4DARA

Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with tubercidin
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
231
structure length
231
Chain Sequence
SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into phosphate cooperativity and influence of substrate modifications on binding and catalysis of hexameric purine nucleoside phosphorylases.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase deoD-type
total genus 79
structure length 231
sequence length 231
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4darA00
4D8XA 4D8YA 1A9PA 4L6IA 1PR1A 2QSUA 3PNPA 4DARA 4UC0A 4YMLA 3KVYA 3TL6A 2HRDA 1B8OA 1ZL2A 2A0YA 1ULAA 2XRFA 3INYA 1SQ6A 3IEXA 3BL6A 1PKEA 5B7NA 1Y1RA 2H8GA 4WKPA 1ODJA 1U1FA 5I3CA 1Y1SA 4DA8A 1ECPA 4QAQA 1Z5OA 3ENZA 2B94A 5C80A 1VHWA 2AI3A 2AC7A 1VFNA 2A0WA 4R31A 4R2WA 4K6OA 3KHSA 4LKRA 3F8WA 1OU4A 1U1EA 5F7ZA 3FUCA 5CXQA 3NM5A 1RFGE 4JOSA 4TS3A 4DA0A 1Y6QA 5EFOA 1B8NA 4YNBA 4LNAA 1JYSA 4TXMA 3DP9A 1JDSA 3PHCA 3NBQA 4OGLA 1Z36A 5F7OA 4NS1A 3DDOA 1M73E 1ODLA 4WKBA 5CYFA 3K8QA 1V2HE 1OUMA 1RR6A 1PR4A 3LGSA 4WKOA 1T8WA 5F7XA 4OGKA 1U1GA 1OTXA 1C3XA 1V45E 4M7WA 3MMSA 3NM6B 4L5AA 4P54A 3IOMA 4L5YA 1JDVA 3DJFA 1T8RA 1V4NA 1CG6A 5B7PA 1JE1A 5FAKA 2AI2A 4DA7A 2GUWA 4MARA 5F77A 2PGAA 1A9QA 2QTGA 4JP5A 4LNHA 4TXHA 4TYMA 1PF7E 5B7QA 3SCZA 1Z33A 1JDZA 4M1EA 2HSWA 5F78A 4DA6A 1SD2A 1V48A 3E9RA 3EMVA 4DAOA 4QARA 1LX7A 1QE5A 4OJTA 5KB3A 1TCUA 1Z34A 3U40A 3DF9A 3E9ZA 1Z35A 1PR2A 4YO8A 4FFSA 3OOHA 3UAVA 5ETJA 3P0EA 4OEHA 3FNQA 1JE0A 4F3KA 2OECA 3K8OE 1T8YA 2A0XA 4TS9A 4TTAA 3KUKA 1TD1A 2ISCA 2ON6A 3GGSA 4X24A 1RXYA 4G89A 1A9TA 3FOWA 3NM4A 2IQ5A 3UAWA 1SD1A 1TGYA 1G2OA 1JDTA 4G8JA 1OV6A 2QDKA 2Q7OE 1V3QE 1VHJA 1CB0A 1YQQA 3O6VA 1A9SA 4GKAA 1RSZA 1XE3A 2RJ3A 3OZCA 4KN5A 4TTIA 3EUFA 3OZBA 4GMHA 3FWPA 4F2PA 1ZOSA 5JPCA 3D1VA 1ODKA 4LDNA 2OXFA 1PR5A 4QEZA 1TCVA 3UAXA 1FXUA 1YQUA 3OOEA 1Y6RA 2AI1A 3KVRA 1PR6A 1PW7A 4G41A 3P0FA 3UAZA 4LZWA 5IFKA 1LV8A 1NC1A 4GLFA 4MCIA 3E0QA 1K27A 5EPUA 1RXUA 4TXNA 3ONVA 1V41E 5CCDA 1YRYE 1TGVA 3UT6A 4TXJA 1JP7A 2HWUA 3O4VA 5EUBA 3EEIA 1T8SA 2OC4A 3GB9A 4H1TA 3EUEA 1WTAA 3OCCA 3BSFA 4M3NA 3LA8A 1Z39A 1Z37A 1Z5NA 4R2XA 4QFBA 5B7GA 4DANA 3FB1A 1RXSA 4YJKA 1RYZA 3BGSA 4F1WA 1RCTE 1Y1TA 2I8AA 1ULBA 4D98A 2A8YA 3PHBE 1PK7A 1OVGA 1A9OA 1K3FA 1OTYA 1RXCA 4IP0A 4NY1A 3OPVA 3KVVA 1SJ9A 4ECEA 5DK6A 4BMXA 4D8VA 1LVUA 5IU6A 1Z5PA 1PWYE 1N3IA 1A69A 2HN9A 1JDUA 1U1CA 3C74A 1K9SA 3UAYA 4EB8A 2I4TA 3BJEA 4QATA 4QASA 1PR0A 4WKNA 2P4SA 4TTJA 1T0UA 3OZEA 4NSNA 4F2WA 2BSXA 4RJ2A 4L0MA 1ODIA 4F3CA 4BMYA 1JPVA 4E1VA 3OZDA 1YBFA 1Q1GA 4BN0A 4PR3A 1PBNA 2QPLA 4MCHA 4GLJA 1PK9A 4D9HA 3FAZA 4DABA 1NW4A 1Z38A 3OF3A 3QPBA 4TXLA 4BMZA 5CCEA 3ODGA 1RT9A 3T94A 4DAEA 1I80A 3LBAA 4EARA 1A9RA 1YR3A 4U2KA 5F76A 5F7JA 2QTTA 5F73A 4WKCA 3MB8A 3DPSA 4L5CA 5CXSA 4I2VA 3PNSA 5K1ZA 2OC9A 1NC3A 4PNPA 4OY3A 1VMKA 4OF4A 1Y1QA 3KU4A 1U1DA 4JWTA 5CYGA
chains in the Genus database with same CATH superfamily
3FFBA 4JI5B 4E3WA 1QOPB 4BC1A 2QTNA 5B6PA 5JWRA 3OPQA 4X93A 1RM4A 3WQQA 4QBKA 4GLLA 1NURA 2NU7A 3SX0A 4Z51A 5BVGA 1AA6A 1W4AA 4RK7A 3PEUA 1XJWA 1QB8A 3I9JA 5COQA 1Y8AA 3FSGD 2R7KA 1UOEA 3U4MA 4HNGA 3SIRA 1TVCA 2BFDA 3G1UA 2A9RA 3SPXA 5HIAA 3LUFA 1QO7A 3AVXA 4UC0A 4F1KA 4QREA 3SBOA 5LKRA 4DYDA 2SICE 2C07A 3DDWA 2GEKA 3B6KA 2JB9A 5LA6A 1F4LA 2EQAA 3SE0A 2QRLA 4ROTA 3WMEA 3VR1A 4ZZIA 2MSDB 3T38A 1JLLB 2XJ4A 1BJTA 2WSSA 1MB0A 1QVAA 3LRPA 4WBXC 4WZAE 3VX4A 4I9FA 2WTUA 4PR0A 1MJGA 5ALIA 2DF8A 4JHXA 5K05A 3IEXA 4DSUA 4C7MA 4E5YA 1N32B 1YJCA 2AOUA 5B7NA 2HFJA 4F5YA 2EDAA 5TGZA 1HYEA 3O4JA 3L01A 3VR5H 1F0YA 4IRXA 3L4BC 4IH9A 2XNSA 4N18A 5EWJA 2XUQA 1BC5A 1S8NA 3IAAA 5BN1A 2PV0A 3CZ4A 1TU3A 1T2AA 3SQMA 5EESA 4X6LA 4F9TA 4YMHA 3CWCA 2IF2A 2G1PA 1XCJA 4RZSA 3QELB 4PFKA 4YX9A 5A4JA 4RJIA 2QLFA 3OOYA 4JASB 3U0BA 1MOPA 2FPXA 2C0CA 4OREX 3KQPA 1DL5A 1N36B 2AUNA 3UMYA 4WOKA 2GBCA 4LHXA 1YMQA 4QE3A 3LBNA 1O87A 3KLNA 4OFBA 5ERYA 1RYHA 2OGTA 3KS9A 3QPWA 4IDAA 1RZRA 2BLLA 1Y8QB 4WK4B 3EWIA 1L7OA 1SU8A 5BNZA 2PA0A 4F4CA 4GZ3A 3ZWKA 2PRSA 1ZXBA 3IJEB 3N3AC 3GI1A 4G25A 3CEAA 4Y7CA 1B1AA 1SHZA 5J4VA 2YICA 1KZGB 4CM4A 4Y9UA 4EVSA 1QDLB 3MJRA 1NIJA 4UJ5A 1BU8A 5IC5A 5FO1A 3PHLA 4FFPA 1QO0D 2GERA 1DXHA 2P2LA 2ZWPA 4IM7A 3ILXA 3OQMA 3QFRA 4OHKA 3J7AC 4PZUA 2MR6A 2KPOA 3MERA 1JYSA 3WIDA 5KWSA 4N7BA 1U0SY 1QHHB 4TZ6A 1G5FA 1V6AA 3JATA 5BR1A 2WF8A 4QM6A 2MSLA 3OJOA 1P62B 4CIXA 3M2TA 2WJPA 1TK2A 3GZTB 2UXCB 5DT2A 2FEPA 5G4KA 1VGVA 2AJLI 2AXNA 2WWHA 3JQAD 3LVFO 2PZFA 3OCWA 3X1KA 2E4UA 4GBGA 3T3MB 4MI3A 2R2AA 2WWRA 1ADYA 2EX0A 3D0OA 4DF3A 4FE7A 4DXHA 1CB7A 2EX4A 1JXAA 1JTFA 3KZVA 3ZWMA 2CWWA 3VKUA 1Q0PA 1CFZA 4ZJYA 3U39A 3GJ5A 2J4FA 4DA9A 1OBFO 4MLCA 4PRKA 1YQGA 1HLPA 1FRVA 1Q3KA 2VBCA 4L5AA 2QJRA 1EWVA 3OCUA 1PHRA 1Q0SA 3OJEA 2JFPA 3EFEA 4JLOA 4RQUA 3WL4A 1RQRA 1U2QA 4AROA 3EA0A 3H6HA 2DLNA 2KI5A 2A33A 1NNLA 4JFAA 4O4LA 5KYUA 5F2NA 4FHDA 2IOYA 3VHXB 3DB1A 1JFTA 2HA2A 2QR5A 1RTKA 2Z57A 5CVJA 3UQZA 3VC7A 4WOCA 1XN1A 1DJLA 4PS1A 5CGZA 2XI4A 3CNHA 3OE5A 1J49A 