA 5LZ9A 1L4KA 2LE0A 1FMCA 5C4MA 1PL6A 1Y3CE 4GOND 1I4TD 4JITA 3DMNA 2DU8A 4TYMA 4BRZA 4PYIA 3NOXA 1C7FA 3L7JA 3O9MA 3EGXA 1CDDA 4U2EA 2CD7A 3EIUA 4X61A 3SLGA 2AI3A 2VQ6A 3A2KA 5D5PA 1LBEA 2QRVB 2VQDA 4DSOA 3CPEA 4OLHA 2G0AA 3KLBA 3Q7EA 1SCQA 4MW9A 4G5FA 1EX6A 1FNCA 1YS6A 1HFWA 3ZIAA 1Z2CA 4YMVA 3MJFA 5BVGB 2XAAA 2FDXA 3ZIUA 3V48A 2IY7A 2BHSA 2X2OA 5BYAA 5FI1B 4YO7A 5FWDA 2CLSA 2EP8A 2PZJA 2K87A 1XDZA 2HT6A 1TQ2A 2WMOB 4NKRA 4R05A 4COOA 3Q88A 2K2QB 3SOZA 4CQJA 2BM8A 2TMDA 4DT1A 4KHZA 4UVHA 2JLCA 1NW3A 2MT9A 2V96A 4TYWA 1P9OA 2D1QA 2R6CA 3E58A 4J7XA 4F45A 1Z2DA 4RH1A 5JANA 2CNKA 4Z9BA 1E1LA 5FBKA 1QIGA 1XAJA 2DHEA 4B7XA 1WZUA 2B35A 3I09A 3KOXA 3GZTB 4WXYB 1WNTA 4Q1BA 2FUKA 3O1IC 4X71A 2NXJA 1F4PA 1M2VA 3AM5A 2NUAA 3EFHA 3N6XA 1KKUA 4GLBA 3ZQ4A 1O4VA 4QBFA 3B5IA 2GD1O 4EW1A 5KQRA 3S2EA 1JIXA 3G0HA 2XA2A 2TMKA 3AVPA 3PNOA 3W05A 1GTVA 2DBZA 1SOVA 1RWMA 2FVYA 2F43B 4L5CA 3QLVA 1E9FA 4A0QA 4B09A 4FDMA 3SYNA 2IZ5A 2JIZD 4B6EA 1NGSA 4MV9A 5EJ2A 2HJVA 3O2JA 3TLGB 1QZ3A 1SBCA 4G8JA 3OA2A 5H16A 3N75A 3AP1A 2IV2X 3P2YA 4YN3A 4ZO7A 2E89A 4JI5B 5IDQA 3IAM1 1G6OA 4RYDA 2GRUA 1LCIA 2I4NA 3ZHXA 1KEEA 1UEJA 4KX3A 4M8SA 4DB4A 2PX2A 1G38A 4XDGA 1XSEA 1K2VN 1NXVA 1V43A 3D4LA 1Z0UA 3EVTA 1E2UA 3GI1A 4HZGA 4O1HA 4PX2A 4P5PA 2RAPA 1ZH8A 4JB8A 1X7ZA 2EQAA 5G0UA 2VAMA 5LM3A 1T5IA 4D2IA 2CL6X 3H2GA 2WA2A 4RE5A 4YRJA 4MPJA 2ZUBA 1KMHA 4JROA 4PPGA 4MW2A 4BBZA 4KLCA 4DNQA 5JFGA 1WHSB 4H4EA 5MHTA 3ZZNA 1FW8A 2NV6A 3L8GA 2I87A 3KEFA 4MWOA 4CTNA 3KQYA 3GLVA 3IUSA 5KVAA 4I14A 4MVJD 1U5AA 1FP6A 1FQKA 1ZH0A 3CISA 1UZAA 4IEFB 5EE1A 5GJVC 5CHYA 4WN9A 1N5KA 3I01A 4AECA 4EGQA 3OFJA 1QMGA 1CSEE 2R5NA 1PSWA 2X1HA 4ESVA 3RS2A 4MV7A 4OI0A 1UZLA 1LUAA 