2A5DA

Structural basis for the activation of cholera toxin by human arf6-gtp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
163
structure length
163
Chain Sequence
KEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/transferase
molecule keywords ADP-ribosylation factor 6
publication title Structural basis for the activation of cholera toxin by human ARF6-GTP.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2a5dA00
3SU8A 4M8NE 3CF0A 1S8FA 3B1XA 1XEWX 2CVHA 4CGZA 4BFUA 4QOSA 1G3QA 5J5CA 2W83A 4QM7A 2J45A 3T5GA 1Z83A 3T34A 4D25A 5KSYA 4MRSA 2AD5A 3A58B 1TQDA 1ZYUA 3CH5A 3QKTA 4X8LA 4M1OA 1GG2A 1ZM7A 4A0HA 1J2JA 4MGKR 1ZCAA 2ZJ5A 4LC0A 1DTSA 3BD9A 2J59A 3HR7A 4LHZA 4NYMQ 4DSOA 2UKDA 4KLZA 2IYUA 4BFXA 3LH5A 3U3MA 3O8RA 3QXHA 5SZHB 3T06B 3U2QA 4DRZA 3FMFA 4M1YA 3TSZA 1RC8A 1MRSA 4I1SA 3Q5EA 5J4LA 1W48A 1Z6GA 5FH9A 3GJ3A 5TXGA 5BXQC 3VR5A 5TMPA 3EZ6A 1W4AA 2VTKA 2V3CC 2HLDA 4KAXA 4EPXA 1OB5A 1AA9A 2IYRA 4PC1A 3A1WA 2L0XA 1AKEA 1LS6A 2GRJA 3K09A 1EX7A 2YWGA 4BFYA 2RGDA 3KQHA 5FTJA 3UWKA 4ZV4A 1I2DA 3CW2A 3ND8A 4F4JA 2GESA 4I4LA 4DT1B 4LI0A 5IDVA 5FPKA 2R8RA 1X3SA 1NJGA 3ASYA 2ZRPA 2XZLA 3P20A 1LW7A 4X8HA 4ZKEA 2KWIA 3B82A 1KSHA 1S4QA 2ZS8A 1JR3D 3QVUA 4TTQA 4LWZA 4JLPA 1JI0A 1Z6XA 2NO1A 4NL4H 4LBYA 3NDPA 1NRJB 4HI0E 1U8ZA 3BE4A 4JT4A 5GJCA 4EFLA 2GF9A 2VIIA 5A4JA 3P4XA 2EFDB 2XX3A 1DAFA 4QRHA 4OQNA 1DAKA 2CEAA 2JEOA 3AF4A 3KXIA 3MJRA 2Z83A 4RJLA 3RS3A 5HZHA 4RCZA 2BJWA 5SZKB 3WNCA 2H1LA 1Q1BA 2Q6TA 3FB4A 4MQBA 3UMFA 2WPDD 3QIAA 2R6AA 4C7OA 2IUSA 1BOFA 1G3IA 2GEDA 3KJEA 1P2SA 4JLOA 4OK6A 1S2MA 2F1HA 2RB4A 4L9SA 1OYWA 4ACBA 4Z54A 3CR8A 4BWYA 2DWPA 5FOSA 3ADCA 2REBA 1OH5A 5F9HA 2QZ4A 4AKIA 5DNYB 3B5JA 5DE3A 4DJTA 1CJMA 1AK2A 2VLIA 1PLKA 4KFSA 2QPOA 2X77A 1EFTA 4XTCS 1Q22A 2EYQA 3C5HA 3NBYC 2CL6X 2OE2A 3K9NA 3FKQA 5DLQC 1DEKA 4HDOB 3ADBA 2NTYC 2DFTA 3TUJC 1QF9A 1ESMA 1MABB 4TLEA 5A5GA 3THWA 2MSEB 2CK3A 4TL6A 2N46A 5CM9C 1IONA 4EIWA 5C18A 3IIKA 1L8QA 3BB1A 2ZYWX 5DI3A 3PITA 2RMKA 1XMSA 1OFTA 4G5GA 4A6XA 1UKZA 4K81B 2HF9A 1HA3A 5FI0B 1G16A 5KUTA 1JQLB 2ZANA 4AYWA 4URUR 3AEZA 1YRAA 4P3YA 1YRBA 1P9WA 2HCJB 3TAUA 1N6HA 1U9IC 5IRCD 4P33A 4IVRA 4PXAA 1I4DD 2ZXUA 1XPOA 4WVFA 2XTMA 5UKDA 3LDAA 3KTAA 4KODA 4ABYA 5KPDA 2D74A 4FCWA 1KGDA 5FBRB 3TRFA 1K5DA 3W9YA 2PLRA 5LB2A 1GNQA 1W2HA 3ICEA 2J5XA 4OHXA 3VQTA 5DI3B 1T4GA 2LKCA 1U90A 1H65A 3EZ9A 2QA5A 3FMIA 3U7FB 1JXMA 5KSZA 2AHOA 1QG2A 1VG0B 2ZI5A 1E1RD 3BIFA 4U02A 2IUUA 4AURA 4ZO4A 1W1WA 1NG9A 4EUNA 2ODNA 1KDTA 2YKGA 1G291 3SE0A 3VKWA 4TLAA 2A2ZA 3PR1A 1YR8A 2ODEA 1MR3F 2D3WA 3QSYA 3LNCA 1F60A 1X1SA 2BWJA 2YOGA 3I72A 2VSFA 3G5UA 3IHWA 4LC1A 4URZR 2GILA 2OXCA 1TTTA 4YXWA 4BQSA 1G19A 2XNDA 3P1JA 4OI1A 1DADA 5FBVB 2IS1A 1KSJA 1A2KC 2IEZA 1JEEA 3KZ1E 4XWOA 2CDNA 2Q9BA 4IDNA 1UAAA 4IEIA 2FA9A 2CE7A 1N6LA 1XXHA 3SYKA 5J4VA 4NZYA 2O8DA 1DAGA 3BJIC 521PA 2BCJQ 5G3YA 1IN4A 5KSPA 2N1BA 4U5XA 3UG6A 2VP2A 2BBTA 2ZSDA 5EXTA 2JA1A 5FOTA 5JHHB 4GL2A 2DFNA 5FOUA 5EUMA 2GETA 4JBWA 4PHGA 3CPEA 1XTQA 2FEOA 3DZDA 5F98A 1R0XA 2GAAA 5JFGA 3ZIAD 5CK4A 1VG8A 1M34E 1GAJA 3I8XA 4BFSA 4C2UA 4A2QA 2J0SA 3IILA 1AZSC 3H4MA 4RD0A 1KKMA 5FTKA 3DKVA 1IN8A 3SYLA 2O8DB 1XXHB 4XD7D 4EAQA 2IS2A 3IIJA 1ZD1A 1ZAKA 3PG5A 5JI2E 1UEIA 3H0KA 1QHSA 2BIFA 4MYHA 4HB0A 2XZOA 3THXA 3IBGA 3K0AA 3SHFA 2RH5A 2GZHA 1OIWA 4GT1A 2JLQA 4CVNA 1R2QA 3WMGA 3MLEA 3QY0A 2FFBA 4YONB 3LW7A 4GOXA 4D0GA 5EXSA 3TKLA 1R0ZA 1ZNYA 3N2EA 3S1AA 4BECA 3LVQE 4URXR 4QGFA 4OQXA 1U8AA 4QC2A 4DCSA 4MYCA 2WSMA 3C8UA 2WICA 2ZAMA 4RD6A 5CJPA 1E1QA 1KNQA 3CRVA 4B48A 1JJ7A 2D06A 1GWNA 4Y0VA 2FFAA 3RS5A 2ZR7A 4AKGA 3IBYA 4LJ5A 4CT4B 4D80A 2LWIA 1E0AA 2ERYA 1KZ7B 3D6TB 4HAZA 1LV7A 3THXB 3TW8B 2J7KA 3K0AB 5GVSA 1YR6A 3B1WA 3UWOA 3I73A 6Q21A 2IWRA 1ZNXA 3TBKA 2H57A 1E96A 4A36A 1R7RA 3ETLA 1Z0AA 1WB9A 5EZ6B 4B3BA 4FWTA 2QM8A 4OHVA 2QT1A 4LZZA 4GNKA 3GLHE 4NYJQ 5JSZA 2F6RA 3IPXA 4LYAA 1HE8B 1HUQA 5E7IA 2BKEA 1SKYB 1IN6A 1DELA 2ZE8A 5E3HA 1S1CA 3CRRA 621PA 3MMPA 2BCGY 1OFHA 2Z6VA 3U3KA 1SVOA 4UNQA 4KSBA 2VP5A 5EE1A 4N3NA 2QAGC 4TL9A 4XH9B 4JKIA 3H86A 5FPTA 4OI0A 1GL6A 1KAOA 4LV6A 3R9IA 1M1YE 2PL3A 1KKLA 4TTPA 2BOVA 2ZRGA 2F1IA 3LAWA 3FOZA 5J4YA 1P61B 1GRQA 2G1JA 2ZTSA 1W4BA 2FSHA 2J7PD 421PA 5AUNB 4IDQA 4KCGA 4OQLA 2W2TA 2ZM5A 4DLXA 1G5TA 1ZMXA 2YWHA 2OESA 4DB4A 5G40A 1E1RA 2V7QD 1OXVA 3A4NA 1IXRC 5JSZB 2J41A 4YDSA 5H8WA 1WMSA 2GXQA 1Q57A 2V55B 2GJ8A 2P3SA 4RD3A 4DXAA 2JAQA 2RKOA 4P4SB 4Q9LA 5FTNA 3CH4B 1KI4A 2YOHA 3LXXA 2VF8A 1M2OB 3IPYA 1SXJA 1CJKC 1TNDA 2R44A 2OBMA 3ZJYA 3F3YA 2ZU6A 4L4UA 1W5TA 2QMHA 3R8FA 5CLQA 2P0EA 1Q1ZA 1JPJA 2GJ9A 3NKVA 4U00A 4B73A 1RYHA 2R62A 2WWIA 3VR3A 4F38A 2ZJ2A 3KXKA 4IVQA 1X6VA 5GVRA 2F1JA 2R9VA 3LV8A 3IO3A 3FMPB 4LOAA 4POAA 2Z4RA 3PEVA 4QNRA 4M1KA 4PFSA 3SJBA 1E9EA 2NZJA 2O0HA 4R98A 4WZ6A 2EVWX 4EJSB 3AVQA 4W5JA 3HU3A 3QQ5A 1NN0A 2NG1A 1QBKC 1TL7C 4Q1AA 2HJVA 3TR5A 3BORA 3HU2A 4JLJA 4DDWA 3KJGA 4Q02A 3RRNA 4QM6A 3MFYA 1XCGB 1SXJB 2RGNC 3IKJA 3MWLA 1ZD8A 1FW6A 1ZUNB 1NVVQ 1XX6A 3RC8A 3WY9A 1N6KA 3EA0A 4QFMA 1ZC4A 4HAVA 4W7SA 3O8DA 