2W2OA

Pcsk9-deltac d374y mutant bound to wt egf-a of ldlr
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
294
structure length
274
Chain Sequence
SIPWNLERITPPRSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDSKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSYCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/receptor
molecule keywords PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
publication title Structural and Biochemical Characterization of the Wild Type Pcsk9/Egf-Ab Complex and Natural Fh Mutants.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 274
sequence length 294
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2w2oA00
1VSBA 3D9QX 5JXJA 1T1EA 5AMXA 1Y4DE 2PWBA 5K7SA 1MEEA 1PTKA 1SUAA 1Y33E 1AVTA 1SCJA 2GKOA 4NE7A 2IXTA 3GCWA 2PYZA 1AQNA 1MPTA 3VYVA 1ZVKA 1BFUA 1SVNA 5ARCA 2W2OA 1R6VA 1PEKE 2Z2XA 4H6VA 3DE3X 1Y3CE 1GTJ1 3AJ9A 1YU6A 3A3PA 1IC6A 5ARBA 1ST2A 3QFHA 4RYDA 4ZOQI 1LW6E 2ZWPA 3VTAA 4OMCA 1PJ8A 1PFGA 4JP8A 5CW1A 3PRKE 1V5IA 2W2PA 3DE2X 1NDQA 3EE6A 1KDVA 1CNMA 1SBHA 3DE4X 3CNQS 1GNSA 1TM7E 1TO1E 4ZARA 1WMEA 1CSEE 1GTG1 5SICE 4DWWA 4C3UA 1SPBS 1R64A 1OYOA 1GT91 3VV2A 2XRMA 4OMDA 1BJRE 5FFNA 2Z2YA 3WIUA 3QTLA 2HPZA 5AVJA 3DW3X 3H42B 1UBNA 2G4VA 5JXIA 3BX1A 1SIOA 3EIFA 3DYBA 1SCBA 4LVNA 3EDYA 3QMPA 1BE6A 1Y34E 4DJ5X 2PRKA 3DWEX 4WOCA 4AKSA 3D43A 2Z30A 2V8BA 3Q5GA 3F7OA 1WMDA 4NMXB 2Z58A 4H6XA 1GNVA 4LVOA 2ST1A 1TM5E 3DW1X 4DZTA 3I34X 1TM4E 3GT4A 4J94A 1SUBA 1EA7A 2DP4E 1WMFA 1TO2E 2ZWOA 4KPGA 1SUEA 4OV6B 3SICE 3I30X 2HD4A 1SCAA 3CO0S 4AKTA 1JEAA 3OSZA 1AV7A 1Y48E 1SUPA 1SH7A 1TK2A 4BWGA 1EGQA 1GA1A 1SBTA 5FAXA 4KB5A 3ZXYA 3DVQX 2WWTA 1SIBE 4MZDA 5AVKA 3VV3A 1AU9A 3DDZX 1S02A 3TI9A 2DUJA 2SBTA 1GTL1 1WSDA 1KDYA 2ZRQA 1THMA 1R0RE 1SELA 2ID4A 3LPCA 3WQBA 2WUWE 1S2NA 5JXHA 1A2QA 2SNIE 1SCNE 2IY9A 3AFGA 5B1DA 1C3LA 4CFZA 3UNXA 4YN3A 1KE2A 5FBZA 2QTWB 2P4EA 3GT3A 4KG7A 3WIVA 3I37X 1NLUA 3DE7X 5ARDA 1GA4A 2PMWB 3TECE 2XTJA 5JMOA 1SBNE 3A3OA 4Z2AA 5AQEA 1S01A 2B6NA 1P7VA 2E1PA 3T41A 2Z56A 3BPSA 1XF1A 2SECE 2W2QA 3AJ8A 4I0WB 1C9NA 1ST3A 1Y3BE 3A3NA 4H6WA 1V6CA 2ID8A 1WVMA 1Y3DE 4K8RB 4CFYA 3DVRX 3VSBA 1C9MA 4CG0A 3I2YX 1OT5A 2PQ2A 1AH2A 1KDZA 2X8JB 1T1IA 2W2NA 1AF4A 3BGOS 3DE1X 5JXGA 5I9SA 3TI7A 1AK9A 4HX2A 2W2MA 2TECE 1IAVA 3DE5X 4FONA 3LPDA 1NDUA 1DUIA 1Y4AE 4C3VA 1BH6A 1P8JA 1YJBA 1BE8A 3DVSX 3ZXXA 1YJCA 3F49S 1SUCA 3Q40A 3LXUX 2Z57A 1C9JA 3F7MA 1T1GA 2X8JA 2DQKA 2PKCA 4M1ZA 3DE6X 4GI3A 1SUDA 1Y9ZA 1SIUA 4WOBA 1OYVA 1SBCA 1SN7A 2SICE 3PTLA 1P7WA 1ZVJA 5B1EA 3DE0X 1HT3A 3L1KA 1TMGE 1Y1KE 4NE9A 1GA6A 1TM3E 2WUVA 1Y3FE 1DBIA 1Q5PA 1GCIA 1KE1A 3P5BA 3SQOA 2PWAA 2WV7A 1SBIA 3LPAA 3HJRA 2Z2ZA 1YJAA 1TM1E 1SCDA 3VHQA 1BFKA 3WHIA 3GCXA 4HVLA 4B5LA 1TECE
chains in the Genus database with same CATH superfamily
3LC2O 3PPVA 1VQ1A 3WADA 2I6QA 4RGVA 1RLTA 2WJWA 1F14A 5IAJA 2OCLA 3BXEA 5F1YA 3TR5A 5ALZA 4ZU1X 3EYWA 3ZZ1A 8ABPA 4W5JA 1G3IA 3VPHA 3ZDBA 5H3HA 2R8EA 1VB3A 2XXBA 3N1UA 4RC9A 4D2IA 3P9ZA 4H7KA 4N18A 1JDBB 4WGGA 5EHNA 4X7PA 5LSAA 1XGKA 4GYYA 3AETB 5KQGA 2RGEA 2E55A 1E9FA 2J9YB 4TLMB 4ZVKA 1NXXA 2X14A 2COEA 4ZV9A 5A3JA 1Z6PA 1Y4DE 2J5KA 3HJCA 3ICPA 2Y8EA 1UQUA 5BOSA 5JNWA 4R3UC 4CV1A 3GDGA 3IEVA 4K86A 4EJFA 4YT8A 2AQHA 4I8XA 4BLQA 4UFPA 1DCMA 1QIDA 3MBKA 2V7TA 1X7ZA 4W6ZA 4NP6A 2LP4Y 4F1JA 4J8PA 3KKNA 3T5TA 1MX9A 2A5FA 3PE6A 4DQVA 3RBXA 2GVZC 1P0MA 1XJ0A 2DKOA 4DY4A 1UFOA 1DCKA 2ACWA 2M1ZA 4PLWA 2WJYA 3E3NA 3GBVA 4U3JA 3JQFC 5B37A 4HC4A 4ZQGA 1R8QA 2VTKA 1I7LA 4V0OA 1MB2A 4I6JA 1Q12A 1UMDA 4XSVA 1H42A 1IFXA 2XBLA 3K1AB 4LQLA 3T15A 5LMZA 1SVKA 3UT5B 4EFDA 3CRMA 2DSTA 2RH8A 2RGBA 3C1TA 5L7YA 3WQSB 2AQIA 4RV4A 1BMFD 1W5EA 2ENWA 2OT3B 4A2QA 3IQFA 4CN9A 1N6RA 2QVCA 3O8LA 4L7QA 2ATIA 3FNHA 4PAMA 4Q3EA 2X9GA 1DBRA 1DEXA 1DMRA 3BCRA 1OE0A 4HN4B 4RMJA 3C7TA 2QP3A 4OX9B 1K7SN 2CVPA 4F9FA 1VCHA 2AHRA 4IDQA 4EPXA 3KYBA 2ZI3A 3HZOA 3G59A 1U9ZA 1YU6A 1A9XA 2CXUA 1X1CA 2PFGA 2VDJA 3K2QA 3BTVA 5TXGA 3DBRB 3T06B 4BO3A 3UH1A 1Z22A 1Y0BA 1J00A 2V9ZA 3CF0A 2N3ZA 2JGEA 3QZUA 1TC1A 4BMDA 4WBNF 1FTSA 3F8WA 2PGXA 4L15A 1PR1A 3C97A 4WCFB 4ZZ2A 4F71A 5JAHA 3RYCB 4GEKA 1RBMA 3CPEA 3E4DA 3IQGX 2GXSA 1GGHA 4IQGA 4O4HA 4RE5A 3JY6A 2VJBA 4YQEA 2QT9A 3GLFE 5BYBA 5LQNA 4JA0A 3CR8A 4GRDA 2I2AA 4ZYWA 1KQNA 3CZAA 3UW3A 3U1BA 2V7QA 1NRXA 1BHO1 4I9GA 5CW1A 1C4XA 2LD4A 4PW0A 5CFZA 1OFVA 2QG4A 2D62A 1FLAA 2BIFA 4UNRA 3LXMA 3WMFA 2IP4A 2IYXA 1WXGA 3V4SA 3NIWA 4J7AA 4ESOA 5L51A 2JGJA 2XOKD 5FTKA 1HI9A 1D1TA 1Z75A 3H2YA 4G5QA 1ZHFA 1T0JB 3NBMA 3UJ6A 1XRLA 2O2GA 2WWFA 3UAYA 4HVAA 4Q6BA 5HFNA 5HKLA 1R27A 2HTEA 3C4VA 2LCIA 4RK4A 4AF7A 3ITKA 3U3ZA 4DGQA 3G2QA 4ZO4A 2RK6A 1UEXC 5K3EA 3TTUA 1BWPA 1FYWA 3LAWA 1W75A 1NW4A 1XRRA 1UOOA 3D02A 3D59A 4OHUA 4QEZA 4WCFA 4DTIA 3RYCA 2O50A 3A6DA 4X00A 4ZD6A 1R5OA 4G5SA 5FBQB 4LDQA 5CNKA 3WK9A 3VC2A 2E1RA 1FU8A 1G3UA 5E3HA 3H8JA 2WSLA 3TTTA 1B8PA 4P22A 5D87A 3GARA 3HZHA 1P80A 4IZHA 4G89A 3U48A 2A6PA 2GR9A 3BSWA 5KHOC 3WAJA 4WESB 1SPBS 1TQDA 2ZBVA 3H1PA 4MUMA 3GA7A 4E7OA 3QA3E 5FUBA 1QM5A 4J76A 4QASA 4QICA 3H2IA 4OMDA 