2A5DA

Structural basis for the activation of cholera toxin by human arf6-gtp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
163
structure length
163
Chain Sequence
KEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 6
publication title Structural basis for the activation of cholera toxin by human ARF6-GTP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/transferase
total genus 57
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2a5dA00
2R8RA 3FHOA 4POAA 1UEIA 4GP7A 2FSHA 2RKOA 1JJ7A 1CKEA 2C04A 2GVDC 1UKEA 2I4IA 2IW3A 4M9ZA 2GHIA 2QU8A 2JJ8A 2HF8A 3U6BA 3GLIE 4NYIR 1AJEA 1E9FA 1S3GA 4AKHA 3C5HA 1KZGB 2FWRA 4Q66C 1VIYA 4DSNA 1VTKA 4OQNA 1P3JA 1NKSA 3K9NA 3W8RA 3M4YA 3K9HA 1GILA 3GFTA 4LYFA 4TYYA 1KJYA 2OV2A 2CEAA 1OH7A 4DBLC 1G7RA 2FSFA 1IY2A 2BMEA 1BH2A 1T91A 3A4MA 1H8ED 1DOAA 1SKYE 1COWA 1XMIA 4FCVA 4HUQB 5DGXA 1GDDA 4DB4A 1SXJA 3EARA 4EPRA 3TSOA 1F2TA 2KBFA 2WAYA 2ZIAA 3AP3A 3NXSA 1VCOA 4MH0R 4US0R 3OF5A 3LW8A 4JLPA 2ZREA 2R6CA 5FTMA 3UANA 1DVRA 1KK0A 4H1VA 1H8HA 2GESA 2C9YA 4NONA 2PLFA 2BDTA 3Q5DA 1PLKA 1I2MA 1A4RA 3GLIA 1TNDA 1YE8A 2C77A 1NRJB 2H7VA 4URYR 4AKIA 3H86A 4FMBB 4ZDKA 1TF5A 4W9MC 1P2SA 1R0ZA 4F7WA 5FBQB 2AFHE 5J5CA 1G21E 5EP1A 1Z2AA 2N46A 3K9GA 1G291 4PC1A 4M1SA 2PCJA 2WOOA 3NKVA 4JLAA 1NJGA 2PX0A 2ZYVX 1AGRA 4AYTA 2H8KA 4DLZA 3QOFA 1KI8A 3LFUA 3PUZA 4YQFA 1Z28A 2IEZA 4EQ6A 5JI2E 4PPQA 5CM8B 2O8BA 2D2EA 2P67A 1ZAKA 3Q7PA 3QXSA 3ZDQA 4RKFA 2ZR0A 5H70A 3SJCA 4M1WA 4J0QA 1ZUNB 2FOLA 1GOTA 3ECCA 3RDPA 1BIFA 1XDBA 4NPHA 1E9SA 2E9SA 4CGZA 3D8BA 1T8TA 4WBSA 1W4RA 1ZD9A 4OI0A 5CK4A 4I1UA 3OIUA 2ZJZA 1U8YA 3KB1A 5KNDA 1A1VA 3G0HA 1XMVA 4L9WA 4GFDA 1D9XA 2R9VA 3PENA 1XPUA 2VP6A 4WOPA 1L8QA 3LBNA 2ZRDA 1C9KA 2EU8A 2KB0A 2AK2A 2IF0A 1JXMA 4PAMA 2J0SA 3OIYA 2ZRHA 2A5FA 3E70C 4MDEA 3PFIA 2HXYA 3PEVA 3PUXA 3GMTA 1R8SA 1QDEA 1GUAA 4JJKA 2WMOB 4Q18A 1XEXA 2ZANA 1AK2A 5ANRB 4GZLA 1NVUQ 3ZD6A 3SYLA 1JR6A 3AF2A 1SVLA 1XEWY 5UKDA 1YZUA 4B43A 1WF3A 3CX6A 2C95A 3B6EA 3LVRE 4JKIA 3QPUA 2AK3A 1FP7A 4MKGA 2GK7A 4LJ5A 4UJ3A 1M74A 1TTTA 2PLRA 4FMDF 1AIPA 1G8FA 3R7WB 3RABA 1CJVC 1WRBA 4GL2A 4DLUA 1U98A 3LO5A 3VKHA 3GJ5A 1GM5A 1ESNA 4O2RA 4DB2A 5DO9A 5AJXA 2JLUA 2OHFA 3GJ0A 3ZS8A 4AKEA 4B3BA 1CR2A 1N2CE 4AG6A 1OFIA 4DIDA 3RS3A 4HDCA 1R5BA 1YZTA 4BLTA 2C2HA 1F2TB 1W1WA 1GZSA 2FFHA 3AEZA 3CNNA 4BWYA 1W7AA 2A78A 4RZ3A 3KFVA 2Z43A 1DAHA 3DPUA 3BFXA 1VDZA 3OEHA 4L4UA 3SBDA 5JI3E 5JJIA 3ADKA 3QPWA 4GMXA 1FUUA 2Z6VA 1PLJA 3QKUA 4TWZA 2CCGA 1S9HA 2VHTA 1D5CA 2C99A 4C0SA 5JBQA 4TSFD 3UMSA 1KZ7B 3GLIB 2H5EA 4F93B 3OIWA 1ZU4A 4TL6A 3ZVMA 5SZKB 2C5LA 4LWZA 2GBLC 4G5GA 2W2VA 3EASA 1TF2A 4MGZR 1NVXQ 4EJSC 3GLFE 5DI3A 2C03A 1X86B 4Q7KA 4D25A 1G8HA 1RPZA 2BM1A 1FX0A 5CM9C 4LBYA 2CJWB 4D26A 2DFNA 4NYMQ 5J4HA 1SKYB 3MJHA 2ERYA 3WRYC 1EFRD 4L5BA 4ZDJA 5JEEA 4ILEA 3MAAC 4NH0A 3P20A 2WKRA 2ZUBA 2G3YA 3P4YA 4CW7A 4BASA 3LQQA 3U7GA 1W2GA 4OQXA 5KO2A 4KO8A 4PX9A 3Q85A 1M7BA 3EIEA 1FNMA 2B21A 4V0MA 3UMFA 4HI0E 2ZUDA 2BKEA 1G3IA 3A6PC 2OXRA 1U9IA 3SEAA 3X1YA 3G5UA 4TSFA 5G40A 5HKKD 5TB5A 2QTVB 3EPJA 5IT5A 1N6OA 4JT4A 5KSPA 1IJFA 5E7MA 2QTFA 1GL6A 4HYYA 1E2FA 1D6JA 1LFDB 4GT1A 1X8LA 1M1YE 4BEBA 1RZ3A 4E07A 4QC2A 2Q21A 3KXKA 1UPTA 3UWOA 4B3XA 1G8GA 1R0YA 2ODBA 2PZFA 1VKJA 3PCRB 4LDJA 5EXXA 5GJWC 2XJ4A 1Z22A 4IDPA 4BRWA 4RZ2A 1MH1A 2REXB 4RKEA 3RS7A 4BFUA 4D82A 5KSZA 5IRCD 3RLFA 5IK2A 2PH1A 1KSFX 4AWXA 1EFRA 2I1QA 1IAQA 1TAGA 4PC2A 3A36A 2X2FA 1QRAA 5FL7D 4JLNA 2YINC 5EUQB 2ZS7A 1GL7A 3U3MA 2R65A 2GWHA 4IDNA 4A1FA 1WXQA 2YYZA 3AVVA 2JDIA 1EX7A 2MSDB 4M9SA 4LYJA 3AVQA 3IDQA 4GOJA 1T5LA 2DFLA 2HCJB 5BQ5A 3W34A 3FHTA 2HDNB 2QA5A 3CPHA 5HKKA 2GTPA 1N6PA 4JL5A 2NMVA 1L4UA 2Z83A 2FSIA 3CRQA 4HLCA 4XIGS 1Q1ZA 2QMEA 4ZKEA 4FN5A 1XX6A 5FPSA 1Z0DA 3DZDA 4DC9A 1OIXA 1KKMA 3A8TA 2B7CA 3NDPA 3O47A 2WJIA 1Z2CA 1G8PA 3SJBA 4NCJA 1GAJA 1L7VC 1KKLA 1ZNXA 2WJGA 3BFVA 4HZUA 2ZS9A 4HLDA 3SC3A 2AKAB 3TQFA 1R8QA 3BH0A 3BJIC 2VSXA 2HYIC 3CKLA 3TE6A 3W5JA 1DAMA 1FX0B 1KJWA 2AHOA 2ZRCA 1E0KA 4R98A 3L8ZA 4G1UC 1XD2A 4IOJA 1G3QA 3CH5A 5FL7A 2GJSA 3W5IA 5AUPB 2ATXA 3B2EA 4JLMA 2JASA 5G41A 2FNAA 1YR7A 1WA5A 5AWFC 3QF4A 2J46A 3MJRA 1P7CA 1II9A 1XZPA 2DBYA 3MWKA 3NC1C 4FCWA 1NLYA 2JGNA 4KSBA 2VP5A 1W48A 2G0TA 1DARA 1P9NA 4QHTA 3DKVA 3F3YA 5CJPA 4H9GA 4Q01A 3CW2A 1SGWA 3ETLA 3CF6R 1E2JA 4EJSB 3TJZA 3NEJA 3HP1A 1ZIPA 1EX6A 2BHRA 1U0LA 3K0EA 4DUGA 2FDCA 2QM7A 3GLFB 4LYHA 2A5GA 1ELOA 4V0NA 3RRZA 4EPTA 2BM0A 3HDTA 1TUIA 2PL3A 3VKGA 4A8JA 1AA9A 4D80A 2RGBA 1WCV1 3BE4A 4E5UA 1S0UA 1LVGA 5KSOA 4QRHA 1WBDA 1OKKD 3K70C 4YMSA 3ZYCA 1UF9A 2A30A 1UBFA 2NO1A 2QROA 3ZGXA 4EPVA 2QT1A 2R6GA 3KKPA 2QEQA 3KUCA 3TW4A 4BGDA 4JLDA 1NBME 4C0BA 1T0HB 1T9HA 4Q9KA 4IEEA 3KFXA 2G6BA 4MKHA 5DLQC 1TL7C 2Q3FA 1EFHA 3I73A 1N6HA 2H18A 2WPDA 2LKCA 5JZVA 4G5RA 1T3HA 1ZD1A 1IQPA 3ICEA 2ZYTX 3QQ5A 3U7HB 2CVHA 1US8B 5E7IA 2OCAA 3SOPA 3THYA 4BLSA 4LUCA 1LTQA 3GCGA 1G6OA 3QXHA 5J40A 3WMGA 4CEJA 4CDGA 4O25A 4ZIRA 4OBEA 3CRRA 3THXB 4PQFA 2EWWA 4N1AA 1OKKA 3RNLA 4HB3A 3SHFA 1MRSA 2P65A 1ANKA 5AJZA 4KVGA 4ZDWA 1Z6TA 