2H0QA 2V7UA 1B4DA 1K75A 2QT0A 5ADUS 3OZ7A 2V45A 4MVJI 5AOCA 3PLAE 3T3IA 5FUMA 2EWWA 3B20A 3RK1A 1H3FA 3H05A 2Q1TA 3DAYA 2NYRA 4MJLA 3IC5A 5K0BA 2NGRA 4GI3A 1XTSA 4EYOA 1NR7A 3K0CA 4IW3B 4Q1EA 1HOTA 1Q2UA 5HNKA 3Q98A 2WSSD 1DWUA 3D7MA 1JQEA 4PSVA 4YMIA 4FB4A 5J2TA 3TX6A 2RC5A 3PD0A 4L28A 3FWNA 2ZWAA 1P29A 1X92A 4DB4A 3ZZMA 2O8CB 1Q92A 2RGWA 3NNDA 2IS4A 1PHPA 4H0FA 2GPNA 3LJKA 4MGZR 4J9UE 1SQGA 1J5XA 3GJTA 2RH5A 1LXCA 3WGKA 4CL0A 5LP6B 4RUKA 5EMKA 4PX2A 1CJSA 2FJ0A 3JQ8B 1JZSA 4PZPA 3L06A 2XPCA 1T13A 1N6OA 4KQKA 1GKLA 5BYKA 4I8DA 4LQ4A 4C2BA 5LQAA 4JBYA 3TOCA 4ZCRA 2ILTA 4NNJA 3NTQA 1KVSA 3VBCA 1QE5A 1WBJB 3OG9A 5LWHA 5J2UB 5K6RA 1GZVA 1B23P 4G09A 2DTDA 3DULA 5CLFA 4LOAA 4KRYA 4P38A 4IICA 4MWGA 1HYGA 4AFNA 4C0BA 4BP8A 1SC3A 3OSZA 2Q6LA 2WT4A 2TMDA 4Q4CA 1Z7EA 2ONKA 5FFMA 2NUPB 4FFSA 4FLMA 4YMGA 2G9ZA 3DO8A 3AI3A 3UAVA 1XZLA 1EZ1A 3CF0A 2IHTA 4FX5A 2LKCA 2Y1XA 2LDXA 2CC2A 1WULS 3FFWA 4HBZA 3RJ9A 2IXFA 1TU4A 2IV2X 2VG8A 2Z4TA 3D3KA 3FHOA 2Y1LA 3PPIA 4O1IA 4B7ZA 5AI5A 5M5BA 3V9PA 1L4YA 4QGGA 3AVYA 2DKOA 3BDVA 5D7BA 2PRKA 1WPQA 1SO8A 4OK5A 1NJ5A 4KPFC 3HCWA 3SXUA 3FPBA 1BMDA 4H0NA 1NFFA 1KI6B 5EAIA 2C5SA 3I62A 4CF4A 3EK2A 2QRGA 1GPUA 4G81A 3RYHB 1VIAA 3UENA 1FNNA 1XG5A 2VK2A 3AI7A 2JI4A 3A3KA 3B60A 3JQAA 3KG2A 1CDOA 3SFVA 1KHHA 2CCKA 2FFAA 1X7XB 2BTOA 1VE6A 2Q2QA 1UOPA 2ZRDA 1DBSA 1ZOIA 1B6TA 5DTRA 4ZYXA 1WW2A 2DQYA 3EA5A 3V32A 3U5ZB 4HFJA 4QTYA 5DCYA 2AFIA 5FEMA 1UXOA 3G89A 3T52A 3H7IA 4D8TA 2CXUA 3R09A 1SU6A 2WTMA 3H9BA 3FMFA 3OE7D 4TN5A 3S2IA 5LZ2A 2XECA 2C88A 5TY0A 5KYYB 1BYUA 1W52X 1TLTA 1FMFA 1ZM9A 5CLHA 3Q10A 3VUFA 2WZBA 3O1IC 4CQMB 3BD7A 1IE3A 5AW2A 1Z08A 5HPYB 1USIA 3PU6A 3WGNA 3DV0B 4LZZA 3OJCA 1ISHA 3BMCB 3BA6A 3KOMA 2WK1A 3OZBA 3PXAA 5ULLA 3ZY6A 4YMVA 1PYDA 2K5UA 3QENA 4LK3A 4Z8YA 3SKXA 4BNIA 3GP3A 3JVDA 5JOQA 5KPDA 4OX9Y 4JUBA 1VL8A 4GMFA 1MDBA 4R1OA 5AKZA 2PT7A 1MO2A 4NRDA 4U7FA 4MV1A 4B2LA 2CLFB 4HAOA 4PX3A 3L9WA 2I1LA 1G17A 5JDIC 3BULA 4C1BA 4WZZA 1ODTC 2C5HA 1P1IA 1TCVA 2QRUA 3GEEA 4TT3A 3WHIA 3VC1A 2ERYA 5DSXA 4PLGA 4CLRA 4AJOA 1NPDA 1JFVA 4O4LF 4Z0NA 3ZY5A 1YDHA 1IU9A 1P3JA 1QONA 2FGJA 1U8FO 5CRIA 4UW9A 2ZRKA 2VUIB 1QVZA 1FP2A 2XWSA 5CNJA 4ZREA 5K6TA 2GD0A 2XNCA 2JI8A 4ZVQA 4OXRA 4XE5A 2HWXA 2FMTA 1R27A 2RCNA 1CQJB 2XADA 3W3AA 2CL5A 3Q8XB 4LMAA 3AKDA 4N4AA 2OO7A 4AJPA 4DRXB 4LXQA 4JYZA 4XZ3A 4NDAA 4D4HA 4DIFA 1CQIB 1E2FA 4L02A 3HXMA 1RADA 1Z6YA 2XEDA 1UPAA 1DKOA 3C3AA 2O8BB 3MILA 3AQ4A 4N76A 1F2UB 4C89A 1RAHA 2AMFA 5JD6A 1WU7A 2MINA 4J03A 2XYPA 3WL8A 3C8ZA 1XXHA 2PS0A 5AUOB 4XH9B 1DIHA 3ZI0A 2Z0MA 3VPHA 3AR9A 3W2HA 2AG0A 1NRJB 3OZUA 2XUGA 3R5HA 2Q2NA 4ZT7A 2VH2A 5JR3A 2HQSA 4YJ3B 3AQIA 1RBYA 5EE0A 4U02A 3RCBA 2XZOA 2CKDA 1XL1A 1LWNA 2YWDA 4LV8B 4AUKA 4EFLA 3IALA 1K5DA 2PAAA 4WPGA 1Z3IX 1CQZA 3KYIB 3AFOA 3JQPA 4C2TA 3HACA 1WP4A 4M3NA 2WAYA 3QLUC 2G3YA 3GLIE 4JUFA 4QHTA 5EXEA 4ND6A 3G6WA 1QBGA 1M0SA 2IEZA 2IX9A 4NDZA 3RJZA 4BAZA 1NN1A 4D79A 4LG1A 4Z2AA 4OFWA 2ZRMA 1TCBA 3NWEA 2F2TA 2UZIR 3RVPA 4AXBA 4AUNA 3IDSA 4DC1A 4UQLA 1R8JA 2UUCB 4F4IA 3FB1A 5DLPA 3HL0A 2JEZA 3I1YA 3FMPB 1W5BA 1MX5A 5JAPA 2GZSA 1FVOA 3LX5A 2UYYA 1EWYA 3O1LA 4J43A 1MW9X 3OCXA 4N5IX 2J3DA 2ZKLA 1C50A 4HFNA 1FF9A 2H4ZA 2NXWA 3GGOA 1HXHA 4KN6A 3TOZA 5GP1A 1FS6A 1NBAA 3DLAA 4F3RA 2ESRA 5E8RA 1QNLA 3FZQA 3LNTA 4RHUA 3SOPA 4PGAA 3RH0A 3TMKA 2GM5A 2W90A 4LZAA 3OQJA 1YR8A 3STWA 3NAMA 4C4ZA 3WKEA 3HXOA 3AR2A 4BNZA 3RUHA 4JBXA 3JVEA 1MB9A 1NG9A 3VFDA 2Y1WA 4KQ2A 1FLAA 1CJMA 3F96A 3DVAB 4M60A 4MV4A 4RX1A 5KU7A 4LJAA 4F21A 3D2AA 2ZYUX 1VKNA 1DJPA 3GQBB 2CEAA 2KS6A 2ZIWB 1J8MF 1NOIA 3HI6A 3AUUA 3N74A 3OPVA 4OOFA 5JBQA 2YMPA 3HDGA 2B92A 4HTFB 1JHZA 1SJ9A 5DK4A 5FLEX 1WF6A 1KI1A 5K8CA 2CFTA 3K20A 4BMXA 2AR7A 4JX8A 4QIHA 3H4MA 5EFZA 4G24A 4JMLA 4EKEA 4P31A 3WKDA 2JGKA 1GVNB 1E3MA 2I1VB 2WJVA 3ZDEA 1DRVA 1PAUA 3NOVA 4QUBA 1CY0A 3E7PA 3BCHA 4HNHA 4AK9A 3Q7RA 2CJPA 4PS0A 1OWMA 2XUPA 3VRHA 4ZIRA 1PE0A 1A9XB 2CLOB 3EZYA 3FZYA 2WTNA 2D8MA 4BKRA 4NWIA 2LXNA 4JU8A 1K9SA 2YC2C 1NVMB 4JI3B 4EYKA 5ABPA 1SN7A 5BWCA 1EG2A 1FNBA 4J3FA 4MA4A 4PO8A 1T9GS 2W22A 3TNLA 3WWDA 2PMKA 2HOQA 4BNJA 4PRYA 5EJ4A 1W2HA 2ZRPA 2UVQA 4ZT3A 1Z5ZA 5CGQB 4Y2VA 2X8AA 3OMLA 1U0HC 2P4SA 5ALVA 2V3CC 4B3FX 1FDVA 3DXZA 1PIWA 1SCBA 4UTOA 1PU2A 3VR4H 3K1ZA 3MWEB 3TCNA 1XVIA 3CXUA 1CUDA 5EKTA 4QZVA 3O4HA 1M1YA 3IDZA 1T4CA 4AWXA 4TRRA 1DC7A 4QXAA 1KXZA 1UBEA 1HG1A 5DFAA 4AJKA 2ZJZA 3USCS 3EZLA 3O93A 5JO0A 4GYYA 1HYQA 3C5EA 4BMYA 1FYFA 1FVFA 2V7EA 3R2JA 4E1VA 1XCOA 3IQDB 1P5JA 2XB2A 1Z83A 2B25A 5B58T 2XOXA 1JEJA 2YX1A 3PUKA 5KINB 1HO3A 1OH7A 4DLAA 2JW5A 4BB9A 2QWXA 2WUVA 4LJ9A 2H00A 1BQEA 1ZEJA 2YWFA 3ETDA 4PR3A 3S2EA 1QRAA 3W6OA 5E0KB 2IFTA 2WSMA 2FWMX 2FWJA 3OX1A 4LK2A 5DI3B 4BQNA 4F97A 3MQFA 5FNVB 1ZHOA 3F6EX 3FWZA 4RQBA 1PDOA 3G17A 3SFZA 5ALEA 5LDHA 3STYA 2EV9A 5GWXA 3NUZA 2UYHA 1V43A 1IONA 1OE0A 3OJWA 1HG0A 2P91A 4XUDA 1L7VC 2ZWOA 4L50A 1P0FA 3MOSA 1MB4A 4ILEA 3MQ4A 2V7TA 1OLUA 4G26A 2E4XA 4NZYA 2VTVA 4AJLA 1LZKA 2O8DB 2IDMA 1T3GA 1I4TD 1WSAA 3F7OA 3I4LA 3IA7A 4ZVLA 4EITA 3OIWA 2XNHA 4GSYA 5MF6A 2WOOA 