1FFYA 4QJ5A 3ANXA 4MRRA 5DNYB 2E89A 3IO3A 4RTRA 4FEYA 4IWNA 4E13A 1DJOA 1MXFA 4ZC1A 1ZGGA 1G21E 2CHQA 1TU4A 1U7XA 1BJRE 4C4RA 2AOWA 5CX4A 4XEUA 5GQSA 5EJ9A 4JC5A 3H3FA 4MUAA 2FN7A 4PTLA 4DUGA 2CJXA 3U4CA 1VG1A 2G4VA 2Z43A 1EUCA 3K15A 4O1HA 2QTRA 4FBLA 2PSEA 5EMMA 1AS3A 3NPAA 1T9DA 3WB9A 4D7AA 2ZJ7A 5FWAA 2CBGA 3UUWA 3PFIA 4ZREA 3FAZA 4GYWA 3ROQA 3GR6A 2CNWD 2YXPX 1IUOA 2B8JA 3NAZA 3QKRB 4EM6A 3TXYA 3P94A 2D4AA 2W8BB 2EFCB 3VU8A 1SUIA 1G20B 5CVTA 4HNUA 5HIAA 5JI3E 1Z45A 4WESA 3F5MA 2BISA 1R16A 2PIAA 2QNRA 2XYPA 5B58C 1FW6A 3WGVA 5A3RA 3CX3A 1YR1A 4PPYA 4BEJA 2HEGA 5M3BA 1NJFA 3VDMA 3NCTA 2WMYA 1XMSA 3TNYA 4UPEA 3CS3A 5CM9C 1NPYA 1T9BA 1RAFA 4WLEA 1MENA 4IQ4A 2UZ0A 1R0LA 1CY8A 2A4MA 2W90A 1OFUA 3OKAA 4NMWA 1BU8A 3PKJA 5HKKD 1JPJA 3VSAA 3KJQA 1HFWA 1QNFA 1RIFA 2EP5A 5EQDA 4D9FA 2P4QA 3QVKA 4LVOA 4NDZA 2YHSA 2ECOA 4NYJQ 2JFQA 3TIGA 2VIIA 1P1HA 1PJLA 4RTLA 3VUEA 2FEPA 2GFHA 4MW4A 5CTAA 5AJUA 3ET5A 4WY5A 1FNBA 3KS9A 3GN1A 2MIIA 1VXOA 4R81A 2VH2A 4GI2A 2N1BA 3HKCB 4YXFA 4NMHA 1WW3A 3KDSE 1N75A 4P7KA 4TSKA 4QHTA 4FFWA 1FFGA 2REBA 1G20A 3CN7A 1A8QA 3PHBE 4PN7A 4OL9A 1UFQA 1WB6A 3CO5A 1Q20A 1R8SA 4HFNA 3WI7A 4KX3A 3RTBA 2JNWA 1WQ1R 1QK3A 2CD7A 4GM0A 4O2AB 3GF4A 4P8RA 3S5UA 3VR6D 3VYSB 3QEOA 4YGXB 1Y5LA 3T5CA 1QLJA 4U9HS 2OUKA 4KI0A 3UCXA 4DCUA 1ISIA 3GJ3A 4UMFA 1EK5A 2P9FA 4AG6A 1N8KA 4RZSA 4Q1AA 4TTRA 3C5EA 1WP4A 2WLTA 1O6BA 3MTIA 5KTNA 4MMXB 1X2BA 3BEOA 3LYUA 2UVDA 3PT9A 3F6CA 4XIGS 2PTGA 4KEAA 2ZYDA 2QLJA 1RXCA 1GLNA 1LRJA 2PT9A 5HYVA 1BDIA 3OQMA 3W9BA 3V7WA 1QR6A 3PFGA 2HRBA 1U7OA 2VQ6A 4IIFA 1Y48E 4ZCPA 3HKCA 1TW2A 3B1KA 5JFTA 2HSEA 2JFOA 2ZXEA 4B45A 3OU2A 4PC7A 1WCWA 3V9PA 1RC8A 3B13B 1ADCA 4MR7B 4EEKA 3HCRA 1NMXA 2RMKA 4HLUA 4Y2XA 4HN2A 1SPXA 3ILXA 2NU9B 1KSFX 2YN4A 3ZLBA 4YA6A 3MW8A 4C2TA 1R0BA 5G3YA 2VLBA 5JZVA 1V4VA 1J0AA 4EW2A 1DIBA 2LWIA 1YRAA 3F1KA 2D1YA 5EJMA 4CM5A 1L8AA 1X15A 4B3MB 1AU9A 2O0LA 4KRFA 1NC3A 1H8EA 1Y7TA 2QG6A 1HOTA 3Q98A 3HB1A 3TZQA 4FFPA 4R69A 5ERYA 1VKJA 3UK0A 4PQEA 1O0CA 2J7PD 3L7DA 3PD7A 2M2IA 1EGHA 1P17A 1ZH6A 1FY2A 3KT0A 2IC5A 4MW0A 1PTJC 3P9NA 5BUQA 1Y4SA 2D1QA 1NLZA 3RARA 1VHDA 2FPSA 1R0RE 2B8WA 1O95A 1XNRB 4E4TA 2DHCA 1F8XA 1VE7A 4MTLA 1LDMA 3ER8A 4NICA 3PXEA 3G0IA 3DAHA 3NBZC 3KOMA 4BO4A 4MR7A 4WQMA 5KYKA 4RWEA 4HWTA 4D57A 1SCNE 1WZCA 3LO8A 2OB1A 1LCIA 1EDOA 1VLZA 1GL3A 1WEKA 4MDHA 5TGTA 3RTCA 3JYLA 4Z1MD 4LISA 1SB9A 4UHCA 1MIOB 4NMMA 4DGSA 1W4AA 4FYJA 3DLCA 3T9AA 1ZUNA 3VI4B 2Q8PA 1JDPA 4Z53A 4RK6A 3I6ZA 1IBCA 2A9PA 2OPHA 3I23A 2PSJA 4YP7A 4NU8X 1EE2A 5ARDA 1ZH4A 1UBHS 3QNMA 2A94A 3HB4X 4K26A 2X0DA 1ULBA 4DIKA 1MGPA 4DRYA 3S55A 4O25A 4Q47A 2FQ1A 2O3QA 3DWIA 1J1UA 4Z2AA 1U8UA 4KTVE 4I7EA 1RKXA 1R6XA 1MO6A 1QKKA 1K08A 2EEZA 2QRLA 3DM5A 1SD5A 3I42A 3QX8A 4G0YA 4G6ZA 2EZ9A 5DXAA 1TYEB 4F4HA 4E32A 4EI7A 4W82A 1XMJA 2J6BA 3C3YA 3MFQA 5D51S 2Q62A 3OQOA 4O29A 2IHBA 2B61A 1ODKA 2J5XA 3DFZA 5LQMA 3MTBA 4RABA 3WLSA 2ON6A 4CHGA 3QYPA 3UWPA 4BFLA 2FZGA 4FFBB 4NCAA 2BV3A 4F11A 1IZ8A 4E5NA 6YASA 2B36A 2XDWA 4BMSA 4D92A 4GX2A 1MIOA 2G1AA 2P2SA 5HUQA 3UPDA 3TS1A 4Q7JB 3UC5A 1T2EA 3T3OA 3NU1A 4YMIA 3AK4A 2Z4RA 2LDBA 1FDRA 4UXJA 3BGSA 4YECA 5CDSA 4P33A 5B58T 1Y3DE 4AZVA 3Q85A 4BBJA 3U9LA 1OREA 3BGWA 4P35A 3AKEA 3S8EA 2C2XA 4KL8S 1S8OA 4R1UA 4GOND 3PR2B 3CRQA 3PWZA 3QVJA 3ZGOA 3T94A 1GZUA 2GJAA 1OXBB 2J9GA 1TUGA 2ZAIA 4UOQA 3DCJA 1X9GA 3E35A 3LDUA 4L8LA 1UBEA 3EA4A 1AK9A 2JCBA 1XN1A 1QRUA 5ESRA 2TECE 3PJFA 4UUMA 4AJOA 5IAEA 2PSFA 5DWVA 3HQ4O 5H1YA 1L5KA 1NDUA 5CFLA 5CYOA 1IPHA 4PSKA 3RYTC 2O7NA 4O4HF 1QIJA 2HCFA 4J4HA 5ITZA 1PX0A 3SYKA 3DWFA 2QY9A 3RS0A 4DQUA 2O8VA 3M81A 1EQAA 3OD5A 2E48A 1I10A 3KHSA 5H4HA 3TLYA 2ZUDA 2E49A 5FEMA 4DCNA 4ZMRA 4RF4A 3QLVA 1MHTA 3Q40A 1RJFA 2EWWA 2OFXA 5GV7A 3TQQA 4JBIA 5GINE 4BXOB 3FUTA 5E3IA 5F23A 2V45A 5JHGB 5C52B 1PP4A 4G1FA 2CDAA 3M4YA 3A7EA 1B42A 4YRTA 4TUYF 3I6QA 1DL5A 3H7IA 5IC5A 1KARA 1GKKA 1T1GA 1VLHA 4L28A 3WLHA 1WPRA 3ICCA 1FF9A 1M2OA 1XCGB 3AFMA 4KO4S 1NMSA 3C3XA 1DAHA 4WL0A 5DYIA 3V2HA 2J87A 1V43A 2AWNA 1M2EA 1C7QA 4G4GA 4MKFA 2RC5A 1Z4NA 3RRNA 1OR8A 2PE5A 5BN3B 1SG6A 2HKIA 2QQGA 4Z8YA 1JHZA 4QO7A 1GVNB 1HQYE 1YMVA 4B3IA 3CX4A 1W44A 2AJCA 2GZMA 2FV8A 1VKHA 2H1WA 2NACA 2RG7A 5ED0A 3HCAA 5LBIA 1SBCA 1A72A 2QRJA 4LMPA 6AT1A 5JADA 4IUBS 1T5HX 1KZ6A 1SN7A 4QG7A 4DN6A 3A1UA 1OXKB 1CDEA 4DMGA 1NKVA 3TZHA 5B2EA 1BVHA 1PJTA 2PR7A 1JDNA 3REGA 4PZUA 4YMUA 2ZRFA 1NHGA 4YJ2B 4B7XA 5KNBA 3C3PA 4JI1B 2GAFA 2EVWX 3PVSA 3W7BA 5HJ5A 3CUYA 2GD2A 1DI0A 1X1AA 4NAVA 2OYSA 5TS2A 5FBVB 1KEWA 4AJHA 4ARUA 4BXOA 4AKGA 5BUZA 3E27A 4AD8A 3BL8A 2FAXA 2WHPB 1Z0ZA 1L3BA 1EVIA 2FW9A 1XG5A 3F6YA 2N0SA 3N0RA 4FCWA 3AFIA 3ZDQA 1P74A 2OCYC 1XQ1A 3SZGA 1C9DB 1Z4LA 3V4LA 3BJZA 2RAPA 3HO1A 1PKXA 1TRKA 2F59A 2WRZA 1CPYA 4M55A 3Q9SA 1BKDR 4J16A 3AVVA 3H9EO 2Z9DA 3N0TA 3MGBA 5G4KB 1P2UA 2RC6A 1IONA 2P6NA 3A4YA 1BWRA 2ZG6A 4YY3B 3W2FA 3PCXA 4URYR 1GRVA 1FOEB 2F3UA 2ABWA 2YTZA 2XT9A 6CHYA 1I2ZA 3T7SA 1GRRA 3LFUA 1RMTA 3ORSA 4BVBA 2P3LA 2OQIA 1JQJC 1YZVA 4HFJA 3PNOA 1DWUA 4NNPA 4BNYA 3KEOA 3OOHA 3OX4A 4OL0A 5ALEA 4YJ2A 2W2XA 3ME5A 2I71A 