4HZUB 2PEYA 3QEOA 5FBLB 1VG8A 4Q4AA 3TUZC 1B23P 2ONJA 1ZBDA 4EAQA 3U61B 2F6RA 4RD3A 2V9PA 2OCBA 2ZS8A 1XD2B 2BBTA 5L3SB 4P33A 1ZCAA 1OSNA 4W5HA 2QP4A 2DWQA 1YRAA 2BVNA 3BK7A 1JB1A 5CYPA 5J4KA 5TDHA 3MWYW 4KITB 1KI6A 3CO5A 2QI9C 4A15A 1Z0IA 1T3LA 2P3SA 1E2NA 3T06B 4MRVA 2FEOA 5FL3A 2A2ZA 3SU8A 4TMVA 3K0CA 2OBMA 3K0FA 2D06A 4BFXA 1FTNA 1ZNYA 4A2PA 4A2WA 4II7A 3ASZA 3MG9A 1SZPA 4DSOA 1E1RD 3KZ1E 2VHCA 4DCVA 2V1UA 4OHVA 1HE8B 2EYQA 1KK1A 1ZRHA 3B1WA 3I3SR 4LGMA 2OG2A 4I1SA 2F43A 1LF5A 2J59A 5TV2A 2XNDD 4LY6A 5HZHA 1NG9A 1YRBA 4HAWA 1RRGA 1WBBA 2V55B 1S1CA 3N70A 4YLGA 2JLSA 1NKTA 1ETUA 1VECA 5FTKA 2NO6A 1QVAA 1SVWA 1HH4A 3KKOA 4IFBA 3MGCA 3CF2A 4IEIA 1QZXA 1DO2A 2B8TA 1QHYA 3Q72A 3B1VA 2GZDA 4OJKA 3HR7A 5HTKA 4V0OA 4ASUD 4Z54A 1CRPA 2KE5A 2KSQA 3TW8B 4B2LA 1KAGA 1HURA 3TR0A 1NMYA 3ASYA 2QP3A 4EIWA 1KNQA 1QBKC 3SYNA 2IS1A 3BERA 3TK1A 1KYIA 3WMEA 5J4YA 3RRNA 3PV0A 3KKQA 2V6IA 2BEJA 4TLBA 3ADCA 5KUTA 3QVVA 5EE9A 4LJ4A 4JVNA 1IN6A 3S1AA 4BLQA 1Q1EA 4V02A 3P1JA 1A7JA 5FUXA 4LJYA 3THYB 4RCYA 3KKNA 1X8JA 4GBMA 2XNDA 2LCFA 5KPJA 3GEEA 4ZIRB 2NPIA 2WKPA 1LS1A 1T4GA 2EQBA 2ODNA 3KB2A 3ZQJA 2QMUA 4DKXA 3GQBA 5KDOA 3U3JA 2HT6A 4PQYA 4XVUA 5B57C 4Z8XA 2R44A 4F4IA 3PVSA 2IWHA 1ZNWA 1E2PA 2HJVA 4K46A 2O8CA 3A1WA 2NQ2C 4Q4AB 1QG2A 4WIAA 5B58C 1YZKA 1Z63A 3A4NA 1W5TA 4UXJA 3VR5A 2FE4A 3WRXC 2FF7A 4ASUA 1MO5A 2YWFA 1NMXA 3BB3A 4I99A 4BZPA 4IXNA 2P5TB 5J4LA 4JYBA 1G17A 2C96A 4LV6A 3CX7A 2HLDA 2GCOB 5CK5A 3ZJYA 1KI6B 4RD0A 2VPPA 3AB3A 1Z07A 3M1IA 4JMPA 4PSKA 1D2MA 4YMWA 3W3AA 3OEED 2SHKA 4BE7B 3GJ7A 3IIJA 3NVAA 1U81A 4QNRA 1HT1E 1AKEA 2OT3B 3K0FB 3V9PA 2WWWA 1XB2A 3UPUA 1KSGA 1NN1A 3I32A 4JVLA 4C9BA 2IX3A 3AM1A 5LBIA 4NYJQ 2NIPA 2YWHA 1Q3HA 2F43B 2REBA 4LBVA 5J4VA 4JVSB 1PVOA 3GD7A 4TN1A 1E2KA 4ABYA 3M0EA 4QJ5A 5CB8A 4WVFA 2PBRA 2BBSA 1I4DD 3X1WA 4XWOA 3CX8A 3AP2A 5EP2A 4BLOA 3AF0A 3B82A 4LYAA 4CEIA 5IHPA 2XTNA 4YDSA 1E32A 2C98A 1P5ZB 3LBHA 4HDOB 1OXVA 5EJEA 2PMKA 1BKDR 4OI2A 1G64A 2GZAA 4DCUA 1MO3A 4NCHA 4XOIA 1KY3A 4H1UA 2WVJA 3IBYA 3DL0A 3J81k 2RGNA 4M22A 1J70A 4LZZA 2H57A 2ZRNA 2WSMA 5FI0B 2JLYA 5JMTA 1ZJ6A 1N5LA 2R6AA 3JVVA 5LD2C 4JL6A 2N1BA 4YDHB 3I92A 2FGKA 3S1AB 4Z1MD 1XTQA 3U6KA 3T15A 1YR6A 2QORA 2FFQA 4Q4JA 4RCZA 1KSHA 3UWKA 2NGRA 4FWIB 2MSEB 1XCMA 2DFTA 3IQWA 1YKSA 3SYKA 1UBCA 5H68A 5LPNA 1KO8A 1XD8A 2HT1A 4D4MA 1VG0B 1R6BX 4TT3A 1P73A 4Q7MB 2UZIR 1F5NA 4RD1A 4X8LA 3VQTA 3FMPB 1KI9A 3I5XA 5SZHB 2BJWA 4TTRA 4TLCA 3KJEA 3SS8A 1S2MA 4FWTA 1XPRA 1KI3A 2VP4A 4JLOA 3GJXC 3BB4A 4L15A 1LB1B 2VQSA 4KBFA 2GJAA 2ZE8A 3DKPA 1TADA 4KFUA 4LPKA 5HCNA 5L3RA 1OJLA 2JEOA 1OPXA 3R9WA 1I4LD 2Z5FA 5DSZA 5F9FA 1T6NA 4GI7A 3AQ4A 3FFBA 1CBUA 1UKYA 2FFAA 4UNRA 4Z1MA 3FMOB 4PHTA 5FBVB 2KWIA 1X8KA 3VR4A 5JSZA 3AVUA 3R7WA 3SZRA 4TMZA 3PEYA 4K8OA 2ZVPX 2ZR7A 3X1ZA 2J0UB 2P0EA 4URVR 1OH6A 2MSCB 3K0AB 3GLGE 3TGPA 5D3MA 2CCKA 1X1SA 4PHGA 1IBRA 1DE0A 1MV5A 4PC7A 2XZOA 3DEFA 1IOZA 4C0AC 2O5VA 5BYJA 2BKUA 4LHWA 1XEFA 2ZRIA 1R2QA 2RHMA 2CCJA 2FV8A 1E0AA 2ZRKA 1UAAA 4OL0A 1OFTA 1XNJA 4JLBA 3PEWA 3Q9LA 1UADA 4CEIB 2HJGA 2AKYA 4S2EA 5FTNA 2YOFA 4KHZA 2JJ2D 3K8YA 1JAHA 4FIDA 2XZLA 4D0GA 4UNNA 1VCNA 2YC4C 4OI1A 1YJ5A 3UG6A 4B32A 4NMMA 1S3SA 2FMXA 4YONB 4F92B 1GNQA 4YMVA 3SE0A 3DM9B 1GKUB 4B3GA 1E9EA 3LWNA 3L0OA 4FD2A 4RZUA 1XJQA 1XTJA 4C0LA 2C78A 2XITA 2CJWA 2VSFA 4Q1FA 1GIAA 3NEYA 3LLMA 2V6JA 1G18A 1G20E 1R7RA 3KJGA 2CMKA 1U94A 4GNKA 1OV4A 3BRWD 4LBZA 4X8HA 3U3RA 2QUZA 1VCIA 4LBWA 4URWR 5IDVA 5JHHB 5BYKA 1PZNA 1CU1A 1XTSA 4Q4JB 2WWXA 4ZPXA 2Y8EA 2BJVA 3HPQA 1EWQA 1Q21A 1SULA 1Z29A 2CLSA 1KMQA 4QFMA 2QG6A 1M6NA 1SHZA 4XTCS 1ESMA 1VIAA 5CYOA 3VR2A 2Z0MA 1YR9A 2L0XA 3CLVA 1QF9A 4IOMA 1XCGB 4M9QA 4QNMA 4B73A 1UKVY 3PQCA 4CF7A 1Q22A 3BAFA 4TL8A 1W4AA 2OM2A 4QBFA 2J3EA 1XXHE 2JJ2A 3RS5A 2IYWA 5LD2B 3C14C 4P4SA 3OEHD 4OHZA 3CPJB 2ANBA 2JCSA 2VO1A 1HYQA 3KDSE 4JL8A 1G5TA 2YHSA 2ZR9A 2ZYWX 4C3ZA 3QUSA 1G6HA 2QRZA 3DO6A 2IYZA 4DDVA 1J8YF 5C1BA 2WV9A 3FOZA 5BXQC 4RFSB 1ZUIA 1G1MA 2OAP1 3AP1A 1DEKA 4IRUB 1OXUA 3CRMA 4Z51A 4P31A 5DISB 4P3YA 5FBWB 5FI1B 2ZRAA 2PZEA 4B44A 4TMTA 1NL3A 3I62A 3A4LA 1AM4D 3PITA 4UJ5A 4MRPA 5CJ2A 5FTLA 3B9PA 4DZZA 3ZQ6A 2HUPA 2GVZC 2QMOA 1N0WA 1OFHA 5JSZB 3U3KA 5FUVA 1L2TA 1Q20A 4NE2A 2KBEA 2P6NA 3EWAA 4LPSA 5FOWA 3RC3A 4ACBA 1FZQA 1XBTA 2ZSDA 5D3MB 5DHFA 2FEMA 2ZRJA 2W58A 4EKDA 4QHYA 4BRUA 3ICQB 4LRWA 1KDOA 5BW8A 2OILA 3HJNA 2C8VA 2ORIA 1YQTA 2OBNA 4JLKA 3NWJA 2PX3A 4QM6A 2V8OA 4TYPA 2XNSA 3L43A 4FMCB 4L16A 4TQ9A 2ORWA 3T61A 3VU9B 4CT4B 5JRZA 4D2IA 4MQBA 4I1OA 2ZSFA 1XWIA 2CLDX 3AGQA 3FPAA 3RVBA 1CJKC 3AH8A 3REGA 4HB2A 4OHYA 1HT2E 3P27A 2NG1A 3BORA 3C16C 5FOXA 2J7KA 4GZMA 2NPFA 4CRWB 5EUMA 1TQ4A 1R5OA 3V00A 2ZM5A 1M7GA 1TPZA 4TMXA 5FPHA 1IXZA 2RB4A 1GL9B 2ZU6A 4IKEA 4XJXA 1E0SA 1E2GA 1ZU5A 1HUQA 4PSAA 2OSBA 2W6JD 3QJYA 5IK2D 4LC0A 4ZCLA 1JXOA 3AKEA 4LV5B 3EIQA 4M0LA 1HTWA 5JHGB 3NTUA 2H16A 4UNQA 1TUEA 2ZVQX 4V0KA 2Q3MA 4A0RA 3BS4A 4DVGA 4QJ4A 1FL9A 2GBLA 5FR1A 3U44B 4PXAA 4GRAA 2XB4A 3RANA 3TR5A 2EFDB 4EJSA 2OLJA 2JDID 2VA8A 4DCSA 4ZI3A 4N0EA 4Y0VA 4B6EA 3CZQA 