4AYTA 2V9PA 4ESVA 5FBWB 1H8HA 4L5BA 1QRAA 5E7JA 3W8NA 4JLVA 4Q7KA 3QG5A 2HF8A 3MSXA 4BFTA 1OSNA 4DIDA 1Z0KA 1BO6A 4MGIR 5J47A 4FMDF 1R10A 3CONA 4X8MA 3VHLB 2R6GA 5DIFA 2RGCA 3T12A 2AK3A 2G83A 4QBGB 3IQWA 1N3BA 3UG7A 2WAXA 1AZTA 4CDGA 4NMMA 3FKSD 1T9HA 4I1OA 4QGGA 1UM8A 1UJ2A 1ZUIA 2GVDC 2FFQA 1PUIA 3AP2A 4NDZA 4NPHA 5AJYA 1RJ9A 5FR2A 3HPRA 1Y3AA 5KTYA 2JLVA 2O5VA 3X1ZA 4LPKA 4AD8A 4G0NA 3EX7C 5FL3A 2YYZA 1P72A 1RRGA 3QPVA 4PAMA 3KKPA 3FTQA 1Z5ZA 5BN4A 2EFCB 2ZJBA 3HU1A 1QVAA 1KO7A 2ZRLA 3W6PA 2C77A 2ZJZA 4TYNA 4JT2A 1K5GA 3IHLA 2QAJA 5JS7A 3QG1A 5JLJA 3BFVA 5G3ZA 3TGPA 4IOLA 2VA8A 4KVAA 4M21A 4C0KA 4YQFA 2QSYA 1CRPA 4IVPA 1NKTA 2FWRA 4FI3C 5DISB 2CLSA 2IYTA 4JLDA 4UNPA 3VHXA 1WBBA 2XB4A 4DUGA 1G3MA 2W0SA 1TQ6A 4PPNA 4FINA 2ZU0C 2QM7A 2EWWA 2ZVPX 4RKEA 4DSUA 3GLFE 1N5KA 2JLUA 2RHDA 2G0TA 1RJ9B 2A7QA 3H1TA 4IKEA 4MGZR 3W34A 4LUCA 1P62B 1JAHA 5AJWA 3GD7A 2BV3A 3C41J 4DCUA 1OH8A 1E9CA 3WYAA 1V5WA 1LB1B 1G8HA 3B1ZA 1FP7A 3AVWA 2D2FA 4M9ZA 4DDTA 1E2HA 2D7DA 4M2LA 3Q8XB 2BEKA 1VYUA 3AM1A 3CPJB 1BH2A 1LVGA 2D7CA 2ASEA 4BFVA 4C0SA 2R6DA 1IXSB 3KUDA 3OE7A 5J4HA 3MD0A 5JI3E 1QHIA 5LB4A 4M9XA 1KI7A 2IT1A 1VHTA 1CBUA 2J7PA 5IF9A 2NGRA 1YVDA 2IHYA 3PIRA 2FGJA 1O87A 4TMTA 3WYGA 5JWHA 3T1VA 3RRZA 2A5JA 3SFVA 4TLBA 2VHTA 3DMDA 5H1YA 2BJVA 2GZDA 3RC3A 3OFNA 4BFWA 4TLDA 5KNCA 1EESA 2JDIA 1OHHD 1G6OA 3PEUA 4DDUA 2HLDD 3GLGE 3AVOA 1LTQA 4JKYA 4N0DA 2F43B 5FFMA 1OFUX 2H16A 3DM5A 4U7DA 3L2OB 1U81A 2HDNB 1TF2A 5JCZA 2NOAA 1GKUB 1PVOA 1RRFA 3CX8A 1WBDA 1Q1QA 1EFHA 1ZCBA 2WMNB 3QXXA 1YKSA 1W0JA 2DWOA 1GKYA 1Z6TA 1E9BA 3FHOA 2AKYA 2O52A 3MWYW 1GIAA 3WNBA 1YZKA 2WOOA 4DBLC 1RFLA 1JXOA 2G1KA 2FZLA 1N6NA 1N6OA 4TMKA 1OLOA 3BH7A 2Q3MA 2DPXA 2NQ2C 3WBJA 4QL3A 2C8VA 4TYQA 121PA 2A78A 1E2QA 5CDFA 3WHKA 5FUWA 4G5QA 2VF7A 4PC3A 4QG7A 4Q5IA 2FSIA 3RS4A 5M04A 3PENA 4TL7A 2QPAA 1EXMA 4BZPA 5EE3A 1KDPA 1SGWA 2FPKA 1S3SA 5SZIA 4DCTA 3K0CC 1Z22A 4LY6A 4QKQA 3K1JA 2QSZA 5IHPA 3MJHA 3Q72A 2QG6A 4Q01A 3B6EA 1V43A 1RE0A 5BW8A 5JBQA 2H8KA 4PTLA 2PZFA 4PX9A 4RZ3A 4W9MC 2FN4A 4C0JA 2MMCA 1KK2A 3I92A 4I1UA 1E2IA 2A5FA 721PA 5HCIA 5CB8A 2WBLC 4GMXA 1Z47A 1HH4A 1VDZA 4JLMA 2ZROA 2OILA 4JLAA 4A6PA 4IXMA 2IXEA 1KO5A 4ERNA 5DHFA 2V6IA 1G5PA 1HEIA 1N6IA 4IW3B 5CIWA 3SDZA 1E94E 2HV8A 3T15A 1N2CE 2PLFA 1E2KA 3X1XA 1XU4A 1Z3IX 2UVQA 3RRMA 4PZLA 2CK3D 1ZUHA 3CLVA 4KFTA 4KYUA 1AQYA 1G20E 3CR7A 4ZCIA 4KJZA 2ZEJA 1W47A 2RCNA 3GEIA 1J8YF 3TIFA 1I4LD 4Q9JA 3LD9A 5C2JB 1IY2A 2O0KA 3OESA 3TSWA 2QE7A 5KYKA 1A5TA 3TQFA 2KJQA 2GVZC 3QF4A 5TVKA 3WXMA 2OM2A 5DSZA 3NC1C 3WYFA 4QJ3A 5B58C 4HLCA 3ZVMA 1OE0A 1XBTA 3HP1A 4PZYA 4H1UA 4OQMA 3T35A 4QGHA 4HUTA 3U7HB 3AB3A 3GLIB 3QNUA 4BRWA 2JASA 1KSFX 4M0LA 4A8JA 2WWYA 4B71A 3I32A 2IWHA 1ZW6A 3IIMA 2ECKA 1OW3B 2SHKA 2W6IA 2ZJAA 1AQUA 1XEFA 2NPIA 2YHSA 3CX6A 1R5OA 4LHYA 4LPSA 1DBSA 2GTPA 4GZMA 1YE8A 2C9YA 1Z6AA 3EASA 2ZRJA 2OV2A 3U6BA 1R8SA 1NKSA 2BMEA 4ZKDA 2XSZA 1EX6A 2R65A 2FOLA 3SQWA 4Y0AA 3QF4B 3BB4A 3A4LA 5L3RA 3TK1A 1ZBDA 3WHLA 1KK1A 1WP9A 3V00A 2YNMA 4V03A 1QHHA 1OH6A 2BVNA 2IYWA 2X2FA 3WRYC 3PV0A 1KDRA 1ZVQA 2QUZA 4DSNA 4A82A 2B8TA 5B57C 1OT3A 4WZAE 2IYQA 1VHLA 2BKUA 1XPUA 4HSEA 4YXWD 2XZPA 2XNDD 3J81k 1U2RA 4OJKA 1G17A 2GBLA 2IXGA 1OHHA 4US0R 5ANRB 1GNPA 3ZS9A 3NXSA 1GDDA 3THOA 4B32A 1BKDR 2PMDA 4F4CA 2IYSA 1TF5A 1NBME 4OQFA 2C98A 1NLZA 4HAXA 3TH5A 2A5DA 1QVRA 4URYR 4M1SA 4FMDB 1N5LA 1XRJA 5E7MA 3TVTA 2VRWA 2IF0A 3OIUA 3PVSA 2Q3HA 2GXSA 1UBFA 3SHWA 4OYHA 1JBKA 3KXLA 1YR7A 4IFBA 1QHHB 2IYZA 3RDPA 1Z6YA 1YZQA 2ZI6A 5EE5B 1E98A 2VHUA 4N0EA 1M6NA 1FMLA 5KSOA 2O0JA 4RSGA 2QORA 4EFMA 1A2BA 1Q44A 2FNAA 4MYUA 3TE6A 3TW4A 3OIYA 3NC0C 4DEYA 1FTNA 4FMBB 1BIFA 2EQBA 4JBYA 2J0VA 3ZS8A 4II7A 4IOMA 2CHGA 3GCGA 1T8UA 3SN6A 4OHYA 1J70A 2ZJYA 2ZR0A 2NMVA 5CIQA 5L3VA 3FMOB 4Q1FA 2FSFA 1LS1A 1CIPA 2KE5A 1VCOA 1D5CA 2VP9A 4Q4AA 4BEJA 1VTKA 2ZUBA 4XSGA 4A0FA 3GJ5A 2WOJA 2ZRKA 2VSOA 3JZAA 3L0IB 4G5RA 1ZD9A 3W3ZB 4C0BA 4Z51A 1DOAA 5DGXA 3GFOA 4E07A 1RRCA 4V0KA 4ASUA 3BH6A 4NP6A 2ZSBA 2XXAA 1TEVA 3R20A 4E5UA 3THYA 1JALA 3UK6A 4LJ4A 2VP0A 4MRPA 4WW0A 2B8WA 2BMJA 1DS6A 1ZU4A 3K9GA 5TDHA 4AIIA 1T5IA 2Z0MA 1E1QD 4Q21A 5JWRA 1DARA 5GJBA 2P2LA 4DLRA 1FZQA 5C1BA 1AKYA 4R9UC 1XJCA 1US8A 4RZ2A 2FEMA 1DAHA 2BMFA 3I1FA 1KI6A 1RKBA 4C0AC 4Q4AB 2NPFA 2FMXA 5KPJA 2JLYA 4C7OB 3IGFA 3DPUA 2QMOA 2IEYA 3G82C 3K8YA 2ZYTX 1S3GA 2IHBA 4UKDA 1HT2E 2ZSAA 1TEXA 1A4RA 3CNLA 1NMYA 4GSYA 5FPSA 1GITA 3A1TA 4XVUA 3KDSE 1C1YA 2HYDA 4C3ZA 4Q4HA 5FOWA 1ESNA 3LA6A 3BAFA 3K9HA 3FGNA 2VL7A 1F3OA 3MWKA 4OBEA 1MRNA 1NVUQ 1XMIA 2C95A 4Q47A 4UNSA 4BRUA 4EJSC 1OF1A 4EPTA 2C99A 3KJHA 3NIBA 4ON9A 2PZEA 2ZITA 2WSSA 4DEXA 2VHQA 1US8B 1UBEA 4ZCLA 3CZPA 5LDDC 2B92A 1SXJC 1GL9B 3LBIA 3A37A 4QHYA 3PEWA 4E22A 3THWB 5AK0A 4KO8A 1BS1A 1P5ZB 2KBEA 3I3SR 2HUPA 1SVLA 2ATXA 2OFXA 3W6NA 4Q1BA 4DLVA 3GJ8A 3CRQA 2EW1A 5FUYA 1XPRA 2W58A 2QMEA 4JJZA 3UMSA 2ZI3A 2RGEA 2ZIAA 4MUAA 5DH9A 1XTSA 2Z4SA 2JLWA 2XGJA 3B78A 5JEEA 4LYFA 2GXUA 4Q4HB 4PO8A 1XJQA 3OIWA 5A0FA 5KDLA 5GJVC 4OK3A 1RRPA 4Q66C 2Q9CA 5EE9A 3KKOA 1OB2A 1KY3A 