2W2OA

Pcsk9-deltac d374y mutant bound to wt egf-a of ldlr
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
294
structure length
274
Chain Sequence
b'SIPWNLERITPPRSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDSKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSYCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
molecule tags Hydrolase/receptor
source organism Homo sapiens
publication title Structural and Biochemical Characterization of the Wild Type Pcsk9/Egf-Ab Complex and Natural Fh Mutants.
pubmed doi rcsb
total genus 93
structure length 274
sequence length 294
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2w2oA00
2PWAA 3ZXYA 5JXGA 2ST1A 1OYVA 1SIBE 1TM7E 1TM4E 1JEAA 1Y4DE 3TECE 2SBTA 3CO0S 1SUEA 4H6WA 1T1IA 3T41A 1AQNA 1CSEE 4I0WB 3F7OA 4LVNA 4DJ5X 1C9NA 2PRKA 1SCJA 2Z30A 1GA4A 1V6CA 2P4EA 2WV7A 1Y9ZA 3F7MA 3EIFA 5JXIA 2GKOA 4GI3A 1LW6E 3PTLA 1EA7A 1P7VA 5FBZA 1KDZA 3VV2A 1TO1E 1SCNE 1BE8A 2G4VA 1GA1A 2Z56A 2E1PA 4DWWA 4DZTA 1S2NA 1ST3A 3A3NA 4CG0A 2WWTA 1SIOA 3VHQA 2Z2YA 5I9SA 3I34X 1BFKA 1WSDA 3DVRX 3LXUX 1IAVA 2W2OA 1GTL1 3DVQX 1ZVKA 3Q40A 4FONA 1XF1A 3BGOS 4C3VA 1Y1KE 4RYDA 2DP4E 3F49S 1TM1E 3GT3A 4YN3A 1Y4AE 2PMWB 2IXTA 3A3PA 1KDVA 5JXJA 2XRMA 1P7WA 3DE4X 1GNVA 3TI9A 1CNMA 2DUJA 4HVLA 1TMGE 4H6XA 1SBNE 3OSZA 2SNIE 1GTG1 3DE1X 2V8BA 3D43A 1BE6A 3I37X 3EE6A 1TECE 3BPSA 1Y34E 1OT5A 1T1GA 1Y48E 2ZWOA 4KB5A 1SUAA 1WMFA 1KE2A 3A3OA 1YJCA 3HJRA 3DYBA 1SCAA 5AMXA 5AVJA 4AKTA 1GNSA 1SBIA 3DVSX 4NMXB 3VYVA 1PEKE 1DBIA 1Y3BE 2PQ2A 2WUVA 1GA6A 2Z58A 1SBTA 1V5IA 1SELA 3DWEX 5FFNA 3SQOA 1ST2A 1Y3DE 2X8JB 3WIUA 4NE9A 1BFUA 2Z57A 3H42B 1C9JA 2HD4A 3L1KA 3P5BA 4ZARA 5FAXA 3Q5GA 4BWGA 3AJ9A 1SPBS 3DW1X 1P8JA 1KDYA 3QMPA 1SBCA 4NE7A 1BH6A 5AQEA 3UNXA 1A2QA 2SICE 3DE7X 4KPGA 2ZWPA 4LVOA 3VV3A 1SUPA 3PRKE 1SIUA 1TM3E 5CW1A 5SICE 4B5LA 1AVTA 1BJRE 1GCIA 1Y33E 1YJBA 3QFHA 3GCWA 1MPTA 2ZRQA 3AJ8A 4ZOQI 2PYZA 1Y3CE 2IY9A 2WUWE 5ARCA 2ID4A 1NDUA 1R64A 5ARDA 4Z2AA 3AFGA 5B1EA 3VTAA 2W2MA 3VSBA 1C3LA 1R0RE 3DW3X 1Y3FE 2B6NA 3TI7A 3WHIA 1GT91 1NLUA 2HPZA 2QTWB 4H6VA 4J94A 5ARBA 5K7SA 1C9MA 3DE0X 3SICE 4CFYA 2X8JA 3I2YX 4HX2A 2Z2ZA 3EDYA 3DE6X 1HT3A 3LPDA 2SECE 2Z2XA 4MZDA 4OMCA 4OMDA 1AV7A 4CFZA 1PJ8A 1MEEA 1AU9A 1SUDA 2PWBA 2TECE 2W2NA 2W2PA 1SBHA 1TM5E 3DE2X 1DUIA 3QTLA 4K8RB 1ZVJA 3WIVA 3WQBA 1AK9A 1SUBA 3DDZX 1R6VA 1S01A 4JP8A 4WOCA 5JXHA 3GT4A 1Q5PA 4KG7A 1WMEA 1T1EA 3GCXA 2PKCA 2DQKA 1S02A 1TO2E 3BX1A 1THMA 1SN7A 3LPAA 4M1ZA 2W2QA 1SVNA 1WMDA 3DE3X 1AF4A 1UBNA 1SH7A 1YJAA 1PTKA 3D9QX 3LPCA 1TK2A 5AVKA 1IC6A 3ZXXA 3DE5X 1NDQA 1YU6A 2XTJA 5B1DA 4AKSA 1VSBA 1SCBA 3I30X 5JMOA 1PFGA 1AH2A 4WOBA 1OYOA 2ID8A 1SCDA 1SUCA 1WVMA 3CNQS 4OV6B 1GTJ1 1KE1A 4C3UA 1EGQA
chains in the Genus database with same CATH superfamily
3HLKA 4A26A 3PUJA 3SDBA 3IEPA 5BOVA 1QIJA 2CVFA 2IHYA 1CEYA 2ERYA 2X42A 3ED5A 1MO2A 3H4VA 2OBNA 5TEVA 1KVUA 4EAAA 4LVNA 1ECJA 4LX0A 3K0SA 1P61B 2Q46A 2WW8A 2I55A 2WV7A 3BE8A 5A4MS 1CYEA 2G83A 2VTDA 2H1CA 4NCKA 5TB5A 2JD1A 2ZS8A 3I01M 5EE5B 4CFSA 5LP6F 3IKTA 4HWKA 3V2HA 1XYGA 3D6UA 4FFBB 1YCDA 3UK2A 1O6FA 4ID3A 4I1RA 3EXFB 3OBBA 3RUHA 5JNWA 4CMEC 3GLGA 2RAVA 2GTIA 2AHRA 2EKBA 3FA2A 4YR7A 1BU8A 3HXQA 4N76A 3AVTA 1CFJA 2EIHA 3HA5A 1GPNA 2ZAMA 4GL4A 1Y4UA 1C2YA 3DDCA 4N7RA 4UBJA 1VHJA 1GL7A 4ZGGA 1HBJA 5LDGA 1G3RA 1K3TA 2JDIA 3D81A 4O59O 4UDXX 4TMZA 3H9UA 3CNHA 3O03A 5BW5A 3VR1A 3D0OA 1WDWB 3K0FB 2KLHA 3E7WA 3PSAA 1XJCA 2YFYA 2PUVA 3KZCA 4H6XA 1EFPB 2AFIA 4JLPA 4OQ4A 5ALGA 1E60A 3AEZA 1HH4A 1Y3IA 2MSLA 3RAFC 1PR4A 4WNIA 4NECA 1U8XX 4GR4A 2OM2A 3AUYA 2JI4A 3BFKA 3E58A 4HWGA 5GMOA 5AESA 3GLGB 3WP0A 3OEEA 5C1OA 1ZI6A 2AJBA 4MQUA 5CG1A 2NPFA 1Y7LA 1EFKA 3OJEA 1VJGA 2IV2X 3TNFA 1N2GA 5DEIA 1H66A 4ZVOA 3RJ9A 1MABB 3HVRA 4M9SA 2EDAA 1TCCA 4CGZA 4Z49A 1SFRA 2A5DA 4QPZA 1EM6A 2EFHB 3IBSA 5BV0A 4JP3A 3U6BA 2HFJA 1J7JA 4CKCB 1L4YA 4EUNA 3LL4A 4ADSG 2Z1MA 4QL3A 3MRXA 2A4KA 2GJ8A 4P7GA 1PNVA 4LUCA 5E4JA 4R3WA 2IP2A 2J33A 4EHIA 2FZ4A 2J48A 2R60A 1QKKA 5DTEA 4I8XA 2J5BA 2L69A 1ISPA 2X8BA 3OZCA 2LCQA 4UHJA 1W46A 1G41A 3R0VA 1QHYA 1UMCB 4IVQA 2C9BA 4J4TA 4ITUA 4MMYB 5HF9A 5ILOA 3THWA 4X1OA 1D1SA 1W5SA 1CQPA 2VTKA 3DD5A 3HJHA 4URFA 4Q9DA 1AGXA 1RIFA 2VAPA 3HFJA 3ZWNA 1Q57A 5BV2P 5IN4A 2Z6AA 1CJCA 3FD8A 1WABA 1LQ2A 2BDUA 2LPMA 3BXFA 2NO6A 3PFIA 4PICA 1FXSA 2QT0A 5ERGB 4CZ2A 4EG0A 5LZ4A 2V6FA 1IYZA 3QOWA 2JAPA 4KXYA 3RFTA 3R3YA 5JD4A 2O2YA 1AF7A 4URVR 2XVZA 1L5SA 1T3ZA 3W5SA 3CPEA 2PMCA 4FLFA 4LOLA 1J1IA 1MO4A 1HMPA 1C41A 4NIMA 4PZUA 2YUTA 2IW1A 2C0CA 1ODLA 4L8FA 1M1ZA 1U2PA 3IV7A 1RQRA 2GN0A 4XWKA 3QLTA 3CLUD 1DIAA 3B6JA 3A9CA 2C83A 3L4EA 3NI2A 3X3HA 2MMCA 3IE2A 5IM4A 1YTUA 3VKHA 4CV2A 4LYJA 4U2EA 3TOZA 1XN4A 4HBGA 5JJIA 2OBMA 2WVGA 4QAQA 3T7EA 2FQ1A 3K9GA 2JI6A 1WHSB 2OV4A 2GEKA 1NG1A 2GLTA 3F3MA 1DKQA 1GZ7A 4RJ2A 2VTEA 4A5SA 2XT6A 5BN3B 4MVCA 3A36A 3UT6A 5AUOB 4F7DA 4U7HA 1BWRA 3UUWA 1N6NA 3SNHA 1AKTA 4FQ5A 4C1NA 3EAQA 4IOJA 1TPYA 4LI0A 3SM3A 2K7FA 2ZUVA 3ZW8A 3EIOA 3SSOA 2J41A 3FWKA 1R12A 3LY7A 3M34A 3QY0A 4RD2A 1QJCA 1QH8B 4P3OA 4TXMA 5HF8A 