2A5DA

Structural basis for the activation of cholera toxin by human arf6-gtp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
163
structure length
163
Chain Sequence
KEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the activation of cholera toxin by human ARF6-GTP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/transferase
molecule keywords ADP-ribosylation factor 6
total genus 57
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2a5dA00
3FYHA 2WBLC 2WWFA 2ZSEA 4KCGA 3SE0A 5EXXA 1KIMA 8OHMA 4BFWA 1VG8A 5D3MB 4PAQA 3T15A 2W0SA 3BFVA 4O2LA 3K9GA 3ZDQA 2XOKD 1OLOA 1XD2A 4NU0A 1RJ9A 3MG9A 4HATA 3L8YA 4XTRA 3THWB 1RW4A 2G88A 4YMVA 1HE1C 2HJGA 5LPNA 2XB2A 4PHHA 2IYSA 2ZM5A 3AQ4A 2D2FA 4PX9A 1NN0A 1SVMA 3TKLA 4HB3A 3REFA 3TVTA 2IT1A 2PX0A 4DDVA 2NQ2C 3CZPA 3ZVNA 3MAAC 1U81A 1SVLA 3MWYW 2ZTSA 2ZE7A 3MJHA 4LBWA 3KXLA 1XNJA 1G20E 2PH1A 3U4QB 2QTHA 5AJYA 4Q9JA 1Z2AA 2MSCB 4MUAA 5GJVC 1KI1A 1N6KA 2DYKA 3CWZA 1E1RA 4GP6A 4US1R 4B3BA 4FN5A 1UBCA 3VAAA 2OE2A 3SHWA 3ZS8A 1P62B 5EE3A 1KAOA 4WA7A 5TB5A 3SDZA 1KZGB 2GZDA 2IYUA 1J7KA 2OZEA 4HLQB 2JLUA 3UPUA 4C7OB 5EP2A 2ZRHA 2DB3A 3DM5A 4AK9A 1T5IA 1J8MF 2WWHA 3OE7A 4GNKA 4PO9A 2NTYC 4X8OA 1RIFA 4MH0R 1MR3F 4YMSA 4OHXA 4D0LB 2CNWD 2OCYC 1SKYE 1II8B 2AFHE 2V8OA 2ZJOA 4RFSB 4DC9A 2ZR7A 3C14C 4IVQA 1SVIA 1VIYA 2CNWA 3BS4A 1JNYA 1DADA 4JYCA 4QL3A 2IYLD 4JJZA 2IYZA 3SZRA 4Q1CA 1YZGA 3QG1A 1P60A 1U9IA 4Q47A 3FMOB 1KO1A 1Z0JA 3D3QA 4V0KA 1W36C 2YV5A 1N6HA 1FX0A 3FGNA 4YMTA 2OFWA 5EZ5A 2CK3A 4QHSA 1AS0A 4P4SB 4UQOA 2QMHA 5CJPA 3B1XA 5ANRB 4ZKEA 1HEIA 1W48A 2ZRMA 4C0AC 4DVGA 1XF9A 5L8VA 3MRSA 4Q18A 2C99A 5D3QA 1JEDA 1X8KA 3Q3JB 5FPTA 3WY9A 3K70B 1KO7A 5H1YA 4F38A 1UFQA 2CL0X 4WIAA 3AP2A 5CDFA 4LJ6A 3A1TA 4PZZA 4I81A 3QPWA 1R4AA 2WTUA 2ZRKA 4CRWB 1I4TD 2JLWA 4GT1A 3CRW1 5H68A 1RRPA 2EVWX 2ZI4A 4A0RA 1D8TA 2CCGA 2WSMA 1KO8A 2BDTA 3SJBA 1BIFA 4JSYA 1E3MA 1W5SA 1E2KA 1RVDA 2DWQA 4LC0A 1XEXA 4V0OA 3SJAA 3T35A 4TMTA 3GLGA 1OIVA 1Q1QA 4B75A 4BGDA 1FZQA 3IPXA 1D6JA 3QBTA 4D25A 5E95A 1NLYA 2VRWA 5LB4A 2KE5A 3H0KA 3MWLA 1HE8B 3N5CA 4JLBA 4KHZA 4Q4HB 3RC3A 5L3QB 4XH9B 4M1MA 3T34A 1JQJC 1MABB 1YZLA 4M1YA 5EP4A 3VKWA 5F9FA 3O8RA 1OYWA 2GVZC 2BV3A 2Z4RA 1Q57A 4KLNA 1L4UA 2EW1A 2VQSA 4YC7A 2FN4A 4XSGA 1H8ED 4C2TA 2AL7A 4MUBA 4JT2A 5HZKA 2ZJ2A 1SVOA 5F3WB 4TZ0A 1DPFA 1T5LA 4LV5B 5FFMA 1W7AA 1H65A 1Z2CA 4M9ZA 4CF7A 3A6PC 2RB4A 1VCOA 1NVXQ 1ZINA 3LH5A 3TJZA 4KODA 2WPDA 2ZE6A 2OAP1 2GK7A 5D3MA 2D3WA 1ZUIA 3SQWA 1TF7A 2GCNA 3QSYA 4XOIA 3G0HA 4IDNA 1M74A 1A4RA 1RC8A 3AVUA 3K0FA 1G8PA 1E2DA 2ATVA 4B32A 2JGNA 3P4YA 2VBCA 3M6AA 3PITA 3DL0A 4MKFA 2X77A 5E4FA 3TVDA 4AKGA 2BWJA 1IJEA 1E2HA 3QOFA 1S9DA 1YZTA 4PC7A 4KSBA 5FOWA 1EFRA 5KOYA 4TYYA 4Y0VA 5DE3A 1ZM7A 4N0DA 4E07A 2WV9A 3QEOA 3NWJA 2PJRA 3AP1A 1CP2A 5KO2A 2GESA 2IBMA 3QY0A 3R20A 1G3UA 2GAAA 2ZI3A 1ODFA 4IFBA 1H8EA 3B9QA 3FHTA 4B71A 1LY1A 1Q22A 5DSZA 2J1LA 4FINA 4E09A 1E9BA 3GQBA 4C3ZA 1ZNXA 3AGPA 3TNFA 3ICEA 1GSIA 1R7RA 2NO6A 5FL7D 1DAKA 2E87A 3CR7A 1Z0FA 4MGYR 4DT1A 4Q4AA 2Q3FA 1CR0A 1W4BA 4ON9A 4QBFA 1EK0A 5FI1B 1E2JA 2QN6A 4KJZA 2OM2A 4KSCA 4FI3C 1NLFA 5KNBA 1OB5A 1PLLA 3VFDA 3OESA 1FFHA 4I1VA 3AVOA 4NYIR 1N6RA 3QF4B 2ZSAA 2HCBA 2RGGA 1IN6A 4AYTA 3QG5A 4F93B 2X2EA 3L0SA 4YONB 4B6EA 1AN0A 4DIDA 4II7A 1G16A 3FWYA 3CPJB 3VHLB 3GLFE 4GOKA 2FX3A 1FMLA 2DBYA 1TX4B 2GCPA 3EG5A 3IQXA 1Q0UA 3X2SA 4YXWD 4B2IA 1AJEA 4EFNA 1CS4C 1CJKC 5DHAA 4AYWA 1ZMXA 1GM5A 1RRCA 2Q3HA 1KKMA 4BEJA 3NHBA 3RABA 3GLIA 2H57A 4I99A 3QEJA 5HPYB 1NY5A 1U2RA 2Z5FA 4TQAA 3ADKA 3S1AA 3EPJA 2WWYA 5TMPA 4X8LA 2FPMA 3WRYC 3KTAA 4O0MA 1COWD 3ZIAA 2OAQ1 4W9MC 2ERYA 4HYYA 1SGWA 1OV4A 3FB4A 2C77A 2GJSA 4QC2A 5CLLA 3WNDA 3RDPA 4WOPA 4B3DA 4EFLA 2RMKA 4EDHA 4DLXA 4FWTA 2DWOA 1Z07A 1KO5A 1NN5A 3NTUA 1NBMD 4Q9HA 3O47A 4GPTA 3W3ZB 2QP9X 2ORIA 2QG6A 4LK2A 1WXQA 3UWOA 1DELA 1JAHA 1OHHA 4M1OA 5FBLB 3QPUA 4NCNA 3RLFA 3WXMA 4EJSB 3TLXA 1S96A 3U7FB 3Q7PA 3THOA 3VU9B 2CBZA 2F1HA 1Z5ZA 1ZD8A 2RHDA 2FZLA 2NO7A 1XPUA 5IHPA 1EWQA 1GNRA 2ODBA 4U7DA 4DSTA 5FTNA 1IM2A 3AVQA 4UXJA 1G8FA 3DMNA 4YMWA 3GP8A 1N6NA 1EG7A 4D26A 1G7TA 3GLHA 4L5BA 4DIEA 4CEHB 4NMMA 2EQBA 3W3AA 3DKVA 4TTPA 2XITA 2F43B 2EYQA 4CZ2A 4I1UA 4C0SA 4DXAA 5TARA 1U94A 4JIMA 2ZAMA 3N2IA 1LV7A 4FMCF 4OQXA 4JZKA 1G6HA 5EE1A 4DSUA 4A0FA 2ZUBA 3CX7A 3Q72A 3B82A 1I4DD 4TLAA 4QG7A 1OIXA 2H18A 2ZETA 5AJZA 1F3OA 2GBLC 1JBKA 2AK3A 1MT0A 1U8AA 2ODEA 3ZLJA 2C95A 3TSZA 2ZRLA 1NMYA 2MSDB 2REOA 3H2YA 3KJEA 2VHUA 4RD4A 3BIFA 4A8JC 2F3RA 3TW8B 5CIQA 2FPKA 1QHIA 3K0CA 4PR0A 3BB3A 4R98A 1K6MA 2GCOA 4GZLA 2WOJA 4DEXA 4Q4AB 3TUIC 4B44A 3IQWA 2V1UA 2RGCA 1U0JA 2R8RA 3WYAA 4JVLA 3SN6A 3WYFA 3A8TA 1AA9A 1U90A 4GMXA 2BCGY 4DLWA 3AM1A 4L4UA 3CX8A 5EE0A 3CO5A 2ORVA 1N0VC 3B6EA 4OYHA 2J7PA 1UDWA 2VEDA 3B8HA 1UBEA 1G64A 4PC2A 2F9MA 1ZNZA 3RRZA 3SJZA 3AVYA 2F9LA 4XWAA 3K53A 4EFMA 3MJRA 1LF5A 1AGRA 2AHOA 3HR7A 4ESHA 2JDIA 5JCPA 1F5NA 3AVVA 3CNNA 3I3SR 4NH0A 3QVUA 4D80A 2G1JA 2OBLA 3KFVA 5HKKD 1E79A 3I4LA 3W5JA 1LW7A 2RGEA 1SHZA 1KK1A 2QGNA 2HYDA 1LNZA 4OHVA 2YOHA 3GLHB 3TBKA 