4DARA

Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with tubercidin
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
231
structure length
231
Chain Sequence
SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase deoD-type
publication title Insights into phosphate cooperativity and influence of substrate modifications on binding and catalysis of hexameric purine nucleoside phosphorylases.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 79
structure length 231
sequence length 231
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4darA00
1LVUA 1V4NA 1PF7E 1VFNA 1LX7A 2H8GA 3PNSA 3OOHA 2AI1A 3UAVA 4OEHA 1K3FA 1V45E 4GLJA 4LNHA 1Z36A 1G2OA 5IU6A 3BSFA 4WKOA 4PNPA 1Z37A 1K27A 4I2VA 4WKNA 5F7ZA 4JP5A 3KU4A 4R31A 3LGSA 1Z34A 4BN0A 1RFGE 1M73E 5ETJA 4YNBA 3SCZA 4BMYA 4WKBA 1SQ6A 2OECA 1Y1RA 4E1VA 1Y6RA 2QTGA 3E0QA 3FOWA 4QATA 3NM6B 1Z5PA 3ODGA 1JE0A 1Z33A 4F1WA 3K8QA 1A9SA 1LV8A 1PR4A 1YQUA 3GB9A 4DA0A 5F77A 4L0MA 3U40A 2A8YA 3UAZA 2P4SA 4P54A 3KHSA 3OOEA 4D98A 3O6VA 3F8WA 2B94A 5F78A 4LNAA 3EUFA 4LZWA 1ZL2A 5DK6A 1ULAA 3FB1A 1Y1TA 3GGSA 3P0EA 4NY1A 2ISCA 1T0UA 3KVYA 5F7JA 1A9TA 4G89A 4QARA 1PR6A 1Y1QA 2HN9A 5KB3A 1PR5A 4TTAA 4GLFA 3BJEA 3OF3A 1YR3A 1A9OA 3DDOA 3C74A 4TYMA 1Z38A 3PHCA 5K1ZA 1RXSA 5EPUA 1PK7A 1NC1A 3BL6A 3UT6A 1PK9A 1ZOSA 4L6IA 5F73A 4TTIA 3UAXA 2Q7OE 2BSXA 1CG6A 4L5YA 4M1EA 1A9PA 3OZCA 1Z5NA 4UC0A 3KVVA 5B7NA 3T94A 1U1DA 3LBAA 1A69A 1SJ9A 1ODIA 1T8YA 5CXQA 4YMLA 1YBFA 1V41E 1JDVA 4DARA 1PR0A 4G8JA 1TD1A 3KVRA 1ODKA 2A0YA 5I3CA 1V3QE 1T8RA 5C80A 4FFSA 1OUMA 4F2WA 4EARA 4DANA 3E9RA 4ECEA 5IFKA 4DAEA 1PR2A 2I4TA 4IP0A 4TXNA 3K8OE 1A9QA 1B8OA 4OGKA 4OGLA 1U1GA 3OCCA 3OPVA 1U1FA 4OJTA 5CCDA 3NM4A 2AC7A 1NC3A 1T8SA 3MMSA 1QE5A 4D8VA 1RT9A 3ONVA 4RJ2A 5CCEA 4MARA 1TCVA 4F3CA 3DJFA 1VHWA 3QPBA 2XRFA 1CB0A 2HSWA 4QEZA 4QAQA 1SD1A 1PR1A 1ECPA 1Y1SA 5FAKA 5EFOA 4R2XA 5JPCA 1TCUA 1PKEA 4DA7A 1RXUA 4D8XA 5F7OA 1RCTE 2QDKA 4R2WA 4DA8A 3FNQA 1OV6A 1RR6A 1Q1GA 2IQ5A 1T8WA 1YQQA 2A0WA 5B7GA 1JDSA 2OXFA 4TS9A 1JYSA 3DP9A 4BMZA 1Z39A 2AI3A 1A9RA 2AI2A 3LA8A 3OZEA 4DAOA 1YRYE 1Z5OA 3MB8A 2QPLA 4GKAA 1I80A 1JP7A 5EUBA 2QTTA 2RJ3A 4D8YA 2ON6A 1RSZA 4MCHA 1RXYA 4YO8A 1C3XA 3UAYA 4L5CA 4TTJA 4WKCA 1JE1A 4NSNA 3FWPA 4OF4A 3KUKA 3UAWA 1N3IA 1SD2A 1ULBA 5CXSA 3PHBE 4TXLA 3EMVA 5F76A 1JDTA 4H1TA 5B7QA 5F7XA 3OZDA 4TXHA 3DF9A 4X24A 1VMKA 4F3KA 1OTXA 1V2HE 4EB8A 4QASA 2OC9A 3ENZA 1B8NA 4BMXA 1Z35A 1OTYA 4DA6A 3NM5A 1PBNA 5B7PA 4MCIA 4OY3A 4TXJA 4F2PA 4JWTA 1NW4A 3IOMA 3P0FA 1TGYA 4WKPA 1OU4A 4LDNA 3EEIA 1K9SA 2OC4A 1JDZA 1OVGA 1U1EA 3INYA 4DABA 1U1CA 4D9HA 2QSUA 4TXMA 1JPVA 5CYFA 4K6OA 2HWUA 4KN5A 4JOSA 3DPSA 3TL6A 3FAZA 3PNPA 2PGAA 4L5AA 1ODLA 1Y6QA 3FUCA 3OZBA 1RYZA 1WTAA 3NBQA 3IEXA 1XE3A 1ODJA 2HRDA 4TS3A 2A0XA 1RXCA 4G41A 1V48A 3O4VA 3BGSA 4YJKA 5CYGA 3D1VA 4GMHA 1JDUA 2GUWA 4PR3A 4NS1A 4U2KA 4M7WA 1FXUA 4QFBA 4M3NA 1TGVA 1VHJA 4LKRA 1PWYE 1PW7A 2I8AA 3E9ZA 3EUEA
chains in the Genus database with same CATH superfamily
2RCNA 4R98A 3ZY4A 4C3ZA 3QF4A 2JARA 721PA 3I61A 2JIZD 4IOJA 2IZZA 3N5CA 3YASA 1MX3A 3F3KA 3GPBA 1UP4A 3BMQA 1IIBA 1MC5A 1UMBB 3EZXA 2FOXA 3DL2A 1NFFA 5EJ2A 3OUTA 4M7RA 3TSOA 2C0QA 5EIEA 4OEHA 3HDGA 1MABA 1ZISA 4GLJA 2V9PA 3EIQA 1DXHA 4IGAA 1WHSA 4LNHA 4N54A 4LRQA 5T6MA 4HAWA 3WJ2A 1E0KA 3SWWA 2YJGA 4UE3S 3ZH9B 4PNPA 2HJVA 3D7SA 3NGLA 5FI5A 3T95A 1QHFA 3TX6A 1S5PA 3SYMA 3ZJUA 5ESDA 3Q8LA 4H2DA 2RC5A 2VVTA 3B7PA 3VRHA 3AYXB 4K9RA 2RB5A 4MVCA 4XQCA 5ALEA 4G09A 2YVLA 2CZGA 5IVPA 1NDUA 1Z34A 3PI6A 3UK6A 3K0EA 4WLOA 3TB6A 3I73A 1IJFA 2OCIA 5TDHA 2GN2A 1ZYUA 2EYUA 2ZTMA 2V1XA 3PTZA 4JB0A 4HZUA 4CIWA 2PUCA 1NBWB 1U2DA 3UM9A 5HRCA 4TQAA 1KEWA 3IJRA 1YJXA 3IBYA 4ZJYA 1I7NA 4UQLA 3BIJA 1MV8A 4ZEOA 5BYKA 2TMGA 1KI9A 3UB2A 4EG5A 1M6HA 2HGSA 1V39A 3WTCA 1BE8A 4NZYA 3OCJA 2H2GA 5D3QA 4IUYA 5A0FA 2DLNA 4CCAA 3FGNA 2H7YA 3PNBA 2PWZA 1TFUA 2GDZA 2J3HA 1RHQA 4WZBA 3S44A 3WIVA 1PQ4A 2CFCA 2A92A 2GVZC 4RH1A 4EHKA 4H60A 4H0FA 4G0WA 3KKQA 1ZRSA 3VU9A 3T7TA 2BGJA 2B82A 4IIBA 3BTOA 5FRDA 2CJFA 1BHO1 2WMDA 3IBGA 4K9NA 4XFJA 4K3VA 1GVHA 1DIAA 4EMTA 2ENWA 2P78A 1EXNA 3CR7A 4A1OA 3IOYA 2E87A 2G40A 2IUEA 3AZPA 2B8EA 4I1VA 3W2TA 3ZI0A 4F1WA 1DB3A 5EIHA 4RTNA 4RK6A 4MICA 2EZ9A 3PUVA 1G2PA 3PFFA 1L5OA 3BOSA 2PVCA 3TTTA 2LCQA 2XDWA 4UHDA 4RESA 4XD7A 2O8BB 2NSHA 3I3OA 2WE7A 4RD3A 5E7MA 3U7EB 1JIXA 4P54A 3LP8A 3I32A 1QHXA 1VL0A 2ZJBA 3T0GA 3TVDA 4BKOA 2H1OA 4J94A 1PGJA 3RUHA 3CGWA 1PEDA 2UZIR 1H23A 4MLZA 1F2VA 4RA9A 4IGEA 5EUCA 2M6LA 1NI3A 3NTRA 4OSEA 5FNVA 5CA0A 4WIAA 3STXA 2UYOA 2GPWA 3FFAA 4LNAA 5LJLA 5E1DA 1TYBE 4F1KA 2FFRA 2X2PA 4JBLA 2JLRA 4ZU1X 3RHFA 1O1YA 1ULAA 4QWMA 3PNVA 3MUOA 2HCBA 1MT3A 2IIBA 2R751 5HW0A 2M1XA 2GT1A 3QQ5A 4NYJQ 3V8EA 2CXOA 4KVAA 4NCIA 3SM9A 4JLJA 3U48A 1ZVQA 4BNDA 4CN8A 4KDRA 1AO3A 1QSGA 4MUFA 3KOMA 3K7EA 1B8UA 3LG2A 5KNCD 1I2MA 1CUEA 3FZGA 2MWMA 5KVVA 5KU7A 5LZ7A 3AVTA 1IUNA 1GTL1 2H51A 3EQ7A 4H9GA 3ZGXA 2YFYA 4OYHA 3LHFA 3HP7A 3PUXA 1ZUNB 4ARVA 4BEWA 5DTIA 3UY4A 2EP7A 2MTBA 3A1SA 3C16C 3CWCA 4S1PA 2A1TS 4MR8A 1A27A 