4LYJA 2WJJA 3H84A 4UXJA 3SI7A 1JR3E 3GJ7A 4KSCA 1T91A 3KTAB 1E2PA 1SXJD 1T6NA 1D9ZA 1XZPA 2CLDX 2RAPA 3FFAA 4V0LA 4UNNA 2Q9AA 1NY6A 5C4MA 4Z8XA 2P5SA 3CX7A 4B3FX 2RHMA 3FDIA 3AGQA 4Q03A 3BERA 4MKGA 3ZZUA 5CK5A 4P0TA 3EPHA 2B7CA 4ARZA 4AKHA 4X8OA 1J7KA 4G3XA 3RWOA 1FMJA 2ZS7A 5JJLA 4PPFA 3KQNA 2YV5A 4LCBA 3GJXC 2QQEA 1EG7A 1FOEB 1KI2A 1OKKA 3CM0A 2ANCA 3RSOA 2WTUA 3BFXA 3Q7QA 4L15A 4QJ4A 5E4FA 4JL6A 1G41A 1HYQA 1S96A 4PHTA 1GRNA 4HATA 4XVRA 2D62A 4BLSA 1QZXA 1UFQA 5TB5A 4Q00A 1KAGA 4PQRA 3ZZ0A 2QPTA 4BASA 3KFXA 3OHMA 4R2HA 1P60A 3VMFA 2NO9A 1TQ4A 2WAYA 1UF9A 3CB4A 3N5CA 4BLPA 3VKHA 4IRUB 3BC1A 1E2DA 4ILEA 4JL8A 4LHWA 3E70C 4L16A 3KB1A 1PLLA 1CS4C 1IN5A 2BHRA 4PQFA 2KBFA 1MO5A 3HR8A 3KUCA 4O0MA 3ZVRA 5EP3A 4B74A 1ZM4A 1PZNA 3RVBA 2XTZA 4NYMR 3WP0A 1H8HD 2FFHA 1NY5A 4V0NA 4DLWA 3KKQA 4C2TA 2NO0A 4M1TA 2CCGA 4TMZA 3AKYA 4QBFA 4B35A 5AUPB 4CEIA 1BYUA 5JEDA 3MRSA 5TV2A 4BLOA 3EW9A 5BQ5A 1TU3A 2VP4A 3QENA 2XITA 2LCFA 3EC1A 4DCVA 1F2UA 5L8VA 1CXZA 1KDOA 2N42A 1UBGA 2AFIE 2CL0X 1MV5A 1VG9B 5AR1A 4LRWA 3AV0B 1RPZA 2PCLA 3B9PA 221PA 1TPZA 5FOXA 4CYMA 4URVR 2F55A 2A5YB 3B13B 3HPQA 5DN6A 1UEJA 1ZU5A 1JR6A 4W5WA 1LF5A 4R7ZA 4PO1A 4Q7MB 3NVAA 4W5HA 3RRYA 4B2PA 1K6MA 2BBOA 2PT7A 4DKXA 3EXAA 4CEIB 5SZJA 3RABA 3QBTA 5IT5A 2GK7A 1OIVA 4DUGD 4NU0A 4O3MA 1Z2CA 3U7EB 1QG4A 4JVSB 1F2UB 1UADA 2JATA 1ZNWA 3S1AB 2PJZA 2QT0A 3OZXA 5HCNA 3QEOA 1ZINA 2D2EA 2ZR9A 5H68A 4YMTA 4C30A 4DWJA 3BK7A 4M53A 1UKVY 1TMKA 4A2WA 1Z07A 4G1UC 1FP6A 1FTSA 1KO8A 3LFUA 4D2IA 1G8YA 4KFRA 4NCKA 4DCNA 4KITB 2WMOB 1RZ3A 5CYPA 4Q9KA 1YZUA 3K70B 3FPAA 4F91B 2IA5A 3DEFA 2G77B 2XNSA 3OE7D 3PUXA 5FBLB 1IM2A 2WV9A 4B3CA 3V4RA 5ELXA 3G0HA 1IXZA 3AH8A 4UJ5A 4AG6A 3U44A 4B47A 4OKSA 3A1VA 3B8HA 2QTVB 1MT0A 2JJ8A 3CUEF 1UKYA 1DG1G 2H92A 3LRPA 1VKJA 2E1RA 4GOJA 1XF9A 2W2XA 2B7BA 3U5ZB 2O8EA 1E9RA 1W0KA 2W00A 2GCOA 3OFND 4Q9IA 1A82A 4KYIB 2JDID 4MKHA 4DLZA 2V8OA 4NONA 2D4HA 3CRMA 1EFRA 2QTFA 2NZ8A 3L8YA 4GRAA 4OJQA 3NEYA 1E2GA 1HY3A 3D31A 2F1RA 1KK0A 3VX3A 2GK6A 2YZ2A 4BLTA 3U44B 1XCMA 4R2IA 1W0JD 3W6OA 4JYCA 4IDPA 2EFGA 4ZI3A 3GJ6A 2HJGA 2VEDA 3GLHA 3AVTA 4V0ME 4TQUS 3TAHA 2WJVA 2CVFA 4EPRA 1T5LA 2WKQA 1U0LA 1KMHA 2O8EB 2ONKA 5P21A 2QL6A 5EJEA 1N6RA 4P4TA 4MRRA 1FX0A 2GCOB 1G9XA 2CNWA 3NG1A 4OHZA 4ZDIA 1F5NA 2DYKA 3GJ4A 3LQRA 4QNMA 5AJVB 4Q7JB 4HB4A 4M1WA 4TQAA 1TUIA 1FUKA 1OXUA 2CJWA 4AY2A 2GEUA 1UPTA 3AVPA 3QI2A 4YMWA 2FX3A 2DY1A 4PHFA 1X8JA 4UJ3A 4DSTA 3H2YA 1OJLA 4YMUA 1AM4D 1J90A 2QGNA 2W6JA 2GDJA 4EFNA 3K0EA 4TN1A 1W4CA 4ZDJA 3U6KA 3GPLA 3AVVA 1Y63A 1D2NA 4TMVA 4TT3A 5L3QA 3GMTA 3GLHB 3X1YA 4MITA 1T3LA 2OAQ1 1G6HA 4V02A 1BMFA 1W2GA 1XD8A 4KFUA 1VECA 1KMHB 1Q21A 2OUKA 1MOZA 3T61A 2EFEB 1N25A 3SR0A 2OCPA 4FCTA 2ZRIA 5KDDA 3LW8A 4BLQA 3D7MA 2E9SA 1A1VA 1G7RA 5FL7D 4AWXA 3I5XA 1GNRA 3JVUA 2K5UA 2RGXA 3QPWA 5F2EA 1CR2A 1OYYA 1VCMA 1S0UA 5TARA 5JWOA 2F3RA 2C2HA 2WJYA 1GFIA 4URWR 4NYIR 2C03A 1P9RA 3CO5A 1MO4A 1G7TA 4IHQA 2FJUA 1SVWA 3ECCA 3QJYA 1N0WA 4Q1DA 3B7GA 4D4LA 1JECA 1G8FA 2F3TA 1W4RA 1LF0A 2CCJA 2PBRA 3BRWD 3VTKA 2J46A 4KXFB 5JJIA 2IS6A 1D9XA 2QE7D 3EIEA 2WIAA 2IL1A 1XTIA 2J1LA 3AF0A 2W0MA 5JECA 2XEXA 1FUUA 1ZIPA 1XP8A 1CR4A 1X86B 3B2EA 2BBSA 3TSOA 4HDQB 4CEHA 2HCBA 2FGKA 1XCPA 3Q7PA 3TLXA 3W5JA 4JLNA 3NDBB 3ICQB 4FD2A 1M7HA 4YMVA 1MH1A 4HLUA 1HQYE 1EFUA 3KX2A 4C9BA 5LD2B 3WMEA 2W6ID 3ZGXA 2GCPA 3FHTA 3JZMA 2GBLC 3O8BA 2ZPTX 4BFZA 1L7VC 3FE2A 2BMDA 2C04A 1KMQA 1T8TA 5GJWC 4A0GA 2Z5FA 3O47A 2HXYA 1AN0A 1F48A 3K09C 3M6AA 4PANA 4TLCA 5G41A 2ZYVX 2XSZD 4OL0A 2WWFA 4QJ5A 1GRRA 2XOKA 3CNNA 2OHFA 2AXPA 4M4SA 1GZSA 4P32A 1FPMA 2QMUA 4B3XA 1AS3A 4CEHB 4TZ0A 2LKDA 1CU1A 3GEHA 3VR6A 1JEDA 2FDCA 5J40A 5DYGA 3PUZA 3SBEA 4RCYA 4CIDA 1RYFA 4IEEA 2OG2A 3NWJA 3RSLA 3HWSA 4CEJA 3U7GA 2WJHA 4A1FA 3ADDA 1G64A 1NMZA 1NSFA 1NLYA 4BGDA 2VO1A 1GKIA 2F9MA 4TTRA 2CMKA 1OXXK 4DLTA 4PC2A 3HYRA 4JLKA 4MUBA 1E9SA 3DDCA 1RVDA 1QHGA 2ZETA 3UIEA 5KO2A 2PT5A 2HT6A 2CE2X 1T0HB 2GEVA 2QGZA 2GA8A 1W49A 3GLFA 1PJRA 1P9NA 4D0LB 5DHAA 3K0FA 4PAQA 1SULA 4LHXA 2ZSFA 1JPNA 2P67A 4BPBA 1L4YA 2JJ2A 4LJ6A 2QAGA 1ETUA 1JQJC 3L43A 4D4MA 2IUTA 1MKYA 1VIAA 4NCJA 1YZLA 2OT3B 4DHEA 1SKQA 4A2PA 1E2FA 4CEJB 4DLUA 1RIFA 2YOFA 4WZBE 3MGCA 3SC3A 3BXZA 1LNZA 5BN5A 2O8CA 2GHIA 1L2TA 1NJFA 3DM9B 4CT5A 3U4QA 3W3AA 1U94A 2C9OA 2GKSA 5JMTA 4Z1MA 3BOSA 2JLSA 1CJTC 3PUVA 1PV4A 4K46A 4LV8B 1D2EA 1ZP6A 1ZIOA 3VFDA 4NH0A 5BYJA 4EDHA 2ZRHA 4FIDA 5FI1B 4JL5A 1AS2A 1KJZA 1WDTA 4IDOA 2JJ1A 3GLFB 4ASUD 3GQBA 1G3UA 2GXAA 4HZIA 2PEZA 4LGMA 3T1QA 1N5JA 2OSBA 3C14C 3ZQJA 1DE0A 2YC4C 1E79A 1IOZA 5F3WB 2AFHE 3GLGA 2WHXA 4ZDKA 5K8TA 2QEQA 4G5OA 1KI8A 3M4YA 4FWIB 4TL8A 3QOFA 4PZZA 5E95A 5AJXA 1EGAA 4XVQA 5FL7A 4BZQA 1IY0A 3U4QB 2B6HA 1CRQA 4HB3A 4BUJA 4D4KA 1T3HA 2Q0HA 3BWDD 1Q1EA 1X1RA 2ZJOA 4A15A 3GFTA 4F7WA 4EPVA 2FF7A 2E87A 1OV4A 1KO1A 1H8EA 3AVUA 2ZSEA 5IK2A 3EZ2A 2VQSA 4MDEA 2FV8A 3KKNA 1UDXA 5JRZA 4B76A 1OXTA 2WJGA 3C5CA 2O8FA 3OIVA 1HTWA 3QXSA 4RD4A 3CBQA 1G8PA 3NHBA 1DVRA 2KB0A 3E2IA 4RZXA 4GDFA 4HLDA 1E6CA 3CF6R 4HAWA 2BM0A 1M74A 3RS7A 3RNLA 