2VIIA 1ZIOA 3QXJA 4UJ5A 3ICQB 2FA9A 1DVRA 2O0HA 1W2GA 1W4AA 1X8JA 2RGNC 3EPKA 5JSZA 4D81A 5BN5A 4M1TA 2O8EA 1NRJB 2I4IA 3HYTA 1FUUA 4R71A 4RZ2A 2J5XA 4JKIA 5LD2C 4ASUD 3RC8A 3FHCB 3HU2A 1IHUA 2R6CA 3E2IA 2WAYA 5DI3B 3MFYA 1II9A 1N5LA 4YDSA 2RGNA 1HTWA 3CR8A 1G3RA 4QGGA 4Q9LA 1ESMA 3VTKA 4LJ5A 4B74A 4B3FX 1UM8A 1T0HB 4JS0A 1PV4A 3ASYA 3MMPA 3WHLA 5FR2A 2QT1A 3VR6A 1GIAA 4Z51A 2PEZA 1A82A 4FMCB 4KO8A 3FKSA 4US0R 3TAHA 1WB9A 4RD2A 1PLKA 5DN6A 1EFHA 4AYXA 2NPIA 1F48A 4KBGA 1E0KA 1I2DA 2PMDA 3JZMA 3AKEA 2VP6A 4FXPA 2ZEJA 5TVKA 2PLFA 1KI6B 3KKNA 1VYTA 4HAUA 1JEEA 2IUTA 3SNHA 2RGAA 3DOFA 3HR8A 5K8TA 1ZJ6A 2WIAA 2CE7A 4JLVA 2XZOA 1J90A 2QAGB 1SVSA 1P9NA 2WJJA 1WBDA 2ANBA 1N0WA 4H1UA 1NSTA 1RPZA 2WICA 3EASA 1KTVA 3EIHA 2PX3A 3VR5A 5FBWB 4BZXA 4IEEA 2FDCA 4JKYA 2A5YB 1AIPA 4KLZA 3K0AA 1OSNA 4A2WA 1E69A 1WA5A 1E4VA 5ELXA 4AG6A 3P26A 1N6LA 3KKOA 4PC6A 1KI7A 2JCSA 1ZW6A 2OV2A 2VSOA 2ERXA 1TQ2A 5KSOA 5JJKA 3VNUA 1E4YA 3OIYA 2ZSBA 4JSTA 1NVVR 3FDIA 2P5TB 4G3XA 4XVUA 3UMFA 1IN5A 1KDPA 4NYJR 1P3JA 1VDZA 1UKZA 3Q5EA 4HI0E 2F1IA 4U00A 2VHTA 3CW2A 3RHFA 3ZS9A 5J4YA 1DG3A 3CNOA 4N1AA 4QGHA 1II8A 3N2EA 4MKIA 2ZYTX 4DCNA 4A92A 2H7VA 4W5JA 1TUEA 2TMKA 3ZVRA 2ZYWX 1A1VA 1FTNA 1BO6A 2XTMA 3B1YA 1UADA 2R65A 4A4DA 1A2KC 4TMWA 4QNMA 4QJ3A 1VIAA 1OW3B 4G5GA 5DN6D 4Q1EA 3T12A 3T1VA 2GRJA 2P6UA 4WZAE 4JLDA 3TUJC 2ZE8A 1GFIA 3BFXA 2ZJAA 1XJ0A 2V7QA 3HDTA 2WAXA 3CZQA 3I5YA 1V43A 4QRHA 4TT3D 3SYNA 1OB2A 4IEIA 2BMFA 4CEHA 5CB8A 2ZVQX 1DAFA 2ASEA 2F55A 1YU9A 1ZM9A 3L0OA 2QMOA 5CDFE 2MMCA 4ZDWA 1AS3A 2QT0A 2OXCA 4UNSA 3D31A 2O0JA 2CL6X 5CJ2A 3V9PA 5JBQA 4P3YA 4EPRA 2Z43A 3L0PA 5FOXA 3BBPA 1NVUQ 1KY3A 1OFUX 1X1RA 1E2LA 2UZIR 2J87A 3QF4A 1G4AE 2YVUA 3PEWA 3EAQA 2YKGA 1MABA 1ZD1A 2IYWA 2WVJA 3I1FA 4NCJA 1RRFA 1RRGA 4HB0A 3RAPR 4CDGA 3ZVLA 3R9IA 2VP4A 4BECA 4XJXA 4IKEA 4EUNA 5EP3A 3KQUA 1X1SA 3F0TA 5JS7A 2WKQA 2WWWA 1E79D 3DEFA 1KKLA 3R7WA 1TU4A 4C0BA 2P5SA 4HZIA 1BOFA 1KI8A 2IYTA 1R10A 2O8DB 1S9HA 1JI0A 4TYPA 2ZRCA 4EPXA 1XTKA 2OESA 4IVRA 4JL5A 1XU4A 4D82A 4DZZA 3KQHA 521PA 2RGXA 4C2UA 1QG4A 5L3VA 3LBHA 4PPGA 2ZRAA 1N6OA 2IUSA 1G1MA 2J0SA 3PR1A 3CH4B 1HT2E 4QFMA 1OPXA 1SKYB 1XB2A 2B6HA 3VR1A 3GJ3A 3IUYA 5BYKA 1ZUHA 1Z47A 1P9RA 4M1KA 5FOUA 1JAIA 5KSPA 5JHGB 2W83A 1C4OA 1Q3HA 4BASA 4OQLA 1RZ3A 4LBYA 1OXXK 3WRXC 2DCUA 5HCIA 1XP8A 1GDDA 3EA0A 4P32A 3N70A 3NVAA 1G6OA 4L16A 3U7GA 1HQYE 3D8BA 5KDLA 2GILA 4IXNA 3U5ZB 4WVFA 1CXZA 1NG1A 2GJ9A 2WWIA 1QHSA 3F5FA 3OIVA 3R9XA 4URUR 1NVWQ 2XNSA 2QPTA 3DOEA 1R5BA 3ADBA 2J9RA 1QF9A 3LBNA 2RHMA 1ZU5A 3THXB 1JR3D 2J0UA 2O8BB 1GL7A 3TUZC 4RFVA 4ZPXA 4M53A 2Q0HA 3VQTA 3NBFA 1TEVA 2FFBA 4LJAA 3VX4A 3UG7A 2FEMA 2QM8A 2WSSA 1H8HA 1NG9A 4L9SA 2D7CA 1G4UR 4ABYA 1UBGA 4NP6A 5C4MA 5JWOA 4TYQA 4HB2A 4NPHA 2NO0A 4MYHA 5LBIA 5BN4A 1W49A 821PA 1R0ZA 5CK4A 2ZXUA 3IEVA 2R44A 2IEZA 4WW0A 2QUZA 2J7KA 2C98A 2OG2A 2ZI5A 2BOVA 2GZHA 1Z6TA 4C9BA 3RVBA 3DZ8A 5FBRB 5SZJA 3TMKA 4W5WA 2A30A 2DWPA 4F92B 4DB2A 2FNAA 2KJQA 3DHWC 2QMEA 5AUNB 5B57C 4TZ6A 5LB2A 4RD1A 3R8CA 5F2EA 2NOAA 1QHNA 4M9QA 1X86B 3OFND 1UDXA 5FI0B 1VCIA 3GLHE 3AKYA 2A78A 1P5ZB 1Z63A 1AGPA 2JJ1A 4LZZA 2I3BA 4PFSA 4UNRA 3TRFA 3SFZA 5E3HA 2ZPTX 2R9VA 3GFPA 4PO1A 4WXPA 1J2JA 3BAFA 3LVQE 2CK3D 3TR5A 3X1DA 2P65A 1OYYA 5AR1A 5TY0A 1G3IA 2GDJA 4LYHA 3VKGA 1VCMA 4LBZA 2J45A 4BFUA 3U7EB 1XEWY 2ZI7A 3NKVA 5GADl 1T8UA 3CBQA 3FFAA 1NJGA 3W9YA 4PXAA 2ZANA 3DVLA 3QE0A 4CW7A 4HEJA 1E0AA 1DAHA 4B34A 5L3SA 4Q4HA 2ZRPA 4RCZA 4KYIB 4WXRA 4B3XA 2F7SA 2WJHA 5G3YA 3KKPA 2FFHA 1CR4A 1F2UA 1NKSA 1YKSA 4OHWA 4EQ6B 2QGZA 3LW7A 3KUCA 1YZQA 2AK2A 2C96A 4LV6A 4HSEA 4CEIA 1E2NA 1AZSC 2IYQA 5AUOB 1YR9A 3LBIA 4C7OA 3UANA 3PG5A 5IK2D 2OFOA 3K0CC 1ZP6A 1OKKA 1J8YF 3ASZA 3JZAA 2VSFA 3O8DA 3PUYA 5EXTA 1SULA 2J0QA 3OFNA 1SZPA 4HLCA 1H8HD 5SZKB 2H8KA 2F1JA 5DI3A 4PZYA 1XJCA 3EWAA 3OEED 5EUQB 3RS2A 4B2PA 3P20A 4LYJA 4R7ZA 5G3ZA 2D2EA 3CRMA 4BQSA 3K9HA 1ETUA 3ETLA 1T0JB 2HXYA 3CPHA 3T1TA 2YYZA 4HZUB 1Z0AA 1YJ5A 5SZHB 2HCJB 4PSAA 3NH6A 3H84A 5FBQB 3GD7A 1IQPA 3U6KA 3NDPA 1GG2A 4BFSA 2QSZA 5EZ6B 4CVNA 3A1SA 2FH5B 2QY9A 4F4CA 4C0JA 1KMHA 1KSGA 1HY3A 2DFTA 4Q5IA 4IDQA 1KK3A 2CCKA 1AS2A 2JATA 3CNLA 4BFYA 1GAJA 2FEOA 2QROA 4G0NA 1CJMA 2HUPA 2IA5A 3A1VA 4Q9IA 3NEJA 2GJ8A 2IK8A 3GMTA 3Q5DA 5H8WA 1XD2B 3HJNA 1GRNA 1LS6A 3WBJA 4ZDIA 1KZ7B 4DEYA 3ZIAD 4CYMA 2C78A 1LVGA 1VG0B 1DAIA 2EFEB 3K0EA 4BLQA 3A37A 4DB4A 2GWHA 1G8YA 2QP3A 1P72A 4JBYA 4CGZA 3QUSA 2HYIC 2ONKA 3U3RA 4TTQA 2A5DA 3VX3A 2A5GA 3KXKA 3OE7D 1UKEA 1MH1A 1T3HA 4M22A 1OIWA 1UBFA 4OI2A 5B58C 4O2RA 5JFGA 4Q9KA 1SXJE 2IHBA 1M7BA 3MD0A 5EE5B 3RS4A 4Z8YA 1CLUA 2C8VA 2XGJA 1OXSC 1HT1E 4BZPA 1KI9A 3GEIA 2C9CA 3W8NA 3T1OA 1EX7A 2G3YA 2OT3B 2YHSA 3E5HA 4OQFA 4D0NA 4PSVA 4WAUA 3KKMA 3T1QA 3HPQA 1X6VA 1W36D 4Q21A 1E2PA 4RD3A 4IVPA 1WF3A 5TDHA 4F4IA 5UKDA 4DUGD 1XD8A 1RJ9B 4L8GA 4Q4JB 5AUQA 3VNVA 2ZYUX 5J4KA 3X1YA 2ORWA 1Z0IA 1L7VC 1N6IA 2ZRJA 3SI7A 4NHOA 4POAA 3I62A 2EFHB 3TH5A 1CEEA 3V4FA 3EW9A 1D9ZA 1R2QA 1LTQA 4XD7A 5CLQA 1ZRHA 3AF2A 4URXR 2DY1A 1NF3A 3IILA 4PHGA 1KI3A 3CF2A 1QHGA 