5KTYA 3HU2A 2X77A 121PA 1M2OB 3CNOA 3LDAA 3GLFA 2BC9A 3VHXA 2GAOA 4P4SB 5CDFE 2ZAMA 3F8TA 3T1OA 1NVVR 2VBCA 4Q02A 1IN8A 1WMSA 1ZC4A 2W83A 2O8DA 4ZDIA 4IOKA 4FXPA 2J9RA 4O2LA 1GRQA 4NCIA 3NG1A 4Y0AA 2WWIA 3FHCB 3THOA 1KY2A 1P60A 2G77B 1V5WA 4PAQA 4MDFA 4PPGA 1BOFA 2A5DA 2V1XA 5C2JB 2W6JA 3L0SA 4LHXA 4JLVA 1KO7A 1Z5ZA 4N3NA 2QBYA 1U0HC 3EZ9A 1HV8A 1OXXK 3FFAA 1VPLA 3SFVA 5EP4A 4BFYA 2W0MA 2DHRA 5P21A 4IDHA 1MO4A 1CTQA 1YR8A 1DAKA 1XD9A 1ZIOA 5LB4A 1T0JB 1FMLA 4ZKDA 3LRPA 1S8FA 4IDOA 1DG3A 1US8A 2JIZA 1OIWA 2AL7A 2Q9AA 1PV4A 4TL9A 1P9RA 1IN7A 2NTYC 3ADDA 4DJTA 5H1YA 1NP6A 4DUGD 4KLNA 4MGYR 1E96A 3KTAA 4MGIR 5JWHA 2JATA 3AVWA 3TH5A 1GITA 3THXA 3R8CA 1A2KC 3TSZA 4M1MA 3EA0A 3P4XA 4P4UA 3QXCA 3W6OA 4B34A 3M6AA 1W36C 1D2NA 1S1MA 1E0JA 3BFKA 4G5OA 5FTJA 3TRFA 3EZ2A 3AGPA 2B7BA 2R6FA 3WBKA 2Z4SA 2WAXA 1OLOA 3KXIA 1P61B 2ZI7A 5L3SA 2JLZA 2GDJA 3B85A 1UM8A 2J87A 5BWMA 3ADBA 3IHWA 3KUDA 1I2DA 1YU9A 5CIQA 3QY0A 4P0TA 4X8OA 4WA7A 1FQJA 2FX3A 4U7DA 3W3ZB 1UJ2A 1GRRA 1TQ2A 1RVDA 2GETA 3OE7A 2REOA 5TVKA 1WE2A 2B92A 2ZSBA 4HB4A 3A1TA 3T1QA 2DWOA 2HXSA 4R2IA 2ZJYA 3U3OA 2PJRA 4IHQA 1E94E 2WPDD 1W0JD 3LLUA 4KODA 3GFOA 3B1ZA 3Q5EA 2QAGC 1FTSA 3AVYA 2D2FA 4NU0A 3K1JA 2W0SA 1N6LA 4CEHB 1KO4A 1KDPA 1G7SA 3QI2A 4DLVA 3LX8A 3VHLB 3A1UA 1RC8A 4WXPA 3QG1A 3AVPA 3KQLA 1E9RA 3R9IA 4B2IA 2O8DB 2BIFA 3C5CA 4MITA 4BEJA 4AY2A 3IILA 1OW3B 1NBMD 3PUYA 1G3RA 3NBZC 1UKZA 2J0VA 4NCNA 3DVLA 3FE2A 4BLPA 1TF7A 1X1RA 4QOSA 3MSXA 4MRRA 1G16A 2QBYB 2QT0A 3BB1A 5FFMA 3SNHA 3PG5A 1IXSB 1QHSA 4MUAA 2WJYA 5A5GA 4LHYA 5GVSA 3W8NA 1J7KA 3BIFA 4PPFA 4GMDA 4QBHA 1SVKA 2YNMA 1AKYA 2ZU0C 4HEJA 5KDDA 4R7ZA 1W0JA 4TZ6A 4M1TA 2V4ZA 3WBJA 2BEKA 3C8UA 1IN4A 2Q9BA 3GFPA 4DLTA 1UDWA 2WSSD 4CYMA 2RGXA 4XD7D 3VNUA 3KJIA 2BBWA 3LQRA 4Q1EA 1D2EA 4HUTA 3EPHA 521PA 1VYTA 3KTAB 4UKDA 2AR7A 2BMDA 3B60A 3N5CA 1W44A 4CVNA 3ZIAD 4NL4H 2W00A 2VLIA 4KFSA 4GDFA 2NOAA 4MYCA 3X2SA 1NY5A 1NBMA 2ZYUX 4B71A 4QG7A 4YMTA 2UKDA 4KVAA 1JEDA 4LSGA 1KO1A 5KNCA 1DELA 4Q1BA 5EZ5A 2O0KA 3VR6A 4G01B 4HLQB 2J5XA 4Z8YA 4R71A 1AQUA 2F1HA 1CIPA 4PZYA 2C9OA 4W7SA 4C0HA 3RSOA 2F9MA 3QXJA 3B8HA 4DDTA 2FSGA 2IYVA 5AUQA 1GKIA 2CLCX 1F2UA 2P2LA 2G9NA 3ZH9B 5CIWA 4NYMR 5AJWA 2GCOA 1HQYE 4TMWA 3EXAA 3CPEA 1N6KA 1RRCA 2WSSA 5FUYA 3KJHA 3W9YA 1WQ1R 1XZQA 2AXPA 4XD7A 2J41A 2A5JA 5B2ZA 2VRWA 3TLXA 3WP0A 4Q03A 5EE5B 1W36B 1FQKA 4A4DA 4AG5A 5AK0A 3O8BA 1A82A 1E2QA 2FFBA 1ZM9A 2ZI9A 1JALA 3BXZA 2X19A 3QE0A 3LAWA 1HQCA 1RYHA 1N0UA 2ZETA 3ZIAA 2J0QA 4NYIQ 1NG1A 2OFWA 2QP9X 3MCAA 4Q9HA 4BFTA 1W5SA 3F0TA 4FMCF 4LJ8A 1E2EA 2BV3A 5AR1A 1G4AE 2JJ1D 1ZP6A 3IO3A 2V7QA 4OK5A 3D31A 3DDCA 2EFHB 4LHZA 2CE2X 3RC8A 2OESA 2GEVA 1AS0A 2B6HA 3DMNA 5G53C 3VAAA 3SQXA 1KI4A 4WAUA 2FJUA 1RRFA 3AVOA 1OH5A 1MO6A 4B3FX 4IVPA 3MUFA 4IJMA 4R9UC 1FFHA 1RFLA 3QIAA 3GJ4A 3ZS9A 1OB5A 2IUUA 1PUJA 1XRJA 4Q4HB 4LCBA 2ZRPA 2EVWX 4UNPA 2YKGA 4EPYA 1JEEA 3LV8A 4HAVA 3VKWA 2H92A 5KPDA 1TQDA 2C9CA 2HLDD 4QBIA 2CXXA 4PANA 1U8ZA 3UATA 5K8UA 2W2XA 3A58B 3B1YA 3QKSB 5F9HA 1HA3A 1P6XA 5EXTA 3K70B 1Z8FA 1OXSC 4KBGA 3WNDA 4C7OA 2ZSEA 4M21A 1EFTA 4DLRA 2ANCA 2H17A 1VHTA 3NH9A 3NH6A 3THWB 3SHWA 1ZYUA 3SR0A 3CBQA 4OI4A 3RWOA 4ZI2A 3BGWA 1NMZA 5C18A 2JLXA 1E1QD 1ZM3A 3R20A 4BFSA 5E7JA 2JJ1A 1NF3A 1UBEA 3K09C 5JWRA 4C2TA 3K0SA 4AKGA 1XCPA 2RMKA 4KJZA 2WWYA 2IA5A 2I1VB 3K53A 2VF8A 2ZRLA 5AUNB 3ZLJA 2YV5A 3MFYA 4B47A 1D8TA 2O0HA 1VHLA 4LJ9A 4X8MA 2BMFA 2EFEB 4MGKR 1TU3A 2WIBA 1W47A 2ZJAA 4FI3C 3IEVA 5FOTA 3RWMB 4C4PA 1NSTA 1CRQA 2WZQA 1NY6A 4OKSA 1HY3A 2CNWD 4UNSA 4HAUA 3FMIA 4HLUC 4AYWA 3MMPA 1F2UB 1Z0AA 3ZD7A 1U8AA 3EW9A 1GRNA 1XFAA 5HE9A 4DLYA 2CHQA 4F91B 4TQUS 3NHBA 2GXQA 4JZKA 4RD2A 1ZM2A 1E4YA 3CM0A 5E3HA 4DT1B 1ZD8A 4KI0A 5KHOC 2HEIA 3WNCA 2OUKA 3I4LA 4U00A 2W6IA 2IXFA 4M2LA 3L8YA 1VCMA 1E99A 1QHGA 4OQLA 5TMPA 3RS0A 4Q9IA 2OCYC 1I4TD 5G3YA 3SDZA 5KDLA 2J0UA 2IEYA 1E1QA 3K0AA 4L8GA 2HF9A 3TUJC 1TX4B 3DOEA 5L3VA 1Q3TA 5A0FA 1MR3F 3CR7A 1JR3E 2F3RA 4HZIA 4B6FA 3H0KA 4KU4A 3E1SA 1G3UA 1F3OA 3E2IA 1VMAA 4JLJA 5EP3A 3WMFA 4EFLA 4A0GA 4MKFA 1IHUA 3MWJA 2FU5C 4G5SA 2G0NA 1QHNA 2K5UA 4TT3D 2ZE5A 2CNWA 2QY9A 1RRPA 3WNBA 5BN3A 1XPOA 4GOKA 4UXHA 4W5WA 3D6TB 4U5XA 1ZC3A 5BN4A 5FPKA 1E2DA 2CL6X 2GK6A 4IXMA 2XGJA 3GEHA 2ZRGA 4M1OA 1ZM4A 5JFGA 1CR0A 2VHQA 3LVQE 2QGNA 1P4SA 1GKYA 2VF7A 4I81A 4DLWA 3L2OB 4NBSA 4TLDA 3LNCA 1LV7A 2ASEA 4FINA 1RJ9A 1ZINA 4KSCA 2PCLA 2BWJA 1AN0A 3LXRA 4Q48A 4D6PA 4D4LA 4EPWA 1KHTA 4MRNA 4XWKA 1M7HA 4C7OB 4HAZA 1BMFA 4IOLA 4PC3A 2Z4RA 2GXSA 2JLWA 5JS7A 2OFOA 4DDUA 2IK8A 4XTRA 3KKMA 3AF4A 1E98A 1AS2A 2YWGA 2QTHA 3EAQA 3TMKA 3KXLA 3VNVA 1T8UA 4MYHA 2G1KA 4Q5IA 2NO7A 1VG9B 2VP0A 1KOFA 2BCJQ 2GCNA 3QEJA 2BCGY 3HYRA 1T5IA 1IJEA 1SHKA 2ATVA 4PHFA 4KAXA 4OQFA 1RIFA 2P5SA 5JJLA 1KMHB 2YC2C 1O3YA 5D3QA 1OYYA 1K5DA 3EZFA 1N25A 3TQCA 3CNLA 2GF0A 4A9AA 3I61A 1G3MA 1CJTC 1JPJA 4RFSA 3FB4A 1E9DA 2F1IA 3U5ZB 1GNPA 1KI7A 2VH5R 4TYWA 1N6IA 4AK9A 1E69A 3Q7QA 3KQNA 2IUTA 1J2JA 3CH4B 3B13B 1W2HA 4XSHA 1DAIA 2AD1A 1S4QA 4NKRA 3H2YA 3FWYA 4BZQA 1SXJE 3I5YA 4XVRA 1P2TA 5BN5A 3DM5A 