3MTIA 3UGKA 1IY2A 3AHEA 5F51A 4GX5A 1IHPA 5DCLA 3CUWA 3L7CA 5KKAA 4YV1A 3JQPA 2X0NA 5HYVA 3O31A 3S2IA 2WJJA 4M60A 1N2CE 5AW1A 3THYA 4F6LA 1DEKA 4PLWA 1APBA 3FI0A 5A62A 1HSOA 3HKCB 4B9AA 2XNDA 3O2NA 1QLJA 1U5BB 3QVMA 1MOZA 3A9WA 5EJEA 4MJ3A 2BFDA 3HCNA 3T7IA 2AMFA 1O95A 4GMFA 5A3RA 3IYLW 4I4TF 1WCXA 3L0PA 3RUCA 4KTTE 3H16A 1QOZA 4ZJUA 4DCTA 1EI9A 2G5CA 3EASA 1HA3A 3KBOA 3MSCA 1MXHA 3P1JA 4EHLA 1O96A 3T1HB 3KR1A 2IODA 4RL6A 3HCDA 1P91A 1T1GA 2FSUA 4F12A 1U28A 1X9IA 3SX0A 1XR3A 5AO9A 1MTOA 4NYMR 1PT8A 1EFVB 3GHYA 2ZRJA 3PXUA 3D1VA 1REQA 2ORED 3NAMA 3N2LA 1YDFA 3KHTA 4Z1MD 4DA9A 3L4JA 2PXAA 4K05A 4AO6A 3WRXA 2B1IA 2VHZA 1Z73A 4ER3A 5JCOA 3F67A 2OC4A 1Y9JA 1RLJA 2FWNA 3JR3A 3MERA 1U5BA 4FYYA 4YRKA 5KQSA 3A6HA 4UVIA 1IK4A 2LTAA 4LE2A 1ADYA 1MV8A 5MGBA 1C4WA 4UHBA 4BMCA 5EZSA 5C31A 1KK1A 2R6HA 1C30B 2CHQA 5GJVC 3B1XA 3DCNA 2WWHA 3HU1A 2X1MA 4HT3B 5FOUA 2Q0HA 4B7CA 5CDTA 3I6BA 3CNEA 3RVLA 4UOZA 2PRYA 2BGMA 1L7VC 3ENZA 4RIHA 1A8IA 5LIPA 5AOAA 2ZU6A 1EUZA 2P90A 3VSBA 1CUZA 3Q9NA 2IHJA 4OI4A 1KRHA 2NPIA 2Q2NA 3AQIA 4B09A 2FOIA 4YV2A 2OG2A 4R83A 1GQRA 3PUWA 2F43A 4B46A 2VJYA 4OPMA 1D1TA 3UGTA 3RFFA 1NN3A 4GGOA 4TLCA 2I4OA 4BVFA 1AY0A 1QO7A 2QK4A 4EITA 4EW6A 1N2EA 4CKWB 3ZXXA 1WY5A 4L3WA 4RKQA 3I9V6 3UB3A 1S01A 3LOQA 2VOEA 4M53A 2PUCA 5EPUA 5NLLA 3PHHA 1NNSA 5KPJA 2EYQA 2R3SA 2ZUFA 2WV9A 4P3XA 4XM0A 3H5TA 2BFNA 7REQB 2VQDA 1II0A 4RY0A 1JQDA 1CDZA 3BDAA 1YWGO 3OE7D 1YCGA 1U4NA 2RB4A 1C1XB 2OCYC 3JRWA 3DUFA 5HMMA 5KQMA 2H3HA 1PNOA 3AYZB 3P4UA 5TE9A 1JXOA 4QO8A 3CH7A 3OZBA 1DNPA 5FDFA 5DWVA 1XRMA 2OILA 2JJYA 1E92A 1NQVA 1RT9A 4CFYA 4J0JA 5IF9A 5LDDC 2A7QA 3IVRA 2FY8A 2GH1A 4BXOB 1XVTA 2Z4SA 1V4BA 1OJ7A 3N8KA 4KKXB 3F3SA 1HETA 1NJ8A 1U28C 1R27A 2BMAA 2N1BA 2OAEA 4EI8A 4C0LA 3B36A 3O8BA 2BFOA 2VEOA 3LKDA 3O90A 1GUZA 3GA5A 1V6CA 3H0CA 1D1QA 3KE9A 2YVLA 3ITDA 1TEZA 4QDKA 1XXHA 5CDUA 1Z5VA 4RKYA 4IDCA 2CL6X 3I3OA 2R1TB 2IKQA 3H17A 1DAGA 4TOIA 3HN7A 1ZOIA 3GC6A 1Y9DA 2D1FA 1NBMD 1XDSA 3JQ8B 2A5JA 3OFSA 3UXMA 2W6ZA 3N58A 3SCZA 1A1VA 1L7NA 3F46A 4CIAA 2V7EA 1DWPA 1QQAA 2WF8A 5AW5A 1W49A 1MAUA 1B8OA 3HCAA 4J3JA 5JAPA 3NORA 3LQYA 1P7WA 3DAOA 3RM3A 1EFTA 2QG9A 4HTFB 4IIGA 2Q6VA 3BERA 2HW8A 1BN7A 4RNDB 2ZS9A 4P9NA 5E6UB 5ALLA 4MR8A 2VBFA 1FCJA 1NPYA 1GGMA 1YGPA 5TPZD 1QANA 1UPTA 3EVCA 2BUBA 5DXAA 4KGZA 4RSGA 5FQOA 4X92A 4EW2A 2HSEA 2P1DA 2H1RA 2P9CA 2V0NA 5K4GA 3GAZA 4QUBA 2PPVA 3HB7A 4HUQB 4ZAZA 1COWA 4GM1A 2UV8A 4DR7B 1Q0HA 1FUUA 1NN0A 2BSXA 2PUJA 2NU7A 1Z6PA 3FOCA 4YJGB 3ZE1B 2LWIA 1ADFA 1WKBA 2AOXA 1FP4A 1YIAA 2YHIA 3ET5A 3H1PA 5J5AA 4A23A 3HNPA 1IJEA 1TEXA 2ODAA 1HLPA 3TAXA 1L9XA 4YACA 2Q3EA 2C96A 2DBVO 1VC2A 3N6XA 4BX3A 3ICCA 2OO7A 2PGDA 1V1JA 2H2IA 3NUGA 5K8LA 2IDMA 4QU5A 2IEBA 4J07A 4NCBA 3VX4A 4IILA 1GTZA 4PZPA 1P0FA 3TRDA 3CE6A 3VDMA 2XJ4A 4ZCQA 4I5FA 4MWCA 4PZYA 3CX3A 4JCOA 3TQTA 4JBHA 4F6RB 3RW9A 1PEYA 2AFIE 2JLRA 3FNIA 4FHEA 5FBLB 3I2GA 1TA0A 3GAMA 4MP6A 2NTJA 3AWIA 1L5ZA 2GO7A 1PJ8A 5K6AA 1VGQA 2BTQA 4JI4B 1UC5B 4ZK6A 1DLIA 4D4LA 4LF9B 1PV2A 4KR7A 4F2WA 1EG2A 1YKGA 4J29A 2ZZNA 3KVVA 2ZIGA 1N2ZA 3W5VA 4ACBA 3AM1A 1SVWA 3M1YA 1JJVA 4HPJB 1PJ2A 1TQ4A 3FPGA 3KJNA 1BKDR 1H0RA 4AYTA 4UNNA 3IP8A 3L7LA 2AZTA 3IHLA 4AU1A 1D0IA 3K8OE 3KLMX 1FFWA 2BE9A 3KXLA 3OZ7A 1L8LA 3ORQA 3ED1A 3ORSA 3ZQUA 1OTHA 4BN5A 3A6JA 4JI3B 4LXHA 1H0SA 2ZIVB 2L2QA 2Q27A 2D5LA 4RV4A 1EUCA 3K1AB 4ZT4A 1B23P 1H3FA 2A0KA 2JJ2D 3AX6A 2VDQB 3C98A 4XOUA 5TSDA 3RARA 1R6UA 1WKVA 1U3WA 2IU6A 3QP9A 4OP2A 2JHAA 4RGQA 5BQ5A 1KBZA 4CF7A 1VLHA 4D98A 2OO5C 5F52A 1LDGA 5BV8A 5AW0A 1XQVA 4UEKA 2IHBA 5KJ6A 1TRHA 3DAHA 5H83A 4D0SA 2RK6A 1XWWA 2UZ1A 4RD0A 3G82C 4OSPA 4V0ME 4WCDA 4CU2A 4DLLA 4B40A 3PIDA 3QYPA 1U7OA 4E5KA 2GBPA 3CRW1 2J6CA 2XBMA 4U0JA 2Q3CA 2HQ1A 2QR3A 3O8LA 1PVOA 3OZDA 4HAZA 3RRXA 1GUDA 3ABZA 5I51A 1LV8A 4LCEA 4OSEA 5SZHB 4BKRA 1A27A 3UW1A 3FOZA 2EDCA 1OXTA 4FBGA 4H3HB 3QHQA 5IM4F 2LUOA 4RHXA 1WXXA 1MEJA 3DULA 4PC6A 1Z7WA 2HK8A 1XA4A 1ORWA 1M1NA 4HVLA 3D0RA 3V5NA 1GTG1 1T3TA 3Q2KA 3N6VA 4IS2A 4NK5A 4FT4A 4R98A 5DWQA 2O4UX 2YJ4A 4NATA 5I7HA 3J7AC 3FWHA 3G6WA 4ZFNA 1IEXA 3SY8A 4NMXB 1QCZA 3TRFA 2WF9A 3KT3A 4YV0A 5JMWA 2V54A 4UAJA 3LNCA 1RWBA 4MULA 4OXKA 4EL0A 3ANSA 4UCWA 5A4IS 3O7WA 2FPUA 3QITA 4PG6A 4Y2HA 3UHJA 2PZJA 2H8KA 3FSJX 4LA4A 1GTMA 2D1YA 3C3AA 4G09A 4TUYB 5F5NA 4BWYA 4TRJA 2DKNA 2HBZA 1YJ8A 2J4DA 5LZ7A 3LXMA 2WOJA 3HU5A 5EJMA 5L3VA 1QX3A 1H65A 1NF3A 2YHBA 4AZWA 4MJXA 4L5BA 2NP7A 1VJDA 4ZOBA 4BNFA 2PZAA 4WOPA 4C04A 3SS9X 3I52A 4B4KA 4OHWA 4YHBA 3CH5A 2WU8A 2XVAA 4KH0A 1U1DA 1CJSA 1ZMBA 4QASA 4EHJA 3WYNA 2R11A 2RGAA 1PZMA 1VTKA 5LQUA 3QJYA 2XB8A 3EHEA 4LJRA 4XYBA 1Z08A 3FN4A 3RFUA 4IGFA 1H2FA 4MDEA 4WESB 1S2DA 2FHSA 1IDN1 1TM5E 1CNFA 3QKSB 1A7KA 5LP6B 2WD7A 3BWXA 1JYFA 3HYSA 1F6BA 3CRRA 1P4AA 3OU2A 4RBNA 4JSRA 4PSVA 2FSVA 2P5UA 4OHCA 2QJWA 2JS7A 5REQB 1GYQA 1GAXA 3TEMA 4RPHA 3KJGA 4R1SA 3IERA 3H6HA 3ZQ4A 1P1BA 3LWZA 2QRJA 5KNLA 5A0VA 1PZNA 5TMBA 3UKOA 1DKPA 1N6PA 2HLDA 1Z7YA 2XCOA 4EQ6B 2QE7D 4A2CA 1RRFA 2FPIB 2Q3MA 2ZRBA 1KEWA 3EZ2A 4FD2A 3U0VA 4M0PA 4UFPA 2MSWA 1WA5A 1N36B 1NP7A 1A50B 