2IDMA 3BWXA 4CLHA 1G7RA 5LWHA 1DDGA 2I66A 5EPUA 3BL6A 1TVKA 3E6AA 2UVQA 5EMJA 4ED9A 1V5GA 1P9RA 2CUTA 2WSIA 2VFAA 5DBHX 5LZ2A 5G4KB 4BKRA 4I81A 5BVHA 2H1HA 2NSJA 5THKA 5E7IA 2DR2A 3GK3A 2I0FA 5A1JA 3E27A 3PQDA 2J4FA 1QAQA 2C7VA 2ORVA 4G0OA 1XA3A 4UMEA 5FUBA 3FZQA 4DJFC 4L2IB 2F17A 5C1PA 3JQFC 4Y9SA 1V47A 1EWYA 4QVKA 3GH1A 4ARZA 4L6AA 4EX7A 3W5VA 3PLNA 3MWDB 5LA6B 2BKVA 2Q5QA 1GPUA 4JUBA 3ZV7A 3OD5A 2VI5A 4RQUA 4WADA 5K3AA 5KQPA 2CFSA 3G85A 4K6KA 2HYIC 1NV9A 3QKUA 1BEUB 4FMBB 1XEWX 3AEUB 1QGED 2RC6A 3E81A 3QU5A 4XX1A 1J2EA 1JW9B 3OEHA 4J9VA 3L7DA 5KNLA 1DAFA 1YB5A 4NH0A 2XVYA 4FFBB 4O4IB 4WD3A 2YJ3A 2ECOA 2UKDA 4HWPA 4Q66C 4EVRA 3BH0A 5G1OA 4QTUB 5JNLA 3K16A 4JVOA 5C1DA 1A04A 2AUTA 4EY6A 4H7FA 4HX5A 4IIXA 1SRQA 3B8HA 4G8JA 3RI3A 3V00A 2AMJA 4P7GA 4H7PA 2GAOA 5TMEA 4UPDA 1IULA 2ID8A 4TL6A 5KYNA 4OQFA 2OY0A 4WCDA 1P7PA 5I8PA 1A5TA 4PYQA 2IIPA 4JBIA 2Q3JA 3RFVA 5C80A 1OPRA 1T9ZA 1UMCB 3PSAA 4FFSA 3Q3GE 4NP6A 1V6SA 1K7SN 2JGAA 2GD6A 5BSMA 5KTYA 3GLHE 2EW2A 1MORA 1VHDA 3ADKA 1GR1A 3P5SA 1W9MA 5JAMA 2VQFB 3E9RA 2NXNA 4X62B 1Z08A 1Z3IX 2QRNA 3E9QA 2P1RA 5CA0F 5HUHA 3MHTA 4Q0MA 1XJCA 3AZQA 3L7BA 4KIGA 2H52A 4FFLA 2AFIB 4X8HA 4LFCB 4F3TA 4ND5A 1W44A 1EFVB 3F5FA 4FEAA 3MAGA 3RVQA 2K87A 4OMUA 5E6UA 1VP3A 4EBFA 5LL6P 4RTJA 4D9EA 3AUJB 1Z06A 2Z58A 2H11A 5TPZA 3O8RA 3A14A 4EPVA 3K6SA 2AL7A 4NJEA 4CODB 3CPHA 4OGLA 2JFHA 3HKCA 4KWTA 4PV7A 2PZJA 3U37A 4M38A 5EIFA 4C3OB 1MJGM 4RPJA 1XNJA 1P5JA 4MVYA 3V8NA 2GEJA 4PG8A 1CE8A 1L7BA 2COEA 1P1FA 1QNLA 2O3SA 4G01B 5FULA 2FPXA 5H0IA 4LV5B 2CNWD 3RF7A 2BGWA 4I1PA 1G3RA 5EWLB 3C3KA 2HGZA 1TL7C 2CLIB 1RT9A 3TCKA 1IJKA 3W1VA 4G5SA 2J9ZB 4ILEA 1DAGA 1U3UA 2CMGA 2QN7A 1G20B 2DH6A 3BBPA 3IP5A 2ECQA 3BCHA 4OQEA 3VNVA 2CZCA 3OECA 4TMTA 4F3CA 2O8VA 2RBKA 2JIZA 2XDQA 4W5NA 2RH9B 3L79A 2QG4A 4UBNA 2QAIA 1E60A 3NFRA 4DUGD 1O97C 1PTJC 1FDTA 2XWPA 1GCOA 3GPIA 4J8PA 4WBSA 1K8RA 3R6LA 4FI3C 5A6SB 1QTQA 2D2XA 4KLAA 1YB7A 5IYZA 1XU7A 4KIJA 5DT9A 3UXHA 4AM8A 5SICE 1P2SA 3DLCA 4ARSA 1BXGB 2R8BA 4RGYA 2LVBA 2Q4OA 3E84A 1PGQA 2I80A 4CFYA 1N6RA 3H9QA 3EGXB 4N6OA 1XEXB 1BSVA 3VR4H 4R1MA 3FCOA 4DA7A 4N65A 4BTEA 1RYBA 3HDJA 4IDFA 1E5LA 2EARA 5AKLA 3T61A 1Q91A 4K05A 1X7WB 4AJ1A 3ZZ1A 1DAMA 5C7OO 3FMPB 1YR6A 3R0JA 3ZWNA 2QTVA 3W78A 5KSWB 1PJQA 4WXRA 3TD9A 2VRCD 1PL0A 1FUIA 5JY6A 3HRIA 4O02B 3M6MD 1SC3A 1YQQA 1F12A 1G63A 4MV8A 2ZXFA 3R7WB 2JBWA 3KFLA 2EFCB 2ASVA 2OHFA 4N0DA 3SX0A 2V58A 4YAJA 1TE2A 2I2CA 3WWPA 4DMCA 1I94B 5KJCA 2CV0A 2GPNA 3DL0A 2D2IA 5J4VA 3RU7A 4N0EA 4U7PB 4ZEWA 5JDIA 1RPZA 4J3NA 3C6KA 2O7VA 4ATNA 1EAYA 1Z7GA 3DE0X 3RKRA 4Q1BA 2AZMA 3TX2A 4PC6A 4X93A 2QZPA 2QENA 1GFIA 1RE0A 2J9FB 3QBEA 1E9FA 2P90A 4FWTA 2PG3A 3HLTA 2IEYA 1SK8A 1IM8A 4B1FA 3Q5EA 4YAUA 1WSWA 3E8SA 2FEOA 5B4UA 4K9LA 1CHDA 3WLJA 5ESWA 4MS1B 2BKLA 4JODA 2XUGA 1P2GA 2ON6A 1NTOA 2Q6OA 1B43A 2X1LA 3M6IA 3OZ7A 5TPWA 4M55A 2DPYA 3GIDA 3FHTA 5CCBA 3BGOS 1B00A 2JFXA 4ZAFA 4F56A 3HVKA 4IOKA 2PDAA 2C2MA 1DIBA 1CJUC 5AVQA 3OVMA 4B74A 4YCBA 4QUAA 5JOQA 1C30B 2J5XA 1NF2A 3AU9A 4IS3A 4PZCA 4F7DA 1B74A 3QU9A 3E53A 1I6KA 2R6FA 2BFPA 5BV7A 3VDNB 4ZVNA 1N0UA 4WKCA 1U3GA 1E1RD 3IRUA 4CKCB 4ZOBA 1ZQ9A 2BCGY 2DQ4A 3G5TA 3KJQA 4E7PA 3WIDA 1HEYA 5D3MB 3CEMA 1X7GA 4I6GA 2IDJA 4HNAB 3VU1A 1ZVVA 3JASB 5LQSA 3ISJA 4UM9B 5IG2A 1JG3A 3IX7A 4H3HB 1YDMA 4NEHB 1PJCA 2EJBA 3NAGA 3PUIA 3QZUA 3ZDFA 4Y9UA 1GAJA 4YP0A 1POXA 4MV3A 3NBKA 3P2KA 2WYHA 1MG5A 3NANA 4B6SA 3DP7A 3G2HA 2FR8C 1FDVA 1V5FA 3MRVA 3PG5A 3SMVA 1KORA 3OY7A 4HDKA 4BN4A 4YACA 1NM5C 2NUTB 5F7XA 2RKBA 4ID9A 5LMUB 4DADA 1ZP6A 4EKYA 1KEVA 4W8GA 5KNCA 3OESA 4X7RA 3TNJA 1LVGA 1ZKMA 4O59O 1YS4A 2WVGA 1P8JA 2FGKA 4B73A 3E1KA 1DU4A 3VTAA 1X8KA 4QASA 5CFNA 5FX2A 2R60A 2HKIA 5FJJA 3ZX5A 4LZPA 2C8VA 3DC2A 3IVAA 1JEQB 1C9KA 1IJEA 4QDKA 4FOTA 2BBWA 2IYXA 1VJGA 2H17A 3FMIA 4DA6A 1AGYA 1G5HA 1OLXA 4F46A 1EK6A 3M3DA 2OM6A 3EW9A 2QRPA 2ZIEA 5TEVA 2GVNA 3C41J 3IVXA 4FTWA 3IJ5A 2HMYB 2E55A 1L5QA 1US8B 4BMCA 1PS9A 1GGNA 1FMFA 2IF0A 4BVLA 5D6OA 1RYEA 4KMOA 1SURA 4TLLB 4KSYA 3CT4A 4WBNB 4EVQA 2G06A 2HA2A 4HNHA 1CJTC 2NZYA 4BQOA 3WGVA 4X1YA 2A1TR 1TXGA 5I9MA 4N1AA 1CQIA 5TY0A 4OH1A 4LOHA 4WXMA 1GGEA 1SVKA 1ZK1A 2IXGA 3R9IA 2JBAA 2FG7C 2CFIA 4DDKA 3VVMA 3O3NB 4L8LA 4QPDA 5ICEA 5CNKA 1U1CA 2NUBA 2QVYX 1H2ZA 2VZ0A 3BA6A 5KX5B 4WI1A 3LHKA 2FLWA 1KJYA 2AVDA 2OK7A 4J1QA 3U3MA 3HUTA 1O08A 5D85A 3ZKWA 4DB2A 3HKBB 1YJBA 4FD3A 1RHKA 2CLKB 4RHCA 4TZKA 3GRKA 4J7XA 1DKLA 2FEWB 3EA4A 4IDHA 4LV6A 5FOXA 4KN5A 1Z2NX 1ODTC 4P1ZA 3PNPA 1JIUA 2W93A 2Q1YA 3KPUA 4YASA 1W19A 2ORYA 2H4WA 3CEHA 5ALGA 3ETDA 1IQUA 4ZWNA 1AO0A 3OM9A 4IMJB 3FSEA 4HEA1 4QUBA 3R9WA 1P80A 4PWYA 2QLFA 2QWXA 2ZBQA 4MKFA 1WF6A 4P6VF 1P4HA 1RJWA 1LBIA 3C85A 4ZHSA 2IHZA 2Y6UA 2B78A 2YY5A 4FKBA 1D9ZA 3AEZA 1PJSA 3HGQA 2WJ3A 3LCCA 3PT9A 8AT1A 5ES4B 4ZQCB 1I10A 2FP4A 1QB7A 3FNGA 4JJFA 3JAMA 3THYB 4HS4A 4K87A 1SIBE 4TWRA 1OXVA 4DSZA 1L8OA 4O4JA 1SXJB 3H42B 1KDRA 4LX0A 5F21A 5JNRA 1ETHA 5E2BA 1CDZA 4GXNA 3I72A 4LE0A 4BPRA 5DIFA 2ZU0C 2BSAA 1GQRA 3T4EA 2WG1A 4YIHA 4AIRA 2I65A 3JQGB 1NBOA 3P20A 4KWEA 3ZZTA 