4FDMA

Crystallization and 3d structure elucidation of thermostable l2 lipase from thermophilic locally isolated bacillus sp. l2.
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
378
structure length
378
Chain Sequence
APIVLLHGFTGWGREEMFGFKYWGGVRGDIEQWLNDNGYRTYTLAVGPLSSNWDRACEAYAQLVGGTVDYGAAHAAKHGHARFGRTYPGLLPELKRGGRIHIIAHSQGGQTARMLVSLLENGSQEEREYAKAHNVSLSPLFEGGHHFVLSVTTIATPHDGTTLVNMVDFTDRFFDLQKAVLEAAAVASNVPYTSQVYDFKLDQWGLRRQPGESFDHYFERLKRSPVWTSTDTARYDLSVSGAEKLNQWVQASPNTYYLSFSTERTYRGALTGNHYPELGMNAFSAVVCAPFLGSYRNPTLGIDDRWLENDGIVNTVSMNGPKRGSSDRIVPYDGTLKKGVWNDMGTYNVDHLEIIGVDPNPSFDIRAFYLRLAEQLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3D Structure Elucidation of Thermostable L2 Lipase from Thermophilic Bacillus sp. L2.
pubmed doi rcsb
source organism Bacillus sp. l2
molecule tags Hydrolase
molecule keywords Thermostable lipase
total genus 153
structure length 378
sequence length 378
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2012-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4fdmA00
2CBGA 3M83A 1MPXA 3RK4A 4FMPA 2Z8ZA 3LCRA 1WCYA 2C4HA 2OLEA 1XRQA 5F4ZA 3X3HA 4EA6A 1CUYA 4EHBA 4LIPD 2O2HA 3GBSA 4G5XA 1EDBA 4N8SA 4JYPA 1G4HA 1QFMA 5AM5A 5A62A 3AIOA 4G8DA 5HK8A 1XQVA 5E2IA 2C58A 1SCIA 1A8UA 4AX4A 2VEOA 5CT8A 2PU7A 3ZI7A 2E3JA 3WA6A 3DLTA 3G9ZA 3LP5A 1F8UA 3WWEA 5DLPA 5BWCA 1TCBA 3ZPXA 3R3UA 3G7NA 1Y7HA 2DHDA 5A71A 2DSNA 2RIPA 5SYMA 4W9RA 3A2LA 1VZ3A 1DWOA 1T2NA 5SYNA 3V48A 4BAGA 4K6GA 2HU8A 3HRHA 2ES4A 4HXEB 3DL4A 2WFLB 1BU8A 2DCMA 3DD5A 4G1FA 1JKMA 3R3ZA 4UUQA 2XUPA 5DTIA 1BEEA 1USWA 2XQKA 4OU5A 4ITVA 5ALWA 3FNBA 1UK8A 3C8HA 5K3BA 3HZOA 3H2IA 4RNCA 1XZHA 3HJUA 1P0QA 2Z3ZA 5ALDA 1LLFA 1R9NA 1S8OA 3MVEA 1XRLA 1E66A 3SK0A 3HC7A 5ALQA 4F5ZA 1CQWA 2C0PA 5JALA 2RAUA 2XB6A 4J03A 3C6BA 2HA2A 2J4FA 4B80A 1K8QA 5T4BA 1YB6A 3FBWA 1P0PA 1XKTA 3A2NA 3WK9A 2Y6UA 1JFRA 1YA8A 4BCDA 2ZYIA 3C87A 2WM2A 1P0MA 2WU3A 2ZJ6A 3E1GA 3H04A 1LPOA 4QLOA 2CZQA 1EX9A 1HQDA 3PE6A 5FXMA 5AI4A 2ZJFA 1JJIA 1ORWA 1CUEA 2AJCA 5DWDA 3WI7A 2BKLA 2ZSIA 4X6YA 3I2FA 1DT5A 2WFMA 4E46A 2PKYX 3ILSA 5AKIA 3C70A 2JBWA 5EHNA 5KWJA 3WK5A 4K6KA 2V97A 4U2CA 4B9AA 1GPNA 4ZI5A 1AC5A 1BCSA 5FPPA 4D9JA 4BVLA 1UOOA 1ZOIA 1Q0ZA 5BWBA 1XKLA 4OPMA 5C8XA 5AM3A 1K4YA 1JJBA 5DTJA 4N8EA 3OC0A 2H7XA 4Y9SA 4G9EA 2J4CA 1LBTA 4J0HA 3I6MA 3W9BA 1P0IA 3T52A 3LS2A 1WB6A 4GEGA 1RP1A 2WUGA 2WSLA 1LPBB 1X70A 3R3WA 3CCBA 2B61A 6YASA 4GLBA 1TK3A 2GBCA 4DMCA 1D07A 2WG2A 1XZCA 3AFIA 4BE4A 4JUIA 2B20A 5AI8A 1CUHA 5DJ5A 2HU7A 3GA7A 4J7AA 3AJAA 4YASA 2GYVA 5D6OA 4OU4A 4DNQA 5JADA 3FOBA 4PF1A 3QYJA 2QRUA 1K6EA 3E4DA 4BC0A 3H0CA 4WCVA 5I7UA 5JANA 3C6ZA 5D7BA 4LKOA 4KE9A 2HFKA 2PBLA 1IZ8A 2DFPA 5ALNA 3QPDA 5HKBA 1ZJ5A 3IA2A 2BJHA 5IVIA 4M0FA 1UOPA 4OB8A 1LNSA 2VATA 3D3NA 2I03A 5ALRA 1UXOA 1ACLA 2HDWA 2PVSA 1EXWA 5JASA 1O6FA 1J07A 1ODSA 5ALYA 2PSFA 5JD6A 1R3DA 4PSDA 1QO9A 2W22A 4H7JA 1H22A 1CPYA 4RPCA 4KAAA 3PF9A 4WDRA 4BTVA 3O95A 4LXGA 1XQXA 1QO7A 3ESAA 3F96A 2WFZA 5CURA 2O7VA 2WJ3A 3WYDA 1W6RA 5ALPA 3BIXA 3DKRA 4JH0A 1CUFA 1E5TA 4CG3A 4EY7A 1WPXA 1ZD3A 3DYIA 3FAKA 5AOBA 3KWJA 4BP9A 5HF5A 3G9XA 1H2XA 2GBIA 2UZ0A 3QITA 2AJBA 3D5EA 4MXDA 1BN7A 2VSQA 2OCGA 3FSGD 2EEPA 2JGMA 4AO7A 3WK6A 3ANSA 3VDXA 2QT9A 1ZGCA 1LPPA 3EF3A 2HRQA 5AHXA 3IUJA 2VJCA 3DS8A 4C87A 2IIVA 4XIIA 1XZBA 5K3CA 4I4CA 1U65A 4BDTA 2HM7A 1XRRA 4EY8A 4H7HA 4B7ZA 1SOMA 4DM7A 4DGQA 5EHQA 4Q3LA 1EB9A 2Y1KA 5CH3A 2BUCA 5C8ZA 1TAHA 5DYWA 4BYMA 4M0EA 2WFLA 1HDEA 1YCDA 1PFQA 5C81A 4GI1A 4GXNA 4W1PA 5EHZA 2CJPA 3W04A 5T4EA 1WB4A 1CUAA 4INZA 3PUHA 3H1BA 3WK8A 2PX6A 2ZYSA 2HA3A 4AN1A 3IULA 4AXBA 5HKAA 1AGYA 4ETWA 5CRIA 4UHCA 1H23A 5HF6A 5ALOA 4QEKA 4DMHA 5ALMA 4KR0A 2PUHA 2FJ0A 5K3DA 2OG1A 1HBJA 3D2AA 4Y2YA 1SFRA 2ACKA 1W76A 4PSUA 3WWOA 3STVA 1EK1A 1ZI6A 3DKKA 3FWHA 4OYLA 1EH5A 3UUEA 1AMNA 2QVBA 5CXXA 4N5HX 4A23A 3BJMA 3G8YA 1CQZA 2JGJA 2XMCA 4ZV9A 3QBJA 5HQ3B 1ODCA 5AM2A 3IUMA 4F21A 3NOXA 1DQYA 4ZWNA 5E4YA 2GZSA 2FUKA 4QDOA 1QONA 1QIMA 2BUAA 2H9YA 3TRDA 2R8BA 4Q05A 2OCIA 1C4XA 4WFKA 4X94A 3G9TA 3M3DA 3IUQA 3PFCA 5I9IA 2CEKA 3MUNA 2C0QA 3DOIA 3HSSA 4H18A 1CR6A 1BCRA 1MAAA 2QMQA 1PV1A 4QDXA 4NZZA 1HKHA 3TEJA 4KE6A 4QDUA 1IVYA 1DWPA 2EDCA 1G42A 4X91A 3VJLA 1YSCA 4FTWA 1WOMA 2XUAA 2R11A 3D7RA 4MWTA 2RHWA 4B82A 1N5MA 1MJ5A 2QUBA 3R41A 3U1TA 5AKKA 2OCLA 5H3HA 1LPNA 3AIKA 5ALFA 3BWXA 4X6XA 3FVRA 3D0KA 1EVEA 1LGYA 1XZKA 4MYSA 4OCZA 2O2IA 3WLAA 5LZ4A 3CN7A 1CLEA 2OGTA 3I6YA 2WJ6A 3WIOA 2BGRA 3BIWA 1DX4A 4HAIA 1QTRA 1YS1X 4B84A 1I6WA 4Q3KA 1RWQA 2VT6A 1A8QA 2HADA 1R9MA 1QIFA 3F98A 1T4MA 5C7YA 3ZWQA 3H1AA 3QVMA 4KACA 4PO3X 3HYSA 3K9BA 5AKEA 5LZ8A 5ESRA 3G02A 3FVTA 4KRXA 4PSCA 3R3YA 5JAPA 4UBOA 5AM1A 1LZKA 1QIHA 4GWLA 3T4UA 1UK7A 3PICA 3WJ2A 3KXPA 1XROA 2I3DA 3JYHA 5KREA 2WHPA 3WKAA 4TGLA 4QE3A 1BRTA 4ZV7A 1AX9A 3IDAA 3Q0TA 5ALGA 4ZREA 4EY5A 5IVKA 2VQ6A 1UKCA 1XZEA 3G9UA 4CCYA 3C6XA 4F0JA 1UT6A 1W1IA 1IMJA 3WL7A 3NUZA 1EI9A 2P8SA 3G0DA 1UK6A 3LIIA 1SCQA 5ALTA 3FLBA 1JMYA 1CUZA 5AO9A 1VE7A 4B83A 1QIJA 2WTMA 3BL8A 4UHDA 1Q0RA 4C4XA 3M81A 3EQ7A 4UHBA 1PJAA 2JGIA 4ZGBA 1EHYA 4X6UA 3UUFA 3GZJA 3GELA 5ALUA 1A88A 