1X8LA 2IW3A 1Z08A 3GLGB 2IX3A 3TR0A 1IQPA 4L9WA 1COWA 2GJKA 3K9LA 2DFLA 3ASZA 2A5GA 3SJCA 4ZDWA 3UPUA 3IEVA 3A8TA 2R2AA 3ZQ6A 2WSSD 3ZVNA 2C5LA 4XWAA 5HTKA 1P73A 3FYHA 3AUYA 2X1VA 2WVJA 4PR0A 2H7VA 3BH0A 5H70A 1VMAA 2ZREA 1NL3A 1Z0IA 1HT1E 3WRXC 4RVCA 3R8CA 2I1QA 3EA5A 2JIZA 3MCAA 2W2VA 1EK0A 4RKFA 4I81A 4TYWA 1TUEA 3O8CA 4FCVA 2VHJA 1FQJA 3AGPA 3KKMA 2JLXA 3EZ7A 2AKAB 3GLIA 2A9KA 2EYUA 4BZXA 1KYIA 1XTKA 5EUQB 2AN9A 2IXFA 3OAAA 3EWSA 5KOYA 2RGBA 5JJKA 2IF2A 1X8KA 5B2ZA 2FU5C 3QXCA 1SVIA 2GZAA 2HXSA 4Q1CA 3ZH9B 2X2EA 3QKRA 4G5SA 4NHOA 2QQ0A 4PSAA 3LBNA 4A8JB 2P6NA 1P7CA 3C7KA 5EXPA 4AC9A 2PEYA 1R0YA 3R9XA 2V54A 4CW7A 1KI3A 4DT1A 3L82B 2G9NA 2IYLD 2ATVA 2Q3FA 4PO9A 3DMNA 2ZRCA 3X1WA 1OKKD 4IXNA 3ZDQA 1E9FA 2BEJA 2AX4A 4PPGA 3D3QA 4S35A 4B75A 4D82A 4EPYA 3PEYA 3SJAA 3VNUA 2P6UA 3A4MA 1MO6A 1OIXA 1CULC 1E9AA 2RGAA 3TMKA 3KQUA 4H1VA 4AI6A 3QEJA 2G3YA 1N0UA 3QKRB 3P26A 3GP8A 1EFCA 3SBDA 4M9QA 4XSHA 2DR3A 1GVNB 3TJZA 3LVRE 3REGA 2TMKA 5JCPA 5JS8A 1W46A 2IBMA 1WCV1 2ZYUX 3X1DA 4LSGA 3QUSA 3K0SA 2FZ4A 2ZI4A 1ZC3A 4J0QA 3MUFA 3UKDA 2OCYC 5LPNA 1NF3A 1IBRA 2YC2C 4B6FA 3K70C 2JLRA 3PUWA 2YWEA 3VU9A 1XD2A 3SEAA 4H9GA 4Z8YA 4DC9A 1G21E 3EZFA 3A1UA 2GJAA 2XTNA 4ZCMA 4B43A 4EKDA 4PQYA 4HLQB 4KU4A 4P31A 3EPKA 1Z63A 1U99A 2J3EA 4TSFD 2OBLA 2YINC 1E2JA 3GEEA 4WXPA 4GZLA 1MABA 2CHQA 4DIEA 4DZZA 5B64A 2KI5A 2EWVA 1NBMA 3ZVLA 1G3RA 1I2MA 3JVVA 4MRVA 1CR1A 5DN6D 1DO2A 2AK2A 5C4GB 4OK5A 5EZ5A 4KBGA 3K70D 5D3QA 2A30A 5KU1A 1AIPA 1NNEA 3DOEA 1DAMA 1KNXA 3CRW1 1XD2B 1YR9A 3VR1A 3OEEA 3VU9B 2CBZA 3E1SA 3M0EA 1DO0A 1M7GA 1D8TA 1XFAA 2QP4A 3FHCB 4B6EA 3CNOA 2GJSA 1OXSC 4F92B 2VH5R 5HKKA 2XXAB 4KI0A 3THYB 2DBYA 2AWNA 1G5RA 1SVMA 3E5HA 2PH1A 1TF7A 4OI4A 3REFA 1N5IA 3TQCA 1HQCA 3CPHA 2V1XA 1W36B 3ZYCA 3NEJA 4RFVA 2AL7A 4R71A 3K0CA 1HE1C 4I99A 3TUIC 5F9FA 3OEHA 2JLZA 2FG5A 3IQXA 5FPHA 5EE0A 5KDOA 2XB2A 3VR4A 3F0TA 5J4KA 4WOPA 5CB6A 1KI6B 4YMSA 2OLJA 1XXHE 2DFKB 2IYYA 2ANBA 2BBWA 4RD1A 2RGGA 2QRZA 4TQ9A 3KQKA 4TMWA 2WZQA 4Q1EA 4YLGA 1BYIA 1S1MA 4A92A 4WIAA 1W0KD 3EC2A 5HPYB 1PUJA 1KZGB 4UXIA 4FMCF 3ZZTA 3P27A 4OI2A 1P6XA 1IN7A 1PLJA 1FNNA 1EFRD 1XEWY 4MRNA 3PCRB 3DVLA 3EPLA 2PJRA 2XJ9A 2QP9X 3RYTC 1JAIA 3MG9A 2ZVQX 1FFHA 4QBIA 2MSDB 1OPXA 2NIPA 1UDWA 2MMGA 2UZ3A 3PXGA 3TUZC 1KJWA 3UMRA 1QHXA 3R7WA 1G4UR 1R4AA 2A3RA 2OFWA 1XB2A 5TY0A 3QE0A 1Z8FA 1JJVA 3LLMA 1II9A 1KOFA 4D81A 4HUQA 1FL9A 5JZVA 1KI9A 2AR7A 2FPLA 1P4SA 2CNWD 4FN5A 2OAP1 2X19A 4AYXA 1XD9A 2I3BA 1D2MA 1ONBA 5EP4A 5HE8A 1SKYE 1KTVA 4KBFA 4LV5B 4F93B 2P65A 1R0WA 2ODWA 5BYKA 1FQKA 1I4TD 1E4VA 1KHTA 2R6CA 1NIJA 2OLKA 2W6JD 2ZE6A 2ZRNA 4B2LA 3LXRA 5G53C 3ZD6A 5LD2C 2F7SA 2QTHA 4TT3D 1NG1A 4LBVA 3EAQA 3SFZA 3D8BA 3B1VA 4NYIQ 5FPYA 4ARZB 3R7WB 4LJ9A 3B60A 2ZUDA 4JYBA 1NIPA 1GSIA 5FUVA 4DVGA 5HZKA 1BMFD 2NO6A 1OFIA 4HUQB 3U3OA 5KNDA 3I62A 5CYOA 2OCAA 2GAOA 4LJAA 3SYNA 1WRBA 1FNMA 3KJIA 1GILA 3PUYA 4NCNA 2QY9A 3EARA 1JR3A 3QKSA 1T0JB 3HYTA 4GBMA 4TYYA 4RFSA 1SHZA 1K8RA 1CJVC 3KFVA 8OHMA 4RY2A 1Z0DA 4TSFA 1WF3A 3L0SA 4GOKA 4C0HA 2NO7A 1KK3A 3ZLJA 4HLUC 4HAYA 2G88A 1RW4A 4NTZA 4UQOA 1HURA 1AS0A 1CP2A 2WPDA 3LQQA 3SNHA 1G4AE 4LBZA 2AD1A 2WWWA 4PC6A 1TAGA 3U60B 3AKCA 1YZTA 1NN5A 1ZJ6A 3F8TA 3EPJA 3RANA 4MYTA 1IAQA 4QXAA 1VYVA 1AGRA 1J8MF 3W5IA 4NE2A 1CF4A 1KI1A 5B30A 2QROA 2ZRMA 3QKSB 1LFDB 4JMPA 2XJ4A 5CLLA 2P5TB 3AF2A 4JIMA 4ZPXA 3HDTA 4NCHA 1P2UA 4RFSB 3C16C 5JRJA 2WM9B 4XJXA 2ONJA 3V4FA 3EIQA 1KIMA 4PAOA 1XZQA 1O3YA 1IJFA 4UNRA 1SXJE 2WKPA 1GP2A 1L4UA 5HE9A 4C0QC 3F5FA 3P4YA 4L8GA 3SS8A 5AUOB 4RD2A 1CEEA 5D3MA 3AKEA 3AVYA 1II0A 1TQ2A 2OO7A 3EIHA 1ZM9A 4JS0A 3RS2A 3I5YA 1S9DA 2BDTA 4MDFA 4C4PA 4E09A 1CLUA 2IS4A 4Q18A 1E2NA 1EWRA 3NHAA 2FE4A 3CF2A 4ZI2A 1E4YA 1MO3A 1YQTA 1NMXA 3IDQA 2F9LA 1U8YA 3DKPA 2XOKD 4LHVA 1N6PA 3U61B 1ZNZA 2PX3A 4WA7A 4EQ6A 1YHNA 2QU8A 4D0NA 5CJ2A 3AP1A 2J9RA 4P4SA 4BEBA 1WA5A 3VNVA 4A9AA 3BGWA 2VHCA 2ZI7A 1TADA 3CWQA 4MGYR 4CZ2A 1KJYA 2MSCB 3AUXA 1SHKA 4CRWB 4IJMA 3W90A 1E2MA 4LJYA 4WBSA 4A4DA 821PA 1DPFA 1ODFA 3EWAA 4QGAA 3WNDA 1ANKA 1CJUC 2PMKA 4DLYA 5D3MB 2XAUA 3AQ4A 4GI7A 3VX4A 1DAIA 1U0HC 4US1R 1S9HA 1KO4A 5BN3A 3Q5DA 2CCKA 2G6BA 2ODBA 2ZI9A 5K8IA 4GPTA 4JBXA 4XOIA 3Q3JB 4JLBA 3T1OA 4HB2A 4EJSA 1JNYA 1U9IA 3C4JA 1E0JA 3L0PA 4EQ6B 1E2EA 3UATA 4UXHA 1VYTA 4HYYA 2JJ2D 2HT1A 1VCNA 4B44A 4HZUA 5EXXA 4TZ6A 1B23P 1TU4A 2GNOA 2ORVA 3KQLA 1NVXQ 4JVNA 1GL7A 4NBSA 1E3MA 4EPWA 2O8BA 1WE2A 4Q19A 5GADl 3VKGA 4Q7LA 3K53A 3PQCA 4AG5A 3QKUA 1P2TA 2VSXA 4Z1MD 3TVDA 3IO5A 3ONWA 3ZD7A 1VG1A 4GP6A 4PSKA 2AWOA 3LX5A 2WIBA 3EG5A 2ZRAA 3ND9A 2IK8A 4LK2A 3LWNA 1XTJA 2JJ1D 1XTRA 3NH9A 3A36A 4HDCA 3VAAA 3WBKA 1NLFA 3AVXA 1XDBA 2DB3A 3AF1A 3WP1B 5EP2A 3IEUA 2ZRDA 1E79D 4HZUB 3T1TA 3AP3A 1J99A 3MWJA 3SZRA 3PJRA 2Y8EA 1FX0B 1A7JA 4Q4JA 5AWFC 1N0VC 3ZIAA 5EP1A 1NVWQ 3RHFA 2O8BB 3NTUA 2CXXA 5L3SA 2VBCA 4JZKA 2CJWB 2QP3A 2WJIA 4M1MA 3NBZC 5FUXA 3DO6A 2HYIC 1KSGA 2IC5A 2GWHA 4KV9A 5FOVA 4XD7A 1C9KA 2YJTD 4LDJA 1WQ1R 5FTLA 2ZQ5A 1H8ED 4AKEA 4A8JC 1NN3A 1IJEA 5FBQB 4V0MA 5IK2D 1VCIA 2G0NA 2UZIR 4D6PA 3L0OA 