1HFKA 2CDBA 3V6LA 2AQHA 2VTEA 1U81A 4LFCB 4GKVA 2P68A 3P0RA 3WB1A 1CUSA 3FNBA 4BO2A 2AEFA 2CJWB 3JTEA 4HB0A 4YHBA 4ZAFA 1L5SA 4DLUA 4JQSA 2YYAA 2PTHA 4RD1A 3VPFA 2R8BA 1CHDA 4UD6A 1EKXA 1T6BY 1BW9B 2SKEA 3FPLA 3FCXA 2BM9A 4Q1FA 3IP8A 1RRKA 3ZHBA 1OSNA 1JXMA 1E1RA 4I19A 4UDYX 4CGZA 3FNRA 4LJYA 2PKQO 3RV3A 5KOYA 1CRLA 2C1EA 1QPBA 4EGAA 3BE8A 3H7AA 4FD2A 4OY3A 1FYXA 3BL5A 3TAHA 5HKOA 2GPWA 3UHOA 9LDTA 5LR6A 3FCUB 3LSTA 2YKGA 4PZZA 4FBGA 2XE4A 3FDZA 4XSVA 3S55A 5CYGA 4EKNB 4CQLB 1JSCA 1KOFA 4RKEA 2QVYX 5FB3A 3I30X 3RQSA 2D8AA 4KRFA 3OQHA 2QRNA 4G3XA 4BVHA 1OB5A 3P0IA 1DOZA 1YVEI 1GT91 1S96A 5HCIA 3UCEA 3EWAA 3ORRA 3LCVB 1KJ9A 2ZJFA 3ZNPA 3L79A 1SKYE 4Y6RA 2IELA 4AM8A 4D0LB 4DARA 4IZHA 4ZEXA 2RCYA 3COZA 2V96A 4J1SA 1HQDA 1XVVA 4QRIA 4I1UA 4DMLA 1DO0A 2WE7A 1G6KA 1B8OA 1LF5A 4DM4A 3G1WA 2W4MA 5G1OA 5SY6A 4F4DA 4ZI3A 4DB2A 2ATVA 1W5EA 3FYUB 2XRFA 4KPUB 2V54A 4CF6A 1PT6A 1VG8A 3NHJA 4LKOA 2JCSA 4RKRA 4TMVA 3C3DA 4PZDA 3ZS8A 3NMUF 4EH1A 2XRZA 2QSJA 4P3KA 2B3DA 4J07A 3HUDA 1WXGA 1EDDA 1W29A 2RHCA 3SHQA 3TI9A 3WLOA 4ZA2A 2DGDA 4LF9B 5DHUA 4A2PA 1QCCA 2AOTA 3Q9SA 2XUKA 3KHUA 1YR2A 4WKPA 1Z74A 2Z9BA 3GYBA 2GN6A 3KD3A 3QEOA 3ENQA 1KE2A 3E7XA 4DCSA 3VKFA 1CDDA 1K7XB 2ZYHA 2X0FA 5DYIA 3RTBA 3USZA 3UFBA 1Z5OA 1F7UA 4IKPA 3J81k 1LB1B 4JT8A 3KTFA 4AJIA 2PX3A 4MV7A 1KAOA 3DDCA 1T0PA 1KDVA 3RSFA 4OAOA 2QZJA 1ILEA 1KI4A 4K6OA 2EJTA 2D1RA 1BHJA 2WD7B 2XTZA 3L7IA 1GTMA 4YH1A 4MUHA 1OU4A 1PL8A 2IV3A 4RLHA 3I0ZA 1JIXA 1E96A 1FLVA 1XU4A 2O2HA 2OCBA 2QTZA 3G0OA 4IJMA 4L95C 5ALXA 4CMBA 3NM5A 1DUVG 2I22A 1P8AA 1IVNA 3AUAA 2XCQA 4MS1A 3GEPA 4A1FA 2YZNA 1HFJA 3AL2A 3MLEA 1AK1A 4M8KA 1H94A 5EUMA 5T4BA 5DN6D 2IS6A 1WXXA 1QZZA 1MQSA 4I14A 4HJXA 3GW8A 4V1CI 2P9QA 4EKGA 5U9CA 3DE4X 1STOA 3NBFA 3P2JA 4EG7A 3CJRA 3L7BA 1C7QA 4BX2A 3BIJA 3FPSA 4EY5A 1P7CA 1XWFA 4JI8B 1SCIA 3NKLA 2WPNA 3UJ3X 2FSVA 5REQA 3ZOKA 4RHCA 1L0BA 3RS4A 1B0AA 1OX4B 1KI8A 1HEYA 2PUHA 4KOAA 4LZOA 3EDCA 2W5UA 3EQ2A 4IIGA 4TRMA 4ZWNA 3RRXA 1RYBA 4N82A 5A3SA 3W6ZA 4YMWA 3RHZA 1D0IA 4WHMA 4YAUA 4TKVB 5JSYA 5GY7A 1NOJA 3E3AA 4P5PA 3S68A 5TF0A 1BHQ1 2O8EA 3MCWA 3Q0IA 2BDUA 3LQKA 4K9RA 1IZZA 1BXRA 1NW7A 2VYVA 1J0AA 1N8KA 1Q11A 4RV4A 2HA7A 2EFJA 1NBWB 3OU6A 2Y77A 2ZE5A 2G9NA 5AVTA 2JAQA 3IAEA 3N75A 1FA9A 4H7JA 1NNEA 3LYLA 3A1EA 1R6DA 2JDIA 3D4LA 4L15A 1NUHA 1N7HA 1LKZA 3NHYA 1CQWA 5H5JA 3AM1A 5DHQA 3BFVA 2G28A 1U1GA 2CYAA 3P27A 3OF2A 4OUDB 4IIVA 4IHQA 2UZ1B 4M49A 3II6X 4IV0A 2R48A 1RQGA 3QUSA 2IEGA 4XDYA 1IBCA 3G0IA 1E6WA 2IOHA 4HUQB 4RV5A 5L51A 4IHKA 4L5YA 1CPYA 4Y9TA 3V8BA 5A4IS 4IDFA 4EDHA 2Q9BA 1APBA 4Q3CA 1WU8A 4X3CA 4QNRA 4L6AA 2HA5A 1T8RA 3I6MA 2NSYA 4ZHQA 2LE0A 4EZBA 5IMSA 1BN6A 1ESDA 1IWPB 2V98A 3V4PB 3ZVNA 4L08A 1J24A 1AZTA 2JJMA 3BBLA 3D2BA 3PI7A 1ZD5A 2AI2A 3M81A 4N0PA 1SIBE 1GFZA 5HCUA 3THWA 1TZBA 3G59A 1XQYA 3JW8A 3KTDA 4GG1A 5C8YA 3RARA 5A5DA 1YR6A 2ORIA 2GUWA 4TM7A 1MIOB 4D2IA 4LS3A 3W1VA 1LRLA 1D2MA 1R9GA 3DO5A 3Q3CA 1MC1A 4TRNA 1E5LA 2HA0A 3DPIA 4JZKA 4I1VA 2Q3EA 2QORA 4YDSA 1E1LA 1OKKA 3NBKA 4HB2A 4H6XA 1SXHA 1JDZA 4X45A 5SZKB 2QZZA 2X9LA 2FA9A 2BGLA 4KTTE 2VXBA 2XRMA 2ZPTX 3JD1A 3KXKA 3DD1A 4LY3A 3SLKA 3GFQA 4O08A 1QWSA 2V6BA 2WD7A 3UZUA 3SQLA 3DNMA 3JRXA 1JHVA 2E21A 4MULA 3DAGA 5LQUA 3LWZA 1ZEMA 4IEIA 2EERA 3TRJA 3KQUA 3PQDA 3EMVA 2R1TA 3SR3A 1KC1A 3DL7A 2ZUFA 2FG5A 1Q7RA 3K0AA 1HYHA 2BTQA 1QJ4A 2JGAA 4PZLA 3TVDA 2Y1GA 2H1OA 5IDQA 4XM1A 1GYQA 3LH5A 1UPXA 1ZX1A 3JD3A 4EGQA 5FBWB 2JGDA 1KY5A 3DAPA 4WA8A 2D00A 4LDAA 2A9OA 3VR2A 3HJAA 2E49A 4YV0A 3PNMA 1K08A 3GLFA 2G25A 3REQB 5KNCD 1DT5A 2QVBA 3V48A 1XZGA 1I2ZA 4GXQA 2PXHA 1BDJA 1DADA 4GEKA 1WE2A 3IUPA 4KIJA 4AQYB 2Q6VA 4L73A 4CLEA 2GNAA 4LA4A 3E8SA 2JLCA 3DLIA 5DGDA 1M8KA 4J3NA 5AKIA 2VWGA 3R5KA 4NE7A 1DB3A 4QPZA 1OIWA 1NPTO 4KZPA 3WDSA 1B6GA 2FU5C 4W5OA 3LTNC 3I5YA 3ZLTA 1EVJA 1LDNA 4HNVA 3NO4A 2C2KA 1D2CA 3JWGA 3M4YA 5LUAA 4MW2A 1EA7A 1PZEA 1VPVA 1NSFA 1PFVA 4LXGA 4ZDWA 4RH0A 2X0DA 4XVHA 5FBKA 2HC9A 1CNMA 2OBNA 3PF8A 4CM1A 2Y67A 3IKTA 2BI8A 3PIIA 5C7YA 1OXBB 2JAHA 5AKLA 4ZPJA 2BUAA 1D4ZA 2VH1A 4ZEMA 3F1KA 1J0DA 3LT5A 4U00A 3H4IA 4HWPA 4CT4B 3EODA 3I9OA 2HSDA 1KJYA 4QU8A 4EB6B 1GA4A 3O90A 3PZRA 1OFUA 2WICA 3GRPA 4G5FA 3ZHYA 4RV9A 1FP1D 5E4TA 3VH4A 3Q5DA 4B7CA 2OMKA 5HR5A 4RXMA 5DLEA 5A9TA 1O8CA 3EY9A 1GM5A 2QDKA 1HRDA 1H6DA 4NPCA 4PQYA 2ZRJA 3DFKA 3T7TA 2WSLA 1YKFA 1AKVA 2CJYA 3EZ7A 1WMSA 3G2OA 4XIGS 2AN3A 4J8PA 3KLOA 5KWJA 3KQKA 2N1BA 3L3BA 2XVXA 2GK6A 2HUPA 3HO6A 1I5OA 4AUMA 1BW9A 5EJFA 4CM4B 3OWXA 4BFYA 4AO8A 1Y6FA 5I8PA 4UFOA 2VSQA 4O1MA 4XAQA 1RMTA 1E69A 4DIKA 4GVXA 1JIIA 2H1HA 4E5DA 4N9QA 4HC4A 3OJXA 1I5RA 2FR1A 1NBMD 3BTSA 3L18A 1PGOA 4G67A 5A5FA 1SMKA 4MYRA 4CL3A 1JVBA 3LW7A 2VWPA 3PFHA 1ZBQA 2CXHA 1CS0A 2CK3D 4PAMA 4CEJA 3ZJ4A 4DJJA 1M8PA 2ZT7A 3O7WA 4R0MA 1HNZB 4D82A 1UP6A 2QR3A 2Y1FA 3ABRB 3ZLBA 3X44A 3D3NA 3V3KA 3QOWA 1J20A 1GDHA 4GP9A 1QCYA 4LSMA 5MN4A 1WQ1R 2GAJA 3HDJA 5IM4A 3IBSA 4IHJA 2YMQA 1QK3A 4NAVA 4D44A 4DJ5X 3A26A 2NNLD 2BBSA 4F92B 2UVDA 2XTJA 1PS8A 3AJDA 4FLEA 3BG5A 4KIGA 5JYDA 1DKNA 1OLSA 1YVRA 2HDHA 2WR8A 4OHUA 