3DEAA 5FKJA 4DNOA 2JEZA 3WWCA 1YR2A 3QMVA 1YA4A 2FJPA 3ESBA 3WL6A 5FP0A 5K3FA 1E8NA 2QXTA 3STYA 2WUFA 3PF8A 3QPAA 3A70A 2Z3WA 1XZAA 3QPCA 3ICVA 4FLMA 1DT3A 3OOSA 2XUFA 1MT3A 5ALZA 4BC1A 3WL8A 3ESCA 4O08A 2ZYHA 4ZXFA 1EDDA 2I78A 5HCUA 4E11A 2H7YA 2WIJA 3NWOA 4MEAA 4FWBA 2QXUA 2IITA 4WFJA 4CCYB 4UHHA 5CT6A 4GBGA 4OSEA 2OQVA 5JZBA 3E0XA 3IUNA 1AKNA 1CUSA 5DYYA 3WZMA 1VA4A 4OUKX 4BZZA 2JF0A 2CKMA 3R3VA 1EA5A 1GKKA 4XX1A 1CIJA 3CN9A 1ISPA 2C5FA 3GUUA 1VJ5A 1XQYA 3KWFA 1DQZA 5DNUA 2O2GA 4I3FA 2OGSA 2XMZA 5FPQA 2AJDA 2J3QA 4YPVA 4BDSA 2PM8A 3V1LA 2PPLA 3KSRA 1KEZA 5LIPA 1ZD2P 1XLVA 3P2MA 4IO0A 4RE5A 3AUKA 2GBGA 4HRYA 4X71A 4WDQA 3IBTA 5CT4A 5E4JA 1LPAB 4J0IA 4YX9A 5KBYA 1LPMA 2AJLI 2QS9A 1EDEA 2WKWA 1N1MA 3B12A 4W1QA 1MNAA 7YASA 1TQHA 2ONCA 1F6WA 1ZIYA 3K2IA 3WKCA 1L7QA 1QIGA 2DQYA 1GPKA 3K6KA 1XZDA 2D0DA 1L7RA 1GT6A 4Y2SA 3LLCA 3I6ZA 2BCEA 2WG1A 4JYMA 1CUDA 3RLIA 2XQJA 2JEYA 2HA0A 5JAHA 1CUXA 3C8DA 4H7DA 5JZSA 4C4YA 3DOHA 2XQIA 3O4IA 2WIGA 4AB1A 2WJ4A 5AI5A 3D4LA 2PSDA 3V1NA 4UFPA 3SWWA 1TIBA 1F0PA 5EIEA 1ZIXA 4E14A 4J0CA 2VTVA 1QLWA 2HA7A 3G0CA 3W06A 4BBZA 4UFOA 4W1RA 3F9CA 4FNMA 2GYUA 3AILA 3PFBA 5DNWA 5JARA 4LHEA 3H2KA 5AK5A 1GGVA 3JWEA 5AKXA 3RM3A 3WKBA 4Q82A 2NW6A 4UBJA 1FFDA 1BROA 5C8VA 1R4ZA 4PW0A 4LXIA 4BVKA 5JAUA 2YXPX 2XUKA 3DCNA 5CH5A 3QMWA 5AKZA 1MTZA 5LKRA 4WY8A 3FYUA 3FLAA 4U2EA 3NGMA 5DYTA 1QZ3A 1G5FA 3I1IA 1K5PA 3F67A 5FDFA 2GYWA 3IIIA 4UBNA 1F0NA 3JW8A 5FV4A 3MUOA 5AKHA 3W05A 3VKFA 2PUJA 1YASA 4HXFB 1UOQA 3GFFA 1H2YA 1B41A 1W75A 1EVQA 4Q1VA 4QWWA 4FDMA 5LZ2A 4FNGA 4LXHA 4EY6A 2VJDA 1GQSA 5FLKA 2V96A 4MYDA 4UPDA 1A8SA 5AIAA 1DWQA 3PUIA 2XUJA 4G9GA 4A16A 1WHTA 4PV7A 1AUOA 3RARA 2XMDA 4B9EA 3AZOA 1FFCA 2XQGA 1DTEA 4DYHA 5CBKA 2QR5A 3WK4A 5A7GA 5AOCA 1DX6A 3IURA 3QM1A 2WIFA 1Z68A 4OYYA 5AKGA 4G4IA 2DR0A 2JGKA 3H2HA 3H2JA 4CI9A 5IKXA 3OM8A 2OGZA 4EZIA 4Q3OA 3DJYA 4TVKA 2QUAA 3FCXA 2ZJ7A 5A7FA 2OXEA 1QIDA 4X93A 3OURA 2OAEA 4CFSA 4QZVA 1VXOA 4UBLA 1XZLA 4FOLA 3V1KA 2OPHA 2YYSA 2V9ZA 4YK7A 2HL6A 1OXMA 2XMSA 2QOEA 3FYUB 3WMRA 1FFAA 5D3KA 1QOZA 1XZJA 1NU8A 1M33A 1GKLA 2OCKA 1JJFA 4FLFA 4KAFA 4CIAA 4EY4A 4G8CA 5ALEA 5JZ9A 5HF8A 5HFAA 2VT7A 2HA6A 4FLEA 2WIKA 3C5WP 4G8BA 5AI0A 4RE6A 5AKLA 4KRYA 1CUUA 1C7JA 2C5GA 2W6CX 2X5XA 3D59A 3FYUC 4J0GA 4J0DA 4H35A 2HU5A 2VJBA 4AO8A 4QDTA 4LYDA 5BOVA 2ECFA 4AO6A 4P9NA 1QJ4A 1QIEA 4DSAA 2XT0A 3DQZA 4BVJA 5FOQA 4GHWA 4NVRA 3FCYA 3CXUA 1J2EA 1NU6A 3SC2A 1Y7IA 2ZYRA 4EBBA 3KD2A 3EQ8A 4XVCA 5AJHA 3EQ9A 1MO2A 3VJMA 5EIAA 3O4JA 2G5TA 1MU0A 5AI9A 1ZJ4A 2OQIA 4S0XA 4DIUA 4BZWA 4ZRDA 1KU6A 1CUWA 2ZVDA 1CUIA 1KU0A 1MX9A 3I1YA 4DMFA 5CT5A 3HLKA 3ICWA 5AIBA 2ROQA 4B85A 2OAGA 3WWDA 1ODTC 4N5IX 4XJVA 4L72A 4Y2JA 1E8MA 2DHCA 3ZLUA 1XZIA 2JGEA 1HLGA 4C01A 1XFDA 4LYEA 1VKHA 4X7BA 5ALJA 2BFNA 1YS2X 1WB5A 5AK6A 2PSHA 4G4GA 3I2IA 3EIOA 4U2DA 5ALSA 4P93A 4U2FA 1MX5A 3WJ1A 1THTA 4WFIA 3F8SA 1J1IA 3B5EA 4ARAA 3A6ZA 2Y6VA 4AMZA 4F60A 2JGFA 4QDZA 4J0KA 1ZICA 3HEAA 1U8EA 4H7KA 2X76A 4FBLA 4U2BA 5CTAA 2DQZA 3W2TA 1QFSA 3O9VA 5YASA 2D5LA 1MAHA 1OCEA 4AN0A 1QGED 4H7FA 4L9AA 2XUQA 3ESDA 4X95A 1AZWA 4HZGA 5AH0A 2ACEA 1VXRA 3S2ZA 1EB8A 1GXSA 3C45A 2VF2A 1GPLA 5LKAA 5ISMA 1JMKC 2B9VA 1CUCA 1EK2A 4UFNA 3KDAA 2HRRA 3FSGA 3R0VA 3PDCA 2O7RA 1ZI9A 2QTBA 4GW3A 4Y2TA 2PU5A 1ORVA 5I8PA 3QMMA 5T4FA 5EIHA 4FFVA 1ACJA 3F97A 4B6GA 3H17A 1U4NA 4XWGA 4ROTA 4FBMA 1N5RA 2YH2A 1E89A 5ALIA 3HXKA 2RHTA 5K3FB 1CRLA 1G66A 2Z8XA 4K5QA 4OB7A 4L0CA 5K5EA 1VOTA 4K6HA 5IVDA 1UZAA 2WUDA 2BUBA 3SX4A 1TCAA 3OTQA 4E15A 3BE8A 4HXGA 3STWA 2JIDA 4CG2A 3WK7A 1TCCA 1QE3A 3G0IA 5JD4A 1DINA 3HI4A 1CV2A 5JIBA 2G4LA 4AMYA 1AQLA 4QWMA 2XE4A 2RONA 5IVHA 2PSJA 2X8BA 5LYYA 2XUDA 3BF8A 1QIIA 4BCCA 4H0CA 4IH9A 1GQRA 3R3XA 4OB6A 3LIPA 3AINA 1RYYA 1CFJA 4BCBA 5KWIA 4PNZA 5FRDA 1Q83A 1XLWA 4IQ4A 5AOAA 1YAJA 3WQHA 3OPMA 4IH1A 1BE0A 1E3QA 4G4JA 5JATA 3UMJA 4OD0A 2XI4A 2XUIA 4B0OA 1L7AA 5LZ5A 3O9MA 2G5PA 4Y2XA 1X2BA 1Y37A 2ORYA 5ALKA 2CUTA 2XMRA 2VA9A 3BF7A 3STXA 1J06A 4Q34A 1BN6A 5ALHA 1CUGA 4MEBA 5JYCA 3O0DA 1TRHA 4AQDA 2Z5GA 3AZQA 1CUJA 3VXKA 5AKYA 4DTCA 3I2JA 2H1IA 2YASA 1GZ7A 3S8YA 4MQLA 4BB0A 1EINA 1R88A 4QA9A 2IX9A 2Y2UA 1H2ZA 3H2GA 5HK9A 1W4LA 1IUOA 3B3QA 4Y2UA 4KE7A 4X92A 4X90A 4M0MA 1W52X 4IH4A 5AM4A 4EUSA 1FJ2A 3AIMA 4W1SA 3G0GA 2AJ8A 5AP9A 3Q8WA 4U2GA 2XMQA 2PL5A 2XMGA 4IHAA 4BTLA 3QZUA 1HL7A 3V1MA 4FKBA 2RI6A 5AK4A 4UBMA 2FX5A 2I3ZA 4FHZA 1JI3A 3H19A 3WKDA 4CIBA 3A2MA 1LZLA 3AZPA 2B4KA 2XUHA 1LBSA 5EI5A 2BAGA 1B6GA 3VISA 5A2GA 3ZV7A 1CEXA 1DU4A 4C88A 3WA7A 1O6GA 2WILA 3D2CA 4ARBA 2EDAA 5LP1A 1VA5A 1XLUA 4RGYA 3YASA 4B81A 3DDUA 4NMWA 1CUVA 5AI6A 1FFBA 1XRMA 1XZFA 4J0JA 4KEAA 5K3AA 3R40A 4DLNA 3IB3A 2RGUA 5CT9A 3ED1A 2WHRA 3BDIA 5E4TA 1UK9A 5CXUA 2WUEA 3HABA 3L1JA 4Y2VA 2HHAA 1MN6A 3RKSA 1WPRA 1BS9A 5EFZA 4PQEA 5AKJA 2XUOA 4FFWA 4BATA 4BAZA 2WLSA 4GDMA 5EHXA 1WHSA 4C4ZA 4X85A 4B0PA 3BXPA 1UKBA 1XRPA 1BEZA 2K2QB 4TPKA 3BJRA 3ZLTA 2QJWA 2QM0A 4DSZA 4K2AA 1XQWA 4UBKA 5AICA 2AXEA 2WQZA 5HFNA 2G63A 4BE9A 5CMLA 4P92A 3U0VA 2XLCA 2JGLA 4CCWA 1H2WA 1XZMA 2C7BA 2CB9A 2VJAA 3I2KA 1IUNA 3WL5A 4BAUA 1VLQA 1K63A 2GZRA 4A5SA 1VE6A 2WG0A 