5JAQA 1JHQA 1NUHA 2VYVA 3C1OA 5GM1A 1PT6A 4LDZA 4MV9A 3B89A 1W49A 3H9GA 2F00A 2C3UA 3IQXA 1N3LA 2XQVA 4TRNA 3K1JA 5SYMA 3VKWA 1ZOOA 3WISA 2QW1A 4ZZ1A 1N2BA 2ZU0C 5M29A 4DV2B 3LGXA 1Q50A 2IL1A 3N2NA 1LPMA 3K9QO 3F6EX 4LJYA 1POWA 1O9HA 5LL6P 4JOSA 4BO1A 3BMCB 5IXSA 3A2KA 2ZB3A 5H02A 3ODPA 5J58A 1K98A 3BQNB 2ZWMA 4ZOAA 5IM4F 1A76A 5G4KA 3HACA 3UA3A 3HYSA 1HDXA 3WQQA 2YXBA 3N2YA 4IGFA 1YB2A 2NIPA 4EA8A 3GRVA 2FWMX 3D0RA 2VJOA 4AMBA 3RIEA 2GM3A 5IP5A 4KR0A 3UMBA 3UYLA 4UUBA 2IT1A 4FDUA 3TAXA 2BEUB 3FWPA 1KFKB 1T3GA 2Q3MA 3L8ZA 5J4LA 3KJIA 1DIGA 1Q7BA 1QVRA 1X8XA 4AQYB 4F96A 2BMVA 4URHA 2D5BA 4JR2A 1P45A 3N5CA 1YQEA 3ITDA 4GGOA 2JVIA 5F76A 4FHGA 4AI6A 4PZYA 3VC3A 3U4GA 4RVNA 4HD8A 3WHLA 4AJ2A 4BMVA 4CUKA 2WWRA 1DRKA 5DEIA 3BXOA 1DQYA 2JPDA 4J4TA 3ZW8A 1H65A 5IKMA 5BV1A 3MGGA 3V1MA 4BLSA 5TSDA 1VLJA 3NHWA 3VBCA 5C8YB 3WP0A 1GNPA 5TR9A 1ZQ9A 3TDMA 3NOQA 2G0NA 4XOIA 2EHJA 3QXJA 1YRBA 1OYWA 2XB8A 5F2KA 3SFTA 4DVJA 2AV6A 3LNTA 1WSWA 2HWKA 4LHZA 3BMCA 4B2IA 1QHNA 3K0AA 2GX6A 2RBGA 4LC1A 3HDTA 1U0BB 2H16A 3A05A 4FKMA 1M8JA 3OEYA 5HE9A 2AG8A 3KHUA 1B1CA 1XROA 1BC5A 1FBTA 3KQTA 3D54D 4MRVA 4K2HA 1CU1A 4AX8A 1Z4OA 2CJWB 2ODNA 3LI2A 4M0FA 3TZ6A 1XMIA 3A3PA 1Y6RA 2DAPA 2WI8A 1KYYA 1EBFA 5DULA 5JSUA 5IVKA 1QYIA 2F48A 3MJFA 5JDCA 2Q9CA 4J1TC 3OX3A 5LJLA 2FVXA 2A0YA 4LTDA 4NCIA 2DLDA 1U9IA 4XWWA 4HB4A 3A6LA 4M0UA 1HFKA 1UJNA 1U6KA 2B4TO 2G82A 5GJWC 4B2YA 3QTBA 2WSSA 3TE7A 3TRJA 4HAUA 3HBAA 4ZVPA 10MHA 4D9HA 2ZE5A 2NPFA 3J7AC 2EZUA 1S2LA 4X61A 3UGKA 1JXQA 3ONVA 1KJYA 3PEEA 4O63O 4UVIA 5B36A 3QEJA 4IZIA 1THTA 4US2R 5KU7A 1ECPA 1RZRA 5KX5B 5D3QA 5C8YA 2FXIA 3KC2A 3G7UA 3LTEA 4DLKA 1F17A 2RAVA 3FSRA 2YKGA 3GK3A 3GRRA 3VO1A 3DE2X 1QYDA 1UL1X 3CH7A 5IFLA 3IDSA 3LLVA 4DMRA 1QZ3A 3GAFA 4FOTA 1VHWA 1N7IA 3M6UA 3ONDA 1T8TA 4BCBA 1NQXA 3FDXA 4HTFB 2CJWA 1ECJA 2I2XB 1NBOA 2WM8A 2GWHA 3MCTA 3P9XA 1XXHE 5EVJA 2C4UA 4MEAA 5FT9A 4C7OB 4IMPA 3R5SA 2C8VA 5G0TA 1Z7YA 3CNQS 3PQ8A 2HJWA 4HVTA 1SQ0A 3TDNA 1H2EA 1XL0A 2NOAA 3CKYA 1SCIA 2ACEA 2WF9A 4ZARA 1GKYA 1NXQA 2V59A 3LWNA 3MWJA 1RPZA 3AGPA 4XJXA 2QD5A 3T7JA 4P92A 3TLJA 4AKEA 1JBKA 4OQQA 4QFBA 2ZUBA 4XOUA 5AK3A 1Y9AA 3TZKA 1QQ7A 1WXWA 2LDXA 2VUTA 2XIJA 1E7SA 4DLPA 4QWWA 4HPJB 5M04A 1A9RA 2P4SA 2FWRA 3HR7A 2X13A 2HJ9A 5A5EA 5L3SB 1Y9JA 3LWDA 1FP1D 2JAPA 4G36A 4CCYB 1ZD8A 3WWCA 1L7XA 2IHUA 4W5TA 5TT1A 3KXLA 5EJ4A 4ARIA 1HTWA 3WMGA 3HP4A 2CXTA 4OY3A 2O3JA 4RD1A 1PR6A 1ZD3A 1X39A 4HTFA 1S5PA 5D3MA 4PQYA 1JU3A 1DKPA 4GICA 5TMPA 1LVGA 2YXDA 2ZAGA 3C3BA 5C3UA 1Y63A 4YHBA 2DC1A 5LNK1 1OBHA 1ZWKA 1DB3A 2X1MA 5LB4A 4QU9A 1J5XA 2CNOA 2IP1A 4YUYA 4YWJA 3BX1A 5ITWA 3FHOA 1M0SA 4L08A 3WBFA 5SYNA 2JGFA 3B2QA 3CUSA 4E6EA 1NWHA 4LZLA 3VX4A 4G0PA 3G1TA 3EZGA 5JARA 2BBTA 1KRHA 1HTBA 3KWLA 5HPYB 2YIMA 3PJRA 1U8FO 3GG9A 4W63A 2I4NA 4CZ2A 1IHXA 2FPPB 1YR8A 1JIUA 2BELA 2VT6A 3KT6A 4WOCA 1S89A 3NRBA 5HZKA 2HRRA 4PG6A 3RUDA 1X6VA 2AYZA 5L3SA 3LUFA 4XVQA 2D5IA 4CCYA 3DOEA 1E18A 1PJAA 3PZRA 5ELMA 2JD2A 1PNOA 3UN1A 1CEEA 2I65A 3Q5GA 1U3TA 4XQGA 3G2IA 1B74A 2LE0A 2Q07A 4TKLA 3UJCA 3FF1A 3DSRA 3SLRA 3AF6A 3JV7A 5F1OA 3TPFA 1R2QA 3ZXIA 2IZ6A 2HLNA 2VZEA 1W5SA 4OA5A 2FUNB 3I28A 4R98A 4ZAGA 4LWOA 4CMEC 2QPTA 2GN9A 4MW7A 1EE9A 3HKDA 3QLTA 5BORA 4PG8A 1Z63A 1SCKA 3JZIA 3WRXA 2PXXA 2NUTB 4K6KA 5FL7D 5I01A 1B76A 4ZOEA 2WUDA 2GEDA 2QTNA 1EJ2A 1KY3A 3WZ2A 2V1XA 4CMGA 2KM1A 1FYEA 2NZJA 3JSAA 3O8NA 1R00A 4DMHA 2C97A 2R7NA 3DM9B 2BLNA 4LKOA 4X62B 1F7VA 3K94A 3D3JA 4ENQA 1N34B 4Y2HA 1KO5A 1XCBA 2FETA 2G7ZA 2Q4BA 1Z29A 1OSNA 4TMZA 5BT9A 4BVJA 1ISGA 3KZCA 1CY4A 3EUWA 2O4CA 4I9UA 1SB8A 3T5AA 1SKUA 4PX9A 2WMDA 1FS5A 2OZEA 4O0MA 4UREA 2O1SA 4BAUA 4FNAA 4KPGA 4BLPA 4IICA 3NP9A 3FPHA 2O9JA 4MW1A 4P7FA 3RFVA 5JNLA 3OZTA 4O1MA 3KZNA 3BL6A 1NBME 3ESZA 1E6WA 4C4ZA 5JYDA 1OFUX 4NV0A 4JLBA 3R76A 1CDOA 1DAOA 1ZVMA 3AYXB 1KDTA 2F90A 2WE7A 5EKUA 3VNRA 3EIWA 4J0CA 3OSZA 1XE3A 2CFTA 2O3TA 1J06A 2WW8A 3G6KA 4FNGA 4P08A 5DHTA 2OLEA 5FXMA 3V8RA 3A7DA 4P86A 2NUTA 3TW6A 3EVEA 4OK3A 4I8DA 4WKPA 1KNQA 5ER9A 1H5QA 1NUAA 4R5MA 4XD7D 1E3DA 1NVKA 4NECA 4PZZA 3K3PA 3MEQA 4QPNA 5SV2A 1N5LA 2DSNA 5HVNA 1T0BA 1BXGB 3FPCA 3V48A 1U63A 1ZM7A 4LDJA 4LRWA 1MQSA 4YAIA 4I3GA 2GN2A 1RACA 3NVAA 4FVTA 1YRWA 1XK7A 3DHWC 1AGPA 2L0XA 4PYQA 4XIYA 4GLOA 4H3HB 4UOEA 2FR0A 4JL5A 3VNVA 1IWPB 4S05A 2E5LB 5CT8A 5EE1A 1OWLA 1SIBE 3UK1A 1PQPA 2R44A 5CCBA 1AZTA 5AVKA 5EIBC 3DDZX 4FYIA 5EHZA 4OLAA 4TQUS 3KPVA 3SJCA 4UULA 5EIEA 2OZKA 5I7VA 5IT9A 2O2EA 4QBTA 4Z9FA 5AO9A 1T9CA 2CV0A 5LYJF 4Y2TA 1ISRA 5IJ9B 3H5IA 1WSDA 1HUQA 3EVZA 4NESA 3A31A 3O94A 3TB6A 4DDTA 5C18A 4K7JA 3C7DB 3FMPB 1ZJZA 4I46A 4RXUA 4B1FA 2VT7A 4HHEA 4YAKA 5CFNA 1I1HA 1W52X 4HDMB 1MB0A 5CB0A 5JV5A 5CPBA 1LY1A 1SR8A 1UP6A 3G0BA 4NSNA 4DEXA 2CXNA 4K03A 2F3RA 2W4QA 4Y6LA 3RVPA 2V8OA 3HBNA 1BXGA 5HCIA 4AJ4A 4CW7A 2TS1A 1G8AA 4H0CA 4Y0AA 5FIUA 1PWZA 4GOJA 4HDCA 5B1DA 5KTOA 4LJ6A 3WLPA 1LNZA 4KO1S 3RVMA 1V47A 5JHHB 1KE2A 2Q5EA 5KYTA 3E22B 3MOSA 3O82A 3PZBA 4KG7A 1NF2A 5FJJA 1TCCA 3QI7A 1N57A 2VTEA 3EFEA 5KI6A 4BRSA 3LBIA 3S3TA 1GNLA 3HO6A 1U7ZA 2H9IA 3PKZA 4FYHA 5F35A 