1VHLA 2APJA 5K0LA 2ZAIA 1UJCA 2WIGA 3S28A 3WIVA 2YVLA 5KNCD 2WUGA 5A7FA 3IEUA 3PC2A 1N6OA 1OIVA 4QPJC 1CR2A 2W70A 3V2GA 1UT5A 4DXAA 1SUDA 3MLEA 2I54A 2ZUWA 2D2VA 3D4BA 3R3HA 4JS0A 3CNQS 5I6DA 5D85A 4H18A 4XGIA 3G2IA 1G60A 4H6XA 3TQFA 1A7UA 4WZAE 2BYTA 1VG0B 4ESHA 1GTRA 5KTPA 4QJ3A 3U40A 3P52A 1M0EA 2Q41A 3PD0A 4KXLA 3X1WA 4HN9A 1QDUA 5DISB 3OWXA 4DMRA 3RM3A 2P4UA 1QHSA 3NAMA 4CTJA 1BS2A 2YMMA 1VXRA 3CNLA 3GPDG 2B4YA 4KRFA 1GDHA 2VATA 3W7AA 3D6JA 1Y3HA 4I1RA 5FA6A 3TPFA 1FCJA 3KDPA 2UAGA 3BEOA 4E21A 5ES4B 1CYEA 4Q4AB 1MDFA 1KS9A 2BFNA 2F3UA 3CLUC 1FS6A 3KKEA 3OFVA 4I4NA 2CXRA 1G6HA 3H5VA 3AETA 4PXSA 3RKRA 3H3FA 4R1QA 5BSGA 4HGZA 4AP6A 4YMSA 2GK4A 1EFTA 4A36A 5JXHA 5HGJA 4KXUA 1DE0A 1WQ1R 3KUUA 1TTTA 2HSJA 1AK1A 4EY3A 4YLYA 4W1PA 2BY4A 2XF2A 2VP9A 4NDNE 1SBZA 2O57A 4II2A 4RXTA 4QLAA 3WLIA 2ATVA 1ZOPA 2I7TA 1DC8A 1NNI1 3MELA 4HT3B 1KYYA 1WV1A 2VZ0A 4UUAA 1A9RA 1Q77A 4GS5A 4I6GA 2BEKA 2FW7A 2PBLA 4XTRA 3SM3A 5EJAA 3HM2A 3VR6D 3GJ3A 5DTEA 1PFVA 4HS9A 2O2DA 1U8FO 2DCUA 1RWXA 3FWKA 1SULA 3WOVA 4HWTA 1HF3A 2WZBA 2YZ2A 3OOHA 3S7ZA 4EG3A 3N05A 2AE2A 4NICA 5TIIA 3C7TA 2X4DA 2PR2A 3G5AA 4MO9A 5D1HA 5IARA 3IL2A 4DXHA 2R6GA 4AJEA 3IAXA 4WMLA 3FI0A 4QEKA 1AX9A 2AQHA 4PE5B 1OI7A 1VKRA 2IPNA 3PHLA 1E7QA 3B3GA 4P81A 4TMYA 2BJHA 2FZKA 2P9TA 4X1KB 1TLLA 4E30A 2C54A 1PSDA 4GZ6A 1NW4A 2VH2A 3N59A 2PKRA 1RR6A 1ID1A 3P9YA 3L0DA 1GZUA 3FZEA 4JU8A 3UMBA 3W5IA 4B35A 5DI9A 3W5BA 3SEFA 1R4ZA 2OENG 2QD4A 4OAPA 5KC8A 4M55A 4P3XA 3WC4A 1TTHA 3TZKA 2UUBB 3H1AA 2N46A 1ZJZA 4IXMA 5BOVA 1UH5A 3LY5A 4P3YA 4UNSA 2QZ4A 2VDLB 2ZWIA 3QBTA 1LVUA 2B4QA 5AJWA 5JQWA 3PEUA 4KV7A 2DUMA 5ESDA 1ORRA 1QB7A 3HUTA 3AWIA 4HJXA 5CHEA 4BNJA 5HJ5A 2R9VA 1SUAA 