3UG7A 2OE2A 4DHEA 4ACAA 4A36A 5JS8A 2VP9A 1SXJC 3TUIC 1NN5A 3MLEA 5L3QB 3KL4A 4LJAA 3KQUA 3T1VA 2KJQA 3QKRA 1LF0A 2J7PA 3GJ6A 4K81B 1G5RA 4E09A 1Z6GA 5L8VA 5GJVC 3N2EA 4C2UA 4TTPA 3A37A 4QKQA 1G5PA 1Z0FA 2D7CA 4HAYA 1Z0KA 5C46F 1XTIA 3C41J 2O0JA 1G8YA 1G4UR 1MKYA 3Q8XB 4US1R 4FCTA 2ZUCA 1OE0A 3VU9A 2D3WA 2ZROA 2QPAA 1XMJA 3NBXX 4NCKA 4ARZA 2LWIA 4BFVA 1CR1A 2PT5A 4HATA 1TU4A 4WZBE 3AKDA 1N5KA 3TAUA 2ZSAA 1R4AA 3BOSA 1JPNA 1EGAA 2CL0X 4OHXA 2IBMA 2QGZA 2O8EA 2F55A 1N3BA 2EW1A 3ND9A 4DDWA 5TARA 1M8PA 1W49A 2GJKA 5B64A 5KSYA 5F3WB 5DHAA 1KK2A 1J99A 4KYIB 3GLGA 1KI2A 2WWFA 3LXXA 2IL1A 1NLFA 1P62B 1K8RA 4ITRC 3RSLA 1E6CA 1RJ9B 3T5DA 1E2LA 1QHXA 1GVNB 2W2TA 3BD9A 3QF7A 2QENA 4RJLA 4DSUA 5F2EA 4A92A 3G82C 2ZI4A 3U60B 1WB9A 4FW9A 4D0NA 1FUKA 1CJUC 3B1XA 5A4JA 1OB2A 3AKYA 5AJYA 1J90A 3WHKA 4GOXA 1F48A 4CT5A 1KDRA 1R0XA 3U44A 5GADl 2QQ0A 2O8FA 1II0A 4JSYA 1H65A 1U0JA 3SJZA 1N6RA 4D81A 1YZLA 1DPFA 4B75A 1Y3AA 3V4RA 3KX2A 4JJZA 1MRNA 3SI7A 1OF1A 4JBYA 2IYXA 2ODEA 1H8EA 3PIRA 2ZE6A 1SVIA 3HYTA 4TYNA 3EWSA 4PR0A 3UMRA 4KFRA 4PFSA 2N42A 1U2RA 2IS2A 2IYQA 1UDXA 3EZ7A 4QGGA 2VL7A 3CONA 2XTZA 3RHFA 1AQYA 1HEIA 4TQAA 3TSWA 1CLUA 2OLKA 4GPTA 5JEDA 4YC7A 4B76A 2YOGA 4OK3A 3WYGA 4PZZA 1XTKA 3AUXA 3CR8A 1N5IA 1CP2A 5FOSA 2D7DA 4M53A 4L9SA 4TLAA 1C1YA 4Q7LA 1Y63A 1DO0A 2GA8A 3WP1B 3PUWA 2NZJA 1G9XA 5SZIA 3T34A 4PAOA 4BUJA 1TEVA 2OXCA 2ZEJA 1KGDA 1TQ6A 1XXHA 2YJTD 4IVRA 3CF0A 3B5JA 1E79D 2BOVA 3FMFA 4JBXA 4OQMA 5LB2A 3QKRB 1OIVA 4DIEA 1CS4C 1E4VA 4NTZA 2VEDA 3WYAA 1GFIA 3FTQA 4NYJR 1EWRA 4PQRA 4KCGA 5CLLA 2R6DA 4QGFA 5GJBA 1KAOA 5JRJA 3T12A 5JCZA 1SQ5A 4G0NA 5AUOB 1EK0A 4V0LA 3RAPR 4ARZB 2VIIA 5JCPA 2DWPA 4BPBA 2IS6A 2DR3A 2F3TA 3FKQA 3QXXA 1FMJA 1K5GA 3CZPA 3BC1A 4C0QC 5FBRB 3ZVRA 2DFKB 221PA 2IYYA 3KQKA 2QE7D 5KU1A 2IF2A 2WJHA 4QHSA 1S9DA 2O8EB 4IFEA 1KJZA 1SXJB 4QGHA 1YVDA 2GZHA 2RHDA 2XOKD 5FPTA 3H84A 3GLGB 4M8NE 4AD8A 1SVMA 2IXGA 3Q3JB 2XTMA 3UXMA 4Q1AA 3PEUA 4RSGA 2RGEA 3RYTC 4V0ME 4DLSA 1AGPA 1SKQA 4CIDA 4DSTA 1DBSA 3QENA 4HDQB 3EX7C 4A0HA 1YZNA 1IXRC 1E79A 4C30A 4DEYA 1FPMA 3IKJA 3A1VA 1W46A 4TTQA 1U99A 4A82A 2WKQA 3MWLA 2RAPA 3LY5A 2JLVA 4U02A 3L0PA 1E3MA 1JAIA 4HSEA 1U9IC 8OHMA 2O8FB 4TL7A 4Q47A 3QNUA 3IPYA 1JNYA 4RZXA 1DS6A 1OYWA 2XX3A 1OFUX 3CRW1 5ELXA 2NO9A 4EPXA 1MOZA 1N6NA 3T5GA 4CEHA 2WTUA 2GJ8A 3FYHA 4LHVA 4EQ6B 2JIZD 2WOJA 2XJ9A 1D9ZA 1OT3A 2ZQ5A 3VX4A 3T1TA 2O8BB 4BFZA 4JS0A 3X1DA 2QE7A 2ZJ8A 3PUVA 2MMGA 1IY0A 3O8RA 1X3SA 4PO1A 1SVOA 3IPXA 1IN5A 5HPYB 2WHXA 2GAAA 4P32A 1WDTA 1R5NA 5F98A 3UIEA 4EFMA 2XOKA 3I8SA 2YOHA 1JJVA 2RGDA 5TY0A 2WM9B 6Q21A 2WICA 1KK3A 4OYHA 2IYUA 2IYTA 1S96A 4PHHA 5J47A 3L0IB 2O52A 1CXZA 3UK6A 3ND8A 5EQTA 2ZI3A 1TEXA 2ZPTX 2EYUA 1E9BA 1NNEA 4OJQA 2Q3HA 4WW0A 1CF4A 2QRNA 2OCPA 1YHNA 2NO0A 1IY1A 1DAGA 2XAUA 4BECA 4URZR 5FPYA 1XEXB 2DB3A 4MKIA 1A5TA 3WXMA 3B7GA 3BWDD 1XXHB 3ZVNA 1CR4A 3EG5A 3OE7D 2CBZA 2WIAA 3LH5A 3VTKA 2GKSA 3AVXA 5CDFA 2Q6TA 3MRSA 3EC2A 2D74A 4ZCIA 3HR8A 2QL6A 1K6MA 4JT2A 1DAFA 4N0DA 2XXAA 2F1JA 1NIPA 1W36D 1MABA 3IEUA 3CIOA 1V43A 3HU1A 4LX0A 2J45A 4NHOA 4RD4A 2ZXUA 2GCPA 4WZ6A 2P6UA 4NP6A 1L4YA 1AS3A 1ZM7A 4O0MA 3VR1A 3X1XA 4KLZA 2BMJA 3REFA 2RCNA 2QQEA 1U90A 1E2HA 4EDHA 2G88A 4ZV4A 4RD6A 5DYIA 3IBGA 3RS2A 5FOVA 3SFZA 5GVRA 4URUR 3TVTA 3FDIA 4IDQA 1Z08A 1XJCA 3O8CA 3A1SA 4W5JA 2AN9A 3W90A 3C7KA 4F4JA 1Q57A 4BFWA 3ZZTA 4PPNA 2X2EA 3GEIA 3OAAD 4Q9JA 3V4FA 4YMUA 4EUNA 4B74A 4DCTA 5K8IA 1XMSA 1FP6A 4MA4A 2WMNB 4JVMA 4MYUA 4NZYA 2G1JA 4KXFB 3N2IA 2VP2A 1Z6YA 2FPLA 5DI3B 3UKDA 5C4MA 1MT0A 2ZITA 2F9LA 3FGNA 2ZI6A 1ONBA 5AJVB 4WZAE 2IS4A 2GXUA 2ODWA 4NDZA 2IYLD 3P32A 3T35A 3TVDA 3EIHA 5DH9A 2FGJA 3P26A 1JECA 4US2R 4LJ6A 1NLZA 3I72A 5HZKA 3K70D 1LY1A 2EWVA 2VHUA 3TIFA 4A8JC 2ZJBA 5IF9A 5KNBA 4XH9B 3JZAA 3GJ3A 5DYGA 3AF1A 4OK6A 2WJJA 4GSYA 3OIVA 5KYKA 1G7TA 2I3BA 5CB6A 1QG4A 1NN3A 5TXGA 2R62A 5EE0A 3RRYA 2VSOA 4DXAA 4CZ2A 2IHBA 4TZ0A 1P2UA 3TKLA 4QM7A 2F7SA 4LOAA 2DPXA 2XSZD 1CEEA 2NZ8A 2ZI5A 5HR5A 2QAGA 2LKDA 3OAAA 1NJFA 2WJVA 1PLLA 1BS1A 4Q4HA 5JWOA 4A6XA 2GILA 1FW6A 3HU3A 3HPRA 1B0UA 1Q0UA 3OHMA 2QMHA 2XZPA 4XSGA 1VG1A 3U2QA 4F4CA 2QZ4A 4GP6A 1KI1A 4Q9LA 3QKSA 3QKTA 4LJ7A 2CHGA 3JZMA 2AX4A 3U7EB 1ODFA 1F60A 2ZRBA 4M4SA 3LX5A 4ESVA 3B78A 3WYFA 5JJKA 2OO7A 2FH5B 3K9LA 1W0KD 3THWA 2XXAB 3GLHE 1OXTA 1ZMXA 5HCIA 4DEXA 1MABB 2ZTSA 4YXWD 3LBIA 5DN6D 3QSYA 1EFCA 2V3CC 1XEWX 3SN6A 4BZXA 5G3ZA 3U4QA 1RYFA 1P75A 1E9AA 2GNOA 3ONWA 2CK3D 5E95A 5K8TA 1Z0JA 5M04A 5FH9A 2JLQA 2XSZA 1A2BA 2FPMA 3AF3A 4P4TA 2V7QD 4JKYA 2ZE7A 3FKSD 2QSYA 1N5JA 5DE3A 1KNXA 4TYQA 2PT7A 2FZ4A 1QHHA 3ZVLA 3CWZA 1ZVQA 4AI6A 5SZJA 1G19A 1PJRA 4JSTA 4B3DA 2VHJA 2GF9A 2YVUA 5CLQA 3RS4A 2CE7A 2ZAOA 4ON9A 1RKBA 3EPKA 4AURA 2X8AA 3EC1A 3O8DA 2V54A 1UFQA 5EE3A 3C15C 2PMDA 3GLHA 4DT1A 1ZCBA 3K0CC 2XB2A 1GG2A 3PJRA 1RE0A 4BLRA 4DWJA 4E03A 2B8WA 1W0KA 3RRMA 4PSVA 4RY2A 4YXWA 4QJ3A 5DN6A 1QHIA 1Z3IX 3CB4A 1Z83A 3IUYA 2IWRA 1VYVA 1LW7A 2IUSA 1NIJA 1II8A 1X6VA 3QF4B 4A0FA 821PA 1AZSC 3LD9A 1R0WA 4I1VA 3D3QA 5DNYB 1JBKA 1GTVA 4AYXA 1NSFA 1RW4A 2CK3A 