1Q12A 1XMVA 4ITRC 2C9CA 5L3QB 1VIYA 3RLFA 4I1VA 5K8UA 1NP6A 1F2TA 4JVMA 4PC7A 2I1VB 4JSTA 1AGPA 4TYPA 5HR5A 1CTQA 2Q21A 5K8LA 2V4ZA 4IFEA 3OF5A 4N1AA 1NSTA 1Q3TA 4FMCB 3L8ZA 4LJ7A 4QBHA 4Q4JB 1COWD 3FFBA 4O25A 4B3DA 2BC9A 5KHOC 3AKDA 1W7AA 3QBVA 1QHYA 2ORIA 1C4OA 1P75A 1R6BX 4M9SA 3TNFA 3U3JA 2V6JA 3BFKA 1NN1A 4GFDA 4M22A 2CLCX 4AK9A 2YVUA 5L3SB 2J0QA 1IHUA 4GP7A 4ACAA 4F4IA 1YZNA 2ZAOA 2REXB 1G8GA 2KSQA 4DLSA 4XIGS 2ORWA 3DHWC 2PX0A 2OEPA 4MA4A 5FR1A 4Q48A 2FPMA 2JIZD 1TX4B 3V9PA 3CIOA 3HJNA 1XJ0A 1YU9A 1F2TB 4DDVA 1CR0A 3BS4A 4MKIA 1Z28A 3OAAD 1XWIA 5KNBA 3KB2A 4V0OA 4HEJA 2QNRA 4IOJA 2CHVA 3B85A 1KY2A 3A6PC 3R9WA 2F43A 1VPLA 1E32A 2QRNA 1DG3A 5CDFE 4S2EA 4IOKA 4D4JA 5AJZA 1ZM3A 1WXQA 3GFPA 2IYXA 2I4IA 4PPQA 1IY1A 2REOA 3N2IA 3BB3A 4KVGA 5CM8B 3I4LA 4WAUA 3IUYA 2J0UA 3UANA 1EWQA 4NYJR 2EU8A 4LJ8A 3LY5A 3UXMA 2WKRA 3NBFA 1G7SA 4D26A 2V7QA 4BE7B 2JGNA 1Q3HA 2C78A 1QHNA 3P32A 4MKFA 1GTVA 1P3JA 1Z06A 4WXRA 3QF7A 1ELOA 1B0UA 3AF3A 3GJ0A 1G1MA 4CF7A 1E0SA 1NI3A 1XEXA 1Z2AA 5BWMA 2VP6A 4BLRA 2H5EA 4HAUA 1G7CA 4PHHA 2J87A 3GLIE 3U3RA 1M8PA 2IYVA 3SOPA 2ERXA 1W36C 2DHRA 2ZRBA 1GOTA 2PZGA 1W44A 4K8OA 3CWZA 2X8AA 1XMJA 4YC7A 4Q9HA 2J0UB 3SJZA 3LX8A 1QDEA 3FVQA 3M1IA 3VR2A 5AUQA 4ZIRA 1E69A 2AXNA 2ZE5A 3QXJA 3T5DA 1GM5A 4B33A 4MH0R 2QN6A 3Q85A 3I61A 1D6JA 2EFHB 3Q9LA 3K0FB 3CZQA 2OCBA 4GMDA 1UKEA 1M7BA 1XEXB 2QAGB 4FW9A 3X2SA 2CL7X 4OHWA 1UBCA 1W36D 2P6RA 4Q4LA 4NKRA 2C96A 4LYHA 5LBIA 1DAEA 1Q0UA 4FXPA 1NBMD 5DI9A 3RS0A 2ZE7A 5DYIA 2O8CB 3MAAC 3NH6A 3WMFA 2ZUCA 3A1SA 1II8A 3SQXA 2WWXA 1XNJA 2FSGA 4JJKA 5JHGB 2QBYA 1E9DA 5C46F 3KL4A 2H18A 3I8SA 3W8RA 1E99A 2HEIA 2PCJA 3B9QA 3DL0A 4G01B 1Z0JA 1Q20A 4O2RA 1E2LA 4ZIRB 1AJEA 1P2VA 2ZS9A 4LBWA 3OEED 4RZUA 1R5BA 3QPUA 4QHSA 2DWQA 5CITA 2B21A 3QVVA 4JVLA 4PSVA 3CKLA 3NBXX 5DO9A 5EQTA 4US2R 3FKSA 4C0LA 5HKKD 2QENA 2FH5B 3LBHA 1LY1A 1W5SA 2JCSA 1NVVR 2YWFA 2ZJ8A 2RGNA 2V1UA 1E0KA 1HV8A 4DB2A 3BBPA 2QI9C 2VPPA 4B2IA 1Z0FA 1SZPA 1G18A 2WWGA 4IDHA 2DCUA 2OBNA 4NCIA 4E03A 4TWZA 1JB1A 4JSYA 2Z43A 1ZRHA 4B34A 1T3SA 3ADKA 1F6BA 1SVKA 4QHTA 3RAPR 1YZGA 1II8B 3OEHD 1U0JA 3PFIA 4KHZA 1OH7A 1SQ5A 2QBYB 4YDHB 1SVSA 1Z29A 1YJ5A 2R6FA 2OFOA 4ESHA 4XTRA 4A0RA 2O8FB 2ZRFA 3LO5A 4B3GA 3LLUA 3B1YA 4XWKA 2OZEA 1R8QA 3DZ8A 5FTMA 2OXRA 3C15C 1GUAA 3DOFA 4KLNA 1ZM2A 3FWYA 4O2LA 1U98A 4LX0A 3RWMB 4P4UA 2WWHA 3N70A 2H17A 2GCNA 2GF0A 4TMXA 2VYFA 2BM1A 1CKEA 1R5NA
chains in the Genus database with same CATH superfamily
3SU8A 2F1KA 4M8NE 3CF0A 3RF6A 4DYDA 1IRXA 3ENWA 2RG1A 4H0FA 4RANA 4XRRA 5KYGA 3B1XA 3PF9A 2BSAA 5ERXA 3O75A 4ZEXA 3OD5A 2DCMA 4QPJC 3COYA 4K9OA 3COWA 1LX7A 3GLSA 7YASA 1JJIA 1A4UA 4RS4A 5CFPA 3ITKA 3SKYA 1OU0A 3JYPA 2J45A 4IDAA 1Z83A 2HCTA 3JQ6A 2WG2A 1DKQA 1FX1A 4LVOA 2GI4A 3A58B 4C6RA 1FMFA 1OBHA 3QK7A 1BXRA 3CH5A 3QKTA 4CL0A 3ESAA 1NW8A 4AJ9A 3OETA 4FHFA 4G0OA 4M1OA 1NF9A 4MGKR 3A6KA 4LC0A 1A9XA 5I01A 3A1CA 3ELYA 1ODSA 1WPRA 3GLUA 3HR7A 4NYMQ 3T0FA 4BFXA 3LH5A 4FHCA 2KQUA 1N3LA 2NV2B 2F1OA 3D0KA 3LVFO 5HGJA 5A4AA 4LF8B 2W8BB 1OBFO 3FMFA 3VM6A 4M1YA 1MJHA 1P18A 2AEEA 2C1ZA 2YY6A 5DJ5A 4I1SA 3RBVA 3Q5EA 2YV3A 2AFRA 2XYQA 4Q1VA 2O6HA 4MW1A 5A3VA 5TXGA 3S8YA 4N40A 2P4SA 2Z4TA 2V3CC 3BJRA 1XKXA 2AZDA 4A23A 4BWFB 3LL4A 3NNNA 4EPXA 4UTPA 1P19A 1JQ5A 3GZNB 3IIEA 4HPJB 1ECGA 4PRZA 2Q6LA 3A1WA 5BR8B 3ELDA 1LS6A 1F6DA 1J2EA 1EX7A 4NLLA 5D8DA 5KHLB 1IQUA 1JEOA 1NDHA 1UFKA 4ZO7A 4DEVA 3UWKA 3AUKA 1JA0A 5B7PA 1O5IA 3HDJA 4OA8A 2PKQP 1ATZA 2BTQB 2BRUA 1U2GC 1G5QA 2FW6A 2V4UA 3EZNA 4XGIA 2WUEA 5IDVA 1SCIA 2A9OA 2ILVA 1L5RA 1X3SA 2WTAA 2QR5A 2ZRPA 4NZZA 4X1YA 5EJ9A 1VKOA 1LW7A 3L7DA 3F1KA 3FUXA 4X8HA 4ZKEA 1A7AA 1FDRA 3ZXIA 5BSGA 2HSGA 4ALLA 2ZS8A 2AQ8A 1H42A 4UVEA 3VU0A 1Z6XA 2SBTA 3A1NA 3EF3A 2DG2A 1NLMA 2PAFA 3NDPA 4MB2A 1NRJB 2R66A 4KNVA 1FLNA 4UVHA 3OQBA 2YN0A 1DWUA 3ZCXA 5A4JA 1S3IA 2EFDB 4O4LA 1DAFA 4QRHA 4OQNA 4X7PA 3SYMA 3AF4A 2OYCA 3TBFA 4D9IA 5HZHA 2Z83A 4KO2S 4RHTA 1JEJA 3DPSA 5D01A 2WLSA 3RYFB 3WLMA 3BULA 2OAEA 5D85A 3FB4A 3BCUA 4M0KA 2XDQB 5JDIC 2Q41A 2V0NA 4ZV7A 3QIAA 3EFOA 2CMGA 2IUSA 4Y8VA 2E4XA 4HVTA 4YHHB 2W43A 1NF8A 1O58A 1OBOA 1P2SA 3KJEA 4CFZA 5HQ3A 1OYWA 1T2NA 2X7XA 5NULA 4FLFA 1PJZA 4QXQA 5FOSA 1Z36A 4ZVTA 1YB6A 5HFJA 5ESXA 1OH5A 5AW2A 3TTXA 1AMNA 1ISJA 4I8IA 4QVGA 1BHSA 3B5JA 2J31A 5L45A 4QOJA 4BATA 4OHOA 1I9CA 2QTGA 2IODA 2DTEA 4JYAB 3EBPA 3PJEA 1X7GA 1TAQA 3AESA 2JIRA 4KYVA 4EJ2A 1GGMA 2X77A 1IM5A 3TG2A 1TVCA 4XWGA 2ZBDA 4YUVA 4DJFC 3C5HA 1OWMA 1W1IA 2P9YA 2QF7A 2WFLB 3NBYC 4H59A 4MI1A 3TO5A 3UOAB 1WAMA 3FKQA 3ANMA 2RGWA 4KACA 4LGCA 5GMOA 5FULA 4AF7A 4JOBA 4IHJA 2NTYC 2BONA 3IP9A 1GPAA 2G4LA 1FY2A 3K8QA 1QF9A 3FOBA 2X2PA 1BJKA 4IKPA 3TUJC 2AR9A 4A0SA 5TJ9A 3J7AC 3T38A 4NK4A 2MSEB 2HB6A 3NBAA 5ICMA 1SOUA 4HQRA 5C18A 4G5FA 3ENNA 2HRZA 1J1ZA 1L5ZA 1ENOA 4ZGGA 3H8WA 1XHLA 1PE0A 1ZKDA 4RUKA 1C0KA 2W90A 3HC7A 4G89A 1GAQA 2OO5C 4YR9A 3W2EA 1G2QA 3P9RA 3L46A 1R0LA 2PMCA 1PCXA 2GS9A 1PJQA 1P4JA 3RVLA 1JPVA 3MIZA 1JJFA 5D1HA 3F67A 2FVYA 1PX0A 2HCJB 2VPXA 3DWFA 1A96A 1N6HA 1WJGA 3ZX4A 3MINB 5K3SA 