4FDMA

Crystallization and 3d structure elucidation of thermostable l2 lipase from thermophilic locally isolated bacillus sp. l2.
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
378
structure length
378
Chain Sequence
APIVLLHGFTGWGREEMFGFKYWGGVRGDIEQWLNDNGYRTYTLAVGPLSSNWDRACEAYAQLVGGTVDYGAAHAAKHGHARFGRTYPGLLPELKRGGRIHIIAHSQGGQTARMLVSLLENGSQEEREYAKAHNVSLSPLFEGGHHFVLSVTTIATPHDGTTLVNMVDFTDRFFDLQKAVLEAAAVASNVPYTSQVYDFKLDQWGLRRQPGESFDHYFERLKRSPVWTSTDTARYDLSVSGAEKLNQWVQASPNTYYLSFSTERTYRGALTGNHYPELGMNAFSAVVCAPFLGSYRNPTLGIDDRWLENDGIVNTVSMNGPKRGSSDRIVPYDGTLKKGVWNDMGTYNVDHLEIIGVDPNPSFDIRAFYLRLAEQLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3D Structure Elucidation of Thermostable L2 Lipase from Thermophilic Bacillus sp. L2.
pubmed doi rcsb
source organism Bacillus sp. l2
molecule tags Hydrolase
molecule keywords Thermostable lipase
total genus 153
structure length 378
sequence length 378
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2012-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4fdmA00
5JYCA 2HA0A 2JGJA 1HDEA 1CUJA 1FFBA 2P8SA 1LPNA 3WA6A 5CT9A 1EDEA 1Q83A 4P08A 4G9EA 4BCDA 4Q34A 3FBWA 3ESDA 5AM3A 1G5FA 4GECA 2XMBA 3AFIA 4ZV9A 3BWXA 2JGKA 5JADA 3DYIA 5ALTA 4BVLA 1UK9A 1QJ4A 3IUMA 3VJKA 1QIMA 2O2IA 1O6GA 1JKMA 4OYYA 4QZVA 2OCKA 4G1FA 3IIIA 4W1PA 4K6GA 4ARAA 4QDOA 3IA2A 5KWIA 1Q0RA 1LZLA 4MEBA 5A6VA 3N2ZB 3FLAA 3C87A 1K4YA 4G9GA 3A2MA 1CUCA 2BAGA 4J3JA 3OTQA 3H2JA 2QM0A 1VA5A 2G5PA 5BWBA 5LKAA 4UFOA 2V96A 1HKHA 3O4HA 2J4CA 1LPOA 1XROA 4LYDA 2JGLA 1XZGA 2ZYSA 3DL7A 4G5XA 1VXRA 5C8XA 2XT0A 1KEZA 3K9BA 5JAPA 3QITA 5FRDA 4HRXA 4LHEA 3Q8WA 5EIEA 2ZSHA 1IVYA 1XKTA 3E1GA 1HQDA 1FFEA 4DYHA 4UHHA 1MT3A 5DTIA 5AP9A 1ZD4A 5I9IA 5FKJA 2GBIA 3G0DA 4JUIA 3QMWA 2DFPA 1QIKA 3I6YA 2WUGA 5HQ3B 4QDZA 3EQ9A 1UFOA 3G9XA 5K3FB 2J3DA 4Y2TA 4DLNA 4LXGA 4BP8A 1ODTC 2WLSA 4Q3KA 1GT6A 3WKCA 4N8DA 1XZLA 3W06A 5CT6A 1UK7A 1QZ3A 5ALFA 1QFMA 3OM8A 2VJDA 5AJHA 4BVKA 5AOCA 1P0PA 2QXTA 4QEKA 4EBBA 4WDQA 3HXKA 4GLBA 3F98A 3R40A 2WHQA 4X95A 4BDSA 3I2IA 1CUDA 4PSDA 4YASA 5AM5A 4EB0A 3DJYA 5HF9A 2G5TA 1A7UA 1AX9A 1CUAA 4MWSA 4PO3X 2XMGA 3BE8A 5ALVA 3AILA 3PFBA 4MQLA 2O2GA 4Q3OA 5IVIA 3IUQA 1UXOA 2X5XA 4J0IA 1W52X 1MX5A 1EK2A 1CUFA 4J03A 4DMKA 4U2BA 1BROA 1THTA 4UBOA 4HZGA 4YK7A 1LGYA 1BE0A 3WK9A 4BTVA 3F97A 3W04A 4CG3A 5AI9A 2GYUA 2IITA 4K5QA 4OYLA 2OGZA 4H7FA 5KWJA 4C4ZA 5ALEA 2I78A 4FBLA 1XZHA 4KE8A 4P9NA 4B81A 5CH8A 2WJ3A 2OCGA 2R8BA 3D2AA 1QLWA 5AM4A 2YH2A 1VOTA 4IH9A 4XVCA 2OGTA 3YASA 2ECFA 4WCVA 5ALSA 1SFRA 3DKRA 3MUOA 4ZI5A 1MPXA 3BXPA 3WIOA 3HC7A 3VDXA 3I2FA 5JATA 1O6FA 3KDAA 3FCXA 2PVSA 4QNNA 3FSGA 2JGMA 4TPKA 4CCYA 4BTLA 1TCBA 2OQVA 5AOAA 4KE9A 2JEZA 5K3EA 1ZI9A 1EB9A 1ZD3A 5DTJA 5AM1A 4Y7DA 4ZRDA 1R50A 1ORVA 1QIJA 1WPRA 3WWEA 2ZJFA 3C6XA 4FMPA 3O0DA 3ANSA 3UMJA 3RLIA 4J0CA 1K6EA 3ED1A 5AH0A 1XZEA 4ITVA 2WFMA 5K3DA 2UZ0A 4RE5A 3K6KA 3FYTA 4DMFA 2ACEA 3C6ZA 4UHDA 2XUGA 1MX1A 3CCBA 2EEPA 2PBLA 2HA6A 1R9MA 5CT5A 3V1KA 2RHTA 2ROQA 5EGNA 1CUZA 2CKMA 2WUEA 3IDAA 1VKHA 1YAHA 4BC1A 1F6WA 1AKNA 2B20A 4ETWA 1QTRA 1XQVA 3WZLA 2JIDA 4IH4A 2BUAA 1VXOA 2X8BA 4U2FA 4WFKA 2H7CA 1MAAA 2HU8A 4HXEB 4EY5A 5HK9A 3WK8A 4DIUA 5K3AA 4GDMA 2QRUA 4KRXA 5HF8A 1Y37A 2Z3WA 3ZWQA 2ZYHA 1CUYA 2WIKA 3HJUA 1DQZA 4X3CA 5EFZA 2VT7A 4GBGA 4W1SA 1ZJ4A 1GXSA 3H2HA 4KEAA 4AZ3A 5DNVA 4NS4A 3CXUA 3PDCA 1E5TA 2RAUA 1XZAA 3QMMA 5LYYA 1S8OA 1GZ7A 5AKJA 1G42A 4LYEA 2O2HA 2ZYIA 1QIDA 3ANTA 4YX9A 1E8DA 5E4YA 5CXXA 3GZJA 4ZV7A 1Q0ZA 3ICWA 3A70A 5ALIA 2H7YA 4KRYA 4E15A 5ALXA 2EDAA 5HFAA 5LIPA 4HXGA 4X00A 2WIGA 2WHRA 2V9ZA 3WL6A 3OOSA 4OPMA 1DWQA 5C81A 3JWEA 3GBSA 4JH0A 4B9AA 3DKKA 4W1RA 1IMJA 2ZSIA 5FXMA 1MO2A 3DDUA 4HAIA 4Y2XA 3AIOA 1ISPA 5IVDA 4AZ0A 5CXUA 3PUIA 5CURA 4K2AA 2QXUA 2WJ4A 1LPBB 3DOHA 2AJBA 4Y2SA 1W1IA 4M0EA 5CBKA 4AXBA 5AK3A 5E4TA 2VAVA 1EHYA 2PU7A 3ZI7A 1EINA 2RI6A 3KWJA 3WWOA 3A6ZA 2DQYA 5A2GA 3VVLA 4BP9A 1IZ7A 3DNMA 4B0OA 4U2CA 3EQ8A 3HABA 1YB6A 3R41A 2C0PA 3H1BA 3R3YA 3JW8A 5I8PA 4GXNA 4X90A 1IUPA 5I7UA 4BAZA 4BDTA 2PX6A 5D6OA 2XMCA 3AUKA 3BL8A 1UOPA 4CI9A 2DHDA 1JJFA 2WM2A 5BV7A 4PNZA 1UK8A 3LP5A 2WFLB 3QPAA 1LBTA 1VZ3A 4QLOA 4A5SA 3I28A 4X85A 5CH5A 1M33A 1CEXA 3PUHA 1OXMA 2BUBA 3C6YA 4FWBA 4Y2QA 1W4LA 1YAJA 2H7XA 1VE6A 4I19A 4IO0A 1BEZA 1QIHA 5T4EA 1U65A 4F5ZA 5CT8A 3D7RA 3QPCA 5AKLA 2PSHA 1QIFA 1QIIA 5DNWA 1N5RA 3KWFA 1XFDA 3DOIA 5EHNA 2PU5A 3WA7A 1K8QA 3B3QA 3STWA 3W9BA 4UPDA 2XUKA 4TGLA 2RGUA 3D4LA 3CN7A 1VLQA 1JJBA 5AM0A 2XLBA 1YS2X 4EY7A 1EI9A 2Z3ZA 4XJVA 1H23A 2HU7A 2VEOA 2ZVDA 5JIBA 2XUQA 4F60A 3P2MA 1CVLA 3S8YA 2JBWA 4Y2RA 3W9UA 4B83A 5AKEA 1Y7HA 1XRQA 2WFZA 1GPNA 2QVBA 4S0XA 4DNFA 2WIJA 1AC5A 1BN6A 4L3WA 1C7JA 4NVRA 2HADA 1P0QA 3STYA 4DSAA 1W6RA 2OGSA 4HRYA 2VTVA 1QO7A 3ZLUA 2BGRA 1PJAA 4AO8A 2XQGA 2XQJA 1UK6A 3FYUC 1FFAA 1UOOA 4N8SA 3H17A 1I6WA 1QO9A 3HYSA 1B6GA 5FP0A 3D59A 4DGQA 2B9VA 4ROTA 4KACA 4BC0A 1A8QA 4B9EA 1ZOIA 2QUBA 2XUPA 4Y2UA 4KAFA 1F8UA 4EHBA 2QTBA 4X7BA 4BB0A 4X91A 2RHWA 3ILSA 3OG9A 3CCCA 4TVKA 2AXEA 1CPYA 5HCUA 5AKXA 5HQ3A 1NU8A 2CJPA 2AJLI 2WTNA 1XQXA 4UBIA 4OU4A 3C45A 4X6YA 2HL6A 1VE7A 3FVTA 4J0JA 