4OBWA 4TQ9A 4XWAA 4RL4A 3R7NA 3UJNA 5JD5A 1T6ZA 5KX5A 3UH0A 4Q9AA 4TXNA 1HF3A 2BHNA 1KVTA 2DUUA 4J0KA 2V7VA 4EHAA 2ZCUA 4YAKA 2TS1A 2P9ZA 1WPGA 1XCGB 3DOIA 3R74A 3OQ1A 2GI4A 5JAQA 4NOKA 3MTJA 1ND6A 2CL7X 3TLYA 3VU0A 3B53X 2RSLA 1TGVA 1E9DA 1XZAA 2BFBA 2Y6VA 3HYSA 1EX1A 1P73A 3JWEA 1WRBA 2R7LA 4U63A 4F4UA 3Q8LA 3HY3A 2CUNA 5KREA 1TO1E 2W43A 3M4JA 4M99A 1T4CB 4GKJB 3GK3A 2EL7A 2QZ4A 3TM5A 1UFVA 3GLSA 3O4VA 1QYVA 5I4BA 2BEJA 1XZNA 5KMGB 1UH5A 1Y6ZA 3EOBI 1AO0A 2YMMA 1Z5UA 5TNXA 5LJLA 3ABSB 1XDGA 4WLUA 1M5UA 2AF3C 1ZGGA 4YRKA 3TM4A 2MYUA 3P9CA 3VMMA 3WLFA 3S28A 3O7MA 2DCUA 1CIVA 3OCCA 3PG5A 4YI3A 3UWPA 4HVLA 4CKWB 3S40A 2E2WA 1MRZA 1Q77A 1S5PA 1AN0A 3ZWDA 2YV2A 5CT5A 3PF9A 5K4AA 3HKEA 3FETA 3BJMA 4OV6B 3IX7A 1REQA 5CLJA 4AVYA 4TM8A 1BQ3A 5FOSA 5AM1A 3GDFA 2SBTA 2ALJA 4M98A 3CS3A 3IT3A 3NHKA 2R00A 3LPCA 3HFJA 4LWQA 3HCPA 3HADA 2AG8A 1MH1A 2GFQA 2Y66A 2Y76A 2ZOSA 3CKYA 3JAWA 3BM5A 1ULBA 4MV8A 1O6ZA 5AK0A 2A9JA 4NATA 2BZSA 4IQFA 2A8YA 3PHBE 5K8UA 3E3OA 2G4CA 2PPLA 3PPVA 1GTL1 3LUKA 3ZXIA 1Q2XA 4GLBA 3U6KA 3S2SA 1W1WA 4D9JA 1LI7A 3ILVA 5B37A 2RB4A 4WCDA 1EP1B 2BEWA 4Z49A 5IWCA 2QMEA 4CEHB 3FUTA 4WVLA 4YJFA 1X3SA 4YQFA 1M0TA 1N2XA 3CHYA 3LKDA 4Q6BA 4QDOA 2RAPA 2VF7A 4K2AA 4JYMA 3PTAA 3TR0A 2IODA 4QGHA 2I7VA 4WY5A 1KJIA 1TJNA 2YINC 2ZBPA 4MW1A 4QJ3A 4FEAA 1K86A 4G36A 4HWTA 1YZHA 4MRSA 3GLFE 2A7QA 2P7IA 3EEFA 4OBXA 2HA6A 4JBWA 3NHWA 3IEUA 4F45A 5KNBD 2Q6TA 3TSAA 4B7AA 3JARA 1L4EA 4YQZA 4PN3A 4BY9E 1T9CA 3BMNB 2V3WA 3V97A 1UJBA 3VKGA 5HQTA 2I4IA 4P33A 4BVFA 5L40A 1DTWB 4NMMA 1E7RA 1L5WA 1JDUA 1U1CA 2RGNA 2IYQA 2JAWA 3KEOA 4DL9A 4EVQA 1Y8RA 2WIKA 2VDWA 3GJZA 4NJMB 1VSVA 3JQ7A 3T7KA 3QUTA 2ZETA 4DJEC 3UFXB 4HGNA 5IJWA 3M83A 5E6RA 1NUSA 4FNOA 2PX5A 3IIEA 5FNZA 2H6EA 1ZK0A 5ALTA 4D41A 5IDYA 4EJMA 2V7GA 3GFVA 2KE5A 3IV6A 4FFMA 2A5YB 2LCQA 2H7CA 1Z0DA 5JQGF 4URXR 4HWKA 3MTQA 1VA4A 1ISIA 2X3FA 2DFPA 1YHZA 3AJEA 4IWYA 2Q5IA 1R8QA 4G1EB 1GCUA 1QDEA 4NJMA 2GB4A 3OZDA 4ASUD 4ZGWA 3LYAA 5D00A 2XUIA 2VR1A 2WU1A 2ONYA 2Q4RA 1TVEA 1TW2A 2IYXA 3FPKA 3I8OA 1Y9AA 3DW3X 4QYMA 3D5TA 3RUIA 4ZMBA 1CS4C 2Z04A 6NULA 2WC1A 1MORA 3VVBA 2PBLA 1EP9A 2ZAIA 3O21A 1SCUB 1D2AA 2WPDD 1DTEA 2WMYA 4R3WA 1AE1A 2PH1A 1AHIA 1UPTA 4L9AA 2VP3A 3AIKA 4GMGA 2DBQA 5THXA 4PQFA 2GVZC 4JELA 1DUIA 3WKBA 3U7FB 4J6EA 1J0XO 1Z45A 2JLUA 5DN9A 1NVEA 3N2LA 4LBYA 3KEGA 2HCFA 1PZHA 4OI4A 4BRSA 1OGIA 4QOFA 2Q5EA 2WTEA 2X4GA 4QA9A 3I9V1 3GLKA 1G7SA 4Y67A 4F2DA 1K1EA 5PGMA 3PTLA 3U19A 3AJRA 3T94A 3OJFA 4CKBB 3ROXA 3TTSA 2O48X 4CV2A 1FOEB 2O0LA 3ZHZA 3IKJA 2D4HA 3R4VA 4O3FA 2I76A 3HXQA 4D74A 3ZTYA 1FJGB 4RY9A 2DFLA 4UXIA 3E48A 4GNKA 3OM0A 2JGRA 4R9VA 4WE3A 2GTIA 1YZQA 5GONA 1TMYA 1DJQA 1IZYA 3BCUA 4MUGA 4UASA 3U7QB 1DJOA 4QGSA 3JZDA 1IZ9A 4FE3A 4TMKA 3UOAB 1LDEA 3OZRA 4HUJA 1RRFA 3Q15C 3A9RA 2QIPA 3GBVA 3H5RA 3N1UA 1E77A 4B4UA 2PKRA 4R01A 2PLFA 2ASEA 5KEIA 2XKJE 3KPUA 4XYMA 1BE8A 4B48A 8GPBA 3DZFA 5DWQA 4JBGA 5FBQB 5JPIA 2O0MA 2ZJ6A 2ZWVA 5C8VA 1SKMA 3L7DA 4KDRA 4PNPA 3B1JA 5FWXA 4QM7A 3LD9A 3P2EA 1MNAA 1AQJA 3N07A 3SVTA 1L1FA 4TWBA 2RBKA 5IJXA 5AXBA 4BFVA 1RM0A 1YS1X 4G4IA 4PNHA 2CZGA 4Q12A 4L6IA 4RC9A 1XKXA 3ROZA 1CR2A 1KEEA 1CNEA 3BFKA 3RS0A 1IBKB 4MR8A 3N2GB 1HDYA 5JNUA 4HX9A 4R5HA 1VCNA 2XNJA 1Z2DA 2OAP1 3UV6A 4WJLA 5IJAA 3O2QB 4F5EA 2VTBB 1QF9A 1SAYA 1HK7A 1P4AA 3QEMA 2X3YA 5AVRA 4BP9A 2FETA 3NH6A 5KTTA 2J7KA 2YRFA 3IVCA 3M6UA 4MUAA 2NUTA 2DJ5A 2HRDA 3UHPA 3RBZA 4UHKA 4XIYA 5F1KA 1QIIA 4AYWA 4C4TA 4CV0A 4ISCA 1IJEA 3UNXA 3W2IA 3DFUA 2II6A 3WIEA 1RPNA 2ZPAA 3BTVA 3RSHA 3VR3D 4D9BA 2YV4A 3VKVA 3HI4A 4E11A 4HLUA 1CUCA 3LT4A 1KKMA 5T3UA 4OLJA 3QP9A 3BL6A 3DHNA 4HYEA 1GGEA 5E7MA 1GAQA 1OXXK 3RM3A 3GDHA 4C5BA 3CCBA 3PIDA 4JEUA 1OLSB 3JTMA 4Z9YA 4CEIB 4ALLA 4U7GA 4B2YA 4AKTA 1OLXB 3UTDA 1YDFA 1XUOA 1EWTA 1E2UA 4Y2XA 5EJAA 4ZVVA 1TZCA 2ZYRA 4EELA 1FRQA 1T1IA 3L46A 4RETA 1HI9A 3I58A 4RK6A 3K9HA 1QLWA 3KZ1E 1V5WA 4G6ZA 2C29D 3DQQA 4I3GA 5AXAA 4H4DA 1WWKA 1DBPA 1T4BA 1U7UA 3WGOA 4QWWA 3HSYA 1RRVA 2B94A 2OCPA 4MICA 3ANLA 4N41A 4F8JA 4DV1B 1Y1LA 1MIOA 2NTYC 5LKAA 3FTEA 2XUOA 1QYDA 2H65A 3GO4A 1UXHA 4HI0E 1EBFA 4NTZA 1EFUA 1EVIA 1TKCA 3PPYA 4BE4A 3H11B 4YGXB 1N8SA 1FQWA 3JQCA 3V2UA 4W5RA 2AN1A 3U4GA 1ZI6A 1PSZA 2HK7A 4BNLA 2VHWA 1A98A 3O1JC 4H7DA 4UNSA 1L4MA 5E9JA 4JOSA 5BQ3A 1DAPA 1K6XA 1KHTA 1D7AA 1ZO8A 4L4RA 4R6WA 2ZIVB 3OLCX 5EFOA 2IU0A 3RYFB 3THSA 1SG0A 4FCWA 3WG9A 4RF5A 4D26A 2E85A 1SD5A 1RQ2A 3FHJA 3A1FA 4BLOA 5HXAA 2H85A 5HGJA 1Y9DA 3EQ6A 5DRYA 3VDMA 1TIPA 3NTXA 3S1AB 3QUAA 2C99A 4ROSA 4HGRA 4F8YA 5CM9C 4K2HA 3UK1A 1NY6A 2RI6A 4US2R 621PA 5FT9A 1XQ1A 4TLCA 3NBQA 4IQGA 1F2DA 4GRDA 2O3SA 3L4JA 4ESVA 4DSAA 3CKLA 2RGUA 3WKAA 1N5OX 3RAEC 2POQX 3IP1A 4HQ0A 5D3MB 3RS2A 1H1LB 2YV5A 3MAJA 1UXJA 4X54A 1AKUA 2F1RA 3ICEA 3LOUA 1Z26A 4M7RA 3UM9A 3MVEA 2B7LA 4RPKA 2GBLA 3ILSA 3BWMA 1I2AA 4DY6A 3B1XA 2EF1A 5DYNA 4BEJA 3R9WA 2YXPX 4RYLA 2WAAA 13PKA 3MRXA 1ONBA 1PYGA 5F7XA 2EJUA 1TW3A 3HP1A 3W9BA 5HJ2A 4KR6A 5EHNA 3E5NA 4MS3B 4G0PA 1ZVQA 1KO7A 2Q07A 2XMCA 3KZOA 2FQXA 3DBRB 3C5HA 4BVJA 4CMIA 1GZ6A 3JAWB 1N6KA 1L1RA 