2FPPA 4NEQA 2ZXUA 4JNCA 1L4BA 1W25A 5HS6A 1YJQA 3DOIA 4WVFA 4E5NA 1L1EA 3LDAA 4YUYA 4JJ8A 1Y4AE 3DO8A 4KR9A 2G17A 2YN4A 3OY2A 4XVHA 2CLMB 3ND7A 2BGRA 1PQ4A 4YJHB 5AO9A 1J33A 2RAVA 2R84A 1WUJS 2E2WA 1E7RA 2PLRA 2IX9A 2PMWB 3KUXA 3RVMA 1GN8A 3SE7A 3SZGA 4EHDA 4OHXA 2MSLA 3CIFA 3EZ9A 1U6JA 2B4QA 3FMIA 3BQMB 3QYJA 3PDJA 1I7NA 2FWPA 4Y6QA 4X3OA 4XIIA 5JH7B 4LYDA 1S8AA 2CLHB 2ZI5A 2NZWA 3BIFA 3E84A 3BEOA 4AURA 1R3UA 4QIHA 3G59A 3QTTA 4BMVA 1V47A 4EUNA 2GCEA 3EXHB 2NP6A 3VKWA 1T1GA 1YJBA 1ONOA 1SWVA 3QWHA 3PR1A 2QD3A 4MPDA 1D7OA 2X40A 2ODEA 1MR3F 4L9RA 4V0RA 4B3HA 1X1SA 3I72A 2GSWA 2VHWA 3G5UA 1FDSA 3D8NA 4URZR 4LC1A 3VMMA 4F45A 2NT3A 1E77A 2VUIB 4MA0A 4TKMA 1YNOA 5LA6F 4AFNA 4UUBA 3F90A 4FKMA 3EQ2A 3ZYZA 3RJ5A 3WRXA 5BOSA 5IABA 1RI3A 3V1YA 4FT2A 4OI1A 1DJPA 1QPGA 2IS1A 3AYXB 1JSRA 2ZZKA 1JEEA 5F5NA 4F2PA 2CDNA 4IZIA 4IDNA 4IEIA 2FA9A 1HNZB 2QLNA 4ND8A 2AEJA 3BJIC 1SPXA 3UTDA 5G3YA 3ZI4A 1VKHA 3VR6H 1C9NA 1Q74A 3MWDA 3RYHB 4KE6A 3O3CA 4U5XA 3SJ7A 3GIWA 1ZN2A 4BGVA 4LF7B 3FNHA 4DJAA 1VPEA 4P58A 5JHHB 2RK4A 1BD3A 2GBCA 3GOHA 3PFBA 3KWFA 4PYNA 1GYQA 2R1ZA 4FZVA 3SYRA 1A71A 1NMQA 3I52A 2TMYA 4RKRA 1PGOA 1ZEMA 3G13A 5FADA 2HPHA 3HWX1 3IR7A 3TLKA 4JXXA 2XNCA 1S7GA 2VZEA 3AI1A 1UWLA 2GAAA 3ZK9A 1FNSA 3UTCA 5IKEA 5JFGA 3ZIAD 1Z7BA 1U0TA 2B4TO 5CK4A 4CKEA 1V4VA 1M34E 4XQGA 3I8XA 4OAOA 2XUQA 1DLIA 2Z56A 1XCOA 5EIBD 2J0SA 1YB1A 3H4MA 3DLTA 3F6BX 1KKMA 5FTKA 3DKVA 4XWTA 2O8DB 4YDRA 1XXHB 2GBPA 2RHCA 4XD7D 1ONPA 4KAJA 1XRQA 4ER3A 3QYFA 1IZ0A 2OZLA 1Z4OA 2M32A 3S68A 3OTQA 3STWA 3JQBC 3ZUPA 1BH6A 4HB0A 1TQHA 2XZOA 3NTRA 3THXA 2EJVA 5IYZF 3BMNA 5DLEA 3FRHA 4IPTA 2B1RA 1IUNA 2OCKA 4JVOA 1E60A 3SS7X 3T3HA 1FFAA 4KGXA 4L4ZA 2QRQA 5EXSA 1EM6A 1TLFA 4JY7A 1Z5VA 4A91A 3EDYA 1LK5A 5DCUA 4QGFA 1NXSA 1Y5RA 5CNIA 1LLDA 2HOQA 3H6GA 2P4UA 4CN9A 5GY7A 3RREA 3D0RA 3QFCA 1IWPB 2WICA 3OU6A 2QR3A 4RD6A 5CJPA 3CRVA 3VHQA 2MR5A 3X1MA 3BIXA 1HSOA 2CMFA 1WHSA 2EERA 3VO9A 3GGGA 4O1IA 4Y0VA 3CY6A 4JJIA 1DEXA 3W5HA 4BC0A 2ZAYA 4REMA 3IODA 4D80A 3PE4A 2LWIA 1RM0A 4I1IA 4RDHA 4XUDA 2ERYA 5CPFA 5ESRA 2PPVA 1KZ7B 1S3FA 2Y76A 3UAYA 5SV2A 4CHTA 1OQAA 2FMFA 2AG6A 2P68A 4X71A 3V80A 1UPAA 3RF7A 4WUTA 3B1WA 4D4GA 3A26A 3GMSA 3OOEA 5IJ0A 1WIWA 1ZNXA 3H2SA 2H57A 3ESQA 3VZPA 1I1QB 4INOA 1JHVA 1IBCA 1IVYA 1ZK4A 5T64A 3WA6A 5EJ6A 1WB9A 2BFFA 3A9VA 4MR9A 5BURA 2HK6A 2C9MA 3GLHE 3CUYA 4R69A 4NYJQ 1AG9A 1F8XA 3QVGA 2J3JA 4LYAA 3RSQA 4B9EA 5JSZA 2C7RA 2BKEA 2VJOA 1W52X 1IN6A 1AZLA 1DELA 4XPIA 3UAGA 1BVHA 1VRCA 2J5BA 3C3CA 1IK6A 1OFHA 3CV3A 1SVOA 2XDAA 2LE0A 4IR7A 1RQLA 2O3UA 4HOYA 1PDVA 4TL9A 3RUIA 4JKIA 2XGMA 4GLBA 4UU8A 2AC7A 4UE2A 3GCWA 1K0FA 4OTZA 2PBLA 1GL6A 1M66A 3L93A 1M2JA 3WB1A 1X7ZA 3R9IA 3ZXXA 4ICIA 2GGSA 4DLKA 2F1IA 1QGUB 3GJRA 3LAWA 4IICA 5E7QA 5BOVA 3WMRA 4EG1A 2ZP1A 1CCWA 1P61B 4C7MA 5JV5A 3CG0A 2ZTSA 3LKZA 1RQXA 3X44A 3GUCA 4WBNF 4KCGA 3H5LA 4OQLA 4OSOA 1TIBA 2ZM5A 2V59A 3GVIA 4MUGA 3C8DA 5J3JA 4DIOA 4YQEA 3SR4A 2CVOA 5IKXA 3JZFA 4PW0A 4RQTA 1IXRC 3AU8A 1R4MA 2J41A 2AFIB 3GH3A 5H8WA 2QZSA 1AO3A 1HDYA 2GXQA 3DQPA 4IO0A 4JASB 4HDNB 1JIQA 1EGMB 4C07A 4DXAA 2JAQA 3C74A 4XYEA 4D3XA 3CH4B 4PM4A 4YRSA 1AMUA 1KI4A 2IIVA 5F2NA 1YTUA 4TV8B 5B3JC 4GC5A 1CE8A 2OBMA 1QG0A 3F3YA 3O0DA 4C2AA 4AWAA 5ITWA 4CF4A 4HD8A 3NVDA 1W5TA 2NAFA 2EDAA 4M88A 4UHFA 4B6RA 2J3QA 3R8FA 2W2KB 3NPMA 5LP1A 4JELA 4MCAA 3O4GA 4B73A 1RYHA 5HFAA 3U4HA 2O4UX 4JX8A 2JJMA 2B4RO 5GVRA 3LV8A 3VR2D 2X14A 3FMPB 1YI1A 4POAA 2PRSA 4PYMA 4EY3A 3DCNA 4ROSA 1JEQB 2R6JA 3B38A 2C29D 3L7AA 1V39A 4PFSA 1VA5A 3Q7EA 1PK9A 4J16A 4OV6B 1VP3A 2HMTA 3FWHA 4W5JA 4EJSB 3HU3A 3N8NA 2MR6A 1NN0A 4Z3KA 3BMOB 1LPSA 4Q1AA 3S2ZA 4JLJA 2Z9CA 3G5AA 1ES9A 3V46A 4AG3A 3KJGA 3VNBA 4Q02A 3RRNA 3G02A 3V34A 3NHMA 3MFYA 4QM6A 1XCGB 3HB7A 2C7PA 3F46A 4A2CA 3GAMA 2H7YA 3T5BA 3CINA 1EX1A 2DQ4A 3FDZA 4Y6LA 1Z0ZA 2ZG6A 2GK3A 2V9PA 4MCHA 3WGQA 4ND1A 3GHHA 3AFOA 3R7DA 1A1SA 5DRTA 1RMTA 1XQ1A 4FHZA 1ZMBA 3PWSA 5E7JA 3W8NA 2VNAA 4YAGA 4JLVA 1B93A 1NTOA 4Q7KA 4WWHA 3KPJA 1VMKA 1BO6A 2YRFA 4MGIR 4FMDF 1M8GA 4X8MA 3ZDCA 4LHEA 4QXMA 5EHQA 4CLRB 2RGCA 4G5HA 4Z4HA 6GPBA 1N3BA 2HZBA 4G2NA 4QYWA 1AZTA 3OOHA 2WYVA 2NZ2A 4NMMA 4RSHA 5JZBA 2VPTA 1T9HA 2YRXA 4LXQA 1QDLB 3HBLA 1KAMA 2BGJA 4FFDA 4JI3B 1X1AA 4PAWA 3UKOA 5LA6A 4NPHA 3ZK7A 2HK7A 5KTYA 5AW9A 3B12A 4DNPA 2DSNA 2HPVA 5FL3A 1VP9A 1P72A 1RRGA 1YFJA 1N7HA 3PNPA 2QRKA 4BMSA 4ZPJA 3RRBA 5K3OA 4G86A 1PWZA 1IMJA 1QVAA 3EQ6A 3O93A 3A9TA 4CR7A 5GWXA 3GQVA 1UK7A 1NQVA 3ZE2B 5JS7A 1T6YA 1WD5A 2B83A 3GIDA 2X3UA 3AY0A 4KVAA 1ZXXA 4M21A 1HYEA 4D56A 2UVDA 5LQAA 1BU5A 4FI3C 2CLSA 4FFRA 2NU7A 3QELA 3UA3A 1J1UA 1VZ3A 3DTNA 2VDNB 4KEAA 1D5WA 3L7CA 4QXRA 4ARCA 1G3MA 2VT7A 3WVNA 4PPNA 3X1JA 5H9WA 2G36A 1QK5A 3ZLBA 5DU2A 1T0UA 3LCVB 2ZVPX 4J91A 2VHVA 2MYUA 4AY5A 5JY6A 2JLUA 1MW9X 1NHGA 1GZ7A 4QSHA 1AMOA 4OQZA 1RJ9B 1RXWA 5HOQA 2A7QA 4CF3A 1E7YA 3N2ZB 3H1TA 4IKEA 4MGZR 1PT6A 5AJWA 1P62B 4DAEA 2RHOA 4ZZ3A 4XQ0A 7REQA 3ZJUA 2BV3A 3ZY6A 5IULC 3VH2A 5BN4B 3BZBA 3LP6A 2JANA 3WYAA 1Q95A 1G8HA 3B1ZA 4K2AA 4BNTA 3ICVA 4W8HA 1XMOB 4DWOA 