5T4HA 4C6HA 3V9AA 1UKAA 3MGAA 3D2BA 3VVMA 4JEIA 1IZ7A 3WZLA 4NS4A 2QJRA 1N8SA 3QH4A 4UHEA 3I2GA 4H7EA 3VJKA 1C7IA 3EBLA 4BRSA 4KE8A 2DHEA 3CCCA 1QTIA 4BRZA 1JU3A 2XQFA 1HPLA 4KYVA 4WY5A 5AM0A 5ALVA 1OILA 5K3EA 4UBIA 4UHFA 1MNQA 5AK3A 3N0TA 4AZ0A 1XZGA 2QKYA 3TJMA 4QLAA 1SCKA 3KOOA 3IVMA 3M82A 5LLSA 4WJLA 1VZ2A 5ALXA 1SC9A 2H7CA 4Y2QA 3STTA 2BGNA 3DNMA 4H77A 4MWSA 3L1HA 1THGA 3VVLA 1JT2A 3WWPA 3TGLA 1AURA 1XRNA 3BDVA 5HQ3A 4KAJA 1MX1A 5CH8A 4HTAA 4MJ3A 2Q0XA 1UWCA 1JU4A 3O4HA 2LIPA 2HIHA 4I19A 2GBFA 1CVLA 1FFEA 4JNCA 5J3JA 4N8DA 1R1DA 4V2IA 3ZLVA 3GROA 2WHQA 2Y2VA 5JD5A 4DMKA 4MQMA 1R50A 5FUMA 2HA5A 2WIDA 3DL7A 2VAVA 1ETHA 1FSSA 1TKRA 4J3JA 4L3WA 3FYTA 4Z49A 3C43A 2HA4A 1ZGBA 4BP8A 4W63A 3N2ZB 1YAHA 3I2HA 2XDWA 4GECA 3H18A 4Y2PA 1UFOA 1WM1A 2QZPA 5DNVA 4H7IA 2ZSHA 5LZ9A 1LPSA 3I28A 3O4GA 5D3ZA 4KJXA 2WHPB 4DNPA 4QNNA 2XUGA 4CG1A 1QIKA 2WTNA 2XLBA 1A7UA 3ANTA 2HFJA 1CUBA 4C89A 3DYVA 4Y7DA 3C6YA 4DNFA 2PSEA 4HVTA 2J3DA 3FLEA 3OG9A 5EGNA 3WKEA 3WYNA 1ZD5A 1NX9A 5JAOA 3PI6A 4P08A 5IH7A 1X2EA 1YB7A 5ALLA 2VAXA 5LZ7A 5HF9A 1U2EA 4HRXA 5CW2A 2CMFA 5A6VA 2XMBA 4HS9A 4Y2RA 3STUA 3WIBA 1IUPA 1E8DA 1Q84A 4X97A 3G0BA 5HZGA 4EB0A 3L1IA 3HACA 3E3AA 4AZ3A 4X00A 1ZI8A 5BV7A 3C5VA 3W9UA 2WU4A 1ZD4A 4X3CA 5A7HA 2V98A
chains in the Genus database with same CATH superfamily
3PEVA 2CBGA 4B73A 5KJ6A 4MGZR 4DR5B 3T3OA 1U8AA 1ZH8A 3RK4A 4PICA 1MX3A 3QFHA 4FMPA 3SIXA 3UMFA 3UAVA 5DFAA 2QPAA 5BURA 5HRAA 2OEPA 1ZWKA 2C4HA 4I9NA 5TF4A 5EQTA 2OLEA 3EXHC 1WXHA 1QGYA 3OD5A 3QF4B 4EHBA 5IAKA 4L6AA 1CZLA 2QU7A 1PWXA 2O2HA 4LOLA 1YFKA 1ODJA 4YJGA 3UCEA 1Z2OX 4IO1A 2Y05A 4RFSA 5KTYA 5JW6A 3P9QA 5AHRA 5IFLA 1PX2A 4HWRA 4F2WA 4TUYA 1TW3A 3NDBB 3GAAA 4J07A 2NOAA 5B58C 6REQA 1PG2A 3EHDA 1YB1A 2EL9A 1J56A 1VJ1A 4J16C 5D85A 4A0HA 4F2GA 5K0SA 2B1GA 5AM5A 3TSWA 3T12A 1DAGA 5AK0A 4KIUA 5TQVA 3RB8A 2XZLA 2V5AA 4G8DA 1LBHA 2CZCA 5KSPA 1QYXA 1EFPA 1BXGA 1KK3A 2HKIA 5F76A 3H8WA 1QR6A 5F35A 2ZDQA 1E1CA 4E21A 5CT8A 4Q4AB 1CDOA 3A6HA 1DXYA 3GMSA 4G1CA 3ZX5A 1G59A 2PMFA 5LP6B 2W83A 2D3TA 1YOVB 4JT9A 5F7JA 3BFPA 4JUBA 2F3UA 4Q19A 1EVJA 4RLHA 2COEA 3LP5A 5D1NA 4UNRA 3BD7A 1NNEA 3EE6A 1YS7A 2YBDA 3QSYA 5BWCA 1IXSB 1SG0A 4QPNA 2I2XB 1Q6YA 3G7NA 4BJ5A 1E6EA 5JS8A 2JJ1A 3PUKA 4UREA 1NJ6A 3K0BA 2E4WA 3BE5A 4X1KB 3HR7A 1MKYA 3ZWWA 2HLDD 5GADl 1V6AA 3CEJA 4WI1A 2ZT8A 4OSPA 2RIPA 3FI9A 4FGWA 3JZMA 3FTQA 4W9RA 3TG2A 1OLSB 2I66A 4BNHA 3EVBA 3ZVRA 3QPUA 3Q2OA 2J0UA 3FIJA 3IJEB 5LQNA 1PFUA 3NDRA 2Q2VA 4S1TA 1ILEA 3JCZA 2R47A 3U48A 3O4FA 4Y0VA 3SZGA 5A3JA 1T6ZA 1SZCA 2WFLB 3DL4A 5CB6A 4BNGA 4U9UA 2NT4A 3PZBA 4UEQA 3P2KA 3KHKA 3DD5A 3TDNA 2WP8J 2FPIA 3FY4A 3H83A 4B5LA 1NIPA 1W8DA 1E98A 2CCGA 1JKMA 5DTIA 4AJ9A 4XWOA 2Q0HA 3K92A 1J8YF 1BEEA 2ACVA 2BFEA 2H92A 4OU5A 4GSKA 4B4UA 1RHMA 3JQBA 4LHZA 3ZNQA 1WB9A 4RELA 1W5AA 2AWOA 5EXXA 2IBSA 1S4QA 3K2QA 1RQLA 2FZLA 1E7WA 3F4KA 4KDCA 4DA7A 2Q7OE 3F8WA 1K7EB 2XOKD 3I01M 2CMKA 4D6YA 2Z3ZA 1FX1A 4BS9A 2HLHA 5EIBC 4D0RA 3JZDA 3MSXA 3GEIA 3T9AA 2NQ8A 3TIIA 5IT9A 1MO6A 1ZRMA 1R9NA 4HGRA 3TOVA 1G20A 3OEYA 4XGNA 2BMAA 1NM5C 1U7UA 1V39A 1X8LA 1UBSB 2C4KA 2PWPA 3KU1A 4F5ZA 2FPMA 1KQPA 3CYFA 4HAZA 1JR2A 2NPIA 3NTUA 5F2KA 1E3TA 1KNXA 3MAGA 1UIRA 2OVFA 3CB2A 3QKTA 5CXQA 4F4CA 2A5LA 4F9FA 3C6BA 1I2ZA 2JZOA 3JATB 2FSVA 2H9IA 4LJ5A 3ZWNA 2HBRA 5SICE 3R9KA 3II6X 4ATNA 2EFYA 4R0MA 2E4VA 1UZMA 3A9UA 3JWIA 4ZDKA 3RHSA 1I5RA 1P0PA 3AOGA 3SQNA 3ZH2A 1DOZA 2JHAA 1GRRA 3WK9A 3VZCA 2BT4A 2QE6A 3EZLA 1JFTA 3MYYA 2LV8A 3DW1X 3LUDA 4JBXA 4OM7A 2WM2A 3T9BA 5AJTA 3W1EA 1IHYA 1P0MA 2WU3A 4G0WA 5D01A 5KOJA 2CSUA 2OYSA 3E1GA 2OGUA 4A0RA 3ZQUA 4UXHA 4U0JA 1RCTE 2BDEA 1KY3A 1BXRA 4RTJA 2ZE6A 5ER9A 5FXMA 5K6AC 2IUYA 1PJCA 5BQOA 2O8CB 3ND7A 4UKDA 2O3UA 4LJ7A 2VUSA 2BEUB 1V3VA 3B36A 3GEHA 5DWDA 1A5AB 2CUZA 3QXCA 2ZSIA 2QAGA 4YEDA 2DU8A 5A3SA 2RIRA 3ZHZA 5FR1A 3G59A 2XNKA 4BQRA 3IOYA 3VR4A 2PXCA 3E82A 4HNSA 2JASA 3LUBA 1ADFA 3DTVB 1DQNA 3MD9A 3GJ3A 4NS1A 4OMDA 3VO8A 1I4TD 4E46A 1FVHA 2PKYX 1V43A 1K9VF 2WAXA 1XBTA 3GP5A 1E0JA 3K5IA 5TT0A 2JJ2D 1C7ZA 2H9AA 2IUSA 3MJRA 3GI1A 1OZFA 4P81A 3HZHA 5AKIA 4CUZA 2JBWA 3LSYA 4UPEA 1TJ3A 2GK7A 3TM4A 2JI9A 1A9RA 2H2HA 1M6YA 3E27A 4LPSA 4PQYA 3IKTA 1S89A 1ZGZA 4HJXA 1BCSA 4XR9A 4D9JA 4QAQA 2CBZA 3EMVA 4LJ4A 4ZRNA 1XPRA 2GJ9A 2JLAA 1E0AA 1Q0ZA 4GC9A 1L1FA 3RPEA 5LQUA 1XKLA 3DE0X 1JPUA 2X13A 1CY1A 1LA2A 4OLHA 1H2HA 1K4YA 5C8XA 4KLZA 1USIA 2VZ9A 3K70B 1G63A 3RS2A 3SEQA 3IA7A 3WMEA 3G2QA 1RVV1 3HS3A 2GA9A 3KVOA 3P0HA 3QXXA 4Y9SA 3FDXA 5C1DA 1Z33A 3RTAA 3SJUA 1NHWA 1CQJA 3ZN2A 4HMPA 4HNTA 1AK2A 4ZCMA 1J1UA 4JP5A 2RGCA 2YMQA 1D2MA 1MO4A 2WM9B 3I6MA 1CU1A 1P0IA 3E81A 4U7FA 4LS3A 4HH4A 5K0NA 3T52A 3TNJA 3UOAB 2X1LA 2PKQP 2JLXA 2QX8A 1GXSB 1A9YA 1F8YA 4TQ9A 13PKA 4FYKA 3QOXA 4G4SO 4UTOA 4GOOD 1W85A 1LPBB 2BGTA 2CLSA 3DDOA 3KYBA 4LTNA 5F1OA 4KPFC 4XDYA 2R0QC 1YS4A 4ZKDA 3QK7A 5F3WB 1IRXA 3K16A 4RA9A 1Q0SA 4JQSA 1Y33E 3QIAA 4V0QA 4OQEA 1EFPB 5SY6A 1G2OA 1A2OA 4QELA 3HY6A 5CX4A 5BSRA 3TZQA 4GLBA 1V16A 5B3KA 1N25A 1PO7A 2DGDA 2X5OA 1CVIA 1VMEA 3KT0A 3KYCA 1D0IA 4JT8A 1C0LA 1D07A 2WG2A 4HTFB 2ZYWX 4DMCA 3F1KA 3CVXA 2W4MA 1F1JA 4IINA 3W1WA 