4BECA 4D80A 3I61A 1ODFA 2QM7A 1PT7A 4G97A 1NQVA 2C4TA 1SHLA 1A5TA 1GKIA 5F5XA 4UDNA 2RB5A 2JGLA 1TK2A 2ZS9A 2ZXFA 1P29A 4XUCA 2Y1CA 4L5YA 6ABPA 4U7JA 3BXOA 3HP1A 3K1JA 2FN3A 1N7JA 2Q8PA 3JD3A 3PDWA 4XQ9A 1U28A 2QAGB 3B7GA 4QEDA 3RASA 2BBSA 3QVMA 3VU9B 1A71A 1SC4A 1CV2A 3V1LA 1XMPA 1CF9A 1T6NA 1XCGB 4X8HA 1NULA 1QV9A 5EJMA 5M3BA 1CVIA 1N0VC 3GBVA 5JCZA 1FXSA 4MOWA 4AMVA 3NRBA 5AKEA 3WGNA 3ZU4A 4ZVMA 3UJNA 2V5VA 4H0NA 4BUJA 1UPBA 1RC1A 4JBNA 5D6OA 1HL3A 3LKZA 4D9KA 5KYVA 2RGBA 3KRTA 3JQAB 2OEPA 3IRVA 5FWAA 1UT8A 5CGZA 5GOZA 3RDPA 4IHKA 4CI9A 2GILA 2ZI9A 4KQFA 3ZS8A 2O8DB 1C0EA 1MW9X 2GJAA 2ZYGA 3UKOA 1U0BB 4RHXA 1MJNA 1TAHA 3L7LA 3RVRA 4Q7LA 4ZYYA 5B4UA 4BFYA 3K0FB 1JVNA 1O1YA 3F49S 4LDAA 2G1AA 1E5QA 2OSVA 2NUTA 3QE0A 4L07A 3ZQJA 4CEIB 4JSRA 3IUYA 1PW5A 2OBYA 2Y4NA 3ZHYA 5C53B 4P4UA 5DNDA 1G7RA 1HDYA 2W2KA 5GOTA 1JIQA 1FYXA 1U2PA 3LA6A 1IG3A 2IITA 4W8HA 4X7BA 1X1BA 3MS4A 3RRNA 4U39A 2J4DA 1WX1A 2IOFA 4MUEA 3SIRA 5EGSA 1BVRA 1S3GA 1XRMA 3H3JA 2N9UA 1NX9A 4PWZA 4QPDA 5FUYA 4OQPA 5M5BA 2C4HA 1OFUX 1S3IA 1VKOA 4OM8A 3ZE9A 4A6XA 5HOQA 4DV6B 3OFSA 5T41A 1N75A 2JFXA 2G76A 3FA2A 4ZVOA 1AU9A 4RIEA 5BO5A 3TTWA 3BJZA 2IEBA 2B8TA 1AS2A 2NO1A 4Y2VA 1AGPA 1IE3A 4Q4DA 2ZB8A 5LA6A 2VBCA 3HZRA 4N9WA 2H31A 3NUZA 2WTMA 1NYRA 4G0NA 3R76A 1G16A 4WX2B 4CMCA 4K9OA 4INPA 4CDGA 4QQFA 2D4HA 3OX4A 3SDBA 1Z6YA 1IIBA 2DBVO 1W48A 4H7HA 4JLJA 4LYEA 5ENDA 3VR2A 1ZGCA 2OOKA 1V6SA 4BNWA 5HS4A 5KEIA 4I08A 2XYRA 4HWPA 1CY2A 3FMIA 3LAWA 3PNYA 3E9MA 3RIEA 1WW2A 3ZKWB 3O4JA 2QE7A 3ND7A 1OFGA 4BV8A 2YRWA 4DSNA 1HK7A 1R00A 1SKBA 2ZJ8A 3R5KA 4D4IA 1KTIA 3GJ7A 2LBPA 3TXXA 3H1EA 1Q1EA 4PSUA 5LIPA 1WB9A 2SCUA 3KG2A 3RC1A 3TLYA 5EL0A 1JWLA 1HNNA 1C9NA 