5I45A 2HLPA 1MEJA 2W70A 3Q8XB 2BEKA 2P27A 3AM1A 1BH2A 2D7CA 3LDFA 3U39A 3KUDA 1XKQA 3OE7A 1IRIA 1UWCA 3MD0A 3WK7A 5IYZA 2L17A 3BMCA 3EJ6A 5DSXA 1QHIA 2VXBA 3RJZA 1Z0UA 5LB4A 3KSRA 4NAUA 2H54A 1K88A 2XBUA 3NTOA 4M9XA 2OD9A 5BSUA 1SCQA 2GAFA 1NSYA 2IHYA 1ORWA 3WB0A 4BQFA 5FOQA 5F52A 1O87A 3WYGA 2WF6A 5HMMA 1V1RA 3SBXA 1IWBB 1NR7A 1CG6A 3ZK8A 3RFTA 5GV7A 4HNAB 3SFVA 2WQ7A 4TSRA 5H1YA 5LLSA 4YJDA 3RC3A 4IH1A 4MWTA 1EESA 2JDIA 2ZJ0A 3IXMA 3VR5D 1FTWA 4KPGA 3FD8A 4YMIA 3I34X 3WX0A 5GIPE 4COOA 4LZLA 1R5JA 5EGSA 5KOHB 1BG6A 1OFUX 2ZTMA 3DM5A 3QEMA 4YRKA 3L2OB 4U7DA 5BR1A 2O5EA 3GPCA 5ECYA 1GKUB 1VSTA 5JAUA 1ONSA 1V1MA 4HMQA 2WJPA 5FQOA 3CF4G 1OWOA 2I5PO 1EFHA 1JT2A 3WB9A 1FXUA 2GFHA 4G97A 4O4HA 5ADWA 2QLBA 1H2YA 5HMLA 1W0JA 2WZCA 3JRWA 4C4ZA 1UJCA 3IRVA 3R0VA 3W5DA 4OJMX 5L95A 3FHOA 2WHEA 3LO8A 3WJ7A 3ZWPA 4DKJA 2WHRA 1EFPB 1RFLA 2G1KA 2P9ZA 4DABA 4NENB 3ZE8A 3BH7A 4RPLA 5EMMA 1L7PA 2YICA 3DNFA 2Q3MA 2RB5A 3IJEB 1LNQA 4EYKA 1B26A 2KMLA 1QNFA 1USWA 3LQKA 3PS9A 4TYQA 3OFSA 4XQCA 4E5YA 5MGBA 3I9V6 3CXUA 3GGPA 3Q98A 4EZIA 2O1XA 5AXAA 1WDMA 2VF7A 4PC3A 4QG7A 1AHPA 3WK5A 1AVTA 4Q5IA 5M04A 4KPYA 1DDGA 1FFGA 1RJGA 2QPAA 4WKNA 1I6LA 1SCBA 3GC6A 1P2FA 1CZNA 1I5EA 1NF2A 5HK9A 3EXFB 1SGWA 3GEDA 2I3DA 3E22A 1EK2A 3QEKA 1KJNA 1S3SA 4C0XA 4RHUA 3KT0A 4KIUA 3ZXYA 4UQLA 3WWYA 4N5IX 4ZFNA 2YFYA 1GFZA 3K0CC 3S40A 2RBGA 2GZ2A 3K1JA 3MJDA 4M0EA 4WBNA 2QSZA 3TKYA 3MJHA 3Q72A 2J48A 2BJHA 2JBAA 1EM8B 2QG6A 4E70A 1AKVA 5BW8A 1ITZA 2GUGA 2YCLA 4RZ3A 2FN4A 1E2IA 2L82A 4DR5B 721PA 4OIMA 3W2FA 5JYDA 5HCIA 3LCCA 4CPDA 5CB8A 2WBLC 4MXDA 5KSWB 2V0GA 1VFPA 5I8WA 2DULA 5E2AA 1HH4A 4AZ0B 4JLMA 1GQYA 1Q0SA 2NWQA 2OILA 2QZ9A 3EDQA 4JLAA 4RVSA 3GLIA 2BE7A 1N2BA 2IXEA 3ZW8A 1HEIA 1N6IA 5CIWA 4ND4A 1JAZA 3UCEA 1NQUA 1XE3A 2HV8A 3H1AA 5F4ZA 3T15A 3MTJA 5C8YB 1ZZEA 2A1UA 4POOA 3ZGOA 3X1XA 1Z3IX 3E9YA 4XIFA 1ODIA 1JILA 2CK3D 2HIMA 2E6UX 4I55A 3O94A 1R6XA 4YR7A 4KYUA 3T7RA 4DC1A 4ZCIA 1QWSA 3O2NA 2OSVA 1DJNA 3IXQA 3FNBA 3R5HA 1QANA 1NDQA 5C2JB 3W5BA 1G38A 4WERA 1R6DA 2HWUA 4BKPA 1XNQB 1FLDA 1ZGJA 2BGMA 3OESA 4MUFA 1Y34E 5KYKA 3VV3A 4MQEA 2ISSD 3K30A 3V5NA 2R1TB 2QVCA 2OHJA 4GDMA 4KXNA 2JFFA 2X8JA 3TQFA 3T1HB 3GO4A 4D79A 4WFJA 3I9OA 4TXLA 2OM2A 3M2TA 4BDSA 5B58C 2WE8A 3MWFA 4HLCA 5E6RB 1OE0A 2RBKA 4UC0A 4D8VA 5KEIA 2PGDA 4H1UA 2D0OB 2HHAA 3K4HA 3Q0IA 3K6RA 4EJFA 1MX3A 3ABQB 4WX2B 2H2AA 4C4OA 4BBPA 1C0PA 1P81A 1VGVA 1CX9B 1XLTA 1ZXLA 1U6KA 3MT0A 4NFHA 3FR7A 4ZRNA 3T4EA 2JASA 4BRWA 3B52X 3KZVA 3TX2A 4KXVA 3VSEA 1MC4A 1K06A 2GPWA 1CQXA 1ZW6A 2CFOA 1JE0A 1OW3B 3I32A 3IIMA 4Z9BA 1QH8B 4ZRDA 1R9MA 3I5UA 4C4YA 4F5DA 4W5OA 3GA0A 3CX6A 5EZYB 3DONA 3KNZA 3JQAB 4YA6A 5I47A 3TQQA 1B2LA 4G84A 1DOHA 4BV3A 1U8UA 2Q7XA 1VE9A 4JUBA 2DUNA 4EVRA 3MYYA 3VSAA 2QV0A 1P29A 3KXPA 4KXXA 1IZ8A 5LZ4A 1NKSA 1Y5IA 4DJ5X 2SKDA 3JY6A 3QF4B 3B7PA 1ZN8A 5EN4A 1A9YA 3VPGA 4TX1A 4DA6A 2LTAA 3OLVA 4RGQA 1MX5A 2FZKA 4ITUA 4LJRA 3L1VA 1ZVQA 5K09A 3DLCA 2V6GA 1RXIA 4HX5A 1VLVA 4OXXA 3L7YA 5DCLA 1OT3A 2CFCA 4D97A 4GI1A 5LWQA 2Z1MA 2W2QA 1D04A 3ND6A 4JGGA 4HSEA 5HWSA 3J81k 1DRJA 1U2RA 4OJKA 3BG5A 1OYOA 2UU9B 4DY6A 1SHLA 1YXMA 5DZSA 4WOCA 2J5QA 1L7QA 2H4FA 2JW5A 3G1UA 1PQPA 1UUFA 3UJ6A 3UJHA 4ZJZA 4F4CA 4HQKA 1E5QA 4OQFA 5JU6A 2NTNA 2CDAA 4CMCA 5E38A 2PFGA 4OMFG 2AOVA 5FUMA 2WP8J 5E7MA 1OPRA 3OIUA 4YJFA 3F97A 2GXSA 4KN5A 4KXQA 1LA2A 2EARA 2O8NA 3AG6A 4OYHA 1JA1A 1PK7A 3SHWA 5SY6A 1QHHB 4HTAA 3FVVA 1DRVA 4E88A 1HFJA 3GARA 4OUDA 5KSOA 1U5CA 3FLBA 3P0FA 2YHIA 4KL8S 3M6WA 4W8GA 1NQWA 3MXTA 2BEUB 3J81A 2J9ZB 4G26A 4K5QA 1Q44A 1T3GA 2PN1A 4MYUA 5AXDA 1I3MA 3OIYA 4MWZA 1TZCA 4DEYA 1FTNA 4JBYA 3I23A 2VJDA 1SB8A 2J0VA 1PDOA 1ABBA 4BKUA 2CLLB 1EJ6A 4II7A 4A10A 3SN6A 4ZOQI 4HKTA 1ZS9A 1J70A 1XA3A 2ZJYA 4LFAB 3A28A 5ALZA 4YN3A 4MUHA 3MUEA 1HTBA 4P54A 4F56A 5L3VA 1DRUA 2XCQA 3EY9A 1DV1A 3VH4A 1XZLA 2FSFA 5TRTA 3ITNA 3WGIA 1UBLS 2J9GA 3G0IA 3FPHA 1V9CA 2ZUBA 3X2EA 4BEJA 2FFRA 4PCLA 5IBRA 5K20A 2B34A 4FD3A 1DOAA 1HQKA 5CP8A 3GFOA 2OL4A 4A5OA 3O1LA 3DL2A 4ASUA 1ST2A 4E07A 1RI5A 1SXQA 2ZSBA 2P11A 5FLYA 2XXAA 1TEVA 1IUKA 1O6CA 1JALA 1WPXA 2ZW9A 5LQRA 3THYA 2J3HA 2FOIA 3NAQA 5EXDA 1Q15A 3ITDA 4XUGB 2BMJA 2Q1WA 3DG9A 3RVDA 4P5DA 3ZWKA 4ECAA 5EMJA 5D7NA 5DTMA 2HHLA 2V6MA 5FNVB 4Q21A 1DARA 3GFRA 4OGFA 4FONA 2Q6KA 5GJBA 2P2LA 1JMKC 3G2OA 1FZQA 3DCYA 3ETNA 4FYVA 4G5XA 3RTAA 2H00A 3PCXA 3DS8A 3VC2A 3CTPA 3F6CA 2PH3A 4RZ2A 3LS2A 2HQRA 3SDBA 3M3PA 1VLHA 3I1FA 1KI6A 1ZBQA 1BXGB 2ZTHA 5U1PA 2OA0A 1ICEA 4MVJM 4U6SA 4P84A 3KDPA 2NPFA 4X64B 4XARA 4DMLA 5IWAB 4LFBB 4BS9A 3UYKA 3DPUA 2EL7A 1E5LA 1RT9A 5DMXA 4M8SA 2FPSA 5HQ3B 2HFKA 3IRUA 1W8DA 4YGYA 1GITA 3A1TA 2PJDA 3LBFA 4WK6A 4G9BA 5ALLA 3ZG6A 2QLFA 2WWVD 2D00A 3ANTA 3IELA 2BFEB 3LA6A 4OBEA 4A8TA 1F3OA 4ZDJA 1I3CA 1MRNA 1RJDA 1XMIA 2C5SA 4KQEA 5LNK6 3WSWA 3N7UA 4QUKA 1NE7A 3TNJA 4ON9A 3A2MA 1UT8A 2YL2A 1ZJ5A 4ZCLA 5NLLA 3TRDA 3VNAA 5C9ZA 2B92A 2HA5A 2P79A 2QQFA 3PD1A 3QW4B 4L0DA 3A37A 4UULA 5JO9A 3OPXA 1KGSA 3U16A 1E18A 5K4HA 3NATA 3I3SR 4OVKA 5JDCC 4Q1BA 5IAAA 3GJ8A 2WG0A 3EVEA 2EW1A 4FIZA 