4BE4A 3EPJA 3KAQA 4NFHA 4DLAA 1JSXA 1Q1NA 3ZHCA 1KYWA 2O2JA 1DRUA 3NHUA 5AI8A 5BSHA 5HDQA 4YASA 4LGMA 4BLOA 3JAMA 5F5XA 3RQSA 4CMEC 3BE4A 1ANKA 1MJGM 4OU4A 3UK1A 4FOOA 1R0ZA 4DV4B 1DV1A 1XTSA 1G7CA 4FJ1A 2B34A 1VSVA 3A4VA 4RQTA 3QBDA 2HPAA 3CISA 2TYSB 5FOWA 2NVWA 1P1CA 4RQUA 3PQ8A 2GCGA 3H0CA 1Z4LA 4KYTA 1IJEA 5LVAA 5BYKA 3WSTA 4X65B 3C3AA 1VCOA 1HO3A 5HMMA 3TW0A 3ZU6A 2CE2X 2I6GA 1R4MA 4L3VA 4KE9A 1VPLA 2HFKA 2VVTA 2PBLA 1EM8B 3DBLA 4LCBA 4YCDA 1JKFA 3HU3A 3TR6A 1TT5B 5ALNA 3PXAA 1JEYA 4KFUA 5HKBA 2IHUA 4HF7A 4P7JA 2O4UX 2XA1A 1ZJ5A 4CUKA 2F48A 2JHPA 4AAYA 1QH9A 3EFHA 2XZOA 1OB5A 1X7GA 2OWDA 3EWNA 1M5TA 4CEIA 1T8PA 2B8TA 3ZBPA 4D8YA 1J8VA 1HDRA 3B7GA 1DADA 1C3XA 4IIJB 1E2FA 1JU9A 5J63A 5ARDA 4FZRA 4KHPB 1LNSA 2VATA 2SKEA 4R1UA 4ES6A 5JFOA 3OI7A 3TFQA 4O2BA 1UXOA 3M1AA 5F33A 4PBSA 3WB2A 2HDWA 1M34B 3NIWA 5CBPA 2QW0X 1Y6ZA 1UT5A 1FZTA 1XZ8A 1O6FA 4G1BA 3C85A 5IKEA 5BNTA 2VYQA 5CB0A 4ZVTA 1UPXA 2GSWA 4XVQA 4GOND 1G6KA 2IYVA 2QRKA 5ALYA 1BDIA 1NJ2A 4TMKA 2PIAA 4W9MC 4PU0A 2PSFA 5BQPA 1R3DA 1Q3TA 4PSDA 2X8JA 4V0KA 4JIMA 5E7MA 1LXCA 1P73A 3WY9A 1FQWA 4GMFA 3BCRA 2W22A 3AEZA 1H22A 4HUTA 5CPFA 1SHJA 3QXSA 2O50A 3DG9A 2RG7A 3A4NA 2YVUA 2ZYTX 3DH0A 3UGKA 1KQNA 3WP1B 5K0ZA 2ZWOA 1G8KA 1WUJS 3H3JA 3G2NA 3O95A 4L4SA 2B5VA 3RC3A 2GPSA 4D56A 3O2JA 1M1NB 1KFCB 2QV0A 1C41A 3O7MA 1SXJE 3RUDA 2EWVA 2O7VA 4FCCA 3P9SA 2VDRB 4N0MA 5C0OE 4TWRA 1GTVA 2VSNA 2GOYA 2PZAA 5HA5A 4H1HA 3MJEA 1T4DA 4YMIA 2FMIA 1FDOA 2FETA 2OPBA 3DZBA 1GFZA 2XWSA 3QGMA 4U0KA 4MZDA 3C48A 3NDJA 1F3OA 5BN3A 2JJ1D 4O63O 2AFHA 3CC8A 4EY7A 2ZJ0A 3F6PA 4TROA 5KVVA 2PT7A 3O2QB 4PGAA 2C2XA 3INTA 5JRJA 5HF5A 1R8YA 1H2XA 1RRPA 4FC7A 1E6LA 5EAIA 4OQPA 3CSDA 4INOA 3E3OA 3QUQA 4KR2A 5HKKD 3KUDA 3D5EA 1UP7A 5KVQA 4MXDA 2PN1A 3DEFA 3C1TA 1BN7A 4QEDA 2D1TA 1H8HA 1TAGA 2IYZA 3MGGA 2GDJA 1EWKA 4R1NA 5J2TB 1YVDA 3FSGD 2EEPA 4N6NA 1PLLA 1QAOA 1ZHHA 3ANSA 3ZGLA 2NZVG 2QT9A 3VRHA 3TSZA 1LPPA 1T26A 1FUEA 2ODPA 4U7GA 1KZ9A 5B57C 1Y8AA 4ISBA 3L6BA 3CRZA 3Q3VA 4X62B 1E5XA 1WSAA 4AP9A 2IDJA 4WK2B 3BWCA 4FGLA 3TTUA 2V7VA 2P1RA 3IUJA 4LXYA 5KKAA 5LPNA 1ZVJA 3B1ZA 4PAMA 1CRZA 2VKTA 4RCYA 3IUEA 5FHQA 4DCTA 3WAKA 1YQTA 3CB4A 3OQIA 4NIMA 3RYIA 4CODB 4BFVA 1XV5A 2A5FA 4FU0A 4H4DA 4NY1A 5CX1B 1NXXA 3B1KA 4RXMA 3FMGA 3RU7A 4DZTA 3FMIA 5KHAA 1AHIA 1YHNA 4XIIA 3SNKA 1A4UA 4GWKA 1X1QA 5A3VA 5DWVA 2ZB7A 3D7LA 1MQAA 4HWOA 2FPSA 4XEHA 2HM7A 5DRTA 1PYGA 4FFPA 2O1WA 3OZRA 1Y6RA 1XRRA 4LQCA 1US8A 4NARA 3K9HA 2I2AA 4ND7A 4NV3A 3WYBA 3QFCA 4NC9A 3SSNA 4BFUA 1Y7TA 4J0QA 3CMCO 1XK6A 1LSSA 4MV3A 3AM3A 1J70A 1KARA 2A57A 1Z0SA 1I33A 2H16A 1QBGA 1DKLA 5LU9A 5MN5A 4PHTA 5CH3A 5AVUA 2RHCA 3FUXA 1QCCA 5JCJA 4M0EA 3H4IA 2VO1A 1BGWA 1HDEA 2EFCB 5HRUA 1H65A 2ECOA 2OAQ1 1WSBA 4P6VF 5A4AA 2C9DA 1O8BA 2DUUA 4PLPA 5EMLA 4FMDB 1N34B 2HEGA 2O8EA 3V4VB 1GZVA 3L7AA 2YWFA 4GI1A 4JMLA 4YJFB 3UW1A 4EGQA 4KHZA 3BS4A 4NCBA 4W1PA 2XDAA 1ICEA 4ZQBA 3CZ5A 2CJPA 1I0IA 2WMYA 3DR5A 3CF0A 4AG6A 3Q3GE 2GM5A 2XD9A 1A5TA 2NU7A 3GZTB 1MPTA 1UBTS 1WB4A 2RDMA 1WETA 1M2NA 1PDVA 1PJ2A 2Q9CA 2XY4A 4INZA 4AC9A 3RUAA 3UCFA 5IKOA 2O5EA 1P1HA 2Q6VA 3COZA 5E0KB 3DM9B 4UVHA 1AIPA 1Y34E 2ZAOA 3IELA 1C81A 2EJWA 2B69A 4AN1A 3HO6A 3GJ8A 2BW0A 4FCWA 4BV3A 3BC1A 4AXBA 1F0KA 2BIFA 1XHFA 2Z95A 2IYRA 3IVRA 4BMYA 1L1QA 4P2BA 3KOZA 3WBKA 5L95A 2QBYB 1KZ7B 3DDCA 3SQXA 2P2SA 1EQ2A 4LN1A 2VLBA 3N6RA 1OBFO 4FXPA 3F78A 4QT0A 1Y4AE 4G63A 1GLNA 2QW8A 1INLA 2GJKA 3V7YA 4DJDC 4R2XA 3QY0A 4JBWA 1LDNA 2J6BA 3QVTA 4RTQA 1KJQA 1XPOA 1S6YA 2P3QA 1EWVA 2X3UA 3TLJA 4JLPA 4BNJA 2FJ0A 1DE0A 3CRRA 3W8FA 3VU0A 3TFOA 5K3DA 2AC4A 4DRXA 1HBJA 3ACCA 5AVYA 5B64A 1JHVA 3QU7A 1CYEA 4KUHA 5JFGA 1T9HA 2V7QD 3A06A 3DSRA 5CM8B 1PK9A 1TJYA 1CFZA 1KH1A 4IZHA 4F3KA 1IPHA 2LKCA 5KNLA 4A26A 5K6AA 1IQ0A 1W76A 2FU5C 2YCBA 3W4JA 1J22A 2OE2A 4EUFA 4FDUA 4XLTA 2D4HA 2QQEA 1QHGA 2QVYX 1B93A 3QJYA 3VU9A 1J6UA 4LWOA 1EK1A 3DKKA 4RLQA 4YCLA 2X4IA 3P20A 1FDRA 2DX7A 4IDQA 4K6OA 4OBBA 4OYLA 3D8SA 1LLQA 2WNSA 5BO5A 1Z2DA 1U98A 4UNPA 2QMEA 2QVBA 4N5HX 4MMZB 4A23A 5REQA 5E6RA 3VR5D 2W00A 5ICSA 2Y9PB 3G8YA 4D7AA 3TLGA 1G21A 5DGHA 1LBEA 4PWYA 1SXJC 2XMCA 4ZV9A 1E7SA 4ETMA 1EVIA 5EE9A 1AKRA 1MB0A 2DY0A 3D3JA 1H4VB 1Z3CA 1NULA 3QF7A 1PG0A 4IZIA 1BS1A 4DMGA 4TS3A 5KVAA 2CJWA 2NZ2A 4KQHA 4RKQA 1DQYA 4BMDA 3QJ5A 3QQ5A 1K8RA 1VCNA 2WVJA 5A4KA 5HUQA 3GLFA 3H16A 5JJ5A 2Q1XA 1BGXT 4UTNA 3NP7A 4QLBA 3MCVA 1ESNA 4WCDA 3RYHB 1XMIA 5CCDA 1HZZC 2CLFB 5F9FA 3EVNA 1E1NA 3CTPA 2FPWA 2C96A 2I54A 2VNKA 2ZJZA 1VJCA 4YYZA 3QPWA 4ARCA 2HN9A 1UWLA 3W7AA 3O8NA 3RS4A 2B2NA 2ODQA 3KT3A 4HZUA 3ITDA 2EQBA 3HRKA 3A3OA 1VDZA 5H7XA 4YIHA 3WRXA 2WMNB 3ZCXA 4KQIA 4WFKA 1SXJA 4BNDA 5FBQB 2EGHA 3KVNA 3G9TA 2FNAA 3VYRB 4QTUB 2ZIXA 5AT1A 1EJ2A 3D6TB 2SCUA 4X44A 4AJPA 4HFMA 3EGDA 5LLDA 3C15C 2ID4A 3MK31 3RG2A 3BD8A 3GIDA 2RAPA 2HF7A 3GHYA 2YYZA 3K70D 2CEKA 1YBVA 4MUNA 3T3PB 3ZE8A 1LQUA 4YAGA 2V7GA 2C0QA 5FWNA 1U6IA 1CR6A 4TTIA 1BCRA 2BF7A 3OCCA 5C8YB 1MAAA 2JVJA 5EUBA 1TQDA 1PV1A 3IBYA 3NH9A 3HXLA 5FB3A 2MSDB 1FDUA 2AHRA 3PHJA 1ST2A 2H2AA 2DPYA 1NXPA 2BHSA 3A1UA 3L4SO 1TVMA 3NANA 4PNHA 4QDUA 1IVYA 3TEJA 1WJGA 1DWPA 4DEVA 3ZCTA 