2QRKA 4IDOA 2A35A 2LKCA 3ETJA 3R7WB 3U61B 2CUZA 3B9BA 2CB9A 3DMHA 3DOCA 3FVWA 4YP6A 3WQQA 2O5CA 3EVEA 1GQQA 3CF4A 4ND4A 4D9NA 1MGPA 1GVNB 3GGGA 1EWQA 4X0EA 3DE7X 1K08A 2QUHA 4AO7A 3TXYA 2DBYA 2D6FA 1MV5A 3KEMA 4EYSA 2GQ0A 2ZAMA 3GFBA 4EI7A 3DUFB 1T0UA 4YT2A 3AJAA 4QARA 2R86A 1B73A 3DZBA 2NZUG 1U2EA 1E64A 3VKUA 4RQUA 3IYLW 1OPRA 2VK1A 1DG1G 4GR4A 1M2KA 2A1TS 4AICA 2XVAA 1GPWB 1ZJ4A 1GAEO 4MCIA 4U5QA 4EEZA 1ODIA 2QLFA 4F84A 5HOEA 3HBLA 3KKZA 4FYJA 2XJ9A 4YDRA 2O8EA 3SR0A 2CZCA 1RC8A 1E66A 3E8XA 4GMGA 1D1SA 1MQAA 3VTZA 4AZSA 1CETA 1VCNA 2O0MA 5HYVA 3C3CA 4RKYA 2YFYA 5AVZA 3U4QA 2XI4A 2YXPX 4M0UA 1H4VB 2UUCB 4G0YA 1NQUA 2PHZA 1D6JA 1OYOA 3BD7A 3NRCA 1D0VA 4HLNA 4Q4JB 4QVKA 3BIOA 2R4QA 3LG2A 1XQXA 4TSFA 2LCFA 2FJPA 3P2KA 4EIWA 3PYXA 4MV3A 5FYQA 2AEJA 2NUPB 4XSVA 3LX5A 1JIIA 4YBRA 4FGLA 2NVUA 3GF4A 3B1XA 2DPMA 1EDZA 1Y1KE 4CFSA 4AF6A 1AUQA 1NVVR 4BN5A 1FDUA 4JD5A 4YRCA 5EUQB 1U2RA 1Y5LA 1APBA 2ZETA 4ZXPA 1Z8FA 3UW3A 4JBXA 4OMCA 1K75A 3LOPA 3CG4A 5FWYA 1BOFA 1S2NA 3I34X 3RJ9A 4QBTA 1KEVA 2W4IA 2QD5A 2Q9CA 3KKOA 2NQ2C 1QPBA 2DG2A 1JN0A 3DWGA 3H8WA 3L1HA 1E1MA 1CUEA 1M0WA 4KDEA 1EA7A 1SQFA 1ZJ5A 2VP6A 3IXQA 4WNCA 5GP1A 4WA7A 4CIYA 3RAEC 3MTJA 4EVIA 4B7ZA 4J1QA 4HMQA 5CFMA 4HEQA 6REQA 3KC2A 2B7LA 1EDDA 2ECKA 3NW9A 5C7YA 4XIJA 3SFTA 4M1WA 4WNAB 2IUSA 4KCGA 2BP7A 4DWJA 1FFYA 3EQ6A 3TLAA 3UBTA 4JC4A 3U4HA 3VR5H 3UK7A 1AKRA 1DTEA 2ODBA 3HNOA 3IDQA 3UV7A 4JOCA 3DV2A 4EQ6A 1BD4A 1EX9A 4BP8A 5ARDA 2JF0A 2N47A 1Z28A 1YL7A 2V6IA 3E23A 4YUXA 1M74A 3G8YA 1N4DA 2CNLA 2ZT6A 4LW8A 4YJ2F 4U3JB 2QN6A 4G4IA 4C0SA 5BN4A 2A5DA 3LYAA 1M6WA 2VF4X 3GBSA 5IKOA 4F4CA 3NDJA 3W04A 3B2QA 4I9UA 2Y1GA 2H85A 2ZIEA 4RTJA 2DY1A 2YIVX 4E03A 1V7PC 