3IO5A 621PA 3KQHA 3C4JA 2EFGA 3SQWA 4OHWA 4IVQA 4A2QA 4C0KA 3NIBA 3HWSA 1DAEA 1E9CA 5JLJA 2QAJA 4JBWA 3EPLA 2IXEA 1IM2A 4A6PA 4ZCMA 1EG7A 4Q1DA 2IT1A 3FKSA 4PZLA 2FA9A 1C4OA 1NI3A 2OEPA 4MUBA 721PA 2OFXA 3OZXA 1KIMA 1DG1G 3IIMA 1EXMA 4ERNA 1BYUA 2P6RA 3R8FA 421PA 2QAGB 3B9QA 4LV8B 3QBVA 2IHYA 3FVQA 3DMDA 2YWEA 4B35A 3GPLA 2ZJ5A 2ZRMA 3I8XA 2VTKA 2YZ2A 4PC6A 3LW7A 4A8JB 2ZRFA 3NBFA 3QBTA 4Q4LA 1NVWQ 4I4LA 3H1TA 4BQSA 2FPKA 4V03A 4AIIA 3MD0A 5FUWA 3BBPA 3SJAA 1E2MA 2EFCB 4PO8A 1Q12A 4PTLA 4R2HA 2DY1A 3IQXA 2IC5A 1KSJA 1LS6A 3QPVA 4G5QA 3VX3A 1E2IA 5HE8A 2QPTA 2W6ID 4XVQA 4LC1A 3AVTA 4QXAA 3W6PA 1OH8A 2ZJOA 5C4GB 1TMKA 1UBGA 1N0VC 1Z06A 4Q1CA 4HB0A 3TBKA 2UZ3A 1GSIA 3BH6A 5EZ6B 3LA6A 4DCNA 4JYCA 2GXAA 3U4QB 4FMDB 2FG5A 2VYFA 1JQJC 2GRJA 5DIFA 2AD5A 1QVRA 2KI5A 3DHWC 3QG5A 5EXSA 2ZJ2A 1E1RA 2G83A 1OHHD 1F6BA 3D7MA 3I1FA 1SVSA 1Z47A 1AZTA 2Q9CA 1KMHA 4TMKA 3AUYA 2RGCA 3IGFA 3WHLA 1XJ0A 1R10A 1QHHB 4CEJB 1LNZA 1Z6XA 3TAHA 4WXRA 3NHAA 4QL3A 1XTRA 2ERXA 3PXGA 3U7FB 1IONA 3F5FA 4QGAA 3AV0B 4HAXA 3K09A 3JVUA 2PJZA 3GLHB 1GWNA 2D4HA 2HYDA 3H4MA 3WY9A 2CL7X 2CHVA 2XEXA 2F1RA 1T3SA 2H1LA 4LI0A 2RH5A 5FR2A 3CRVA 2JLRA 4JIMA 2IYSA 5LDDC 4LK2A 1JR3D 1II8B 3TNFA 5L3QA 5KOYA 1EFUA 1BMFD 2GJ9A 2DCUA 3OFND 3PR1A 1UEJA 3BH7A 4HLUA 4AC9A 4F38A 2WBLC 5GJCA 4B2PA 3NBYC 4D4JA 1OHHA 2QM8A 4B33A 1JI0A 2FN4A 3GJ8A 3DZ8A 3SBEA 1PUIA 3OESA 2BBOA 2PZGA 2QNRA 4ZO4A 4IW3B 3E5HA 2WWGA 4XWAA 1YZQA 1Q1QA 2AWNA 2AWOA 2E87A 2OBLA 2X1VA 5B30A 4TLEA 1XU4A 4D4KA 1WP9A 2GEDA 3CWQA 4MRSA 1ZUHA 2RGNC 1KTVA 4HUQA 1W4BA 1Q1BA 2WWHA 2MMCA 2HCBA 4B48A 1YZGA 2A3RA 1FNNA 4D0LB 2QSZA 4KYUA 3R9XA 1W4CA 5EXPA 4EFNA 1XP8A 2ORVA 2JAQA 1M34E 1Q44A 4M1YA 5FOUA 1DADA 2ONKA 2QPOA 5E4FA 1P9WA 2AXNA 3L82B 3EZ6A 2FZLA 5DI9A 4RVCA 3W6NA 3DOFA 1JR3A 4QBGB 3VR3A 1ZNZA 3ZZUA 3NDBB 1KDTA 1P72A 4DLXA 1P2VA 1HE1C 5K8LA 2ECKA 3OFNA 2D62A 1VYUA 2J1LA 1KO5A 1G7CA 4O3MA 1XF9A 3IIKA 3GP8A 1NN0A 4S35A 3OEEA 4MYTA 4Q7JB 5EE1A 2PEZA 1GP2A 4UXIA 2GEUA 1CJMA 4PO9A 2J7PD 1J8MF 1BO6A 2R2AA 4M9XA 5JECA 4Q00A 3IHLA 4E22A 3QVUA 2UVQA 1GNRA 3CUEF 4Q21A 1Z6AA 4KV9A 3EA5A 4UQOA 1DTSA 1O87A 2TMKA 4Q19A 2CVFA 2DYKA 2IYRA 2QN6A 4ESHA 4URXR 1CULC 3ZZ0A 4RFVA 2RGGA 4G3XA 1JQLB 3AKCA 2OAQ1 2RGAA 3NC0C 4DRZA 1COWD 1FOEB 1SXJD 2A5YB 2CDNA 2JA1A 4B3CA 3VFDA 5CITA 1NVVQ 2O8CB 2HV8A 2A7QA 2E1RA 2A9KA 2OZEA 2AFIE 1G41A 4KFTA 4M1KA 1H8HD 1ZW6A 5H8WA 2Q0HA 1EESA 4C0JA 3VMFA 1BYIA
chains in the Genus database with same CATH superfamily
2XMCA 1E92A 5C51B 1GQYA 4C30A 2C04A 2IW3A 5CB4A 2I4IA 1RRMA 4HTFA 3GLIE 3HJUA 1E5TA 4JZYA 3SC6A 2DG2A 3OD5A 1PTKA 4YRNA 3ENZA 3U6BA 5IM4F 4ZP1A 3HCCA 4JJFA 5H5JA 4RF3A 2O1EA 2QVCA 3C5HA 2GYWA 3BPSA 3I83A 3ROQA 4F8EA 4DSNA 1VIYA 3ZZMA 2ZBPA 3BDAA 4RK4A 3RJZA 3C43A 3UJ7A 3K9NA 2AN1A 2GR9A 4CFYA 4NXMB 3ZKWA 1EK1A 4W8OA 4J0KA 4G8BA 1KJYA 2CEAA 4ZQIA 1G7RA 3FMGA 4ZOLF 1UMBA 4L1KA 1CVIA 1BH2A 2ES4A 4R31A 4Z9BA 3C39A 3C74A 3PHBE 1COWA 1XMIA 2RHBA 1SCAA 2IPNA 1GDDA 4HUQB 4MW7A 1YIAA 4C4RA 4EG7A 3U4CA 4FU0A 1RAAA 2EGUA 1JZQA 3ICOA 3T5PA 1VCOA 2SECE 4JC4A 5C3UA 4NENA 3PVCA 4Y2JA 1B0AA 2ZREA 1YOBA 5CVJA 4H1VA 3W78A 2G40A 3CEJA 4NONA 2PLFA 2GD1O 4WESA 1KVQA 1DOZA 4LY9A 2PUDA 4MLDA 2DECA 1JTFA 3HVRA 1TNDA 1YE8A 2O3RA 2C77A 4IHJA 3ZW9A 2H7VA 1TVKA 3AHGA 3I2FA 3H86A 4ZDKA 4U2KA 4PN3A 5IXSA 2H0AA 1P2SA 1XAIA 3ZNPA 2NT3A 1NW9B 1R0ZA 3GXBA 4JWKA 5FBQB 3PQ5A 2GWRA 4AN0A 4YY3B 5D85A 3NWEA 1Z2AA 5EP1A 1H2EA 1WOYA 2LP4Y 4PC1A 2E1PA 1R9JA 2JNWA 1VJDA 3NKVA 4M1SA 2PX0A 3WNZA 3QVTA 2H8KA 4AYTA 4DLZA 1OFUA 1KI8A 4K2HA 2GD6A 1Y6JA 2C4NA 3JATB 2IEZA 1ZIDA 3IQEA 4ER5A 5JI2E 2HNKA 2Y1DA 1PVVA 3RHZA 1IXYA 1N5OX 4BEWA 2O8BA 1QIKA 1ZHHA 3ZG6A 5F4BA 3PJRA 3CLUC 3ZDQA 3ZBUA 3NAQA 3K9FC 5H70A 2WI8A 4GM4A 2V74B 4RVUA 5H80A 3UANA 1GOTA 3RDPA 5IWAB 3WGZA 1SOWA 2E9SA 5JNTA 3D8BA 1R3DA 2B25A 3B3GA 3C8DA 4OP3A 4PZ9A 3FAKA 4WBSA 5J2TF 4MKZA 5CDTA 2RCYA 2X1MA 4OI0A 1LVUA 3DL7A 5JZSA 3KB1A 4IJ6A 4DLKA 3G0HA 4LQLA 4OLAA 1D9XA 2R9VA 2NO5A 3BJZA 2O7RA 3PENA 4JOCA 5IH3A 3AYZB 2WB2A 4NF2A 4OQDA 3TTTA 5BY2A 1C9KA 2EU8A 2PA3A 3WB2A 3QLVC 2IF0A 4PAMA 3I4FA 2W6ZA 3KOWA 3NHJA 2L17A 4FMPA 1RQPA 4QUBA 4R3NA 3MFQA 1JDSA 3MWDB 2O20A 3N07A 3PUXA 4AM8A 4EG0A 1R8SA 4Z99A 1QDEA 4BX3A 4JJKA 2WMOB 4Q18A 4YK7A 4PX2A 5ANRB 1SG0A 3GCZA 1HTTA 5CT4A 3SYLA 6GPBA 4Q6BA 3AF2A 5FUMA 2IHVA 4HGPA 2LTAA 3E61A 3R3VA 3JWGA 1XEWY 4B43A 2W8ZA 3TIGA 3CX6A 4YRPA 5K03A 3LVRE 4R54A 2FZWA 5KVQA 2CN1A 3WDKA 1TUGA 1PVDA 3AJ8A 2OBYA 3HS3A 2XNJA 4ZHQF 4NU8X 1LPBB 1ADGA 2GK7A 4MWZA 4UJ3A 1KFBB 1U2PA 4MW5A 4P9NA 4JOBA 4URHA 5DZSA 2R7KA 4FMDF 4LNAA 1G8FA 3R7WB 1CJVC 2JRLA 4DLUA 1UIMA 3VKHA 4UC0A 3GJ5A 5AOCA 4C5CA 4DB2A 2HQSA 4NFLA 4O2RA 4KRFA 2FSVA 1UMBB 3G0CA 1O57A 3GJ0A 4WECA 4B3BA 5K3SA 4OO3A 2FCAA 3W2EA 1N2CE 1PZGA 4KIWA 4CF6A 4BQFA 1XLVA 1R5BA 1YZTA 2P5UA 1ZHOA 1RQ7A 1W1WA 4WNAA 1ONNA 1POWA 3AEZA 3CNNA 3D7SA 5JQGA 1L9KA 1XQVA 3HJCA 2A78A 4IDEA 5C1IA 4Y18A 5ALJA 5D7NA 3EDQA 2Z43A 3OEHA 3K0BA 2WWRA 4L4UA 3SBDA 1HE2A 2QGFA 2PMFA 3ADKA 1H5UA 3JASA 4GMXA 4TV9B 4Z4FA 1NP7A 3LHKA 