3NAZA 4M55A 2AF3C 3RAFC 2VF4X 3VJLA 3AKEA 3AFGA 4MS3B 1L3CA 5B3AA 4G0ZA 1I3OA 2QL9A 4HAXA 4PXAA 1ABFA 1U3FA 1BTOA 2LTAA 3D7RA 1P9NA 5FULA 1IJFA 3S2YA 5D3MB 2JEOA 821PA 3TCKA 3WNQA 3KYJB 1WLSA 3FPHA 3R41A 4K9QA 1NUAA 4YRDA 3VAAA 5AKKA 4TKVB 5H3HA 4MKRA 3RF6A 4IGIA 3E2PA 1L5YA 1RXIA 2OT3B 3CLTC 1YZNA 1SXJB 3AIKA 3EWSA 2GARA 3QVSA 4O2AB 3LGSA 4Q18A 5KWVA 3RS8A 3H0KA 4OQQA 3A3PA 4X6XA 2PQMA 3F90A 4R1PA 4V1CI 1FNNA 2QJOA 2ZI9A 4S1OA 5G0SA 4DF3A 2O2YA 2GKOA 1PL8A 3AEXA 1C80A 1NQ5A 4R8VA 1EVEA 2QMZA 4WN9B 4F6CA 1PR1A 2FN3A 2BFOA 4D4JA 1L5FA 1ZP6A 4NF2A 3H99A 4JYAB 2G36A 3K9LA 1SULA 2JLBA 1OJLA 3C98A 3IH5A 4IUBS 3DVQX 2PRIA 4JOSA 5LDGA 4NMXB 4X3OA 3WADA 4CT0A 4URUR 4Y0NA 3OJLA 5IUJC 2O2IA 4WWHA 1VBNA 5EE1A 5DBHX 2G0NA 1B8NA 1H94A 4L8VA 4US2R 4BLWA 3I6YA 1N8KA 1IAVA 5DM0A 2B8WA 3BM5A 1FX0A 3CQ9A 2FR8A 1KVRA 3WIOA 1A04A 4KPGA 5HFJA 3SQLA 1Y82A 4G86A 1ISRA 1WZIA 4BFXA 4H1WA 1NNLA 4B84A 1RAFA 1ZA2A 4NONA 1KVQA 1T4GA 3SM9A 1IB6A 5L6LB 2ATCA 4Q3KA 3BOSA 4CEIB 4Q02A 1BD3A 2VT6A 5MHTA 5EXDA 1CQIA 1KAGA 4URHA 3ZWQA 4BMOB 1CERA 4L2IB 5DPMA 1W49A 2A9QA 3CZ4A 3RSSA 4PQRA 3VTFA 4PO3X 1SUWA 3SBXA 3K9BA 1G291 3VC1A 4F8JA 3MJVA 1TUEA 3V34A 2ZYAA 1WTAA 2ORIA 1QNFA 2ILTA 3L01A 1OWOA 4KRXA 5J5VA 1TAQA 2G06A 4BPBA 2EHJA 1I4OA 2QZJA 3OETA 3R3HA 2ZSKA 3ZW8A 1R9GA 1DCTA 3I53A 4LZJA 5DVZA 2E4ZA 1E96A 3T4UA 4BZQA 5JXIA 5T8KC 5TEVA 2FGKA 5I4BA 1O96A 1GKUB 2IEZA 3ABIA 3F5SA 3KZNA 3KFXA 3RVJA 4OFXA 3T41A 5KYYB 1VKZA 3KJFA 4BQOA 2OORC 3D3WA 5H9WA 2VPTA 1JFFA 3JYHA 4AYWA 4XUEA 2WHPA 1OV6A 2AOUB 2XWPA 3WKAA 3ZXYA 4C7VA 5HUJA 3GZNB 3DV2A 5EVCA 3KOYA 5C5IA 3ENZA 2Q9BA 1GCOA 3DVAB 3E2MA 3GLSA 2IOYA 2P90A 2QTMA 2RHRA 4FFNA 3B1WA 4ZREA 1P5RA 1IWBB 3AO0B 4F5YA 1W88A 2QGFA 2Z4SA 2A3RA 2JC3A 2VQ6A 2IE0A 4QD3A 2N1BA 1W48A 2PTGA 4IOLA 1L4GA 2A14A 2HUPA 3MCWA 1M9NA 1UKCA 4QJ3A 2MYPA 4CCYA 2AR9A 3OEHA 2Q07A 3EAQA 4EI7A 2MSKA 4RJKA 5JDCC 3SPXA 5AUNB 2JHFA 2K4MA 2I91A 2EX1A 1BJTA 3LO8A 3RT9A 4E4YA 1KQFA 1PDOA 5ALTA 1MO3A 1SN7A 2BLLA 2VXBA 2VUUA 4B3CA 3OZIA 4D3FA 1VIMA 2REQB 2H29A 1CUZA 1A7AA 3AMVA 2X3FA 3MJ4A 4H9GA 1U2PA 1VPDA 2QMUA 1X9HA 3FDIA 1RWOA 2Y92A 4XXHA 5C4MA 2Q5EA 3B2EA 3OLVA 1W4RA 4C2BA 1LK0A 4DLYA 4YAKA 4A8PA 1T0PA 4UHDA 3ZHYA 2J30A 2PMKA 4GMXA 4HPJB 3M81A 5MDHA 4Y1GA 3PRYA 4KIWA 2J5KA 4UHBA 3AG5A 2AA3A 2C99A 4LK2A 3VZPA 2GXQA 2ZT7A 1GRVA 2JAWA 3WMGA 4J2HA 5JH7A 3R9WA 2CDBA 2AN5A 1PF7E 3GELA 4DIDA 3DUFA 4QRIA 1TPYA 5ALUA 3VQTA 1ZD9A 2ST1A 4C7XA 5FKJA 4DNOA 2JEZA 1GY8A 5CHYA 3R8CA 4FS8A 4LCJA 4HWPA 2PWAA 3HCEA 4L9SA 4X8HA 1H0SA 1N7GA 4BN0A 1FDWA 3SHVA 1G8YA 2FCRA 4ZVKA 1I6MA 4EPRA 3Q3EA 2ZBDA 3WL6A 3K6RA 2B0JA 4Z3OA 4RF4A 4B87A 5KTTA 1PQPA 1SMKA 2VYFA 3IMCA 4CKCA 4LZAA 5DW0A 4PLYA 3P2YA 4Q15A 1XYVA 3A1WA 3KTOA 4TZ0A 2JFWA 3EDMA 2IHNA 2Z3WA 3TL6A 2DR3A 4ZZIA 4LWZA 1Z8HA 4H6PA 1M2FA 1BE1A 3M6AA 2W4QA 1GKIA 1MXFA 3QPCA 4C29A 2IEDA 5ECYA 3G79A 3MS2A 2X41A 2R48A 1EM8A 2I4RA 2GPBA 2H31A 2NO7A 4LW8A 1T8SA 4R3WA 1RLOA 3MMNA 2PL1A 5E95A 3I34X 3SR0A 4BNKA 1HT2E 1ZNYA 3DDWA 4DLZA 2I76A 3U09A 5FTWA 1MDBA 1YL6A 1QB7A 5BVGA 3ICEA 1ULUA 2XUFA 1SBZA 1MT3A 5CVUA 2WD7B 3MQ4A 5A9RA 1L4MA 4II2A 4O08A 3ETGA 4P32A 3UYKA 2XRMA 3H2SA 5HGXA 1A8HA 2CVZA 4NBUA 1IXYA 1KKMA 4LSWA 2LDXA 2PWBA 1JWLA 2VQSA 2FP3A 4C6TA 2QYOA 5FQNA 3Q41A 3SC3A 1O95D 1Z6PA 5HCUA 2IOHA 2H7YA 3OMWA 4L78A 1L4EA 2HJGA 2C5SA 1EHIA 2PKEA 3EQZA 4JJIA 2QMOA 2IITA 3RRZA 3WYFA 4A8JC 5H83A 5JJKA 1F60A 1PQUA 3S0JA 3MM4A 3H9JA 3M6VA 2OSVA 3LXUX 3G49A 1P0FA 2V3CC 5EYPA 3OLCX 5EXSA 5M7EA 4GOXA 3KQNA 3ZCVA 3KKNA 3DMPA 3MS7A 1GCUA 3F6BX 1JQ5A 3L7KA 1VA4A 2GERA 5E1MA 5DYYA 3WZMA 1I94B 4JKOA 3PT9A 2ZANA 5FYDA 2HTEA 1TL7C 1NASA 1YE8A 1VMDA 1LDEA 2JLUA 4FT2A 1HFWA 3MILA 4XX1A 1CQXA 2HJ9A 4GBMA 1LJ8A 1YR6A 3TJZA 3M70A 3EF0A 5EEGA 1V5FA 3E3LA 3MC1A 4MV0A 4JNKA 4YPVA 4BU0A 1JZQA 2PX2A 2IXFA 1GZ3A 3DO5A 5BW5A 1EUDB 1Y81A 1G4UR 2E55A 3QKSB 4Z7JA 2ZCVA 3FUVA 1KP9A 3AYZB 4GRAA 4RWZA 4DWJA 1CVRA 1S2LA 4GU5A 3SS9X 4MR8A 1FC0A 3PR3A 4PINA 4HRAA 4HPXB 4TV9B 1ZD2P 1C0IA 4D1YA 2QZ9A 5BSMA 3IDSA 2R86A 3DZDA 3RNOA 3AHDA 5IT0A 3B3GA 4PY2A 4CVNA 2IYLD 4IKEA 5HIIA 4ZK6A 1KE2A 2RAVA 1L5VA 3B48A 2GBGA 4RE5A 4X71A 5DX0A 5IC5A 4F9GA 5IAAA 2Y1LA 4IX9A 1C50A 2ZBRA 2OYCA 1VCHA 1GITA 3CKMA 3IBTA 3QKWA 3H86A 4UMVA 5E4JA 1LPAB 2QN8A 4J0IA 4MV9A 4EUEA 4YX9A 5C3UA 1VIYA 4JR1A 1I9GA 1IDN1 4RABA 2IZ1A 2FW6A 5SV2A 5KBYA 2Z2IA 3DPSA 1LPMA 1BS2A 1QR2A 2QS9A 1PZMA 2R6CA 3I5XA 5JXJA 4O2AA 2GJ4A 4MS3A 4RTLA 2YVQA 1D9XA 4N0EA 3B12A 4W1QA 1NF2A 1RTKA 7YASA 4GD3Q 2G72A 1V16B 2FAXA 3TAXA 1GA1A 4B7CA 1DAHA 2XCLA 2Z0MA 4MKIA 3DZJA 1ZIYA 3DVAA 1H2RS 5DI3A 3NHJA 1EXDA 2H06A 4WLNA 3UFXB 3K2IA 4XQGA 2ZYDA 1L7QA 4HZIA 2F9MA 2Z9CA 1G1MA 5KYWA 1TVKA 3K6KA 3L7YA 3FFXA 1WZNA 1NY6A 1XEXA 4COOA 1BJRE 1UJ6A 4ZTZB 1XJQA 2D0DA 4QUGA 1JDUA 1L7MA 3M3PA 3JQ7B 4QTXA 3E9QA 2ZROA 3HDVA 4DIKA 5KKNB 1EZ4A 1GT6A 4OVKA 4CTMA 1EGMB 4HKTA 2QHXA 3HA3A 2B3TA 4XB6B 4Z9YA 4P7KA 4Y2SA 3Q12A 1PEAA 5FUXA 3UJ7A 3LDAA 3S81A 4RENA 3I6ZA 2YJZA 2BCEA 5G0TA 1VB5A 4WESA 1RRGA 3R24A 3VV3A 1LRJA 4KQEA 4R8LA 2XADA 2PGAA 3LK7A 3PDUA 2J0UB 1CJVC 4KSBA 4TV9F 1WOYA 2OXTA 4YDQA 4MZXA 2CNNA 1XJCA 