2GLTA 2YDYA 5FOVA 3UUGA 5AVSA 1OLOA 1X14A 2QTHA 3D8SA 3NS7A 3SOPA 4G81A 3WLTA 4UM9D 4L6CA 1AMUA 2J3JA 4E5DA 1U63A 1B1CA 1ZH8A 4BNHA 2WUGA 1C4XA 2DQSA 4KUHA 4NTZA 1C5KA 1QC5B 1CRZA 2XF2A 3RS9A 1YZFA 2AQKA 4PR0A 2CNWA 2QSZA 5JXWA 2VHCA 3MW8A 1YMUA 2W2PA 2RIRA 2R1TA 1A77A 3AOEA 3KWJA 4XJVA 1PS0A 3IHWA 2VZ8A 1SVWA 4KE9A 4P3YA 5TQVA 3LWDA 1V8ZA 3P0JA 1R0KA 1TM1E 2K7ZA 4ZN6A 2P6RA 1U2ZA 3QXGA 3AGQA 4N3CA 2ECFA 5BRNA 1Z37A 2BZGA 4KN6A 4NWIA 5CVDA 5P8WA 3E48A 4C2TA 1N32B 2ZITA 1Y8RB 3JQ9C 1GL3A 3NGMA 3NIDB 2CNKA 3QFCA 1SHUX 4MI1A 2VATA 3VSDA 1WSAA 4DUGA 5CG2A 5IRCD 4R31A 1BRTA 3GJ8A 5JAIA 3U56A 3FROA 3IPRA 3QUAA 1F6BA 1JI3A 1NDHA 2V96A 4IBOA 2Q50A 4FDAA 4QECA 4NBUA 5CLJA 1Y5NA 1JMKC 1KI6B 1USUA 3NW9A 2YOGA 1C3OA 2ZJ5A 2VDKB 4Y9TA 4I4IA 3RHTA 1R15A 4C0QC 3LPMA 1MB2A 5G1NA 1YRAA 1ZJWA 4E6EA 2AH5A 2BKUA 4ZVMA 3SKXA 3FOAA 1DE0A 4YGYA 4C4ZA 4FMCB 2HXGA 4HWKA 4AY6A 3L8DA 2VC2B 3BWCA 1OAKA 1YDEA 2H2HA 1QUEA 1T9KA 1Y1RA 4A0SA 1JYEA 1F8FA 1G2QA 2H1LA 3DT9A 3SNHA 1ADJA 4GX2A 1Y6RA 4CV1A 3FYUC 3L5OA 5L51A 2FPRA 2C82A 3QPUA 1NUTA 1I2CA 1NF8A 2VRCA 1LUAA 1DJNA 1K7CA 4TTRA 3WGKA 1OGIA 2NZVG 3AVOA 2NPOA 1ZUIA 3EZ2A 4HS9A 2V6JA 2VDOB 3NH6A 4BCCA 4IDQA 5BSFA 5LQJA 1WUIS 1KEUA 3KSUA 3U2QA 1U9IC 1FUEA 2WVAA 3VGJA 1EXVA 4RK1A 3TBKA 1LQ2A 4PE5B 5F1KA 3FI0A 1P3Y1 4KR9A 2P2GA 4I7EA 3WZLA 4F9EA 3G23A 5A03A 4NBSA 1BO6A 1LV8A 2QMHA 2VLBA 2LBPA 3K0BA 4L9WA 4URVR 3R44A 1TUIA 2IGTA 2X3FA 3DMYA 4F92B 5IJ0A 2ZJAA 2ZBVA 3FBWA 1UKZA 1Y0BA 2BEUB 1ONPA 2NW6A 3KYIB 3ZGLA 4GKKB 1M6YA 1F1BA 3OOEA 4PLVA 1NE7A 4O4JF 3KSMA 1VKZA 4ZCMA 5DXAA 4ZDIA 3EVNA 1BFDA 1DRKA 1ZCFA 4MWGA 5JBNA 4ARIA 5J2UB 3S27A 5IP5A 2ZE7A 1JHOA 3F71A 2F8LA 3RVBA 1SH7A 3BN3A 4HRAA 2A6PA 3DBRB 4HLCA 3S5JA 1IY0A 3JWJA 4MKXA 3OUUA 4FCVA 3RRXA 1MNQA 4AG3A 1NL3A 1FDOA 2GEKA 3KR1A 4S1WA 6LDHA 3DMTC 3ILXA 4LZWA 3VC3A 3T3NA 4MDYA 4I1RA 2VSFA 3V4LA 4BS9A 3EZ6A 4DMKA 2MR6A 2YW2A 4YAIA 1C2YA 4HYEA 4J29A 1A96A 2I03A 1H1DA 2PA0A 4YCCA 5HJEA 2HWXA 1E1RA 1D07A 2F9MA 3JQPA 1Z0UA 4F7WA 1OBHA 3PRKE 1LKZA 4HXYA 4H08A 4TUYF 1LBTA 3RBZA 5K8IA 3U4HA 3KDPA 3ONDA 5EXXA 1A8IA 1O94C 1R6DA 1UQRA 1WCV1 4W5TA 4EKDA 1YZHA 1BMTA 1U8XX 1H2FA 3ABZA 1QHIA 2Z9CA 2Q3DA 5JASA 1IRIA 1A9OA 2XTMA 1RKXA 4QWWA 2B1RA 2QAGA 1P4GA 3QW4B 5LP6A 1JAHA 2E49A 2HM7A 4L4XA 2BM9A 1NXVA 3EXHB 4LRXA 5K1ZA 1WCXA 1YI1A 2WHPA 2OORC 3EZLA 1NC1A 1V5WA 1FTQA 3MINB 1A8QA 4JYCA 2WU3A 1PK9A 4HT3B 1E6UA 1Y7IA 1KH2A 4UHCA 2NZ2A 5AKGA 5B1EA 4L8GA 5DWVA 1GNQA 2Q2NA 3DLIA 3UUWA 1XL0A 3VR2D 2CHFA 2XMZA 4MQ4A 2FPKA 4AZ3A 4RYLA 1FBTA 2Q7OE 3I6YA 4HC4A 4ZRDA 4H4DA 4R2MA 4YP6A 3ZGZA 3KBOA 5D1HA 4KSCA 9MHTA 3NDIA 2X8LA 1DAHA 1CUUA 2TRSB 1JL3A 3B89A 3FWZA 4GHWA 4OHKA 1K5HA 2W71A 4Z2YA 1KEKA 2JIRA 1ACLA 1Z2AA 2QP4A 3KTFA 4FYPA 4MR7A 4Z4GA 1K6XA 4F6LA 1X7DA 2HV9A 1VXOA 1QOPB 1U1DA 2FQWA 4P36A 5FD8A 2D62A 4U2EA 4B6FA 2GJKA 3EC2A 1OAOA 3SIPA 1PL6A 4B3FX 1T35A 3A2NA 5JYCA 3BT7A 2HMVA 2Z5FA 4CL2A 1UBJS 2WYOA 5CH3A 5KPJA 3VR4D 2F9LA 3LKZA 2PZMA 3QXHA 3WIUA 4DCGA 4WV3A 3SZOA 1THZA 3OQIA 1P33A 2OMEA 2WVHA 1HQCA 3DE6X 3NKLA 5G0TA 4CXMA 3GLVA 2Z0MA 4YV1A 1Q1QA 2F3RA 1JAIA 3QBDA 4G1MB 1M2HA 3OX1A 3O1IC 1J06A 1SZDA 1N5JA 3Q10A 3RANA 2SCUB 3OKFA 1OFUA 4NCXA 4MI6A 1QMPA 3SLKA 3CCCA 1NXTA 1MAWA 2QQ0A 1S7CA 3EGWA 3GUCA 5IMSA 4LF8B 2WTNA 2CLMB 1V2GA 1LPAB 3KQKA 4DANA 3TFOA 3D6FA 2NG1A 5C8XA 3U0BA 1TA4A 1KQGA 2HJWA 4P0PB 1KC1A 3NYWA 3ZZMA 4HR7A 4PTYA 4TV9A 1APBA 2IOHA 2R79A 4REQA 1JJFA 2B37A 2OD2A 3EDQA 1CK4A 1AVTA 2YCBA 2L18A 1ESEA 4U7HA 4F38A 1FYDA 1BE6A 4WXYB 4EM6A 1NP6A 3RRBA 3O94A 1KVSA 3RVNA 4DCMA 2O23A 3BMCB 3ITKA 4FFDA 4FZ3A 2R4TA 4OGKA 4WFIA 1SHKA 1Z2CA 1LC3A 2IYFA 2P8JA 3K0CC 3JD4A 1QR6A 3AXSA 5E1OA 8ATCA 5HRAA 4CMKA 2X15A 1YASA 1TZMA 3VTKA 3GQBA 4DIUA 2HUPA 1V4VA 3H8WA 3V5NA 3PDIB 4JJEA 4LUCA 3GFSA 1T1RA 3NM4A 2QLBA 4U2CA 3HWSA 4ZAZA 3LP6A 1MHTA 2ZSHA 3U81A 2GK3A 1ZLYA 1JU4A 2P67A 4ALMA 4KQFA 4C7XA 3T3OA 2H85A 1WY5A 2ACEA 5IABA 5DYGA 1S2GA 1TZKA 4FBGA 4FEGA 4GWLA 4RGQA 1RZVA 4QRHA 4C14A 5IJWA 2JPDA 3TZQA 3ADOA 3GLSA 1Z2PX 1Q0HA 5CB8A 4L16A 1RAEA 2VDMB 2GZMA 2IXAA 1P1BA 5AW0A 4RV4A 4V1CB 3I9V1 4BGDA 3H5TA 4RIGA 2QN8A 3GPLA 1EWKA 4ROSA 4BDSA 2NYAA 1UJMA 2OG2A 4BO8A 1BXRB 1WBJB 4R9RA 1D2RA 4F4FA 3UKOA 4NHOA 4AZ0A 2A9QA 3VSCA 4I5GA 3VUEA 3FPHA 1LY1A 2X5OA 4NATA 4OUDA 2OB1A 4JBXA 5FWXA 4H0NA 1SCQA 2W6OA 1WWKA 2B98A 4IXWA 4MRVA 1IHUA 2ZWAA 2BFCB 3D4NA 1NUHA 2JI6A 1RXUA 1XF1A 2FSHA 4Z3KA 5ARDA 3NKVA 3W5DA 2ZWOA 4ZAVA 1AJEA 1JMYA 2DHQA 3L8EA 3SJBA 2VHVA 2OQVA 3EODA 4PSVA 3HBLA 4XDHA 1RPTA 4U3JB 2XUHA 4G8CA 3HJAA 1JPNA 1OE0A 3UHOA 2DJ5A 4PX2A 3WB0A 4F6RA 1OQAA 3HJTA 1A88A 1H2XA 1HG1A 1LNZA 1U0BB 5ICFA 2HJSA 4OFZA 1JDSA 1DX6A 3W5AA 1WUKS 4IIJB 3RFFA 5DXFA 4EGSA 4S3MA 3CBQA 1FUKA 5DGIA 2PS0A 3PHGA 5DCUA 2J4DA 2ZG6A 2VAVA 3GAFA 3G0CA 4BO0A 1LNSA 1Y4AE 3CX3A 3PKZA 1GQYA 4WINA 2GF9A 3C4JA 2WUWE 5EZSA 3JWPA 3KE9A 3TBFA 3O4IA 4JBGA 1F4PA 2ZSJA 4JEHA 3H18A 2ODTX 4WX2B 3ULKA 5EHXA 5KHLB 1M7GA 1JYFA 1YRYE 4J90A 1Z5OA 1ZI9A 2C1ZA 2IKQA 2O2YA 4NE7A 3JSXA 1PCXA 1U2GA 3EE6A 3S2IA 3N8KA 4OA8A 3V80A 1NMSA 4CWAA 3BXGA 