1FBNA 3CMMA 2HWWA 1S9HA 4FS8A 4YAOA 2C99A 2IELA 2RG1A 3BILA 3KR2A 5JBQA 3G9XA 2HLNA 3CNHA 3G2NA 4OGGA 4PGHA 5B55A 1PNRA 1KYTA 3SJUA 4EB8A 1ZU4A 4YMGA 6LDHA 1OD6A 2I7XA 3GDGA 1Q19A 5ETJA 4RQUA 2GBLC 1Z4JA 2W2VA 4B6OA 4EHHA 2GERA 1CYEA 2OR3A 2GPAA 2R6R1 3KZXA 2CVOA 1ID1A 4FOOA 4R8VA 1HRDA 1JAZA 1MNQA 3CO0S 3LOUA 4KXWA 4BNMA 2P69A 1GTSA 4D25A 1A5BB 1V6AA 1WXXA 1Y6GA 5TIIA 3NRCA 1GR0A 4KXYA 2QM0A 1MVOA 1Z7WA 4F2GA 1KY4A 4EP1A 3VDQA 2DFNA 2XD4A 3NAZA 4Y8VA 3RVPA 1C4XA 5HKBA 5H16A 5FLEX 3WRYC 3W05A 3PFHA 2D5AA 3ZGLA 2Z8YA 4XFJA 3HBMA 4ZDJA 3CYFA 4QBKA 1EIZA 3WL7A 3TSYA 1W0CA 4AS3A 1YJCA 1LLQA 4W6QA 4X1KA 1XJWA 4EY8A 5ITZB 1ZX1A 3KT8A 1Y7TA 1XKQA 3ER6A 2NUAB 3I6YA 3P9CA 2D5IA 2B21A 2HDWA 2UUBB 3WQSB 4C08A 3TRIA 1JZSA 3GVIA 4NBVA 1B8OA 4ECEA 1EVLA 5EMLA 3T1YB 1PFKA 3EBLA 4G1MB 4AZ0A 3FW1A 1J1IA 2BGTA 3VA7A 1N6OA 2H4ZA 4F2DA 3PQFA 3HV0A 4JT4A 3ORSA 4QVKA 5KSPA 3D6HA 3P0IA 3RS9A 3HB9A 3FNIA 2H07A 2I8CA 3GBVA 2Z95A 1DDOA 4R1QA 3V42A 2RD2A 1L7QA 3WSVA 3ZPXA 4ZMBA 3S81A 5IKXA 2Q4DA 1FCJA 1M1YE 2D2VA 3FNRA 3W4IA 3EY4A 2Q21A 3KXKA 1UPTA 4EUEA 5F2NA 2VTEA 4DJEC 1DT3A 2X23A 3UTDA 2PGJA 1YIOA 4QPNA 4Z6KA 1CZKA 5IJ0B 4D82A 1ESEA 5ERGB 1ABFA 4FQ7A 2YUTA 3QV1A 4G26A 3GFVA 4G1VA 4PQEA 3TZHA 1KSFX 1K0FA 4KQGA 1UBSB 3LPAA 1EFRA 2I1QA 4P6VF 4RADA 4Z0HO 2ZLBA 3E9DA 3E35A 5IM4A 1A8SA 1DSSG 1AY0A 4Y6GB 2HOQA 3QE3A 1F7VA 2ZS7A 4LWPA 4EYQA 3OT1A 1GL7A 4MHTA 4V3BA 3D8HA 1K88A 3A2LA 2VC2B 4JXJA 4ER3A 3GZTB 1EFVA 3T1NA 3AVVA 4W5QA 4JGGA 4E5SA 2YCLA 1HLDA 4OTZA 5LMZA 4E94A 4AMVA 2CKMA 1VKHA 4PTZA 4ZOLA 3IDQA 5A1TA 1PG5A 4GOJA 4V39A 1VLJA 1C4KA 1T5LA 4WNAB 5BQ5A 5GV8A 5LZ8A 2PJDA 2HDNB 2QA5A 3B1JA 2GHQA 3CPHA 4L51A 2GTPA 5HKKA 5KTOA 5L7TA 1RPTA 3I53A 1S6YA 1AXEA 3F4LA 1FFYA 2FSIA 5DHRA 4YCSA 2HPAA 4DRXA 5BUCA 3JYQA 2BMAA 4FNGA 4B09A 2EG5A 4CFSA 1KKMA 1W88B 2FMKA 2C8KA 3HO1A 2VDUE 4B9AA 1Z2CA 3RTAA 4DNFA 4OQEA 3SJBA 1L7VC 1KKLA 1PZHA 5ESDA 1XRPA 1H6DA 1XDZA 1Z73A 3V8MA 1R8QA 3BH0A 4KO4S 3BJIC 1XQ1A 3WA6A 2VSXA 3CKLA 4JUDX 3W5JA 2OGZA 2AI2A 5H83A 4ZTZB 2R1UA 1FVHA 4KWIA 2PGDA 5ILGA 4EO4A 1IQ0A 4R98A 1DC3A 4ENWA 5CXUA 4IOJA 3CW9A 5KWIA 1LGYA 1G3QA 2KHZA 2OK8A 2GJSA 2QF7A 3CH5A 3NC4A 3VXKA 2ATXA 3LRXA 5G41A 1V9SA 3V7WA 4Z9FA 2IHTA 4H0NA 1NPTO 3G8BA 1SUCA 4S1PA 3QF4A 2J46A 3OZBA 1FRZA 1YL6A 2LR0A 1K06A 4FCWA 4KSBA 3SC2B 5TT1A 2H9IA 3GAAA 2G0TA 2YJ6A 3O0DA 1DARA 2V7BA 2WDZA 4QHTA 2XYVA 5CJPA 5AICA 3FYSA 4X1KB 3RUHA 5MGBA 2Q1YA 4LW8A 1QCZA 1X74A 2Z2XA 4DPKA 5T67A 1J5PA 3VO9A 3BA6A 2GZRA 1TJNA 3TJZA 2ID9A 3A9WA 1EDDA 2P7HA 3NEJA 1ZIPA 2OZLB 2L82A 4H27A 4HL6A 2XUHA 4P3PA 2L19A 4XGRA 5LWHA 3OMWA 2FDCA 1YFZA 3NEAA 1MO2A 2MDTA 3NBQA 2QM7A 3GLFB 3UWMA 4RTLA 5DF1A 5I9IA 4B2YA 3CR3C 3ZHUA 4I1YA 4MUMA 5BURA 3FKJA 4Z9YA 2JBHA 4A8JA 4D3YA 1LQ2A 1I51A 1OWLA 4ESOA 4XA8A 1DQSA 2CW5A 3WQRA 2PBLA 4LF6B 2X4GA 3R77A 5JH7A 5DTJA 4UMEA 1MX3A 1L5SA 2A30A 2GLXA 1BCSA 2NO1A 4MIYA 5EKDA 3ZGXA 4XZ3A 4EPVA 2QT1A 2R6GA 3G8AA 2BR3A 3CKYA 1SUDA 1USUA 3GCWA 3ZCPA 3F73A 2JB9A 5I7UA 3OLWA 5EJAA 4JI8B 1UJ6A 5B5SA 2VTBA 2JFWA 1K7SN 1DNPA 1T9HA 2VDRB 1QIIA 3AHJA 2QR2A 3DP7A 3FIUA 3GUZA 3JQPA 4S1OA 5DU2A 5BV7A 4H1TA 4QJIA 3Q7EA 5EQFA 4MKHA 4ZHQA 3C7DB 3V6MA 2VWHA 1N6HA 3ESQA 1C8LA 3K4QA 3IYLW 1EWVA 4YALA 3D43A 4M0PA 5KKAA 3R75A 3BEOA 1JKMA 1VLVA 1B0PA 2GK3A 2PV0A 1IQPA 1DT5A 4ZOLB 3VMMA 2VXBA 4QVGA 5K4AA 3ZXUB 4BN5A 4C4XA 4OPMA 3THYA 1D8AA 2GKOA 3KUXA 5AHWA 3BXHA 1P8JA 1EK5A 3H5LA 3RG2A 1F8XA 4UASA 3IR7A 4N8EA 4LYGA 4P0QB 4FJ2A 4BCBA 1WKBA 3GC6A 4JX9A 4R83A 2HFJA 3KVNA 3NOQA 4QSHA 4UVIA 1Z7YA 2YQZA 4OBEA 3PX2A 1JIUA 5EPEA 1N57A 3P2KA 2PKYX 3HLKA 3SHFA 1MRSA 2G9RA 1ANKA 1YA4A 2Q99A 2IW1A 3GFSA 3PFCA 1U9CA 4ZCQA 5HP4A 3ZIUA 1OU0A 3E23A 3CZMA 3B2NA 3G2PA 2PEYA 5FBLB 4FSDA 1JDJA 3ZE7A 2ONJA 1ZBDA 2Z5VA 4YCMA 5HIMA 1XAJA 4D0RA 2F6RA 2DEUA 2MCFA 1UBKS 1NNLA 2OCBA 4Z4GA 1YOVA 5ALKA 1ZCAA 3WIUA 4ISBA 1EXNA 4W5HA 1IB0A 3WYEA 1QF7A 3UB2A 1YK0A 1IBLB 3D7NA 1Y6QA 1FRQA 4QOEA 4E14A 4CMIB 4UHEA 2IOQA 2PTHA 1T2AA 3MCVA 1WB5A 2FQ1A 5ICSA 3WBFA 1T3LA 1E2NA 4R2JA 1FTWA 4KZKA 5FL3A 2H2FA 4ALMA 4D9IA 2Y93A 4WK6A 5DSTA 1LTHR 3OIDA 1WU8A 3COZA 5THQA 4A27A 4BFXA 5IASA 1AGNA 1Z4LA 2B6NA 2I7CA 3DKIA 3MG9A 4JELA 3TNJA 3KZ1E 2C8LA 4ZT2A 3WIEA 2D54A 1AO3A 3QMPA 4ENPA 2EYQA 4D5GA 3KQMA 3U9TA 5J2TB 2DH5A 3LQ1A 4HADA 5C8YB 3V33A 3I3SR 4QXOA 5FQOA 2EAUA 2CLMB 3UMVA 2OG2A 4I1SA 2F43A 1LF5A 2GA9A 3S4YA 4BMCA 1N33B 5HX7A 1A0OA 4N8SA 4O08A 5L4SA 2V6BA 5TE9A 3MTJA 3YASA 3HK2A 3TLEA 3HFGA 3IIEA 1WBBA 4O2BB 4KR6A 1WL8A 4ZZ2A 4DG8A 1ETUA 3LT0A 2A67A 4E30A 3Q3CA 4RM2A 1WX1A 1SVWA 5DM70 1MU0A 3MZ0A 1X7XB 4YRQA 1NXQA 3KKOA 1QQ6A 3CKKA 1MC1A 3MGCA 4IFBA 4QARA 3CF2A 3FNBA 3ELUA 4LKOA 1QHYA 2NU6B 4MV5A 4QDUA 5AHKA 4MICA 2N75A 1YZHA 5HTKA 3OU7A 4ARSA 2DHDA 2VTBB 2ZIXA 4O6VA 2KE5A 2QXTA 3RU9A 4M8KA 1W73A 2WNHA 3FDFA 1J22A 1P1JA 1QR6A 1HURA 1Y8RA 1YMUA 3TR0A 3ASYA 4ZHQB 1U7XA 4NZZA 3LXMA 4QUHA 5B2EA 2FZVA 1G8JA 3KR9A 1QBKC 2O2HA 2IS1A 3BERA 3IVGA 5JSQA 2FK7A 1J9ZA 1Q0HA 2I99A 1J24A 2YWCA 1JJIA 4JP2A 4U2FA 1A8HA 3GVCA 3PV0A 3WMEA 4Y1FA 4XWYA 3SR3A 