2P5TB 4IO0A 1W6RA 4A5OA 3WMXA 3SQLA 4A73A 3EMKA 1KO4A 2G80A 1W4RA 4KVFA 3ZPXA 1L4UA 4C08A 4UUOA 4N8DA 1SOAA 5AW1A 2JLVA 1LDNA 3EPKA 3OU6A 5FQNA 1W4CA 2YNMD 1VKNA 4R1TA 5IJ9A 4UVHA 1QFZA 2C1ZA 3F5QA 1WEHA 1O8CA 3W5IA 5HK9A 2ZJ3A 4WY2A 4D6PA 2E1PA 1CZLA 3QG5A 1PJZA 1U5CA 4KGXA 3ZYZA 3KJEA 4P93A 1CKEA 1KZGB 1X38A 2DWCA 3KHTA 4HDMA 1L4LA 3V2IA 1FIUA 2O7RA 4R7GA 1GZ4A 3BJRA 4MYSA 3IBGA 4XDHA 4MPRA 4RX1A 1PZFA 3NHKA 1EVYA 2QN3A 3H6HA 3MFYA 4M0KA 3IO5A 4DDMA 2YWBA 4YT5A 1AQ6A 3D6MA 2PT6A 4P3OA 4Q66C 1UKEA 2MSLA 3BC1A 3E22A 3JQEA 3CR7A 2X6QA 2Y1GA 3BCHA 2XV1A 2IDJA 3KVRA 4X97A 4YRBA 5KVCA 1JALA 3OT4A 3ZGVA 5KQRA 3TINA 1NXTA 5HF9A 4Q3OA 5KNDD 1YVPA 2DGDA 2DKNA 4J4BA 4BS9A 1N4DA 3F96A 1RQ7A 1C9MA 2GGSA 5DN6A 1JB9A 2HF9A 3RC3A 3K5IA 3RS3A 5IULC 3AP1A 3O2NA 1ZMOA 4CQJA 2NP6A 2ORVA 4EQ6B 1OOEA 2VZ8A 3O75A 2V7VA 3TDKA 3NDRA 3E82A 3ZYCA 4C7KA 2XNKA 2PH7A 3ND5A 4GS5A 2EX1A 2C83A 3JQ9A 4XM1A 3SNKA 1VDZA 2QZSA 1E94E 4HGZA 1ODJA 3MQFA 3RJMA 5K1ZA 3DKRA 2AUTA 1VXRA 4KKXB 5ES4B 5EIXA 3E84A 4LS3A 3KVYA 3N2EA 5DHRA 5IASA 4LE2A 3JARA 1NI4B 1KH1A 1W73A 3GGSA 3KXPA 4GZ5A 4HWSA 1E79A 3SYLA 4LE1A 3V97A 4EA7A 1F20A 5IDXA 2WQ7A 4CTNA 3ASVA 1F2TB 5DB4A 3HUEA 3FOWA 4DB4A 3GPDG 4B3XA 1JLRA 1XZJA 4HKTA 3C8UA 2FMUA 5EAIA 4V1CI 2FQWA 1SQ5A 3FNRA 4FS8A 3K70C 1GNQA 4HWOA 4Q16A 2KQUA 3AUFA 5C8YF 1WRBA 3RFXA 5FWNA 1QH9A 1G18A 4HDQB 1RDFA 4WV3A 3C3AA 5CVCA 3HSSA 3OLCX 2BUAA 2PFKA 2CFRA 3GGPA 1JX6A 4NOJA 3PCTA 3SHTA 3IERA 3N8NA 1D0SA 3ZHQA 2O2SA 4M1KA 5KB3A 4UM9D 5TMBA 2BFBB 3EXHC 3NV7A 3VR4H 4EQ6A 5KQLA 2R0QC 4B3FX 2B1JA 3H6KA 2HIMA 1YE3A 3FUUA 2D54A 4YDRA 1QG0A 1KJZA 3J81A 4EI9A 3CCFA 4DNQA 2VP2A 1PFUA 4AUMA 2R6R1 3NTQA 3DEHA 3TEFA 4FE4A 3ZHUA 4UAUA 3JPYA 4KLRA 3LXXA 1P9RA 1NI4A 1V35A 3AEQA 1VRWA 2PMKA 1ND5A 3AVWA 1Q1AA 2REXB 4M1OA 4OM7A 1TLFA 1F2TA 3GRAA 4QYTA 2OV2A 4XYBA 3K92A 2HV8A 4FLMA 3CZCA 3KOYA 2HNKA 3VZSA 2XHEA 3DE0X 3Q6IA 1JG6A 4F8YA 4V0NA 1D1SA 1DT5A 2Y92A 3C6YA 4KQ6A 3UQZA 4DUGD 2IH5A 2XYRA 1B4DA 2W71A 4GZ3A 1IWOA 1WR8A 2O1EA 3O8DA 1JUDA 1M33A 2ADMA 2JGKA 2M9MA 4XJSA 5G1NA 5LFAA 3WNZA 2Q45A 2QZ4A 1DBIA 1KYVA 3LBHA 4BUJA 1ABFA 3RRXA 3LX5A 5JS1A 4TLLB 4XUGB 5WRFA 3U7HB 1GPMA 1DX9A 1JQBA 2WP8J 4LJ4A 4UEOA 4QNMA 3UJHA 3DAYA 1Q74A 3EUEA 3OBIA 3D8HA 2YN2A 4JC8A 2HW8A 1D4FA 4AN1A 3OM1A 4F2GA 1YUMA 2WWIA 4PFKA 4I1OA 3OAAD 4FYWA 1RZUA 3PPWA 5B30A 4AMZA 1IHPA 1QQ5A 1T3LA 5CBKA 3KSUA 3OA2A 3LPLA 2NZYA 4FS3A 4N03A 1MBZA 2RK3A 1KAGA 1LBQA 2Q2NA 2QMOA 3PLRA 3X1YA 4UJ3A 2ZI4A 3U6KA 2DLCX 1Y8RA 4BNJA 3CKKA 1NUQA 4KWHA 1H4QA 2BT4A 2XVZA 1TF2A 1T4MA 2C57A 5JDIC 4F1WA 4FDAA 4PLFA 1ECFA 2ZBRA 3ISTA 3U0BA 4FE7A 4XI9A 2XW6A 4JJKA 5ALVA 1D4OA 1VECA 1YS9A 3TLGB 5L7TA 2O52A 1LSOA 1S2OA 2IOHA 4I55B 4OH1A 3RHSA 3ZHYA 2XB9A 3D9QX 1JHPA 3B36A 3NJ8A 4QOGA 3E3LA 4K8OA 1K8XB 1XCOA 5K4AA 4MYCA 4LX8A 4PXAA 4IXDA 5D2CA 2OBYA 1G16A 3M3DA 5K0GA 2PGAA 3GPLA 3NEPX 1ZKMA 4X8MA 2FP4B 4REOA 3Q8LA 1E2LA 3IBTA 1Z5ZA 2NSYA 2WDPA 1R66A 1Z5UA 2IE8A 2PGOA 3WV4A 5AXDA 3NP7A 3L93A 2JLYA 1HWYA 2DMRA 4RF3A 3WLFA 3WV5A 1PZEA 3CW8X 3VZDA 3HNPA 3AGQA 3LP5A 2BFEB 4BO2A 4CWAA 3TX2A 4PQRA 1W1UA 1XNJA 1Y37A 2R7KA 2CN1A 2X1VA 3O3CA 4IOJA 2B20A 1KOFA 4TVSA 2B1GA 2LUOA 3ZV6A 3GCWA 2WB2A 4CCAA 1XLTA 2Y6VA 3U7FB 2JGNA 3UXMA 1HH4A 3B1YA 3WS7A 4CT5A 2QT0A 1I9CA 3M3PA 1TOAA 2P40A 1V8BA 5F3DA 2QVXX 5A0FA 4CTJA 3DL4A 1JDUA 4FCVA 5LC1A 3HUDA 2YWJA 2YMLA 3D7NA 3OC0A 4B84A 3SY8A 4DJAA 3X1XA 1IN4A 3V8PA 1WXEA 4JAVC 1R4NB 2AEFA 3OOWA 2LTAA 2FP4A 3SC3A 4BNFA 1E0JA 4GBJA 3FKSA 5ES3A 1E2NA 2P69A 2QVZX 2A0WA 3UUEA 4S04A 3NLLA 3QU5A 1V2GA 3O1JC 1G38A 2YY5A 4KBFA 3D4BA 3EVDA 1C7JA 2VDUE 4BNDB 4R2MA 2IZ7A 4AL4A 4B80A 2BFEA 1EDEA 3TW8A 5ARBA 1G1AA 4R31A 2VWQA 1FEZA 1MN6A 4QL3A 5KSPA 4E30A 3VJLA 1ZH0A 2XNHA 3DLHA 2HR1A 1DRVA 1H8ED 2G9VA 4JIMA 3EIEA 4RQUA 5L3ZA 2ZWPA 3RR2A 1QTQA 2I1LA 4ER6A 3HCDA 2BMAA 3G9ZA 4IILA 5I4CA 3RU9A 3OZAA 4IR7A 4CEIB 2X40A 1YK0A 1GAQA 2C94A 1XF9A 1TVMA 3N8IA 4K9PA 3NALA 2DX7A 4D74A 2XGSA 4PZAA 3N3BC 2QM8A 3VPBA 3MCZA 4N01A 1G64A 2QN1A 2HJGA 4N5DA 3U3MA 1E2MA 3CWCA 2QR3A 4L8YA 3W77A 1G8JA 3I2HA 4NZMA 1KDVA 3WLLA 3QU9A 2VF2A 1D5WA 4Q05A 1E1MA 1UK6A 2BTOA 3NWOA 4PSAA 3UFXB 3VX3A 4DMCA 3JVEA 3Q8XB 2AZDA 4I4TB 2IHZA 2X7HA 1KDOA 2FSPA 2XE7A 1K92A 3A1WA 2A8YA 3A9TA 5AR1A 4BNDA 3DE4X 5DIZA 3I4CA 4G0VA 4TN1A 1L7VC 4BLRA 1ZSVA 3BD9A 4EENA 1L7RA 1ONSA 2EX4A 2H1CA 1L1RA 2NTYC 3OEHD 1MG5A 1TM7E 1U8YA 3OZEA 3IVCA 4PAQA 5HF5A 2ZDGA 2HXYA 5AI0A 1KMMA 4TKUA 1HMYA 3N8HA 4KE7A 1GTG1 2FSGA 2WT9A 1TFUA 1ENOA 2OPBA 4EY3A 2NZWA 2H54A 2HHLA 1ZNYA 2PGNA 4CEIA 3EGWA 1XCPA 3H86A 2QV7A 2VJPA 4LTMA 3JASB 2QLFA 3KSRA 4GX5A 4TXMA 4UMDA 1XJ5A 5IZCC 5I8PA 3W1VA 2QBYB 1XLVA 2BGUA 1YB6A 4UAGA 4B3GA 4Z4CA 2SKEA 1G9SA 4JENA 3WJ2A 3R3WA 1WWKA 5AI9A 3RQSA 1A4RA 1QSGA 1XTUA 1VGQA 1YH3A 2QD4A 3NBFA 4TTTS 5K51A 221PA 1E4EB 4S1OA 1O7JA 2VG8A 1CUFA 2QD2A 3SHWA 5ALPA 1JDSA 3BF7A 3JZAA 1PUXA 4K1LA 4YT2A 2DQZA 1FX0B 4MV5A 5BSTA 2VJAA 3QLUA 3PQDA 2YX1A 3CNHA 3DW3X 4OSPA 4QTZA 2QPOA 3TQSA 1XU4A 5DIFA 1NKTA 3IMGA 3ROFA 3UMSA 4R2WA 3D64A 5DTQA 4BFCA 3EIFA 3QHAA 3WLOA 1D1PA 3QGMA 