4Q4JA 4A2QA 4Q1FA 5FUXA 3B78A 2QORA 3RS7A 4FMBB 4C4PA 4LDJA 4BFXA 3GEEA 1IY2A 4GZMA 2O5VA 1BKDR 2AD1A 1Q12A 1E0SA 2PBRA 1YZKA 4ZDKA 5E7JA 4A0GA 4E5UA 2OLKA 1FW6A 1AQYA 2AWNA 3BOSA 3LQQA 2PJZA 4NYMR 5KHOC 3LW8A 4PSKA 1M8PA 4BFTA 4U02A 3SU8A 4RFSA 1Z8FA 2FE4A 2QU8A 1E32A 2ZVPX 1DAGA 5JRZA 5F98A 3ADDA 3CRQA 3F8TA 4TN1A 4OI1A 4UNNA 5BWMA 2P6NA 2OBNA 3K8YA 421PA 4MYCA 1E9CA 2QTVB 1GUAA 2YOGA 1W4RA 1Z28A 1R0XA 1VHLA 3ZJYA 1Z06A 1GZSA 4GBMA 2IXFA 3WMGA 3PUZA 1MOZA 1G5RA 1KY2A 2GEVA 3EIEA 1W47A 4K8OA 4PZLA 3K9LA 1E98A 1XPOA 2GXQA 3AVXA 2QA5A 5J4VA 2F3TA 5C4GB 3BRWD 2FSGA 1OH5A 4JBXA 3U4QA 5BYJA 3FFBA 3PCRB 2P2LA 4HDOB 1FPMA 1PZNA 3KJHA 3FPAA 4PQFA 3AP3A 4YXWA 3K0SA 3PUVA 1QHYA 1ZC3A 1ZM2A 4M8NE 1FP7A 3THXA 1ZVQA 4A82A 2Q6TA 2HV8A 3TK1A 5AUPB 2OCPA 4HDQB 4AI6A 2YJTD 1MRNA 2ATXA 3W8RA 2C5LA 1WRBA 4LHYA 1K8RA 4NKRA 4YDHB 4C0LA 2HF8A 1ZD9A 1W5TA 2GXAA 4PC3A 3W6PA 2CHVA 3KQNA 1N2CE 1LS1A 4XIGS 3J81k 5L3QA 1E2QA 3QVVA 3WMFA 3PIRA 2BEKA 4B73A 1MKYA 3K70D 1W44A 1FNNA 3F3YA 3IIJA 2BBOA 1WP9A 3TW4A 3VR4A 4JVMA 1E2IA 1Q21A 2WWXA 1W36B 4Y0AA 2DFNA 4M4SA 5DYGA 4HUQA 2V4ZA 1G8GA 3TSOA 5JJLA 1N3BA 1KJWA 1Z83A 1ZBDA 1G5TA 1VKJA 2RH5A 3EZ2A 3B1VA 3FMPB 3ADCA 1NBME 2FV8A 2GHIA 4PPQA 2W2XA 3D6TB 2XJ9A 3IHWA 2H92A 2R62A 4FCWA 1Z6AA 1F2UB 4M9XA 2V6JA 4B6FA 4MKHA 4QBGB 1FOEB 1R0WA 4DBLC 3ZD6A 2I1QA 2X19A 3I61A 5FTKA 2JJ1D 5L3SB 4AIIA 1CIPA 4G5OA 1P4SA 2BMEA 2ZI6A 5FTJA 1R8QA 1WDTA 2HT6A 1VG9B 3THYA 2WM9B 1LB1B 3Q85A 4TL9A 4LUCA 1Z22A 5JI3E 2UZ3A 1QHHB 2XNDD 4A6XA 3AEZA 3UK6A 2ODWA 3Q9LA 3HWSA 1ONBA 5FPSA 3ND8A 1Q1ZA 3TIFA 5AJXA 3QKTA 4Q00A 2FGKA 2JLVA 2J41A 4G5SA 4ARZA 1JPNA 1II0A 4XWKA 5DGXA 4PTLA 3SYLA 2WJVA 4CEJA 4AC9A 2N42A 4Z8XA 4W5HA 2V7QD 4HAZA 5HZHA 5KNDA 4Z1MA 2Z83A 3O8BA 5JHHB 4ZDJA 1KDTA 4HAWA 3RNLA 5HR5A 3CRRA 3LAWA 1NNEA 1QZXA 4EPTA 1XZPA 5G41A 5KSYA 1NVVQ 1GOTA 3LXRA 1W2HA 2PLRA 2V3CC 2BBTA 2ZIAA 1G5PA 3QKSA 1UEIA 4TSFA 1BH2A 3NG1A 5F9HA 3C8UA 3VKHA 1KO4A 4KU4A 4NONA 2A3RA 2AXPA 3GJ7A 3GLIE 4BFZA 1P2TA 2XTZA 4V03A 2BEJA 2V6IA 1M7GA 1TU3A 2IS4A 1W1WA 3QI2A 4P0TA 2XOKA 2W6IA 5FTMA 1U99A 4AG5A 2Q3MA 1QG2A 2W6ID 1QDEA 2XTNA 3AH8A 3EX7C 1E2FA 4O25A 3EZ9A 4KFRA 1R6BX 3IO3A 3KDSE 4LHWA 2ZRDA 1MO4A 5FTLA 2ZUCA 3DPUA 4PANA 2GEUA 4KITB 3LX5A 4DLSA 1OXTA 2EFGA 4B3GA 3CRVA 5EXSA 1WBBA 3BFKA 2OILA 3PUXA 4NCKA 2A7QA 3C41J 5KNCA 1OH6A 1MO3A 1GILA 1KAGA 2QE7D 3PEVA 3D7MA 2WKRA 3Q8XB 1N5IA 4LJ8A 2V1XA 4Z1MD 1HURA 2QEQA 4DLYA 1E2GA 4PO8A 2JA1A 4MRPA 4C0QC 3KQLA 1M6NA 1TF2A 4LYAA 1AQUA 1ZU4A 1WQ1R 5JJIA 2IXGA 1QHHA 3QF7A 2QBYB 4Q02A 1NBMA 4DRZA 4GP7A 4U5XA 5JEDA 2FF7A 4EJSC 2BHRA 4AY2A 4RY2A 3TQFA 1B0UA 4P31A 2CLSA 4OL0A 1NP6A 2PL3A 3LO5A 4BE7B 5GJWC 1GRRA 3MSXA 4XVQA 3DO6A 2CDNA 4BWYA 3GFOA 3GCGA 1TF5A 5FPHA 2AR7A 2EWWA 1YQTA 3LWNA 1KJYA 4HLUA 2IWRA 4TL6A 2QL6A 1WE2A 4IHQA 1PUJA 4GDFA 5C1BA 4DKXA 4G5RA 3KUDA 5EE9A 1P2UA 2REXB 4FCVA 3SQXA 2P0EA 1Q1BA 3B60A 2IL1A 3WHKA 2VL7A 3QXXA 3P27A 1QHXA 3EWSA 1GWNA 2K5UA 3HU3A 4ZIRA 1HUQA 4BLRA 3H86A 4KFSA 5HTKA 4O3MA 4MDFA 4EKDA 3O8CA 3BB4A 2V54A 4JLJA 2X8AA 3IO5A 1R5OA 2BIFA 2XX3A 2QTFA 1CR1A 2OEPA 2JEOA 3U7HB 3AB3A 2ZRFA 3DDCA 1YRBA 1XCGB 1VG1A 3W6NA 5FBVB 4YLGA 4DSNA 5GVRA 5JEEA 2FU5C 2IWHA 2D7DA 4GRAA 5JECA 4P33A 4MKGA 3LNCA 4RCYA 1TQDA 2FJUA 3VR2A 2OLJA 2GK6A 2IW3A 2P67A 2NZJA 1U8YA 1E1QD 3OF5A 4A2PA 2YWGA 2F43A 4RKEA 3A1UA 4MYUA 5C18A 1FMJA 2DPXA 1U9IC 4C0KA 1Q44A 4AKHA 3BORA 2QZ4A 2VYFA 5CK5A 1U98A 1UKYA 4TMZA 3UIEA 3LDAA 2XJ4A 4C0HA 5B64A 1DARA 1SXJC 4QM6A 4HZUA 3NC0C 2QRNA 2EYUA 2XNDA 1ZNYA 4MYTA 3BD9A 4S35A 3A36A 4M21A 5J4LA 2ZREA 3VU9A 1GTVA 2BM1A 1ELOA 2ZJ8A 3OZXA 1Y63A 3EZFA 4I1OA 4JT4A 4DWJA 1DE0A 1GNPA 1AKEA 2DHRA 2ZS7A 3K09C 2UKDA 1KK0A 4WZ6A 1SHKA 2IC5A 2R6DA 1TTTA 5GJBA 3MWKA 2XAUA 2WPDD 1S1MA 4LCBA 3TSWA 1KMQA 4TMKA 1A7JA 3M1IA 1J70A 2VP2A 1ZIPA 3CM0A 3KKQA 4KBFA 1QVRA 4OK3A 1QRAA 4QBHA 5EQTA 2Y8EA 4F4JA 5JCZA 4H9GA 4D4LA 2J0UB 1S2MA 3QENA 2XXAA 1RE0A 5GJCA 4ESVA 4EQ6A 1E9SA 3ZZTA 4ZCMA 4UNPA 2WJYA 2C9OA 1KJZA 2C9YA 2KWIA 2QE7A 4OJQA 2GCOB 3ZGXA 1DG1G 4TQ9A 1VYVA 1SQ5A 2JJ2D 1P2VA 2LKDA 2BJVA 3OEEA 4OKSA 4BLPA 1LF0A 721PA 4ZCIA 2YC2C 2O8CB 2P3SA 1IN7A 2D74A 2ZRBA 4B48A 2A5JA 2JLQA 4OQNA 2Z4SA 5AJVB 3E1SA 2JIZD 3FMIA 1UAAA 1GL9B 1MRSA 1DAMA 5SZIA 5KDDA 2ODNA 3FE2A 4TLDA 3M4YA 1AZTA 3U3KA 4QJ5A 1OE0A 5DI9A 2NO1A 2B7CA 2EWVA 5E7MA 5P21A 3SJCA 1EFRD 3B85A 3FKQA 2ZSFA 4MRVA 4JLNA 3IHLA 2D62A 3QKUA 5L3RA 2AKYA 2CXXA 1ZAKA 3BH6A 2WWGA 4US2R 2VF7A 2IEYA 4M0LA 4GOXA 5KPJA 2BJWA 4IOLA 2FGJA 2G83A 2KI5A 4TMVA 2XB4A 4ZKDA 1E99A 1ZNWA 1KDRA 2Z6VA 1CULC 4JL8A 1FP6A 2GXUA 3FTQA 3U44A 2J7PD 3WYGA 5GVSA 4JLPA 1NLZA 3ZQ6A 4ZI3A 1P9WA 4B3CA 2IYXA 1Z29A 2CL7X 5DISB 4Z54A 2YC4C 3G82C 4DCVA 4EPYA 4QHYA 4LBVA 1OXVA 4KV9A 2H5EA 3I8SA 3U3OA 2HLDD 4JMPA 4KFUA 4OBEA 3X1XA 2EFCB 3A4MA 5K8LA 1E1RD 1VECA 1JJVA 3T06B 4NYIQ 2AX4A 2YZ2A 1EXMA 1US8A 1FQJA 2DFLA 3A4LA 5JLJA 3DM9B 1F6BA 4DDTA 2XSZD 1TPZA 4LV8B 2XSZA 2BCJQ 2O8BA 3IPYA 5A0FA 5BQ5A 1X3SA 3K9NA 4QHTA 1DO2A 1S1CA 2FSHA 3MCAA 1G3MA 2A2ZA 3BWDD 4UNQA 4ACAA 4QGAA 3U60B 1S8FA 