1X1QA 2R48A 3QX3A 4DB2A 1UJ6A 3SJ7A 4CG3A 4QYIA 4MPDA 2H7XA 3WHLA 4MVJP 4BO9A 5DT9A 1R4NA 1JLMA 4QJIA 1OWOA 3U7RA 3ZD7A 1ZI9A 2D00A 4GDMA 3EUAA 4TRMA 4TTTS 4GECA 7ABPA 3WWDA 3AVWA 3DEHA 4HPXB 1SCJA 3PQ4A 4UUNA 1GZ5A 1HOXA 1XPJA 3RJMA 4FS3A 2QN6A 1XPRA 1ECPA 5ALMA 4Q02A 1M2VB 4IJ5A 4BNTA 4ENSA 3OU7A 2DUMA 3EAFA 3MILA 5AK6A 1U8EA 5CYFA 4ZYVA 1Y1TA 1PZXA 2W42A 1EM8B 4ETNA 1HYEA 4J2TA 2OHXA 2WSIA 3S5UA 1O08A 1PQWA 3B6ZA 1D09A 3UT0A 3ODPA 1GGFA 4OFXA 3NOOA 3BB4A 1XTSA 1S96A 4P2BA 2VAXA 1XL0A 1RM0A 4DDWA 2HTFA 1JFVA 2PZEA 2FKNA 4H7FA 6CHYA 1NOJA 2ZSDA 1JQ3A 1R4NB 2G9RA 4ZHQB 1O95D 3DMYA 3N2KB 2BOVA 2FU5C 2XMPA 4C2BA 1BE0A 1CR2A 1IBSA 3HVUA 3TIIA 3ZHBA 4BV2A 5IJ0A 4B81A 1ZNQO 3VU1A 1FVFA 4TSFD 3KZNA 3MELA 4LN1A 4XH9B 5LN1A 5IXYA 4KP7A 4RACA 4IV5A 1ZC4A 2ZR8A 1Z4IA 1FTSA 4IFIA 1FTQA 3K9QO 2XMSA 5TS3A 2J9RA 2QPTA 4GPBA 4L6AA 3P9NA 2INGX 2O1EA 3TGPA 2A4MA 1E9AA 3G7SA 1YZHA 4UHKA 5K05A 1FS6A 4K9OA 4LXQA 1IY9A 3CW2A 1JWAB 1P5FA 2FFRA 4DV1B 3AZPA 7ADHA 4BCCA 1ZWKA 3FNHA 3OCXA 1YZQA 5FYDA 3S1AA 3OAAD 3IAM1 5A5VA 2EJVA 1XRPA 2Q41A 2PJUA 5AUQA 5G0UA 4A8TA 3D8HA 3Q98A 4H7HA 2BBTA 2G6TA 4F7WA 4EVSA 5FHQA 1A9YA 3UPDA 1KPGA 1YOVB 3KBBA 4L15A 2I6UA 4OXIA 3KKMA 1VIAA 4PAGA 5CLFA 1OLUA 2C5BA 2H0QA 4JODA 2B98A 1SOAA 2BGLA 4TMVA 5U1PA 1BS2A 5HWSA 1KAEA 2PGNA 3IDAA 4DM3A 2I1VB 2MWMA 2AC7A 2GFHA 2PXHA 1HK7A 5FPSA 3H8VA 1Y3FE 4M3NA 2PEZA 1KAMA 1XOIA 5EL0A 4GLBA 1H2EA 3U80A 4E13A 5ICEA 4QZVA 4YC7A 4DSAA 3GGCA 1TLLA 2ZT7A 4B3TB 1IBLB 4DEXA 3ZCQA 1I2AA 3TVDA 1IZ8A 3ZNOA 3MTQA 4NS1A 1WL8A 2HDHA 7MDHA 1K08A 3KD3A 3MGBA 2HAEA 3UV3A 3OZAA 3MAAC 4RE6A 5IC4A 2D2VA 2VP9A 2ZIWB 4BWVA 1HNZB 1LJ8A 1RPJA 4GUDA 1JSXA 4PO8A 1JKIA 1CVLA 1NJ5A 3CUYA 3KR9A 4UVHA 5I3ZA 1WMDA 2ZBVA 4LS3A 5BN4A 1KEPA 5LQDA 3ZE9A 1AQLA 3AUAA 3ISVA 3PZBA 5EMMA 3TQHA 3ZC3A 1NW9B 5HZHA 3G6KA 3EPKA 4Z3OA 2XWBF 3P27A 2YDYA 4RF2A 4ED9A 2F1JA 4YP6A 1XIVA 2GCPA 5ITSA 1B2LA 3OCYA 2RD2A 2WU3A 1SVOA 1Z7EA 4HRAA 4I81A 3BCHA 4DSZA 2BM9A 4OV6B 1MIOB 4V3CA 4XQEA 1YBFA 2WFAA 3HGQA 3QKIA 3OP1A 4J1TC 5T4BA 1QGUB 1V8OA 3T1TA 1UBHS 3E6AA 1ZGGA 2B7LA 2VPTA 2P2DA 5GAJA 1XRNA 3KV1A 2IYTA 2DE0X 3EDRA 3V2GA 1WPRA 2ZBQA 3A7DA 1X94A 4AVYA 4EZBA 4Q4LA 4OQXA 2P9BA 2RGNC 1CP3A 4FPXA 2VXBA 1QHHB 1XTZA 4D25A 4RAQA 4R8RA 5KWVA 3EVGA 3THXA 1WB9A 1MORA 1N0HA 4M8IA 4JXKA 2WK1A 3AU9A 3I6IA 4TTRA 5EC8A 2AZ4A 2ZBUA 1NVMB 5EE1A 2ACWA 5IDXA 4DCUA 5IH7A 4KQKA 4EF6A 5FBVB 5HJ5A 1MJ5A 1U2EA 3I28A 5GJWC 1V8ZA 1JJIA 2C07A 1T8RA 2Z98A 3L7IA 4FS8A 4P34A 4CLOA 4U0KA 4WZZA 4XEUA 3GLIA 5I5GA 4DV3B 2E3JA 2C4TA 3G9ZA 3A9TA 4OHRA 1SQ5A 3G88A 1ACLA 2HZBA 4CYMA 1XEXA 5ALPA 4FDVA 3PTZA 2V97A 3IODA 5T5QA 3K6SA 5EIWA 1NF9A 1A5BB 2F17A 4JUCA 4QXOA 2VH1A 3JZFA 3AV3A 1TVMA 4RO0A 5DN6A 1J56A 1G7SA 1HLGA 2VG8A 4K6MA 4MYRA 2POCA 1IL0A 1DQRA 3GQBB 3L0CA 3PPYA 1F8FA 1LC3A 1PYDA 2O2ZA 2WYIA 4L5AA 2PCLA 3R20A 4KK3A 4MUIA 5H3LA 4LI3X 1QG2A 3CN7A 4TZKA 5EINA 3GWZA 4ARVA 4X66B 2AG8A 3TQSA 3GT7A 1Q1NA 3NHSA 3Q0EA 4CKBA 1K5GA 4ZYUA 3HYCA 1G8JA 4HMOA 4CLOB 3WZMA 4BL5A 2GMWA 1UZAA 2D3WA 3SF8B 4EI7A 3TLKA 4E5VA 4DJJA 3BILA 4B3BA 2MU1A 3WSVA 4FLEA 3V9AA 5EIXA 2K4MA 1CUJA 4I2VA 3RS7A 2CDNA 3IJRA 1RXCA 1XU9A 3EEBA 1GSOA 3NX4A 3KQMA 4MS4B 4P84A 4ZCTA 3PC7A 1HZZA 3EEYA 4DNPA 4IZHA 3VR5H 4N0QA 3IKMB 1H23A 4H0FA 4F4UA 5AVXA 1GG9A 1TKCA 1HFKA 3AETA 4JC4A 4FMDB 2QUIA 2FSVC 4KFSA 5TNXA 1PJ4A 2V7VA 4NZ9A 1O96B 4PSDA 4QLAA 2OCIA 1QRRA 1Y9AA 5GV8A 3IUPA 5DTMA 4KWHA 2X6QA 4LV6A 1I80A 2FX5A 1BQ3A 1AU9A 1QDLB 3IDZA 2VUIB 3FFBA 3ZHVA 1N75A 3HMQA 1AK9A 2NO9A 3SE0A 4INAA 3PX3A 2WTMA 2X3FA 3STVA 2P2CA 3ASUA 5IRCD 3I9V1 2FRVA 1N6KA 1Y42X 3WWEA 2PKCA 1BDHA 4QBKA 5FNZA 4CCYA 2KYRA 5ICSA 1T4GA 1X80B 5B7GA 4L0MA 5P8WA 2DLNA 4OJMX 5KJFA 2YBEA 3C3XA 3Q1KA 1V3TA 3K70B 2JZCA 3B6EA 3G3EA 4EDFA 4EMTA 2PUAA 4RVDA 4KGVA 2WDZA 1F0NA 3DEIA 2QUJA 4KBYA 2WTEA 5DISB 4EZIA 1U2TA 3A1TA 4DG5A 1NX9A 2EYUA 3C5HA 1QH8A 1X7WB 2AV6A 4MV8A 2JGDA 3UA3A 2GHTA 4CQMB 2AXPA 4QT4A 5KUTA 2WF7A 4RELA 5J4HA 3LUKA 2EP8A 3W0LB 1TVKA 3O4JA 4C05A 1T5DX 4G9EA 3WGZA 3AC0A 3U81A 3E7FA 3NJ4A 4JJEA 3MLBA 2ZUWA 1Q95A 3WL8A 2E1RA 5ITWA 3PXGA 2G17A 2RKOA 1UC4B 2QZZA 4KPFC 4Y1RB 5C4IA 3ER9A 1IU9A 3GFRA 1L8OA 5AHRA 1ZONA 2H17A 3ZHSA 4A0RA 2XMRA 2G8LA 4Q6WA 3D4PA 5IAAA 3BWVA 3SKXA 3FCSB 1TTHA 5JALA 5KTNA 4YJ2F 2O6LA 1KPIA 5D84A 2VJPA 1MH1A 1LVHA 2AKEA 2JGDB 4CQMA 4HUTA 2YV3A 3DPSA 4UFNA 3C8ZA 4D6PA 3OQOA 5BWMA 1DDOA 2C4KA 4BGVA 3HJUA 3LUFA 1FNCA 3F6CA 3R6TA 5DYNA 5KYNA 3UMMA 4BGIA 3K70C 5DLPA 1LK0A 2ZVDA 4QE3A 4YJ3A 4L3VA 3PGVA 2V7UA 4P3YA 2OLEA 4LDQA 3H5IA 4JBNA 1YCFA 2HC9A 5T8KC 1RU3A 2Y1DA 1A3CA 3OVMA 1RAGA 4P32A 4XPIB 2GHIA 2HSGA 3MMZA 4P8RA 2WI8A 1RYFA 1IQUA 1L3CA 3BIXA 1X0XA 4JLDA 2X2EA 4YRIA 3MG9A 2GCGA 2ZTLA 1XXHB 3EC1A 4FFVA 1I36A 2OGZA 4TT8A 1ZA1A 4DEVA 4FMCB 4TSKA 5LYJF 1I7QB 4MKZA 1Z38A 2WUEA 4TLEA 1DBPA 5T4FA 1KDYA 5BNTA 1SXJE 1ZRHA 4XUCA 3AHIA 1PT7A 1NXXA 3FZNA 3G23A 5CFNA 1ID8A 1ND6A 4AP5A 1ILWA 3GLFE 4TTPA 2CXSA 2NQ2C 4O6VA 2F43B 4Z4HA 4DLBA 1DQZA 1M2KA 2ZRCA 2L0XA 3HVHA 3LX5A 1BEEA 3KOUA 1G42A 3I9KA 5IJWA 4XPIA 4HNAA 4DTCA 1D2EA 3O47A 4B47A 