2P1ZA 4KUGA 4RMNA 3DBHB 3PKIA 5B1DA 3DDSA 3OFND 4PHGA 3UCFA 4AZ0A 3DYBA 4EBFA 1NN0A 3TRHA 4TV9B 3I73A 1AX9A 4Y1EA 4PYOA 1LDGA 5BSWA 5FOUA 2Q41A 1VIDA 3ND9A 2JDID 2BDEA 3EQ7A 4Y8VA 3DKPA 4NG5A 5AIAA 1B1CA 2GPBA 2QYHA 2WM9B 4X41A 1QV9A 1VMIA 4HAUA 4WACA 2NVUB 2YWXA 1KARA 4YREA 3AESB 4P58A 4C4PA 1MJ5A 2IHNA 2VJAA 2XZPA 3M5CA 1FS5A 3EZNA 2JZNA 1W85A 3QXXA 4TYPA 4EF5A 1N2OA 4TMYA 4LXHA 1M33A 1HGXA 4Y2SA 1EBBA 3DEIA 1WCIA 4HGOA 5D85A 4H18A 2AYXA 3OE4A 2L19A 3W8RA 5KOJB 1DEAA 3H2HA 3L7KA 2NADA 4TVKA 5KHOC 3A6ZA 4Y9SA 1RZRD 5CH5A 3SQOA 1FLNA 4ZAXA 4OHYA 2WVHA 3GA0A 5DHTA 1N6LA 4XD2A 2Q28A 1O03A 3GNSA 3WK6A 3EOAI 2ZCJA 1ISFA 2BFBB 4IBOA 1E9RA 1YIDA 3A27A 2FY8A 3AHGA 5BNWA 4RCYA 1FMTA 3E5HA 4M22A 1URPA 3PA8A 4Q7KA 3B3AA 2IEIA 2E55A 2X1LA 5CEJA 1WP9A 4O5OA 3HEMA 3ROTA 2BEVA 1L5YA 2GK4A 3DF9A 4IFEA 4JOQA 3KQOA 3RSOA 1IBMB 1IM5A 1JIJA 3NPAA 1CUIA 4AN0A 2QJTA 3EVEA 1MX9A 4O2BB 2QGFA 4C0LA 4YS6A 4OXXA 4EWLA 1JAHA 3R8FA 3P9XA 3MTIA 4RDHA 1JE0A 2C4NA 2VZEA 1SA0B 1WLSA 3BEOA 1NI3A 1XF9A 2I71A 3HUTA 5B57C 3RROA 3ANNA 1D6SA 2KLHA 3EPPA 2R60A 1NDUA 4NKRA 2NUTB 1T15A 1TD1A 2QJFA 3CU5A 4OUDA 2PNJA 1AQIA 3GGSA 3WMXA 3H84A 3QPDA 1XNRB 3UWKA 5I7UA 4HBGA 4AICA 1Y5IA 1I0LA 1SCAA 3OM9A 4Z53A 1PUXA 4GT1A 3HDTA 2R65A 4N0DA 2BBTA 5FI5A 4EY7A 2VKQA 5K09A 3WR5A 2MYTA 2WQ6A 4A8TA 4QUKA 2C61A 3T1YB 5CDUA 2IQ5A 2L17A 2YR0A 2AMJA 3IB6A 1E3LA 4HS4A 4PICA 5BRAA 4KGDA 4RJJA 4AURA 4IZOA 1Q1AA 3DBOB 3N8HA 4GVPA 5AXCA 3R41A 4UVGA 4KHZA 4FZJA 4D9MA 1S4QA 4E33A 4ESHA 5B64A 1XC7A 3UBMA 5BRJA 1X9IA 3W1EA 4YUYA 1T8UA 2GPAA 1NJ1A 2OHJA 3TEMA 5GMOA 3O4FA 3ZQ6A 3HXLA 5ALLA 3C24A 1QP4A 1U7DA 4IILA 1GKUB 5KTNA 3HHPA 1L2TA 5D6NA 4E51A 5IJ0B 4GKAA 2QYSA 2RJ3A 3NHPA 4FDVA 3SJAA 3OZCA 4H60A 3HSKA 3L05A 5DNVA 1QOQB 2OOKA 4NF2A 2I34A 2Z08A 2ACWA 3IAS6 4JA2A 3UAGA 5JNVA 4IIJF 3HB5X 1OYOA 3TZCA 1OBHA 1ZOSA 2OZEA 1LLFA 4EB6A 3HO8A 3HU1A 3NHLA 3ZVKA 2NX2A 5LQCA 2WUEA 2PRIA 4E1AA 4KV9A 1DG1G 2H7XA 2FMUA 4N5DA 3RLFA 1GU0A 2A1TR 3HR4A 4EQ6B 2QPTA 1DIOB 2DFDA 3H6KA 2EFYA 1YNSA 1PR5A 4OMFG 4OXKA 4D57A 2BEVB 1Y3CE 1AT1A 1JSZA 4ECAA 5CTAA 3H5OA 2O19A 4Q9HA 3RUFA 5EINA 2VA8A 4CW7A 3AHDA 1C4KA 1IXZA 1GU7A 1Z0JA 2K87A 3CVUA 1RZVA 1FS4A 1WDLA 2C9BA 1DAOA 2F7SA 4BGUA 1P4RA 1PT5A 4DIOA 1DC5A 2BM8A 3ESZA 1QFZA 5KVSA 2BHTA 5LP6F 1J1IA 3GLIA 4N6NA 1PQPA 1J22A 2NG1A 1X3LA 3HBLA 3P0FA 4G41A 1QHYA 3IBTA 2AN9A 2JARA 2CXTA 1LLUA 1IN4A 1MIHA 2VS1A 5JDCC 3SNKA 1F38A 1E1YA 2Z9CA 3K5WA 4RIFA 1BWRA 4TWJA 3LFUA 5EKSA 4B9AA 3OY2A 3AX6A 4Q9DA 5EY5B 1VGQA 4QQFA 3Q9LA 4NOLA 5CVTA 2R7MA 3X1MA 4CN9A 5HF6A 2R44A 3C6KA 1E2IA 2ZG6A 4GVLA 4E32A 2OWDA 3C1TA 3QSYA 2J0SA 3E7WA 3FSEA 3NX4A 1C1HA 3CH5A 2IGTA 2P90A 3WGHA 4BX3A 4KYTA 2HMTA 4NE9A 1VFPA 4CF5A 1LBHA 1V47A 2BZ0A 3CX6A 3VC2A 5IM4F 2B4TO 3PRYA 4QT0A 3ZWNA 4AMUA 3EGWA 5IP5A 3B48A 5DX8A 5K0CA 3HYNA 4P7FA 5LYJB 5JCXA 4Y2QA 4ARZB 2VNIA 1C3LA 2H18A 4NI5A 1NASA 1OYYA 1JHOA 2VDWB 1GLNA 3CBGA 2IIVA 5ALJA 4ZK6A 2B82A 4ZQHA 5EIOA 4Z1MD 2P2CA 3Q0TA 3DFIA 3NWPA 4BECA 5CBKA 3PSAA 2OT3B 5CM8B 3URMA 1Z5NA 1VL5A 4UPDA 3M8KA 2O5CA 4I1SA 5KTKA 3KWMA 5LB4A 3MF4A 3D6AA 1DCTA 5DX0A 4IH4A 1KZ6A 1OZGA 1T35A 1RXSA 3ELDA 4ZVTA 3RBXA 3DQPA 5DW3A 3SJ7A 2H1VA 3PT9A 4JC5A 3CF4G 4U2CA 2HK6A 3IKLA 3V33A 4ZCPA 4B4KA 2YRXA 3OURA 1O89A 2FR0A 3HWX1 3QHPA 2INGX 4NLLA 1D2HA 1O94D 1T3LA 4NMWA 5CPFA 1CZKA 3P20A 2GRJA 1NP3A 4LRYA 3DGFC 1EXMA 4RYDA 3ZDYB 1LS1A 1A9OA 1K3FA 3RT1A 1DQZA 1GQQA 3FSRA 1DCMA 4BBPA 3A9WA 2H1SA 3BWYA 2KB0A 2PCJA 3RAJA 3GPLA 1QHIA 3UH1A 2X6TA 2MSWA 2YXLA 3TQFA 3ZE7A 2ZRHA 4BZXA 1PS9A 4TT3D 1CEEA 4FOSA 4HH3C 5IAAA 4IGKA 5KYVA 1LCIA 1YTLA 1GZ7A 2OV6A 2CKMA 3MBOA 3OIVA 3OIUA 3PC8A 3OC6A 6ABPA 4L27A 4IMJB 1B76A 1ZD3A 2WT8A 4ECEA 5EQFA 4MIYA 3A1DA 1M0EA 4TLDA 5A6SA 1F1BA 1P1RA 2I7DA 2OD7A 1M1NA 5KDOA 2LCIA 2WIFA 2WP8J 3ZBTA 1WEHA 1YULA 3NDPA 3EGDA 4EDFA 1H5QA 2NM0A 2R4UA 2GTHA 3O3OB 3CSDA 2CXPA 2YHIA 5JVDF 3SIXA 1HEUA 3B7PA 1OFTA 2NU6B 2R62A 3PZBA 1H05A 3DL4A 4J2HA 4PTYA 4XTRA 4R71A 5I47A 1P31A 3M2PA 5FHRA 3ADDA 2D5CA 2PSFA 4NH4A 5AW4A 2IE8A 4M1KA 1FFHA 3PC2A 3T9CA 5EKDA 2I4TA 3SSOA 4J16A 4NULA 1BX1A 3M6AA 4O1HA 3EQ8A 2AJ8A 4QASA 4UCXA 3DZCA 5K8TA 4MVJG 2FXVA 3E9YA 1B3RA 3GYGA 1G2PA 2Q3LA 7AT1A 3HH8A 1DRKA 3AHCA 2A5DA 2XYQA 3CLTD 2TYSB 2OCKA 1EU1A 4H15A 3IPCA 7MHTA 3F5FA 5E7JA 4WT7A 4OBEA 4UVIA 3WLEA 5T4FA 3ACCA 4I1YA 4LBVA 2J5XA 5BV7A 4XQEA 4F3CA 1LNZA 1O97C 1A5TA 5C8XA 2ZI6A 3OT4A 1TAQA 4IG9A 3SKVA 2JLBA 2P3OA 5MHTA 5BSFA 1UC8A 4TL6A 3L0CA 4EHFA 5F98A 3HM2A 1LPBB 3KJNA 5B12A 2I1WA 3B2EA 4EYSA 3HBJA 3CQ9A 2HJHA 3QKUA 4NG4A 4R9UC 4CEIA 3H2YA 4ZEVA 2PGXA 4HDOB 5LOVB 2XMPA 4MGIR 4GC9A 2A57A 3IQGX 4A2QA 3GQVA 3KD2A 3LF2A 3WIVA 3FAZA 1WPXA 3CC8A 2UZ0A 3NJ8A 4RL6A 3M6LA 3O75A 1P80A 1ZI9A 5TSDA 1HM5A 1N5MA 3QPBA 3U17A 4Y2GA 5ARCA 5KVCA 4RKWA 3WK9A 3D4OA 4ZICA 3NJRA 2NP7A 3BK2A 4BMPB 2QLMA 2Q4EA 3CLSD 3LZCA 5CK4A 4N5NA 1C3OB 1ZJZA 3HLYA 3AF3A 4MQ4A 4NP6A 5FULA 4RHXA 3P9QA 4XGIA 2P5UA 3AVVA 1T8TA 1K63A 1KGDA 1QZUA 3HVUA 3LBAA 1YR3A 3GJ8A 4JB0A 1OXTA 2QX6A 4BZPA 5FTMA 1F60A 3NHZA 5KJEA 3CR7A 4RPHA 4MWBA 2F67A 