1KNQA 1TMKA 3BJIC 4NCHA 2R2AA 1KDOA 4NYMQ 1T4GA 2C04A 2WJIA 4HB4A 3W6OA 4A0HA 2G0NA 1E1QA 1RKBA 4PAMA 4V0LA 1N6PA 1Z0KA 1G3QA 3CIOA 1XPRA 1NN1A 1COWA 3AF1A 3SBDA 5HE9A 2Q21A 2QQEA 3BK7A 3KXIA 2QM7A 2PT5A 3RS5A 2QAGA 3ZD7A 4PAOA 1S0UA 1I4LD 4RZUA 5CIWA 3GJXC 2VTKA 3LX8A 3B7GA 2KBFA 3EA5A 3GFTA 3IKJA 4PHFA 4TTRA 5CM9C 1JR6A 1IY1A 3Q7QA 3HU1A 1XFAA 4IOJA 1OHHD 1A5TA 4MQBA 1J99A 4RZ3A 1XEFA 4IRUB 1GVNB 3BGWA 3U2QA 4DDUA 4E03A 3GJ8A 2QNRA 1Z0DA 1HH4A 2ZJYA 1EWRA 1EX6A 1XTRA 4KAXA 5BN3A 1PVOA 3A58B 3EZ7A 1E94E 3C4JA 2FG5A 4KYUA 3X1WA 4QKQA 4HAXA 4MRSA 2O8DA 3REGA 2A9KA 1M2OB 4HAVA 3I73A 4JL6A 1T8TA 5FPYA 2NZ8A 2KBEA 1GKIA 2NIPA 1Y3AA 3GJ5A 1KSJA 3AGQA 4OQMA 3SBEA 1IAQA 1CTQA 3AKCA 2B7BA 5TV2A 1GNQA 1Q1EA 3B1ZA 5G40A 1RFLA 4LX0A 4XTCS 3ZVMA 1CF4A 1EESA 3QIAA 4HDCA 5KDOA 4LJ4A 4TL8A 3T61A 2Q9BA 4L15A 5CM8B 4CT4B 5FUWA 2C2HA 3EIQA 5KTYA 4EAQA 2HLDA 4JYBA 4UXIA 4V02A 2CHQA 5LD2B 3IIMA 4OI0A 2ZITA 5CB6A 2ZRIA 4Q4LA 4HUTA 2HEIA 2JIZA 4V0ME 3KFXA 3OIWA 4P4SA 3PXGA 2RGDA 2ZQ5A 1P7CA 4P4TA 2ZU6A 1AKYA 4V0MA 1KMHB 2JJ8A 3K70C 2VPPA 3PV0A 2AKAB 3JVVA 2JLYA 5KYKA 5AJWA 1NN3A 1ZUNB 1D5CA 2R6FA 1G291 2G1KA 5FL7A 3RANA 3RSLA 4A6PA 621PA 1NMZA 2GXSA 3AV0B 4PPNA 3G5UA 1XZQA 1XCMA 1ZCBA 2MMGA 4M9SA 2BMJA 1TL7C 3AF0A 2MSEB 2VHQA 1G17A 1T3SA 1XMVA 5H70A 2Q9AA 2ZROA 1T91A 3UWKA 1I2MA 3E70C 3GPLA 1HQCA 2IS1A 4M2LA 4DLRA 1E9FA 2A5FA 5FL3A 3KQKA 4CEIB 3BE4A 3LLUA 1OH7A 1FQKA 2CLDX 4IOKA 1IBRA 4UJ3A 4LHXA 3RWOA 3S1AB 1KK2A 3HP1A 4QXAA 1KI2A 4ACBA 5JSZB 1HYQA 2B8WA 4M1SA 2KB0A 3I92A 1R8SA 2GA8A 3NDBB 2H1LA 2ZJ5A 5BW8A 1FL9A 2J0VA 4LJ7A 2JLSA 1CJUC 4MGIR 1ZM4A 3EARA 1GKYA 4MA4A 4A8JB 2AN9A 4DCTA 5A5GA 2G77B 2O52A 3MLEA 4URYR 3LRPA 3L43A 3RSOA 4URWR 2VHCA 1E9EA 1XMIA 4NL4H 1DTSA 1IOZA 4B33A 2FOLA 3WMEA 1E0JA 1NJFA 1TQ4A 2NMVA 3KB2A 4ZCLA 3CPEA 3K09A 2D06A 4DLUA 4MRNA 4PC1A 2ZUDA 2FWRA 1F2TA 1XD9A 2W58A 1JXMA 2XEXA 2JLRA 3IBYA 3IGFA 5TXGA 1FX0B 4JBWA 5FPKA 5KUTA 1CKEA 3AKDA 2CJWB 2C03A 1X8LA 5JI2E 2W6JD 1VPLA 3OEHD 2GEDA 4Q48A 1P73A 1WCV1 4FMDF 1CRQA 4QM7A 1D2NA 2H16A 2R6GA 1Z6YA 1KGDA 4LC1A 4PQRA 5DO9A 4MDEA 3IIKA 4B2LA 1RYFA 1HV8A 3V4RA 3CF6R 3OAAA 5DH9A 3L0IB 4TT3A 4DSOA 5KU1A 4Q1BA 1M34E 2CCJA 4ZI2A 1F60A 4IDHA 3AUXA 3CB4A 4IW3B 1YE8A 3HPRA 4ERNA 3QKRA 3CLVA 3SR0A 1L8QA 3DZDA 3TAUA 2E1RA 1IY0A 2OCAA 2GNOA 3U44B 4Q1DA 1P6XA 1Q3TA 1VMAA 5AK0A 4F7WA 4TMXA 4ITRC 3QXSA 3UMRA 1OXUA 3KTAB 3RYTC 2RKOA 1W0JD 4URVR 1KHTA 3A1WA 2CMKA 2ZJBA 3SYKA 4AWXA 4RVCA 2CVHA 3UXMA 5CITA 2PCLA 3OAAD 4D0GA 4LYFA 4LRWA 1EGAA 4K46A 2WJGA 4FIDA 2PMKA 3AF3A 4OK5A 5J4HA 3RRMA 1CU1A 3NXSA 1O3YA 4XWOA 1NMXA 3NBYC 4A36A 3U61B 2ZRNA 3DKPA 4GMDA 4LPSA 4DUGA 3SC3A 1TEXA 3CF0A 3CH5A 5DNYB 3ZYCA 1IN4A 2BM0A 1JB1A 3CWQA 5G53C 4B43A 1BS1A 1Z6XA 3A4NA 3I8XA 5J5CA 2O8CA 4ARZB 2W2VA 4IXMA 4OJKA 3QNUA 4OHZA 2UVQA 5K8UA 3U3MA 4YMUA 2CHGA 2GF9A 2OO7A 1XMJA 2GBLA 5IDVA 4F91B 1ZM3A 4Q7LA 1DBSA 5KPDA 1EFCA 4DDWA 1U8ZA 3NIBA 1D2MA 3SEAA 2ZSDA 1M7HA 4AKEA 3THYB 4KVGA 4KFTA 2WOOA 3W5IA 3M0EA 3QJYA 2PZGA 2XXAB 4DLVA 2RGBA 3ECCA 2KSQA 2WKPA 4R9UC 1N25A 4TQUS 4Q1AA 4BEBA 3LY5A 1DOAA 1F2TB 4Q66C 3W90A 1P61B 3B5JA 3K0AB 1OJLA 1B23P 3BB1A 3C5CA 2VF8A 1OF1A 3PEUA 3X1ZA 3GEHA 4N3NA 5EP1A 3RWMB 4PQYA 1V5WA 4HUQB 5JS8A 2IS6A 1KYIA 4LGMA 4NZYA 1TUIA 4QOSA 1XTSA 2YOFA 3K1JA 1VTKA 2ZU0C 3KZ1E 5IK2A 3RRYA 1U0HC 2B8TA 2O8FB 1KNXA 4Q7KA 1XWIA 2OUKA 5E7IA 4A8JA 1JJ7A 2HDNB 1YRAA 3ONWA 1JECA 3C15C 3JVUA 3QBVA 2SHKA 2HXSA 1XTJA 3CX6A 3IDQA 1SXJD 2F6RA 1GRQA 4Q7MB 3ZZ0A 4DT1B 1FNMA 2FPLA 2J46A 1DS6A 2OXRA 2YNMA 4C30A 4LHVA 121PA 3RS0A 4DCSA 4IOMA 2BKEA 1M1YE 2LWIA 4BRUA 2OFXA 4OI4A 1PLJA 2IYVA 3CONA 1DO0A 1W0KA 1NIPA 1TAGA 3WP1B 1JPJA 4V0NA 1GL6A 4I4LA 2QMUA 2FSIA 1OKKD 4FD2A 3QKRB 4FW9A 2VO1A 2WZQA 1SKQA 3QQ5A 4S2EA 2GAOA 3CUEF 2LCFA 1MO6A 3LVRE 4X8HA 1YZNA 2D4HA 3FHOA 4QGFA 1MV5A 1YR7A 2JASA 2VH5R 2IYRA 2ZR0A 3BXZA 4XD7D 1XX6A 5DHFA 4RJLA 3BERA 4LJYA 4QNRA 4K81B 4Q7JB 4IFEA 3RS3A 1L4YA 2VP0A 2VSXA 3K0FB 2BVNA 2GZAA 2VP9A 4D4MA 5M04A 1UEJA 4MGKR 1UPTA 2AD5A 3IBGA 5IF9A 1JQLB 1KSFX 1UKVY 1HA3A 5EXPA 4RSGA 5B30A 4D2IA 3HYRA 1YZUA 4LI0A 5FOTA 4GFDA 221PA 2GF0A 2IUUA 4D6PA 1U0LA 5JMTA 3BH0A 2YWEA 4DJTA 3V00A 1OFTA 4LSGA 3THWA 2GJKA 1E96A 1G19A 5LDDC 2W00A 2ZYVX 4BFVA 4JLKA 1BYIA 3SHFA 5FOSA 4TWZA 2ECKA 1JXOA 2W2TA 3NBZC 5HE8A 1NI3A 2FZ4A 1D2EA 2QAJA 4RD6A 2DR3A 4M1WA 2CE2X 4IJMA 4PPFA 2ZJZA 2FSFA 2XZPA 1N0UA 1IN8A 2PZFA 3SOPA 4KI0A 2W6JA 1KI6A 2NGRA 5JWHA 4TLCA 5C2JB 1XCPA 1IXSB 1KOFA 2HJVA 2YWHA 3FVQA 5BXQC 3BC1A 1XMSA 3KX2A 3SFVA 2WHXA 2XZLA 3FMFA 1AM4D 1TADA 3GLGE 2WMNB 4LOAA 1NL3A 2CEAA 5A4JA 5IT5A 4EJSA 1XXHB 3L2OB 4G01B 2J3EA 5EUMA 2EU8A 1XEXB 4AD8A 3L82B 2GTPA 2GVDC 3GJ4A 2V9PA 4IDOA 2NPFA 2IX3A 3P1JA 3R8FA 1XXHA 4Q19A 1W46A 2X2FA 1BMFD 1FUKA 4L9WA 4ZO4A 2ZAOA 1CRPA 1DAEA 2BBWA 4LHZA 4N0EA 4ASUA 2QI9C 3KJIA 2ANCA 4KVAA 2LKCA 1IONA 3AUYA 4TYNA 4FWIB 1T9HA 2B92A 3EC1A 4GOJA 5CYPA 3EZ6A 4QBIA 2G6BA 1QVAA 3U3JA 2O8EB 1SVWA 3LQRA 4NE2A 4NBSA 2QBYA 4AKIA 1XBTA 1XTQA 3L8ZA 3MUFA 4YQFA 2IXEA 3QKSB 4PHTA 5AWFC 2O0KA 4B35A 1Z6GA 