3H18A 3I2KA 3QBJA 1XZCA 4H7EA 5AI8A 5A7FA 2WG1A 4J0GA 1EVQA 1WCYA 1LPSA 3STTA 2OG1A 3WL5A 2XUOA 2GBGA 5AKGA 4B6GA 1X2BA 2Z5GA 4A23A 5JALA 3OPMA 1FFDA 2VT6A 3O9MA 2OLEA 2I3DA 4N8EA 1DWPA 1QIGA 3UUEA 3PFCA 4PW0A 1CUHA 1AURA 2I3ZA 4EY8A 4BZWA 5AI4A 2Y2VA 3STUA 2Z8ZA 3G9UA 3WJ2A 3NUZA 4BCBA 3FCYA 1EH5A 4RE6A 1XRNA 5ALWA 3D2BA 4AN0A 3KD2A 1A88A 1FSSA 2WHPB 2XE4A 1B41A 3KXPA 1Z68A 3DEAA 4KR0A 1JI3A 4X6UA 2D5LA 4DM7A 5AKZA 2PUJA 1J07A 3QH4A 3F9CA 1TCAA 1YA8A 4H7IA 1HBJA 1RYYA 3G0IA 4QDXA 4QDTA 4H7KA 1HLGA 3BJRA 3WJ1A 5KBYA 2C7BA 1RWQA 1XRLA 3IVMA 3WWCA 4L0CA 1WB6A 5JANA 2QMQA 3QMVA 1LPAB 1QGED 3QVMA 2BFNA 4GW3A 2BJHA 5LZ8A 2WIFA 4LXIA 5EHZA 5J3JA 2WU3A 3D2CA 3O4JA 2WHPA 1E3QA 3ESBA 3MGAA 2YXPX 2XUHA 3L1IA 1QFSA 4PV7A 4Q3LA 2QOEA 3C8HA 4ZWNA 4FHZA 4WDRA 5FPQA 2GBFA 4Y9SA 2CB9A 2CBGA 3IB3A 2HFKA 5SYMA 1AGYA 1K63A 2FJPA 3AIMA 4OB8A 2DHEA 1ACLA 2J4FA 5JZ9A 2Y6VA 5YASA 1DINA 1JMYA 4H7JA 3GFFA 1USWA 2WTMA 4BAUA 4CG1A 2NW6A 3L1JA 4FBMA 1AZWA 4FLEA 3ESCA 1HPLA 4OB6A 3WMRA 5ALLA 2HRRA 3LLCA 3N0TA 2WJ6A 3F67A 3AZOA 3FNBA 1LPPA 4BE9A 1WB5A 4CCWA 3M81A 4MWTA 3STXA 1MJ5A 5DYWA 3O9VA 4RNCA 1ACJA 1CRLA 4GHWA 5AM2A 2WILA 3QZUA 3NOXA 5K3FA 1C7IA 3ZV7A 1UZAA 4G4GA 3C70A 4UFPA 1CUEA 3ZLVA 1X70A 3ICVA 2ORYA 3LIIA 5ALHA 1H22A 4H18A 1SOMA 3FSGD 3WKDA 2W22A 3E0XA 4J0DA 1BS9A 2OXEA 1SCQA 3WKEA 3R3UA 2G4LA 4FNMA 1EX9A 4HXFB 1F0NA 1XRPA 1TRHA 4CFSA 3MVEA 3I2HA 1XZFA 3O95A 3FYUB 3SK0A 4KAJA 1T2NA 1XZDA 3HLKA 4BYMA 3WK7A 1DX6A 1JFRA 5AK4A 1TCCA 4ZREA 5A62A 2XLCA 1A8SA 3RKSA 5AI0A 4B7ZA 5IKXA 1ZI8A 4PF1A 5CH3A 3T52A 3DLTA 2GBCA 4C4XA 4Y2YA 1KU0A 5AHXA 3H0CA 4AO7A 6YASA 4DNOA 5EHXA 1IUOA 3AJAA 4HVTA 2ZJ6A 1DT5A 1X2EA 1ETHA 5DWDA 1W75A 2YYSA 1ZJ5A 3WZMA 1R3DA 5HK8A 5FDFA 5FPPA 2W6CX 4W9RA 4WJLA 2XMSA 2XMRA 2C4HA 3VKFA 5T4HA 3TGLA 3EF3A 5E2IA 3OC0A 4FKBA 3SX4A 1L7RA 1BCSA 1YA4A 3M83A 2X76A 2HDWA 1LZKA 1N1MA 2WUDA 2AJCA 4CG2A 4C89A 1SCIA 4GWLA 1ZI6A 3PICA 4DTCA 2XMDA 5ALKA 3V1NA 3NGMA 3D5EA 2PSDA 7YASA 2QJRA 2HA4A 3STVA 3FOBA 3VVMA 4H7DA 2BGNA 3G0GA 4B80A 1CLEA 2DHCA 4J0KA 5LZ9A 1VZ2A 2C58A 3E4DA 4FLFA 4BVJA 2DR0A 1AMNA 1EK1A 1T4MA 3D3NA 5JZBA 2LIPA 2FJ0A 3WK4A 3KSRA 3W2TA 2WKWA 4QDUA 1BEEA 4G8CA 3V1LA 1E66A 1N5MA 4DNPA 1TAHA 3I6MA 3R3ZA 3AIKA 4K6HA 3R3WA 2ONCA 1CV2A 2RONA 1WM1A 2Q0XA 3SWWA 4KE7A 1BN7A 3M82A 3I2JA 5A7HA 4BE4A 4M0FA 3JYHA 3WYNA 4GI1A 2CUTA 3G7NA 5C8ZA 5ALYA 2HIHA 2CEKA 1QOZA 1XZJA 1CUSA 4DSZA 5AIBA 2JGEA 3DCNA 1U4NA 1OILA 4OU5A 2G63A 3FWHA 3R3VA 2B4KA 4NMWA 1CUUA 3WL7A 1EXWA 4MQMA 3WWPA 1KU6A 5C7YA 3R0VA 3CN9A 1YSCA 1CUGA 2HA2A 2BCEA 4BATA 4BCCA 1XLUA 3WKAA 4N5HX 3H2IA 4F0JA 1ZD5A 3LCRA 1CUVA 1JU4A 2IIVA 3L1HA 2VA9A 1P0MA 3GA7A 2ZJ7A 4F21A 4G4IA 4UBMA 3RM3A 4HS9A 3B5EA 1E8NA 1H2ZA 5LZ2A 5IH7A 2QS9A 1MNQA 4UHEA 1E8MA 3S2ZA 4AMZA 2VF2A 1GQRA 5ALDA 1W76A 2GYVA 1EVEA 3I1YA 5AOBA 3IUJA 3BDIA 2QR5A 4AQDA 2AJDA 5DYTA 4V2IA 2C0QA 3H19A 4NZZA 3DS8A 4JYMA 2XI4A 4FTWA 4RPCA 1WHSA 3A2LA 1H2WA 4X94A 1A8UA 2Y6UA 5DLPA 1WPXA 1DQYA 1Q84A 2XB6A 1IZ8A 2JF0A 4EUSA 4H0CA 1YCDA 3WKBA 3V48A 3ZLTA 3B12A 3VXKA 5HF6A 3FYUA 2DCMA 3F96A 2PKYX 3DYVA 3GUUA 4UFNA 2Y1KA 2HU5A 4MXDA 2Z8XA 2K2QB 3C5WP 1VA4A 1QTIA 3R3XA 4YPVA 4ARBA 1R1DA 1YS1X 1BRTA 3DQZA 1MX9A 3G8YA 4CIBA 2VJBA 4J7AA 5IVHA 4K6KA 4C6HA 1GPKA 5BOVA 3WLAA 2HM7A 3V9AA 3IBTA 4AX4A 1L7QA 2JEYA 5LZ5A 3AZQA 2GZSA 2OAGA 3WYDA 4H77A 2VJAA 5EI5A 1PV1A 1YB7A 3WL8A 2IX9A 3ESAA 4BRZA 5JASA 4A16A 1ZD2P 5HKBA 2XUDA 3QYJA 2B61A 5CW2A 4XX1A 1XZBA 4HTAA 1AUOA 3AZPA 4P93A 4OB7A 1EDDA 3WK5A 1WHTA 5FLKA 2XQFA 3BF7A 3BIXA 1CQZA 4MJ3A 4N5IX 3O4GA 4J0HA 2QKYA 2HA7A 4UUQA 4C87A 4MYSA 5CTAA 4AN1A 2XUJA 3HSSA 3W05A 5FUMA 5LZ4A 5ISMA 1XZKA 2XUAA 2OCIA 2PPLA 1MNAA 5CRIA 5E4JA 4JNCA 4QWWA 4U2DA 2PM8A 2QT9A 4MYDA 4LKOA 3IUNA 1PFQA 1F0PA 1YR2A 1ZGBA 2XUIA 3MUNA 2WFLA 3TRDA 4L9AA 5AIAA 3WWDA 5K3CA 2CZQA 4DMCA 5AO9A 3DL4A 2V98A 4BZZA 2ZYRA 2O7RA 2D0DA 5F4ZA 2JGFA 2O7VA 3D0KA 2RIPA 4UBLA 3EBLA 2DQZA 4BBZA 1THGA 4GEGA 5ALZA 3NWOA 4CIAA 3DD5A 1UOQA 4OCZA 1RP1A 5FV4A 2EDCA 4BAGA 1J1IA 4CCYB 1QONA 3F8SA 5ESRA 5C8VA 1UWCA 5A71A 3K2IA 3FAKA 2OCLA 4FFWA 1LNSA 2OQIA 5D3KA 5JAUA 4PQEA 3V1MA 2PSEA 1U8EA 5K3BA 1HL7A 3BIWA 1GKKA 2BKLA 3IURA 5JARA 3U1TA 5AI6A 1MN6A 1XLWA 4X6XA 5ALRA 2ACKA 4Z49A 3BF8A 3HEAA 4H7HA 3ZPXA 5LKRA 1DT3A 4X92A 1DU4A 5HF5A 5JZSA 5D3ZA 3G0CA 1CIJA 1UT6A 1ZGCA 2PUHA 4Y2VA 3LS2A 3PE6A 4KAAA 1D07A 2WSLA 4X97A 4U2GA 4DMHA 3WQHA 5HFNA 4O08A 4Y2PA 5AICA 4UHCA 1TIBA 1NU6A 5D7BA 2WU4A 4U2EA 2I03A 3EIOA 4E11A 5HKAA 5H3HA 5AKIA 1G4HA 3HZOA 5K5EA 4EA6A 3WK6A 1WB4A 4DNQA 3SC2A 1XRMA 1XZIA 1ORWA 1ZICA 3H2KA 5EIHA 2QUAA 1JJIA 3G02A 5AKYA 3E3AA 4H35A 4E46A 1C4XA 2XDWA 4INZA 3G0BA 1GQSA 2XQIA 1XKLA 2H9YA 3WI7A 2XQKA 1GGVA 2PSJA 4L72A 3PI6A 4XWGA 4UBNA 5A7GA 5ALMA 2PL5A 4AMYA 4QWMA 4WY5A 4XIIA 2AJ8A 2ES4A 1DTEA 1AQLA 2FX5A 1QIEA 5ALQA 4JEIA 5KREA 1OCEA 3WIBA 3QPDA 2BUCA 4WFIA 4EZIA 5ALUA 5AI5A 5DYYA 3EQ7A 4B85A 2PSFA 4P92A 1LLFA 1JMKC 3M3DA 1EB8A 3X3HA 1JT2A 4UBKA 3I2GA 4KJXA 3OURA 4G8BA 5DNUA 4Y2JA 1R88A 1FJ2A 1QE3A 1CUIA 3IULA 3BJMA 3G9ZA 1XQWA 5CMLA 4I4CA 2OPHA 4PSCA 2VSQA 3RARA 4UHFA 3PF8A 4QLAA 2HA3A 2VQ6A 3PF9A 