1CR1A 3QX7A 2PSFA 4F8EA 4X5OA 4F0JA 5I7FA 4DRYA 5J4YA 4BWGA 1DQSA 3UHFA 3GAMA 5BR8B 2V54A 4D9GA 4FHDA 2OYCA 5JEEA 1PT8A 3AFIA 3EOBI 4LPKA 4LS3A 2YIMA 5IN5A 3V2IA 4X66B 3OQOA 1O7JA 2GM4A 4NAUA 2CXSA 4NZNA 4MW6A 2W2TA 2R6ZA 3JQAD 4JENA 3ZV5A 1P39A 2F4NA 3IV7A 4D6YA 5F5LA 5CDTA 1N6IA 1QH8B 5TXGA 2FRDC 1C0IA 2P4EA 2WU3A 1DU4A 1H0HA 3PUVA 4F86A 2BDEA 1DIAA 1PUXA 1X87A 2N1BA 3I64A 1E7YA 3OVMA 5LL6P 4O2BF 3U3OA 1KK0A 1NLMA 1DAOA 1XPUA 2A9FA 3WHPA 1ETUA 1PRYA 1YULA 4D3SA 1I7QB 1VIVA 4BWVA 1WVGA 1IHYA 1YAJA 4CM9D 3IE2A 2R84A 3VR0A 4BP3A 4MVCA 4WXEA 5LQMA 1Z39A 1L4UA 1UKYA 4HJRA 3VPDA 5A03A 3U49A 3WAJA 4LGMA 5JSZB 3ZEIA 3L82B 5CM8B 3N8GA 4TTIA 2BGGA 4ECAA 3L4SO 3F98A 2H08A 3AFMA 2J0EA 4GUDA 2VUUA 4BC1A 3FE2A 4MIKA 4D8VA 3DPUA 3HA5A 1PNVA 3PJGA 5G02A 1CPYA 2R8ZA 3ORQA 3CX8A 1GGMA 4JUAA 5JNLA 2NTYC 1NHWA 3DFKA 4FKZA 4WK2B 4Y0AA 2XHEA 5I9TA 3ZH9B 1C9EA 4J0HA 1DELA 3I8SA 2NPFA 1DCTA 3H99A 2D06A 4Y6PA 4CUKA 4DMMA 1B23P 3CC8A 4H7KA 3FDZB 1U1FA 1VDZA 2HGZA 2OVFA 3KXLA 2BH2A 4JKYA 4JLNA 2R8PA 3DM9B 3GZ4A 2R7NA 2OD2A 4PAGA 1KDYA 5IK2D 3LFTA 1OZGA 2PBZA 1K4KA 5AM2A 4RXMA 4HDKB 1SKYE 4NZ9A 4UMVA 1QKIA 4Q3EA 2D0DA 4ARSA 2KQUA 1V8ZA 1MTZA 3CVJA 2ZVDA 3VYSB 5DCLA 3CPJB 1XCPA 3OCZA 1QG4A 1VP9A 2XQVA 1TM4E 3A26A 5BW5A 2IEYA 1QYXA 2RJNA 3RFTA 1WZIA 4F72A 2VH5R 1FTSA 3ANXA 3K8QA 5C8VA 2LP4Y 2FOXA 4FYWA 5JG7A 2VF7A 3H5IA 3TMAA 3PDCA 4ZC1A 2G9ZA 1N3BA 4BFWA 1E89A 3ILSA 4BCBA 1M1XB 5D00A 2I99A 3GRAA 2G77B 5FXMA 4F9EA 1Q1BA 4Z9AA 3IESA 1ZAKA 3IIMA 1O8BA 4KQ9A 2O5RA 3S2FA 3I5XA 2WHXA 2OZLA 4ZV9A 4P1ZA 4NG5A 1DX6A 1W73A 5HM6A 4AY6A 1FYDA 4INZA 1HYQA 1GXSB 1VKJA 2ZJBA 4KRYA 4MSUA 2BTOA 4IGEA 4W99A 3GEIA 1B6GA 4DLNA 2AZ4A 1DUSA 1F0NA 2PLWA 