3ADCA 3LQYA 3QVVA 3PZBA 4EDFA 1IM5A 3DP9A 4LJ4A 1PWEA 5AK4A 1Q1EA 4V02A 3RIXA 1LDBA 2RIRA 3THYB 4RCYA 1MX1A 1NR7A 3KKNA 2YHIB 3K71B 1X8JA 2WHRA 1UDAA 4IF6A 4KPUA 2Q7DA 3ILXA 2LCFA 3VJRA 2CJYA 1BNCA 3L1JA 4CI9A 4C6RA 1JU4A 4YJ3F 2QPLA 5B37A 4G84A 1LS1A 1W9HA 5DXAA 3UYKA 5H9VA 3I5UA 5B57C 1R4NA 1J20A 3R7DA 1EX1A 2MIIA 5BSHA 1AB6A 1ZNWA 1YWGO 1E2PA 4K46A 4O4JA 3A1WA 3PFNA 3ULKA 2O8CA 5JBNA 5EKTA 2ZAIA 2GUGA 3A4NA 4UXJA 2FE4A 1JFFA 4GRDA 2XYGA 4O1IA 5ELLA 4ZT4A 4ZVSA 3WRXC 3FUVA 4EA7A 2OC9A 1E5VA 2QIOA 4BZPA 1MRZA 3DV2A 3O5AA 1NQUA 2VRCD 1REQA 3C3DA 1XVAA 3P0HA 5AKGA 1BA3A 3TW0A 3L6OO 4OGFA 1G17A 3PQ3A 1DC6A 2IIVA 3P2EA 1ZWLA 4GKBA 2AUTA 3KAPA 4JWTA 1ODLA 3GUYA 4CG0A 1VLLA 4FEYA 2H1HA 2WWVD 3AB3A 1Z07A 1BMTA 3M1IA 2BI8A 3AM4A 3FAZA 4JMPA 4PNEA 1D2MA 2EG9A 3QA9A 3VYVA 5BQXA 1JEQA 3D1LA 2W22A 4NCAA 1PS0A 5CVTA 4XQ9A 1D6NA 2QRMA 4OU5A 5IAEA 1U81A 1GPWB 1ILEA 2OT3B 3KEQA 4EY3A 3NYWA 3WIOA 3ELBA 1Z4MA 2VI5A 4P2BA 3DZKA 2PRZA 3UPUA 1VXRA 5BQPA 1TJ4A 1ZVKA 3I32A 4C9BA 5JD5A 4E33A 3AM1A 3Q6IA 5ER9A 3GNLA 1VLZA 2QW1A 1M76A 2F43B 4X20B 5J4VA 4JVSB 2BCEA 4QFDA 2Y1XA 1KXJA 2M1ZA 3GD7A 3UB4A 3ITKA 3ZGYA 1NV8A 4D3DA 4QJ5A 5ICEA 4WVFA 3IVAA 1L7RA 2QW0X 2VDMB 4OXYA 3W8EA 3T7TA 4QU8A 3X1WA 4MZXA 4REQB 3D6VA 3ZV3A 3G9QA 4PLPA 4FHEA 1FFDA 3S28A 4CEIA 5CX1A 2XTNA 4EMTA 5F76A 1E32A 3JQEA 5EJEA 4LOJA 3WHPA 3PK0A 1G64A 1KJ8A 3KYIB 3GUVA 4NCHA 4YUVA 4GGOA 2ZIXB 2F3UA 4TLMB 4UUBA 4XYMA 1Z4PX 1XYVA 2DH6A 2PUWA 5KOYA 2G7MC 4WY2A 1Z4KA 1IEVA 3VPHA 4GMKA 1J70A 4F9FA 4I1PA 2Z1NA 3OQ6A 4II2A 3LYLA 5CPFA 5FI0B 5AW5A 1JMVA 4KAJA 4N65A 3JVVA 4AZ3A 4JL6A 1Y3DE 4FCCA 5K6AC 4L5AA 2PK3A 3NNSA 1YV9A 1R1DA 1VLHA 2EDAA 3HUFA 1R9NA 1XTQA 2JF0A 2J3KA 3RYHA 3T15A 1XGKA 4JD5A 4MQ6A 3GI1A 5IBRA 5BMOA 1NYTA 4MINA 4CGYA 1KSHA 1OI2A 2P7IA 2AMLA 1USGA 2PXCA 1SO8A 4BOYA 2Z08A 2E0IA 4YXFA 2NAPA 3AHDA 4IR7A 3C24A 3N0VA 1W29A 4KO3S 4GF5A 1AKTA 5H68A 3O2SB 5CNIA 2IH5A 2DUUA 5TMDA 4IO0A 2JFPA 4D44A 2Q4OA 4DCMA 1T6XA 2FUNB 3TE7A 4BMZA 1R6BX 4DM3A 1C9EA 2FW1A 3RV4A 3NHLA 2DR2A 1KWKA 4PRLA 4LFBB 4UTZA 1RJFA 3HUUA 3VQTA 3KJEA 4EVQA 2Z4TA 1S2MA 2CFSA 1HZZC 2VP4A 3UF0A 3GJXC 3MM4A 1BJTA 2J85A 3HBNA 3BG5A 1CUDA 4L15A 5KYVA 3M83A 4ARIA 2GJAA 4PXYA 1TADA 1UFRA 3GYBA 4KFUA 1REQB 2P2YA 2JEOA 3VRHA 1I4LD 1DB3A 1QCDA 4NLLA 5D00A 3GROA 3GBPA 2NU8A 3IQIX 2RGUA 4CDRA 5DSZA 4GI7A 1RXUA 3IOEA 3KZOA 3GPDG 4X61A 4QLOA 5ICMA 4TUYF 1G8KA 4OMDA 3OZWA 3FFBA 2FFAA 2YJ5A 3M6VA 1O6CA 2EFJA 3M33A 5AH0A 3UMJA 1MAWA 1RFGE 3IP7A 4C43A 4YRBA 4HF7A 3RFUA 1LXCA 4J7AA 1XTVA 2VJMB 3KVVA 4AMGA 5E2IA 3TOVA 3AVUA 2FWAA 1XDGA 2D1YA 1GQSA 1Z2DA 1CERA 2J0UB 4DM7A 3AESB 1MN6A 5IZCC 5D3MA 2P1DA 3IOBA 2CCKA 3W3AH 5EJ4A 1IK4A 2HU8A 1X1SA 3KDPA 3I23A 4QLBA 5LP6A 1DE0A 2WZDA 1DDIA 3TI7A 4Y6PA 3IR6A 3E82A 5FIUA 2AFIA 2XKBA 5C5IA 2VWGA 3H42B 5B7PA 4YLEA 2X8WA 2RHMA 3RSFA 2V7PA 4HFMA 4JGBA 4NY1A 4DZTA 1E0AA 4D98A 3BWVA 4O4HA 1MIOA 1PIWA 2VTVA 3OOWA 3Q4GA 4EOGA 4FB4A 1I7LA 2YMLA 5KNDD 1YFLA 4GE0A 4CEIB 2HJGA 1T4BA 2TMYA 5FTNA 4XDYA 3K2BA 3TTWA 2JJ2D 4WD3A 3K8YA 2QTCA 5BNTA 2ZSJA 1Z0UA 1EX9A 4B3RB 4OI1A 2YR0A 1YB7A 1ICIA 1IBSA 2FMXA 4YFVA 5JNSA 1XG5A 3IERA 1GNQA 3MRTA 1P4GA 3PYLA 3QOWA 1ZOPA 3NIGB 5JHGB 1DV1A 3CV3A 3UXEA 3HCBA 2MYTA 3MBKA 4FD2A 4ZQFA 4C7VA 3H8JA 1O96A 2C78A 2CJWA 2AQIA 4DHWA 4Q1FA 3K5WA 4I4CA 1GIAA 2R1ZA 4AZ3B 4UU1A 3NEYA 3COPA 3RFVA 2ODAA 3ZY2A 2V6JA 5K4GA 2BE9A 1G20E 2CMKA 1U94A 4JB3A 1OV4A 5A6SB 3U3RA 3ZHBA 4Z4CA 3RYHB 1VCIA 2O05A 3RKSA 2C7QA 3IPRA 3GLRA 4HG2A 2LCIA 2O0LA 4JB8A 5JHHB 1FJXA 1JIIA 1CU1A 1CY1A 4IG9A 4GM1A 1YZYA 4NBRA 2Y8EA 2BJVA 3HPQA 3X1MA 3ETCA 3FTFA 4HRYA 1SULA 3N0WA 1Z29A 2GZ1A 3OZTA 3I6IA 1KMQA 4G4GA 5EUCA 2C2YA 2QG6A 1XRMA 3VR2A 4XTCS 5A2GA 1WTAA 1YR9A 3Q2KA 3WB0A 1YZVA 2OV1A 2DCMA 4Y6RA 3ZE8A 1XCGB 3OZGA 2B3DA 3OZAA 4M9QA 4N0PA 2Q5OA 2IPMA 3LDUA 2Q5HA 4PYOA 4YJ3A 3QMVA 2X7XA 1W4AA 4TL8A 2BH2A 3K5IA 3CUSA 4G0PA 3P0EA 2GM4A 2J3EA 3QOXA 2XAAA 2HNBA 4MYRA 4AKTA 1LLDA 1XZHA 2WZBA 4P53A 4IMPA 2G8NA 1UANA 2ANBA 2VO1A 3CZ5A 4ECAA 1ZK2A 2YHSA 5ADHA 3I5AA 2C5GA 2ZR9A 2ZYWX 5G0TA 3L7KA 1G6HA 2QRZA 4F5ZA 2JI4A 2HSDA 2DPGA 5CFMA 4Q3OA 4AJ4A 5HQJA 4YJKA 4OOEA 2C5AA 2ZDQA 5I3CA 3A27A 1E6LA 1G1MA 3AP1A 3QX8A 4KE9A 4JC5A 4X1IB 1HNXB 1JT2A 4Z51A 2G0AA 4L5CA 4UBIA 1G66A 5FI1B 2G25A 2ZRAA 3OVMA 3I62A 1RE1A 4N18A 2ZXFA 3A4LA 4MRPA 3KHKA 4IZ6A 4CLEA 4DZZA 5GZ6A 3LQ2A 4R9NA 4KR7A 5FWNA 1U5BB 2JVJA 1VP3A 4C14A 4AS1A 2BFFA 3A28A 4NE2A 4NG5A 2KBEA 2O5EA 3I0MA 3IP6A 3RC3A 1SJ9A 1IG0A 2XPCA 2XUDA 1XBTA 1EVEA 5D3MB 4N49A 1EHYA 1DJOA 1PJSA 2W58A 4MYDA 4QHYA 3VR4H 1IJBA 2Y05A 2JIPA 4LRWA 1L5OA 1XPJA 2AFIB 2BFNA 2GNPA 4LA4A 3HJNA 1YVRA 5BW8A 2C8VA 4PEVA 5TR9A 4S24A 4JLKA 2NQTA 2BSAA 2R8BA 2X8JA 3UENA 2V8OA 2VEOA 3DVAA 4K87A 3Q7TA 4M9RA 1MIOB 4GOND 4L16A 4ZAFA 4YWHA 3LWDA 3M9LA 3SX0A 5BMVB 3VU9B 3H05A 4MVWA 5JRZA 3U09A 4OIFA 2IGTA 3DDSA 4JUBA 1L4BA 3BTSA 4D2IA 4MQBA 1I80A 4OUKX 3UOAB 1D1PA 3DT8A 4Z7JA 1YC2A 3AH8A 5L40A 2ABWA 5JAQA 3O4GA 1XZCA 3VU3A 2C59A 2NG1A 3C16C 3DD5A 3PWTA 4X54A 2Z2ZA 4FE3A 2BUCA 2NVWA 3P2JA 2WTUA 