4F4FA 4P0PB 3P2KA 2BR5A 3DTTA 5G2OA 5CCEA 3W7BA 2HKIA 4OM8A 2R4QA 1LDMA 1Y8RB 4B3SB 1MV5A 2DCUA 1WPXA 3VSDA 1K2VN 1LPSA 1Z6ZA 2RHGB 4I9HA 2QWXA 1VPWA 4YT4A 1NSYA 2Q50A 3DUFB 3ONFA 3DOFA 3WBBA 2WKPA 5FEUA 3G2MA 1IIBA 1QV6A 1E2GA 1Y5LA 3B9BA 1WZ2A 2IHTA 3IQDB 5KQRA 1B6RA 2A0UA 3QZUA 1ECLA 3UJPA 3W1WA 1U65A 2DUWA 3H11B 2MSEB 1LQUA 2NU7B 4I5DA 4G0WA 2EL9A 3LCMA 2ZIEA 3VDNB 3HBMA 3X2SA 4KHPB 1BXRA 3LX8A 3EW9A 3F1KA 4XJSA 1L6RA 5CPBA 3DE3X 4EYSA 1RXVA 1VE9A 2NTYC 4DR4B 2HRQA 4NJMB 1Q7CA 1YDMA 2HWUA 3W8DA 3ETHA 4FSHA 3O5AA 3WP1B 3U4MA 2C2GA 4DY6A 2JJ8A 2ZOSA 4K9MA 4YT5A 4PHFA 3QEOA 4JASB 5A4AA 1N2CA 3LHIA 1LBEA 1ZNXA 3VFDA 2OV2A 2IXGA 2CJWB 3JYNA 5GZ3A 2OFOA 3AR8A 1YB4A 1OBHA 1SZCA 3C4VA 1JI3A 4ZO7A 1N8SA 3PC4A 2CT8A 4YT2A 4J7CA 1N9ZA 1V1MB 3TIVA 2V6BA 5C8YF 5KTMA 1E3DA 1J0AA 1X7ZA 2FWJA 3VZSA 1ZN7A 2V0CA 4IJUA 1GEGA 3A4YA 4KREA 2OD2A 2EHJA 4WZBE 5L3ZA 2FB9A 4FXOA 4CHGA 4X61A 1FDOA 2AXEA 1Z5GA 2AK2A 2I2WA 3KZKA 2RDMA 4X44A 1RZVA 2W5UA 2F1HA 4YJHB 5CVJA 4M0EA 2XEXA 2CN1A 2ZIUB 4QECA 5E1BA 3TN7A 5ALUA 4DWVA 1NY6A 5CFOA 5DMXA 1U80A 4BFXA 2W8BA 3IBYA 4M1QA 3GWGA 3SBEA 3PUZA 3EVEA 3EWIA 5IDWA 3JQAB 5DB4A 2B1RA 4XGQA 2O2CA 3DAGA 5ERYA 4PZ0A 1YKFA 3VZDA 3CJRA 4EECA 3NUQA 1WXGA 3D4OA 4F8YA 1VDMA 3EZLA 3RJZA 2H7YA 1PUXA 1HRKA 4UQOA 2RK4A 5GJCA 4PHHA 5ADHA 2AOUB 1PIWA 1T0BA 1M74A 2REQB 3RVQA 2AIRA 1AUQA 1IQRA 1PG5A 3AI3A 4YJHA 2Q5QA 3DR5A 1KK3A 5JNTA 2PM8A 2Q4DA 5IKEA 3ZDCA 3K4HA 1THGA 1DAPA 2UZ1B 4CQNA 1E61A 3SK0A 1J9ZA 4YASA 1IVSA 2HIHA 1ZAKA 3E2IA 3IMEA 4CW7A 1QE5A 1UQTA 2GA9A 1I01A 2O8DB 2V3CC 4PCAA 1U8FO 1DRUA 1JE1A 3IQHX 4LV5B 4Y8VA 4ID9A 1UKBA 3UNXA 3WLMA 5K6AC 2QZSA 1A97A 4PQFA 1TM3E 2WSSA 1ISFA 1E3MA 1L7EA 2X2FA 2XNJA 1E2QA 1V41E 4Y67A 4A5OA 4BNYA 4S0ZA 3X1KA 4IV0A 3L2OB 3NASA 1NTRA 4P81A 2O8BA 4GZ5A 2QM0A 3FRIA 4NXNB 4B3CA 3EQZA 2YXPX 2NVOA 4BVLA 4CTKA 1Y4ZA 4FZ5A 3PJEA 4LBWA 3R9IA 1WNTA 5B4VA 3UT5A 2JIOA 4DNXA 1R8YA 2RG7A 3PQEA 3U17A 3S44A 2DFNA 3A6DA 4OYRA 3NVKI 2YXDA 3LS2A 3W1EA 5LU8A 5JMTA 1ZVJA 3E8SA 3KKEA 5G1OA 3DL7A 5LPNA 1E5QA 1T2DA 5HUHA 1N33B 3W04A 5HSGA 2XTNA 5I7EA 5J43A 5CRIA 4Q34A 3TSYA 2FPGB 3HRKA 5KNDH 1EWTA 4HG2A 3T0GA 3HB5X 1HY3A 3IUJA 2PTHA 2FLVA 3ZZ0A 4O3FA 2IXEA 4LW8A 4MITA 4I46A 4ZO6A 2GSWA 5KB3A 2XXJA 3VVMA 2Z9BA 1NMZA 1T6YA 1YRLA 4CM7A 5TR9A 4IDFA 3OJFA 1VHDA 3C3PA 4PZEA 3UT5B 1H0HA 1AH2A 1FX0A 1Z0KA 1VLQA 1XK6A 3VJLA 4RY2A 2RAPA 1FLVA 1GO2A 1Z6YA 1ZIXA 3B78A 1USWA 3CIOA 4GGPA 4H17A 2EZ4A 4FSDA 3HC7A 3KWJA 3MMPA 1I5RA 3SHVA 3WMEA 1N0VC 3U4DA 2DHQA 2J3DA 4OX9B 3UMGA 3A58B 4R2MA 5FX2A 4UM7A 4BMYA 1N0IA 1Z62A 1AA9A 1DDGA 3QUAA 4X1YB 2V74B 5AUPB 2EQAA 3JTMA 4AYWA 3FYHA 1LK7A 1RLOA 2WHEA 1FC0A 1T9CA 4TPKA 4GYYA 1G6OA 3MVEA 4Q9KA 3PYLA 1H8ED 3BJMA 3WSTA 1IY0A 1Q20A 3LCRA 3VDXA 1O9HA 2P4HX 1ENOA 2BDTA 2HU2A 2QXTA 1NL3A 4L9SA 3INRA 2GQ0A 3DMHA 3UAXA 4FIZA 2YVQA 1DXHA 2JCBA 3LQQA 1E9DA 3PGXA 4YJ3F 1JDVA 3OD5A 4ZAYA 3ZHTA 4AJEA 3FCUB 2VH2A 3EBLA 5DCUA 4KUHA 1HDOA 4Y6QA 3ZI7A 2DLCX 4D97A 1S3IA 4R1OA 3T3EA 3TL3A 3AUJB 5CIYA 1R4MB 2BUCA 3UTCA 4WBXC 2H48A 3TX2A 3LHSA 4M49A 4OH7A 5AXAA 4CL2A 1BDJA 1L7DA 4Q7LA 1I7PA 1SAYA 4QYIB 4DQLA 3TW4A 3GEEA 4KIGA 3NCHA 1RZ3A 3NQ41 3PIRA 1XZBA 4URXR 1UQRA 2A1IA 2P2NA 1RYNA 2FOLA 1ZOPA 3OH8A 3PUHA 4KDFA 1YULA 1F8GA 1LPMA 3FF1A 1ZK3A 4PBTA 1P1JA 3E9ZA 2X8JB 2J4CA 3RJTA 4AQ7A 1ZL2A 1GPDG 1JQ5A 1MC8A 3C6XA 3M49A 1G9XA 1LPAB 1O57A 2HD4A 3PJFA 1L7PA 3ZHQA 1KGDA 4EBFA 5CITA 1XEAA 3AF1A 3A2MA 3L41A 4JY7A 2ORYA 2CMHA 1PNTA 4XIJA 4B3HA 3B53X 4YRCA 2PT6A 2CUNA 4S1VA 4D5EA 3JXEA 2KBEA 3MTDA 4AZ0B 1V43A 1M2GA 1OV4A 2VP2A 3ZS9A 2IOFA 4WESA 4G0XA 1KSHA 4YO8A 2VBCA 5ARDA 4KAJA 3HJFA 5KYVA 1DKOA 2O8EA 1R4ZA 4RJIA 1IEVA 5DIZA 3U3MA 3LFTA 1Z63A 5EWMB 4ND4A 4DJEC 4OQYA 3SYNA 3LQ1A 5AYVA 4L5IA 1GLNA 2X8JA 3N6RA 4BP9A 1KJYA 4W5JA 2HSWA 3E0QA 3R09A 1JIIA 2J3HA 4WLNA 4UBOA 3TNYA 1YHNA 2FN8A 1W9MA 3GT0A 2H54A 3DE2X 4RA6A 4N3GA 5KZMB 3OPVA 4Q03A 2F59A 2OECA 4EQ6A 1DBSA 1FSGA 3E1GA 4C4SA 3UHFA 1W0JD 2QX9A 4JS0A 4AP9A 3EA4A 4WI1A 5JSHA 3AKZA 1OFHA 1E6KA 5K3DA 4D44A 3Q5DA 1K89A 3M6MD 4P0QB 4FSXA 3PHCA 1C29B 3SQWA 3DXZA 3E3NA 2ZI3A 1PGJA 3DDHA 2VJKA 1GNQA 1M66A 1I7LA 1M34B 1NDQA 2JHGA 2ODTX 1D2HA 2IE8A 1C1HA 4TVSA 2FJPA 3JQEA 4J0FA 3BHJA 3DZBA 3RYHA 2XDWA 3CVXA 4I99A 4Q37A 3U4CA 1NZDA 3I04A 3V1TC 1DFIA 1HLDA 5DYIA 3EYAA 3AL0C 1Z2PX 1DAHA 4WJZA 2P4UA 1K2WA 3SEQA 1M2VA 5KOHB 5L3QB 3GPLA 2YC4C 4ZCMA 4QPNA 4FYKA 2O54A 3KB8A 5AW6A 3HXOA 1J1UA 4XFKA 4KYVA 3X44A 3ZBPA 3AEXA 3ZXUB 3E5HA 4I0WB 3O8CA 3UQZA 4Y2XA 1K6JA 1WUHS 5FOTA 1QWSA 3KEFA 2Q1TA 3UMSA 1LF0A 2ZROA 4C4AA 4WCFB 4RTSA 3QV2A 3L0SA 2JI9A 4IX9A 1KTIA 1A72A 3H8WA 1R00A 1E2IA 3WYEA 3UG6A 421PA 1O97C 3C1OA 1SCNE 3I5AA 2ZJ3A 3D7RA 3ZJYA 4D6YA 5FWNA 1GWNA 1OLOA 2BKLA 1BFDA 3IULA 2JFZA 3JPYA 1YS1X 2LR0A 3ROKA 5BR8B 1JR3A 4UHDA 3BTUA 1KHTA 3WGGA 4D43A 1WSDA 1LW7A 3U44A 3IV9A 3KE8A 4JVLA 2VOJA 2MCFA 3PFCA 3GRFA 3UQYS 3DQPA 3BF8A 3EGXB 4LHYA 1SQFA 3FR8A 3TZHA 4N8EA 3WJAA 1DG9A 1OOEA 1LRLA 3F5FA 4FWBA 1QHNA 4IHAA 3DE1X 1G5HA 4ERNA 2G70A 4DLYA 3C1AA 3SEFA 2X1HA 4K6OA 5I7OA 2JGKA 3JZIA 3NHYA 