3FW1A 4ZHQB 3FVTA 1GGEA 4JZKA 4WZZA 1D4AA 1D6MA 3SDSA 4PYJA 5BSGA 3WGJA 1U9JA 1T3TA 2CEKA 1IVNA 4ZJYA 4U6NA 4G8CA 4ALIA 4QQ8A 4CMIB 2HRZA 2BRUC 4MVXA 2PY6A 3CNNA 3LK7A 3LA6A 1FK8A 2C9DA 4KXLA 4U7HA 3JWIA 3W8RA 1HE5A 4MGYR 3JASA 2E2WA 1T8WA 4HXYA 1JEEA 3EGDB 3DNFA 4JXXA 1SGWA 3FMIA 1YTLA 3VR1A 4AKSA 4LYYA 4N0EA 3PBKA 5TMDA 5HZMA 3KSZO 4X20A 2QSJA 2Z30A 1E4EA 5E9WA 2EU8A 5EWMA 2RGNC 2JRLA 4P32A 2ZYVX 2UYYA 1F5SA 1FX0A 3UA4A 4WKBA 5DDIP 3B3FA 1N0UA 4AZ3B 5EJ2A 1MFZA 3GEMA 4M37A 4ZQBA 1O94A 3HDGA 1T2AA 3DZBA 2CLIB 5K0NA 1TKBA 4H3SA 5TV2A 1CJBA 2PLRA 2IGTA 3RKUA 1MQ9A 4DLRA 5CP8A 3MF4A 4XEHA 2GN8A 1KOGA 1NUTA 3M4NA 1FYFA 5B64A 3TQTA 2P2LA 3ETNA 4B3TB 2JH3A 3UAXA 1QE3A 3N59A 1UODA 1WD5A 1JPUA 3PGVA 4E4RA 1DKNA 4NY1A 5JCPA 5KNLA 5CH8A 3Q88A 4OATA 1KSHA 3G0GA 5DX1A 4FNMA 2XADA 2NSLA 3EGDA 1DAIA 1Z12A 3TLBA 1CQWA 3GMTA 4DM4A 5I47A 2Q3JA 5ERGB 1UBTS 5DNDA 4NPAA 1I24A 4U4AA 3X1ZA 2JFYA 2DP4E 4YCAA 2OGSA 4B9AA 5JAIA 2GEUA 4QSMA 3REQB 4D3YA 1YJ5A 2UYOA 3A1NA 1YHYA 4JJ6A 4M76B 4PLYA 3M83A 5G53C 1TVKA 1H2XA 2OD2A 2ZJOA 4RAQA 4ARZB 3LECA 1QYXA 3MJCA 2ZQZA 3I5MA 2GYWA 2NN3C 4M49A 4WFQA 3AR3A 4RACA 4KR2A 1QDLB 3ACBA 3U4DA 5BSRA 4AZ3A 1EDDA 1R4ZA 4ZVSA 1XRNA 3OQBA 4R8LA 5I7HA 2IHJA 1D8AA 3CU5A 4MVJP 3RKSA 2BEJA 4X65B 1M66A 2FU5C 2X22A 1J23A 1QGUB 2RHJA 4XB6B 5IXYA 2CJYA 2IFTA 1HYEA 1CR6A 3CB2A 3FGPA 3GGCA 2JAQA 3MRVA 3QVLA 4LYAA 3UTDA 4XA8A 1M10A 2UKDA 5EFZA 3S2IA 6REQB 5JJKA 3FUCA 3LSTA 4DQKA 3NPMA 3OEEA 2ZBGA 1KEEB 2OHFA 3E7WA 1TMKA 3HWSA 4U2GA 2C4VA 2JLBA 3TBHA 1WTAA 4XYLA 3ZXUB 3O26A 1PJ4A 3IQZA 1L4NA 2QHXA 4B0PA 2CHVA 2ANBA 3ZHBA 1T3HA 2HSDA 4KOAA 3JAKB 3RS2A 3RHZA 2ZSIA 3REQA 3U40A 5I7OA 1IBKB 3B5EA 1SHZA 2H11A 1DX4A 2QX4A 4OK5A 3OT5A 3TKAA 2BMEA 4QRHA 4QELA 4ARZA 1YFLA 2BR5A 4G8BA 1KFJB 1NP3A 1R6TA 3F6SA 3J7TA 3QY0A 4IJ6A 1DT3A 5H70A 1K89A 4HNQA 4M88A 2JDIA 3OWHA 4ZANA 1C3VA 2TSYB 2ZRQA 1NOKA 4GE3A 3I62A 2H4WA 2FX5A 4EBBA 4M0LA 4QOFA 1JTVA 1VIVA 2R79A 1QGUA 4WK6A 4CF4A 1TQ6A 4Z0NA 3P19A 4ZYYA 3K6RA 1LBIA 2FE4A 1OX4B 1L5HB 4CR8A 3S81A 6REQA 4DREA 1AGYA 1XRSB 4FOSA 3L84A 2MOKA 2VAPA 5JXGA 4ENWA 2ODAA 1KEEA 1NVVQ 3TOCA 3DO5A 4IIXA 3OPXA 1RLIA 3THWA 2A5JA 1IXRC 1WDWB 3EMVA 1IBMB 3PGMA 2PSSA 1C3LA 1HZZC 3IQIX 4QODA 3U7EB 1AD2A 2P4EA 4IDDA 4NOMA 3IPXA 3QM1A 2RJ3A 1JAHA 1OXMA 3A1SA 1XAHA 3NKFA 2Z9BA 2AL7A 3B9BA 4IHAA 1UAGA 4Q19A 1IL0A 2J0VA 1Q6YA 1TLTA 3DXFA 2G09A 3UICA 3VKVA 2BH2A 4WZAB 2O8BB 3UOGA 3G82C 4PO9A 1FSPA 3SK0A 1FMLA 4BMPB 1BW9B 3OI7A 1EFVB 1RCUA 3Q3HA 4OQLA 2NXEA 1JHAA 4V0ME 4KQ2A 3C39A 4LSWA 2CF6A 2XNSA 4EZBA 1J22A 3H1BA 2TMDA 1II8B 1NTRA 1FXUA 1RXUA 3HUTA 4KWTA 3TLKA 1I1QB 3NOXA 5HW0A 5KWJA 1Y6ZA 1KOJA 1H2AS 3EAFA 4UFOA 1P6QA 4KAAA 3I2FA 3PIDA 2PBLA 4GI1A 4F5YA 3LYLA 3CSDA 2FPGB 4LWQA 2RE8A 5ICFA 5AI8A 1P1KA 1OX4A 1P5FA 2FJPA 2P9QA 4HGOA 2WG0A 4KYUA 4LYGA 2ERXA 1L5HA 4W5RA 3H11B 1JMKC 2AJLI 2XCQA 3W9SA 1ZIPA 2Z9CA 3FR8A 2JHAA 5KTTA 4LJ5A 1G8GA 1A71A 3GZTB 5ALYA 1EZ4A 1QQTA 1LBTA 4ALMA 4OX9Y 4LFCB 5HM8A 4JSTA 3GP3A 1ICEA 3H84A 4UQPA 3STVA 1QF7A 3TVYA 3IT3A 3KNZA 1XL1A 1QWOA 2I34A 3FYUB 2QG9A 3P71T 4D44A 4YRJA 9ATCA 1UUFA 1ZCZA 1X1QA 2J41A 4WZAA 2V7EA 2ZIXB 4G67A 3ZZTA 4MULA 4PGGA 3ZDFA 1BW9A 4IKEA 2WSBA 5EIAA 1T10A 3AI2A 1ONNA 1RZVA 1W1IA 2KYRA 3M1AA 3ZBUA 1II8A 2WSSD 2H1RA 4HT3B 3NTUA 3IVXA 5BXYA 4RVUA 1DPGA 2FOXA 5EZQA 1V1JA 2KJQA 3IBCA 2FPGA 3FZNA 4Y6OA 2OQVA 4KACA 1FNMA 1LXCA 2A57A 4CI9A 3U61B 2QUIA 1E5DA 2WAAA 4H1HA 3WLKX 2IU3A 2AN5A 1IAVA 1QK5A 1S9HA 1K5GA 1L8OA 2ZR9A 3MTDA 4PYNA 1OWPA 1TU0A 5JI2E 1UJMA 3W8NA 1KAQA 1Q1EA 2YWXA 3K9WA 4IIGA 2VRCA 2PKEA 2CYBA 4RPCA 1Y4AE 3VPFA 1WDTA 5FPQA 1S96A 4RJIA 4TS4A 2HSWA 3ITEA 3N2IA 4BATA 2ZUVA 3FA2A 1KJQA 2XITA 4HYTA 2HLHA 3BM5A 3T7RA 2IS6A 3LP6A 2EJWA 5HOEA 1L7BA 3FYUA 3MM4A 1KZ7B 3LVBA 2NO4A 4ROSA 3RAFC 3F46A 3NRJA 4JLAA 3ETLA 4DW8A 2DVMA 4EL5A 2AW5A 1NQTA 2GUWA 4YALA 1LPPA 2X3FA 2KBFA 1MO4A 3LUDA 2P41A 2X19A 5FTNA 3R6LA 4ILEA 3ZXSA 1YACA 4IIBA 3CWQA 1DRUA 2WFAA 1U8TA 4NATA 3W7VA 4I5IA 2I7XA 4XWYA 3ECSA 3K73O 1Q0HA 2VQSA 2QNIA 4IOLA 1J5EB 2DWUA 3BRWD 4RA6B 2LZ0A 3EVAA 5CHEA 1YNSA 1SUDA 3SZRA 4IJWA 1JTEA 2YYZA 2QTVA 4PHGA 4AG5A 1OTYA 4I50A 3ANTA 1NM5C 1X7HA 3R3VA 4P84A 3VNQA 1W7AA 2XRFA 2AI1A 3I0MA 1ZN8A 2D2FA 3L7JA 4BWYA 2UUAB 9LDBA 1CUVA 3K8QA 4G86A 5ALGA 8GPBA 2Z5VA 3UCEA 4AECA 5A0VA 1DEAA 1RYZA 1V5EA 1W48A 1KFCB 3DTVA 4Q34A 4PC1A 5D01A 5I9BA 5HJEA 3EG9B 1OILA 3ANYB 3DZDA 2ATXA 1ZLYA 1Y1KE 3ZNPA 5FYDA 2IK8A 2G72A 2ZPAA 2VQ3A 2ZIEA 3LYAA 3VH1A 4YMHA 4ZDJA 5AVXA 4UMEA 3GLFB 3SE7A 3HO8A 1O6ZA 1P18A 2QENA 2HF7A 1DEKA 3D5EA 1SVMA 1IJKA 4GYKA 2DWOA 4CLXA 1VBMA 3D8TA 1KE1A 3AONB 1XEXB 3C6XA 1EE1A 3AH8A 1PI3A 3EOBI 1QP8A 1S2MA 4RA6A 4AY5A 1X7WA 2SKDA 4MTCA 2WY2D 3EYAA 5BWCA 2Z2ZA 4D4MA 1H2FA 4IDPA 5FAKA 2PS3A 1BTOA 1P9OA 1QGYA 1PR3A 3SHVA 1H6CA 2V5VA 4AKIA 5BSFA 3GA0A 3PLNA 4G4JA 2XRYA 4OI1A 5CCEA 2AEEA 5AKYA 4FWTA 2ONZA 3HRIA 2MSKA 1FJ2A 1R0KA 2C9OA 3ONEA 4HDSB 4DM7A 1WB9A 3EG9A 3G7SA 4F85A 4AURA 3IOCA 3MIIA 5CFPA 1J0XO 1MTZA 2XWSA 1YL6A 3AJEA 4LY6A 1FS6A 2X42A 5K3BA 3PQCA 1SU8A 1B8VA 3W2TA 5T4BA 1XTQA 1E5TA 