2UKDA 2XA1A 3LWBA 5CLIA 3W8EA 4B2IA 2CHQA 1W0KD 5TS3A 1C8VB 3BWYA 3WLHA 2FEOA 1IYZA 1QLHA 2HMYB 2YYYA 4RLHA 3FKQA 1DS6A 4HRXA 5DU2A 3RU9A 3P8ZA 4QICA 2Q21A 3BFPA 1B2LA 1DB3A 1LSSA 1Y33E 2OXFA 2W2MA 3WL5A 3ECCA 4B48A 5ELXA 1F3OA 4NAHA 1LK7A 3HS3A 1XMVA 3QVXA 2E21A 2PU7A 3UTCA 2BM1A 2ZJ6A 2O7VA 2COUA 2CE2X 3PU6A 2QL5A 5A3JA 4NQZA 2PD4A 4AS3A 3DLIA 3GGCA 5LR6A 1I7DA 3BGOS 1DJQA 1TF5A 3ZWQA 4FONA 4AX8A 3B6EA 4WI1A 3CKKA 3TOVA 3BTVA 1SHKA 3RS5A 2ID7A 3TD2A 4YWJA 2JL1A 1M7GA 1QIKA 2R1ZA 1YB1A 1E7SA 2G5CA 3BGVA 3F4BA 3LF2A 1NU6A 3PXEA 4RM3A 1UFKA 4QU8A 4ZU1X 4DDWA 1PR3A 2O6LA 4S1OA 4BO5A 4RIIA 4LGYA 1YFLA 4MW1A 1JFFA 2XVXA 4CBVA 3CRNA 3WYDA 5HS6A 3O4IA 1CRPA 1LX6A 2WJPA 3QPVA 5H9VA 3RS0A 4EJ0A 1Y80A 3IIEA 1I9GA 3INYA 1Z5OA 1QCCA 3K7EA 1IDN1 4K28A 3SKYA 1VGRA 5CTJA 3T38A 3V4OA 1QO9A 1OKKA 1SJ9A 2OZPA 2WWXA 3KU4A 4RA9A 2ALJA 4OLAA 2QMOA 4QYXA 1Y4SA 1N1EA 1K86A 5TQ2A 1IZ0A 2XDAA 1Y9ZA 1TEVA 1XF1A 4FVTA 2GZMA 4WK6A 3SLKA 4AB1A 1CWUA 4NFSA 3RARA 3ZHRA 4MYCA 4OOEA 1UOQA 3VI3B 4IFIA 5DM70 5FOXA 2OQVA 1CUAA 4KGVA 3IE0A 1TYZA 2NV2B 3K20A 2NU9B 1KK1A 4S1PA 4ETMA 5TQJA 3GHYA 2EW8A 3I28A 1Z4MA 2EL9A 2QBYB 3K0KA 1OAAA 3HCPA 4PHTA 5J5VA 1UBKS 3B6KA 3O84A 3W5VA 2IQ5A 3HY3A 4DMLA 3PNSA 3NBFA 1Q0TA 1SVMA 2QGNA 2P8SA 4GH5A 2WNIA 4Z0TA 2D8MA 1V6CA 1HDGO 1L4MA 2QENA 3ZJYA 4B7AA 1VJRA 2AJTA 3UICA 2BF7A 4AI6A 4B3BA 4Z49A 5HW0A 3X43A 1SK8A 3RW9A 5A71A 4XTCS 2R6DA 3RYCB 1BU8A 3WBKA 2QP3A 4UNIA 3ETEA 2JGAA 3Q6IA 2YX1A 3C39A 3PBKA 5LZ5A 4YX9A 4IZ6A 4C30A 1T9AA 3QF4A 1N0HA 4ZT6A 1AKVA 1ZVJA 2O9JA 2V6FA 3BHNA 5GONA 5IW8A 4CHGA 5B6JA 5C7OO 5HZGA 1YHYA 1NVBA 2CBZA 2E6KA 2VAWA 3I1JA 2XDQA 2R25B 2OAQ1 3WHLA 2PN1A 2WLSA 4M49A 4LOJA 4PGFA 5FBQB 2EW1A 