3P0IA 4H18A 4LIPD 2PMKA 5H3HA 1JV2B 1OAOA 3VNAA 3PK0A 4YALA 1VSQA 2OMEA 1OI2A 4K8OA 4L4UA 3PQ2A 1NUPA 3WICA 3T9DA 3V4PB 2WJHA 5KYWB 4JJ4A 1FQWA 1TEHA 5FLEX 1S8NA 1Q7RA 1ZINA 2F3RA 1ZD4A 5BSKA 2O50A 4QDXA 4D4KA 4U1RA 2UUAB 2C2OA 2FEXA 2O2JA 2C3OA 4HH4A 1PCXA 4JWKA 3NBFA 4FHZA 1RLTA 5HA5A 1R9MA 4BNUA 2RGNA 1EEHA 1A2QA 2BFAA 4O1IA 1N5JA 1ISIA 1QH0A 1L5KA 1GKKA 1XVAA 1ZKMA 3CYFA 2XBUA 3S1SA 1SZPA 1NT4A 1OI3A 1VYTA 3GCGA 2ZCUA 1JBEA 4WGGA 1SVSA 3UFXA 1PG0A 2WUFA 3VHXA 5C5IA 3M1AA 5AM0A 1Y80A 2VCEA 4CM4B 1NDUA 1XZFA 3H6KA 2BMEA 1HX7A 2ZAIA 3GGPA 4ND6A 1OWPA 2DT8A 4CMKA 5DE3A 5HCIA 1FUYB 1LFAA 4ON9A 5J5VA 2QTNA 2FSPA 2VLIA 2NZ2A 2VSNA 2I3BA 3KR2A 1E5DA 3KP1A 5AVSA 1HDGO 4JU9A 2HRRA 1G7TA 2C0QA 2GVNA 3EDCA 1ISMA 4IH4A 3VJRA 2JGJA 3ZYCA 3QKTA 2YN4A 1RJEA 3KEGA 4K8RB 3K0FA 1U0FA 5FEMA 3ND8A 3QRWA 4WHMA 2DPHA 1Z25A 3OQVA 1PR3A 3CBQA 1RABA 3OA2A 2ZR7A 5JADA 1KGSA 2QRNA 3RC1A 1XRQA 1RCTE 2CCJA 3G1WA 1NC3A 1T9GR 1YHZA 1ZZEA 3BH7A 3PD7A 5BVHA 4QT0A 5AH0A 1D8TA 4QHTA 1PWEA 3KUKA 1ZVQA 5ELLA 3DE5X 2IXFA 1ZC3A 2WYUA 3QMWA 4X7BA 5A71A 4Q7KA 3NMUF 4FVTA 2QJRA 3EVZA 3JD3A 4MS4A 3N0TA 3V7YA 5C32A 4JBIA 3H3FA 4ZJYA 4XE5A 1SVUA 4RKWA 1T5HX 2AMYA 4DA8A 3VAAA 1OI4A 2GESA 2Y77A 5C8DA 3MPOA 3AETB 1LLCA 3L0ZA 4K9SA 3K2IA 2HA2A 4PAQA 1VMEA 4K9QA 3AMVA 4NBTA 1RXIA 5TQJA 5C37A 2C00A 4H1TA 1NOIA 3EHDA 4KN9S 2WOOA 5CCBA 1J22A 5KWIA 1NIJA 5HRUA 5A0TA 1S8FA 4RV5A 4CT4B 2FMKA 2LRHA 4FGJA 4IIYA 2VK8A 1UBJS 5LLDA 3NAZA 2V9PA 4F4CA 1P80A 1I6WA 3CR8A 3LQFA 4H4CA 1PKXA 1XNJA 3H2KA 2CC2A 5I9SA 5I9BA 3PGMA 3KZMA 1M2JA 3I8XA 4QYSA 3MWEB 4W7HA 3WDKA 1QTRA 1A8UA 1L4NA 5EXEA 4AO8A 5IBQA 4CN9A 5IVPA 3R9KA 3UMBA 1EVJA 1NMEA 1XZDA 3PXCX 4JXJA 4HZUA 5IBCA 3W6OA 4QUHA 1E2HA 1A69A 4KAAA 3EQ2A 4V0OA 3TR5A 1FFDA 4QU0A 3K0AA 5HK8A 1A9XB 3K92A 3VR6H 4V3BA 1IB0A 3MA0A 5DHSA 1W36B 1K75A 3PQ7A 5L9AA 1JSRA 2ZB8A 3HVKA 5LQAA 3DZCA 2OYCA 4ND8B 2D2FA 5EG5A 5BSHA 4G0MA 2IEDA 1R0WA 3FBTA 4XQ9A 1KMNA 1XDDA 2KI5A 2PQ6A 1GG5A 4ZARA 4J1TA 4FP9A 4EI2A 1FE8A 1WP4A 2HXYA 1IUNA 3T8YA 1LBQA 1Z5PA 1UPUA 2ZE7A 3DDOA 2CFCA 3HADA 4AB1A 4E5SA 5COAA 4TLMB 1JIKA 3JATA 3ZDZB 3OY2A 2V6IA 4EA8A 1GXSA 2RJNA 1VBKA 2A0YA 3AVOA 1BJRE 4FDAA 2HWWA 4GAEA 4JWTA 1EVZA 3TDMA 4EG7A 2IGTA 5C18A 3DEKA 2KE5A 3QHPA 4X65B 1NLZA 2VYCA 2J3EA 3I0ZA 5AJYA 1TQDA 2Q21A 4OQDA 3G7UA 4UVDA 3GU3A 4GDFA 2ZR9A 3ZU2A 1UPBA 1OXXK 4IWYA 4C30A 4NABA 5E7QA 3T6KA 1C9MA 1X92A 2JH8A 3VOTA 5TIIA 1E4OA 1V3VA 4GMHA 4HLCA 3HYRA 4LCBA 4KRYA 1RFGE 1O9BA 2YQ4A 4DT1A 2DHCA 1K66A 2H63A 4LWPA 4QATA 5C7OO 4D9BA 3M9WA 3WQSB 3GUUA 3CO5A 4ZI3A 1FTGA 4L74A 1A76A 2WJZB 3N8DA 5CAEA 3TM4A 3TBHA 2WAYA 3OHPA 4AY5A 2GB4A 3WKDA 4Z5XA 1NBWB 3JQFC 4X95A 1I7NA 2B7CA 3IA2A 4QFDA 1GRCA 3ROFA 5FKJA 1UBUS 1XKQA 3GZNB 1MHTA 1UANA 1WMBA 1GHTA 1KI4A 4JROA 4GG1A 3UUEA 1U8CB 1NUTA 5EY5B 1AIPA 2PLAA 3S7ZA 5KBYA 2OVBA 1QPZA 3FHLA 4BE7B 4HNGA 2DECA 1UQUA 3DBOB 1J0EA 3LPMA 1ISGA 1V5WA 4EHFA 4EW3A 3VZCA 3ZHRA 1FFSA 3B60A 3AM4A 2F1KA 2ZTUA 2IY8A 3IE0A 1T6XA 4FE7A 2YQZA 1R8JA 2OAQ1 2B4TO 2H85A 1KBOA 3FKQA 1VG0B 4WLOA 5DHFA 3JAWB 4NCJA 4YAGA 3ZCRA 4AMVA 3AHJA 1R18A 3OOWA 3JZMA 3G1UA 1PR5A 1KZYC 2X8WA 3GOHA 2HT1A 1A9SA 3DAYA 3IUQA 5G02A 5JG7A 4ZCLA 3TIXB 4BMVA 2BVNA 3KO8A 3O1JC 3PEYA 3RVJA 4EY3A 2BEUA 4GPAA 1ONBA 1HDIA 2OC9A 2Q8QA 3DOJA 3OA0A 4R3NA 3V3KA 4MV7A 3H5LA 1BXRB 3PC8C 2PIDA 4GPZA 3AV0B 2ZRHA 1HO3A 1P72A 3LUJA 1TMOA 3I92A 1C9EA 4R9VA 4RPGA 3W3AH 2ZJ5A 2VQEB 1H2ZA 1RIIA 3ADPA 1Z18A 4BS9A 3ZQJA 3KOXA 3DJFA 3T7AA 3WL3A 5TX7A 2QTZA 4PFJA 3ZIAD 4M98A 7REQA 1XO1A 1X8JA 1RXEA 1BCSA 2O5VA 3NS7A 3RRNA 4DSUA 1UKEA 2QQEA 3AIKA 4UBMA 1IN8A 1SUAA 1L4EA 1UAYA 2OPBA 2ZXEA 3CT6A 3K0CC 5DTIA 5KWSA 1SCAA 3MT0A 3AY0A 1DV1A 2ORIA 2VHYA 4MUFA 4RF3A 1ZI8A 4BLRA 3OQJA 1C7RA 4NQZA 4E2FA 1E1MA 2BLNA 4ETWA 3SIXA 5K2OA 3CVVA 1QMGA 4OQFA 2HMSA 1TJPB 5AOVA 4Z0NA 3D4BA 3ERCA 1KKUA 1YR2A 1D8AA 1KAOA 3IAS1 2OV1A 3F6YA 5ICMA 5IZCC 1E0DA 2QD5A 3NHZA 3WLFA 5JRJA 4B73A 3DW1X 3PHGA 1E4YA 3JWEA 4GR9A 1W4ZA 4YTEA 1RJFA 1I51A 2I80A 3GLTA 4NE7A 2RGEA 2XWSA 3GDGA 5T67A 2B36A 4BQFA 3S7TA 2Z8YM 2GF0A 1UC9A 4G0OA 5BUSA 5KVCA 4UEQA 4XVQA 1XALA 2OFWA 4JEUA 1LF5A 3EJWA 4N12A 4TWIA 3RO7A 4B80A 1EQ2A 5JHGB 1BG6A 1I1HA 2WU1A 3LV8A 3C0KA 3GGSA 3JWHA 4IKPA 4E5YA 2H1IA 4ZAFA 5DM70 1EFUA 2PWPA 1RM5A 2XB9A 1SHZA 3JQ8A 2R6JA 5ALKA 3AP2A 2DY1A 5ARBA 1NLUA 2CDCA 4J8PA 1KJ9A 3S81A 1YR7A 3L04A 3WV5A 4RFLA 3UEOA 2IX9A 2PR2A 2ZB2A 4FQ8A 1MC5A 3TK1A 2X23A 3EDMA 4W8OA 5IS2A 3V2IA 3WGNA 4CR6A 1GPWB 4UJ5A 5I8ZA 4YCMA 1M34E 1ZOLA 5BR7A 1UP6A 1WXFA 2QN2A 5HJ2A 3VR5D 3EPHA 1A5ZA 5IXJA 3R3ZA 4KIJA 4IG9A 1JEYA 2QV0A 4GLFA 4PX2A 1D7OA 4ZAXA 5DEOA 1V3QE 1EESA 2WNIA 2QTBA 2ILVA 2J6IA 3EZ9A 3E9RA 1MH9A 1YFJA 1WLYA 5FAKA 4W9MC 4H7IA 1W34A 2I5PO 3UJBA 2MINA 1U4SA 2G0NA 2AEEA 2XTJA 3IQZA 5L7TA 1BHJA 1UL1X 2BC9A 2VHCA 3B38A 3BGSA 4GQAA 4LNHA 5CVUA 1X7ZB 1DAMA 1YQQA 1N78A 4GYJA 1SCDA 1F9EA 1RFLA 1U3VA 2JCXA 3D7NA 1Z2CA 2NSDA 2QJTA 2E5FA 2E7ZA 2XMQA 3H84A 1H2RS 4ZI7B 5I9MA 1CR4A 4QJ4A 4KOEC 2VSQA 2OORC 3KCQA 1KSJA 3NGMA 3HCBA 5FPTA 5HXAA 2XWJI 1Z36A 1T43A 1DS6A 4KWTA 2E37A 1MJGM 