4I3FA 1XRRA 4BRSA 5JD6A 1J06A 5T4FA 1H2XA 1MU0A 5JD4A 2VJCA 1DWOA 1TQHA 1CUWA 1UKCA 4IQ4A 3H04A 4KE6A 5EIAA 1DX4A 1N8SA 2HFJA 4W1QA 5T4BA 1SCKA 2V97A 3TEJA 3A2NA 2DSNA 3C5VA 2QJWA 1ODSA 3C8DA 1TKRA 4IH1A 1ZIXA 1CUXA 3GROA 4C01A 3O4IA 4MEAA 1JU3A 3H2GA 5AKKA 4Q1VA 3FLBA 2QZPA 4X93A 2WG2A 4WY8A 4FDMA 4ZGBA 4WFJA 1XZMA 3HRHA 4KYVA 4Q05A 5CT4A 4ZXFA 1E89A 3I6ZA 1IUNA 4UHBA 2J3QA 2C5GA 3RK4A 4AB1A 1K5PA 2YASA 2CMFA 3HI4A 4FOLA 1R9NA 2JGIA 3C43A 4LXHA 4EY4A 5ALGA 5JD5A 3T4UA 1G66A 2HRQA 1EA5A 2HHAA 3VJMA 3VJLA 1LPMA 1YASA 4PSUA 2GZRA 2HA5A 3H1AA 1GKLA 1CQWA 5HZGA 3HACA 1CR6A 1H2YA 3U0VA 2WQZA 1U2EA 1LBSA 3BDVA 3AINA 1CUBA 3LIPA 1MAHA 3C6BA 1ODCA 2WIDA 4RGYA 2VAXA 1P0IA 5DJ5A 4FFVA 1L7AA 5ALOA 2GYWA 4E14A 2WG0A 3QM1A 2XMQA 4OD0A 4FNGA 4JYPA 4UBJA 4AO6A 5EHQA 1UKAA 1XQYA 5JAHA 2XMZA 1WOMA 4C4YA 1BU8A 4B82A 3FLEA 5SYNA 1NX9A 2R11A 3TJMA 1Y7IA 4C88A 5AKHA 3FVRA 4W63A 5LP1A 5ALJA 2OAEA 4B0PA 3GELA 3I1IA 3G9TA 4QA9A 3UUFA 5AK5A 1J2EA 4D9JA 4LIPD 4QE3A 1UKBA 5JAOA 4G4JA 2Y2UA 1EDBA 1XLVA 5LLSA 5BWCA 2FUKA 4IHAA 1BCRA 5LZ7A 2XUFA 1VJ5A 1R4ZA 4M0MA 4B84A 4FLMA 5FOQA 2WUFA 4G8DA 4X71A 1MTZA 5ALPA 5ALNA 4Q82A 2VATA 1FFCA 4OUKX 3VISA 3KOOA 2H1IA 1SC9A 5AK6A 3Q0TA 4EY6A 1GPLA 5IVKA 1TK3A 4OSEA 1CFJA 2E3JA 2C5FA 1ZIYA
chains in the Genus database with same CATH superfamily
1M6EX 3SPXA 1SVIA 2ZJ4A 3W9YA 3HK2A 4HDOB 2HA0A 2I29A 2P62A 2AQKA 2B82A 2JGJA 4HAZA 4PM4A 4WECA 5H9VA 1Z0AA 1GLGA 1P1JA 5DHRA 1W0KA 2PUDA 1PZGA 1FFBA 1Z29A 3KWLA 3ELBA 4OP2A 1FYVA 3SEAA 4DVGA 4FYJA 3WA6A 1U8XX 4UNQA 1E3WA 4ZEXA 5MN4A 3OX2A 3E35A 5F77A 3P7MA 2Q0QA 1DELA 3PVCA 3OFJA 4EGSA 4UMFA 3C14C 4ZI7F 5CYGA 5JCOC 4CEJB 4L2IA 2MOKA 3BIOA 4E09A 1GG5A 3EXHB 2P30A 2D06A 2R8YA 3UFXA 2NUTB 4DYVA 3MCZA 4ZK6A 3ISTA 4HH3C 1SG6A 2IQIA 3Q2IA 5JSFA 3S2SA 4B87A 1ZXLA 3IE0A 4C05A 4R1TA 4V02A 1A5SB 2IL1A 1JQJC 1BTOA 3FUCA 1QYXA 4RF2A 1JEJA 1JDPA 2R8OA 4REOA 4XZ3A 3MAJA 1NLZA 4CM5A 3MW8A 3CF4A 2D74A 4I55F 1YRHA 3AFIA 4RTRA 1EVIA 1FVHA 2XH8A 4ESVA 4XDHA 3JXEA 1CJTC 1Q19A 2MYPA 5CCEA 5G40A 4OFZA 1NC3A 3G1TA 3I1JA 3HTXA 2HEGA 1CZRA 2C9OA 4QFCA 1UK9A 3ILYA 4TLBA 2UVPB 4RZIA 4UQPA 4TL9A 3IUMA 5EKDA 3ZQKA 3ONFA 2OLJA 1LWOA 2O2IA 4WFQA 5DLYA 1Q95A 1XL1A 4OYYA 2I62A 5JY1A 4QZVA 1SVNA 1FFSA 4YRMA 4S1VA 2A5LA 3QUAA 1SVMA 2XY4A 4FUQA 1NL3A 4EVIA 1DBPA 1J9GA 3N7UA 1D2NA 1HDZA 2WA1A 4XH9B 3IA2A 2P0EA 1QOPB 3MFYA 4XQGA 1NY5A 4QAQA 4YS6A 5FPHA 1UODA 2RE8A 2D7DA 1KQNA 3IIJA 3AJRA 1C7EA 4R7ZA 3RRYA 5KTSA 3LZ6A 1WRBA 1VHJA 4RETA 3D8UA 1I1NA 3FLAA 5CR9A 4R1NA 2B21A 1DBVO 5EXDA 1KBZA 1T25A 4Q7JB 3FZGA 3A2MA 2IS4A 2NVWA 1WXGA 4BLQA 3OTQA 4S24A 2QF7A 1PNTA 2NM0A 2QZZA 4RD4A 2QJFA 4YI5A 3WLOA 3QXHA 1FUYB 2BCGY 2M6RA 3V2IA 3FFXA 2AEEA 1RHQA 1VA5A 3VKHA 1JFVA 1V35A 5D00A 4KFCA 4PY2A 4C6RA 2A7XA 3M6FA 4WZBB 4UFOA 1WG8A 1V8BA 2QD1A 3D6JA 2C7VA 2W2KA 2XYPA 1OXTA 5KSOA 1NKSA 3O2QB 4OLAA 1LPOA 5JYBA 2DU8A 4ANFA 4NDAA 3HU5A 3QI7A 5JSHA 3L4JA 4WV3A 4G5XA 4CKWB 1U04A 5HSGA 5H7XA 2H54A 2Z5FA 4AMUA 1LDBA 1FB5A 4LQ4A 4YRRA 3S2IA 3TL3A 1ADCA 5I9LA 2F3SA 3K9BA 5FHRA 5C5EA 3B36A 2Q3JA 3ECCA 4CETA 3QFHA 2OAP1 4HRXA 2VQSA 2B98A 1RAEA 4IHJF 2W8ZA 2HW8A 3P96A 3KJFA 4IBOA 4FGSA 5EIEA 4IOLA 3T9CA 4K8RB 4NJOA 1XKTA 1Q12A 2HHCA 3WMFA 1V8ZA 3DE1X 4JNKA 1JZQA 4Q9AA 4WTOA 4R8MA 3SKYA 4D46A 5F9FA 3WLTA 3TF5A 2A35A 1FCJA 5AOVA 1EQ2A 1TVCA 5GONF 1XFAA 2XIJA 1B4DA 2QIPA 1XVTA 4HX9A 4JBWA 2A86A 3CRQA 3ILHA 5DTIA 5GOZA 2ZQZA 5B3JC 2VQEB 3OZWA 4QO7A 5LOVB 5B1HA 2R4TA 3B9BA 2ZRPA 5LBTA 5I9IA 5JVDA 3QNMA 4ZRMA 4JUIA 3RVLA 3I9V6 1IZ9A 1WF3A 3N1UA 4MUFA 3QMWA 4ROSA 2IOYA 1KY3A 2ODAA 1P2UA 3I6YA 4KJZA 1IM8A 3C4JA 4M7OA 4QDZA 2OYRA 3S70A 3G9XA 1B8PA 2YXLA 3S99A 3NOOA 3SBEA 4BMVA 4P54A 1UBJS 4D44A 1JLLB 1H4VB 1ZY2A 1E6MA 3A3NA 3D7KA 2D13A 2FXVA 4L4RA 4HB3A 4UDNA 2OKCA 3ZY3A 2YUIA 4DLNA 5LXTA 1D3AA 2GJKA 1YDFA 4J76A 3EPRA 2G06A 4GXTA 2WLSA 3GA5A 1JXAA 1GT6A 1U63A 2JRLA 4MW0A 4X62B 3UUWA 1EJ0A 1QZ3A 4LNAA 1IAVA 1JF8A 1JDSA 1MF7A 3A36A 4K81B 1NV9A 4BMDA 3OM8A 1K97A 5J5CA 2CVPA 4QJIA 4OKSA 3QSGA 3EULA 1MENA 1YZKA 1OFTA 4W5RA 1BW9A 5EJGA 1PW7A 4RX1A 3HXKA 4GLBA 3LVRE 4WDQA 4DIDA 2ZJOA 4QD3A 3WYGA 1NLUA 3EEYA 2EJUA 2QLTA 3F98A 3TJZA 1TYBE 5BPFA 4DV5B 3OZSA 3KKMA 4QGHA 3F4KA 1MC1A 1ADGA 2Q8QA 2W70A 2LKDA 1U80A 4FU0A 1RHRA 2Q3MA 3F74A 5IJ9A 3I2IA 5BNZA 1FS4A 3I4CA 1PK8A 3IIKA 1VJRA 4GSYA 2DTEA 1AS0A 5DI9A 3AV3A 3JD0A 4YASA 4B6SA 4EKDA 1QZXA 3R0XA 5KKNB 4WKGA 4RFSB 5EZSA 4C6TA 3CNOA 3OIYA 5TQ0A 2XYGA 3QHQA 3KJQA 5TC4A 1D2GA 3AM1A 2F1RA 4DG9A 5BUQA 2N9UA 1V39A 4PQRA 1A7UA 2B37A 1XV5A 3I9V1 1CUAA 1K89A 1YQEA 4GOOD 1JR3E 5KTOA 4FE7A 4TXLA 1ZA1A 4O4IA 2AUMA 3AILA 4LJYA 1CERA 5FOWA 1OQAA 4E22A 1KYIA 5JS7A 2Z95A 4NJEA 2LE0A 1Y1KE 5IVIA 1GP2A 3D6HA 1DHTA 2XCIA 5AJYA 2G6TA 1K1EA 1YI0A 2WWTA 4J0IA 1YZVA 4ZZ1A 4V1CI 1W30A 3COPA 5EP3A 5HYVA 3I6QA 2J87A 3B6KA 3PG5A 5K0GA 1SUDA 3AETB 3KOUA 4GPIB 1W46A 4QU5A 4F2GA 4IIVA 2HDNB 4URZR 3S1SA 3UANA 1OYOA 3WSWA 4IZIA 4TV8A 3UXYA 4FWTA 3HSKA 1SCJA 4G0OA 4G0NA 5CHYA 3PQ7A 3EVBA 4R0NA 3J7AC 2QXYA 5CDUA 3DLBA 3AUJB 2XOXA 2XNSA 4DQLA 1BE0A 2VDVE 1YJAA 3VOBA 1PJBA 3VGPA 3X1MA 3C7CB 1D7OA 7MDHA 4K9LA 4HLNA 