5GGXA 4X6YA 2O14A 2K7FA 2HMSA 4AU1A 5AKLA 4HAZA 2AG8A 1P44A 4FBGA 2WKQA 3DPSA 3H5RA 1XD9A 1B15A 1AB6A 1P5RA 1XNQB 1NAHA 3SPXA 3GEEA 4CTMA 5E9AA 2AA3A 3QVGB 4KYUA 1BCRA 1GZVA 5E6SB 2ODPA 5BR4A 4URXR 2ZU6A 2WMDA 4BVBA 2PWZA 3OJCA 1O77A 3TEMA 4B5LA 1WUTA 1MC1A 4LNAA 4IDGA 4MVJH 5LBIA 4H31A 2ZZKA 2Z30A 3IAUA 2NZVG 4FHEA 4OGWA 2WP8J 2FQWA 1N2HA 3U4DA 4IZHA 4CMJA 2YQ4A 5AJZA 2CHEA 1JFTA 2NX2A 4ZVLA 4BZZA 3M6XA 3SF8A 4XM2A 2ZGVA 2AVNA 4BMSA 3WGGA 3QI2A 2HK9A 3Q85A 4PCAA 4DXDA 2XZOA 2YTZA 2BFPA 3HSYA 2ODQA 3DP9A 4EHFA 5INTA 1CERA 1RI2A 1QZXA 3RROA 5JR3A 2HH9A 4ZQGA 4F71A 2Y66A 3ZLTA 3ZCXA 1CXZA 4C5AA 1QHYA 2CFOA 2IGTA 5AJHA 2QPOA 5CEEA 4MA5A 1QIFA 1FRQA 1T15A 3FYHA 5K45A 3F74A 4FX5A 2AIRA 1QXSA 5BT8A 2Y1OA 3NVKI 2O8CB 2A9OA 3FNRA 4V39A 4R8SA 4BNIA 2GN4A 2O4UX 3TLEA 5LQCA 2JLUA 2I3AA 2QXYA 2X9LA 1ODLA 1W96A 1ZK2A 3EZFA 4MA4A 3IP7A 4EY8A 1TYDE 4D4KA 4B34A 2AWNA 2RI6A 4S04A 1J97A 3ZVMA 3OQHA 2J9ZB 2MOKA 3NV9A 1VSBA 4Z2YA 2R1TA 1USUA 4DLSA 1NPDA 2O7NA 7REQA 2A4MA 2V6BA 2CXXA 1W5FA 3Q12A 4JYCA 4MWEA 4NABA 4EQZA 4UM9B 3ONEA 1KJIA 3ONWA 4PINA 4ZXFA 5MN5A 2VRNA 2W9XA 2G04A 3SNHA 2XTMA 3WLJA 1QK3A 4DCMA 3RWBA 3ZD9A 1OE0A 2VDVE 3HYNA 3L0SA 1P19A 4FLEA 1UKBA 3RIXA 3IDFA 1AZTA 2NT4A 4F2WA 1BQEA 4G41A 1NLZA 1KDTA 4WESA 3SQXA 1E96A 3ESCA 2G9RA 2HW8A 2DBRA 5HCIA 4N48A 3FGNA 4Z4HA 2A0WA 1JV2B 3ZJVA 1EGMB 1DHRA 4HGQA 5L45A 2I65A 4FEEA 1VSQA 3KBOA 3M2PA 4B6QA 4C4XA 1SXQA 2A14A 2AOXA 4L4RA 4LE1A 3JRXA 2C2YA 2HA5A 5TT0A 2UUPA 3ZI4A 5IM4A 2ZIXA 5LC1A 3PHHA 2PA3A 3JYHA 5FJJA 2DH6A 3H9BA 5BVHA 1MLDA 2EKQA 2IHTA 1N32B 1Y3BE 5IVIA 4AC9A 3EEIA 1PQPA 4Q66C 4GBJA 4UMEA 1EBUA 3MLAA 4JOBA 4GAEA 1GPLA 1YJXA 2EZUA 3GDOA 2FP3A 3PUXA 4BLWA 3FOFC 