1F8UA 4G81A 4MR9A 3R9WA 1QHGA 3VOAA 2AG5A 1IG0A 4LRXA 1LCIA 5CDFE 4O4LF 3HB9A 1OWLA 3D8TA 2FPKA 4OQLA 4AJ4A 3O8OA 4HAIA 4MUNA 4WLUA 3EPRA 4RZQA 4QOSA 3NVDA 1RRGA 2A30A 3LRPA 4KBFA 4BNKA 3EC2A 4EKGA 1CDOA 4UTVA 4FIDA 3WG9A 4HB0A 5FI0B 3ZH9B 2JFOA 3SBOA 5HJ7A 3LBIA 2AHOA 2E5WA 1WDTA 1ML4A 5DGDA 3TJRA 2HU7A 3L9XA 1J07A 3PNVA 2ZQYA 2REQA 3GT3A 4FYPA 3PNSA 1OYYA 3ZR4B 3W9YA 5JXJA 5KX5F 2O5RA 2BM8A 2FE4A 4JLNA 2W2XA 1HC7A 4LFBB 1FX0B 3LUPA 1NATA 5HCUA 2YMMA 2GHRA 4EUKA 5I4IA 4JBLA 3BL5A 1RMQA 4J0IA 3VR6D 2MSDB 4M8LA 2BCGY 1BMFA 3A25A 2RKBA 4Z1MA 4R2WA 1YMUA 2Q3HA 1CZHA 4U5QA 4UCQA 5KJEA 3K9BA 4ABTA 3ZY6A 2ZSBA 3F8TA 1LA2A 4O33A 4S0XA 5HZGA 3QVVA 3VI3B 4BPRA 1V4NA 1ECBA 1BC5A 1VJCA 1YGYA 5BSUA 3VQTA 3IT3A 2XAAA 2GK6A 3UWSA 2DWOA 3AUXA 4CKXA 4D3DA 2X7XA 2V6GA 3PB3A 2A9JA 4PC7A 3D3QA 4Q48A 1Q19A 2A14A 1CVIA 3GP8A 3EZ6A 3FIJA 4KPGA 3ZNPA 3OOSA 3RS2A 5CW1A 1QVVA 2V65A 4BATA 2JBHA 4JXXA 3LVQE 4YAIA 4MWEA 3UXHA 1NMYA 5EHQA 1M8FA 5AKKA 2VUHB 1L7QA 4A0GA 4LY6A 2PSSA 3QA9A 3DMPA 4HLQB 4RADA 3KYCA 1DPGA 1F0PA 5ICFA 1CIVA 1ESCA 1JAHA 3QTTA 5C7LO 3FAKA 2Z3VA 1QO0D 2IYUA 3P0RA 4DMKA 1SZJG 4MRRA 1EP9A 3CLSD 2FJ0A 2X1VA 1JHYA 4D79A 5A2QA 1MZPA 2QI9C 5JI3E 1R0KA 4CQMD 4Y3UA 2R6ZA 3SVLA 3QLUC 3UOGA 1E96A 1KDZA 5KNBD 5IZ4A 1IIRA 4MI9A 3OZTA 4V1CB 5EI5A 2WKWA 4OFZA 2XVXA 1G18A 2G82A 3K72B 4KQEA 3RUFA 3ZWKA 3QFTA 2FPMA 2BHSA 5F4ZA 3CUEF 5AM3A 3B89A 3NWOA 4PU0A 1CT9A 1GV1A 3LVFO 4I6EA 4RZXA 1Z5ZA 5ALDA 5I01A 1KEKA 2WAOA 3O8RA 3D5TA 3P20A 4DV2B 5B1IA 2ID9A 1D6MA 1M8GA 1N6RA 4IJVA 3SBXA 3KZ1E 3KYCB 3UWOA 3UPUA 4KX5A 3ZVNA 2IDZA 4WKCA 1Y1QA 3MJFA 3NNNA 2VDMB 3NW9A 4EJSA 5EIBD 3SMQA 4YRBA 3H5VA 5DBFA 1D2CA 6REQA 5FUMA 3IIJA 2D06A 2LIVA 4C0JA 1VCNA 1PFKA 4DANA 3WLQA 4DLVA 2ZUUA 1BMTA 4BRWA 1CZLA 1PQ4A 2AC4A 4WN9B 2WB2A 1Z88A 1OHHD 3AHCA 1C50A 2YH2A 2FQYA 3QUSA 5EWMA 4RJLA 2JIMA 1ZX1A 4ZVPA 4I2NA 4JXZA 3DAPA 1K97A 3L07A 4ASUA 3AP1A 3GJ3A 3KR0A 2XRFA 5G0SA 1P4HA 2GK4A 4G5QA 4HUJA 1TF7A 3MWYW 3SYLA 4DNFA 5I7RA 2ZBRA 1VCMA 5TQVA 3NYRA 3VR3D 5IMSA 3L6EA 4NPAA 3MD0A 1F1JA 1K4YA 4CI9A 1CHDA 7MHTA 3D3KA 3FSRA 3QTBA 3OPNA 4MZXA 3C6KA 3TLBA 1X6VA 4DBZA 1LX6A 4QA9A 2EZTA 3HZZA 1W5BA 1I5OA 4MLCA 1W4RA 1W94A 1Z3IX 5A2GA 5AM5A 4XYLA 4UVGA 4NSNA 4EENA 2AG1A 2HCJB 4JR2A 3BCRA 1SXPA 3OY7A 5DCYA 4IPTA 2COKA 2NNWB 3BHMA 3F73A 4WOKA 4FEEA 1TF5A 1BHQ1 1NI4B 3B13B 3GFSA 3STYA 3Q6IA 5FNVF 5PGMA 2JLBA 5BN5B 4BGUA 2VPQA 5JSKA 2A1TR 2ZJ6A 1BS1A 1UKYA 4FHCA 4NBVA 3R5XA 1M2EA 3SMVA 4PGGA 4CBVA 2KM1A 1BAPA 1MJFA 2XNHA 4HRVA 1DARA 4I1UA 2WM9B 2P9ZA 2CBGA 2VJQA 2Z9CA 3FM9A 2YS6A 3ZDYB 2X1LA 1GOTA 3FLMA 5FOWA 1M2OA 1RAFA 2NXNA 5FV7A 4BP1A 2G67A 4CMJA 2SKCA 5K2MA 2CV1A 3MC1A 2AZDA 3PA8A 3RDPA 3E7DA 4II3A 2R6GA 4AZ0A 2KSQA 4J43A 3J80A 3NJ8A 2AXNA 2BJWA 4JT8A 1IWOA 1UDRA 4M9QA 1ZO8A 2O7NA 3Q5GA 5IARA 4BE9A 1KL7A 1NFFA 2AQKA 1J8MF 2PMDA 5IBRA 5SY4A 5HRAA 4TQ9A 2QBYA 3A6PC 4CXMA 4YCNA 3ZCPA 1NP3A 1YVEI 2I91A 4LC1A 1DIBA 1AUVA 2VZ9A 4FINA 3RD5A 5HIJA 1YI8A 2ZRFA 3H6GA 3ZY3A 5HE8A 3OQPA 4EB3A 1T8UA 3IP3A 3JWIA 1DTSA 1Q16A 1M2OB 1Z6XA 1SCQA 1MQ8B 1Z12A 1LS6A 2ABWA 3GEMA 3HM2A 3RQIA 1UBLS 4CNQA 3ETEA 2VT6A 2AYXA 4CMEA 2OHFA 5HUQA 4ZDIA 2CNDA 2IXDA 3RH0A 4QHYA 1MX3A 4E3WA 1RJGA 2R96A 4CFZA 1RHMA 3QWAA 4AX8A 1PGQA 2GN8A 2H2DA 5BR4A 1T2AA 1X1TA 1KYYA 3NPAA 1XFAA 5IJ0B 3E05A 2DJIA 4IDDA 3HS3A 3I2JA 3DD1A 1AZLA 4EX7A 1Z16A 4KOAA 3CEPB 4R6XA 2IYWA 2DHRA 3S27A 3KXPA 2GZDA 2ZCVA 2QTCA 3B1VA 1BDMA 1CUIA 1YU6A 2H9YA 5IEJA 3KPUA 1MX5A 4UNIA 1G1AA 4Z6KA 4GBED 3DTNA 5IABA 2AOTA 4UASA 4CTNA 4Y0AA 1GPBA 3N70A 1G17A 1H2XA 4XSGA 5DBOA 5GTDA 4D82A 3G13A 3VR4D 5HGXA 1U0HC 4YFYA 4PZCA 4BDSA 1IXSB 1VMAA 3VBCA 2PSFA 2G1AA 3EOAI 5DMHA 3MMSA 1TC2A 3ECCA 3I09A 4JJ6A 4TWAA 2WVAA 4YRPA 5CEFA 4FZ3A 4EG4A 1WEHA 3DEFA 3VH4A 1OLUB 3VVLA 2JIZA 3PC3A 3QUBA 3GUCA 3MZ0A 2M6RA 4PPNA 2YZ7A 5I8WA 4ESOA 1IFXA 1ZJJA 5EYPA 1R9NA 2CVPA 3MQFA 4LGVA 2HK9A 4AJJA 3GVPA 4TXNA 2PSEA 3V7WA 2A9PA 4NNJA 3GV0A 3DLAA 3KM0A 1TTQB 2WP0A 2C88A 1GVNB 1RXYA 3RSFA 4YUXA 1AMUA 4F84A 2OB2A 3AZOA 2B25A 5KSOA 2F3TA 1KI9A 2K5UA 1I3NA 3BHIA 3WLAA 2C5LA 5A4JA 5KYWA 2DXIA 4M7PA 1OAOC 1ZOOA 2YJ6A 1SRRA 2VHUA 5CNKA 4M0CA 4QD3A 3H86A 1FPQA 5I4KA 1N3BA 3ZLJA 1N5MA 1O94D 1TECE 2BT4A 3N8NA 3WO0A 3L8DA 4Y2PA 4P3PA 2NZ8A 2GPTA 1H5UA 4MQFA 3DXYA 1HF3A 4XM2A 5AKHA 5KQPA 1N2BA 3G8YA 2ZYSA 4B76A 5K0FA 2CXTA 3C7DB 4KITB 3T3MB 2PXCA 4C7MA 3REOA 4KN8A 4EABA 2W00A 2QAGA 4YMUA 1QIGA 2VHQA 3PEUA 5KYYB 1C0LA 3F4KA 5EMNA 5C0OE 4AJKA 4BXOA 4BCDA 2R8XA 4RA9B 3TVYA 2KBFA 5M29A 4UDNA 1V35A 3L02A 2EF1A 4LRQA 4NYMQ 5DHTA 1ZMTA 3WLTA 2FKAA 3G8DA 1GQYA 3AXTA 3MGKA 1L4GA 4EJ2A 1UOQA 4KBGA 2QRKA 3I9MA 4V0KA 3EISA 2N75A 3S2GA 2FW6A 3TR0A 2ID4A 2PX4A 3DLIA 3OLVA 4PINA 3RV4A 4D99A 3QXJA 5KNCH 2UYOA 5FLYA 1N2IA 3PDUA 3GG9A 3PDWA 4DAOA 3OFKA 4P3KA 3ZIAA 2EP5A 1JR2A 1P2TA 2GILA 2QUKA 1DIGA 1RC1A 2YY5A 3HDGA 3NTVA 3PC2A 1VL2A 4NFYA 1DKMA 1W88B 2DSTA 3RT1A 1G5FA 2LDXA 2ZYAA 3STWA 2C7QA 3WYAA 1XEWY 2HADA 3F5QA 3K9LA 1V5FA 1GSIA 1TZ2A 3NBAA 4G84A 3MJEA 4K9KA 1E1CA 3EC7A 1G8SA 1SQSA 2PANA 1G8YA 3FCXA 3QWIA 4I50B 4ND8A 