3I5MA 5IDWA 3EZGA 2A1TR 5JAHA 1T9GS 2O0HA 3L2OB 1R5NA 3L8YA 3O9ZA 3B6MA 4N48A 1EG7A 4UM8B 4FN4A 1QAMA 3DBVO 1AMOA 3CGWA 4B2IA 1EQUA 3CV3A 2D2VA 4JHLA 4US1R 3ZVMA 4ARIA 1NXTA 3N6XA 4X54A 4GPD1 1A9ZA 4I36A 2IC5A 2C2YA 2R1TB 3AJRA 4W9NA 3I9LA 1WVMA 4EZEA 2JJ2A 5FYQA 1LNZA 3PG5A 3MWLA 3CSUA 2WJ4A 5TSDA 3ZDDA 3D4LA 3OX3A 3E7PA 3QOWA 4NE9A 1ZM9A 4HGZA 4DANA 4ZAWA 4UFPA 2FWMX 3IQFA 2FWBA 1I2CA 2HMWA 1F0PA 2AXPA 2Z6QA 1A76A 1NV8A 4GUDA 1VIDA 2XTNA 2G88A 1XJ0A 1E1DA 2UZ4A 1TU0A 4NOMA 3BFKA 4RWEA 1KGSA 3RC8A 5HKLA 1RQXA 1B23P 4E14A 1JQDA 3AGQA 3D81A 4J76A 1SD5A 4LDNA 2HA7A 3AH8A 3G0CA 1NWHA 3QLUC 3EFOB 4QAJA 4B40A 4BBZA 1VHJA 3H8SA 4XRGA 3LF1A 3L77A 2W6JD 4GZMA 4XQCA 1TE2A 2X23A 5HCNA 4BWVA 2WFAA 3MTEA 4FFDA 4G0NA 4FNMA 2GYUA 4JQCA 3ANXA 1QLJA 3AILA 3TBHA 2YHIA 1IFXA 4I4LA 1VKOA 5IP5A 3UAGA 5ITZA 2N9UA 3OF2A 4GICA 4Q1DA 3DOOA 3H2KA 1F8GA 4FR2A 2HCJB 1TZBA 1GGVA 2W6MA 1PDWA 1WMDA 3PQ2A 5L9AA 2QVCA 3QLTA 4NSNA 3KBOA 1ZKMA 1CR1A 4PO1A 3RM3A 2BH9A 3BWYA 3KELA 1ZMOA 1JDTA 2A4MA 3FFBA 3I45A 2NW6A 3PXEA 4Q82A 3T34A 2ZRGA 3TZBA 1UMBA 1C1DB 3H2ZA 3K0HA 2JRLA 1TD9A 1WABA 3V7WA 3NDPA 1QCYA 1RJWA 1SXIA 2OV4A 3HCRA 4WBXC 5BOSA 1P17A 1GZ6A 1PT8A 1FFDA 1GTZA 5C8VA 3ZJ4A 1NFQA 4R54A 2EGUA 3B7PA 5FORA 5ESDA 4R01A 4C1NA 3Q3IA 3GLIE 4RUKA 4WMLA 2R9VA 4W7IA 3SD7A 1G5PA 1Q91A 1AQIA 3MS4A 2BHNA 2NSJA 3SE7A 4NBLA 3LA6A 3WSVA 3PITA 1KYYA 3BE6A 4O4LB 2WC1A 3L8FA 4GH5A 1GNTA 3RBAA 4KFCA 1Y1QA 4PSAA 2PKWA 3ZS8A 4D4MA 4E13A 3Q9UA 3IAFA 1A72A 3PA8A 5AKZA 1C9DB 3IL2A 4TZ6A 1MTZA 1Z63A 4ZVPA 3GN2A 4P82A 3I9KA 1QORA 3QVVA 1C3OB 1JHYA 1KI1A 3FPJA 3FYUA 1X1EA 3Q85A 4WY8A 3N8HA 4LOAA 2QU8A 1G5FA 4IIDA 3W2IA 4AS3A 2BGUA 4GXQA 1XTBA 3FW1A 2XBLA 1H2AS 2HIMA 3CFYA 3PEUA 4JJGA 4O0MA 5I7FA 2HPZA 4GEKA 2NP6A 3VDMA 3WO0A 1GP2A 2GYWA 2RHDA 3IIIA 3RYIB 1GDTA 4HH3C 1AT1A 4Q39A 4YP0A 1Z07A 1L1EA 2LDBA 2EATA 2V9CA 2ZWPA 5H0IA 5JMWA 4DG8A 4Z5XA 3SLRA 3URMA 3UV3A 4JYZA 3RBZA 1ZMXA 2VDOB 4FSHA 3WGUA 3OZ7A 4UPVA 4HXFB 3NUGA 4EJFA 4O4JA 4CN9A 2JFPA 3IEMA 1QO0A 2G3YA 2MSEB 3HMQA 4MW9A 1JLKA 4BJ3A 4BLTA 5JH7B 1U1CA 3LH5A 3PWSA 2OV1A 1VP9A 4ZO8A 4RXUA 2FEMA 9MHTA 1YB4A 3PU6A 1RD4A 3NTVA 1L8XA 2VQ3A 1OF1A 3A6JA 4JN6B 5IXSA 3WGNA 2PMCA 4P0QB 1T8UA 3QWAA 5EZ5A 2VCHA 5EL0A 4MAMA 4LYAA 2ZIGA 4DGSA 3UT6A 4D92A 1JVSA 1TO6A 2H11A 2O48X 2C8LA 1RYHA 4RSGA 1H8HD 4FDMA 2YHBA 4O4IF 1YIDA 2CHGA 4B8YA 4AQYB 4DA8A 4I4TF 1NUHA 1C9MA 2R60A 2VJDA 1GQSA 4K28A 4NHOA 3OLZA 4KPUB 4NAHA 4MYDA 3TSOA 4P4TA 1BD4A 3DMTC 4UM7A 5INTA 1TUGA 1OUMA 4ZVOA 2Q1SA 1AXGA 1U94A 1O94C 1UEJA 2CMHA 4FHEA 3ANYB 4JR2A 4MWBA 2HZBA 4NTZA 4YBRA 1V8BA 3EPKA 2RHMA 1XGKA 1UXHA 4HMOA 3IOEA 3CLHA 5F77A 4RY2A 3ZR4B 2ZR7A 2CHVA 4UVIA 1H8ED 3HB4X 4C6SA 4B9EA 1TGYA 4CV1A 4OXIA 3JQRA 2NT3A 4BECA 4EW6A 1BKYA 1E7MA 3C97A 5KAMA 3AEUA 2G70A 3OIGA 4JBGA 1DTEA 3NOVA 3LFUA 2VH5R 4QREA 4HWSA 1VKJA 4JC8A 4WK0B 2E2WA 3WK4A 1GU0A 1S4MA 1VYUA 3HNPA 4EL0A 1W87A 3IURA 5ARBA 4ZEMA 2EOAA 3QVLA 1PZNA 3P9ZA 4ON9A 4MQBA 3E7XA 2DR0A 5D7NA 5IDXA 3H2JA 1KETA 4HR7A 3JQFC 5A0FA 3JRNA 2QE7A 2CVPA 1ECFA 1ZU4A 3M5PA 4TVKA 1NG9A 1JFFB 4LBWA 2PV7A 1G8SA 2QUAA 4RIHA 3C5EA 1UXJA 1WD5A 2J3HA 2ZJ7A 3I32A 1NN0A 1ODLA 1XLTA 1P4GA 1GNRA 4F38A 3HXMA 2Z3VA 2YY5A 1QP4A 1C3LA 2RB4A 4RY9A 2YIJA 5MN6A 3M7IA 4OFBA 2HDHA 3RJMA 1VXOA 4TMVA 3O8OB 4UBLA 4P3PA 2RE8A 1D6JA 4I4TB 8LDHA 5I9NA 2V9ZA 2VYNA 1Q44A 2WYHA 3BFXA 3LOQA 2IHYA 3NASA 3Q7PA 3VU1A 1VIAA 4BOYA 1OXMA 3PIRA 2HYIC 4KU4A 1ZAKA 2XZPA 1W5EA 3S7TA 1FFAA 3VC7A 2X5NA 5KTRA 1QOZA 1XZJA 3LW7A 4MQ6A 5HJ5A 4WOCA 1M33A 2B4AA 3NBKA 2CF5A 4KBGA 2FQQA 3WZ2A 2XQVA 3ZE2B 3A6PC 2A1UB 4PAWA 5DCYA 5SZIA 2D1RA 1ZUIA 4EA7A 2AOXA 4NV1A 5AFSA 1OX4B 4EUHA 3O90A 1Z7EA 3HWX1 4MQ4A 5ALEA 4PIMA 1I0LA 5HF8A 3UJ6A 5IZCA 3Q11A 2HA6A 3NUZA 4MYUA 5L4SA 4BMNA 5EERA 5LC1A 2FOIA 4R1SA 2NO5A 4IVPA 5J4LA 1TC1A 3C5WP 4YI3A 4EG1A 2CCJA 5AI0A 5AKLA 1RQRA 4KRYA 1PW5A 4CEJB 2P7HA 2A2ZA 4B33A 4AKIA 4PTZA 3OWHA 1V2HE 2VT2A 3T7IA 2O14A 1AQ6A 3EVDA 4OXKA 2JI4A 1D09A 1H4TA 4J0GA 1XTPA 3OE5A 3OESA 3SVTA 3V55A 1NXQA 2I1QA 3LLVA 1X1CA 4AO8A 5A1JA 2D3WA 3HXOA 1SPBS 4XOUA 3T9FA 5GZ3A 1M34A 1KJJA 2B1RA 2GEKA 2ECFA 4Y6SA 2LGJA 5G3YA 1ZXXA 1MXHA 2P9EA 3DQZA 1C9JA 1B26A 3DBOB 1THMA 1GPWB 2G0AA 3U17A 4BVJA 1U5BA 5FOQA 1CRQA 2JIZA 1VSBA 4NVRA 5E6SB 2FW0A 2FCAA 1A50B 3H75A 4Q3AA 1MVLA 3IIMA 3BILA 1B16A 1TU4A 2G82A 2D5AA 1KVSA 2ZYRA 3QWBA 2V7EA 2M6RA 5I9LA 3ELWA 1Z4MA 4FFRA 5EKDA 2QTTA 2OLJA 3V8PA 1JIUA 3HKBB 2FTKE 1QKIA 4KITB 4XVCA 4RVHA 2CKDA 5AJHA 1S2IA 3EQ9A 4Q21A 1MO2A 2MMCA 4QG7A 4Q4HB 4XTRA 2V0GA 4OX9B 3O4JA 5T8KA 2GILA 3WGYA 1FSPA 3H9UA 1JNYA 4QQ8A 4Y1EA 3CG0A 1GZSA 3UAZA 1KGDA 4RJTA 2NN3C 3FOWA 1Z4QA 1D1TA 4M36A 4IHKA 5FWYB 1CUIA 1KU0A 1ZMRA 2KWIA 1MX9A 2TMYA 1DKRA 3DT6A 3FPFA 1TUBA 4IDPA 3FPAA 4JL5A 4UE6A 3MXOA 2B35A 1WDLA 2H8GA 5CT5A 3V8VA 1SVIA 4MI1A 3U16A 1TA0A 3ICWA 5AIBA 5EIXA 1ZVMA 1YCGA 2I3AA 2YR0A 4LC1A 2OKCA 4ODIA 1FS6A 1PEYA 1Y9JA 5EJ6A 1IWPB 1AA9A 1EFKA 4C0QC 2I4LA 4XJVA 2YZKA 4L72A 3LQQA 4TMYA 1GAEO 1N0IA 2DULA 3ZHXA 5L40A 1Y80A 1QDEA 3OY2A 5K8UA 3FKSA 3KTAB 3OIUA 1PVVA 4IXNA 4TSKA 3ETNA 1P18A 4XIFA 3RJTA 4H4EA 1O6CA 2OILA 3GMDA 3H5AA 