2X77A 2X8WA 4NBKA 2WM2A 5KJEA 3PKJA 4EHIA 4ZZ1A 1LBQA 3QWBA 1W8IA 4MB0A 3ZLUA 2YN0A 4EFKA 4FFOA 4ENUA 16PKA 5FPPA 4OUDA 5DGTA 1XLUA 2XBUA 3VC7A 2V6MA 3AUAA 4WBXC 2PUAA 3B53X 4O1IA 3SBXA 2HCBA 3PHGA 4LYYA 4LV8B 2JLXA 5FOUA 2A67A 1DQYA 4RSHA 3Q0IA 3KU1A 2FAXA 3AK4A 3K16A 3TQQA 2E18A 4ILEA 4ALJA 3BS4A 3M3DA 1FRZA 4XAQA 1F48A 2X0KA 4MP6A 3S2UA 4E31A 5MGBA 1YRAA 3AEXA 1S3SA 1XLTA 5SYAA 2P3SA 3FH0A 1IJFA 3FW1A 2RKBA 3R2JA 3UJAA 3W6OA 1M73E 1OBCA 4YCSA 1ISJA 4I1UA 1MIOA 3TUZC 3MGGA 4KEAA 4UNQA 2JFVA 2QR3A 2EBFX 5T3YA 4E70A 4QELA 3U4GA 2X86A 1SA0B 1UIMA 2FEPA 5DYTA 1AO3A 4ZAWA 3N9IA 3OA0A 2X5JO 3OD5A 4IVRA 2RHBA 3TEJA 4AT1A 2EC5A 4D9HA 1LY1A 3OX3A 5SYNA 1SCJA 3E5RA 2HN9A 3O4GA 4W5HA 1G0OA 2RKOA 3OQMA 1E18A 1GUZA 4I0WB 4FYMA 4UOEA 3UAVA 1JU4A 2BI8A 3QUAA 5CH5A 1PZGA 3X2FA 4UEKA 3D54D 4JDPA 5KOHA 4PHCA 4E5YA 1UMDA 3VR3A 5KMGA 3TRFA 4LOHA 1H23A 5BV2P 2QTZA 1OASA 4XWOA 1YKFA 2PH3A 4ESOA 5JJLA 2PGLA 1LDNA 1O94C 3QPBA 1NJ1A 1T0BA 2C61A 2VH1A 3PQ7A 4B2LA 3CWQA 4UBLA 3UOWA 2DXIA 1YKSA 2C3PA 4DLTA 2XJ4A 3DC7A 3EHDA 3DBIA 4JA2A 4TT3D 1V4NA 1URPA 5KOJA 4KXFB 5IJ0A 3L1VA 4UEJA 4JXJA 3PXCX 1LS6A 2NSLA 2ZIAA 2HEGA 4Q7EA 1F8GA 3QWHA 4QUIA 4TTJA 5KNBD 4XB6B 1DINA 2XNDD 2Z8ZA 3SICE 3BJRA 1CFJA 1U7ZA 4BNKA 3R74A 3B6IA 5JCPA 1CVLA 3GO4A 3FNFA 4JVOA 4OAOA 5ALVA 3D6MA 4OQEA 3SJ7A 1YDMA 1RM4A 3OM1A 1OIWA 3FSGA 3TDKA 3A6HA 2IYOA 3B5JA 3L01A 3DKIA 3A37A 3LLCA 2DFPA 4IQ4A 3WYNA 3BDAA 3Q40A 5REQA 2A0XA 2LCIA 5JPIA 4JLOA 4Q9JA 3STTA 1G17A 1XF9A 2JBHA 1KPGA 2Q5JA 1TIPA 1B4DA 3I9JA 3NTUA 1PT6A 3A4MA 3LBAA 2WZDA 4EH1A 4L7VA 4XIFA 1XVUA 4G0XA 3I52A 5SZHB 3W2HA 3JZFA 5JSYA 2G0TA 1LVGA 3F6BX 2PLFA 1NHGA 5IJZA 3SQWA 4FS8A 4YV0A 4A27A 3BXPA 1T3LA