1XRSB 1D09A 1YRYE 4PNEA 2Q5QA 5CAEA 4U8GA 4RZHA 3DF7A 2VSYA 5AI9A 2DOKA 4NK5A 4RUKA 4N1AA 4TLDA 4C7XA 4FDVA 4NPCA 4YQZA 3ASVA 3A1WA 4C08A 4NNOA 3IRVA 4EOGA 1T1RA 5KWJA 2FQXA 4YO7A 4AQYB 2EEZA 1J24A 3E9ZA 3TLEA 3WLPA 1BA2A 4DBLC 3X44A 2VVTA 1AOXA 1GKUB 4FBLA 4J0EA 4BO5A 1XZHA 4L5BA 1X86B 3A6JA 3KVRA 4N0PA 1T2EA 1RQGA 4ITUA 5DBGA 4B81A 3MWYW 5ITZA 1EKXA 3FUWA 3LHFA 5CH8A 2HTFA 2VRCD 4RTQA 4CM1A 5G4KB 2OCGA 2CCGA 1FS6A 3D2AA 5AM4A 1KY4A 1G3RA 1VYHA 1UMCB 1FTWA 1SC3A 3PLNA 1L3BA 2H3HA 2YVKA 4CMKA 4XVCA 1IXYA 1Z12A 3YASA 5KYUB 3WSVA 1KFBB 2XBMA 3GZNB 4WCVA 1MZVA 3HQ4O 4HNHA 1D0VA 4JB3A 3RU3A 3UMVA 5K0EA 4C5BA 5KOHB 5EUQB 1T8UA 3KV1A 1KOJA 3O73A 2AG5A 3GRAA 1UPFA 3FDZA 3BXPA 2GLUA 2OG2A 1K66A 3HC7A 2IE8A 4L85A 3ZHOA 3FSGA 4RWZA 4RTKA 1KYZA 3PNQA 1MZPA 5F1PA 2JGDB 3GV0A 3FPKA 4CCYA 3IDZA 4BTLA 4IZOA 1NKVA 1C50A 4K9QA 1VG8A 2FR8A 3PDUA 4ARIA 3OIVA 2P3QA 4WZ6A 2AR0A 1R3UA 4KI7A 2DR3A 1RTTA 4FHDA 1TCBA 3HL4A 1WX1A 5C0OE 2AXNA 1N1DA 1Q7EA 4DWJA 1MD9A 4Q12A 1JU9A 4WXRA 4ZAFA 4AKHA 1U0NA 4C21A 1XNQB 3W34A 3IKTA 3I9NA 1AJEA 4GOKA 5IT9A 1ZD3A 3KEFA 3M6LA 3RF6A 1GZUA 1NV8A 1Q21A 3E5MA 4ZMRA 5I7EA 1QCCA 4U39A 3D4OA 5CJPA 3KD3A 4Y7DA 1L4UA 4ZVRA 3COYA 3OM9A 3VZSA 5FOUA 4EG7A 2W4MA 4O25A 1XKQA 4QYWA 4AFNA 1NRWA 5F2OA 3PHJA 3F73A 3GQBA 1JG4A 4S1TA 1RZRD 3DO5A 5L40A 3WQQA 2ATXA 4L9SA 1HYBA 1ZCJA 1EXVA 3QQ5A 1H8ED 1T1IA 3VR3A 5IBCA 4OAOA 3TH5A 3U4QA 4GRIA 1M1UA 5CD9A 4BQEA 3WG9A 2C95A 3H65A 1DZIA 2PGJA 3IJEB 2RHRA 5HM6A 4TXNA 4W9NC 5BWMA 5AVTA 2ID8A 2OSVA 3F6YA 4GQIA 5ELMA 4Z1MA 1N3IA 2BM9A 1RJ9B 3U2QA 3GJ6A 2JAXA 4NV1A 5TNXA 2H9AA 5K0FA 1LI5A 3KPWA 4ZVVA 3A27A 5EG5A 4KQKA 1O5TA 4B3BA 2AHRA 4U63A 2IYZA 4M9SA 3CCBA 4W5JA 2EEPA 1M6YA 3CH6A 3GYGA 3HR8A 4JEHA 3RBAA 1ZOPA 2W0MA 3N39C 4OHZA 3M3PA 5C4GB 3B2QA 4R68A 3D8RA 3K09A 3H1TA 3SJCA 2RHTA 3ONWA 1HZZA 5JFTA 3ZV3A 3IYLW 5IULC 2J5XA 1RADA 4RLSA 1O1YA 1G5PA 2A0YA 3CUVA 3ESXA 1KP9A 3FWKA 4GLFA 1VKHA 4PLTA 2DYKA 5A02A 1F6WA 1A95A 1NN5A 4WK2B 3WC4A 2B20A 3DZFA 3ISJA 3HUEA 3GGOA 1B3RA 3MAGA 2B83A 3GEMA 3TQOA 3FVQA 4W5OA 1NMEA 1BFUA 2E4WA 3I4LA 2J33A 3EXFA 1KEPA 2XF2A 1E1NA 3NWEA 4CJXA 4Y0NA 2XWPA 3C8MA 1ZISA 4U2FA 2JFXA 2RHLA 4WFKA 3L46A 4RKQA 4ZOLB 3ZHTA 5LR6A 1Y5LA 5EHIA 2QRVB 4ZDWA 1SKUA 4D99A 4Z7QB 5KPJA 2HGSA 4RKRA 2AC7A 1HFKA 3PKZA 3V00A 2HU8A 4D96A 3EA5A 4D25A 1ZL0A 2WSSD 4HWSA 4QTUB 3PFHA 3TDKA 3PQ2A 4OBBA 5EMHA 4D2IA 2MSKA 1YI1A 1T5OA 4EGFA 1JHOA 5A5FA 1L3CA 2G5CA 2ODQA 1Z6AA 3HDVA 1Q1NA 4FOPA 4R2KA 1ZVMA 3V9PA 1N36B 4W82A 4KRXA 1GL3A 3DBIA 4O2AA 3TD2A 2VDRB 1W0CA 2EFYA 2FJUA 2J0VA 5CYFA 4LF7B 3COZA 1ECLA 3H4TA 1AUVA 4NYMQ 1PGNA 3DWEX 4TLCA 5GJBA 2UVDA 3OA2A 1KJJA 4PYJA 2XSZA 3LLSA 1Z36A 1IEXA 1Y1LA 3PVSA 3PX3A 1H4QA 2O2CA 4XQEA 4I4TB 1D03A 1MEEA 3HB7A 1C1XB 4I3HA 3DOJA 1UKEA 2B92A 2I8CA 2NYRA 4JBYA 4CKBA 4F45A 1OB2A 4NOLA 1G59A 1QV9A 4YJ2F 4N6GA 3SXUB 3UOGA 3Q3EA 1SQ6A 3B6EA 4K9DA 3G7UA 3PENA 1NN1A 4CMEA 4L50A 4AIRA 4YY3B 1QP4A 4IDPA 1V16B 4PGAA 4PEVA 4N3AA 2G76A 2F2TA 5I9SA 1GDTA 1J8DA 1W36B 2Q5OA 3TOCA 1XZAA 3IV7A 1V1MB 4TUYA 3WY9A 3JATA 3RIYA 4CODB 5G0SA 2JKVA 4HP8A 5HIIA 4L6IA 4WK0B 2YIMA 4A8HA 5JZMA 2R6HA 2Q9AA 3FRIA 3ZUGA 1U2TA 1Z38A 4QQRA 1XNGA 2AH5A 4WLVA 1QIDA 2E5LB 3L92A 3KTAA 4V3BA 5E4YA 3G82C 5CFQA 4UPVA 2ZDHA 4RPLA 4F91B 1RLIA 3LNCA 1REQB 2JVKA 3GZJA 1G21E 2PUWA 1O6ZA 1Y1QA 3LPNA 2FF7A 3LPLA 1QAMA 3H8WA 4MWGA 4KRYA 2V3VA 3CLRD 1NYRA 4YRLA 5F33A 2EDAA 4WBSA 5JS2A 1RYNA 2OZKA 3OE7D 5HFAA 2P2SA 3DHEA 3V8PA 2JHPA 4HXGA 4X00A 3TSZA 3DD1A 3FR8A 4BO6A 1UBLS 2E49A 2RCYA 1MABA 1NVUQ 2UZ3A 1RJWA 3TSAA 2IDMA 3F49S 2V4MA 3E48A 3HUFA 4KIWA 5EWJA 3EPKA 2V0CA 3P5BA 3R9WA 1LF5A 3R5FA 5ECGC 3NWPA 3LXMA 2VK2A 1L8OA 4G5SA 4W1RA 4O4IF 1IMJA 1JNYA 2POCA 3KSMA 3I9OA 3OKFA 1YF3A 3TK1A 4WK4B 1H1DA 2B4YA 3DOEA 3RJ9A 2BI4A 4HAIA 3K53A 3AESA 4G6ZA 3OLCX 1SEVA 2BWJA 3OIFA 4IGIA 4PC6A 2NU6A 4JJEA 5CURA 1SPBS 2YOFA 4WL0A 4IQ0A 3B48A 4HDSB 4AJHA 3EA0A 2QPTA 4DCVA 4ZGWA 5HGXA 2BFFB 3INRA 3MGBA 1CDOA 1LPBB 3DOHA 3NAQA 4PYMA 4R1MA 3GPLA 2BM0A 2AJBA 2DX7A 2JNWA 2QYOA 4PAWA 1W1IA 4PLWA 4S1OA 4M0EA 4AUMA 3QX8A 3ZBPA 1H9CA 2CXOA 2PU7A 1GUFA 3EWAA 4NTZA 4TOIA 1GPWB 2D0OB 2FGKA 1JG1A 3DGEC 5D5QA 5C9ZA 3WLFA 1KJQA 2XAUA 3NV7A 3QOYA 5BN5B 4YREA 4B4OA 1R4MA 1SIOA 2Z4SA 3AEUA 3AUSA 1Y8AA 3NC0C 3MTDA 3WWOA 3HJAA 2F17A 3VR4A 2DQYA 3O3OB 2PH1A 5BV2P 4YBZA 3F90A 3B20A 4MV6A 4PYKA 5C7OO 2BEVB 1IQRA 3D3WA 4TVSA 1NRJB 2B1RA 3IHKA 1BJKA 1U1DA 2A4MA 2X15A 8LDHA 3SQDA 3VR5A 1T1SA 1Q91A 2YQ4A 3MPOA 4U2CA 1EVYA 1IHXA 2V7GA 4TLMB 1OWMA 1RAAA 2A9JA 2OB2A 2I7CA 1B6SA 3HABA 4PZ0A 2G0AA 1G3QA 1OXKB 3T9FA 4BV2A 3R3YA 1H0HA 3ABOB 3FI9A 4RAQA 1ECJA 3U3KA 1P0CA 3OMLA 1DIGA 1DC3A 1XXLA 3RTEA 5AVZA 1W85A 4TKVA 1PDVA 2Q4EA 1NIPA 2NN3C 2ZBDA 3P26A 1IUPA 2Q6IA 2UZ1B 1SVUA 2ATEA 4KBGA 1TQ6A 1M6HA 2BCJQ 2ZPUA 3LBNA 4BMCA 1OXUA 1N34B 2PX6A 4B6PA 1CQXA 4DWOA 3AUKA 4LQLA 3E5NA 2K7ZA 4GOXA 8ATCA 1CW2B 1MXHA 1J0AA 1N9ZA 4M76B 4RQBA 2DHDA 3IV6A 4HDRA 2Y1WA 4E5NA 5JT1A 5KTNA 4NARA 1JJFA 1OW3B 4QGAA 1GU7A 2E1RA 4NBLA 2BRUA 4PNZA 3UF0A 1WCWA 4KITB 1DCTA 5ESWA 1XN1A 1VFNA 3RAFC 3LP5A 2WFLB 3LPDA 1P6QA 3EHEA 4WOKA 1XA3A 1GIAA 