3R2JA 2B8TA 2RHBA 3GL9A 3H65A 3GLFA 4MW6A 4O08A 3V4RA 2FSVC 1Y4UA 3PYLA 4B31A 1LPAB 2NQTA 4ZAVA 1NYTA 2BM8A 3O4IA 2VT2A 2VF4X 1PEAA 1YRQA 1DP4A 1LH0A 1XEXA 2R8YA 3CEMA 3E23A 3O8QB 1NJ6A 4L5AA 2VPXA 2SCUB 4M99A 3WOVA 3EJ6A 4J0JA 4TMKA 4ZT6A 2UU9B 2XVAA 4NTZA 3KVNA 2AOXA 5GWXA 4BN5A 2DECA 4Y9UA 3R1IA 4JX8A 2REOA 2YDXA 2O48X 5FPPA 4RQTA 4D9MA 5CEFA 5JU6A 1F0KA 1G21B 2IEIA 4BJ3A 1H69A 1Y5MA 1Q7RA 1E2DA 3EZXA 1Y7IA 1E4VA 1X1BA 2DTEA 2ZYHA 2XF8A 4MUGA 4A03A 1M0EA 4KFCA 1J56A 3TLAA 1GPJA 1IY0A 3OJXA 4HDSA 4IVQA 5COQA 1AK2A 4CQMA 3PDUA 4CL2A 1UAYA 1PE0A 3S2ZA 4QECA 4TYMA 3K0KA 1CQZA 4DKJA 2NV6A 1NJ1A 4TWZA 4DL9A 3QHPA 4F5EA 1L9KA 1E20A 3F5SA 1CUJA 2OAEA 1N9KA 2HU8A 1FMFA 3IUNA 4WINA 5DYYA 4DVGA 3HTXA 5FA8A 4DLSA 2GRAA 1DFIA 2WLSA 4CNQA 1QO0A 3IFSA 3O8OB 1E1QD 3Q11A 5L53A 1XQVA 1JXOA 3RK1A 2REQB 1OFIA 3F4BA 3RSHA 2SCUA 2R85A 4H6VA 5DK6A 5K6AC 1SM4A 5AJWA 2QS9A 1EUDB 1JZTA 3MGCA 3NEAA 1JJIA 5TPWB 3PXGA 4CR7A 3NASA 3ZC3A 1I4EB 3KKMA 5DV9A 1G21A 4K87A 2O2HA 1T8PA 1E9EA 3CZQA 3F5FA 2ASVA 4M1TA 2VHCA 3K2IA 1M6YA 4RLHA 1II0A 3X1DA 4CV2A 1YL7A 2QW8A 3LWZA 3NVDA 4UVEA 2ZE8A 5IARA 2AXNA 3JR7A 1A8SA 1M2VA 2WJVA 4OPMA 2GYUA 2GJSA 1CG6A 1WLSA 3OLWA 3IVAA 5AHXA 5I3CA 4IS2A 4RL4A 3H9JA 2WQ6A 1UH5A 5T5QA 3SKXA 1KY2A 5HOQA 5LP6F 3BJIC 3I6IA 2YY7A 3NFRA 2WUFA 1ENZA 3H5OA 2O2XA 1EVQA 4R1SA 3QQ5A 1EB8A 4Z0PA 4M7RA 2REQA 2CEAA 4FGKA 1W0KA 2AK3A 4JLDA 1BQ3A 3KOZA 3MD9A 4NK5A 1T25A 2WF7A 4OBXA 1QAMA 4RPHA 4XVHA 1HDRA 1CNMA 1OCEA 4HH4A 1P6XA 3NUGA 1LRLA 4KC0A 4R83A 3WL5A 1EUDA 5TPWA 3AFOA 5FWDA 4KO3S 3UAZA 2XMRA 2VK4A 3ZDEA 5E38A 4P3NA 1NVXQ 4WBXC 1PJQA 4UZSA 1XC7A 3V8BA 1YR7A 5CLQA 4S0ZA 5A04A 3JCZA 4B4VA 4TWJA 4UTZA 1NNUA 1UPCA 1I8TA 2GBGA 1TO1E 5PNTA 4IPTA 2QZZA 2FTKE 1EINA 3QMVA 1NX6A 1G3MA 1T8UA 1HBJA 4FSHA 3L46A 4MWCA 3CM0A 1CT9A 3VR3A 1WTCA 1WO8A 5AUOB 2I8LA 4X90A 3G9XA 5AW6A 4XCQA 1ZUD1 3KLBA 4B6SA 5JLJA 3G8BA 3KCQA 1GPBA 1EFCA 1VSQA 3B8HA 4B2PA 1GT91 4L3OA 1AJEA 4TTSA 1PQ4A 2VHYA 4PYOA 3G2PA 1LI5A 2Q21A 1FFEA 3MINB 2P6RA 1RI2A 3ZV3A 1M0WA 1QQAA 2VATA 4RHYA 3RCBA 3RIYA 1Z17A 2CZGA 1XVTA 4EABA 5DM60 5CVEA 4R8KA 3NTXA 3U3XA 4YCCA 3WLAA 4QGAA 2YC4C 3H42B 2Z8YA 2DFTA 4IG4A 1OASA 2FE1A 5DLDA 2ZM5A 5JXIA 4EKEA 4P34A 2RONA 2ZTLA 4MNTA 1RTTA 3NETA 2I4OA 3FRIA 2XCTB 4XGIA 5AOBA 1KZYC 3UK7A 3VYUB 4LJAA 4ZK6A 4AAYA 5IU6A 3FOZA 4W8OA 5EKXA 3UK6A 3A6PC 2AFHE 3JVUA 1XEWY 1P2DA 3UJ8A 1RQXA 2Y71A 4M83A 1D2HA 4TV8A 3RF7A 4CLOA 4LXUA 1BXRB 1TTPB 1WLYA 1XRJA 4XZ3A 2Y66A 4Y8VA 3AEYA 2PXHA 2WV9A 4A2WA 1SUWA 3OQPA 2GBCA 2BYTA 2NADA 3T9FA 2WT4A 1QGED 2V5AA 2Z8YM 3KYJB 1JNXX 1I3NA 3G0DA 1A1VA 2C5GA 5KYGA 2G9RA 4QJIA 3HRHA 4BB9A 2FN4A 4FN5A 3V4ZA 5L3QB 1C2TA 3MINA 4XWKA 3DB1A 3O90A 2CXOA 2JKYA 3IAM1 4RMNA 4YJDA 1Z74A 4AY2A 3GDFA 4GMKA 4FHCA 1DMSA 4ABYA 4X1KB 4MPJA 1XZHA 5K8VA 2Z3WA 4MA4A 5EA2A 2C9CA 3U6BA 4GVLA 1WPQA 3D6FA 4KIWA 3LNCA 5BY2A 2DZDA 4U0JA 1QO9A 1XVUA 1EXWA 3AUTA 3NAQA 5DLEA 5JD4A 3WFIA 3C3CA 3OM0A 4MQUA 1SD1A 1YMUA 1UBCA 2GEVA 2VNJA 3LUJA 4LV5B 4IBOA 1GPYA 1PS9A 4YQYA 2EEPA 3I34X 4WCFC 3EOZA 3GT4A 5EHIA 1KYXA 1FPMA 2J3LA 4KVGA 1DIAA 1I3CA 4Y0VA 2C99A 5J2UF 5LKRA 3K16A 2JCYA 4B8WA 4DG5A 4DCTA 3TWOA 2PXCA 1QIFA 3LC7O 3IKJA 2I7DA 5EXDA 4HH0A 4TZ6A 5AW3A 1NFFA 3IE2A 3AIIA 4MAMA 2WUGA 5JH7B 3H05A 1K97A 4A27A 1UT8A 1JYEA 4OIMA 4QBHA 1JBQA 2JAOA 4J0GA 1K66A 3CO0S 4O5AA 2AUMA 3BHJA 2O54A 1RAGA 3GVPA 4X1KA 1VDMA 1ZY2A 3RTEA 3PEYA 1YDFA 2VBGA 4P3YA 5EOVA 3NM4A 5A02A 2G0AA 2D5CA 4NVRA 4LJ9A 1VE3A 4N5IX 1HQDA 5AKIA 4AIIA 4CIVA 3W2IA 2XECA 3MUNA 2C9ZA 4FFMA 4F5WA 1U7PA 2P1DA 3PUIA 2EF1A 5DHSA 3ZDRA 3IJEB 2AF4C 2ZJ5A 4I50F 4DT1B 1DHRA 2ZRPA 5LQCA 1PF7E 1NW9B 4YJFB 1C0PA 1SD2A 1NVDA 1P72A 4RFLA 4KZPA 1KH2A 4CVNA 1I4LD 3E3MA 3OCWA 2WUEA 3KAQA 4TLBA 1IEWA 3B70A 3JQAD 3KQSA 4XVRA 1AGNA 2XUHA 4RLSA 1VTKA 1HLDA 1JQ5A 1XD2B 4J0HA 3KHKA 4JQYA 4W9MC 3CVXA 2HBQA 5IC6A 3HFRA 3R6WA 4OP3A 721PA 1LDBA 3RU7A 4DR1B 4L9WA 4R4JA 5JH7A 3QUAA 3H16A 5KPJA 5FI0B 3K4HA 1YF3A 3WL3A 4TS9A 3A4IA 5AK5A 1JP7A 3EXIB 2JCXA 4FZ3A 4Q9LA 2I62A 4QLAA 2FW1A 1N6HA 3WRYA 3KYDB 3QV2A 1I36A 4UBKA 1YI8A 2W37A 1DIOB 3OT1B 3P4XA 5A03A 3A8TA 3CLTD 4RD0A 1K8QA 3FPSA 4ENSA 5JQGF 4Q24A 1JIVA 3DBHB 3E1KA 1S3SA 3ADOA 3N0VA 3HB5X 2O0KA 3WK5A 1C7EA 4YJFA 2VYND 1H2BA 3GC6A 1C7IA 1UK8A 3SQNA 4B76A 1CUXA 5EP2A 2XTNA 2QVYX 4BNZA 4OI0A 3PC6A 4DMKA 4E70A 5C2JB 3A6KA 3UGJA 2FW7A 1SWVA 2Q9BA 3G02A 5DASA 1DDGA 4DLZA 2QV0A 1XD2A 1X1DA 3UNXA 3GEBA 4MLPA 4CJXA 5BWNA 3D6JA 3MXOA 5EMHA 3U4MA 4C4OA 1JAZA 3DFKA 3L8HA 4QYMA 5HDBB 4O4IB 3UH0A 2CNLA 2Q5QA 4MQMA 1QIIA 5FOQA 1HYGA 2JGMA 1TQ4A 1P3JA 4AWBA 1JG1A 1QCCA 5FH9A 2H65A 3LPNA 4A16A 1Z7WA 3IP5A 3PFWO 2BMFA 4BX9A 5KWSA 4PPNA 4EYSA 3SD7A 3ZHZA 3A3OA 2WG2A 4R2IA 4XYMA 3PHJA 2PNJA 1DKUA 1VMKA 2P6PA 2Y1OA 4IDHA 3KX2A 1R10A 4JNKA 1YWGO 5EINA 3NATA 5ENDA 3WTCA 2IKQA 1IUPA 4BQIA 1RAAA 1NRWA 3RS9A 2XUAA 5BSMA 3ZI0A 3NHYA 3OICA 2W93A 3DBHA 3UVEA 3N53A 1Y8QA 1OZFA 2BLLA 1IJFA 3P0JA 1JI0A 3IQDB 4KVAA 5EP3A 2AKEA 5JS2A 2ZW9A 1RWQA 2J9ZB 1PYOA 2F2TA 4BQRA 1I0LA 2E4ZA 3SYTA 4FEAA 2NUPB 1GL7A 2BPOA 4R9RA 5MN4A 3AUUA 1PYGA 