4UBIA 4EJFA 5BNFA 1E4YA 3E22B 2H0RA 1I80A 3L41A 4YMSA 4FDTA 3RK4A 4D4MA 2VDVE 2QTTA 2XXAA 3CZQA 3OSUA 2VWQA 2CJWB 4P32A 2DFNA 1FP1D 4RIEA 3ROKA 3EDOA 1R0LA 1RXYA 1UDCA 3HY6A 3UZUA 1PSDA 1XZAA 4GBMA 1EIWA 2BZ1A 4RD6A 3SC2B 2E4XA 1SEPA 2CFRA 1ISHA 2FFJA 1MFPA 1PL8A 3I6BA 3IAS1 3NXKA 4K46A 2V03A 4TWBA 4Q1AA 4PLCA 5IBRA 1AIPA 1EJ2A 1RQXA 3PPXA 2XCRB 2BDUA 1KRHA 1CUZA 1JJIA 4LY9A 2V7QD 3JRNA 4ZCSA 4CDRA 1FLNA 5IMBA 4EUKA 5BPFA 1T4GA 4FE4A 2Q3LA 1RHJA 4AXBA 2AUNA 1J24A 1HDGO 3OMXA 4S1OA 4D4LA 1GTZA 2R1ZA 2C0PA 3A0UA 1E5DA 3B2NA 4S1NA 4AG5A 5EJ5A 4HB0A 3K3PA 1XGKA 1HR0B 4AC9A 3GI1A 4N49A 1JXQA 1Z63A 2H1RA 4A5OA 4GC9A 1GKUB 1XFAA 2BBOA 3TW8B 3ZXIA 5AD1A 2ZZMA 4G5HA 1EG2A 3W2FA 3DEKA 4U39A 4GL2A 1E1CA 1GOTA 4H1TA 1ZK2A 3DOHA 4MWZA 1SIUA 4R3NA 4D7AA 3U7QA 1IE3A 2FPPA 1MO2A 2X4IA 3AEKA 3OOWA 5DH9A 1IN1A 1Y7LA 5KSOA 1QHHA 3DMHA 2OXEA 2PD3A 1FNMA 3CISA 4X1KA 3SHFA 1M1ZA 3HR7A 3RNOA 3ENZA 5JRZA 2H63A 4L1KA 4BMXA 2AXEA 3R6DA 3DHEA 4X97A 4A8JA 3WDKA 4P3NA 4Z1MD 2Q1SA 3UF0A 1KQ3A 3NIGB 2MYNA 4IGFA 2XUZA 1E92A 2NO7A 5AIBA 2HK8A 1HKHA 4E1AA 4MGEA 2DT5A 3QH4A 5IK2D 4P58A 1FZTA 1ZK0A 4M1ZA 2OPBA 4CEJB 1QQ7A 3DQZA 3C1TA 5ALQA 5FLKA 4K1XA 1IDOA 2DPLA 3WLIA 5SY4A 1A7AA 1AQLA 2PSHA 3IOMA 5HDQA 3KDAA 1ICEA 3QU2A 4HGOA 1ZC4A 3RC1A 2IOYA 4CZ2A 2FXIA 3ZBQA 1YE5A 1WE2A 1KAOA 1IHPA 2B6HA 4H6WA 1QV9A 3VR2A 4C0BA 3OOYA 1Q19A 3PU6A 2FQYA 1WVGA 4AB1A 5C53B 3U7FB 4LDRA 1K9SA 2DQYA 3I04A 4KIFA 3WWZA 5LOVA 4X65B 1WB9A 3O9ZA 4IG9A 4DCPA 5I4BA 1JHMA 3ZDAA 1QJ4A 3U26A 1ENOA 1U1EA 1UEIA 2WKWA 3JVEA 5FBWB 2CFOA 5IF3A 5L8VA 2NZXA 1BWQA 2VPIA 4JI3B 4JT8A 1FNSA 1UAYA 2Z3VA 2Z5LA 4LC0A 4Q39A 5FBHA 3ZY5A 5COBA 4PLFA 3FDIA 4TXMA 2JHAA 3HSKA 1YFZA 2F8MA 4B6PA 1JPVA 4U6SA 5FCDA 1C50A 3UICA 1N2SA 1ZUWA 3QGMA 1M10A 4LVOA 3OLXA 4CQLA 4S12A 3HDHA 5KCMA 4J7UA 3STTA 3H5NA 3NV9A 4QE3A 3VR4A 5THQA 3WDMA 1KWGA 1L4BA 1XU9A 3L7MA 4OBBA 5DHAA 1RC8A 3O03A 1C8KA 1ODLA 2XCIA 1ZBQA 3OT1A 2OBNA 2RJOA 4QD3A 4Y9RA 4M46A 1KFKB 2DKNA 3W5IA 3KKOA 1ZJJA 2B3TA 2I2XB 3UK1A 2Z1DA 1NP7A 1Y9AA 4O2AA 1VL1A 1EFKA 1V96A 4JVNA 4YWHA 2KSQA 4Q7MB 4YN3A 1UBTS 3IULA 4CGYA 2ZUEA 3U80A 1EVJA 1Z4IA 2TYSB 2A5LA 4TS3A 3ZZUA 1TEVA 2G6BA 3N2KA 1HL3A 4HVLA 2QDXA 3RU2A 4LBWA 2VNIA 4BGEA 3JRXA 1RXCA 3J81k 1IY1A 1OXUA 2HWYA 4ARZB 3E4CA 1FFHA 2XLCA 4HGRA 4B45A 4INJA 5AHRA 2FUKA 3IAHA 3DVQX 4JHLA 4UHEA 3CLVA 3FZEA 3SZRA 2GUWA 3GFFA 5BQFA 1WHTA 4X0EA 2QN9A 4JLOA 2R6HA 4MGKR 2F2TA 3AY7A 3QJGA 2EV9A 1KK2A 4KBFA 1WABA 1YSCA 4P84A 5LNK1 1MC1A 3OBIA 3UANA 2REXB 5FI1B 4Q9NA 1SGWA 1YKFA 5H5JA 4R05A 4S05A 3UUFA 9LDTA 2X8JB 1Y1PA 3TSAA 2B4RO 2OEPA 2PBZA 1PF7E 1PW5A 2XYVA 3LKBA 3FRIA 2CXNA 3LUBA 4KQCA 4LK3A 4W8OA 1L4GA 5EUQB 3AG6A 4EA9A 5BURA 2AEFA 1IIRA 1I24A 2OVFA 2JVIA 2ZROA 3SXUA 5IJ9A 3DE5X 2YQ4A 5IN4A 5DNCA 4RTRA 1X1RA 1XVUA 2B7LA 4D46A 3OCUA 3RJTA 2HWWA 4G1EB 1L5GB 5A4KA 1CY0A 2ZJYA 3BWVA 1P17A 3GD5A 2ZCJA 1GSIA 2K7FA 3Q72A 3GMTA 2C9ZA 1J20A 1KU0A 2WW8A 1GNVA 3IVCA 3QLEA 5DASA 4KYIB 2X0IA 4GPTA 3G88A 3RG2A 1L7XA 1BS1A 1V11A 5KTMA 3IHLA 4CV3A 2WNHA 2VHUA 1SO8A 4KNVA 1N5RA 1QV6A 5CDFA 3JYOA 3BS4A 4YPOA 1U7TA 5ETJA 1MF7A 1T10A 2WWWA 2H3EA 2FUNB 2Q1TA 4J6FA 3SBXA 1R74A 1P0MA 2K5UA 2I71A 2DTEA 2R87A 4FFRA 2X4DA 1TM5E 1KYIA 1UPCA 2QL9A 4JYBA 5JDCA 4R8RA 1TKAA 2PCLA 1PO7A 3QQPA 1EJ0A 2DUWA 2H48A 1TECE 2IBMA 2H1VA 4Q9IA 3VHXB 5CGQB 4BBPA 3D5EA 3DFUA 5HG0A 1CHNA 3PNKA 1QIKA 3HZRA 3TLXA 5C52B 4I55A 2EDAA 3M34A 1T6XA 4XLLA 4MVJG 4CQJA 2GRJA 3PD0A 3PA8A 1GQOA 4WL0A 3WWOA 3I23A 5DFAA 5C4GB 1XZQA 1UPBA 3CF4A 4AN0A 2G67A 2P30A 4RAOA 5M34A 1OWNA 5JNVA 4R0MA 1Z5UA 5HUJA 2JD0A 3B36A 1TO2E 4NV3A 5HF6A 5I9BA 1JLKA 1RVDA 1GHTA 1VPTA 1WV1A 3GG9A 4KFSA 2ZSEA 4N48A 4WUVA 2PUFA 4I1YA 4LOLA 2UXCB 1DXYA 4OQDA 5FUQA 2XI4A 2XTNA 1KDPA 4U0JA 5T67A 421PA 1U7WA 3MA0A 4Y2XA 3ZHYA 2QBYB 4I6EA 3NYQA 1JBEA 1TJYA 1K89A 2TMYA 3CUYA 1V7CA 4M9ZA 1LQUA 2IPOA 3OT5A 3PLRA 2P35A 2A5FA 4L0MA 1UXKA 5DNEA 3O83A 1Y3BE 2Q21A 2QM3A 2R44A 1DJPA 5IXJA 1ZSNA 1ENYA 1AA9A 4REMA 1CQJB 2VWPA 4RVSA 2QVZX 2A78A 5KYUB 3H2HA 4KQWA 3KALA 3T7SA 1SXGA 3Q9LA 4J0EA 1WDWB 1SKBA 3V8RA 2JATA 3H4MA 2I3GA 4QQNA 2IYRA 4LJYA 1E2PA 4WNIA 3FVQA 5DJ5A 1P4RA 4Q16A 3WMFA 4CEIB 2P3QA 3EVEA 4ZVRA 1E3DA 5BQ3A 2Z1MA 3Q6NA 4W9MC 4JXXA 4AKHA 4JH0A 1TAQA 5DK6A 5E6SA 2O4CA 3LX4A 3B6KA 4LHEA 1CBUA 4COKA 4ZCRA 3NHUA 5A7GA 4NY1A 5KPDA 3GNSA 3HCRA 1HT3A 3U4CA 3RSGA 4BX0A 2V7QA 4I14A 1MEEA 4G37A 3PV0A 2BFFB 5JBIA 4ZEVA 2GXQA 1QU3A 2PO7A 3N59A 4C43A 2WPDD 3FETA 2JC3A 3MWEB 4HLNA 1GGKA 3VNAA 3CC8A 1C9NA 1N2CA 2ZYWX 3DOCA 2HN9A 4JA2A 5H3HA 3GLGA 2HB6A 4QICA 1RS0A 1TC2A 3VNQA 1VA5A 1E89A 2XUJA 1Q0UA 3QYPA 5E9AA 1W36B 4CQNA 3CLUC 1R1DA 2CJYA 1V1MB 1KSHA 1YQEA 1YR3A 5LXTF 3DDOA 3RSHA 1C7FA 1ULUA 1DCFA 2EQAA 4ZGBA 4B4WA 4J0JA 4NDNE 2DLCX 3RC2A 2AMYA 4QLAA 3K9WA 4YHBA 4DL9A 1VHTA 5CFZA 3PGXA 4KX5A 3FMGA 4EKEA 2FYTA 4AKIA 3OPYI 3N74A 3OPYA 4G56A 4P82A 3RRZA 3EPHA 1RWBA 1Y3IA 1N7GA 3GJRA 4E94A 2D5AA 3ABSB 4O1IA 5D2CA 5IDWA 5AJXA 4Q6WA 1H85A 2YFQA 1P2FA 2PV0A 1CZKA 2VRNA 1QF9A 3OIFA 4IDOA 5BN4A 1G7TA 1M0WA 2GTHA 3W6OA 1GNSA 4Z1MA 