4EO4A 1GPDG 1JW9B 1KEWA 3R44A 2WM8A 4KKXB 2A0UA 3M6WA 1SUFA 1S01A 2N47A 1QHEA 3DDSA 1G8GA 1B6SA 1WBJB 2UV8A 1R0WA 1V25A 3RKRA 4FHFA 1VJRA 1VKHA 2BSAA 2HJSA 4MEJA 4CMKA 3BORA 3DTNA 1JA1A 5ALJA 5DBGA 3VH1A 1EK5A 4RM3A 1DJOA 5J5CA 4FOTA 2C7PA 5AJUA 1Q20A 2QD4A 3V4OA 4BKOA 2D0IA 1IYZA 1SUCA 3V7NA 1FBTA 1UEXC 2M2IA 4JVMA 5AK6A 1CY4A 5CFRA 1TVEA 3AIIA 2FPXA 3M9WA 1YR1A 4FIDA 4TUYF 2PSHA 2BFMA 1R00A 3LU1A 3NNSA 5DV9A 4NEGA 4CT5A 3EIOA 4GKVA 4P86A 3MTBA 1M34E 2D5BA 3IILA 3SZMA 1THTA 3H6KA 2UDPA 3B5EA 3F8SA 2WEKA 3O93A 3OJOA 3HQ4O 4LSZA 4DWWA 1JPJA 2Y6VA 3LZCA 3AF4A 1CWUA 1IXZA 4Y9DA 3RSZA 2FZ4A 4AJIA 1DO8A 1P39A 3KEQA 4J0KA 1XF1A 2ZE5A 3SJBA 1XDDA 3FPEA 4Q0MA 3EGXA 1YBMA 2PRYA 5DM4A 5K0TA 1LTHR 4MWGA 4H7KA 3GEPA 2R8EA 4GLFA 4OM8A 5B12A 5LIRA 3KTDA 3UJCA 2P68A 1Y1KE 3IKJA 3B38A 4HY3A 4JKIA 5DGDA 2I99A 2JAQA 2DQZA 3IHWA 3WWZA 3AW9A 1NMQA 1Y6QA 4HC4A 1U7TA 2BY4A 3D1JA 1GPYA 1MAHA 2Z2XA 2ZUCA 4H3KB 4LA4A 3L7IA 3W3ZB 2ZETA 2F1KA 3U3MA 3TF5A 2PV0A 1C5KA 3AI3A 4QYSA 4RYDA 1GTG1 3EGEA 1S2MA 4DDHA 1RC8A 1V3QE 2XUQA 3C3BA 3CKLA 2PTHA 1HF3A 3DPIA 4X95A 1RYDA 3I0NA 3ONEA 3P9NA 3UFBA 2R62A 2ZRBA 5HZKA 4IZOA 2HPVA 5JVDA 4G0MA 5AH0A 621PA 1HEIA 4DRXB 1AV7A 1M2EA 3QKRA 1VXRA 1X1DA 2AR0A 1EB8A 2NTJA 3DBHB 1MRSA 2FF5A 3NTQA 1GXSA 1QUEA 4LCEA 1A97A 1U5BB 1J49A 5FOUA 5DISB 4ENQA 3M4XA 5LKAA 4IJMA 1X0VA 2PUEA 1TCVA 2ZTHA 2E6KA 3CM0A 3NFRA 5CLHA 1L5HA 4NE7A 1PNQA 1NUUA 1SZJG 2LE0A 5KYYA 3VA7A 2RGGA 2WK1A 2FOLA 1EK2A 3QSGA 5FR2A 4EHAA 4I3GA 4UFNA 3KDAA 4A1OA 3KKKA 1OH5A 2PZMA 2Q50A 3GZNA 1T2DA 3FZEA 3VR3A 3VSAA 5EMJA 1Q1ZA 5JDIC 2NSDA 1L5OA 3R0VA 5TPWB 1SVOA 2QTBA 4GW3A 1XTVA 4MITA 3GEGA 3VX4A 2QBYA 2SECE 3FLMA 2PRJA 4WN9A 5FUWA 3CLKA 4D8XA 3QMMA 1PZFA 3HDTA 4HDMA 3CX4A 1OY1A 4OHRA 4DB2A 5F5LA 3U3KA 5EIHA 4YRPA 5EIBD 4XIGS 1ACJA 4NFSA 1RHUA 3WGZA 1XXHE 2F4NA 1YRYE 2AWNA 5CA0A 3U4HA 1DQSA 2VOJA 3E0QA 1U4NA 5EA2A 1AOXA 4WL0A 3HFSA 1E94E 3D6UA 1UMKA 4JQOA 2K7FA 2GETA 1RHJA 4QATA 1JR3E 1PNTA 1ZCBA 2P2CA 4LMRA 3IT2A 2CVQA 4OG2A 4Q01A 4LYFA 3T1HB 3LUJA 1SA0A 1JN0A 1OU4A 2AQ8A 3OZAA 4RK5A 3ZV5A 3SYTA 1GUYA 2AYZA 2PA3A 3IEKA 3T5BA 3VPAA 4YQFA 4Z4EA 3AR7A 3JQGA 5I4KA 3DWFA 1J5PA 1QPGA 2RHTA 2RGAA 4R8SA 2WNHA 4R98A 1CR2A 4TL7A 4OAPA 2G1AA 1EWYA 2CY0A 1J8QA 1C7EA 1Z45A 4G2NA 1F5SA 1MA3A 2WUWE 3HU2A 3PR2B 4K6HA 4EG7A 2W0SA 4IP0A 2H0QA 1DRKA 4EITA 4QFBA 1RWPA 5D1HA 4ZEWA 3SX4A 3DP9A 4FCVA 4OMUA 4DQVA 3FUWA 3NQ41 3OTQA 4PGHA 2W2TA 4ZCQA 4D57A 1RKUA 2HPHA 4W82A 5LOVB 3SHFA 4NMHA 2ISQA 4TRMA 1J2YA 4B17A 4OBXA 3ZV6A 2DPMA 3P0IA 4WTOA 5M3BA 3ZVLA 2C8JA 2QROA 1V3TA 3GX1A 1NVUQ 2IEBA 4MVJG 1V4VA 3G0IA 4IZ6A 3CUYA 3TZCA 3A11A 3N2KB 3I9NA 4H6XA 4WOJA 3L9WA 2CXOA 4MRRA 5U4XA 4B6PA 4ARUA 2HMSA 2RSLA 3CNBA 3H87A 2PBRA 5GV8A 1DJMA 2GLXA 3OEHD 4OJNA 4BKRA 1J23A 4DM3A 1E79D 4C06A 2GB4A 5CP8A 3LPMA 2HMTA 1CV2A 3M34A 4ZPJA 2G4LA 1P75A 2GI4A 4YV7A 2PPVA 5JIBA 5KQRA 3BGVA 2R6FA 3AR5A 2X86A 5A5DA 4QWMA 1PGQA 1E5DA 4W5NA 1NOJA 4ALKA 5IVHA 4C04A 4RZ3A 4QUEA 4ZYLA 3GZ4A 1U04A 1RC0A 1XN4A 2X8BA 2YRFA 2XUDA 3BF8A 3WHIA 5FUVA 5G53C 4BCCA 3L0PA 4FX2A 3DP7A 4GWGA 3SQOA 4TTPA 3L4KA 1BH2A 2AMLA 4OB6A 3EVCA 3U6BA 5HIMA 4YNBA 5AOVA 2ZR8A 3PA6A 3WFIA 4HJRA 3SYRA 3KJZA 3BH7A 3PRJA 4NJEB 4PNZA 5A05A 1ZM4A 1NQAO 3I61A 4P33A 1JIXA 4LXXA 4IQ4A 1GRQA 5DOVA 5FUQA 1HYQA 3RADC 4PAGA 2W58A 3KP1A 3GRAA 1S1MA 2VYND 3OPMA 1J97A 2HDOA 4KXFB 2LBPA 1RWMA 3A9VA 3WB0A 1S8NA 3W7BA 1CJUC 1PT6A 3GO4A 3UMJA 5C8YA 1O0CA 5G40A 4XYEA 2GD1O 2IP2A 3BK1A 3Q7EA 4OD0A 1XTKA 4AF8A 1G9XA 2WLTA 1K08A 2I8LA 2MSNA 2XUIA 1L7AA 3EVEA 4JBIA 5EPUA 5DCUA 3JQPA 4EHDA 2EEZA 5IZ4A 4IG4A 1GRCA 2G5PA 5JSHA 5CEJA 1K2VN 4I3HA 3U4QB 2C9OA 2LRHA 3RE1A 2EZ9A 1KIFA 3G1TA 1JA9A 4KXLA 5ALKA 1LK7A 1V5EA 5A9SB 3BF7A 4MVJP 3IAHA 5I47A 3KG2A 5TPWA 2BPOA 1C30A 2CLCX 1GNSA 2WIAA 1J9GA 1TI7A 4YBZA 4S24A 1PJTA 3F6RA 4R0NA 1M83A 1DC5A 2QUJA 4IHJF 4NK5A 4YGXB 2PFKA 2Q46A 3P9CA 3AVPA 4B4OA 3JASA 3L1KA 2YS7A 3FHOA 4Q7KA 4F8EA 2X4DA 3T7TA 3OZSA 4NHEA 3TXYA 1TRHA 5EP2A 3TIVA 3GPBA 2O1EA 1SHLA 4AQDA 4JI0B 2QQ0A 2Z5GA 4MVJM 1W47A 1CS4C 2CN1A 3NAGA 1FTQA 4G67A 3D3EA 4LJSA 1G1AA 3UAXA 2CGEA 1C9NA 1XLTC 1YDHA 3EBOA 4ROSA 3Q6MA 1HG1A 4URZR 3A0RB 3HCDA 1JHRA 1KZ4A 1GZ7A 4K9DA 5I8WA 3O73A 2ZM5A 4BB0A 1QE5A 3ET5A 1SA0B 1T4CB 4XYMA 4MRVA 5JSQA 4KQWA 4U9IS 1MQSA 2ZB8A 2EKBA 1G55A 2ZPTX 3D9QX 3UAWA 3LUFA 3DFIA 1KP3A 3TIFA 3B52X 1LFAA 3JQGB 2XEXA 5EWMB 2VXCA 1CDZA 3H2GA 1W4LA 2WAMA 1IUOA 2AOVA 5J43A 1FFHA 4LXUA 4BVEA 1K1EA 1HRKA 2IVFA 1JEOA 1M76A 1DDOA 1D6MA 2Q99A 3CNQS 5AESA 5BWLA 4G0OA 4L51A 3RUPA 4DLXA 2NX2A 2P9JA 3EY4A 2VG8A 2IV2X 1N4DA 4D8VA 1VPWA 1NBAA 2KE5A 1JJVA 2XWQA 4KLCA 3OFJA 2PL9A 4RNDB 4IH4A 4X1IA 1Z12A 1NT4A 3HBLA 1SKUA 1L4NA 3H3FA 4ZQIA 2I71A 4DA9A 4EUSA 4DDTA 2WQ7A 4U6SA 3ND9A 1N0HA 5J4KA 5KDLA 1LX6A 5B3JC 4PYLA 2E7ZA 2Q4OA 2P5UA 2WD9A 1N2CE 3IKMB 4MI6A 3VYUB 1R9JA 3T6KA 3AF6A 4U2GA 2XMQA 1M0EA 1R4NA 1T25A 4BGDA 4X1YB 2G1PA 3LRXA 1FXUA 4IHAA 3GNQA 5BSVA 4X20B 2RGDA 3N8IA 4EEKA 5LP6C 4FEAA 2EXXA 4RHUA 4EFLA 3S8EA 5BSTA 1Z0UA 1XD8A 2XE7A 3MTGA 1WV1A 4IFEA 4FFBA 1G7TA 4Q4JA 1WY7A 1GU7A 2ID9A 4LHWA 2R96A 4Y8VA 3SS8A 2X5KO 4I1OA 