3TUIC 3NJ4A 4I0WB 4C87A 2CF5A 2EF0A 4B2LA 1APBA 2GERA 2P9BA 3E05A 2EIHA 3LSYA 1ST3A 3KG2A 4H6WA 2Q6TA 1E3SA 1GLVA 1VKZA 3S2YA 3QU4A 4KMRA 4MUNA 4CFSA 1F9AA 1UJ5A 4M87A 3IMCA 2P9YA 1NW3A 1NL3A 1Q92A 2GS9A 4N7RA 3RVLA 2BSXA 4OQNA 3SKVA 5LDDC 1B2RA 4LVUA 1R6DA 4I6GA 1HDZA 3NUZA 1VMEA 3PS9A 4AWAA 2IHTA 3INYA 1KDZA 2FZ5A 4NS1A 2XMSA 3RTGA 4BEWA 4PSVA 1S7CA 3F78A 4C7VA 4QUKA 2J9RA 1Z5WA 4BQEA 3LP8A 5IRCD 5IYZB 1K27A 5IUJC 1SU7A 4OHZA 4Y1FA 3FUWA 2RHMA 4K9MA 3WNQA 2PX3A 4DSTA 1KMIY 5GIOE 2ONCA 3I12A 2J0UA 3GGGA 1YZYA 3B6EA 4JI8B 3F3KA 1YQWA 1O95C 1H23A 1IDN1 3JZDA 2E5WA 5BNIA 1IMOA 2XDQA 3QU7A 2NUPA 4GWGA 5AKEA 4AQDA 5BW5A 4NZ9A 1E4OA 3ZD7A 1XZAA 5J59A 4CXMA 5BR8B 1BCRB 1YJBA 4KAFA 3FRHA 2VSQA 3AVYA 1U04A 3CVVA 2A9JA 1JQ3A 2ZSEA 1RYBA 3CTMA 4RYLA 1YQGA 2D0IA 2HTFA 1E7WA 1YJCA 3H87A 1MOZA 2J4FA 3C7CB 3ORYA 3ZHXA 1UBMS 4JODA 3VVCA 3REOA 1S0UA 1EWKA 1Q0RA 3DA8A 3FCEA 5EEHA 3VISA 3K4PA 4G2NA 2X0IA 3H5WA 1BQEA 1F0PA 2O3UA 3AXTA 4C9BA 3SR0A 1RJWA 4G25A 5L4LA 1DO0A 4S2EA 3RC8A 2TMYA 3FG9A 5IYZA 2VP0A 1G8PA 4QVIA 1I5RA 2W2LD 2Z1NA 4ZVTA 3UJ3X 1RBZA 3DZGA 1QHFA 4DNOA 1XMQB 2I3AA 1BU5A 3OX2A 1PUJA 1L5YA 4LGMA 1KQ3A 2CMDA 3L4SO 4LCEA 3TLEA 3GP8A 3DV0B 1DQSA 2HUNA 4PO3X 3AF5A 1BCRA 3BXFA 2O05A 3HGMA 4QUDA 3ECAA 5DNAA 2Z6UA 1GV1A 2IPXA 1A8IA 1ZXLA 4ND2A 3GO4A 3LQ2A 1BROA 2H06A 2YQZA 2VZ0A 3GAMA 4D98A 5K01A 2NV0A 5ANRB 2GN6A 2GK3A 2H8KA 2R5FA 4FT2A 4CM6A 4L50A 5KNBH 3NHJA 1JT9A 4WZ6A 1DFHA 1M2NA 2Q28A 1TFRA 1GVHA 3AP3A 4DLVA 4F2DA 3ST7A 1Q1NA 2V6MA 2VP3A 4UXIA 2VBCA 5A5VA 2V5UA 1P1FA 3ACCA 4PXYA 1YVDA 2NAFA 4N8EA 1X3SA 1YIAA 2VJCA 1LEHA 3PICA 4ND6A 2BGIA 2CFSA 4TKVA 1NVAA 2I7TA 1SHTX 1VRVA 1YR2A 3FWYA 1F51E 1ZNQO 3GLKA 3LQ1A 4L4SA 2WFZA 1R8XA 3WB2A 3OC6A 2V74B 2D2XA 3LPAA 3PIRA 6ABPA 2PA0A 3B2NA 4EGCB 3DJFA 1RQLA 1RHQA 3R7WB 4EQZA 1KPGA 5BSHA 3K4QA 1F4VA 3VTZA 1R8JA 2BI4A 4C4AA 1ZCJA 4DLBA 1N1MA 2D0DA 3HP7A 1XXHB 5ENZA 5H68A 1EFAA 3D6HA 3P0EA 2WP0A 3VPXA 1OXUA 4LBVA 5F98A 4MJ3A 4TV8F 5A3QA 4WKCA 2IP2A 3AKDA 1E0AA 2CNKA 1HX7A 1O94D 2C9YA 3V4PB 3VZQA 2CZQA 1M72A 3QXHA 5FHRA 4LZJA 3LY8A 4G24A 3JQ6A 3EIOA 2AMYA 4K9DA 4PTZA 4BTVA 5K0CA 2CLCX 1DJNA 2GXQA 4RF5A 3AV3A 5BMVB 5EXSA 1LPSA 3SCZA 1WMAA 3QLVC 4R2LA 3SN6A 2F4VB 1U3FA 4NEGA 2NLOA 5KQMA 1J8MF 2WJ6A 3RS5A 4D9IA 5AMXA 5ABPA 2FWJA 3NH6A 2DBYA 1Q17A 2G25A 4WFKA 1Q91A 3FPLA 4XR4A 2WHEA 2JBHA 3BD6A 3EEIA 2PR2A 3M6MD 3OE4A 5BQPA 3P52A 4LHYA 5KJCA 2FWIA 3IUBA 2YUIA 5IN5A 1FSZA 1VYHA 3EIUA 3Q3CA 2HAEA 2I4TA 3ETCA 1ODIA 1X7YB 1Y33E 2HB6A 1VLLA 3CIFA 1E96A 1QKJA 2WU4A 3CX6A 4MARA 1XXHA 4NX2A 4QXOA 4WNAB 5LQDA 1G42A 1P9WA 2W00A 3NVMB 1T34A 1Z2EA 4HG2A 1LVUA 4ZVMA 1JFLA 3F90A 3Q3JB 4J0KA 4RZQA 4ZCQA 1M0TA 1QAOA 3PC8A 3VI3B 1U98A 5A3VA 2AQKA 1IB0A 3OTWA 1U0LA 5EPOA 4NENB 1NA5A 3FMFA 4Q9AA 4WACA 1QBKC 1UT5A 5KQPA 4MVJH 1Y5NA 2NNLD 3OLXA 2R8RA 3KV3O 3T3GA 1XZQA 1AA6A 3SFZA 4CUJA 4WNIA 4ED9A 1EGAA 5BMVA 1TTHA 1KVQA 3EK2A 4UAVA 3X1MA 4A0RA 4CPDA 4EHKA 5ECYA 2MSCB 4QDKA 4OXKA 3P9PA 3DKVA 5C8XA 4XW2A 3UK2A 1YQ9A 1MV8A 4KHPB 2OMKA 5TY0A 1BIFA 1JDJA 3ZJUA 1IG3A 4Y2YA 3T5PA 2C0QA 4OB7A 3UXEA 4OBBA 5TEWA 4PQFA 4GIBA 1X7YA 3JD0A 4J16C 4N5HX 1L4MA 2XA2A 2OBMA 3DMRA 3PF9A 1Q0PA 1ST2A 1O57A 1I6MA 4M1YA 4WNAA 5GJBA 2BDTA 2N46A 4ROTA 5FUYA 1U94A 2OC9A 4ALLA 2HMAA 4N39A 1WHSB 1NV8A 1RWVA 1PHRA 2MMCA 3N2LA 1ZD1A 2JFGA 5LCXA 5IT0A 2I9PA 2OFWA 3NT5A 1G8FA 5SZHB 2ZYGA 4CIYA 2JDID 4QRIA 1PJ8A 4NENA 1JIIA 1XVVA 2FEKA 1YDEA 4MWEA 5FKJA 2A9FA 4D6XA 3KLOA 5I9MA 3TJZA 3CSSA 2ET6A 2EYUA 3UENA 1XB2A 1QG2A 2VNHA 2Q3FA 3TEMA 5JH7F 1CX9B 1FS4A 4EBFA 3LBNA 4JROA 3TTXA 3WMEA 2XZLA 3ZEIA 4F6CA 4P2GA 2KX7A 1KZ4A 2ZR7A 3R0VA 2C77A 3OLZA 1MOPA 2ZT6A 3CCCA 4TTIA 1MX5A 3P26A 5K0ZA 4OHRA 2PJRA 2H1IA 3DT6A 1LU9A 3LCJA 3H3JA 4ECEA 5JSFA 5E0OA 3L9XA 1IBLB 2GVNA 4RSGA 4AO6A 2RFLA 3A6HA 4KFSA 5ADWA 1E61A 5BR1A 5JXWA 3TD9A 3CPSA 1T6XA 3W5JA 1U1FA 1FDVA 1WHSA 5CA0B 1USVA 2WVHA 3JQ8B 5EVCA 1XQWA 3RSSA 1Z15A 1U7WA 3OVMA 3IAFA 5MHTA 4IQFA 4CF5A 3UT6A 4P81A 4MI6A 4PAGA 3TZLA 3SEZA 2B4RO 2QY6A 1OLXB 1QZTA 1ZRHA 2IIPA 3Q41A 1BH2A 5DI3B 1JG4A 3M6LA 1UZMA 3BJMA 1QG6A 4PFJA 5FLXA 3EZNA 1GSHA 1ZGZA 1BFDA 4BZQA 1GKUB 1F0YA 2VXYA 3GJ0A 3PXXA 1TZCA 5I4BA 4R5HA 2J3QA 1YBHA 3WB0A 3NS7A 3WQRA 3RE1A 1LPBB 2G5PA 5AHRA 4OM8A 4XFKA 5CIYA 1R9NA 5C35A 3H75A 2Z2KA 1E59A 1U8XX 4DMMA 1PO7A 1NBMA 3RVKA 1GRNA 4M6WA 3TG8A 4HO1X 1TYZA 1XDSA 4BYMA 1XZDA 1U81A 5CA0A 1C7ZA 3N7AA 3OY7A 3R6TA 5BW6B 1IUKA 1D2EA 5A7GA 2UYHA 4HL6A 1L1EA 3ZV5A 3TGPA 3QMPA 4NWIA 2JLUA 2HI0A 4NRDA 3VR2D 4LXIA 2BM1A 1U9IC 1E8MA 1QGDA 1OLXA 4K6CA 5GZ3A 5HGJA 5ICGA 3ZV7A 4C22A 5DI3A 4HGPA 3X43A 2QYSA 4NH4A 4TQAA 3I04A 4IOMA 2PRSA 5JMWA 1H2YA 4IGAA 2YJTD 5EC8A 2YWGA 4BIMA 4BLOA 4KAJA 3FSEA 1I5EA 1Q7GA 1EP9A 1I6KA 3R7BA 1U9YA 1Q1ZA 3M0EA 5G2OA 2V8BA 1SFRA 1ABEA 1P77A 2AFRA 3E5RA 5EMJA 4J7UA 2G4CA 3L92A 1KMHB 2NVOA 4TMVA 4G0XA 5DMHA 5AW2A 3P20A 2P3OA 4JSYA 5KAMA 6Q21A 3THRA 2RCYA 4KR6A 3IULA 4H6XA 4QPPA 4HDNB 2B78A 3IVRA 3A11A 3I04M 2L2QA 2O2CA 3LQKA 3MERA 3ROXA 4QBGB 4KLNA 3MOGA 4C0SA 3HU3A 1Y9EA 2J30A 1A69A 3MB8A 3VMFA 3UMCA 5EJEA 2JL1A 