4DVJA 1OR8A 4D9IA 5DTIA 2WJGA 3PUYA 3AT1A 1EK2A 7ABPA 1T9BA 2VQDA 4D97A 2RHWA 3F49S 1AHPA 1C30B 1V6SA 1WMFA 3HJCA 3UAOA 2W98A 4YLEA 1C9EA 2HZBA 2VT2A 4L5CA 2BJHA 3COVA 5EXSA 4ZEOA 3LPDA 4R3UC 2IRWA 3THOA 1U4SA 1J0EA 1YNOA 3ZU2A 1H4VB 4IX1A 1N75A 1Y8ZA 2PZGA 3CE9A 1YQEA 4GOJA 3AW8A 1GEEA 2G0TA 1YZLA 1AUXA 2B4AA 2HRQA 1PR9A 2EDCA 2XVAA 1OT5A 2CLKB 2ZGVA 4KX3A 2FEKA 4RY2A 4YPVA 1XU9A 1WMDA 4R9RA 5AR1A 3VAYA 3QY9A 3Q7QA 2WJYA 1BXGB 4INOA 5HUQA 1RKVA 3HKBA 2C3PA 2WM8A 1R6BX 3DR5A 2O23A 1YBHA 3M1YA 4LRTB 4QJBA 4WQMA 4KIFA 1QGUA 4D8XA 4X8MA 2C7VA 1KRWA 3OQBA 5JSUA 2Q5LA 1CP3A 1BH2A 1GAJA 4KDFA 4WZAA 3UICA 2AW5A 3C6MA 3MUOA 4NARA 1C0IA 2V6IA 4K6MA 1N9GB 5C51B 1U9ZA 2CDRA 2DTXA 1JG1A 1A0OA 1KZ9A 3HA3A 2WMOB 3CLKA 4LSZA 4UAGA 1NVBA 4DUPA 2G07A 1WUIS 1DV2A 3FPJA 2F90A 3UHFA 5K4HA 3GZNA 1WQ4A 2GWRA 2MSEB 1XT6A 3ETJA 3DM5A 3NB0A 3W8NA 2F9FA 4LOJA 2QRQA 4PINA 1NT4A 1XJ5A 3TZLA 3U9TA 1VI6A 4LW8A 2ZAMA 4UDOA 3D6MA 4XPIB 3CIOA 4U1RA 1EAYA 4FSDA 4V03A 2FOIA 5JVDB 4CTOA 3EULA 3G0DA 3TGWA 2GXQA 4H7KA 3DWFA 3NHRA 3RS7A 4DG5A 5AVWA 2B5WA 2FN8A 5FTWA 4FCCA 2FUNB 4G2TA 1R10A 4K9NA 4BGVA 4EG5A 2BFNA 3SC4A 3WNZA 3QVTA 4K87A 1LV7A 2BE9A 5G0VA 5KNDD 1UAGA 1ECPA 4L75A 4ND8A 2X8JA 2OQ2A 2H9YA 4NBTA 2WUFA 4Z8XA 4EYEA 3ZGNA 5AVSA 3ENZA 3LO5A 5HRUA 2OFOA 3IS3A 4LGCA 1KSFX 1QBKC 1XNJA 2XDYA 2XXBA 3JASB 3K6KA 4LHVA 5E9WA 4KQ1A 5H3LA 4MV6A 1RYMA 4I46A 1F0NA 2W2XA 3L7JA 1F8GA 1N0HA 1SFRA 3FOEC 2W7TA 1KR5A 2XDAA 2GJ8A 3HEBA 3Q3HA 5CTJA 3VOTA 5EERA 2CN1A 3KHSA 3LA6A 3R24A 3G9XA 1JF8A 5EWJB 5A1JA 3M6MD 2G1JA 2BGJA 1WXEA 4NFSA 3L4KA 4TL7A 3L7NA 2GHTA 3C3JA 4UE3S 2FAXA 2IXDA 1JQ3A 2QDXA 4Q16A 4OQNA 3W90A 9MHTA 3HXPA 4F71A 2QVLA 4Q9KA 3K4QA 4F2HA 4L6CA 2BEWB 3LCRA 1PFWA 3W5BA 4Q05A 4TYWA 4M9UA 2VJNA 5BWMA 5KNBH 3Q3GE 3ASVA 3P45A 1CJBA 4QPNA 1L5MA 1FRZA 2VEDA 3EGDB 3H5LA 4U2FA 3ROPA 3ZV3A 1XP5A 1BX0A 4QPPA 3LCJA 2IWRA 3JYHA 1M1NB 3C85A 4S04A 5C31A 1J9GA 3FOZA 3ZCQA 1RLUA 1NVAA 1BMTA 1X8JA 5DTQA 2IEDA 3S2YA 5I7EA 3PICA 5E1MA 3I39X 1NKTA 4YXFA 1HEIA 4CM3A 4RVUA 1K92A 2QX7A 3UK6A 1SKYB 1GJRA 5E0OA 5DASA 4AMYA 2NZVG 1DHTA 3ZDDA 1S3GA 2H48A 1GNQA 1DQSA 2IXEA 3F5SA 4NYIQ 2Z2IA 4X95A 1XVAA 2PO5A 5CX4A 3AP3A 4GF5A 5C7IO 4ZAVA 1RYFA 3BRSA 5FUXA 1DIGA 5F33A 1ZC3A 3MMSA 1RHUA 1SULA 4AMZA 5JHHB 2ZXUA 1W0KA 5J1SB 2QSZA 3PQ2A 2V8OA 3O8NA 3PFGA 4IHJF 1L7BA 4PGHA 4TL8A 1IG0A 4YJGB 1RWPA 4FOTA 1UEIA 5ED0A 1XTVA 1GGHA 4OIFA 1Y9EA 3KKQA 1BD4A 4JKIA 4TSFD 2VK8A 5CK5A 4EY4A 3OHMA 1T5LA 3D81A 2EWMA 3K70C 3IIIA 2EJBA 3PE6A 1ORTA 4LFBB 1W4RA 3H04A 4JGIA 4UEOA 4DADA 5FAKA 4BKMA 1QQ7A 4WFIA 4FB5A 1XVUA 4MIEA 3TTTA 4MR7A 1L8XA 4RORA 1X7WB 4RZXA 4BRZA 1GTSA 3K16A 3UJ7A 5MGNA 3WAKA 1GPKA 2AV6A 2FW9A 2MOKA 3IE0A 1AUQA 4IVQA 4MARA 4V0MA 4YP5A 5F77A 3D0RA 1GQ2A 1RP7A 2YY5A 3N8DA 4PSCA 5HUHA 4KBGA 2FW0A 2YJ5A 3A1UA 1KJJA 2O2SA 3PC8C 4JC0A 5LWQA 2Q1YA 4RHTA 4EABA 1HPLA 2DR0A 1H9BA 4PX9A 3GDWA 1U8YA 3UB2A 1ZLYA 3QXSA 3OQOA 4G0VA 3TKYA 2XWBF 3K9NA 1VJDA 1ZUHA 2CT8A 4BNUA 2HSWA 3KT3A 5IVIA 2BEUB 1KWGA 4P4TA 1NBIA 1YOVB 4DR1B 3ETGA 1AHHA 3G02A 4MA0A 4QVKA 2YS6A 1K6JA 1ODSA 1ABBA 3V7YA 3WBBA 3DEKA 4V0KA 2PSEA 3GEIA 2H51A 3SYNA 4BASA 1IOVA 2JD0A 3WI7A 4B82A 4NZMA 2BGIA 5I9TA 1TK9A 3AV0B 1JNXX 3JU3A 2HRCA 2B8TA 2QRMA 3E9ZA 1Z35A 4FOOA 4FZ3A 4BYGA 4KXYA 3ZY4A 5JALA 1E6EA 3H1AA 1USWA 2C0PA 2PZMA 2B21A 3I2FA 1C14A 3K94A 4CL8A 1EJ6A 1A5SB 4B2IA 3P0EA 1H0HA 3VZRA 2XOEA 1ZIYA 1SC6A 1T24A 2XZTA 3CSSA 2ZI5A 1GPWB 1GG9A 3B1FA 1MAAA 3FYUA 3T3EA 1JB1A 4DMKA 1ZY2A 3GLGE 4QTUB 4JYBA 4Q4DA 4L8FA 1L7EA 1BVUA 3PQ8A 1UJMA 2WZDA 3FNFA 4EI2A 2VJMA 1ZJYA 5KTMA 2NP6A 3SOZA 2FHSA 4HYQA 1W2GA 1TQDA 4K3VA 4ACAA 3HY6A 2ZT6A 4H27A 4TZKA 4CKYA 1GRQA 1K2WA 1O54A 4QUGA 4WCFA 1QG4A 3CLTC 4X24A 1VB3A 3HDYA 1V16B 2J48A 4IGFA 3Q6MA 1MEEA 3V34A 4QBIA 3ZU6A 4ZGBA 3GNTA 3WYEA 4HD8A 1QKJA 3M3HA 5JTUA 2UUAB 1A9TA 1BDBA 2R5WA 2XMBA 5LBTA 4X62B 2X1MA 2I2FA 5DM1A 4DUGD 1Z4KA 2AQKA 1R4AA 3CNNA 3FUVA 4KWTA 1PGQA 2F3PA 2REXB 2VQ6A 4LZPA 3GJXC 3MGGA 1XPJA 5HTOA 1C0KA 1U8TA 2QTMA 3JV7A 5CIWA 4IOLA 2Y05A 4GPEA 3QUQA 3V42A 4X84A 3V1LA 2PUEA 5I6DA 5FI0B 2Z9DA 4OP3A 3DBLA 1R66A 3ENWA 3BXGA 3OZTA 1Q19A 3MGCA 4W5HA 3THXB 5EEHA 4X6UA 3PGKA 1E5XA 4FXOA 4Y98A 3QWAA 4GPBA 3U3OA 3JPWA 4GMHA 4EJ2A 4XWGA 1QQ5A 2FF7A 2R8PA 3RREA 1M7BA 3OEWA 1NF3A 3DKVA 5JQGA 2EBUA 1DAEA 3B3GA 4H3VA 4CG2A 1NLYA 1C8VB 3AUKA 4L4UA 2V7WA 5KVAA 2FG7C 4ZALA 1ZRNA 1Z2NX 1IVSA 1JEYA 1G42A 4IINA 4J0QA 1CLUA 2HY7A 3ROMA 4K9QA 1NF9A 3B9PA 3S1AA 3SWWA 3RJ5A 1B93A 3IEKA 3COYA 3W8DA 1G3QA 2BTQB 4ZQBA 1Q0HA 2PZEA 3LOQA 1W49A 3E84A 3FYSA 4HDMA 1EFRA 1ZG3A 1ZSVA 4F12A 4IIYA 4WW0A 4GAEA 3UUGA 2XQKA 4LZWA 3WSWA 3KSAC 2IY9A 3LV8A 2D0DA 2ID7A 3H11A 1GIAA 5BXYA 3RYCA 4YRGA 4C30A 3FSGA 3Q7IA 5BURA 3BE6A 5B2EA 4GL2A 2RE8A 1KVQA 1M2KA 4A0FA 4DR6B 2VSOA 4Y18A 8LDHA 3MJTA 1I1OA 1IHXA 1TJPB 3G8YA 4LXIA 3N5CA 3MUEA 3K9FC 2PMCA 4YP9A 3T3DA 1FQJA 5FADA 3VBEA 2D74A 3B38A 1GGVA 3AL3A 3IQHX 4HDSB 3EXIB 4DTCA 4Z3DA 3K5IA 5EI5A 3UGKA 2H17A 3P9ZA 4BXOA 3JPYA 4UAJA 3ZW7A 1WZ2A 1O9BA 4PC1A 4BLTA 2VNHA 3B7WA 3D5EA 4UZSA 3HU3A 