4HWTA 4A5SA 2J8ZA 4NBNA 4WX2B 3FFWA 2B5OA 5CUQA 1L3IA 2ADOA 2P7IA 3C4QA 4UAUA 3UY4A 4HDNA 2ENUA 1CEXA 4B4DA 5LQJA 1OXMA 4JB2A 4B5LA 1Y1RA 5E1OA 3N87A 4RIHA 1X1QA 4INOA 4BASA 1P2GA 3E22A 7AT1A 1WO8A 3OEWA 3PRHA 2PX4A 3GPBA 1KH3A 5JTTA 2Q1XA 3DFUA 3RO7A 1YAJA 1H5UA 2UV8A 3BA1A 3W78A 1KJYA 4EBFA 1BEZA 4A03A 1NQAO 4D4JA 4MITA 3IMFA 3WDSA 5JRDS 5REQB 5T4EA 2BHTA 1U65A 3H0KA 4RGQA 4F5ZA 5CLQA 2YJZA 1C2YA 1HYEA 5AKLA 1ZJYA 2PSHA 1U3VA 2JHFA 4FYMA 1QIFA 2J5RA 1PEYA 2H7VA 3A26A 2WKQA 3AY7A 2R6FA 4FIZA 4AY6A 4DIMA 3HA3A 2B8WA 2XODA 4FCVA 4OAPA 5EHNA 2HSJA 5TXGA 2XBUA 1TM3E 1PFUA 5DBEX 3W9BA 3RD5A 1ISFA 2V4ZA 1JDVA 4V0KA 4DPMA 1F2TB 4G4SP 3PL5A 1A1SA 2V7VA 3CN7A 4TMXA 4C0BA 1TDJA 4UEWA 3E9DA 2ZUFA 2X0KA 1U9CA 3CUSA 3UV6A 3AIIA 3A3YA 2VI5A 1VLQA 3TFOA 1SO8A 1E1QA 4IVRA 4PX2A 4O1IA 2A5DA 1YS2X 2XLBA 5AM0A 5EWJB 4X41A 3ZDEA 3ZKWB 4Z7OB 5DX0A 3SYNA 4ZEMA 5JNWA 1DXHA 1ZWKA 2E5FA 5TS2A 1Y4UA 2VEOA 4D8UA 3OAAD 1Y3CE 2AYXA 5C3UA 1AZTA 1NQVA 1KJWA 2XDQA 3F78A 4MYUA 3CLUC 3IAS1 5LB2A 5JIBA 2HQ1A 2A14A 1VLVA 1BKSB 1EFKA 2PV0A 2XDYA 4B83A 4F4HA 2Z0MA 4YJFB 3CIOA 4XGKA 5AKEA 1FLAA 3CTMA 2NO5A 3KIPA 4D56A 4OXXA 2VEDA 4B44A 2CXUA 3FDXA 3LSYA 4J4TA 1X77A 5K6TA 2DH5A 4ZAWA 3CLUD 4JA0A 4QKQA 1WPQA 2QBYA 4PG5A 4OYHA 2IPMA 1AC5A 4OGFA 4XA8A 2EJWA 1T36B 4JWKA 1NPYA 4L3WA 4WEOA 3CEPB 3BH6A 4WLFA 4YLEA 3EBPA 2W90A 3ZGVA 1PK7A 4EFNA 5BN5A 1KSFX 1E1MA 1FDRA 4YCMA 3KXLA 2O20A 4LA4A 2RGNC 2OK8A 3OZCA 3TDMA 3WGHA 3WAGA 1Z4JA 2CCJA 2OGSA 2C2KA 3AO0B 3EZGA 3KYCB 1JUDA 1XSEA 1W4BA 3O2NA 1Q1GA 2AE2A 4IFTA 4RJIA 4AO8A 3TOSA 2C2MA 4X8MA 1Q1ZA 3T5CA 5JNTA 1JIJA 4EG4A 4KODA 2XQJA 1TZJA 4HGZA 1T9GR 1LH0A 4HJRA 4HDSA 3QXXA 4MVJH 4YCDA 4CEJA 4YQEA 1PUIA 2FEKA 2PKEA 5EVCA 1VP3A 2AWNA 3BUSA 2XEXA 1FOEB 1R6VA 1GM5A 2EG9A 3EGDB 3LMKA 3NHWA 4HJXA 4TZ0A 3R4CA 3ZWVA 3A1DA 5KSWB 1H3EA 3U7EB 1RWPA 1E1KA 3EPPA 3BTOA 2ECQA 4NICA 4ND5A 721PA 5FP0A 4OSPA 3D59A 3SP1A 3C24A 2CDBA 3QE9Y 3BWYA 2YFKA 3HXLA 4IO1A 3CNHA 1HEIA 3TOXA 3O93A 2PJRA 1H8HA 2AKYA 3E1SA 2O5RA 4B9EA 2D1QA 4IOKA 2ZB8A 4JOBA 3JPWA 4BO2A 2W6ID 2XUPA 1MX3A 2QUKA 1DV2A 4Q4JA 4Y9UA 3BKWA 5BVHB 2BTQA 2QEQA 1N2IA 3RTBA 2VJYA 4B35A 1QWSA 2WVHA 3O26A 4QXAA 4I4IA 3TR6A 3RYCB 2C9ZA 2QTBA 1CVRA 4F2PA 4IOMA 7MHTA 2QMHA 5EZQA 4A7PA 5KYXA 1EP1B 3BJZA 4I8DA 4PBTA 3BMNB 5KINB 3LCJA 2W6ZA 3RFCA 1NIJA 4N0QA 3OG9A 1ZGGA 3HFSA 3CCCA 3F6EX 1KRXA 2Q5LA 2AXEA 5IUJC 5F3RA 3CWZA 4JV5B 1QR2A 2B5VA 1NMQA 4WZBE 3Q8XB 5CW1A 5AKXA 3G5MA 2DR2A 4E88A 2HEIA 5DBIA 1XQXA 4G85A 4OU4A 4TVOA 4UBIA 2BMFA 2I6UA 4M9UA 3TIVA 2FWRA 1T1GA 1THMA 2HK8A 1ZRHA 3B52X 3H4VA 4FDLA 1V9SA 2HL6A 1VE7A 3N0RA 2O1XA 4Z0TA 1ZL2A 2OBFA 2Z2ZA 4B3IA 3H18A 4C1NA 4TVBA 3QBJA 1XZCA 2H5IA 4H7EA 2IFTA 2QWXA 1JAHA 2WG1A 4Z51A 3DUFA 4RS4A 2F9MA 3R7WA 4YV2A 4M1QA 2AZ4A 2WE8A 3ORSA 2SCUB 1FYWA 2JJ1A 2GBGA 1UEIA 2QA5A 3NJ8A 4QG3A 3GHYA 3I8OA 1K3FA 2X0NA 3I01M 3X1ZA 3FSRA 4NR0A 4L16A 4RHCA 1X2BA 1AQIA 3CH4B 4M0KA 3PHLA 1KMMA 1RHUA 2HRBA 1DKRA 2NGRA 3FKSD 3VO9A 1ECFA 4HNGA 3FYDA 4LSMA 1T8TA 3R5XA 3OPMA 4MPJA 4JI8B 1FFDA 2WT4A 3AHCA 3HNRA 4ZAYA 3OHMA 3E7XA 3OPXA 3O9MA 3WNZA 3ZBTA 3I5XA 3N8NA 1KNXA 3QU5A 1N3LA 4DR2B 4I1SA 4K9RA 3ZJ4A 2IDZA 2QTCA 1SKQA 2YW2A 4RIEA 1UBNA 3BSFA 1QK5A 1N0HA 3LU1A 3FNHA 3T3MB 4LK2A 2WE7A 2Y0DA 3GNQA 2VH1A 4MIOA 1SKYB 4RW0A 2G04A 4Z3DA 4MI1A 3SHQA 4KSYA 3EGDA 4S0ZA 2R751 5C51B 4PG4A 2ZSDA 4AP5A 1EESA 1B76A 4GUAA 1VBFA 5L51A 4YRZA 3FA2A 2BISA 3CLSC 4PYIA 5F7JA 3CRW1 2C7QA 1S2LA 3U9SA 2N0SA 4N6OA 1IVSA 2O2SA 1ISIA 4M21A 4CMGA 4OO3A 2ZB4A 3JV7A 3VNVA 1BKDR 1EVKA 2IU6A 4E4YA 2EFDB 5AVVA 3FCYA 1I0ZA 2FW1A 2GUWA 1R0KA 3UPUA 1CT9A 3D02A 2ZETA 1L5OA 4R3UC 4ZPJA 5E6UB 5BOSA 4LDQA 3KD2A 3FMOB 1A88A 2R5WA 5B6IA 2Q2WA 2J85A 3DLCA 4KK3A 4L8LA 2WHPB 3IQWA 2HQRA 4AUNA 2HCRA 4QASA 3Q6IA 4MV3A 5CVVA 2E4XA 2JBAA 2YFHA 5EJ2A 1F06A 3NH9A 3BIFA 3QGMA 4OUDA 3LQ4A 5KOJA 3PFFA 4BNDB 3AVTA 2FP3A 2XE7A 3JAWA 1ZH6A 2YWJA 2VTDA 1SWVA 3K2QA 4E5DA 4QOHA 5BUSA 2EOAA 5AKZA 5BYBA 1KZ4A 2PUJA 4LV6A 1FFYA 1S6YA 2ZRCA 3L4BC 1TTQB 4LX8A 1EM8A 2QTGA 2W8BA 2WF5A 3B1JA 5DT2A 1ZN2A 1RRFA 1ZHHA 2I2FA 3PU6A 1ZMRA 3NB0A 3QE4A 4H7IA 4Y1RA 2VJPA 2VYFA 5EJMA 1BS2A 2JIQA 4OXRA 3AXSA 4ZAGA 4YB8A 1WKBA 4H7KA 5E7IA 3CR7A 3NJRA 4DXHA 2M6LA 3OICA 4MLPA 1HLGA 1PNOA 1VJGA 1CSEE 2DJIA 2W8BB 3BIJA 3SJ7A 2UVQA 5B6JA 3AB8A 3GP5A 3ETJA 2FH5B 4KFSA 5C1IA 3V32A 5JANA 2QMQA 3QMVA 4JODA 3B7PA 3FWPA 5LU8A 1OZHA 2IPNA 4MMXB 2YXNA 1IU9A 2CZGA 3MWEB 2IY8A 2PL9A 2Y67A 2DFLA 2WAOA 3EE6A 3MINB 3OLZA 3CS3A 3PKJA 1ZXXA 4ND6A 3UYLA 3LPAA 4MV0A 3LGXA 4JD5A 4MTLA 5THXA 3UB3A 2BE7A 1Y8QA 1ZCBA 2QG4A 3I8SA 3D0QA 3BFPA 3EWNA 4G36A 3UHJA 2WIFA 5A05A 5LDDC 1VGVA 3AHHA 4G5GA 4ZVSA 4KVAA 3OE4A 4QRHA 3MCUA 3CLVA 4GICA 5JSKA 3ZDAA 1U7UA 3D6UA 3G6KA 4WT7A 3CVYA 3MC1A 1LSJA 1XVUA 1Z73A 2C4NA 2F43B 4LS3A 1JILA 1ZIPA 2X6RA 3DXYA 3L1IA 4I6EA 3PNYA 4WADA 4ZQGA 2V8OA 3SZUA 2RHBA 4HMOA 4Q3LA 1PVOA 2QOEA 4JS0A 1U1GA 1EJBA 3C8HA 3VNRA 4ZWNA 3GMDA 5E1BA 3NV9A 2FSSA 3GQBB 4B7XA 3GUVA 3OCXA 4PR3A 1ENZA 1N7IA 1ZSVA 3F5QA 3GLVA 2ETVA 2GBFA 4Y9SA 5FPQA 3W2IA 1E6WA 3Q9SA 3OQMA 3E5HA 3IB3A 4ID9A 1C4KA 3HY4A 2RARA 1M83A 3H5OA 4KOAA 3LDFA 