5EUMA 3SQLA 3WJ1A 1R5OA 1ZD3A 2VK8A 2W4IA 1F12A 2QRQA 4MA5A 1O96B 1IXZA 1ZK0A 5E6RA 3BE6A 1FSZA 3VYRB 3RV3A 1PU2A 2AE2A 1E0SA 2REQA 1N2CA 2X0KA 4J1TC 2BFDA 1R9MA 4PSAA 1C1XB 3SXPA 1OLSA 3QJYA 4H31A 2QVGA 2D0IA 4LC0A 5TQ2A 1NDUA 1JXOA 1PV2A 5FBHA 3EIQA 4ZAWA 3WJAA 1HTWA 1RACA 4GC9A 3UCXA 4EKGA 2ZVQX 4WCFC 4V0KA 3HO8A 4A0RA 2CXOA 1GZHB 2PS9A 4H77A 3BS4A 3GLQA 1L4LA 3DEIA 3IEXA 1FL9A 1WZUA 1N8NA 2AYYA 2FJPA 2GNAA 2RG7A 2X42A 3NTXA 4C1NA 4R3WA 2XRZA 2XB4A 3TR5A 1JVNA 2OLJA 2JDID 2O5RA 2P0YA 4DCSA 4ZI3A 2QTZA 4INJA 3STUA 3BTUA 3RH0A 4X45A 5FJJA 5CA0F 7MDHA 1M72A 4YJ3B 3L1KA 5HFNA 1NQVA 3OOYA 5KYUA 5AHRA 2BC9A 4KMMA 1EM6A 1T5TA 2QT9A 2JGMA 1X1AA 1MUUA 2GAOA 3LY7A 4UCXA 5CDFE 4F45A 2QX9A 5J58A 3F8TA 1YRWA 5BUSA 1NVVR 2DR0A 1QB8A 1T6ZA 1U1GA 2WTNA 3FNFA 4OB8A 3DL4A 1ZC4A 2W83A 3T9DA 1WR8A 3KYBA 4I1RA 4ZDIA 1GPAA 3PDUA 4Y0AA 9LDTA 2PN1A 2AG5A 1A3CA 1RHQA 2WWIA 1KY2A 2Y99A 3FHCB 1QIMA 3HABA 3LE8A 1V5WA 3EZXA 2WJ3A 4J75A 3PGKA 3KSZO 3L7JA 3E9CA 4PPGA 3RJ5A 1MJGA 2PSSA 3L0SA 4Q37A 4IGFA 2BKXA 1AOXA 1R6DA 1TT5A 5G4LA 1JX6A 3ZEAA 4TUYA 3FPEA 3WI7A 1Z38A 2EQ5A 3H2SA 3I9JA 5BWBA 1OXXK 3FFAA 4JEMA 4BB5A 5I4BA 3GBSA 2BFFB 5AM4A 2PRJA 3NBMA 2C2WA 4OFXA 3SFVA 1GPKA 1RWOA 1BGXT 1J2YA 4AMBA 1HF3A 3H13A 4G86A 5IBQA 1RCTE 2IDKA 1QKKA 3OQMA 2RAUA 1XD9A 3IVCA 3IJEB 4R1PA 4WY5A 1UP7A 5LB4A 1T0JB 3HWX1 4DC1A 3LRPA 2AA3A 4IDOA 1DG3A 2GHRA 5CDSA 2JIQA 1BE8A 1L1QA 4BKUA 3DVAB 2W6QA 5CTJA 1U0GA 2YN2A 4TL9A 1M1YA 1YCGA 1V41E 2NTYC 2XYRA 3MEQA 5SYMA 4QFBA 4KQ1A 3OLYA 4FEAA 4DJTA 4DUGD 3OU2A 3KTAA 3ABSB 1U3DA 1R8YA 4HAOA 1N5DA 4HH3C 1R9GA 1IWBB 1V39A 1WMAA 3TH5A 3WGNA 1GPMA 5HGJA 1CWUA 2TSYB 2KLHA 1U8EA 3UUEA 4FFRA 4C01A 4F60A 4C6SA 3AYXB 3AEQB 3P4XA 4R9VA 1RQXA 4YREA 2HK6A 1ZIXA 4U5QA 1W5BA 3FSGD 1WMBA 3M6AA 4MVXA 4X97A 4XLZA 5E4JA 1S1MA 1TRHA 4P2GA 4W6ZA 3IQZA 5TS3A 1K27A 1ZCFA 4B82A 4CLHA 4E88A 1Z2EA 3TLYA 3AGPA 3ZV4A 4MV3A 1ARZA 2B82A 3V8QA 2A9QA 2WAXA 4NNOA 3W5SA 1P61B 2JLZA 3HB0A 2REQB 1N2CB 3FPFA 1QO7A 2BFDB 3KVOA 3CG0A 1MW9X 3KUDA 4D96A 4E4YA 1YU9A 1OLSB 5CIQA 3IC5A 4P0TA 4X8OA 1OXBB 3QBEA 5IUJC 5JU6A 1RP7A 2H1VA 5GGYA 1SVUA 3AFHA 5A9SB 5TVKA 4MUYA 3A1TA 1ZMRA 3LKVA 1VI5A 1HFJA 3DW1X 1CIJA 5IS2A 2DBQA 3M9WA 2DX7A 1VA5A 1KBZA 2X9VA 3DS8A 4IRXA 3V4OA 2WPDD 4RDHA 3C6YA 5HQ3B 4CR8A 1DC8A 4F11A 4A5OA 4EB3A 2QAGC 4NESA 3WGIA 4J6FA 1FLNA 4LXHA 3CHYA 3SSAA 1NXWA 3C45A 3I1YA 5E7QA 1YCHA 1JSLA 1I1OA 2HQRA 2W0SA 1OR8A 4G89A 4U7HA 4DGSA 3QEMA 5KYUB 1G7SA 3QI2A 4HGQA 4C1BA 3V9AA 2MINB 3LX8A 3WX0A 3WYNA 1LW6E 2WJ6A 3NOVA 2XUIA 3ROPA 4C3UA 3QG1A 2Q2QA 3G49A 4L74A 3BF8A 4YRZA 4L5YA 4WK4B 4Q9DA 3FDZB 1V35A 1A98A 2BAGA 3C5CA 4WCFB 5ALFA 5HJ2A 4BEJA 1VE6A 1Y9ZA 2RAFA 1XMOB 4L9RA 4EG5A 3HP4A 1VRWA 4AY2A 4DA8A 1QU3A 3PUYA 2ODTX 5COBA 3BGVA 1VMIA 2OG1A 1PSZA 2B83A 1FS4A 3G1WA 3NBZC 3R3SA 1OTXA 5KNCD 2J0VA 1WUKS 2A0FA 3EQ9A 3IFSA 1ADCA 3MT7A 3TD2A 1M2VA 3UT6A 3BGIA 3OKCA 4QOSA 1M0WA 3WGHA 1QIGA 4PBRA 2VTDA 1VPVA 3GZNA 3PICA 3W2FA 1G16A 5E1BA 1JYEA 4TUYB 1JKJA 1O97D 1QHSA 3P45A 4Q3KA 3CW8X 3PC2A 4V3CA 3I9KA 3O7WA 3EGXA 4LHYA 2W37A 2OHXA 1J7KA 3BIFA 4G37A 1YB4A 3WL8A 4HH4A 2VFAA 3ZHVA 1CY6A 3LKBA 4M1TA 2QX7A 2V4ZA 3GRAA 3BIWA 3K6SB 1EDEA 2DERA 3C8UA 2Q9BA 4V1CB 1CDDA 3DR5A 1KDZA 4R5MA 2Q6LA 4HJRA 2FW6A 4UOQA 4CYMA 3AJ9A 5IARA 3U40A 2RGXA 4XD7D 3F6SA 3H2HA 3KJIA 1JV2B 5E4TA 2BBWA 3LQRA 1A5SB 3A7EA 4C05A 1M1YB 2NUPA 4RTSA 3SKXA 3EPHA 4FUTA 2O3TA 2NP6A 1CS0A 1JVSA 1WSBA 1VYTA 5H02A 5IFLA 1RWPA 1KQFA 2BKAA 3KTAB 3CUVA 2AR7A 2AS0A 4R68A 3CINA 5TJHA 3UZUA 1A2QA 5F4ZA 3V7NA 1J6UA 3P97A 3ZIAD 2ZJ3A 3OPXA 5KQPA 1NXVA 3HEAA 4OHFA 3N2KB 4ARCA 2UKDA 3BKXA 4KVAA 4K1LA 4XIIA 3ZI4A 3H83A 1KO1A 2AEMA 4DRYA 3DVRX 4ODIA 2OXEA 1OBHA 5EZ5A 3FLEA 1WHTA 5I5EA 3ZU6A 3B48A 1AQUA 5I7AA 2OP0A 3RK1A 3KZCA 3DJFA 2C9OA 4W7SA 4ZVUA 1C8BA 1EXWA 2BLNA 5JFTA 4UUQA 1M2EA 3PFWO 2DPMA 4FFSA 3TLGA 4DDTA 2FSGA 4AQYB 3BHJA 1D04A 2OMKA 2OHOA 3FCCA 3CVWA 5AJWA 3KC2A 2Z2KA 5BSMA 1BKYA 4K9MA 4TPKA 5EWJB 5H3HA 4F84A 2FMIA 3CPEA 4ZVVA 4D9FA 1M1XB 1YMQA 1TKCA 2WSSA 1W6RA 2A4MA 4F4HA 5DW0A 4Q03A 3GLKA 4JODA 4OM8A 3O8BA 3ZD9A 3BXZA 4WZZA 4H16A 4EHFA 5JAZA 3V7UA 4R9RA 3QE0A 1HQCA 3AUJB 3QEMB 1U2GA 3JYOA 3N2LA 3K9WA 3JRNA 1NG1A 3ZDAA 5CA0A 2J0QA 3D8TA 1U28C 4A26A 1W5SA 4FMCF 5DJ5A 4TSKA 2BV3A 5AR1A 3W5HA 3ETJA 2QTWB 1HDIA 1RWKA 2A6PA 1RJGA 4J4BA 5CP8A 1N7GA 2GD2A 2JJ1D 2V7QA 2WE7A 2BGWA 4DA0A 5FDFA 1QH8A 1U3UA 1SM4A 2AFRA 4G4IA 2A9OA 2X0DA 5JROA 2A1UB 1L4FA 3WA7A 2R4TA 4JP5A 5CR9A 2VH2A 1Y6ZA 3DMNA 5J5VA 3VU1A 4DNXA 3SQXA 1KI4A 4WAUA 2FJUA 5IC4A 2BP7A 4L4YA 3UJ9A 1E6UA 3BWYA 5L6MB 4KL8S 1GY8A 1ZA1A 2QXUA 5IABA 3QLJA 3VNQA 1FDOA 1JKJB 1N75A 3B6ZA 5KZMB 1OB5A 1BQEA 1A96A 1UWLA 2FZ5A 3EGXB 2P9CA 3PQ6A 4U9IS 3EQ7A 1K2WA 2IZ5A 3FOCA 1U28A 3IEKA 2OP1A 3F1KA 2ZJ1A 4DG9A 5KPDA 1JHZA 1QFJA 4PANA 2I91A 1UINA 1Q16A 4EM6A 3IHKA 1HA3A 1PTJC 4CNQA 1DHRA 4I4NA 5EXTA 1C4WA 1RRKA 1RCUA 1Z8FA 2C7GA 3GT4A 4IH9A 4NOMA 4C7OA 4M21A 4DLRA 4EF4A 2ANCA 2H17A 2I2CA 3NH9A 1VI6A 5K3FB 4C7KA 3W2TA 4BU0A 4WCDA 3WKCA 1ZYUA 4EH1A 1NMZA 5C18A 3ZZNA 1SKBA