3EWNA 2BSXA 1VE6A 3HBMA 3HSSA 2GA9A 3OJXA 4NFSA 1J9ZA 3P9RA 4JJIA 1X86B 2PT5A 1J25A 3HB5X 1SCKA 3IBFA 4YK7A 3IKLA 1P1CA 2P2YA 3OHSX 5IK2A 2QE6A 5L4LA 2G1AA 5IUNC 1RKUA 2VHEA 2I4RA 3P0IA 1M34E 4CKWA 3OE7D 1EX6A 1S8AA 1TJPB 2Z2XA 1FFXB 4GW3A 5CXUA 3GVIA 2AJLI 1NLZA 3AWIA 3AEQB 5F1PA 3BORA 3FYTA 3IIEA 3IKJA 4Z7OB 4HNQA 4IQ0A 3ZD7A 1BVYF 2CBXA 2FG5A 3DNMA 4N7BA 1ODIA 4R1PA 3HB1A 4DBVO 4EGAA 3LQRA 1DJOA 1YBFA 5G1PA 3OWOA 1ZRMA 3JW8A 3MJVA 1TKRA 2BTQA 2P6OA 4A36A 4MCJA 3E82A 1BGVA 5HHTA 1MEOA 4B71A 2A9RA 2IHTA 3ZS8A 4CIXA 4ODIA 3DGEC 5ALIA 2W8BA 3NBUA 1M5UA 3LQKA 3VZPA 1QTIA 4IY1A 4L3WA 1JVNA 1XXHE 4DYHA 4RTLA 2AEJA 3L1JA 4JDUA 4OP1A 1AA6A 3KTAA 1VPVA 1B2RA 3TD6A 1O58A 5AI9A 1C81A 5T6BA 4CNQA 1N2GA 1I2BA 1RAAA 3NNSA 1KO4A 1IOWA 1QBGA 4JXJA 2JIDA 3ZLTA 3LE8A 5DTRA 2CBGA 4AY3A 3HTXA 4HLQB 4EW6A 2P2CA 3KYDB 3HP1A 1SELA 3JY6A 1YBVA 1BVRA 2FRDC 3CF6R 4EK9A 4IFTA 4PVDA 5FWNA 3FFWA 5K8UA 4F85A 4GFDA 3K6KA 4QBIA 1O57A 1EUDA 2GJ8A 1IZ0A 2C96A 3PJFA 2I4NA 1XTZA 1RJGA 1TYAE 2D3WA 3JX9A 1AD2A 4RQAA 4ZC1A 4MUBA 3VZQA 5KWJA 3K9HA 3AY0A 1KTVA 3T5PA 5E4FA 1GAEO 1PJTA 3TM5A 3VOTA 1QPGA 2O1WA 1XA4A 4LKOA 4MUJA 1Z75A 3LIPA 2QRJA 3DXYA 1IEWA 1BKSB 5F5LA 1JSZA 2VG8A 4OJTA 3WIBA 4ENUA 2ZDGA 1QB8A 1SG9A 3TTXA 4CT5A 5BY2A 2XOEA 1MA0A 2O6HA 1WNFA 4NZMA 4UHFA 1HM5A 4Y67A 2CN1A 3UWMA 3UXEA 4BQIA 1SQ0A 1M1YB 2ZYAA 3E18A 4IJKA 1YGPA 3TH5A 5LWQA 2QRMA 3N76A 3GPDG 1RWVA 3A28A 1RKQA 4R2JA 1GEEA 4LWZA 4J91A 4NMMA 5FFNA 2OXTA 3TDNA 1YD7A 3TIFA 2KPOA 2JGEA 3CPJB 3MWKA 3NU1A 4AG6A 4AJKA 4Y2JA 3MT9A 4F5WA 2PTGA 2QGFA 3AM5A 2CUZA 3HKEB 2XH8A 2JKYA 2LKCA 3IAFA 2R68A 4GO1A 3AR7A 1JDPA 2HPZA 2I2AA 2DPXA 4R9SA 2TECE 3MTGA 3QKIA 1GG5A 3SP1A 3R77A 4B87A 1AKEA 3A1CA 3SPXA 3P9PA 4NPCA 5GWXA 1LWNA 4QYWA 3TK1A 2VF5X 2C3PA 2HCTA 4YLEA 5KQRA 1JHRA 3BM5A 1W88A 1Z4PX 2DBYA 2PRSA 3RAJA 3IVGA 4IV5A 5JPCA 2PFGA 4ZD6A 3AB3A 3A1WA 2ZGVA 2GJ4A 4E3ZA 3PEWA 3SIRA 3M6XA 3LYLA 1PQWA 2GN6A 2V5VA 4XE5A 5I7UA 3AEYA 1VIDA 4TPKA 4ESOA 4AJIA 1H65A 4QUHA 1II8A 2EVWX 1PFVA 3WNVA 1VFPA 3OJFA 5DRYA 4Q01A 1N5MA 2Q2QA 3RIGA 4FEEA 2GCOA 3Q2OA 1KAHA 2FEAA 4HFJA 4LSWA 4TROA 1RR6A 1Q1GA 2RGNC 5CJPA 4TS4A 1QFJA 3LW7A 4FYWA 2HA6A 3L46A 1T8WA 1W2GA 1XTKA 3STVA 2WMYA 3VAZA 3ZQ6A 1X8JA 2C95A 3ABRB 1FTGA 1MPXA 4ESHA 1CUSA 4F5EA 1PWXA 1P4JA 3WRXC 4V3BA 1WD5A 1FW6A 4D3FA 3GJYA 1JHQA 2F62A 3U4AA 1WMEA 4B84A 1JFSA 1YT5A 5K3OA 1Q12A 1YNOA 2YQ5A 1SXJC 4HQRA 5FBZA 3DP9A 3A9VA 2BE9A 3FPGA 4TMWA 2WU0A 4KGZA 4L0QA 4DIMA 1II0A 3QSYA 1GU1A 1QIMA 4O25A 5EJIA 4RK5A 2OHHA 5L3QB 1E2GA 2YKGA 4CCYA 4Z4HA 2IHBA 1XF9A 4ZQBA 3MYYA 5F2OA 5JXGA 1WA5A 1R0WA 2VHWA 3I45A 4E4TA 3UT5A 1A71A 1KMIY 2V5UA 3I34X 4ICIA 1JFFA 4K5QA 4L3OA 5EZQA 2HK7A 3RRNA 4E0BA 5I7AA 4D43A 1KDTA 1U8EA 1YR2A 3SJCA 1I0IA 1IZ7A 3R7BA 2IY9A 2RHGB 5IKPA 1J2UA 3NHWA 1OH6A 2C2OA 5IBCA 2BC9A 3WB1A 1U3WA 2W4MA 3A4LA 3LK6A 4FMDB 4HP8A 5ICSA 4IDPA 2XKAA 3KWFA 3OTWA 4FX2A 1HSZA 5DHQA 3BL5A 3ZLUA 4QGBA 2PMWB 1RYDA 1NN5A 2J0UB 4CQMD 4JNKA 3PUHA 3HI4A 3D7KA 1XN4A 2GM3A 2QW8A 4WJLA 4ZO9A 1NUSA 3M5PA 4LF6B 4QULA 1O8CA 2I1WA 1H93A 1UXGA 3D4OA 1G59A 1NG1A 4YP1A 1P1JA 3BEDA 2A14A 3WRVA 4O6VA 5AW2A 5F3DA 4FS3A 4GICA 3KZVA 4OYYA 4M98A 4GYYA 3DO6A 5JPDA 1I2AA 3N53A 5ALRA 2GS9A 1VG1A 3GLHA 1SAYA 4Z0NA 1TT5A 2B2CA 3ZQUA 2RIPA 4GIBA 1ZFNA 2BHRA 3V8PA 2BFNA 2UVDA 3B6IA 3B7GA 3WVNA 5BUZA 1YQWA 4LXHA 2HDHA 1H1LB 1J90A 2EFDB 4FCTA 2VUTA 4G84A 3GLRA 4QOFA 2IA5A 3F3SA 1JPUA 4XTCS 4DLSA 4EYQA 2YXEA 1N8SA 3HGTA 1Y1LA 1HO3A 4G4SO 2WPDA 5SYAA 3ICVA 4Y1EA 2BFBA 3HQ4O 1WKBA 1L4KA 3P1JA 1J56A 1E9SA 1O9GA 3VXKA 4EJSB 4YAKA 3CWQA 1L8QA 2WDZA 5B55A 6REQA 3QPVA 3SF8B 1YZGA 1DPFA 1TK3A 2W6NA 2P69A 4B3TB 4JUAA 1UZNA 1UBUS 3UK2A 1LF5A 4TKVA 1S9DA 2N75A 3FMFA 2PJRA 3HCBA 4NZPA 4OHFA 2JAUA 2UZAA 3KJEA 4J16C 5ALPA 1HMPA 1FVFA 5DWQA 4ZT2A 5DGHA 2OBLA 1YS1X 3LUHA 2JK0A 2XYHA 3C7TA 3W5SA 2QROA 4KITB 2OYSA 3I53A 3DEIA 1MLDA 3PPIA 4DTCA 1AK2A 3IAEA 5F9MA 3SDBA 2QX9A 6ADHA 2IYEA 2WJAA 3NNNA 4AF6A 1ORIA 1QLHA 2A86A 5AJYA 3KSRA 4FUTA 4QYMA 5EGNA 4E1BA 3LDGA 4OMCA 1EE1A 3WQQA 4W7HA 5JAHA 1Z7BA 5L7WA 3HP4A 4W1QA 2CLLB 3C6ZA 4IF6A 2X1HA 3GQVA 1WQ1R 4JS0A 5DGXA 1JDZA 5JROA 3ZBTA 4ZYTA 1WZ2A 4IGKA 1R4NA 4ITVA 3A3PA 1ORDA 4ZOCA 4DCNA 5HCIA 4QLBA 3U6KA 2ZZKA 2YJ5A 5HCUA 2MJLA 4R83A 3PVSA 3OE7A 4D9HA 5DN6D 2BEVB 5D5HA 4WN9B 1XRMA 3CFYA 3PHIA 1ATZA 2ZJ4A 2R8XA 3HR4A 3S0JA 1BDHA 1AUQA 3IAM1 1KZ7B 3RYIA 3W9SA 3KNZA 4BQEA 2GLUA 2OZEA 4FB5A 3H83A 1E2JA 5HMLA 1Q0SA 1ZX1A 1QP8A 3BFPA 3C4VA 3A4NA 3BAZA 4LVUA 1ZGAA 4NESA 3URMA 3TL6A 1MVLA 3KSDO 1E7RA 2ZRBA 3EZGA 4LBYA 4NL4H 5F2EA 3TQTA 6PFKA 5B64A 3P19A 4Q4AB 1O96A 4PZPA 4ZAYA 3V3KA 5CFLA 1TF5A 1DTEA 2AKYA 1Y6QA 4HFRA 4XGIA 2IEDA 4DWWA 4NULA 4H1WA 1TZ2A 3NAZA 4D3XA 4P81A 3TOZA 1T3TA 2D59A 3LDUA 1EX7A 3NEJA 3T7RA 1I7DA 3QE3A 1FQKA 2A2ZA 1NFQA 1UOPA 4BKUA 2JHFA 1AGPA 3LLSA 3O82A 5INTA 1G5PA 3AR6A 3C3AA 2G25A 3LQ2A 4A91A 3BREA 1NYRA 1SCNE 2AVNA 3K9FC 3GLFB 5ESRA 4MK4A 5CYGA 1G8HA 5GM2A 2XDAA 3I6QA 2XE4A 3VR6H 2G88A 1R64A 4OJKA 4ZEMA 5BWMA 1ZRHA 4A8TA 2CXUA 1NIPA 2VQEB 1G8GA 5CYPA 4NS4A 4BLRA 1G5RA 