3OHMA 5CYOA 2FFAA 1S3SA 5JZVA 2OCBA 3FKSD 4LWZA 2QP4A 3TGPA 3I32A 1G18A 3C7KA 4CIDA 4R2IA 1VHTA 4TLEA 2ZS8A 2WSSD 1W0JA 3T5DA 3FOZA 1ZCAA 2IF0A 4BZQA 4P4UA 4A1FA 1P75A 1US8B 5J40A 1YR6A 3TQCA 1R5NA 1E9DA 1GP2A 3PEYA 2H17A 2GJAA 2IF2A 1UJ2A 3ND9A 3WBKA 1JR3A 1KI4A 1IJFA 1P2SA 2PCJA 5FR1A 2IHYA 3NHAA 2JLXA 2QQ0A 4HAYA 1JR3E 4MGZR 1RYHA 4A15A 1IXZA 2N46A 1ZC4A 1QBKC 1CBUA 1YHNA 1KSHA 2ZE5A 1JALA 4NTZA 4RKFA 4W7SA 4DHEA 3AVPA 3I5XA 3ZZUA 3T5GA 3LA6A 3NBXX 3B2EA 4I1SA 1XXHE 1E9RA 3P32A 2CVFA 1N5KA 3NEYA 3TE6A 1O87A 4QJ4A 2P6RA 1MO5A 4ZIRB 2EFDB 4OHYA 3VMFA 3OIUA 3PENA 3W34A 5DLQC 3VR3A 2QPAA 3GLGB 1Z08A 1G41A 4AURA 1Z3IX 1W0KD 2Q9CA 2WMOB 1VCNA 4JVNA 2VHJA 2X1VA 4B47A 2NO9A 3BH7A 5FUVA 2AFIE 1TNDA 4Q03A 3B1WA 1ESNA 4RZXA 4XVRA 1XTIA 3RRNA 4RD0A 2VP5A 2JAQA 3WNBA 1A2BA 3B13B 3IEUA 4UKDA 1CJVC 3I72A 4IDPA 1XEWX 2AWOA 3LFUA 2YWFA 3GLFA 2VLIA 1L2TA 2G0TA 2QSYA 1S4QA 6Q21A 4B76A 3LV8A 2IYYA 4GI7A 5HCNA 2O8FA 2ONJA 3R9WA 2ZRGA 5HKKA 3UMSA 1S3GA 2Z0MA 2AXNA 5IRCD 2CLCX 1E2EA 1PUIA 3NC1C 5FOVA 3LD9A 4HLUC 4D4KA 4EIWA 1K5DA 3OEHA 1D9XA 3GJ6A 5FH9A 1OFHA 3ZH9B 4LJ9A 2BC9A 1ZYUA 2GETA 4NYJQ 4LY6A 4TL7A 4WBSA 3AVWA 4DLTA 3UATA 4FMDB 5JWRA 1T6NA 4MRRA 4TLBA 2G9NA 4MITA 4XSHA 3QXHA 1SVKA 2OSBA 3P4XA 2B21A 3LXXA 3ZQJA 2HT1A 3UG6A 5FUYA 2BKUA 3C5HA 3VHXA 2DFKB 2PEYA 3PVSA 1NIJA 4JLAA 4JVSB 1YR8A 4NCIA 3R7WB 4A9AA 4BPBA 1PJRA 4TYWA 1DEKA 1AK2A 3KJGA 1LFDB 2FMXA 1E9AA 4WZBE 5DYIA 1EFTA 4FCTA 2ZS9A 3EXAA 4H1VA 3SS8A 2RCNA 3B9PA 1CJTC 2PT7A 2NG1A 4E22A 3CKLA 1G7RA 4ZV4A 1NSFA 2WIBA 2JDID 5EJEA 4CT5A 2JJ2A 1G7SA 2VA8A 4D4JA 1NY6A 1G8HA 1YVDA 4LPKA 2BBSA 1G21E 3PFIA 1FTSA 1XRJA 2F1RA 3GLIB 1E6CA 1IXRC 4BLSA 3PJRA 3DMDA 1G7CA 3KL4A 3PQCA 1G9XA 2BMDA 4G5QA 3UKDA 3U6BA 1GITA 3H4MA 1E2MA 1OFIA 1Q20A 1BYUA 2OHFA 4BRWA 2N1BA 4BLOA 1VYUA 2E9SA 4URZR 3TR0A 5B2ZA 3WP0A 2JLZA 2QAGC 3AF4A 4X8MA 3EPLA 4GSYA 1CR2A 4CEJB 4BLTA 2FFQA 1GKUB 3MWJA 4JJKA 4JLOA 1K5GA 4ILEA 2L0XA 3GLFB 1NKTA 3KB1A 3H1TA 4DCUA 4Q01A 4EPVA 4OK6A 1ANKA 1EFUA 3LLMA 2I1VB 1T3LA 4G1UC 5C46F 3AVTA 2GKSA 2IS2A 4KXFB 4BUJA 1UF9A 5K8IA 2YINC 3EC2A 2RAPA 1OH8A 2J59A 1W4CA 5KSZA 3C16C 1XJQA 2R6AA 3NH9A 4HLDA 1BMFA 1WMSA 5DIFA 4NDZA 1SXJA 4GL2A 3PUWA 2QRZA 2V55B 2QPOA 5JRJA 2OBMA 2HF9A 2W0MA 1SXJB 3GJ0A 2REBA 4EPWA 4R2HA 4UXHA 1C1YA 4J0QA 2QENA 2ZR9A 1R0YA 1TQ6A 2CJWA 1OT3A 1N5JA 1XDBA 4JLMA 3QPVA 4DLZA 3MGCA 2ZI9A 3QXCA 1C9KA 3WNCA 3EPHA 4TSFD 2PZEA 5J47A
chains in the Genus database with same CATH superfamily
4AW9A 2F4VB 2C7QA 1YS4A 3S68A 3TMYA 4BHTA 4D98A 1QKJA 5EIBC 4KCGA 1Y1TA 1KIMA 3EF3A 2SICE 2W0SA 2H7CA 4QPNA 1FYWA 3OM8A 4IDEA 1OI3A 3A6DA 3K9GA 3WGZA 4WFKA 4P5DA 3ZDQA 5K5EA 1C30B 1OU0A 3PF8A 4CHGA 5KYUB 5IS2A 1E5TA 1WW8A 3HDGA 5COAA 2JC3A 4FXOA 1UP7A 5EIEA 1MGOA 4L75A 3THWB 2OPHA 1BHQ1 4MV3A 4R8MA 3NGXA 3P2EA 2EKDA 1NN0A 1U1GA 4HB3A 1PR0A 1CNFA 3EC7A 3BGSA 4BP3A 1UZNA 2ACKA 4DQLA 5F52A 4DDVA 5IWCA 2NQ2C 3W8FA 1V11A 2P2ZA 4CIAA 2OV3A 3CZPA 4OHFA 3D0OA 1B6RA 4G0VA 1LH0A 2PQ6A 2ZTSA 3MWYW 1X9HA 3R4CA 4LN1A 1D2GA 3ED5A 4BC1A 4CMKA 1VLHA 4DV6B 1DXHA 4GWKA 1UKAA 1G20E 3BMOB 3JQFA 4CKXA 2E4XA 5JAOA 3KPWA 3TEFA 4DBLE 1QG6A 3CU5A 3E7FA 4JUIA 5GJVC 4AWAA 1N6KA 2DYKA 3PPVA 3CZ9A 4KQ6A 3CWZA 5BR8B 4NJMB 3A6EA 3KRTA 1LV8A 1QGUB 1XNGA 1YDMA 4E70A 2A9PA 1BQEA 1PX2A 2VF5X 2P0AA 3IP8A 5TS3A 4FLEA 2AG8A 1Z74A 1UPBA 6YASA 4WA7A 5FV4A 1CB0A 1J7KA 2F00A 3G79A 4Y2QA 3OJXA 4IFIA 5BNTA 3ZVKA 4P6VF 1V2GA 4C7OB 1F6DA 3EZLA 2CW5A 3NOOA 3LX4A 2JAWA 4TXNA 4NBNA 4KOEC 1RIFA 5ED0A 3UHPA 1U04A 1MR3F 1CYDA 4OHXA 4BBAA 2CV1A 3ZJVA 1PGOA 1VIYA 2CNWA 3BS4A 3IQHX 1JNYA 1DADA 1LLCA 2QRMA 2IYLD 3STVA 4A03A 4OHOA 2NZWA 1YD7A 3FWPA 1ZLYA 2GPNA 2DF8A 1YZGA 3QG1A 2NXCA 3HYCA 1U7UA 5TJHA 1FP4B 1KO1A 2GGSA 5GGYA 3IJEB 3ZWVA 3JQDA 2YV5A 5K9ZA 1J0CA 5I7RA 1TA4A 1PU2A 5IK2A 4QHSA 3B1KA 4BNIA 1XELA 3I12A 2ZG6A 3IVGA 1VSTA 4ZKEA 4V1CI 1BGWA 3H5WA 1W48A 4I9FA 3SQNA 1M10A 3S8YA 3QEKA 3UGQA 4K05A 5AVTA 1JEDA 1YTLA 1QR6A 2HF7A 2HNAA 3DVSX 1KO7A 4KK3A 4MLZA 4UEKA 1UFQA 3UK0A 4AUNA 3K6RA 4ZJPA 5CDFA 1R12A 1XNHA 4I81A 2JLWA 1I4TD 4V0KA 3CY6A 3U0BA 1A5AB 3OM1A 3H4IA 2Q4RA 3O3CA 2CCGA 2VP3A 2BDTA 4PGMA 2KW5A 4RS4A 1E3MA 2W2PA 2K4MA 2VHZA 1AUXA 3PQ4A 3OC0A 1BDHA 1ZA1A 4LC0A 4V0OA 1GL3A 2IELA 4TMTA 2ZB8A 3N8GA 4J91A 4KXUA 5FUQA 1CZLA 1OIVA 2OGTA 3LQFA 5MF6A 3RAEC 4P4NA 5KJ6A 4OIMA 3QBTA 2MR5A 3LCRA 2VRWA 1PD0A 3E15A 4JOCA 3VBCA 4YCCA 1QQ7A 5FDFA 2LDXA 3BEDA 1QGZA 3EXHC 1HE8B 3N5CA 5JC8A 3TQSA 2VAPA 5BV2P 1B8OA 3L40A 1EFPA 1N1DA 2B2XA 3ZI0A 1NBHA 4AAYA 4OLJA 5FO0A 4XYLA 1L4KA 4ETIA 1JHZA 2YTZA 3GFGA 2AH5A 4RJKA 5BUCA 5I4KA 2I8CA 3FDZA 3S2GA 4YEDA 3DLIA 1CETA 4HNRA 3ZCXA 5AW0A 2BV3A 3VZCA 1HG1A 1DG9A 4PYNA 2D1QA 2AOTA 2FOXA 3DB1A 5ADVA 2JW5A 2CFIA 4PSCA 4YV2A 1C0IA 2VJAA 2FZKA 2OFFA 3PNMA 2O9JA 3R1IA 3UWMA 3VXKA 1H8ED 2REQA 3G7NA 1RYMA 2CFRA 4K28A 4ZOLA 3ZUGA 4MUBA 4JT2A 3ME5A 1C9EA 4Q93A 1P80A 1T5LA 3R75A 4IWXA 1H65A 4M9ZA 1LUAA 2ZIFA 1W7AA 2RB4A 4N7BA 1VCOA 1JYFA 3JASA 4ZZ3A 3BCRA 2W2MA 1V95A 4CPDA 4IIBA 1EA5A 2QVBA 4OJNA 1ZINA 4X1YA 5HF6A 3HCPA 