1GPWB 1ZZEA 3AF4A 3C3JA 2VRWA 2ZRKA 3H0CA 4G4SP 4ZU3A 3TW4A 4C78A 1LPOA 2NO5A 1C3EA 1VE9A 2P8SA 3A0RB 3HU1A 1RD4A 3N8KA 4MIEA 2EERA 4DIFA 4MKXA 4XQEA 4EG4A 1OVGA 4N3GA 4RNCA 1Z8DA 4DKXA 1Y9DA 1BYUA 2YC2C 3GNTA 2C54A 1N2EA 3LT0A 3MJRA 1NULA 3B1XA 5IKXA 5DZSA 2VJYA 2IEAA 2F8TA 1MZVA 2ZKLA 5DU2A 4P3PA 1RQ2A 3V1KA 2F8SA 5F7XA 1QIKA 2Y0EA 3I30X 3IR6A 1DDOA 1SCAA 1W8DA 1ZM3A 1J9ZA 5HSGA 5J1SB 1TEZA 1XZGA 4DJFC 4REMA 3K9GA 5LLTA 3BYZA 4EJ6A 1DAFA 3DTVD 4MCHA 2EW8A 4MWOA 2ZUWA 4HDNA 1KPHA 3G8CA 3TZBA 5IYZF 4NL4H 4WVLA 2C7VA 1G6OA 4RTKA 4MRAA 3OTOB 4OVKA 1NLMA 3ZWYA 3EMDA 2IH4A 2JJYA 3QBJA 2PCJA 2C7QA 1SXQA 1ZAYA 3PENA 4UUNA 1R9GA 3GAZA 2MR5A 1WCIA 4Z9AA 4F3RA 2JHFA 4YLYA 4R1NA 5HQTA 4MLCA 1LLCA 3LCUA 1RJDA 2CKDA 2B5WA 1NFRA 2RHOA 4MR8A 1DELA 4RPIA 3V1NA 3VH2A 2DQSA 2HHJA 4AJIA 4J0DA 5IW8A 3KZXA 4IS3A 4D82A 3QKWA 4EKIA 2YJ6A 2N42A 1DTSA 1JSZA 1V7QA 2OSBA 2R6DA 3N2ZB 4QYXA 3NM6B 1B3RA 1CJSA 1OYYA 3AT1A 2X8AA 5D7NA 2MSEB 2OKGA 2IYWA 3OSUA 3OCXA 4XQCA 1KGSA 2NT3A 2YN0A 1V7ZA 3PFBA 1DTWB 4NJEA 1YZFA 3D4OA 1VIMA 5CA1F 2WYOA 3FLBA 3OETA 4JITA 1XPOA 4TL9A 3HDJA 1R7RA 1FBNA 3PRHA 2J0SA 1P7ZA 2ZIAA 2I99A 2G0TA 5E6UB 5CCDA 3GB9A 3KUCA 1DU4A 3KU4A 4IMIB 3BMNB 4OGGA 2X8LA 3GRCA 4Y2JA 4YQZA 1E9RA 2RGCA 2WUWE 4NBKA 1AQJA 3D8BA 3WRXC 2EAUA 2X1LA 3MAAC 3EX7C 4QIHA 4AP9A 1C1YA 1YR3A 1SJ9A 3P0FA 1XWWA 4E2YA 3EFOB 3H5RA 4WN9B 2IYPA 1PYDA 3I6YA 2BTEA 1K3UB 4LDRA 4LOIA 3EDCA 3GLQA 1GGVA 1GSOA 2EL7A 2QPAA 3PUHA 4II3A 5CT9A 3IDOA 4NBVA 5J5VA 2XBUA 3E61A 5LDHA 1JJAA 1DQRA 5M5BA 2V3WA 1FUKA 1T26A 5JG7A 1OI7A 3S2FA 1U0FA 2FDXA 2I76A 1G0NA 4P3XA 3BJEA 1JLKA 4LA4A 1L6RA 3RVOA 2HADA 5HE8A 4CQMD 5KZMB 5AHWA 3U44B 1COZA 4ZFNA 3DZIA 3KTFA 2D2VA 1W6UA 2F67A 3OO0A 3QWBA 3W6NA 3KL2A 2W11A 4EYGA 3LHSA 4GT1A 3A36A 2PH5A 1R1DA 4BRUA 4XRRA 4OI4A 5I9IA 1REQB 1GWNA 3UCFA 5DNUA 3Q7RA 4HZIA 4WXMA 5ILGA 1M34E 3QVSA 1PD0A 3BMNA 1TPYA 1ID1A 4CIBA 4P6VF 3IKTA 3O1HB 2EQAA 1PT7A 4RPKA 1UPUA 1WZNA 2YHBA 4YCJA 1KC3A 4ARSA 1ZMRA 5JUWA 3EFOA 3K96A 3DOOA 1P1RA 4WN9A 3ZWOA 1CRQA 4OGFA 4HBGA 5KNCA 3GMDA 4OHMA 3A37A 3WNBA 5DLQC 4WXHA 4N6GA 1Y81A 4OKIA 2VDLB 3D3WB 3H2BA 3LLCA 3RAJA 1CE8B 3Q72A 2ZSKA 5BMVF 3LX6A 2ES4A 4LJLA 5CAEB 2ZUFA 4LF6B 1B73A 4KLZA 2YXEA 3EZ7A 3JYQA 3KQWA 4LXHA 2R2GA 3ZIAD 3G9QA 3U9TA 1NVGA 2Q5LA 1U0TA 5F77A 3ANNA 3FZGA 4QU8A 2E4YA 4LXYA 4WNCA 2HLDD 1YBVA 3G6WA 1Q22A 3PCRB 1KI6B 2OHHA 2QWXA 2V6GA 2A0KA 5JIBA 5DT2A 2AEMA 2WQZA 3MHPA 3NXKA 3GGOA 2XQJA 4EB6A 1BN6A 2PZAA 5IK2D 4CG2A 1REQA 3FB1A 1RI1A 4EHLA 5KEIA 2W2MA 4ZOCA 3EZYA 1V1RB 1EFKA 1E9AA 1JEOA 1D2NA 2R1TB 5DBOA 6NULA 4DG8A 1W0KD 1F8FA 3EGVA 1GCGA 4DLNA 4ENUA 3R5XA 4NCXA 3UG7A 3AR8A 4Y98A 3WMWA 1GN8A 1M8KA 1C4OA 2J5RA 1BH6A 4OJMX 5KO2A 4DBLC 1MA0A 4R05A 2FMHA 4PHFA 2J07A 2ANCA 2HHHB 2DFNA 3BS4A 4UU1A 1XOIA 2IOYA 4M9QA 3TVDA 1E5XA 2P2NA 1GOTA 3D3WA 4AWXA 1CEXA 1CE8A 4CIDA 4JIGA 2NQ8A 1WD7A 1E0KA 1N2XA 2FEXA 2ZSFA 4RE6A 4A8PA 3EDOA 5CAEA 5ADVA 1RRCA 1PLKA 1Y6GA 2LXNA 3FYTA 1P2FA 4FGLA 2V7UA 5DYTA 2ZSBA 1KR5A 2PZEA 2KE5A 2ZWAA 1COWA 1PAUA 3B3AA 4IL5A 1TJPB 1CC1S 4R9VA 4OAQA 1R18A 3ET4A 3OJ0A 1SULA 3U49A 1VP9A 2OWEA 4LIPD 1SKMA 2HXSA 2B7LA 3QJYA 2AG0A 5A06A 3TPCA 4GI3A 2P3QA 1OY1A 1FRFS 2AKAB 4NQZA 1KSJA 2J9FB 3HYRA 1V1RA 5ALDA 2H48A 2R4QA 3W5BA 4MHTA 4HTAA 1XKLA 2R1TA 2FWPA 4TLCA 4TMFA 3CWZA 4B6JA 1MJGA 4KO2S 3SOPA 2FJUA 4ZYVA 1Z0FA 1BE0A 2QL5A 1KVUA 1TLLA 2AR0A 3M5CA 4WW0A 2YCBA 4GKAA 1G98A 4HXFB 4W5HA 3LW8A 4PPGA 4H6PA 5J4KA 3IALA 3HCBA 2BWJA 3B1FA 4F93B 4R51A 4RKQA 2O8EB 3T1QA 1DAPA 1Q0QA 1YIOA 2Z6VA 3IP1A 1NLFA 3B78A 3PHIA 3HM2A 4I1UA 4MO9A 3VOSA 5DBEX 4Z4HA 5FUMA 2HMVA 5JVDF 4PU0A 1N32B 4OXQA 4YV0A 4ZC8A 5BRAA 1CEQA 2RJNA 4OQDA 3RTDA 3FNGA 3NJRA 5FOTA 5JNTA 4ZTZB 2QN9A 2R9VA 4RADA 1VI6A 5ALIA 4U9UA 1YJQA 5JANA 3KT8A 3THYB 3SQOA 4IUYA 2DUWA 2B9EA 2B82A 4IIUA 5JROA 1UJ6A 4P80A 3LUKA 4D41A 4Z49A 1TXGA 3N7UA 4BGVA 1SCUB 1CHDA 4OJTA 4EHIA 4NCNA 4UBLA 1CB7A 1O03A 1GL6A 1RWWA 3ASZA 4YXWA 4PE5B 1JQAA 3JQ9C 2Y1FA 1DC5A 2G7MC 2V6FA 3BIFA 4RMGA 4QUJA 2UXCB 2FQYA 3UC9A 3HVUA 4ARBA 1DOAA 1NAHA 4HVLA 1RS0A 2G5GX 5BYKA 5J3JA 1E8NA 1VHJA 1RWKA 4C30A 3FOAA 3M1YA 1J09A 4NYMQ 5HFAA 2QZPA 3ZI4A 2O8EA 3L1IA 2VT3A 4BLUA 4BTEA 2YVQA 4BEBA 3PQEA 4NPCA 2WYHA 1ML4A 1WCV1 821PA 4MQ5A 3KUXA 1YAHA 2YCLA 4P54A 1L2TA 3FFAA 1Z4MA 2Q7DA 1QU2A 1K2VN 3A4NA 4AUNA 1AUXA 2PJZA 2DBQA 2ZBFA 4YRGA 3LUAA 5K0LA 1YB5A 1Z25A 3HPQA 3THYA 3VKGA 1GUDA 2EFEB 4GAEA 4BVFA 3FGOA 3FDIA 2WTUA 1ODTC 4RMIA 4Q7QA 1CP2A 1ZNXA 3EVNA 1PK9A 2GPNA 2ZLBA 5F9MA 2X0EA 1SCUA 3IH5A 3Q0EA 2ZAOA 3WLEA 4KFRA 3CX8A 1A77A 2E6KA 1I7QB 1WUTA 3MJVA 3N2KB 3U56A 1KEUA 3BDIA 2VYQA 1CUIA 3AHEA 2NVUB 3NKLA 4RMHA 4A2PA 2F55A 5HNKA 2AMLA 4A9AA 2WZQA 1A95A 1Z73A 4QTUB 4WK4B 2PN1A 2PT5A 4KTTE 4AW9A 4QBKA 4R9SA 1VE1A 4RIEA 4KODA 3HKEB 2Q4RA 2W6CX 3ZNNA 4GGMX 2R60A 4JKYA 5B1HA 5A5FA 1SXJD 4P4NA 3RLIA 1MRZA 1R0SA 3GRFA 5H9VA 3C4JA 3FWKA 4QXMA 2XMPA 3W05A 5F4ZA 1E7RA 3KR9A 4LXXA 4QUGA 1PEKE 2P68A 3JWGA 4OXRA 1E9BA 2Y1EA 4RQAA 3ED1A 1PL8A 3FAKA 1J8YF 1N2IA 1LI4A 2R11A 4XQ0A 2VDQB 3VZPA 1ISMA 1PQYA 3DE3X 3HJUA 1ESZA 3AOGA