4RDHA 2PKQP 2W2XA 3AUAA 2W6MA 4X63A 4AURA 5JWOA 4H1HA 4LFBB 2BJHA 1G3UA 3CZ9A 4J3FA 5ECWA 1E18A 1L1EA 3DNFA 3MERA 4OBWA 2QYTA 3OZSA 1TAUA 1SBCA 1R9JA 1QRTA 5F9FA 1QNFA 2DG2A 4MKZA 4EMSA 1H0KA 2ZETA 2JLZA 1X39A 2ZUFA 1MQSA 3S1AA 5IEJA 3AETA 3G9QA 3L9WA 2EL7A 5GP1A 3EGEA 1Z12A 3UGTA 1UDRA 4Q4HB 3QNMA 4B3CA 1IK4A 1J0XO 4OP3A 4D45A 3EVAA 1YDFA 2ZJ8A 4QYTA 5BV2P 4KGXA 3OJWA 1WZCA 5FWAA 5AM1A 4ABYA 2WFLB 2BW0A 1YVUA 3HMKA 4K03A 4G1BA 1D0VA 3K09A 4ETMA 2CE7A 4MHTA 4IZOA 5EP4A 4E2ZA 3CLSD 4PVCA 1QLJA 1VRWA 4Q47A 5HZKA 3EC7A 4F9TA 1YZYA 1GUAA 1EG7A 2Q8QA 2HBQA 3FLEA 3QEJA 4HH0A 3LI2A 1LPMA 4ON9A 3H13A 5DK4A 3W9UA 1X7XA 3EARA 4BQQA 4C5CA 4A2PA 3UJ7A 3VYWA 1T5SA 1LD3A 4PYLA 4YRDA 4BATA 4EABA 4BE9A 1H5QA 3I3SR 2JLVA 4LXGA 3OZIA 3TMAA 3TW6A 1Z4JA 3U16A 4X45A 1H4TA 3FJYA 4MB0A 3P5BA 1M2OB 3P45A 4OTZA 4YXFA 1C9EA 5JXJA 4ARCA 4KODA 4QYIB 1KZ9A 1XMVA 1Y8CA 2QR5A 1E6KA 2QRLA 2TSYB 2BGKA 3G89A 5HQJA 1YI0A 2C31A 3WA7A 2JFWA 4KXYA 1DO8A 1KY4A 2W2MA 4RZHA 5LKRA 4EPYA 5F9HA 1NHWA 2XZPA 3BD8A 4TQ9A 4TTVA 1Z26A 1Z22A 1WUHS 4DR6B 3OPMA 1ZQ1A 3KOYA 1NVEA 1P7ZA 1N57A 1DLJA 1TA9A 1TYCA 2B4AA 3EG9A 3MWJA 4YUXA 5JSZB 1U7UA 4HMPA 3ZD9A 1NHGA 2YYSA 2X76A 4H1VA 4G85A 1CIJA 2XDYA 1QYCA 1ZDMA 4QRDA 3A70A 1XEAA 3CLKA 4LYYA 1ISIA 4XPIA 3RV3A 4B48A 1XCLA 1TT7A 3CU5A 5AW5A 2JG3A 3CBGA 3HVHA 5BSWA 5AVUA 3DO8A 3DTVD 4H15A 3RB8A 5YASA 5HE8A 4LSMA 1X74A 4BKMA 3MCAA 1DMSA 4OKNA 1GADO 4IVPA 1TJ3A 2R6GA 1HETA 2E82A 5IM4F 2Y1LA 4Z9XA 3GFPA 3GOQA 1IVSA 4IQ4A 1QORA 2OCBA 2WEKA 4Y0AA 4P0QB 5JI2E 1WO8A 1NXPA 4D4IA 2QB5A 2FZ4A 2OUIA 2Z4TA 4PLHA 3AO0B 5JTUA 5F77A 3U7JA 2BGLA 2JAXA 1D09A 3CSDA 3UJBA 5AUNB 4R54A 4NJMA 1GZ4A 3VV2A 2AJ8A 2E4YA 4KK3A 1OR8A 3PFCA 1C7QA 5JC1A 1LPNA 1PDOA 4R8VA 5L95A 4JLWA 3WYCA 4YBZA 1CYDA 1E1MA 3UG7A 2EFGA 5I8WA 3JALA 1SHJA 3HXLA 3QELB 4JVMA 5EIBC 1V16B 5L3RA 2I6FA 2PKEA 3K5HA 2C2ZA 3J7AC 4GLOA 4YT4A 5M5BA 3SI7A 2I55A 3TGWA 3V2GA 3HPQA 4US2R 2ZAMA 4GVPA 2BM0A 4QDOA 5EHNA 3WXBA 3NBFA 4J03A 1K68A 2ZBRA 3R7SA 1MAHA 1T26A 1J07A 4DNQA 2E89A 3IE0A 4RHFA 4XR4A 1UKYA 3QWIA 1XCGB 1SC9A 4ZEXA 3QF4B 3MTIA 2O5RA 3T3PB 3QVLA 4L7VA 1Q95A 4M22A 3IE2A 1NX9A 1T8PA 4G89A 1LBHA 3ZU2A 3BB3A 2WVJA 4O63O 3FFXA 1IG0A 1Z4KA 1BX0A 3FPFA 3K9QO 3KEOA 3LVFO 4IUCS 1P2VA 1WOMA 4X9XA 1GL6A 1ZO8A 4WZAB 1FP6A 3SR0A 4XYLA 3BKXA 3QMPA 4N40A 5B3JA 1T2NA 1GKKA 2VPQA 3TRFA 5DW0A 1FYVA 1MABB 4A26A 1KPHA 4NONA 1NT4A 1WHSB 3GD7A 4K9DA 4N76A 4I5DA 1JSLA 2PGJA 3LA6A 4BNKA 1EWRA 3B52X 3KJIA 3TRJA 5H9WA 1YRQA 2QPTA 2JH3A 1F9EA 1EFTA 1G9XA 2PSDA 2GR9A 3CRQA 3QLJA 5BNTA 3G5UA 3LX8A 1EAMA 2OE2A 1K7FB 1DPGA 1KY3A 1GG2A 1I6MA 2HHAA 3NOVA 3R6TA 4IJUA 4Y7DA 2XUDA 3OLQA 3BXXA 2WHYA 4ISBA 5AVYA 1ZOSA 4AZTA 2VT7A 3U39A 2QQEA 4HMOA 4EGJA 1HTWA 4CKXA 1XZNA 4UDYX 3JD1A 3RUIA 4XWWA 3UFXA 2FI1A 2RMKA 3GLKA 4ALIA 1CG6A 4HZUB 4BBJA 2BMVA 1L5WA 2FUG1 3PYXA 2QJWA 2XWSA 2UXDB 3G8AA 3W3ZB 4Z8YA 4EELA 1D4FA 5EC8A 4EG7A 5KOJA 1YOVA 3RVSA 3KELA 3NOXA 3PUJA 1HSOA 3GA0A 5EKSA 1XZLA 4C3VA 3P26A 3LGAA 4N0QA 3H1FA 2GA8A 4O3FA 1LBSA 5EPEA 4F5YA 4C4PA 2I8LA 2QD2A 3VJRA 3FTNA 4HF7A 4KDFA 4KVZA 2BT4A 4GUAA 5EMMA 1MIOA 2YCLA 3R0QA 1UBMS 3FCCA 4ZVOA 3VKFA 3QM1A 2RHCA 1YTLA 1PNRA 4BVJA 1EVEA 3VU9B 3OKPA 1VECA 1U2PA 4BRSA 4HPJB 4G97A 5GGYA 1GSOA 4B34A 3N7TA 4PRLA 4JUDX 3BWDD 2ZR9A 3UMVA 1M2VA 4F6CA 5C7LO 3FR7A 4AJJA 2BDEA 3JR3A 2ZR7A 5BSKA 2NOAA 5DN6A 2ZJOA 3KT8A 3RBXA 4M36A 1ZW1A 1BS9A 3QVGB 3LXRA 1WX1A 2YZ2A 2OCAA 3OHPA 5FPTA 3HXKA 3KQNA 4PEVA 4CMEA 1SFRA 3CUTA 4F2WA 3HCEA 2QXTA 1C0KA 1NBEA 5JWRA 3H97A 4NBRA 5DU2A 2DECA 3L6CA 2ZKIA 1FRVA 1W7AA 3A1VA 2RGRA 2LUOA 3ISTA 1OLSB 2ORIA 2X0KA 4GZ3A 4BASA 3AB7A 2QSYA 3CE9A 1O03A 4WE3A 4MVJI 5DYWA 4AVYA 3AIMA 4DWJA 3RCBA 4ZK6A 5C5EA 3NYRA 4RA9B 1Q22A 2BIFA 2H06A 2WV7A 2I4TA 1KS9A 4X71A 4DIDA 4KR0A 3D02A 5FNVB 1KK0A 4MJLA 2VSQA 4JQZA 2GBFA 4KEAA 4LIPD 4M0CA 4JDPA 1CY4A 1DEHA 1KAGA 1ZGBA 2WIFA 2YTZA 4XPZA 5DISB 3A9CA 3K8OE 3PI7A 1JSRA 4N5HX 4H6VA 2A9FA 4OU4A 3C3EA 2C99A 4GP7A 4OFBA 4BLOA 5AM4A 5B30A 2W8ZA 3NZEA 3B8EA 1MB3A 3QKRA 1U1GA 4GDMA 4QPJC 3IP9A 4KQ6A 1YJCA 1T5TA 4L8VA 4EPTA 1FEZA 4OX9Y 2ZSKA 4BRUA 4QJ3A 3TQSA 4XYBA 1FDSA 3D0KA 3R8XA 3HN2A 4MP6A 3NORA 3A10A 3ZGOA 2F1HA 3V8BA 4C2UA 1FFSA 1G8AA 1BZYA 1WZNA 3FDZA 4GSYA 5TC4A 3C7CB 3TPZA 1MAVA 3DBIA 4U9UA 3DO5A 1N2JA 3V42A 1Q6YA 3UGKA 1IQ0A 1CUCA 2CL6X 2B69A 2PMBA 4L08A 4LYAA 2W4IA 3OQJA 4GPBA 1GG8A 4YT2A 3ZU6A 2HV8A 4D81A 1Y98A 3RFCA 1EQUA 1KFEB 4DLYA 1OXXK 2XB9A 3HVJA 1DXQA 1LLQA 2PWAA 4PSDA 3WBFA 5I48A 4RTMA 4MVWA 2Z8XA 3AKEA 4D8TA 1CB0A 1VZ3A 3GLIA 1WV0A 3DEAA 4LPKA 4QDXA 1SD1A 1JB1A 4TTQA 5BVHB 1AQNA 3Q1LA 4WESB 1PR1A 1M5RA 5G0SA 2A33A 3K0FA 4XM0A 5DM2A 3OJCA 2D6FA 2VTEA 2CZQA 4R2XA 2ZQZA 1A82A 4HXGA 4KDEA 1XPUA 1A4IA 2EFJA 2IELA 3AF5A 1W48A 4NCNA 3S2SA 1JJVA 4OHMA 4J2OA 3F73A 2P5UA 2ZI3A 3K15A 4IPTA 1COWA 1F8YA 1QFXA 2XB8A 4P4SA 3UHAA 2I3AA 3NHYA 2WICA 4A92A 3B2QA 4CM7A 3DLBA 2J33A 4OXXA 4XJTA 2V3WA 1NN1A 1S8FA 2CB9A 2G63A 4N5DA 4RFLA 3DCNA 2Z1NA 4CF5A 2I99A 3IT2A 4DJDC 2C9DA 3TJRA 3U1BA 5EAIA 1R50A 3ZZNA 1F3OA 3I30X 5FA8A 4OB6A 2A5GA 