5D3QA 3TKAA 3V8MA 4B0PA 2ZWIA 2OG1A 3FLBA 3GRVA 2R44A 1T0IA 2O1XA 2XCUA 3PJDA 1Q1BA 2DQKA 4QNNA 3VU8A 2P91A 4XIIA 3ETCA 4RABA 4ZOLF 3T5PA 4K9DA 1Q92A 2HIGA 4BIIA 1TF2A 1DWQA 1TJ3A 2WIGA 4DM7A 1AUPA 2XUAA 1Y8ZA 3SKVA 1PZGA 1GCGA 4BJ6A 4G85A 2FSFA 5JSQA 1IM8A 2BBOA 1LLQA 3S8YA 1X15A 4JDUA 1O5IA 2PUWA 1ONPA 4BFSA 4KI0A 2TSYB 5BQFA 1B3BA 5JJBA 4LJAA 1O1YA 3B8EA 5H4GA 1NF2A 2JJMA 5HBRA 1W5TA 4JH0A 5F73A 4ARSA 4MX8A 2QE7A 2WG1A 1JEAA 2PJDA 4F46A 1JRLA 3HU3A 3G2LA 2VA9A 3VNQA 3I9JA 4A0SA 1WJGA 4DCGA 1C0PA 1U0RA 1K8XB 2X19A 4M9XA 4FFWA 1DIHA 1CZUA 2Q8NA 4JMLA 2ZE5A 3W8FA 3Q7PA 5F2NA 2XZTA 1ST3A 2ZKIA 4DCSA 2YWHA 2WJGA 5A4DA 4AMYA 4H59A 4M0KA 2JVIA 5F76A 4D5GA 5IUJC 4KPYA 3FB4A 1BFKA 5BXYA 1I9GA 1CHNA 3U3XA 3PDIA 5JWRA 2PYDA 1AXRA 3IRUA 3C3JA 3VPXA 1EK2A 2VHTA 3GZNA 4Y9TA 2IUTA 1GPUA 1XZNA 2HDNB 1VCHA 3L5KA 3M4JA 3PYXA 3QPWA 5AQ1A 2G71A 1PQYA 4UW9A 5DULA 4JNKA 4MO9A 4NAUA 4X7PA 2JLXA 2ZB4A 2CVOA 4KXNA 4ZDWA 2ONKA 3I9NA 1X70A 3C1UA 3G0CA 3ICEA 2MSNA 4IMRA 5E9AA 5FH9A 1T0UA 1WMFA 3SC2A 3M2TA 2Z5VA 1KJ8A 1BMFD 3Q3GE 5CLJA 1JMYA 3O0DA 5T41A 3MQ2A 1N3LA 2GEBA 2QAJA 1ZIYA 5D3KA 5CK5A 5G3ZA 4D3SA 3NGXA 1LDBA 5I7AA 4Z2YA 1R37A 4BX8A 4UEWA 1X7XA 4DMCA 4NZZA 1A9QA 1FDRA 2EZ8A 3CZ9A 3H05A 3DV0A 1GXSB 3NHPA 1GN8A 4HXGA 4BMNA 1TLFA 1NTOA 3ANNA 4UE3S 4MKXA 1Y7IA 4XIFA 1G98A 4ZVVA 4CCWA 4HGOA 2SHKA 1TX4B 3H4MA 1B14A 1CQWA 1Z4LA 3UGJA 1GPJA 1TVKB 2P75A 4IEIA 4F5EA 2COUA 2Y1KA 2VPPA 4QBFA 4A2WA 4D41A 1UBMS 1BH6A 3PPWA 4DYDA 3FUWA 4EK9A 1V0JA 2GSDA 5AVZA 1K98A 2FLKA 4TT3D 1BYIA 2OQVA 4ZT3A 3RC7A 3ZZMA 3AVYA 4J7XA 4P7BA 3OI7A 4IXDA 2EG5A 4N9WA 4AY4A 4B4UA 2WBLC 2Q99A 3M6UA 3MK31 2ATCA 2QVCA 2ZT8A 4G5RA 4ZT6A 3WYDA 1LBTA 3HN6A 3T15A 4KE9A 1LZLA 3B1ZA 4OMUA 3TSAA 4C87A 3LYLA 1UBKS 2Q3BA 1SQ0A 4OQPA 4RY9A 5CLLA 2WHQA 4NYIR 4MRMA 1DJLA 4TKUA 1SVIA 1EGHA 1BCSB 1MQAA 2J1LA 2DH5A 2ZJFA 3JCZA 4Y7CA 3T5AA 4GKBA 3V4OA 2IYZA 1XDUA 3MWJA 3ZV7A 4TXHA 2PWBA 1E3SA 3AIMA 1XWIA 1YK0A 3QTLA 3WLRA 2VWHA 3ADCA 5JV5A 4U2FA 3LMKA 2AR9A 1YBAA 1R5BA 2W6MA 4HB2A 3WK4A 1DBQA 2Q9CA 4GMGA 4CPDA 2P2LA 3WOVA 5A05A 3MJHA 1LPOA 1QFJA 4KO2S 4NG4A 5TXGA 4QSMA 3QX7A 1XCGB 1UBNA 4V0LA 2OPHA 1KDRA 2C58A 2PBRA 4DE5A 4G0UA 1Q74A 5JPIA 4DZRA 3X1XA 1EGAA 5H1YA 4IGIA 4PCVA 5A7HA 2GYVA 1IBCA 3FPJA 4MRMB 3V00A 3ZXSA 1KYIA 5CD9A 3KQWA 4TTAA 5K8TA 3DGFC 4TROA 1ORVA 4F8JA 2NX2A 3CCCA 2XKAA 3F5DA 2W7TA 5KQGA 4NMHA 2C1XA 4MWSA 1BXGA 3GY0A 3H42B 4QTXA 2VP6A 4E2YA 4RU1A 4COKA 1GPLA 4BU0A 5A1TA 4MKHA 3SIWA 5JAIA 4XR9A 1OY1A 3CLVA 3M4NA 3WB2A 4PFQA 1EEXB 3WMFA 3AVQA 2FG5A 3IUNA 3P0HA 3DG9A 4RXUA 1IZZA 1OFIA 3BA1A 4G5XA 5PNTA 4C7OB 2IS4A 4ZGBA 1E6UA 3B6MA 3HZRA 2X3UA 5AVQA 1ZQ9A 5JCZA 5EHZA 5GGYA 5CVTA 3NBKA 1IK6A 2CJXA 2QLMA 4RK4A 3DEZA 4AD8A 5CDSA 3Q8KA 4K6KA 4XR4A 2NSYA 2XD4A 2F4NA 3C3KA 3ME5A 3KLPX 2YYYA 3OIDA 2VHJA 3ABSB 3LXUX 2JJ1D 2QGZA 1JFLA 2B1GA 5LJLA 2FG6C 3PGJA 3OZIA 3ZV4A 1E3LA 3HPQA 2PMWB 1CEXA 3SJCA 2XKJE 1QUEA 4XCQA 2AR0A 4C4YA 5IJXA 3GVHA 5HGJA 3HSSA 3VPGA 4B32A 1ZJ5A 1TZKA 3C6ZA 1THTA 4N3AA 4LRUA 1WEKA 1OT5A 2COEA 5A4FS 4HYTA 1MAAA 2NUBA 1NP6A 4HSGA 4EYKA 4X6YA 1NUHA 3C48A 4ZVLA 1GD1O 5KWEA 3UHAA 2B8TA 4BOYA 1MB4A 2G40A 4MQEA 3UBMA 2OQRA 2LVBA 2VRWA 2MJLA 3LG2A 2BMWA 3R0XA 3L3BA 4J9VA 2H06A 1E9EA 4N0EA 3P0FA 3ZY4A 4LE1A 2OYSA 3G9QA 3NDJA 2GRJA 5KSPA 4NL4H 1CIJA 4PC2A 4BVEA 3HRHA 6PFKA 5EJ7A 1Q3TA 2BFDB 2CL0X 1AURA 3BMXA 2OCKA 2XA9A 4IKEA 4C4PA 5HQTA 2XRZA 4N6NA 3WKCA 1R6DA 1RWQA 4BNHA 1WUJS 3M9LA 3A1WA 4MWZA 4TV8B 3TB4A 5C1BA 2EQ5A 4WMLA 2Z3ZA 1QKIA 2WF5A 2XT0A 3NM5A 3E23A 1SD2A 4OIFA 4TTVA 3W8RA 1IDOA 3SOZA 3PNYA 4OAOA 4UUAA 5G53C 2Y99A 2Z83A 1M7BA 3E70C 1C3LA 1E2JA 1GGJA 4QKQA 2XKKA 4O2BB 2H4WA 1J70A 2JIPA 1T2CA 3GNLA 3LE8A 4KE6A 4BAZA 1E2BA 3SBDA 2D1TA 3K0BA 5HNKA 2FPLA 2PS1A 1F6DA 1QXSA 3G9UA 3QXHA 2P2GA 1HKHA 2XW6A 4G65A 2YMPA 3E2MA 4WH0A 4RZIA 2V7QD 4FZRA 3ECSA 5E3JA 5KJCA 3AEQA 3FHOA 1IY1A 3IOMA 4I1SA 2FW9A 3IMFA 1OSNA 1Y8AA 1CQIB 5SZIA 2PK3A 3FFAA 4LY9A 4N8SA 5AJUA 5EUCA 2VS1A 2GXUA 2XY4A 1NVKA 5GOZA 2IUUA 2QPAA 4BQRA 4BVGA 1JBKA 4YB8A 4D96A 1N32B 2PEYA 1BHO1 3O1HB 5DLYA 1IB6A 3BGIA 3L6RA 4Q3NA 4TVKA 3T5GA 1RCFA 3HI4A 3ZU4A 4AJPA 3K31A 4J1SA 5CLGA 2R7AA 5KQLA 3LF2A 3ROZA 5CEJA 3FGZA 3HY6A 3PXXA 2XI4A 4TL9A 4RKRA 4YDQA 1N25A 2QORA 5IYZB 3ZWYA 4C07A 4GOND 4CKWA 3LA6A 9GPBA 2ODWA 3SAJA 4QVIA 2WPNA 4LPSA 3WJ1A 4LQ4A 4FM9A 2EAUA 2ZXFA 3FYUA 2XB2A 2ZJ0A 4FFOA 1S3GA 1NYRA 1JBQA 1MC4A 2CLDX 2K7ZA 2O2DA 2LKCA 2VDJA 3E22B 2MMGA 3IKLA 2B83A 5A06A 4DR6B 1EA7A 2ZAYA 1O8CA 3Q7QA 4LBZA 5IJAA 4I9GA 3ZU5A 1O0BA 1FUKA 4D8UA 1NQXA 5BNFA 3D1LA 4PBRA 4X60A 4YUVA 2Y0DA 4HRYA 3KTDA 3RS0A 3HK2A 3HVJA 3Q15C 1H42A 5GINE 1L5YA 1CB7A 1L5HB 1NVGA 1X3LA 2QM8A 4PTYA 3TJZA 2F55A 4GUAA 3GFQA 4EJFA 1QG4A 1JQLB 4DILA 4D8XA 2F8LA 4BO7A 4N4AA 1WM1A 2XOXA 4JBXA 1ZM9A 4CDMA 5L4LA 1KYWA 1NJ6A 2DWQA 2FPGA 1O77A 2DT5A 2XNKA 3GUHA 5KO2A 4TV9B 3EGIA 1JXAA 4AFNA 4DVJA 3CLUC 1P81A 4EP1A 2X7HA 3VAYA 3UUGA 1CY7A 2BE7A 1NVTA 3LIPA 4TKLA 1Q91A 4ND3A 3MW8A 1PGOA 1TU4A 4URYR 1Z0SA 2YXNA 3TPCA 3ZXIA 5JYDA 5CD1A 3FYSA 3R5JA 3U7JA 5JASA 1PDWA 1SK8A 