3INNA 4IIXA 4L6IA 3UMSA 1FVHA 5EPEA 3L8HA 2RGEA 4FYJA 2FQXA 5CUQA 3IURA 6PFKA 4OL9A 1JH8A 1EJ2A 2C7QA 3B78A 1QONA 1ID1A 1Y8QA 5AI6A 1X7WA 4QULA 1H4TA 1CY4A 1URPA 1XJQA 3LYHA 1D2AA 3NTLA 3OIWA 4PO8A 5A0FA 5KDLA 2UYQA 5ED4A 5M5BA 4MQMA 5FHRA 1HTTA 2R7MA 3NM6B 4IZHA 1PG0A 1I10A 1QB7A 2BH9A 2BF4A 2FPPB 4HP8A 5ERYA 1WLSA 3FPJA 4BMZA 1S8NA 5K6AA 2UUCB 1WMBA 1P74A 1JR3E 3Q6IA 3GJ7A 4QPCA 3IPAA 1DLJA 4LDQA 3ACCA 4XUEA 1D9ZA 3FOCA 4GOOD 4IDGA 1GA4A 2RHMA 1YA4A 4ZOBA 3AJ8A 4H1WA 3BERA 5K0TA 4N41A 3LUCA 2G04A 3AUAA 4K9SA 1PJLA 4H3VA 4MIOA 4ARZA 3PX3A 5CVJA 3DWIA 1P8JA 2BTEA 1J7KA 3F6YA 2WE7A 1C4WA 2GYUA 2HAEA 3VR3D 2CFSA 2W6PA 1A8PA 2DH5A 2QQEA 4UTOA 5B7NA 1PT7A 3WMWA 2ENUA 3QLVA 3CM0A 2ANCA 3RSOA 3CVXA 1ZLXA 1O0SA 3AJ9A 3EVCA 6ADHA 2WTUA 3BFXA 5B7GA 3Q7QA 5HQJA 1DZ3A 3RC2A 5KTRA 4QJ4A 2H1IA 2P2NA 3JXEA 4KO4S 3LUJA 4PHTA 5J43A 2D62A 5A5DA 1E3MA 4MB6A 3R8XA 3G2IA 3OCXA 2VJMB 3FYDA 4PQRA 4Q7EA 5LP6F 4IQ0A 4K9MA 2KLHA 3H1BA 5J59A 3M6FA 3OHMA 4NAVA 2ZWIA 1Y8RA 1Z5OA 3M4ZA 4RK0A 3VMFA 1TQ4A 1CUBA 1J2YA 1CUIA 3GFGA 1UF9A 3CB4A 4PZUA 5IVKA 3VKHA 1R27A 3UW3A 4D44A 4EABA 4OY3A 4L16A 4BVGA 4IYRA 4B84A 1MO5A 3HR8A 5A02A 3P0EA 2GBGA 3C6QA 5EP3A 1Z2NX 5JATA 1ZM4A 1RZRA 1AQLA 1PZNA 4NYMR 4GM4A 4WA8A 1H8HD 4M3NA 5CH5A 3RVBA 3WP0A 2FFHA 1E64A 1CUDA 4ODIA 4J0FA 3LPDA 2GNAA 5COQA 4C2TA 4WY5A 1U3FA 3MWDB 1CUUA 3W7VA 5IM4F 3ZHCA 4EUHA 4QBFA 3PGJA 3KZMA 1FRFS 3SZLA 4CEIA 4QTZA 1CFJA 2QRPA 4EI9A 1UBJS 5JEDA 4FFLA 1XR3A 4EO4A 4LIPD 1K2VN 1TVKB 4R84A 4WFIA 1TU3A 4OCZA 4DDHA 2XITA 1F2UA 1IJKA 1KDOA 1CYEA 3STXA 1KMIY 1N2GA 4IDFA 2C2WA 4YP6A 3KVYA 4LRWA 1P2BA 2PCLA 3B9PA 3LT1A 4IDBA 1GADO 4UU7A 1JG7A 4BE9A 2PL9A 2C3YA 4INAA 1ZG3A 4U9UA 1K0UA 3D59A 1U65A 4UVGA 1L7OA 3FY4A 2FB9A 5TQ0B 3WYEA 3ZNOA 3HPQA 5TX7A 1UEJA 1E2UA 1M6YA 2KLBA 4OSEA 4G1VA 4W5WA 1R8JA 3LFTA 3A06A 4W5HA 1N1DA 3IOBA 5H3CA 4S05A 4PHCA 5SZJA 3IAM6 3OD1A 2BHLA 3M83A 3QBTA 2QTVA 4XX1A 2GK7A 4RXUA 2RARA 3N0WA 3QMWA 3HFJA 3HJAA 1Z2CA 4MS1B 4C08A 1VBFA 1QG4A 4JVSB 1RZUA 1UADA 4LRYA 4LYEA 5TQ2B 1YBVA 2AW5A 3WLFA 4KE9A 1M34A 2IFTA 3OZXA 4HQFA 4QUJA 1XRNA 5H4HA 3SWWA 3ZCUA 4C30A 3WBBA 4BBZA 4N9QA 5B4TA 3FKJA 2GD0A 3KUKA 3WZLA 5JDIA 1TMKA 3KAPA 1PW5A 1RXVA 1FTSA 1PS0A 1WHSB 4IRXA 1KO8A 3AB7A 1OFUA 1TE2A 3FFWA 2PWBA 1O2DA 3FPCA 4DCNA 3F49S 2JLAA 3CURA 4KITB 1G42A 3NT4A 3S0JA 3SK0A 3TI9A 4MMXB 1QIHA 2J6CA 4RTPA 1GZ5A 3K70B 3MF4A 3FSJX 1JFLA 2IA5A 3DEFA 3NR2A 3PUXA 4RA9A 4RDIA 4MYDA 2C2XA 1B74A 1D07A 4TV9B 3E3AA 4IO1A 3AH8A 4X61A 2RHWA 4CF5A 5TSDA 1RWXA 1B73A 8AT1A 1ZN7A 3H42B 2P2CA 1UKYA 2C4NA 1DTEA 1V9SA 3H2GA 3JS5A 3U7IA 3LRPA 2D2XA 1SCUB 3G49A 1IPHA 3B6JA 4GX5A 4O6VA 4ALNA 4BKOA 4CE6A 4CM6A 4KIGA 3UW1A 2UXCB 4U7PB 4L22A 3RBXA 1E9RA 1KXZA 1TOAA 2G06A 4WTOA 5KTNA 5KNCD 3PIIA 4KYIB 3TQHA 1ULTA 1B41A 2HF2A 3AHDA 4IJQA 2D4HA 3N28A 5AW5A 5IKOA 1ZNQO 2YWRA 3VU3A 1BCRB 4R1TA 2QTFA 1W96A 2VT3A 2IOYA 1NUPA 3OJ0A 4OJQA 2XMSA 5REQB 3ZLUA 4KQCA 4G4IA 4HRXA 2OCDA 4DFDA 3M2PA 4D8UA 2EG5A 3FVRA 2GK6A 3WLKX 1X7ZB 4D9EA 5DNAA 3U44B 3HWWA 3DAHA 2EGUA 5E4YA 1KIAA 3EHEA 1CYDA 1RD4A 3GLHA 4HDMB 4V0ME 4XJSA 3QFFA 1Q6ZA 4YJKA 5IUJC 2VKTA 1Y4UA 3IHKA 2JFQA 2OXTA 4L5YA 2A8YA 4OGKA 5K6RA 1WL8A 2IZ0A 2W22A 4J6FA 2OYRA 1N6RA 1R4MB 3F9CA 5H4GA 1L7AA 2XTAA 4MRRA 3WFJA 4U2EA 3LYLA 1G9XA 3S2UA 3HB9A 4ZDIA 1HSZA 4D43A 2EJCA 3GY0A 4EW1A 4ZYTA 3A3YA 4QNMA 5GP1A 4BMNA 2WA2A 2MINA 4TQAA 2V4MA 3U56A 1E3DA 3ENZA 2CJWA 4DR1B 4AY2A 2GEUA 1ATIA 3NDIA 4QSMA 3I04A 4YMWA 2DY1A 4PHFA 4UFNA 1CV2A 3X0DA 3H2YA 1Q0HA 2G67A 1HNWB 4KXYA 1N4DA 5K0LA 2W6JA 2GDJA 1NPYA 3K0EA 4M9RA 1CR6A 4EQZA 3GRYA 3VYTB 2J67A 5KJ6A 1Y63A 3TMAA 5K51A 4MQFB 1YQEA 4NZMA 3HSSA 2G1AA 1PGNA 1EXVA 2EGGA 3S81A 3U09A 2BLLA 2D2IA 3L1KA 5L3QA 2JRCA 2ZB3A 2JGMA 1SA0A 4BBAA 1SUPA 1SG9A 4OJYA 1T3LA 3GGOA 5HRAA 1IXKA 5A4KA 3QYPA 1KEUA 3R2JA 4YRRA 2OD7A 4KFUA 4EKGA 1Q21A 2OUKA 3MXOA 4WLOA 4BFLA 4CLOA 2NUAA 3VPSA 4H08A 3WIBA 4K8RB 5CVUA 4KOEC 3G5TA 4EYEA 2VDJA 3OZTA 5JSHA 4CMHA 4FCTA 1J25A 1L5HA 1GCUA 4BLQA 1K63A 4Q93A 3D7MA 4WSOA 1MV8A 1UC4B 1O8CA 4FB4A 3G17A 2K5UA 3NAGA 4FJ2A 2ZIXA 1ENZA 4JBLA 4L7VA 2G8LA 1EB8A 4M0MA 5T4BA 1M1YB 1PF7E 5BRJA 1O95D 4YCLA 2IH2A 2REQA 3QIVA 3HVKA 5JWOA 2C2HA 4YMHA 2WJYA 5KQMA 2NV0A 2BP7A 1SXPA 2O3RA 2PSFA 3IVCA 3QX9A 3H5VA 4YP9A 4QODA 3CO5A 2Z58A 3CBGA 1YZVA 1SVWA 4UMDA 1GKKA 3JQAD 4Q1DA 3K1YA 3WO1A 1G8FA 4D4LA 3LY7A 4G1MB 4U2DA 5GQSA 4KK3A 1Q7CA 2WJAA 2PBRA 4ZQFA 1KH3A 5DM0A 2PT6A 1D9XA 2QE7D 1NFRA 1V3QE 4ZQGA 2IL1A 3QUBA 3D8SA 4QPPA 2Y4NA 1NX6A 3RC9A 2X6RA 5JECA 2BKLA 2FR8A 3AVWA 1FUUA 1ZIPA 2ZYIA 4ZAGA 1K5HA 2DPMA 2ON6A 1XP8A 2O06A 3L77A 3DHVA 1IUPA 1YKGA 3FOWA 5LP6A 1N77A 4CEHA 3DDZX 3DHNA 3FHJA 1DQSA 1XCPA 2O2HA 2ZIWB 3EVGA 2IXTA 3NDBB 3ICQB 3EFBA 4BUZA 5IJWA 3KX2A 1EFUA 2ZZMA 3JQBA 1BVUA 1N1MA 2OO3A 3WMEA 3HACA 1J1IA 1T2FA 2FQWA 1E6WA 2GPTA 2PX2A 2XNKA 3DEZA 5I9TA 3EUFA 2I71A 2GBLC 3JZMA 3KZOA 3T1YB 4YH1A 3G1TA 4DVJA 1KMQA 1PQUA 3U7JA 1GG8A 5IM4A 4A0GA 3GNLA 2Z5FA 1EEHA 2BHSA 5CA0A 4J3NA 1IHYA 4PANA 3U31A 2ZYVX 3PUHA 5JVDF 4OL0A 5DSTA 3RVPA 1GRRA