4PCAA 3ZCPA 5IDYA 2IS2A 1I7DA 3MT8A 1RM3A 2F3PA 1ULUA 2R85A 4TKUB 1K63A 1NUUA 3IO3A 2FJPA 3O94A 1JDBC 2FSGA 4ARZA 1QH1A 4CHGA 1CIVA 1P7WA 2AF3C 3WBJA 1YK0A 1C1YA 4YXWA 3CUTA 4V0OA 2Y6VA 4ZYYA 1NT4A 1F4VA 3CUUA 5AXCA 1H2RS 4HDCA 3SICE 1JMYA 3OLYA 4A5OA 3HCOA 4BNHA 3T3HA 5IPFA 4HQNA 4HVCA 3DNPA 3T1HB 1G8MA 2VYNA 1I7SB 3KVVA 3GCXA 3L1JA 1HRDA 1C0LA 1KIFA 1RW4A 2YZNA 1EGVB 4FJ2A 2PANA 1FK8A 5ITSA 4BXOB 5DVZA 2HSGA 3D6MA 2W00A 4UAJA 1D0IA 2YICA 3ZXIA 3OJFA 4D0RA 2H1RA 2H5EA 2CHUA 3MWGA 4Q4AA 3T9DA 3ZY2A 1Y6RA 3UZUA 3E18A 5KYUA 1SUAA 4CCWA 1I4OA 4U6NA 4O1HA 4Z9FA 2O2YA 4MWTA 6GPBA 2C94A 3D4NA 5E8RA 3KSAC 1P73A 2ZAGA 3PC3A 1RMYA 1XEFA 2YY6A 3AI7A 3KTAB 1MA0A 2DKOA 3O9VA 1ACJA 4M0LA 1RRVA 4RNCA 4D6PA 1H5NA 3LFHA 2WILA 1I13A 3GJTA 5DHPA 3V1UA 4ACAA 5KJ1A 2YWFA 3CZ4A 4MRSA 3I01A 3M9LA 4PZEA 3ZV7A 3E58A 1USVA 3ZD9A 2WTXA 4CI0B 1I4DD 1KZYC 1UZAA 2NV0A 2HF8A 4KVFA 4XYGA 1DL5A 3K96A 2HJRA 3CPHA 2H85A 4HEQA 4UFPA 2AG6A 4OHYA 4NL4H 3SHTA 1M7HA 1J0EA 1X70A 3ICVA 3OPYB 3P2JA 4QUGA 2UYGA 4HAYA 3TW8B 3LRXA 3CHYA 1ZG3A 1PFVA 1UT5A 2NAFA 3EXEB 4YRJA 1GEEA 1OLSA 2GR9A 1G1AA 2NSDA 4P38A 4WW0A 5FA5A 1BQEA 3RUIA 3WO1A 4BP1A 1XCJA 2DWUA 2GN2A 2M1XA 2OCXA 3BHJA 1EE1A 4IJ6A 1YZ3A 1OYVA 2P4UA 3CZCA 5GOTA 3CPEA 3IOYA 2D8MA 2ZSFA 1LW7A 3HCWA 4TYNA 1C1XA 2R9VA 3ZE2B 3PHCA 3KQYA 4OREX 3R3HA 3PPIA 1NHWA 2P2CA 4QRIA 4XCXA 4TV8B 5K4AA 1KI3A 3WICA 2O3SA 3R9XB 5C5IA 2VPXA 1KA9H 1NBMD 4O6VA 3SJUA 3V7WA 1JSZA 1SCQA 5CGQB 2V0GA 3TL2A 3WKEA 2QPOA 2IYSA 2I6FA 2XYRA 3R3UA 4GOLD 4G1VA 5CM2Z 4YRAA 3UKJA 2NTNA 4HXFB 4NSNA 3LQ1A 1UJ2A 2ZIFA 1EFPB 2OD2A 4DQUA 5GV8A 5BN4A 5DLQC 1XQ1A 4C76A 4E33A 1AV7A 4CQJA 2FPMA 3MYYA 5FADA 4YHHB 2XT9A 4OQFA 1N1EA 2H6EA 4CFSA 3BD6A 4EB6B 1NMXA 4KLZA 5DE3A 3HB1A 4ZQEA 1C8KA 4BX9A 3IEVA 1XZFA 3P4UA 1IJFA 4GGOA 5IABA 1P3JA 3SG0A 3OU7A 5JH7F 2X2OA 4OM8A 1SHLA 3ANYB 5JDCC 3LXRA 4HDKA 3KP1A 2Z6UA 3SAJA 1AKUA 3M3HA 2H07A 4KAJA 3ZVLA 2P8JA 1JKFA 2YW9A 4TS4A 3DP9A 1NJ6A 2C2ZA 1XZDA 1YL5A 4YJ2A 3SNKA 3WOVA 4YDSA 4BYMA 2GD1O 3LWBA 4XAQA 3GLFB 3HWSA 4DC1A 2WJVA 3ICEA 1TCCA 1JS1X 1H0RA 1QDLB 1VKZA 2BKXA 3EA4A 3GP3A 4OK5A 1NR5A 2XLCA 1NY6A 4C4OA 5AI0A 2NO9A 9LDBA 1BYIA 3MMXA 2NVUA 1JB9A 1VCIA 1I0IA 4QJ4A 1VJTA 3AKCA 4FI3C 2QGNA 3VR5D 5AW5A 1KARA 4N3BA 5AHXA 5FEUA 6YASA 2ZJ0A 4DNOA 1SJ9A 4GMGA 1GU0A 1M8GA 2PLNA 3SGLA 1ZNXA 3GJXC 4GX0A 3TRJA 3Q6NA 4GVXA 4YRTA 3SN6A 4U0KA 4GEKA 3N7TA 1U2DA 2KMLA 3GPDG 3W0LB 2I1LA 1AH2A 1NN3A 3GJYA 3RHTA 1NFQA 1O4VA 2L0XA 5EJIA 5JCJD 3LW7A 1ETHA 1CE8B 1GAEO 1W75A 1WVGA 4MV4A 3ZKWA 5A9TA 1SHUX 2DQSA 2O6HA 1IPHA 3P71T 4P7FA 5HTKA 1IZ0A 1R5NA 3M4XA 3Q5EA 2Q3EA 3T1VA 2SNIE 1YJXA 4S3MA 3INNA 4LBWA 4W9RA 2J45A 1D4ZA 1AHIA 1LI4A 4YROA 1CYEA 3SIXA 5FBWB 1CG6A 2XMSA 2FOXA 1NYTA 2XMRA 2C4HA 4WLOA 3MF4A 4ZT5A 3VKFA 1HSZA 1BIFA 2O0KA 4DLRA 4EEKA 5LLTA 4B3TB 5KDDA 5TJ9A 3EF3A 4Z7NB 5E2IA 3TLKA 2BH9A 2P68A 3Q72A 3ZWYA 4DA0A 1D5CA 4R51A 2D2VA 1D04A 1MW9X 2TYSB 2PUTA 3JQFA 4FKBA 4JJAA 3BPSA 3ONVA 3SZLA 4KPYA 5I8ZA 2YUTA 2G09A 3HJHA 4OHMA 4Y0VA 5BMOA 1XDGA 4ND4A 3THWB 1YQXA 1LZKA 1BCRB 1Z6XA 3A11A 3WRWA 1JQ3A 4G1EB 2XGJA 1NXVA 1RQNA 4PAQA 4MP8A 1S3SA 4PQFA 5F5NA 4GNRA 1G8YA 1OFHA 2VNAA 2HZBA 1SCIA 1P31A 1CQJA 1Z5NA 3GT7A 4GWLA 2PYDA 3S55A 4DV0B 2M6SA 1NA5A 3GLIE 4MJXA 1LS1A 2LDBA 3B13B 4J4BA 1G64A 5DTEA 1V71A 3U44A 3VMMA 3HMKA 4FBGA 2GA8A 4LE0A 4QXRA 3UHPA 3NGMA 2Q28A 3D5EA 5KTYA 3RREA 4DUPA 2NUAA 3IJRA 2JIBA 5JBNA 2QJRA 2JFHA 2Z98A 2HA4A 4OI0A 2XHZA 3D3KA 4TXHA 3STVA 3KO8A 3RSZA 2QLMA 3K0AB 3B3GA 3GH3A 2ZUBA 4JHXA 1FDUA 4LSGA 3DPSA 3NHJA 1B2RA 1A9XB 3K9LA 4B80A 3M9XA 1DAKA 4DCSA 5TEWA 1C80A 1SQ5A 5KVVA 2K87A 1QM5A 2V03A 4J0KA 3RS3A 3F7OA 4I1RA 4TM8A 4HQOA 2RGGA 1N2CE 3S2EA 3U3MA 4C5CA 2C58A 3E4DA 3PFWO 4KKXB 4WSOA 4EAQA 1NJGA 2CVZA 3A1SA 5HJ2A 4YCCA 4YMUA 1A3CA 5IK2D 2P9ZA 2ILTA 2WT8A 4BQSA 3UATA 1DRKA 2FK8A 3D3NA 3AF6A 2BGMA 3TNYA 2GN6A 2QGZA 1FNCA 2DWPA 1YXMA 4HYTA 2ZFUA 1OLUA 4XWWA 3A9UA 2PLRA 1XXHA 4RWEA 1KJNA 3KSRA 3OT1B 4J94A 1G20B 1WSBA 3PXEA 4JKYA 1BEEA 3H4IA 3EH2A 3QWIA 5I5EA 5DW3A 5HNKA 3S44A 5SZJA 1TAHA 4Z99A 1XHLA 2O4CA 1KI6B 4JYBA 4Y6LA 5FPYA 3PQFA 2JIZA 2BFBB 2W2VA 4K6HA 5CNIA 2VDWA 3GRUA 1XEXA 3A6LA 3R3WA 4RU1A 1SXPA 2O8EA 1CV2A 2DBRA 3E82A 2EX0A 2Q0XA 5EIFA 5F52A 1O77A 2F8TA 1GCAA 3D64A 5EIBD 2IV2X 2YJGA 2NNLD 3G2IA 3U7HB 2YWHA 4DCJA 4NDZA 1TUGA 5KMGB 2A5FA 4DPLA 4M0FA 3R7DA 4MQ4A 3VU8A 4KQ1A 1M2OB 3D7NA 4DS3A 1GUBA 1FUEA 3QPBA 3PDIA 4L75A 4OI4A 2CVQA 2CUTA 2KSQA 3TPZA 4IIXA 3AVVA 3A1NA 1OLUB 3EZFA 4L02A 3PA6A 4IWNA 5J2TB 2LR0A 2PQMA 1KC3A 3V6LA 2XZTA 4J1SA 1U90A 3G13A 4DSZA 4ENPA 5B1DA 1H9BA 2JGEA 5TDHA 4HDKB 4PRLA 3AHDA 3HDYA 3VH1A 4JFAA 3Q1LA 3V5NA 4MROA 2ODTX 5T8KA 1U4NA 3K9QO 2EKLA 3EPHA 1W2WB 1Y1SA 1Z16A 2NU9B 1N5DA 2MMCA 2FSIA 2UUCB 3BMCB 3U9LA 1KY5A 2FFAA 1GYQA 2C3PA 3ETGA 3R3VA 4ZT6A 4D3DA 1OVMA 3GLHE 4FYVA 4HD8A 5AVOA 5BSWA 5I7FA 5IJ9B 3BILA 4PVDA 3LWZA 3W3ZB 2O6LA 2L17A 2O8BB 1M1YA 1S2GA 3T4EA 4ZK2A 4L51A 3AYZB 5BV0A 1ESNA 1YU6A 1FW8A 3CXRA 3ZU3A 4X61A 4BIIA 4BL5A 1C30A 4PQGA 3T7AA 1N6OA 1SG0A 1I4WA 4NQZA 4DLLA 5KNDH 1T8PA 2QG6A 3PYMA 4LQDA 3I9KA 4H6PA 5NULA 4KX3A 3RYFA 5EMJA 4AZ3B 