1UZLA 2EKPA 4OK3A 5HX7A 5JG7A 3IYLW 2HWUA 3I9NA 3C43A 2XQVA 2OUKA 3C7DB 9ATCA 1I94B 1YA4A 1P5ZB 2HIAA 4ALIA 2FNAA 1O1YA 1N5LA 3C3MA 1QH1B 3FDJA 2BWJA 3NVAA 1S8FA 4OH1A 4PVCA 3OPYA 2P6OA 3ZS9A 1ZMTA 1O6BA 3I23A 1KJ8A 3L7MA 4OATA 1NQAO 5LBUA 3EUEA 4IYRA 3WRYC 2D3TA 3FFTA 4ACBA 4BATA 3HN2A 1UBHS 4NQRA 3BSFA 2H4FA 1G8AA 1L5HB 2IYRA 4M8IA 4O25A 3HCAA 2KMLA 2CNOA 2WNSA 4PZ0A 2BEKA 3FDFA 3PJRA 3F6SA 16PKA 1LW7A 2Y1DA 1JHXA 4BLQA 2ZRNA 4DYHA 2GLUA 2VTBA 4DQVA 3ZXUB 1JJ7A 2QTLA 5JZMA 1SZPA 2H1LA 4UHDA 1XIVA 3TMAA 2FK8A 4FGUA 2X14A 3HLTA 2PH3A 3FH0A 4G86A 1J2EA 2A78A 1W0JA 4IIBA 4Q4AB 3EGIA 4MQBA 1CEQA 1E2HA 4MPDA 3EPKA 1WMAA 5M7EA 5KTRA 5C34B 2WF9A 3UA4A 2QAIA 2RGEA 3KM0A 4IKOA 1II8A 1FCJA 5F2KA 1OVGA 3E4CA 3AZPA 4URHA 5LNK1 5TDHA 1TFUA 2Q3DA 1C1XB 1YJXA 3VDXA 2EGHA 3PYXA 3ROGA 4HCJA 1QX3A 4JP1A 3U81A 1RXCA 4A0QA 1XEFA 3FYHA 3WNVA 1O95A 4AG6A 5CFZA 1DEHA 1UPBA 2PX4A 2HJGA 2ZUBA 2ZIUB 4MS1B 4UULA 4CIWA 2ORED 2HLDD 3UY4A 1W25A 4OXIA 5L4LA 3SHOA 1P60A 3AETA 4QPCA 3UG6A 3U7EB 4B9EA 5ADHA 3S27A 4CMEC 1B15A 5JSFA 3IULA 1KRXA 3QPAA 4N01A 4KU4A 2BMFA 4MW0A 3R8XA 3BRCA 2YS7A 2YWBA 3FLMA 3R3SA 1Z5PA 3EIXA 4LECA 3WGYA 4IIUA 4A6XA 4ANFA 4OJYA 4AJNA 1JG7A 5DHAA 1F4VA 4DNFA 2PR2A 1UQTA 2ZQYA 1YQTA 1OPRA 2HI0A 1B43A 2WHEA 4BPBA 1ZK2A 1EPUA 2C7GA 3I0MA 4K3UA 2HSZA 3DONA 1NYRA 3PQFA 3VV2A 4NEGA 5CM2Z 4DKXA 2F8SA 3DHWC 5JAOA 1X86B 1P9LA 2OLKA 1JQLB 3TO5A 1HL7A 3NC0C 2PX8A 4BFCA 1QG0A 1BKSB 4G8BA 2FRDA 3ZV6A 3R40A 3U1BA 1EIWA 4UJ3A 2GN8A 1FX1A 3QK7A 1ECBA 4ABYA 4TQGA 5TX7A 2CLHB 2V59A 2XMRA 3OZEA 3PLNA 4F9EA 3IBCA 1K0UA 2BUBA 5KYGA 2AKEA 1YS4A 3L0YA 3FFAA 2GBLC 4ZZ0A 1JH8A 3ETEA 2VATA 5HGXA 2ZB8A 4XYBA 4RIHA 4PLVA 1X1AA 5BPHA 3WJ7A 1QVVA 1SPXA 2AFVA 2WM2A 3MMXA 3RVOA 1EGVB 1I2CA 1RTTA 2C42A 1ORVA 2EP7A 1Z4MA 3FCSB 2IQIA 1E4VA 3PVZA 5H82A 1TC2A 1QYIA 3E1KA 2BV3A 1KY4A 3T5BA 1TA0A 4KX5A 3WRXA 5HM6A 5JRJA 2RHMA 2M98A 3DEHA 1X7ZB 1ZUD1 4MROA 2BEUA 1PQ4A 4MWDA 5DM4A 3WWCA 5TQVA 2JGLA 3SHVA 1KIFA 3AMVA 1TPZA 3NIWA 4X1YB 1L4HA 4J75A 3PCRB 4CQLA 1TUBB 3DBRA 3FYUC 1NBEA 1VRWA 3IBYA 4FONA 1TYEB 4JR2A 2CLEB 4L9RA 1NVUQ 2BGUA 1LQ2A 3UJ9A 1TYCA 2HDWA 3S5JA 3ZJYA 4R98A 2PRJA 3V5NA 1BWQA 4QOJA 1JT2A 2GEUA 1CLEA 5LNK6 5AO9A 5B58C 1I7SB 5AH0A 4ZQCB 3BREA 4MRPA 3LW8A 5DTEA 4BNHA 1EXDA 3GAAA 1G1MA 1KI2A 2EAUA 1XZCA 1PVOA 1O6FA 3GLVA 5ALGA 5TMDA 4O6VA 4ZXPA 4C9BA 1SUDA 2A0FA 3GUHA 3IAM1 4YV1A 1JPJA 4EB3A 4WJZA 5DIZA 3HFGA 4CM8B 4PCAA 4GMKA 4N48A 1GFWA 4K9KA 1W9HA 3OE1A 4QQNA 4RM3A 2GD6A 3J80A 5DBIA 3K7EA 4EG4A 3DXXA 1CHNA 1GQOA 5JXWA 1Q6ZA 3UTCA 2QTWB 2PKQP 3C3WA 3PNSA 2OXIA 1WHTA 1YR9A 3EFOA 1NG1A 2ZI7A 2Z5LA 3GT0A 3WMGA 1VCIA 3P0HA 3DHVA 5DVZA 5IC6A 4FMDF 5AKHA 1TO6A 4N7MA 2QGNA 4RMIA 1O95D 2AQIA 4N6OA 1QQ6A 4BMDA 2E87A 1QKKA 2HRRA 1FDWA 4RFSA 4RK4A 1CUFA 4U4AA 5EHGA 4M0LA 5M3BA 3RFTA 3ZOZA 4X66B 3IO5A 2C92A 4PIPA 4UU7A 4YRPA 3K71B 1DQYA 3SR4A 2CL0X 4DIUA 1CRPA 1RWWA 4GSLA 4IUCS 3OZXA 2O0HA 4PAGA 2P3QA 2I33A 4U9IS 2PGJA 3PX3A 5FYDA 2JD1A 1TVKA 1J21A 1XQXA 3IKVA 1LVHA 3ANXA 1ZGJA 1BE6A 3EDRA 4EPRA 3TF5A 3T54A 3EFBA 3I3SR 4DIMA 1AB5A 2FZLA 1G55A 3EXG1 1ZD9A 1THZA 2VL7A 1MGPA 3DAFA 3DTVD 2ZWIA 3U3ZA 5JNRA 3U09A 1R8YA 3PFBA 3EXIA 4WLNA 4XSHA 3D4IA 5BVHB 4YCNA 1FEZA 1DDIA 1VE3A 8ADHA 4DV3B 1EUDB 1H2ZA 1QHXA 3O84A 1VDZA 1T9DA 3E70C 4AMVA 1IXRC 1LSOA 2O5RA 1T4GA 3KE8A 3WE7A 1XMOB 3BXFA 4UMFA 4RE5A 3EMKA 3IAFA 3KT6A 1TEVA 3LUBA 3DMTA 4UUOA 5GM2A 4J7XA 2X0JA 4PCUA 1ZM2A 1RHMA 3TQRA 4NL4H 1XDWA 5FD8A 1H6BA 3PFFA 4FBMA 2CV1A 1GCGA 1ODJA 1IVYA 1YB2A 4JVMA 4OQDA 1FVXA 1VKOA 1Z5GA 3RAFC 4OA8A 4PRZA 1Y1SA 3F5DA 1ZW6A 1T34A 2X9QA 5GQSA 2DH5A 4GX0A 1CFJA 4MQFB 2FFJA 5C80A 3EGOA 3VYUB 3ZH9B 4YJHA 2VNKA 1C7EA 3HQ4O 3BFXA 4OLBA 2OBXA 1W5FA 2ZIFA 3D3QA 2JFVA 2GZ3A 1JNYA 3PC3A 4QODA 4JT4A 1VM6A 4TKLA 1QO0A 1ZQ1A 1AUVA 1HE5A 4J9VA 1YASA 2AK2A 2GCGA 1HX7A 2JVJA 3GJQA 1SVMA 4YJGA 3OC0A 5DYWA 5KTPA 2DUNA 1G59A 2G77B 4KI0A 1GADO 1BCRB 1XXHE 2C96A 4RVHA 4UCFA 5AMXA 3N0XA 4MPJA 3VSBA 1F8FA 1SC9A 3O3CA 4DS3A 4NXMB 3ASUA 2ZJ2A 2HCTA 4I5FA 4K28A 3RIGA 3DCYA 1OASA 1CRWG 1ZAKA 3LQQA 1JDSA 4GI7A 5J43A 1V0JA 4E03A 1Z36A 4BQEA 1VPWA 5CFPA 2HF9A 1R9JA 2V7QD 1G38A 1EHCA 3NH9A 1I3MA 5L3QA 1ECFA 4IZ6A 3A31A 4UTPA 3L8HA 3MGBA 4FJ1A 5CYFA 3PEVA 3TS1A 1P0IA 3QWIA 1CX9B 2GCPA 1CUBA 2ZE7A 3OQPA 2J0QA 1ZFNA 1EFPB 1OUMA 3DZJA 4ARSA 4F85A 2WINI 1PVVA 5CB0A 1PR4A 4EX6A 1G7RA 4BLVA 5CFNA 4UVHA 5HFJA 2O6LA 1GTZA 4EA7A 5JXHA 3IURA 3A4MA 4IMIB 2RBEA 3VAZA 3F8TA 2BC9A 4U2EA 5DH9A 3QVMA 5IAJA 4L3WA 4RIIA 2V1XA 4L0DA 1ZITA 4W1QA 1E6CA 4JBLA 2Q3JA 5B1IA 5IDXA 1KU6A 3BN3A 4MVJF 4P54A 2DQSA 3IOMA 2DKNA 2NWQA 1ZZEA 2OK7A 1V7PC 3I6BA 4R1TA 1XELA 2OENG 2NVBA 2DR3A 2WABA 4NU8X 1BFKA 5BR7A 2QLLA 4KI7A 2I99A 3QTLA 1MVOA 4NCJA 4TROA 1J2UA 3L7CA 1LD3A 5ITZB 3INTA 4D9KA 2Z6UA 3IQZA 1QFJA 3GCWA 1ULHA 4U6SA 3O8RA 3NATA 2A5JA 1YA6A 2BH9A 3LBYA 4JLSA 3ZKWA 5JD4A 5JU6A 4DA7A 2Y1KA 2R8YA 5HF5A 3TCXB 3KOYA 4ZGGA 2WB2A 4B3RB 4C76A 3TTVA 1A9QA 2EKZA 5J59A 4O2LA 5LDDC 2C20A 3F3MA 4JP5A 1ATIA 3U44A 1VSTA 2PTGA 4BVKA 2NU8A 2EP8A 2FN3A 4MB6A 1XEWY 5LZ5A 