2CVOA 1E1CA 2WPDA 2ZE6A 4S1OA 4ZVNA 1R3DA 4E2XA 3HZHA 2N75A 1JQBA 2RH9B 3K1AA 1P1FA 2GK7A 4GOOD 4QREA 4HFNA 3SQWA 4H1HA 1DX6A 2PIAA 4R40A 1PW5A 3PRKE 1K08A 1H4SA 1XQWA 1S7GA 2F2TA 3N74A 3G2LA 4IDNA 1RC8A 3AVUA 3LSYA 5C3MA 4F84A 5IMBA 1E2DA 2P79A 3D2CA 2ATVA 5DULA 3GRCA 2JGNA 3N2LA 3NKFA 3DL0A 2BT4A 2X77A 1RCUA 2BWJA 5B53A 5IJXA 2WWVD 2GPYA 1J1UA 1GGFA 3OOHA 1S9DA 4PC7A 1QE0A 3P9XA 5JQGB 4L5JA 1PD1A 4U2FA 4XI9A 1EFRA 4KQ9A 1C1XB 4OHKA 3DCIA 5EHGA 1ZM7A 4IHAA 2JKZA 2WV9A 3G0DA 3NWJA 4MUNA 2PJRA 3AP1A 1Z38A 1PG2A 1QOZA 2XUPA 3UJNA 4NOJA 1UKCA 5KO2A 1DXQA 1BS9A 3EXEA 2G06A 4LMRA 2I76A 1WCIA 1ODFA 3K1ZA 2WYIA 3VNSA 4I3FA 3ZGVA 1HDZA 1P2FA 3LRXA 5DSZA 3DTVD 4JASB 5ALUA 3GQBA 2GASA 2OCKA 3M7IA 4C3ZA 1YB5A 2EX1A 1ZNXA 1RRVA 1R7RA 5U1PA 4RMNA 2GZSA 1PG5A 3B51X 1QS0A 3I0NA 4JFRA 2YWXA 5T67A 4MGYR 5B4TA 2Q3FA 2PTHA 3R3ZA 1VKHA 2FW1A 1EK0A 4D4HA 1E2JA 2QN6A 4UUMA 3R3HA 2Q3CA 4FI3C 3OZGA 1NLFA 1WWKA 2HSWA 1FRVA 2KQUA 3OESA 1FFXA 3B1FA 2KLHA 4NYIR 1YBFA 2D0DA 4DT1B 2HCBA 3PA6A 1RBMA 2WF7A 3HJHA 4X7MA 2R7LA 2DFDA 3DV0B 3L0SA 3O73A 5TQ0A 3JQAA 3GLUA 4DIDA 1G16A 4IWYA 3T9AA 3QUBA 4L1KA 4QU9A 2R4TA 4GOKA 2BEVA 3OFKA 2GCPA 4OGWA 5KVQA 3T3HA 3V1TC 5DEOA 1YKGA 1CFZA 1XMOB 4ZN6A 5JNSA 1GM5A 3H5LA 1KKMA 2Z57A 4ZQHA 1Q77A 3TJRA 4BEJA 2O1XA 3QSGA 3KYCA 5HK9A 2CLFB 1UAGA 2G25A 3K16A 5DIZA 1AQ6A 1LK0A 1GYRA 2R8ZA 3FLAA 2EV9A 4I5FA 5JQGF 5DOVA 2G76A 5CXQA 4X8LA 3WRYC 2YIJA 1G8MA 2HPVA 2QWXA 2F3QA 4HWRA 5A05A 5LUBA 1COWD 1UM9B 3LQYA 3ZIAA 4AUKA 5ALYA 4FFOA 2C42A 2XKAA 3D2LA 1ULZA 2V3WA 1P2GA 1YRYE 4H0NA 5LQRA 3DBVO 3RD5A 4B3DA 2NN3C 5DT9A 2WJZB 3OCXA 1LSUA 1R74A 1VL0A 3V32A 4EDHA 1JP7A 1KJNA 1Z07A 3E05A 2QSJA 1NN5A 2R3SA 3NTUA 3PHLA 4IMRA 4AJ2A 9MHTA 5EWLB 3E58A 3W3ZB 5IVDA 3Q8LA 3H2HA 1OHHA 4M1OA 3RLFA 3U7FB 1S96A 1N4DA 5KOHB 3PFBA 3Q7PA 3TFQA 1FTQA 1U31A 2I6GA 2CBZA 3P8ZA 3THOA 3ZGNA 2CNNA 3TBFA 2FZLA 5M3BA 4NMLA 1XPUA 1NUPA 2I3ZA 3KD2A 3FVRA 4FYJA 3VPSA 1EWQA 4LXUA 3NUGA 4R8LA 3MLAA 3O9ZA 4U7DA 3AI7A 1GHTA 1K7SN 2E1PA 3DO5A 1KAQA 3CBGA 4J8PA 3C3JA 2EW2A 2KPOA 5IW8A 4D79A 3R77A 4YMIA 4L5BA 3GLHA 4CWAA 2XWQA 1U2DA 3DDUA 3IOCA 1QBGA 1VKOA 3MBIA 3OTWA 3W3AA 3U7JA 1CUDA 1N92A 3JQEA 4CZ2A 4FEAA 4OHCA 4BO1A 1MN6A 4NV0A 5TARA 3TLYA 1U3VA 2BUAA 1N2GA 2ZUSA 3MBKA 3I9V6 1O94C 3DFZA 4X3PA 5FNZA 2V6MA 1G6HA 4M7WA 5EE1A 4HGQA 4DSUA 1VHQA 3DL7A 1C7IA 1UQRA 2ZUBA 4LX8A 4UHEA 4A0FA 1M83A 1C3LA 3H1EA 4PZEA 3UWPA 4L8FA 2E49A 1OIXA 3PF9A 1U28A 2ZXFA 1TCAA 2HWXA 4JH0A 5I8ZA 5D2CA 5IX8A 5BO5A 2C95A 2JD0A 3PRJA 5H83A 2BSQA 3OTGA 2MSDB 2RFLA 2OXTA 3RT7A 3UXYA 1NZJA 2FPKA 4U7JA 3MRVA 1O8BA 1QHIA 5C1DA 1IAVA 1PDOA 1YMUA 4GXRA 1YQWA 4R98A 2NU8A 1BE8A 5DTEA 1TEHA 1THMA 5CHEA 1NYQA 5B3KA 3WYAA 5D87A 5IANA 3QLUA 5K3BA 4FFSA 1PWZA 4CR6A 3AM1A 1ITZA 1FQWA 1LRJA 3CX8A 3KLPX 4OHMA 1PKXA 4MMZB 4OHBA 1SBYA 2EKQA 3B6EA 1FFYA 4XASA 3QVMA 1Z4OA 1Y8RB 2QN7A 5JO9A 2D59A 4CL8A 5JD5A 4PC2A 3V3KA 2F9MA 3WGOA 1ZZGA 3G0CA 2F9LA 4IIXA 1S3IA 4KG7A 3QE9Y 3MA0A 4IHJF 5FO1A 4MARA 1LF5A 1AGRA 3KYIB 3M5WA 2AHOA 3D9QX 4EHBA 1F5NA 1Y8CA 3CNNA 4L4YA 4Z7JA 1MC5A 1UKBA 3NEPX 4R81A 4JD5A 2ZIVB 3K8OE 3AZQA 4CF6A 1AHNA 5JW6A 4FNAA 3CZMA 5FV7A 4NAVA 1E79A 3GRAA 3I4LA 1LW7A 4RDCA 4OFXA 1Y9DA 2Z6UA 3PPYA 2G4LA 3WDSA 4QTXA 4Z9FA 1DB3A 4OFWA 1SUAA 2WI8A 4XEUA 1Z2NX 5PGMA 5JBIA 5DM2A 3GLHB 1BX1A 4WNAA 1AKQA 1H94A 1ZK0A 2VIIA 3DE1X 4FYMA 4OREX 4Y7CA 3TBKA 3TXXA 3ICQB 1H9BA 1YCGA 2IXBA 3LL7A 1DVRA 3PTZA 1NW8A 1X8JA 2RGNC 2ZJ4A 4O4IA 4WOJA 5JSZA 3JYOA 4LRXA 2A35A 3HYTA 1JLHA 5K0CA 1NPTO 2HADA 1XXLA 2QX6A 4JKIA 1MHPA 5DJ5A 5IT0A 1HYEA 5LD2C 3RC8A 1RT9A 4RLFA 1FYVA 4GI2A 3WIVA 4M9CA 3AU9A 3E2IA 4MQEB 5EWJB 5DYNA 1II9A 1J8DA 1QYRA 5K3SA 4CFYA 3CR8A 3Q12A 1N1MA 4RA9A 3SFTA 1GR0A 2HRCA 2OP1A 3AMVA 4PZDA 3LCCA 2YY6A 2ICAA 2RBEA 1XOIA 4O5AA 1A5BB 2QT1A 4Z51A 2AZ4A 3O5AA 1IE3A 4ZOEA 3QYAA 3KC2A 4FMCB 2AQKA 1BVUA 3WFZA 3FKSA 4OYLA 3IR7A 3ROMA 3ITNA 3L7BA 4K1LA 1WB9A 4DJDC 1NU8A 2DC1A 2PK3A 1Y6GA 4WZBB 3HFSA 3FOEC 3IP3A 1SC6A 1MBZA 5KNCD 1QLHA 1U9CA 4QULA 3QEBZ 1X9IA 4V0RA 1I2DA 5H9VA 1Z25A 3WLNA 3AJDA 4FSDA 1MH9A 3EUFA 4FXPA 2ZEJA 3GVCA 4OBBA 2PLFA 4KRXA 4B6SA 4BVBA 4GMFA 1VYTA 2HI0A 1IOLA 2IUTA 2WZBA 5GAJA 1JZSA 5U4QA 3DOFA 5K8TA 2CXRA 3PP8A 4CV1A 4KE6A 5B36A 3FOFC 4MXDA 3KJXA 2XZOA 1KBZA 3ESYA 1ISPA 2ZFUA 4PVDA 1JFSA 1P9NA 4H77A 2WUWE 3EGVA 4MOWA 3GELA 4BL5A 2R84A 4ER3A 1GCGA 1ZPDA 3PDIB 2GSWA 2WICA 1GZVA 1E7QA 1P91A 3IKMB 4PGAA 1E2UA 3VR5A 1QLJA 3FTDA 5F4ZA 2BE7A 4JKYA 3MJVA 4QATA 4KLZA 5I7VA 3K0AA 1P1RA 2JI4A 4HSGA 4Y98A 5EQDA 5IT4A 3GNLA 4ZGWA 1EB8A 5DVZA 3OTQA 1EP2B 1QK3A 3W06A 3IDSA 1TQ2A 3NCTA 4L5IA 5L45A 4HH4A 1T34A 1KFEB 2ZJ3A 1SCDA 2XLBA 2ZSBA 3M9LA 4HDNB 4WFJA 1NVVR 3FDIA 3I45A 2HV9A 4ZQCB 3K2BA 4OATA 5FA8A 2QRPA 3NCHA 1P3JA 4B85A 1HOXA 2Y4OA 4NESA 5K3CA 1UKZA 1J0EA 4HI0E 4DWWA 2IJGX 3A2KA 2F1IA 3BGVA 4LDAA 4U00A 2J8ZA 3H9JA 3RHFA 9GPBA 3CNOA 4QGHA 3VO8A 3AVVA 5EZYA 4KOAA 3V34A 1H66A 4II2A 4MKIA 1XO1A 2C5EA 4Z3DA 5CUQA 4A92A 4UMVA 3TQTA 1CEQA 1QO0A 3THRA 2GHQA 4Q15A 3FPCA 1IZ9A 1L5LA 2ATEA 2ZYWX 3EMVA 1WP4A 3GMDA 