2UYCA 2F8SA 2O1SA 4POAA 3QELB 1IFXA 4IAOA 3MCWA 4KO1S 4RQUA 2YMQA 3BZBA 1ZD8A 2HA2A 3U7GA 4G09A 4BATA 4KDRA 5ADHA 3ZDBA 3ZVMA 3HLTA 4ZAVA 3B5JA 4F0JA 5DTMA 1H69A 4O4JB 4FYXA 3M4ZA 2EGGA 2R25B 2R86A 4KUHA 2GCPA 3THRA 1CUVA 2IIVA 3V4FA 2WF8A 1C5KA 2Z08A 3GA7A 3ZIDA 1L5MA 4KXFB 4R2MA 4DT1A 5KVAA 2PN1A 1M1YB 2ZE7A 4Q7QA 4IXNA 2CLOB 2H57A 3NOQA 2BFEA 4CM8A 2EWMA 3PCTA 4B3MB 1QTQA 2P6OA 3SVZA 1JV2B 4DQVA 4IIFA 3UMMA 3CBQA 4HS9A 3B5EA 1E8NA 1H2ZA 1M10A 1TB4A 2REXB 3GVCA 3S28A 4EJSB 1V9LA 2VBGA 3GRZA 5T8KC 4EF4A 2QS9A 1MNQA 3B6ZA 3OTWA 4UHEA 3BRWD 5JV5A 1RBZA 1SKBA 1BMQA 3NIDB 2PL1A 4BB5A 1PBNA 1A8IA 2GYVA 5B12A 1EVEA 3AY6A 1MB4A 5IHXA 5CA1F 3LM8A 1UMBA 3BDIA 3ODGA 1LNZA 3HPQA 3GB9A 2YC2C 3VHQA 5AUOB 3D4IA 3ONNA 5KNBH 2DERA 4WERA 1TM4E 3OE7A 4UNSA 3VR0A 3VKWA 2BTQB 1SCBA 1A72A 2DULA 1YJ8A 2Y1OA 3FR7A 3HDJA 4JMLA 4RV4A 4L5JA 3U13A 2C0QA 3DBRA 4FX5A 1ZH0A 3DWFA 4AVYA 5FBHA 1C30B 1SD1A 2XI4A 3HKBB 4RPCA 5SYAA 3WYAA 3A2LA 5DEOA 3UWKA 5A04A 3NKFA 4O3MA 4YCJA 1EX6A 5L3RA 2HOQA 3A9TA 4MJLA 1Y3BE 1LTQA 2ECPA 2WB4A 4PLZA 1P5ZB 2JLVA 3SX0A 2HYDA 1WPXA 3BQ9A 3L8EA 4BV8A 2PO7A 3JQAB 2XB6A 3LQQA 1JQAA 4R5MA 2IXDA 1S4QA 2QL5A 3VPCA 2ZS9A 1W96A 2JF0A 1DBSA 3AFNA 2WU0A 1QC5B 3DXFA 3P0RA 3R6LA 4H0CA 4KMSA 3AY3A 3OFSA 2H1WA 5HIJA 5JO9A 1X0XA 1AA9A 1M2JA 3H11A 5ECYA 4C29A 2K7FA 3B12A 1QYIA 4L9RA 4RKEA 5HF6A 1N2HA 3PD0A 2YJ4A 3TLCA 3PZBA 3DMGA 5CFOA 4HT3B 1SB8A 2DCMA 2YJ5A 4BVGA 3TAXA 1GRVA 4DA8A 2BN4A 2F8MA 2YCBA 3MOSA 3FPFA 4D9HA 3UJBA 4RZ3A 2CEAA 1JWAB 3JVEA 4JI4B 4GX2A 4UFNA 4I81A 3GJRA 2HU5A 3GBVA 1QQAA 2B2CA 2Z8XA 3JZAA 1E98A 4B47A 1JEOA 1RKVA 5CFRA 3EZNA 3IQZA 2D1SA 4KBYA 1OAKA 5GTDA 1IVNA 3P9CA 4AMGA 4CM9D 2BFDB 4JLOA 2LKCA 2NTYC 4RVHA 1PVDA 1C7RA 2B35A 1K9VF 4QUKA 4BLVA 1OXVA 1WKVA 4YPVA 4DIOA 4P98A 3DQZA 2ZT7A 3R6GA 1MX9A 1G7RA 3L0BA 3SSMA 5SY9A 5CXSA 4CIBA 5CA1A 4UD2A 2IHKA 2Y0BA 4ERNA 4HWKA 4CMBA 1W19A 3WGUA 5HCIA 4CQMA 4RHXA 4WQMA 3WLAA 3NNSA 5J2UA 2HM7A 1Z7EA 2W7TA 1QFZA 2FVYA 3W4KA 1D5WA 4DCPA 1SXJC 2AZMA 3I72A 1IHYA 2IHNA 4RKWA 4FHEA 4MDYA 3LQKA 4EF5A 1JIQA 3JRWA 1VKNA 2R6ZA 1E9AA 1JIUA 1A9SA 1VGQA 3IVRA 5CDTA 2GZSA 2O8DB 4JP8A 1UM8A 3M6MD 3F9IA 4H77A 4FOOA 1PV1A 1M6NA 3DAOA 4TL8A 4MCHA 2CN1A 5TMPA 1WXIA 2WZQA 4KWCA 4DM3A 1HXHA 1NXWA 1QVVA 2Q6LA 2H65A 2I6SA 2IX9A 3G68A 3GRKA 5FQOA 3U40A 4DLPA 4IXDA 4YUXA 4GYKA 4JJ4A 4BRZA 4RJ2A 3VI3B 4AJIA 4N5LA 3A3KA 3LDHA 4OVKA 5HKBA 5CFZA 2HNBA 3UB4A 4MW9A 2E4AA 4JXZA 1E2MA 2DHRA 1OZFA 5KPDA 5JSUA 3THYB 2O19A 1DO0A 3SC2B 4MKGA 3HJFA 1PT5A 1ZBQA 3FVVA 3NDRA 2B61A 5FJIA 2O7QA 2QVYX 3HUTA 1FFWA 2D7CA 1C1DA 2EU8A 5SY6A 1DFGA 2OC4A 3URMA 1T2CA 3RK1A 5JPIA 1JZTA 4I5DA 4Y1FA 3DBHB 1GRNA 3EYWA 3A37A 3LBAA 3EN0A 4FEAA 2IW1A 2XDAA 1BXZA 2D0PB 4Q1FA 3FNEA 5KYYA 1V41E 2I4LA 4P93A 4S1PA 1EDDA 5DNDA 2P9FA 1ADFA 2XX3A 5HFJA 3WK5A 3KM0A 1JJAA 3L04A 4YRIA 4C78A 1A9YA 2HUNA 2RC5A 3IBGA 1FMFA 1ZVJA 2KJQA 3R77A 4LDRA 5FLKA 3BF7A 2QAGB 3IMGA 5EE3A 4URVR 2G3YA 2C97A 2EKQA 3B51X 4FGLA 4J0HA 3JD4A 1Z0KA 2P2GA 1YB1A 3ZU5A 2ID4A 1IBRA 1LK0A 1DI0A 1P91A 2PO5A 2Q2OA 2NSYA 1JECA 1DRWA 1F20A 3GFBA 3KK0A 4FDTA 3U3DA 1GILA 2NZ2A 2ZDGA 4UM7A 3ND7A 1VPDA 3HSSA 2CD9A 2JGAA 5KQRA 2W6JD 1E9RA 1SGWA 2BDUA 4TTAA 3D3EA 1P77A 3KYDB 3MCTA 5LZ4A 1QK3A 5FAKA 3QLJA 4D0NA 4FP9A 3E5RA 3FWNA 2R7LA 3CRRA 1ZR2A 1I3LA 1DKLA 4KQXA 2PX3A 2DTDA 621PA 3OZXA 4BLUA 1OGIA 1CDDA 3MHTA 2EG5A 4PZ9A 2RHHA 4KQIA 1SULA 2PD6A 3UV3A 3L9XA 4K6MA 5G1NA 4C0WA 1I32A 1JQKA 1JHPA 1W73A 2HD4A 3W6NA 2PM8A 3T3IA 1CEYA 4K7JA 1OJ7A 3CKKA 3TRKA 1XO1A 3IUNA 3TLGB 4B79A 4IIGA 4F5WA 2Z83A 1L1QA 2Z09A 4BEWA 4MSUA 2DY1A 5KTKA 1H65A 2A1TR 2D5CA 2ZJZA 3BD7A 3CT6A 1Q11A 3E3NA 4IHJA 4L9AA 4TN5A 4X5OA 5AIAA 4Q3DA 4IR7A 2JAQA 4RS3A 4DMCA 3LC1O 2VZ8A 4M1WA 1CJBA 1RYDA 2UKDA 4JBLA 4M86A 4OA8A 3TW0A 3X2FA 2RSLA 2ALJA 1X80B 3EZ9A 3QXGA 2COUA 5KUTA 4LOAA 4DB4A 5TVGA 3DQPA 3KJIA 1U2RA 2ZYRA 4BZZA 4CUKA 4PBRA 4PICA 1P0FA 5HBGA 4H6VA 1CYDA 4TWBA 1J25A 1R6TA 1ZGAA 2P67A 4I2NA 4POOA 1L4BA 2NSJA 2JGFA 2NZXA 3I45A 3Q3HA 4GS5A 4YV0A 5HHTA 2UYHA 5FORA 3L4SO 3ZD7A 4UQLA 4ZC1A 2RIPA 3F8WA 3PEEA 3KPYA 1H0SA 3TQQA 1XZQA 2F3RA 1EAMA 3VPDA 1KYXA 1AY0A 5AWFC 1CK4A 3NWOA 4P5DA 3PX2A 4CIAA 3OWXA 3IQXA 2Z2YA 1RFGE 3DD5A 3KZNA 3OPYA 5LQAA 2YS6A 1HQKA 1SQGA 3PNOA 4MHOA 1R0ZA 3H16A 5IRCD 4B6JA 1XTJA 1QF9A 2EDCA 2JLRA 1RTKA 3TOVA 1L5KA 4BAGA 4EZBA 1J1IA 1WR8A 2D5AA 4CCYB 1DIRA 2P78A 3H9CA 3W79A 2A8YA 2Q3CA 4OI2A 1CY7A 1ULHA 4URYR 4G0PA 5L3SA 2GHQA 4FM9A 1FW6A 2FZWA 1D4OA 1SXJD 1NF8A 4YUAA 5EUMA 3WTBA 3FHJA 1C7FA 1S9HA 1LNSA 2G7ZA 5D3KA 3L6CA 5EINA 4EG5A 3TSCA 1RPNA 1J09A 1PJQA 2H1LA 5CM8B 5JAUA 2NXCA 1KHHA 1WQ1R 4IVNA 1XNRB 2C78A 1MB2A 4LI3X 5K09A 3LT5A 3VSDA 1F8FA 3JAKB 1QU2A 2IVZA 5LMZA 4HRAA 5K0LA 4OKIA 2K5UA 2OHOA 3IURA 4A6DA 4DZRA 1ZHOA 1VDMA 3LCMA 1KAOA 5DI3B 4P82A 4A16A 2VR1A 2AKAB 2OCYC 3QKTA 4L4UA 1QRTA 4ADSG 3BXOA 4LG1A 3VO1A 2FDXA 3PFIA 4QBFA 3O1LA 3LDGA 4NZ9A 1BDJA 2FETA 1I36A 2X9NA 4CMIA 1A7KA 1O94A 1WULS 1NMZA 2ACKA 4H7HA 4CUZA 2MSWA 3KXDA 3LTEA 1DT3A 1EGQA 4K05A 1KQGA 3WDLA 2C2HA 4D43A 2HBYA 3MLAA 1YQDA 1TK2A 1IN4A 1CIJA 1UT6A 3OCCA 1ZGCA 2B34A 2IT1A 2W2XA 5IP5A 