1CQIA 3PKZA 3W9YA 3VNUA 1OV4A 4KH1A 2C78A 3IVRA 4F06A 1TZKA 3WKCA 2ZUDA 1Q7CA 3OJLA 4WTOA 4YJ2A 2HQBA 2CHGA 3CX4A 4GPD1 4Q1BA 3T8YA 1YA8A 2B9VA 3OAAA 5DE3A 1EX6A 2QW1A 1QQTA 1NSYA 4KZKA 5FWAA 5C3UA 2P3LA 1YO6A 4JLKA 4JZYA 2HB6A 2Z4RA 2P1RA 3EMDA 3IRVA 1J5PA 1DXQA 3KHTA 5FUVA 2EGUA 4AY4A 1DC4A 4TKUA 3HY4A 3NYRA 4BGEA 1OJ7A 1IG3A 5DEOA 4DAOA 1B00A 5FPPA 2NNWB 4JI1B 3TPCA 5HDQA 4MMXB 5DW0A 2JFWA 4AP9A 3JR3A 1CK4A 5FLKA 4E46A 2Q9CA 1KVRA 1H2WA 3KVOA 4MUBA 3FLBA 4AXXA 2DSNA 1AXGA 1GUYA 1WCXA 3L1JA 1PV2A 2G1UA 5MN6A 3NWOA 4BU1A 3BXZA 2QM7A 1GQFA 1V7QA 2Q3HA 3ANSA 1KP2A 2NQ8A 1LTQA 2XOKA 3CH7A 3S3TA 1PV4A 1OI4A 1VYUA 1YACA 4I66A 3GXOA 3N2IA 2G88A 3DC7A 2QLBA 4ZU6X 2POCA 3KJGA 5K3DA 4B35A 3FNQA 5BWBA 1LA2A 2V74B 3EYWA 2P65A 3D3WA 3FWYA 4KR0A 1JG4A 1GNRA 2NV0A 5ILGA 2OYCA 4B7XA 4C06A 4N03A 1AV6A 3UB4A 1XNHA 4JLAA 3K8OE 3KCQA 2H7VA 4C0QC 1Y3FE 1TM2A 2Q3FA 2G8NA 2GVDC 3E9DA 1BROA 3TDMA 4TS9A 4JMPA 5LUBA 1G18A 1K4YA 5KYYA 3ILHA 4LISA 2RK3A 1WVIA 1X70A 1SUAA 1W7AA 1NPYA 3NBMA 2AYYA 1MO6A 3V7WA 3H9QA 2XUHA 1SY7A 3IRUA 4EJ6A 3NOXA 3SDBA 2J0VA 5L7WA 2W37A 1JHDA 3FOWA 3M89A 5ALWA 1G3UA 4CBVA 2NU7B 2W2TA 5BVGB 3Q6IA 1CY8A 1Q95A 2G8LA 2ZYGA 2JD2A 2O1WA 3DGEC 3IVMA 4HRXA 2BFFB 1E2BA 3EBOA 1VOTA 3DDHA 2XTNA 3CZCA 4ES6A 3DKKA 4FQ8A 1G2OA 3U4QA 1RI2A 1TF5A 4DHWA 2CHFA 3LP8A 4RDXA 4JOCA 2XV1A 2IY7A 1GRCA 2FSSA 1MV8A 4LBWA 3SZ3A 1TVMA 4LDJA 1M2VB 4TLLB 4DRYA 5K20A 1VHJA 5F9FA 5DYTA 3U3RA 4CI0B 4I4CA 2Q45A 2OWEA 4GPIB 1B42A 2UVPB 5ALQA 1I10A 3H17A 1VG1A 1THTA 3HJBA 4KN5A 1MCZA 1D2NA 1SBNE 5FR2A 2IUUA 4LQLA 1YCHA 3QMMA 2F48A 3GMTA 1H65A 2R6R1 3N70A 3QBTA 4C7OA 5HJ5A 3H0EA 3T9EA 2HH9A 1OB2A 4TMWA 1EK5A 2ZP1A 1ZCJA 3UB3A 3KQYA 1RKBA 4AUEA 1P7YA 3GPDG 5IKMA 1QP8A 3UMCA 2JJ1A 4GYWA 3TXYA 4G37A 4CMKA 1K8RA 5KX5F 3O2JA 1TADA 4Z9XA 4CLOB 2R751 4CJXA 4ED9A 3JD4A 5REQB 3TG8A 1WKVA 2CHEA 1Q84A 4G5GA 1T9AA 3HPQA 4OHFA 5FTNA 2QTFA 1EE1A 3DLCA 1B74A 2H1WA 2FRDC 2D0PB 3WRWA 5BOSB 1BRTA 2I9PA 3PR2B 1ESMA 3IDOA 4MP6A 3KUXA 5DT9A 2WTAA 3IHKA 3QW2A 4GRAA 1V35A 1KTVA 2AI1A 4YMSA 2IC5A 4Z99A 1L9KA 1NULA 3AEKA 1ZRMA 4FYYA 4IJVA 3W2GA 3ZV5A 5CDFE 1NQWA 5ISMA 3D7RA 4IIXA 3EA4A 3HNOA 5EZQA 4MW7A 5C1BA 1PR6A 4YDQA 1V39A 2EZ4A 2IPNA 2AT1A 5EIWA 2IEYA 3JYPA 4R1PA 3MTAA 2A5LA 1XJQA 2W2KB 4LYHA 3K8ZA 5BMOA 3CNOA 4U7PB 3E0QA 3JQQA 4D3ZA 2FG6C 2JGNA 3CE6A 5J2TB 2D7CA 4TTVA 1SVNA 4O8CA 3RTCA 3G13A 3E2MA 2MMGA 1J8QA 1JI0A 3BGOS 2OKGA 3MTDA 2VXYA 3TDNA 3V1KA 3T9FA 2PXAA 4U2BA 2YFYA 4B4VA 5CDHA 1YRYE 2CXXA 1AO3A 4D8UA 4DPMA 4Z4IA 4JJ4A 4MRNA 4BQRA 1T5IA 1IRIA 3CRZA 3EB9A 1SEPA 4KXNA 5IX8A 1KEPA 2L42A 2EARA 4FILA 3D8NA 1YCGA 4S0XA 4TRJA 3SJCA 2QXYA 3NGMA 5B1EA 1BGVA 1Z28A 3BZUA 3GV0A 1T5SA 4R8KA 4O4HF 2QTHA 3CXRA 4JXKA 4YR7A 2ZRLA 2HJSA 4YAIA 1KYWA 1AKMA 1PJZA 4O4LB 4RHEA 4BTVA 5KNLA 2C03A 1MAVA 3PGLA 5TEWA 4C21A 1Y7TA 1W88B 4FUTA 1E4YA 4BFTA 6AT1A 1RQPA 2JIDA 4M0PA 4YP7A 2W8BB 1P1BA 4PC3A 4WXHA 2OHXA 1GQRA 2JCXA 4C7VA 4P98A 2ZSFA 4GMXA 1OZFA 4GOXA 3UT0A 4L5IA 2O8VA 1X0VA 1H2HA 3MGAA 4GL4A 4P7KA 3PXBA 1CYDA 5E38A 4WGGA 1H69A 1OIVA 4RVSA 4AP6A 4E7PA 4IXTA 1RXWA 1H4QA 3O2SB 3QZUA 4I5DA 1KJNA 3UKOA 4LYAA 1X7GA 1F20A 2EBHX 4WAUA 3W5VA 4QX6A 1UFRA 5ALUA 3WRYA 5CD9A 2QKYA 2DLCX 2PZBA 4R2KA 3W5CA 1MTOA 5CXQA 2HHAA 2JGIA 1MA3A 3MS2A 3I53A 5HJ7A 4GWGA 2XLBA 721PA 1QQAA 1V11A 4GECA 4X60A 3HV2A 3ICCA 1VZ2A 4B3DA 2PZAA 1KMHA 4EGJA 3UW3A 1RAGA 2OAEA 3K53A 2GKGA 2I6TA 5DNEA 1J2JA 3U4DA 2G5PA 1TKRA 5KAMA 2RHJA 3IV9A 3N7TA 3UJHA 4CT0A 3EQZA 4EEKA 1O3YA 4G0QA 2O8EB 1PZNA 2P8SA 3ER8A 2ZI9A 4QDUA 1ARZA 1YL7A 2R1UA 2AFIE 3F98A 3NU1A 4NYJQ 1M6VA 2WWGA 3M70A 5ELMA 5AESA 1XZIA 3QIVA 5FOWA 4F04A 2JVIA 3DOJA 3RDPA 5JEEA 1QDUA 3CVOA 4GYKA 1Y8QA 3K30A 5CG2A 3CKMA 3HS3A 3CM0A 4OHRA 4BVGA 3QX9A 4Z5XA 3IT1A 4IIHA 2F00A 1HT3A 2XA2A 5B4UA 5C1OA 5C81A 2VYQA 3I2IA 2ES4A 3EVGA 2MU1A 4MQFA 4WBSA 4BTLA 1W0CA 2IZOA 3D4NA 3R77A 4FYVA 1OLUB 3M1AA 2CFIA 2AWOA 3DYVA 1Z7BA 2HLDA 3I9MA 5EP4A 5DBEX 2X3UA 1DP4A 3AKYA 1F51E 4G0MA 4R5MA 2WWVD 3WYCA 4ZJPA 5DGXA 4HYTA 4IXNA 1R0KA 2QN9A 2XVZA 4I9HA 4ZEWA 2YQ4A 3R3UA 2JAUA 5JC1A 421PA 1AUOA 4DHEA 2DFTA 1KEZA 3N6RA 3EDYA 3HE3A 3GJ0A 4I81A 1MPTA 4K6FA 4PU0A 5A7GA 3VHRA 2BHLA 2FWPA 3NRJA 3X1JA 1HDCA 1SELA 1MENA 1TMOA 2FSIA 1ZGBA 5F1YA 2IK8A 5DEIA 1TPYA 1W8DA 4X7MA 1CY2A 3ETLA 4KLNA 1TM5E 2HD4A 1M5TA 5KOHB 4KR7A 4HOYA 3O95A 2MYNA 3H1EA 1C41A 3B78A 1USVA 2GCOB 3N3BC 4KITB 3IJPA 2X0IA 1K5HA 3FDIA 3T35A 4FEGA 3WNQA 1Y7PA 2WJHA 1QHSA 1Q1GA 1ZKMA 1DUSA 1UT5A 1ZYUA 2ID9A 2XVMA 1S6YA 2N75A 3E81A 3OFSA 4Q3EA 4D96A 2C9DA 1PNQA 4BN0A 4B3CA 2J6IA 3U16A 4PN7A 2PFGA 4P4SB 2QVCA 1I51A 3M4ZA 2AL7A 2PKXA 3GN1A 2PA3A 4IO1A 1PLJA 5EP3A 1KO4A 3CRVA 3CUVA 4S2EA 4WASA 3NVMB 2ZUUA 5MN5A 2IU4A 4M1QA 4OKNA 4UE2A 5IT0A 3BZWA 1JFFA 1LU9A 4YAEA 4NBLA 2YXBA 4R7ZA 5CURA 2P9BA 2RHTA 3BHJA 4IOJA 3U3JA 1E1QD 4M9XA 1DEXA 2VAXA 3K35A 5DWVA 4CLXA 4YT2A 3D6UA 1ORHA 1KPIA 3VA7A 1SNYA 1QP7A 4MLPA 2QVXX 3QLVA 4MB2A 4RWEA 3PX7A 1QRTA 5JY1A 2KX7A 3QJGA 4RY0A 1QS0A 2WWXA 4UUAA 3ZGXA 2A5FA 1DDOA 1HWYA 2EP5A 1FW6A 2JIPA 4Q6WA 2E37A 4U6NA