2CK3D 1JX6A 3HBAA 1PS8A 5DLYA 1NI4B 4FHZA 1DC7A 3SMQA 4D45A 3EOAI 1UANA 5BXYA 2AZDA 1M7GA 2FG5A 5J40A 3ZBUA 4HNAA 4CIBA 7REQA 3R8XA 4MGKR 3LWNA 4OEHA 1NKTA 2XVXA 2JCBA 3HUFA 2X9NA 2AH5A 4IXDA 3W3AH 4FYVA 1XHLA 5BMVB 1GSIA 4YMWA 4NCNA 1ADJA 3ZHVA 4ZYTA 1LBSA 2BAGA 3K0FB 5EI5A 4XWYA 5A2GA 2YVKA 3S68A 1BHQ1 2A0WA 2BMFA 3RWOA 4CIWA 4XYBA 4LF8B 2O0LA 4OMCA 2TS1A 1CRPA 3L8EA 1H42A 4B35A 5BPHA 3W2FA 5KNCD 3WA7A 2ZYGA 4HN2A 2WILA 1GNQA 3IRVA 1S8FA 3HFRA 2FDRA 1J20A 2WVHA 4MTCA 3S1AB 2XCTB 2PD3A 4ARBA 3OQBA 1FRNA 4GI7A 3QI7A 3ROZA 1ZEMA 3IAM1 5E6UA 4RMJA 1PUIA 3SFTA 1GKYA 3B9PA 1JRLA 2X0FA 1O03A 3USZA 3E9ZA 1C1DA 5F9HA 3ASUA 2R79A 2ZBPA 1CUVA 1EJBA 3Q7IA 1YZ3A 1SU4A 1QB8A 1V0JA 1J4AA 3TO5A 3BB4A 3NZEA 3K94A 3BIOA 4L74A 4LRXA 3FNRA 1SUDA 4JQZA 4MVJF 4WV3A 1BC5A 5K3AA 3VR5H 4LVNA 2B7CA 2FZ5A 2IIQA 4A9AA 4MWCA 1L8OA 2XBUA 4J1TC 1UBMS 3FM9A 2AXQA 4KWIA 1VDMA 1XU7A 3UWPA 4DIMA 5ES3A 1U90A 1M5RA 3H5RA 1A9SA 1SAYA 5HP4A 3PIIA 2VJKA 2CNOA 5ABPA 3RAGA 5EMKA 4FT4A 1RJGA 1ZC4A 3A6EA 4GS5A 4ICIA 4Z86A 5EWJA 4DG9A 2MR6A 5KYVA 1D4AA 3K9NA 3MQ2A 5I9BA 4PCLA 1F4LA 1M2OB 2BM8A 4P35A 1ZN8A 2XB9A 1NQWA 4RMIA 1PSDA 3NV7A 1N2GA 4IWNA 4XPZA 4LECA 2F6RA 3PHGA 5FI3A 4B3TB 1J0BA 1X7DA 2WAOA 3G8AA 4GPAA 1YHZA 4PYRA 4EF4A 4MGEA 4KO4S 2A30A 3PUYA 3S28A 1CCWA 3SXPA 3WIVA 1WPRA 4TM7A 1U4SA 4D9IA 4PQEA 3ZDBA 3D54D 3OOWA 5AKJA 5LL6P 1JBEA 3H11A 2DZDA 2QLJA 3TAUA 4BATA 4DAOA 3ER9A 2WLSA 4GLLA 1N2SA 2XF8A 4G0PA 3NU1A 4L4XA 4CLRB 2PBFA 4K88A 4D8WA 5GWXA 5EJ4A 1NQXA 1T91A 1TW2A 2W48A 1C0KA 1PNVA 4LRUA 4X85A 1YUMA 4C4ZA 1BEZA 1DPGA 2RGBA 3VBEA 3CF4G 1CP2A 3BJRA 1XG5A 2A5GA 4OQYA 1WEKA 2R3SA 4ZC8A 1ONNA 3ROFA 4V1CA 2QTLA 1DS6A 3S4YA 4LRWA 4YT2A 8AT1A 4R8KA 2AN3A 4MV8A 4N49A 1STOA 3THWA 2QM7A 3QE0A 2AZTA 2EQAA 1Y3HA 4ZN6A 1YRQA 3RROA 3V8NA 3JPYA 1R7RA 2J87A 4BFSA 4YMLA 2NXWA 5AICA 2WQZA 1C9EA 2OGWA 3ITKA 3NPAA 4ZPXA 1U1EA 2R4TA 2BC9A 2W8BB 3K8YA 2F3SA 4UZEA 5KYKA 1Z38A 4P92A 3A6GA 5GONB 3T3GA 1BJKA 3IGFA 2J9FB 1LB1B 3GMIA 5HDBB 2P65A 4F7DA 4GMDA 1CRWG 1JEAA 2QJTA 4FYYA 1XZMA 1IHUA 2VJAA 3A32A 2C9MA 3I2KA 3IESA 1G8MA 2XMPA 5AJWA 4AIRA 2PGDA 1Y5MA 5FOSA 5JROA 3GRYA 4BXOB 1TNDA 1C8KA 4D43A 3MCZA 5L8VA 2B6HA 2NU6B 2PXAA 3V9AA 1R6AA 4I8IA 1U0GA 1JTEA 3EUWA 3MGAA 1TM1E 3VVMA 3CNHA 3UY4A 5A4FS 1IZ7A 2XYRA 4F3CA 3QH4A 4MRAA 2JCGA 3AR6A 4ARZB 2EP5A 2FX2A 1RLJA 3LQKA 1KSFX 2Q9AA 1I80A 2IW3A 4Q9JA 2RB5A 2FXIA 3DMYA 2ZB4A 4EVSA 3U4MA 5EIFA 4DY4A 2YMPA 4RH3A 1H9CA 1RXSA 3NAMA 1T3SA 4DJFC 4L75A 3IKVA 2JFYA 4BRSA 3FZGA 1K0UA 2CFTA 3SQMA 3OIWA 2IU6A 1GQ2A 2CDRA 3VZSA 4PZLA 4XQ9A 4DBZA 4KE8A 2FZWA 2DHEA 3OZCA 4P34A 1SUPA 2F8MA 2UZAA 4HB3A 4A82A 1BHSA 3BVPA 3ZIUA 4EX7A 4F96A 4MUEA 4HQOA 1PD1A 1P5ZB 3QHQA 4EHHA 3HUEA 2TECE 7ADHA 3RO7A 1Q0PA 3ZUGA 1E2NA 3GGCA 4JIGA 5CCBA 5JMTA 4JODA 1AKWA 1XKXA 3N9IA 4KYVA 4WNYA 5AM0A 5K3EA 3ETDA 3ISJA 2C9CA 3R76A 4UHFA 1MNQA 2GVDC 4UEOA 5ILOA 1XZGA 2QKYA 2JKVA 4NATA 4FYIA 3ZHBA 3GNSA 1Q0HA 1SCKA 2PLNA 4XAQA 1UZUA 5DXAA 5LQKA 2JVKA 1IBCA 2UXDB 1L8QA 1YQGA 4MS4A 5FNZA 2ATIA 4KR9A 1VE9A 2H7CA 1VBFA 2QPTA 3OZXA 3P97A 2BGNA 4Y2QA 4Y67A 3V42A 2LXNA 3OJFA 4F1JA 5JXGA 3B9QA 5BWMA 1S7GA 1A2KC 1WW8A 3U2QA 4BV2A 1CF2O 4R84A 5C32A 4F4IA 5CH8A 3GRFA 2NUAA 4XDGA 4HB0A 5EWJB 4A91A 1UEIA 2EARA 3H97A 2I67A 5E0OA 1ZH2A 4NFLA 4QNRA 3CIOA 4DUPA 4DCJA 1E3DA 1H1LB 4NOLA 4DRYA 3MJTA 4IDDA 5DP2A 1A2QA 1YCFA 2ZR0A 2GWHA 1GD1O 1C1HA 1G3UA 3UMMA 2GGSA 1Z0IA 1AG9A 1P6UA 3UTDA 4BKUA 3THXA 1YV9A 2HLDA 4WT7A 5CLIA 2ZS8A 4RLFA 1KI6A 2GBFA 5J3JA 1UJ5A 3MJFA 3OPNA 4GPZA 2RHJA 4DDKA 2PZLA 1H3EA 2A6PA 1BCRB 3Q98A 1QHYA 3QEMA 3ESZA 2GZ3A 3RGGA 4LSMA 2GZDA 3ZLVA 1IQRA 1D5CA 2V3WA 4YXFA 5JD5A 1FJXA 1VC2A 1U11A 1FVFA 5D5PA 3LHFA 2BSQA 2FSSA 2HREA 2F90A 2R2GA 1XD2A 5BYAA 3LECA 5IULC 2HA5A 5SY9A 5HRCA 4YV2A 4W6ZA 3ZZUA 2J0SA 1ACMA 1IC6A 1ETHA 2IDKA 1BMDA 4NX2A 2NV6A 1CTQA 2J5QA 4LSGA 5EVJA 4GP6A 3FYTA 1AS0A 3TSCA 4MGIR 4Z49A 1G8JA 3C43A 1ZGBA 2HO4A 4EENA 3A1FA 3FPKA 4I0WB 1G6Q1 1YAHA 3OTOB 3QUTA 4C7JA 2V03A 5GJVC 1VHLA 3GLRA 1K3FA 1TYEB 4M46A 4MR7A 4TWBA 3IR6A 4Z7OB 1GDDA 2QZPA 4L0QA 3WC4A 1GO2A 2J6HA 3BWBA 1ENYA 4R4JA 2C95A 5A4DA 2E18A 4H7IA 1YQEA 4I2VA 5B3JA 2Q28A 5IUKC 3PNOA 1IN8A 2ZQ5A 4NCKA 4RK4A 3O4GA 2JCSA 2PEYA 5LJIA 3MBKA 1BQ3A 3P0JA 4II3A 4RK0A 2A7XA 5D3ZA 5B6IA 1ESZA 2HSDA 3CZRA 2IJGX 2GF0A 4PTYA 1EPUA 1Q2UA 2YVLA 3E9DA 3AQ4A 3HFGA 3MTAA 2BFDA 4IIFA 3L4JA 1HOTA 1I01A 3DAPA 1JG7A 4MVJH 4UEJA 5ELLA 4Q9LA 4Q1CA 5TQ2A 4C6RA 4TKMA 1MG5A 5KYUB 2O3TA 2O07A 2VH1A 1UWKA 3DYVA 4RADA 4Y7DA 1FTNA 4C89A 1NYQA 1R8SA 4QOSA 3THWB 1RU3A 3WTCA 4HVTA 2YKGA 1IMOA 3LQFA 5CFPA 5IH3A 4FP9A 5CB8A 5FD8A 1S3GA 3DOJA 3K6JA 3LYHA 3VDQA 1WMEA 2PYZA 3WYNA 3RIXA 4J29A 4DCNA 1RRKA 1JTFA 2F7SA 2QRLA 1MJGA 1U7ZA 3WIUA 3GGGA 4HUJA 3J7AC 2VYVD 4GL2A 4R81A 4W5TA 2AI2A 4NENB 1DGQA 2Q27A 1Z6TA 4GI2A 2NO4A 4EBFA 5IH7A 4IEIA 1X2EA 3AF0A 2AMVA 3DA8A 4U5QA 1OAOA 2O6LA 1WQ4A 1N5LA 5J9FA 2LW7A 2VAXA 1I3MA 5DHPA 3K09C 5E1DA 3W0LB 4L2IA 2G6BA 3HP1A 2WWWA 1CB7A 5LZ7A 5CPBA 2EIXA 2OR3A 2H0AA 1N2CA 4KO3S 1U2EA 4CIVA 2Z2KA 4A3SA 2A9PA 1FXWA 3I3OA 3ZHRA 1J5XA 5LN1A 2OXCA 3JWJA 4FFSA 4IRXA 2A59A 4TSFD 1OXBB