2NUBA 1LEHA 4P7BA 4IGFA 3LS2A 3PE6A 4KAAA 3KE9A 1PZMA 2WSLA 3LW8A 5HKKA 4F6RB 1XU7A 5AVWA 4B74A 4HEHA 3PHGA 1IRIA 1NI3A 1R0YA 3P20A 4HUQA 4L8GA 1YS6A 4PLPA 1NVFA 3H1EA 1DTWA 5EEGA 5J2TF 4UTRA 4UZFA 4DCCA 3JD3A 2D2FA 5FNZA 3T5DA 1RYHA 1SUWA 2ZI9A 3EFEA 3O2SB 4IS2A 3W77A 1V9CA 2QMEA 1GRCA 2WU4A 4FMCF 2NU8B 5JRJA 2I71A 4K9PA 2AQ8A 4QIHA 1RC8A 3P0JA 4E3ZA 1Y6FA 3EIOA 1GPYA 4JQSA 1PYGA 2DQKA 4H27A 3AI1A 2V6BA 2AYYA 3B9RA 4UMEA 3WIVA 2GF0A 1GGMA 2W2PA 4QXOA 4ASUD 1FJXA 1JG2A 1EZ1A 2O7SA 2GTHA 4RVDA 2ZUTA 1KMQA 1PP4A 3S1AA 3K4HA 1EWQA 3G9QA 4JYZA 2F3UA 4EA6A 2Y1GA 4DNQA 1OY1A 4HTFA 4UTNA 1MKYA 3U49A 3I0ZA 1L5FA 2IEIA 3S7TA 1ZVVA 1DADA 4FDUA 1GR0A 1N6NA 2MHCA 2GO7A 2FN7A 2CK3D 3DJFA 3V34A 1GJRA 2DPXA 4ZOLA 5F3DA 4F1WA 4TKUA 5B7PA 3BMQA 3RS4A 2OC9A 5EIHA 2EFEB 2CLDX 1PJ4A 4G0YA 3SNHA 1JJIA 1TYEB 2HTEA 3H5TA 5AKYA 5L95A 5K0CA 3EF1A 3PE4A 3LUHA 1A4UA 1BSVA 4INZA 1XJWA 1H9AA 4I1PA 3G0BA 3OTIA 1BOFA 4JLVA 1IDOA 1Z4NA 1GAQA 1QHIA 1GNTA 2IYXA 5CEEA 3IHWA 1HE5A 3L2OB 4U1RA 4QJ5A 5DO9A 1KMHA 2XQKA 1PQ4A 4LYHA 3K0EA 4LI0A 3RRZA 1GGVA 2YZMA 3NW9A 5IUKC 4BNWA 1ZXBA 4F4UA 1NW4A 3B1FA 3OLWA 4L72A 4EB8A 4EELA 4RK5A 1A7AA 2ECKA 4FFMA 3KKQA 4KQWA 1Z5OA 5I9BA 1U98A 1P60A 1OH6A 5A7GA 1JKXA 2O8EB 1P1FA 5ALMA 4F7DA 1VLHA 4XSHA 4BLPA 1ORHA 4Q37A 2WW8A 4D74A 2IU3A 4NF2A 2YBEA 4R16A 4CMHA 2GZ3A 4DSNA 2AJ8A 4GH5A 1JTEA 2FOIA 4MW7A 4OEHA 2FMHA 1ZSYA 3QU9A 3IIMA 4UOEA 2FX5A 5UKDA 1HR0B 3AR5A 3ESZA 4C06A 4CR8A 4TRRA 1KO7A 4JEIA 4EY4A 5ARBA 5T3UA 1Q0UA 3QPDA 4XFDA 1PO7A 2PIDA 3VU0A 1QUFA 4EZIA 4DA4A 3EW9A 4U5XA 1WZNA 5DX1A 1ICIA 3NOVA 5DYYA 2J0EA 5I7OA 4EX6A 1KL7A 1Q3KA 2QRNA 3S8EA 4G0VA 1EB8A 1OV6A 2EW2A 4REMA 1FSPA 1UJCA 3CF2A 3A9CA 4KJXA 1P9OA 2H1VA 1H66A 2M9MA 3ORRA 4G8BA 3UTCA 1AIPA 1HGXA 1X8LA 1Z8DA 1JIIA 2E4VA 1I0LA 2GEVA 4L2IB 5IM4A 2C5BA 2PSSA 4LMAA 4EJMA 2AVDA 3NMUF 1D6MA 1WXXA 5EYPB 3IULA 1QFYA 3LZDA 3G9ZA 3C41J 3RRXA 2X2PA 4QO8A 3UBMA 2ZVQX 1GDHA 1LVHA 1XCBA 2QAIA 2XOKA 4R1OA 1BXRB 4WBNF 5F23A 2WU1A 4I4CA 2FLVA 2PS3A 3AFHA 4MS3A 3H6KA 1VMAA 1F12A 4PSCA 3RARA 6ADHA 4N4AA 1QRSA 5LYJB 4LVOA 5KWEA 4DBZA 4XSVA 3TZEA 2F64A 2FKNA 4LXTA 1L9XA 2O23A 4MAAA 1YL7A 1BYUA 4TTJA 4P1ZA 1FFHA 2R1VA 2GPBA 4FFRA 3GRFA 1N5OX 2PWZA 1J06A 2QTFA 1AV6A 1RJDA 3AKEA 1KK0A 2XWBF 1GNVA 3JALA 4NCIA 1PYDA 1XWIA 1YO6A 3SZ3A 1M2EA 1J8VA 3AP3A 4JP5A 2DE0X 2FRDA 5EIAA 1I3OA 2P9HA 1N8SA 3RSQA 3UMBA 2QX7A 3D3QA 4YUWA 4ZYUA 1SH7A 4E7PA 5JDIA 3IUEA 5IW8A 5ULLA 1XDDA 3K0SA 1A50B 2WAMA 2FUEA 3V4LA 2O8FB 4J16C 1GSAA 2DSNA 4QEDA 1Z6QA 1HNWB 3AESB 3L07A 1E3EA 4RK7A 3O4FA 4KBFA 3WP0A 5BQFA 1U2SA 1YT5A 3CWCA 1TKRA 2EFJA 4I6GA 1ZBDA 2P5UA 4IH1A 3RC7A 1YBMA 1ZIXA 3GROA 4X45A 1W0KD 2IF0A 3TIFA 2OZLA 2DHQA 2DBYA 3ZDCA 4RJLA 3VR6A 3SJZA 5IT0A 3FLBA 5JVDB 4PLYA 4NBVA 4JELA 2QZPA 2JL1A 3OPVA 4X93A 1TTTA 1PR6A 1V4VA 2WG2A 2QTVB 4IM7A 2Q2QA 3DM5A 4KIJA 4WY8A 4ZGBA 1ML3A 4WFJA 3CG4A 3G2QA 1XZMA 4MS3B 3II6X 3HNPA 1QH0A 2QD4A 1XEXB 2OV3A 2NZ8A 3ACDA 4A0FA 4D9FA 1AO0A 4ZOCA 4ZXFA 2CZCA 4S1WA 4JVSB 4YQFA 4WACA 4A2QA 5HDBB 2C5GA 4QICA 5CNMA 2FHPA 3RK4A 1LI7A 3ZCTA 1GPMA 4FB5A 4E4TA 3L8HA 4AB1A 1Y9ZA 4DIFA 3TOZA 3BB4A 1ZAYA 1VBKA 3W7BA 3HI4A 3K5HA 2QSYA 3SBXA 4EUEA 3ETDA 5SZHB 4QELA 3PUZA 4UDXX 1CKEA 3IEXA 3JQGA 3PRYA 2V7WA 3E05A 1OROA 4ZI3A 5LFAA 1DEOA 4Z4FA 4LXHA 4PYQA 3W5HA 4DQDA 3A4IA 2GRAA 3DTVB 4J1TA 1L5VA 4K1XA 3MILA 4UU1A 2BD0A 4HO1X 2HRQA 5D51S 3ZXXA 2HHAA 3QOXA 3NIFB 2O8FA 2R8PA 1TL7C 4NAUA 2A94A 2XYVA 5B3JA 3T38A 4PSUA 4BKRA 4KYIB 2Q3BA 4FD3A 2C83A 2HA5A 5AUQA 1G9SA 3ZX5A 5J63A 1U0OC 3FOFC 1PQPA 4TYQA 4TMKA 5HZGA 4F3KA 1YIDA 1C9DB 1A9OA 1CR6A 4ZVQA 1UJNA 1Z5GA 3G6WA 3JVIA 4HH0A 2AGVA 2BZSA 5HBRA 4YFVA 5FF9A 3U0VA 1FYXA 1GQFA 4ZYXA 4Z1OA 2I33A 1QVWA 2V6GA 2A9QA 4RXTA 4ME6A 1AUPA 4D8YA 5HUHA 4C2TA 4GOND 4G24A 3FUTA 4QT0A 3SIRA 4UVIA 4LF6B 4JC0A 2I4IA 1NR7A 3QPVA 1TUEA 1EM6A 2R79A 3EPLA 1A77A 1NAHA 4XUCA 1O94C 3EXAA 1Y9JA 2R8RA 4JBXA 4IQ8A 1TVKA 1QH8A 3WGOA 3EOBI 4OJMX 4UQOA 3IERA 4WWHA 1CUBA 5DGTA 3RGGA 3U48A 4CEHB 5EXEA 2C4VA 2J9XB 2UVPA 3ZE1B 4BO4A 3ZHVA 3IVXA 4XR4A 2IIBA 4AS2A 1J1UA 4EJFA 5EYPA 4MW2A 5DNAA 5G0TA 5DJ5A 4WBNA 1EQUA 4XVRA 1L7AA 3GLQA 3NRCA 3VHXB 3IPAA 3AKYA 5E6SA 3T5MA 2VAPA 5ALOA 1J5XA 3K9CA 4GOMD 2OHGA 1TZ2A 2CUZA 2WG0A 3PRJA 4FGJA 4PCLA 1FC0A 1LLCA 4F4JA 2CY0A 2R44A 1DKUA 1QUEA 3PHHA 3R9KA 1K7YA 3ADOA 4DKJA 1AKEA 1HE4A 4PE5B 4QOFA 3TZCA 1S9DA 4FNGA 5HILA 1P2TA 3TSWA 2WTUA 1Y3AA 4M8KA 1T36A 5FUXA 2J0UA 3R0QA 4ZJZA 1XQYA 3FAZA 3BULA 3F6RA 3U7FB 3NETA 1IJBA 1WOMA 1N0VC 1T3GA 5ER9A 4YJHB 5JYEA 1BU8A 3UVEA 4FSHA 1TM7E 3FLEA 3RR2A 2R11A 1AD2A 5KTMA 4GQAA 2QT1A 1XQ9A 3OY7A 4G5HA 4C3OB 3AF3A 3T7JA 2X8LA 3I12A 4YWHA 2I91A 1YJCA 1AKTA 1EBBA 3EB9A 4NHOA 1IBKB 4NECA 1PJ8A 4PGHA 3C3JA 2ZE6A 3N3AC 3JQ7B 3GELA 2X8JB 4CG0A 3R7NA 2CXNA 2X4DA 1GO2A 3C39A 3RUFA 4DLSA 4QM6A 3ZK9A 1NLMA 2GN4A 3DEZA 1Y3IA 3WTCA 4PONA 4D9JA 3PSHA 2IUSA 3HB0A 1TNDA 1YMUA 4OLBA 1T0IA 1EXDA 1S1CA 1UKBA 2HXYA 1CRQA 2VWPA 3GA0A 5DXAA 3VC1A 5DN6D 2OHIA 4G4JA 2Y2UA 3O3CA 1EDBA 4E7OA 5BRJA 2Q0HA 3LL7A 1E3IA 1EGAA 3C3DA 2RI0A 1W1WA 5A3JA 1A97A 3NHAA 4MUHA 4UOZA 1M75A 4KI0A 1S89A 4YP9A 4B84A 2RJ3A