2XTMA 3KEFA 4BJ5A 4HN2A 3J7TA 1UADA 3KLBA 4A4DA 4TMWA 4YPOA 3JWIA 3HFJA 4KKXB 3H2KA 2BJHA 3GUZA 3HV0A 1T3GA 1YUNA 5LU9A 2BGGA 1DRJA 2B37A 2IY9A 2QR5A 3A25A 5FWYB 4J49A 3VZDA 3ZWAA 5HTOA 4XWWA 5IDQA 2GRJA 2P6UA 2YQ5A 4HBZA 1MC4A 4QEZA 1GFIA 3AB8A 5KBYA 1HSOA 1RHQA 5M5BA 4WGGA 2FZWA 5KYNA 3HDTA 2R6JA 3OU6A 2WAXA 3CZQA 3I5YA 2HA2A 4QRHA 3SYNA 3DBHB 2FUCA 3H19A 4MK4A 1TD1A 2P6PA 1WKCA 5GINE 2QLBA 4LDZA 1ZM9A 1YVEI 2QMOA 2XUIA 4EW2A 3GWGA 4ZDWA 3RTGA 1AS3A 4IDGA 5LZ4A 4KXXA 5CJ2A 4D3ZA 4X84A 1F8UA 2CUNA 1JT9A 2SKDA 2W8BB 3FNQA 2VDOB 4Q37A 1DEHA 1K5HA 1TIKA 2JIOA 3K0HA 4G5XA 1NVUQ 1OFUX 2PH3A 4LYDA 3QFCA 1E2LA 1QYCA 4KR7A 3GBSA 3MTGA 1A9QA 3DE7X 2MSWA 4NZ9A 4PFJA 3SBXA 4E7OA 2ZRQA 1FFCA 2Z9BA 3OLVA 1ZD1A 2IYWA 3CVWA 5FYQA 3ZHYA 3HXKA 1RRGA 4H17A 4CDGA 5BNWA 3C3PA 1T4MA 5ITZB 5B1IA 3R9IA 3PFHA 1D6SA 3AILA 4BECA 4XJXA 3PTAA 2GM4A 4LSZA 3QU9A 4G63A 3F0TA 1SBNE 1JBEA 1R6TA 1XQ1A 2P91A 2VS1A 2WWWA 3IUNA 5E1OA 3RHTA 1CZUA 1YQQA 3WLHA 4F12A 5HHTA 1D3AA 3LBAA 2IYTA 3D3WB 1T25A 1OBVA 3I83A 5B1EA 3SZUA 1JT2A 1IJBA 1OTHA 1S9HA 4CTKA 1JI0A 3U56A 2KM1A 1JKMA 1UK9A 2OESA 4LYEA 1DBPA 3DDWA 3L7IA 2Z6AA 4X64B 3WBFA 4MP8A 1J20A 4O63O 1BXRB 2RGXA 2WIFA 3PJDA 1NHWA 3G5LA 5EESA 3UJ3X 4G4IA 4QAQA 1QG4A 3RUHA 3E18A 3LBHA 5L3VA 2IUSA 2XHEA 3EIUA 3PR1A 4ND3A 3CH4B 4URHA 1Q1NA 2K87A 1W1IA 2VHWA 4QFMA 1QX4A 1XB2A 1JDPA 3W2TA 5E9JA 1YIDA 1M0EA 1JAIA 3O93A 2FR8A 5A3VA 5JHGB 2W83A 1NNLA 1N2OA 3AIOA 5EXEA 1FTYA 4QPDA 1V8FA 3JARA 2HHCA 1AV6A 3O3OB 3HBFA 2Z6QA 1TB4A 3C6ZA 3QV2A 1NW6A 1SIBE 3DAPA 3HKDA 4G25A 3P2IA 2IV7A 3OU7A 4LJRA 2HU7A 4UUAA 1V6CA 1WKVA 2H3HA 4FIZA 3U5ZB 3OT4A 1NG1A 2PU5A 3ROPA 2IHZA 3OIVA 4UBLA 1NU6A 9LDBA 1V0JA 2I2DA 1GFSA 2CYCA 4CIYA 4KPYA 3ADBA 4BQEA 4LGCA 2PUEA 4ND7A 5TQJA 5I45A 1LXCA 3RVRA 1WXDA 1J8QA 1GL7A 2AMJA 2HMSA 2Q0HA 1QF6A 5AW5A 3VYTB 3NBFA 4GVLA 3VSBA 5JMWA 1H8HA 1QNFA 4L9SA 3AZPA 1UBMS 1AHIA 3DOJA 1D4AA 3GZNA 3T9FA 1X80A 2R8XA 4J2TA 5C4MA 3LDHA 1BQ4A 2OBYA 3EF1A 1M3SA 1XDZA 1W49A 2YWBA 4P3KA 3AHDA 4UTPA 2ZXUA 2Y0PA 3ONEA 4D0SA 3FDXA 4PN7A 5A3QA 3IEVA 2YCLA 2V3VA 1HLPA 1KH3A 1JI3A 4WW0A 1YVPA 3PUJA 1TIBA 3VTZA 3N0TA 4DUYB 3ISVA 2ZI5A 3R6LA 1LCIA 1UK7A 4ZICA 1E9VA 3ECAA 1YQGA 2XV1A 3VI4B 2E89A 5IXSA 2P30A 2KJQA 2E4WA 2QRGA 2QMEA 3ZN2A 4P3PA 1B0PA 3M2TA 5LB2A 1IQRA 1EFKA 4NPAA 5H3LA 4ZCRA 2OQVA 3DUWA 1I6WA 3ORQA 3R9KA 2LNDA 2OZKA 4RTPA 1B0AA 2LRHA 2ZVDA 4HEQA 3JTEA 3ORYA 5IJ9B 5K99A 2GO7A 2X1HA 2C57A 5AKXA 4PFSA 2QTLA 3GOHA 5LQJA 3DMTA 3TRFA 3TD9A 1XZJA 4LK3A 3D8SA 1XKLA 3HADA 1I94B 3AVXA 3BAFA 2WTEA 2FP4B 3TR5A 2X23A 3DBLB 5I9BA 4UCFA 2BFOA 4P7FA 3JR3A 4X54A 4LYHA 3S81A 3VKGA 4LBZA 3U7EB 1XEWY 2XR1A 1FBTA 2P1RA 3NKVA 1T8UA 1PSDA 2PZMA 4FHGA 3GN1A 1AQLA 3L0YA 4PXAA 3GD5A 1Z5UA 3U9TA 1MVOA 4KN8A 4AP9A 4CW7A 4E5MA 2XA1A 4HEJA 1NJ2A 5JNUA 2XEDA 3HBJA 1J07A 4X91A 4B34A 3BJZA 3ZHUA 2PAAA 5L3SA 2NUPB 4KYIB 4JC0A 1EP3B 1QF7A 3ESZA 1E6EA 4B3XA 4DE5A 2VI5A 3TRHA 3IBSA 5G3YA 1E7SA 3SSOA 2BZSA 1XDUA 5DMHA 3SXJA 5C52B 3NMUF 2EX0A 4OHWA 1KFJB 3EEQA 2QGZA 1JHDA 3KUCA 2AK2A 2CF6A 2F1OA 5JE8A 3EODA 4IJWA 4O6VA 2PX8A 1RQLA 4MPRA 1A9PA 2GUGA 5K01A 2NUAB 3U81A 4KMOA 1GDTA 1H6CA 4YRAA 3LBIA 3BX1A 5G1NA 3UANA 3A9TA 2A8YA 2G8LA 1ZP6A 1Y3IA 1ZI6A 2J6BA 3E1KA 4M55A 4PCUA 3UTDA 3WIDA 3JZAA 3O1IC 3P0JA 5AK4A 3PUYA 5EXTA 5AVJA 3T5PA 2VG8A 2QHXA 1RMQA 4HLCA 2F1JA 1WDWB 3EWAA 3HABA 1L3CA 4LRTB 1FBNA 3P20A 2WP0A 4R7ZA 3RS2A 2D2EA 1XDSA 1PJAA 4XIIA 1ADGA 3ETLA 1TTPB 1I32A 1V16A 2HXYA 4BTEA 3T1TA 3HC7A 3ZWMA 2Q0XA 3Q9NA 1Z2EA 4Q6WA 4HNVA 4L6AA 2XA9A 4BO0A 4EITA 1NUQA 1WXEA 1P7WA 3NH6A 3OJ0A 3AONB 1NV9A 1BXGA 3NDPA 1GG2A 1QTRA 2FSVA 1Z0SA 4M0PA 3A1SA 4X92A 4OBWA 5AI5A 1W9HA 3H4VA 2P9QA 1KMHA 4UATA 4Y6QA 2DFTA 3D8NA 4JSRA 4WOBA 2FLKA 2FEOA 1VE6A 2FSUA 3RK4A 4E51A 1YMQA 2QROA 3ZV5A 1T4CA 4V1CB 5LOVA 3SWWA 2IA5A 5BYAA 3D7SA 3EGIA 2B6NA 2VNKA 1IH8A 4G1BA 4UVIA 5CXXA 4J6EA 5H8WA 1XD2B 2AJ8A 1GRNA 3GFQA 3WS7A 3ZY3A 1FE8A 1BU8A 4DZRA 1IEVA 1W9MA 3JQFC 1Q95A 2LCIA 4EHHA 4I1YA 2J3KA 3LT2A 2B0CA 4B31A 4HN9A 3H3FA 1D1QA 3K0EA 3C87A 4QDOA 4DB4A 1LJUA 4C14A 3OMXA 4K9NA 2GT1A 3WGVA 4LF6B 4N01A 3Q2KA 1OAOA 2D1RA 1XCJA 4IKOA 1KEEB 3MQ2A 5JCXA 1VIMA 3KXKA 4MNTA 1FDIA 1RAFA 2QNBA 1UKEA 2HQOA 2O2ZA 3JVIA 4OOEA 4DN6A 1SEVA 2FW6A 3FNGA 2A33A 2PZ8A 5CNIA 1SXJE 4FOTA 3W6UA 1V5IA 4WY8A 5CDYA 4L73A 1OXSC 3ZCSA 1HT1E 2FR8C 5A2GA 2ZB7A 4K26A 4KTVE 1U6JA 5E6RA 3GIDA 1A4UA 1K7YA 1QIEA 2IHKA 2OT3B 2YHSA 3HP7A 1EK1A 5HZGA 1PJ2A 2HEGA 4TV9A 3COYA 4EA9A 1ZQ9A 3AM4A 4Q21A 4WCFB 1E2PA 4QSMA 4YQZA 7ADHA 4BQIA 4F4IA 4I5IA 4YXFA 1OJ7A 4GPZA 4KX3A 4UAJA 4UHJA 4YQEA 1XD8A 1RJ9B 5EI5A 1NQ5A 4L8GA 5AUQA 2J33A 4N3CA 2ZYUX 1OZFA 2BKVA 4G5FA 5LN1A 3BHJA 4I55A 1N6IA 1B73A 1ZN2A 2IEIA 4NHOA 3TLBA 2WF9A 4POAA 4DVGA 3I62A 3LUFA 5A04A 1KETA 1QRTA 1D9ZA 3AKZA 1LTQA 5CLQA 1IATA 3GUHA 1ESZA 2ZWOA 1KI3A 2KYRA 2VAXA 3NTRA 3USZA 1H6DA 2V5AA 3CLTD 3HKBB 4Q4JA 3FJOA 2F8TA 1T8RA 3QQPA 3FYDA 3GNSA 4K1XA 3VDRA 4A2QA 5T4EA 3CC8A 1NPDA 2BI7A 2W4IA 3IAXA 3WKBA 2NP6A 2UZ0A 3W0LB 4PLVA 4BFXA 1LBIA 2C7RA 4CIXA 5LL6P 5IABA 