2QP9X 3AESA 3ITNA 1KOLA 3A1UA 5AW9A 2QGZA 2CW5A 4IDDA 5JRJA 3C3DA 4R81A 1EHCA 1CRWG 1KBOA 4N3BA 2ZUTA 5KYYB 2VK1A 2W2QA 4TVBA 4URHA 2RHBA 2JJ1D 3O9VA 3QMMA 5JXIA 3B12A 1IN8A 1EWTA 3LBYA 3REOA 5TV2A 4FZRA 4DR5B 3C3XA 4KTVE 5CW2A 3TOXA 1HPLA 1WKVA 3PC2A 1CF2O 1OFHA 3LLUA 5AJUA 5H9VA 3ECCA 4TLCA 4D5EA 1VP9A 1SXPA 2PUBA 4YCSA 1U7PA 4QFDA 3EX7C 1G3QA 3K4HA 2C5BA 2ZI5A 4J0KA 4LXQA 1RBYA 2XBLA 3DTVA 2ZREA 4I4CA 3UKDA 2ZR0A 2YYZA 1LS1A 2V7GA 4PN3A 2WUEA 4LX8A 2KM1A 5DGCA 3OQHA 2P77A 2RKOA 4JKYA 4E2FA 2ETVA 2NMVA 2VOJA 1NVUQ 4NU0A 3DJYA 4PM4A 1ZR2A 4Q4CA 5CB6A 2PLAA 3D0OA 1EFCA 2WUDA 3QWHA 1IM2A 1CXZA 3MUFA 3K4PA 4LDZA 4PCAA 5JD5A 3ZD6A 3VZCA 1KJIA 1H9AA 4U2BA 3ZWWA 4MMYB 1HYHA 1AF7A 4NJEB 3RUPA 3K6SB 4HQ6A 2XQJA 2YWHA 3HKCB 4FGSA 1RM5A 2PYZA 4K26A 3GFQA 3X1YA 1U3DA 3UK0A 4JUFA 5K0JA 1OH7A 1NU8A 4NV1A 3FWPA 5BYJA 5K8JB 4EHJA 4AY5A 4DNXA 5E4TA 1Y9ZA 3SZGA 1CE8B 1K4KA 3LCUA 4RE5A 1SOMA 1GJRA 1N0HA 3IP8A 3VMFA 1H9BA 3BXOA 1OROA 4MVJE 1TW2A 1VSUA 2V4ZA 2RBEA 4KH0A 2HLPA 3WLOA 3AJEA 5PGMA 3WV5A 4DT1A 1G4UR 1T8TA 3BQMB 1QS0B 1X70A 2OD9A 3IR7A 2VO1A 4HWOA 2RAPA 4MW5A 3UVEA 3V1YA 5AK4A 3NWEA 3VR6D 1HFEL 1QO7A 3AJDA 1QPZA 1EDDA 1VCIA 2XDQB 3R3HA 2IYVA 1P62B 3S8EA 3KUDA 4RENA 1L7QA 4PQFA 3THXB 2AOTA 5JQGF 2FRXA 4Y0VA 3GDFA 1BXZA 4TMYA 3RTDA 2XGGA 1A95A 1STOA 3U4GA 5IYZB 4A6XA 2ES4A 1S01A 3PC7A 1MJNA 3VNBA 4BMSA 3JV7A 1V37A 2NO6A 4KX3A 4PYIA 3OO0A 1Q3TA 4C6HA 4XIJA 2GRAA 3WGMA 4CHGA 1JDBB 5CFMA 1E61A 1F2UA 4FGKA 3PDWA 4E46A 2O19A 2WV9A 1Z0IA 5CH8A 4YMVA 1B3BA 1OKKD 2B25A 4IQFA 1BU8A 5JNTA 4DDTA 2AN5A 3IXLA 3P0FA 1AKWA 2EKQA 1VXRA 5DX0A 4E09A 4ZZ3A 1C1DA 4PG6A 2GHRA 5TE9A 2QTVB 5H4GA 2XT9A 2XODA 5LLSA 1GDDA 1J2RA 4ZCTA 2H65A 4L57A 2ZRPA 4GUDA 1PJAA 1UBLS 3MPUA 4G65A 4XI9A 3O8QA 2A5YB 3JSAA 1KBZA 4FYIA 1NQXA 5T8KA 3O7WA 3PUWA 1VB3A 1N1MA 3B38A 4LDAA 2V97A 4KMMA 4RM3A 4IO1A 2XBMA 1RQ7A 1D4ZA 1OBVA 1YGYA 4EFNA 4JSTA 4MUNA 2FSPA 3IE1A 5KSYA 1FP4A 4MKRA 4JP1A 2QZJA 2P79A 1LTHR 4D9IA 4DMHA 5H3CA 4M0UA 3L7KA 2EHDA 4P3PA 1L5HA 2I7DA 1YA4A 2ZSBA 4UHHA 1EJ6A 2AZ4A 2E4UA 3DDHA 1FMJA 2IPMA 3IDOA 4PG4A 1U2EA 5IAJA 3WGGA 5F4BA 2PH1A 3RGWS 1A2OA 1RKBA 4J1TC 3AHHA 4Y2SA 4YECA 5FO0A 1KWKA 1NQVA 4L5AA 5FAXA 4RK4A 1N0VC 4B35A 1U3TA 1GFSA 3EZNA 1KI3A 3G0IA 4TRJA 1PNTA 1UXOA 5DM0A 5TPWB 3VZRA 4G1CA 4LHSA 1Y89A 1WTAA 3ZCXA 1VE5A 4EMUA 2NACA 1SULA 1V25A 3N8IA 4UAGA 2G7MC 2ZWVA 3O2QB 2ATIA 4KXXA 3M81A 2VP5A 1ODJA 1BKYA 2E2WA 3NP7A 4DBZA 3TUJC 4J0GA 2F55A 2I2FA 2EX1A 3NC4A 1IY8A 4IXNA 2WWXA 4UNRA 2DHRA 5G3YA 5A5FA 5HS4A 3UXMA 3L8GA 3H6KA 2HQBA 1OFUX 1F2TB 1Z6AA 2GZDA 3B5JA 1NF3A 2FF7A 1D7OA 1NMXA 1RWPA 2UYGA 3H0EA 1KYZA 1PWEA 2W00A 3C3BA 4L8WB 5CT8A 3LUCA 4D0LB 1J8MF 1KEPA 3BIXA 3WIOA 5A2GA 1DHRA 2NTNA 5DTJA 5M29A 3NIWA 4JASB 3WGNA 4BMOB 2ZI4A 3DV0B 4G24A 1K63A 1T36A 2OMKA 3OWHA 3IEMA 2CHVA 3USCS 5IPFA 4PHFA 1K5PA 1LVUA 3I2IA 2QOEA 4LBVA 2G4VA 2HJGA 3L82B 2JIPA 4KH1A 1D1QA 2VOEA 4WHMA 4WZZA 4B82A 4D42A 5JNUA 3COJA 2AN3A 1UKAA 3G2NA 1JAXA 5ILQA 2Q49A 1AB5A 1KMHA 1LDGA 2RG1A 4DYDA 1SVSA 2R8ZA 2IYYA 1WQ4A 1LEHA 5J43A 4TMKA 3DOOA 2JFVA 3UJ9A 2PZKA 2NNWB 5E1MA 4HY3A 1CJVC 1AN0A 1JLLA 1L5ZA 3V4OA 3MOSA 3T9DA 5COAA 2C04A 2ZIAA 3T4UA 3U09A 3EPJA 4ESEA 1EB9A 1SPBS 5ECGC 1C14A 2XUOA 3DZFA 1WEHA 3UAGA 3KQYA 5MFZA 3HNRA 3ZIDA 1KETA 4DNOA 4G9BA 2C00A 4R69A 2P91A 5CFOA 3SBOA 1EE2A 3CZRA 5AKIA 3MMXA 5BMVA 1BH6A 3C97A 2HPAA 3I1IA 4LJKA 4RFVA 2H18A 4B4OA 3KJZA 3O4FA 1UJBA 3CLHA 1TQ4A 4KI0A 4X1YB 4DJJA 3ZVNA 4NYIR 4GS5A 1UWKA 4IIDA 1CY7A 1W73A 4V0SA 4KFUA 1GD1O 3BBLA 4C0WA 2JBAB 1SC1A 2I33A 3H3FA 3TAXA 4EYGA 3QFTA 5G4LA 1I9GA 1NF9A 2AF4C 5LLDA 2PGLA 2AD5A 1QOZA 3RS2A 3K9CA 4L4YA 1KO1A 2IEIA 2I6GA 1KIMA 3IAUA 2GDJA 1OILA 2VPTA 4CMIB 1VLLA 3OCXA 1FK8A 4IJVA 3A9UA 2Q3MA 3T5GA 1Z5ZA 1NVKA 3IPXA 1GPDG 4QU8A 1DRUA 2R47A 1LGYA 4I46A 1VSTA 4MUMA 4CLXA 1I7PA 1ZH2A 1QZTA 2BM1A 2DMRA 4G0UA 3GT7A 1RQLA 1TU3A 2V7EA 5HKBA 1IBKB 2JJ1A 1JE0A 3MFQA 1U2SA 1SZJG 2C4HA 1VLJA 2VP9A 1RTKA 1MA3A 1Z6YA 1AZLA 3C8ZA 3CZ5A 3NTOA 4JY7A 4ENQA 4MDEA 1WXHA 3MJDA 2YNMC 4W82A 3GB9A 3ND7A 4TGLA 4OGFA 1KYVA 1RTTA 2CVOA 5K4AA 1CW2B 1GZDA 3ENVA 4X8OA 3U40A 3W05A 3B1WA 3ZVLA 4DMRA 1KVUA 2AFIE 3CIOA 4IWNA 3UAZA 3ZLBA 4D9CA 4NCKA 1YAJA 2FP4B 1SU7A 1X80A 3BD6A 3LIIA 4QHSA 2IHVA 3BFVA 2WM2A 3HJNA 3SM3A 1K8QA 1GPBA 5A3JA 2I4IA 1TUEA 3ZY3A 3F8WA 4J0DA 1VG9B 4BC1A 4XSHA 2O8CB 3T3HA 3O9MA 4Y2YA 2QVLA 5CIQA 3WP1B 2G9QA 1SUAA 3QITA 5A9SA 1TPYA 4TLEA 3G5MA 4M8KA 2E21A 2G08A 3QVVA 1BKDR 4R2KA 2I91A 2H1IA 1PZEA 4IX1A 3F3YA 5B58C 4LF5B 4LGYA 2Y1GA 1I5EA 3ZV4A 3E03A 4G07A 1ORTA 5FTLA 5FOSA 2F3PA 1LPBB 1YB2A 3GVXA 1MMFB 1EVLA 3IO5A 4KKXB 3RTBA 3V3TA 3R7AA 4DILA 3SQDA 1H2AS 1QHYA 1JVBA 2NT3A 4J0FA 1X87A 1VGRA 3LHIA 4OHRA 1C7EA 2C84A 2AG1A 3TFQA 4D9MA 3TNFA 2PCJA 3T7IA 1PR5A 3IIKA 1TK9A 4WSOA 2WE8A 2R1TB 2NZ8A 3A4IA 4Z9FA 1JJAA 3RFUA 2A84A 1G20E 2IJGX 2YINC 3DKVA 4QGFA 3OF3A 3WADA 2FFBA 4W9NC 3MCUA 1F06A 4EUFA 1UIRA 4XB6B 3IIMA 1GCGA 1IFXA 2FK7A 2PKYX 1ZGCA 2YOFA 3M8KA 3P9YA 4PYOA 3RIHA 2WWFA 4IUBS 3ZYCA 5A5VA 4YJHA 2RH8A 2J08A 2Q0XA 3EY4A 1M5TA 