1VJ0A 5FUYA 1PZHA 3RREA 1NONA 4NE9A 4YYZA 3O8DA 1KI2A 2PRIA 3CKYA 1KYTA 1N8TA 1SA0B 1V7ZA 4K28A 4MUBA 5I9TA 3TWOA 2O6HA 3VGPA 1L1FA 2XCIA 1Z6GA 4ECEA 1R9JA 1XJ5A 3IBFA 2H9AA 1U0TA 1MN6A 2OOSA 4X20B 5F4BA 1K7XB 3V8BA 4ANFA 2V5VA 4G1MB 3ZS8A 4HTFA 1UXJA 1VYUA 2HGSA 2HSJA 2VHEA 2Q4TA 2GN9A 4JLBA 5LXTF 3ZV5A 3N07A 3IQXA 1C5KA 2YL2A 1C4XA 1OTYA 3IQEA 4LBVA 2ZYHA 4IJQA 4Q3EA 4WA7A 4UTPA 3B48A 1Y63A 2DBYA 2H2FA 4JR1A 2BBWA 2RCYA 3ZPXA 1N5LA 3IVAA 3MCTA 1L5OA 4JZKA 1QO0A 2F7SA 1DEAA 5B58C 1XVUA 1E8MA 2QE6A 3DEAA 4P5EA 4PWZA 5MN6A 4Z4GA 2C5GA 5G4LA 3UFBA 4HMQA 2FFQA 1XYYA 2HX1A 4GGMX 4D80A 4QRIA 3ZUPA 4AJLA 3NC1C 5H82A 1P60A 3L1VA 3ZN2A 2BISA 1R4MA 1KFCB 1XQYA 2OBFA 3NYQA 3MAJA 3W4IA 1N0WA 2AWNA 3PT9A 4MH0R 4V0MA 5JQGF 5T6MA 3K16A 2PCJA 4FGSA 3FUVA 2B5VA 3H8SA 4U00A 5HKAA 4EO9A 5AHOA 5B37A 2QTTA 1X3SA 1YVUA 3SR0A 2ISSD 4GHWA 1B00A 3BAZA 4QELA 3WLIA 1DRKA 1OIWA 3U39A 2D7JA 4F2GA 3L77A 4P08A 2GZRA 4CV3A 4FYHA 2OBYA 3CRQA 2DQZA 1V4VA 3EXEA 4D56A 5M34A 2YBDA 2VYFA 5JDCA 3NEPX 4V38A 1R10A 4F3TA 1DBRA 4WOBA 3KFXA 2Q6TA 4LXXA 4DA0A 3AB3A 4M8NE 1SUCA 4DPMA 3ENKA 3OMXA 1QYVA 1L8AA 2ES4A 1GUAA 4OBEA 4WOJA 5FTKA 5L4NA 4C4TA 4QPPA 4PQYA 1YRWA 3THSA 3TNDA 1K8YB 4J6FA 4EJ0A 4HCJA 2JA1A 2QZ9A 2R6CA 1UFKA 2JEZA 4CMBA 4XIYA 3QGMA 5JLJA 1MNQA 3VX3A 1GUYA 1JHVA 1VMDA 2AVNA 4LXGA 4R9RA 4WA8A 2QPOA 4PX5A 2QUHA 4R1QA 5TJ9A 2Z0MA 3QX8A 4MCIA 2O8EB 3KJFA 3GGOA 3H13A 2NSHA 5FADA 1W36D 1WBDA 3GK3A 2E1PA 5E7IA 1W29A 3WY9A 2AUMA 1NZJA 1BMQA 4NZYA 1NOKA 1U02A 5AIAA 3RYFA 3V34A 4BV8A 3MCUA 4ENWA 5HIIA 3SSAA 1J09A 1Q0LA 1XJ0A 3ZJ5A 2QLLA 4BNZA 2XQJA 2QA5A 4LYDA 5L4SA 4X5OA 5BT9A 1Y1SA 3KD2A 3O4VA 3UIEA 4RA6B 1S7CA 4LRYA 2E4VA 3R3VA 3TLJA 2XZOA 1YMQA 1MNAA 1UFQA 3HCEA 4LK3A 3U7QA 1ZNYA 3T54A 4HQFA 5HKBA 4OA5A 4CF3A 3DA8A 2WLSA 1L4MA 5ITVA 5LVAA 3UA4A 3R6DA 4XUDA 3PGKA 5A3QA 4YJKA 4YY3B 3PX2A 4JP5A 4XSHA 1EDDA 4N3NA 2WUVA 3LH5A 4HKTA 1PW5A 2JCGA 3VH3A 4F96A 5FFNA 3OOYA 3ZGZA 5L8VA 5J58A 4RS4A 2VPXA 4PQRA 5E2IA 4GC9A 5B3JA 2D7CA 5JROA 4KVZA 1CF2O 1Z07A 2QYTA 1U2QA 5BSMA 4CIDA 4RUKA 1HGXA 2OMKA 3VR4A 2DR2A 4WEQA 4ARUA 3R2JA 4C22A 4U3JA 5U4XA 1PJ3A 1R4AA 2PGLA 1MU0A 3E4DA 3LKBA 2BAGA 4DIUA 2NO7A 2ZJ4A 1FMTA 1U1GA 2F9LA 1TQ6A 3R77A 1ENPA 1QIFA 4HDOB 4QBTA 5EKTA 5FOXA 2J5XA 1KYVA 5CTJA 1PK9A 1GAWA 2FP4B 3RVKA 4Z3DA 3PTAA 5ABPA 2I9PA 1Z4OA 3OM0A 4CMIB 4FW9A 3NXKA 3RQSA 3K0EA 3MAGA 3R23A 5ERXA 1EGVB 4J6EA 4F38A 3RV3A 2HK7A 3K0HA 3TJMA 1U0SY 1NYTA 2D54A 2NVUA 1DT5A 4UUQA 1Z75A 4H4DA 2QYSA 4G3XA 3W8NA 5LC1A 3UB2A 3BMQB 1ND5A 5AT1A 3ZZ1A 3B51X 2F4VB 3N74A 1BGVA 2O2SA 4U3JB 5T64A 5IKPA 4JHLA 4CF4A 4E94A 3MLAA 3LT0A 3NHWA 3A1CA 4DA4A 4PX9A 5GONF 3KK0A 2H1WA 4HXEB 1E9VA 1IOWA 1R3UA 3EJ6A 4JD5A 9ABPA 1XAHA 3REQA 2CZQA 2W6CX 3O82A 1YUNA 3DVAB 1E0JA 4GH5A 2JAWA 1H5QA 5I7SA 1IHXA 2GJSA 5B55A 1O6BA 4G2NA 1IMJA 3WHKA 1PFWA 5AHKA 1SXJD 4JJZA 1YB5A 2Q62A 2XECA 4IP0A 4K86A 4X0EA 3T1OA 3W2GA 6AT1A 5H8WA 1DJQA 2IYFA 2XXAB 2UUPA 2X5KO 4F5YA 5BWCA 4C3UA 4I1OA 5DGHA 1KSGA 2OXFA 5C80A 2ORVA 1EGQA 4PLHA 3OT4A 3A9VA 4I7EA 3C74A 1COZA 1WV0A 1JN0A 2I4IA 4MDYA 2IPAB 3ROTA 2VDWB 2WD7B 2Y68A 4M38A 2GO1A 3MJRA 4MICA 4QTTB 5AOCA 1ORHA 1K3UB 5JVDA 3CUVA 2B30A 121PA 4GOJA 4TVOA 2GD6A 2IKSA 2FR0A 1I13A 1L5RA 4IQ4A 4DWWA 4NWIA 3TINA 3KYIB 2DWUA 2X41A 3MGAA 1KKLA 3ZNQA 3W2FA 3DVRX 4NU0A 1ZA2A 2Q5OA 5IVKA 3JQGB 1N5DA 4CLDA 3WIDA 1U81A 1U6KA 1RYZA 4Q3KA 3AK4A 4DAEA 3F96A 2J32A 2BONA 2XA1A 2P30A 3E5MA 3QG1A 1G8GA 1OXSC 1P33A 1PJTA 5DV9A 5JT1A 4OF4A 3EWNA 1CYDA 1UJBA 5B53A 3W3ZB 1O87A 2VJLA 3G7NA 3IELA 3TG2A 3GLFB 1ZH2A 2FFHA 3QBVA 3KJHA 4ZQBA 4AKTA 2C20A 3ZIUA 4LZLA 3MGGA 4HDKB 3I39X 4FMPA 4RX1A 3RTAA 3WDSA 5CXUA 1QVWA 5LMCA 1DG1G 4JIMA 3FJOA 3IDFA 5CFRA 2CV0A 2Y76A 2NPOA 4B74A 4JEIA 1KI8A 4D9GA 2ATIA 1RDFA 2XUOA 2PL1A 3ZD9A 3P5BA 5H5JA 1Y7PA 1B74A 2XITA 4QTYA 4ND2A 4Q0MA 2HLDD 1KQ3A 2HCFA 4CMHA 2BHRA 1S3FA 4MKFA 4EUEA 3UMYA 2XUQA 4LV8B 3HBJA 1B8PA 1EFRD 4QFBA 3H7AA 4PG8A 1GKUB 2G4LA 2CXPA 3ABIA 4ZOQI 5KDDA 2BH9A 3RGWS 2MIIA 2GASA 2OXRA 4E4TA 4F9TA 1KA9H 3GLHA 2Q1WA 1R3DA 2JVKA 4X85A 4E88A 1FMFA 3M6IA 1U3CA 1P5ZB 3R0QA 1H8HA 4Q7MB 1YS4A 2BGJA 4BAUA 1R6TA 1RRMA 2PX2A 3B82A 1QZ3A 4XJTA 3DE0X 4MEBA 3A04A 5FBQB 2A0XA 1HUQA 1NSTA 2WINI 2W2PA 2OZKA 4RKFA 5CJPA 4NYJR 1SG6A 2H65A 5FWAA 4B87A 2XDQB 2F67A 4H27A 3GLRA 1XRLA 4YI3A 5H9WA 4HATA 4G01B 4QOFA 2V7QA 1MX9A 3IAFA 2BHTA 4MW1A 4O4HA 3GRRA 2X0JA 3RHSA 4DCNA 4KRGA 3CZ5A 4EAQA 1QH1A 1U9YA 1YB2A 1X1AA 1RQLA 2CVZA 3CV3A 3MJ4A 4IZ6A 4MW7A 4NYIQ 3HJAA 1JEQA 2NUAA 3QE9Y 2OEPA 3VR2D 2REXB 2CHEA 4M4SA 1TU3A 3AFMA 5J2TF 5B7PA 1RRCA 3DP7A 4RK7A 5B6JA 4A10A 3FI9A 1ICEA 3BORA 1GR1A 4BO1A 1L3BA 2CJYA 4N9QA 4UAVA 3X1JA 3C7TA 1DU4A 2O19A 3VPSA 4HDRB 2XXBA 3WLJA 1KOJA 4DC0A 4MLPA 3GW8A 1ABBA 4C5BA 3C5CA 2H5IA 2X0RA 3RRBA 3LPNA 4WCFC 4D8YA 1SBYA 4MA4A 3OP4A 3P9QA 3QG5A 3IQFA 3IB6A 4Y30A 3V8VA 5IANA 1ZICA 2CLKB 4FDMA 1XF9A 2LBPA 4UREA 3H1EA 3WB1A 4PRLA 2HLNA 1HTBA 2B3DA 3U7EB 3WLHA 5TLSA 4DR1B 2WAAA 3FKSD 1OLXB 3ETLA 1DO0A 3T1QA 2B8NA 4ZKDA 2XLCA 4UJ3A 1RMTA 1YQXA 3DMDA 4G5HA 2GJAA 1Y1KE 1CUCA 4WASA 5EWJA