3INNA 2O5VA 2C2OA 2NXJA 4PG7A 1Q12A 1E0SA 1RHJA 1RRMA 1UBOS 1KJIA 4HTAA 5F76A 5AXAA 4DAOA 4ZDKA 10MHA 4RK6A 2AWNA 1E1MA 3DWIA 3QYFA 4MV4A 2RGRA 4K6FA 5F64A 4ZCPA 4WTOA 3LKBA 5B1DA 1G8SA 1MB3A 4IHKA 3SU8A 1AGYA 1RWQA 2FPOA 3KBBA 1YB4A 1VE3A 2ZVPX 1KZ4A 3KPJA 4UNNA 2HUNA 2P6NA 3BQMB 5BWMA 3TL6A 421PA 1PJBA 3PWTA 4XAQA 3STYA 1GUAA 2AFHA 2YOGA 4ZOCA 4Z9XA 1FXUA 1Z28A 4D9CA 5JSHA 3NHPA 2PANA 3BRQA 3PUZA 1MOZA 2ZULA 3QTTA 3D7NA 3ZQ4A 1VC2A 1W47A 4K8OA 1KYZA 1X7YB 1VPVA 2WE7A 1GNTA 1E98A 4ZGGA 2PXHA 2F3TA 3X0DA 1DI0A 4EJ6A 4O2AB 4JBXA 3CCFA 3PGXA 4WOKA 3SZOA 4C0WA 1N34B 2P0YA 5BYJA 4L28A 2CFTA 4B3HA 2DEUA 2DKFA 4Y6PA 2JFPA 4BMOB 5EJMA 3ILHA 1Z4NA 3WIBA 4HDOB 1FPMA 4F8YA 1V9LA 2BMAA 5DNDA 1U3DA 3WRWA 1RJEA 3KJHA 1EK5A 1LVHA 3ISTA 5HXAA 4ZHQF 3D3EA 2VPYA 4YXWA 3K0SA 2PVCA 2DVMA 3PUVA 1QHYA 1ZM2A 2GN9A 3EF0A 3THXA 1U3GA 1ZVQA 4A82A 5AUPB 3TK1A 1EAYA 2IEBA 2OCPA 2G71A 4AI6A 2ATXA 2B98A 4QX6A 1XKQA 1IJKA 1WRBA 2VXBA 4E6PA 1Y7TA 2KHZA 2QRJA 2XVAA 5TR9A 3OX4A 1I7LA 1OYOA 4JGBA 1P5RA 5AESA 2PUFA 2CHVA 2VBGA 1BKSB 2JZOA 4M0EA 3SQLA 3WMFA 3PIRA 1XRRA 3IKTA 1F1BA 1W44A 1FNNA 3F3YA 2BBOA 3LUPA 1WP9A 4MV0A 3VR4A 5CURA 2FMUA 1UMCB 4CTNA 2FPPB 2HCFA 3NAQA 2D00A 1E3QA 4JP8A 1IVSA 2ARKA 2V4ZA 4JELA 4YBZA 4AQYB 1JEQB 1N3BA 1QAOA 3AR2A 4Y1EA 1Z83A 3HSSA 1ZBDA 4GL4A 4RADA 1VKJA 2RH5A 3P9QA 4DPKA 3EZ2A 3B1VA 3N8HA 4YYZA 5CB4B 4BIMA 3ADCA 1D03A 2W2XA 2FI1A 2ZTUA 4LRYA 2H92A 2R62A 4X20A 5TPZD 2IEAA 3DEIA 1I1OA 4EOGA 4FSXA 1T6XA 5DHTA 4YUVA 4MKHA 2OMKA 1R6AA 1B8VA 4DBLC 1R0WA 5KVSA 2A1TR 1JHYA 3KM0A 5FTKA 5LQDA 1PZFA 3LYAA 3AU8A 5KVCA 4O4LB 2PBFA 3BE8A 3NHJA 2CSUA 4BWVA 2HREA 5YASA 2R7NA 4LYGA 4CMBA 1VG9B 2F90A 4DV7B 2WM9B 4BDTA 2VPTA 2WA2A 3Q85A 4TL9A 1EFLA 3ER8A 2NLOA 1F12A 2P40A 3UK6A 1ND5A 2AT1A 4PPYA 4IIJF 5BWLA 1XQXA 1DQYA 2XQGA 3G2OA 5AJXA 3QKTA 4Q00A 4U0JA 4GPEA 5IUNC 1W0CA 3JRXA 2J41A 4G5SA 4TV8B 1MAVA 3SVZA 1CDOA 1HT0A 1PBNA 3HXPA 3N87A 4XWKA 4PTLA 4MVJD 2YMMA 1NVAA 3DAGA 3F4KA 3ROTA 2EIXA 1FFAA 4PYKA 3SYLA 4B4DA 2I9KA 3GJZA 2GBFA 3D4PA 2N42A 5K0JA 4W5HA 1F5SA 3B1JA 4HAZA 3E6AA 3BD6A 1O7JA 2Y1FA 3M34A 4H6XA 3AERB 4ZT5A 4E13A 3O8BA 4I4TA 3T0IA 3GNQA 4ZDJA 3PXUA 3PKJA 3NPMA 3WL4A 3WGIA 4OCZA 4M98A 4YUYA 4EPTA 3GA0A 1XZPA 1RBZA 5G41A 2BFFA 2W6OA 4KEAA 2XYRA 3A9RA 1A8UA 1Z26A 4LY0A 3SR3A 4EJ2A 2GTIA 1W2HA 3N0XA 1T9DA 3Q10A 5F1OA 5B2EA 3VKHA 3C8UA 1AXEA 4NONA 2AXPA 4WGFA 3QLEA 1R1DA 3CE9A 5JBNA 3UMGA 3ZU3A 4II3A 4C1BA 1U1IA 4XM0A 1D04A 2EP5A 4A1OA 2V74B 2V6IA 4YH1A 1GDHA 1M7GA 1U2TA 1YVRA 1FDOA 5CYGA 4L8YA 3AF6A 3QI2A 1JU4A 2Y92A 3FUVA 4U5QA 2OKCA 2Y6VA 4AO6A 2AN4A 4AG5A 2Q3MA 3HCEA 3UC5A 4JQSA 1X0VA 3D6NB 4EI9A 5KYGA 5JPIA 1E2FA 3G8CA 3U4GA 4RULA 2XCRB 1R6BX 4RKWA 3OCYA 3RJ5A 2YQZA 3UH1A 3ZY2A 4CIWA 4YIHA 2FSVC 1NKVA 2ZRDA 3NONA 2PV0A 4AZ3B 4MAMA 5JPDA 3HBLA 1T36A 1PR4A 1IOWA 2C2ZA 5DBEX 4PICA 4KITB 4YI3A 3VAYA 5DMXA 4ZCSA 4M0KA 1Q7BA 3D64A 2A1TS 3VH2A 2C92A 3I01M 4NCKA 3VOBA 3C41J 2BGTA 4MLPA 1D6NA 2X9QA 1MO3A 4U2CA 1OH6A 4R2LA 4G1FA 4NV3A 1HGXA 4HC4A 1KQ3A 3JQ8A 4FW8A 1RXUA 4LG1A 4XW2A 5G0SA 1EVKA 4F5YA 3ESDA 1AK9A 3DLCA 1BQ3A 1YS1X 4HDNA 3MRTA 1XAGA 2R1UA 2GA9A 3ST7A 1ZH6A 4L0CA 3UCXA 1T0IA 4LYAA 1AQUA 1Q0LA 4FHZA 5T6BA 1ZRNA 2OP0A 5HG0A 2FWJA 4D57A 4E88A 4QARA 2HWYA 3PHIA 2AB0A 3PFWO 2CT8A 3ACDA 3O2JA 3DCYA 4HNAA 4X1IB 4AX8A 3KEQA 3W5DA 1YHYA 1NAIA 1A9SA 4H4EA 5IEJA 2BHRA 3FCXA 4AY2A 4JP1A 4XE5A 3MM4A 2JG3A 2CVZA 2O57A 2A0KA 3GDOA 3QGMA 4KLRA 4BNUA 1X1TA 1G5IA 2GHTA 4IMJB 1R4ZA 1IBCA 4HP8A 4BE7B 2JBAA 3KWMA 5BNFA 3KDPA 1IZYA 3QBDA 1OXMA 2CDNA 3A70A 3UKOA 4LZPA 4BWYA 3QU4A 4C04A 1VE5A 3L8GA 2DG2A 4KK4A 2EWWA 2JBWA 4YGYA 1RWMA 1V8PA 3IKLA 2Y99A 1WE2A 3CRNA 2IWRA 1EIWA 5GGXA 3DEYX 2HRRA 3TD6A 3KUDA 3GGCA 5EE9A 3W05A 4FCVA 4QUEA 1HNZB 1I01A 3RYFA 3FNIA 2FTKE 3H5NA 4WFIA 5K4GA 3QFTA 3TINA 2Q4BA 4MR9B 3VVMA 2IH4A 1M66A 4FWBA 2EXXA 3H86A 3HHEA 3C5VA 4RHFA 4RSHA 3T41A 2PXCA 3BB4A 2R751 3WNVA 2V54A 3ITDA 4KX5A 4DIBA 3IO5A 1L6RA 1RADA 5HMMA 5IC5A 1XN1A 2BIFA 4GGOA 2AN5A 2QTFA 2OEPA 1KQOA 4Y9TA 1TVKA 2C83A 2QL7A 1YI0A 3WIOA 1KFKB 2XCLA 3VO9A 4ZD6A 3H1AA 5A7HA 1YRBA 3W6NA 3BVPA 4DSNA 2CV0A 3R3VA 4AJNA 1WO8A 1QZTA 5E8JA 4GEGA 4JC4A 1Z16A 4GM0A 1VXOA 3O38A 1WCYA 1SH7A 3LNCA 1TQDA 3CVJA 1BMTA 4GOMD 4RCYA 4X6LA 5KWIA 1N33B 1QFZA 1TZCA 2GYUA 2IW3A 1GLVA 2H54A 3DP7A 1DP4A 2OXFA 1KZ6A 1GG9A 1J2EA 2WRZA 1E1QD 1AKVA 3OF5A 2WAMA 4PYRA 1BMQA 4XGNA 2F43A 3ZW8A 1E7MA 1GU7A 3DDSA 3LBYA 3JD3A 3DKKA 5G0TA 4MX8A 3Q15C 4PLPA 1Q44A 4AKHA 1IEXA 4KWTA 5F23A 2VYFA 3UVEA 1JHAA 1PG0A 1O96B 1UKYA 4CKEB 4POOA 2HM7A 3TX2A 3H1BA 3Q98A 1VBMA 1QP8A 4AMUA 2WDPA 3ROXA 3FX2A 3SKYA 3HB7A 5B64A 2PKEA 1PJQA 4KZKA 4QM6A 3C8ZA 2GR9A 4JZYA 1ZNYA 2ZBEA 3DDNA 4BNYA 2HSGA 4MGEA 3F46A 3A36A 4M21A 3F74A 3GR6A 3H75A 3G23A 4GMHA 3CLRC 3Q0TA 1QMGA 2C4KA 4JODA 4JT4A 4FDMA 3U37A 4B7UA 1RTKA 1Z6ZA 4MKRA 1GNPA 5ALOA 4AXXA 1EX9A 2WTNA 2ZS7A 3E5MA 3F98A 1P4GA 5IM4A 4L8LA 2Q5JA 2J3MA 4PNZA 1EHIA 1SHKA 2VDNB 1YB2A 1S1MA 1L4MA 1XYVA 2HCTA 2IZ1A 1T2UA 1MPXA 2H4FA 4LCBA 3ZJ5A 3M1IA 2W6ZA 1ZIPA 4BN0A 4HK4A 4QBHA