5CVEA 5BT9A 4ZQGA 5EJEA 3K70D 3F6YA 2INGX 1XNQB 3KFXA 3K2QA 3RHSA 4GPIB 3Q5DA 4OM7A 4DR1B 1T2CA 2YMLA 2FXVA 1H3FA 2R8OA 4X60A 3D8HA 3FBGA 4PFKA 2W6ZA 4U2FA 5FB3A 1AK9A 1C3OB 3EXG1 4JFRA 5CK5A 1RC1A 3LX6A 3V4ZA 3VPGA 4CM8A 4A0FA 5BR8B 3A6PC 1CUVA 4N5NA 3HVRA 2ORWA 4AZVA 2GKOA 4HBGA 4Y6RA 1KO5A 3TNLA 2Q9BA 4U9HS 1V3TA 4KB5A 1OKKA 3KM0A 3CNNA 1L5KA 3ROPA 2GK7A 3ORQA 4R16A 3OMLA 4DCOA 4M6WA 1H6CA 2PXAA 1SU8A 1AGXA 3LBAA 5AHXA 4QJ4A 5K0FA 4E4YA 2HDWA 1T25A 3QLUC 2VUHB 3RYCA 1T6NA 4LSZA 3LXUX 3K5WA 7REQB 1DBIA 1USWA 3DBHB 5T4BA 3ZHRA 2IX9A 1B2LA 1E1NA 4YP9A 3SK0A 5E3IA 1DBPA 3E8XA 2HI0A 3OICA 5FIUA 2GPJA 4M9XA 2WT9A 3SIWA 3X3HA 4FW8A 3MJRA 4CDGA 5BW8A 1WU7A 5K7SA 4DARA 1D6NA 1KDZA 3W5CA 1D6JA 1RPJA 2JNWA 1BW9A 2OBXA 3DT6A 4ZP1A 1FXWA 9LDBA 1M8FA 1HEUA 4UASA 1XDZA 1UFRA 2YHIA 1SHTX 2YXBA 3E0XA 5IJ0B 4ARBA 2BFAA 5BUSA 2R00C 2XYQA 3UC9A 3WSTA 1AV7A 3ZE6A 2XMBA 4ND3A 1ZAKA 3BDIA 1K06A 1UDAA 1PL7A 4GR9A 4M9RA 1SBZA 1IQRA 2GZAA 4UU1A 2FA9A 1O87A 3RW9A 5IFKA 2HFJA 4Q3DA 2C4MA 1O97D 3DKKA 1IZ9A 1ZKDA 3A27A 2E4WA 3L7AA 2WQ6A 1Y9DA 4PG5A 3IQXA 3ACDA 2VP2A 4ZHQB 1V7QA 2NUAA 4OHCA 3AINA 1YB4A 3T9EA 3DZDA 4D9KA 4KRFA 3KKEA 5KYYA 1ID8A 3DFZA 3OCZA 3E05A 2CLFB 3LYUA 2HOQA 2CY0A 4UHBA 4R7ZA 2WJ6A 4UUQA 5JNSA 3FSGD 4O33A 4C03A 4I9FA 3OU7A 4DBLC 2E9SA 1Q7GA 2GRUA 2BF7A 1JQKA 2QXUA 4FOSA 4R68A 5BSHA 3LL7A 3OCCA 1NY6A 1R9NA 2GD0A 2XV1A 4HKTA 3WGQA 2WJHA 4URXR 1CX9B 1U02A 1TVMA 5BSVA 1CULC 4OQMA 2BBSA 1CP3A 4NIMA 2QT0A 4Y6GB 4I5EA 5LQUA 3P9ZA 4E5VA 1J22A 3GZNA 4EKNB 1GCAA 4IXMA 4EG8A 4XGRA 4D96A 2UUAB 1OASA 4XARA 4GPZA 1F7VA 2C5LA 5H8WA 4IOLA 1O0SA 2H4YA 1S3IA 2CCGA 1E2HA 1YAHA 1L1QA 3K1JA 4AN1A 4JI6B 1LLUA 3KS9A 1J2TA 2QPAA 5K05A 4E12A 5LP6B 2FEKA 2ZXUA 2PRJA 1ZG3A 4C7VA 3DDZX 4RY9A 2AXPA 2XRFA 2RHLA 3ENWA 3K1AA 5EQJB 4EY5A 2FZCA 3HJCA 3NVDA 5LPNA 1GGFA 1UOEA 4O4LA 1QDEA 2J1LA 1H2YA 2FRVA 3S70A 3OO1A 3EXEA 5EN4A 3SF0A 2CCJA 2PRZA 5IDYA 3GJ5A 1R8YA 2EYQA 3MLAA 4AZ3B 2B83A 5JCJD 4DA4A 3KEMA 4JGGA 4MYDA 2DT8A 2C7GA 5AVVA 3G2IA 1HI9A 5CB4A 4EFKA 3GA7A 2NV0A 1PV2A 2QW0X 4E5PA 3FRHA 1M2KA 3AHFA 5EKTA 5C7IO 4A16A 2OV3A 2JJQA 3P9SA 3ZK7A 5B4VA 4N82A 3ER8A 3EYAA 4YB8A 2QL7A 1XMSA 1FJ2A 3VDMA 1H0SA 4NZZA 2D0OB 1DJMA 1KL7A 2O48X 3UHJA 1ZITA 3MS4A 1TIBA 2FUCA 1CS4C 1G1AA 2AN4A 5A3RA 5I9NA 4UHKA 2WWVD 4TKUA 5AK0A 3UMBA 2ENUA 1PHPA 3RAFC 2DU8A 1G19A 4NZ9A 3IESA 4IHJA 3LLVA 3VU8A 3VYUB 3SY8A 4A23A 3ACBA 3OQIB 1QKJA 4I0WB 4UBKA 2BJWA 4RU1A 1T1IA 1Y8QA 1F1JA 1I3KA 4IFIA 1ECBA 4M0PA 1E64A 4GBGA 5AMXA 1X1QA 5EI5A 4NDZA 1JFTA 1FFAA 3H9CA 2P6NA 3V4SA 4IIEA 1KGSA 1LB1B 4L74A 5I7OA 1GPH1 4YH1A 3LL4A 4GI2A 2OUKA 3VKVA 3DEJA 2QRHA 2R66A 4TVKA 1BCRA 4ZALA 1RRGA 2W0SA 2C9YA 2Q9CA 1AOXA 2YICA 2B4TO 2O9JA 2C92A 3GDOA 3GRFA 3RYHA 2GOYA 5ALLA 2KBFA 2VKQA 1W87A 4KAFA 4TV9B 2O1EA 2L69A 3WQSB 1MO4A 1MXHA 1FA9A 1NVFA 1UODA 3EN0A 1M34A 3K35A 2OAEA 4U2GA 4JJ7A 5AW3A 3A1TA 3PJDA 2I4OA 2W6CX 1B0PA 1R7RA 4F9FA 2CEKA 1R10A 1TNDA 3HN7A 5DBFA 3ROGA 4X3CA 4BAZA 2XXJA 2ZYGA 2YRFA 3ETNA 3WLEA 3NR2A 1EXWA 4PNEA 2BELA 2Y9PB 5IS2A 2BONA 2IITA 3K2IA 3U3XA 3C8MA 1SXJE 3G8CA 3OTQA 3P9XA 1D5CA 4RVDA 3JAKA 2O1XA 2Y0BA 3GQBB 3EHEA 4S04A 2PUGA 3U1TA 1Q57A 1R0RE 3MJFA 5CPFA 5FYQA 3WRWA 3QEAZ 5ALYA 1W36C 3IR5A 2CCKA 5C0OE 4P4UA 4LOAA 3FPJA 1RYFA 2I54A 3JQFA 2HLNA 4AULA 2FZWA 3UPDA 3RVLA 4ZO7A 4DV1B 4B3GA 4S1VA 4ZCPA 4LYFA 2ZP1A 5J47A 5BR1A 1FLAA 1ND5A 2EEZA 2Y27A 3THSA 4JCOA 4MA4A 3I6ZA 4DA9A 1FVXA 4OYRA 2NXEA 2Z8ZA 2I6TA 4TXHA 3VO9A 4BJ1A 3AHJA 4EGQA 2ZJFA 1EX9A 1FYFA 1A7JA 3GVHA 3HZOA 1JA0A 4HUTA 4WFJA 4D0NA 4CL3A 4KLZA 3CH7A 1PUXA 2BFWA 3DCYA 4X92A 5DYTA 3BGVA 3AFGA 1DBSA 2XQIA 4FUQA 1QDLB 4OMDA 2QTBA 2XCTB 4AZ0B 1B8NA 1U31A 1Q3HA 3FKQA 5AVTA 4LZLA 1PJ4A 4NF2A 2I8CA 4YJ2F 3COVA 1CUDA 1JN0A 2XNKA 4OUDB 2Y1DA 3P2YA 3T1HB 5EQDA 2JFQA 3MILA 3ZXUB 1UJ6A 4CMJA 3L0CA 3TNDA 3DUFA 2A0FA 3KD3A 4EW1A 1CY6A 3K92A 4PAGA 4QG3A 2PM8A 3IEVA 3KC2A 2AQIA 1XAHA 4ZK2A 1GZ5A 4TWZA 1DQYA 2QYSA 2QN1A 2Y71A 3AIOA 1GO2A 1K66A 4IJWA 4NG5A 3RJZA 3RS4A 3FHJA 2XVMA 1XB2A 3HA3A 3NIBA 1XHFA 4QJ5A 1I3LA 1JEAA 2RGUA 3C70A 1O5TA 2IYPA 4UAVA 3T1QA 4MI9A 2PANA 3I12A 1LBEA 3JQ7A 1T2VA 3LF1A 1XKLA 1DC8A 2J7PD 2O6LA 4NMXB 3DLTA 4NK4A 1HZJA 4TMZA 5C35A 1AZWA 1E6CA 3BFJA 2P41A 2H07A 3RODA 1R2QA 1XTQA 4B3JA 4EFDA 4P22A 4E5YA 2OVBA 3I9MA 3EEBA 3P2IA 1Z74A 1OD6A 4NH4A 4ZXFA 4EO9A 3CVXA 4ARUA 3I09A 2OHVA 4URZR 3JYHA 5IAAA 1QQ5A 1GNRA 2FSVC 2V7PA 4NARA 2GJ9A 2VDRB 3DE1X 3HJHA 3ED5A 2BTEA 3LC2O 4DF3A 5I9LA 5LVAA 2O57A 2YIDA 4LFAB 1HORA 4CUZA 4DEYA 4RIIA 4G25A 4BWGA 1TU0A 1G3IA 2GPYA 1IPFA 4J2HA 4PAWA 4DSNA 3UJAA 5JD4A 3MXTA 5KJFA 4XA8A 4C5BA 3L1HA 3SC4A 1H69A 1M72A 2QM7A 2YC2C 3CRW1 1RPAA 1S96A 4R5MA 4WDRA 4XZ3A 3SQNA 3GHHA 2XCOA 2XXAB 5GV7A 3U61B 2X2EA 3VPFA 3X1KA 2C5HA 1R0ZA 4I19A 4RJKA 3ENNA 3WFZA 1Z6TA 3SDSA 2HH9A 2RHDA 2H7CA 4FLFA 1H2WA 1G8FA 3EZ9A 2C54A 1PI3A 2FPOA 2OTCA 2VUUA 1E3IA 3NTQA 3OHMA 2E0IA 4I8DA 4YRLA 1IM5A 4ZKEA 1Z0AA 1PTJA 3R0IA 2GGSA 2A7XA 3AY3A 1R9MA 3O95A 4UOZA 4ZOLA 2ZDQA 5EP2A 2G17A 3BHJA 2FNAA 1FB5A 4R1QA 3D1VA 4GMHA 2ZR8A 2YJNA 1HE1C