5HILA

Crystal structure of glycine sarcosine n-methyltransferase from methanohalophilus portucalensis in complex with s-adenosylhomocysteine and sarcosine
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
244
structure length
240
Chain Sequence
DHYEEEYVLGFVDKWDELIDWESRAESEGDTIINILKERGVKKVLDVATGTGFNSVRLLQAGFDVVSADGSAEMLVKAFDNARDHGYLMRTVQADWRWMNKDIHDKFDAIVCLGNSFTHLFDEGDRRKALAEFYALLKHDGVLLLDQRNYDAILDSKHAHYYCGDTVSVYPEHVDEGLARFKYEFSDGSVYNLNMFPLRKDYTRQLLHEVGFQEINTLGDFKETYKEDEPDFFLHVAEKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine sarcosine N-methyltransferase
publication title Structural Analysis of Glycine Sarcosine N-methyltransferase from Methanohalophilus portucalensis Reveals Mechanistic Insights into the Regulation of Methyltransferase Activity
pubmed doi rcsb
source organism Methanohalophilus portucalensis fdf-1
molecule tags Transferase
total genus 86
structure length 240
sequence length 244
ec nomenclature ec 2.1.1.156: Glycine/sarcosine N-methyltransferase.
pdb deposition date 2016-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5hilA02
3MERA 2OKCA 1YUBA 4KRGA 2NYUA 2XYRA 3BKWA 2QE6A 2G72A 4ER6A 2FCAA 1O9GA 4MWZA 5MHTA 4RX1A 5EZSA 1XDZA 2IGTA 2PX5A 3BXOA 2ZFUA 4C08A 1JQEA 3KQSA 2B3TA 4QDKA 4EKIA 4PCLA 4QPPA 1HMYA 5DPMA 4A6EA 2B25A 3MGGA 1AF7A 2GH1A 3TLJA 2ZZNA 4PINA 4PGHA 1VQ1A 3I64A 3A26A 3AXTA 3IHTA 1D2GA 2GA9A 3EEYA 2AN4A 4E32A 3KR9A 2B2CA 3THSA 3OE5A 4YUYA 3UJBA 4YV2A 3GXOA 4RTQA 1JTEA 3ELUA 5E9JA 3P2KA 3TQSA 2IPXA 2YTZA 4GC5A 5HIMA 4R8SA 4RVFA 4DCMA 3FRIA 3PVCA 5DSTA 3MQ2A 1R8XA 3OZRA 3HM2A 3MTEA 4RVDA 5GIPE 1XXLA 4YUZA 3LHDA 1SQGA 1AQJA 3FTCA 3P9CA 1P1BA 2GLUA 4E70A 2B9EA 2G70A 3UJ7A 3O7WA 4BY9E 3BT7A 2AOVA 3NWBA 3LL7A 1KIAA 1L3IA 1VP3A 5EQJB 2C7PA 4LWPA 2PT9A 4F85A 3OPNA 2PX4A 1X1AA 1SUIA 4PIPA 5DM1A 2ZWVA 2NP7A 3KQOA 3RODA 3KQPA 5IH3A 4DZRA 3DMGA 4P7JA 2UYHA 3Q7EA 3M6XA 3C3YA 1I4WA 3M70A 5FADA 3SSOA 1UWVA 3QOXA 3DLIA 1G60A 2DPMA 3GWZA 3KPYA 1YFLA 1JG1A 5K0FA 3SSMA 1QAQA 3KQMA 3EVGA 5E2AA 4E2XA 1YFJA 7MHTA 4PYKA 4R6XA 4QTTB 3BUSA 4CKBA 5K8VA 4OA8A 4ATNA 3MAGA 3NWEA 1TW2A 3GRYA 3LKZA 5FQNA 5C1IA 4GQBA 5K09A 1I9GA 4F86A 3CBGA 5E8RA 5T64A 4AZWA 4RTPA 2NP6A 5EG5A 4ER0A 1EIZA 1FPQA 3ANXA 3HA3A 3OCJA 4R05A 5GP1A 1G8AA 2CKDA 2WA2A 2N47A 1NW8A 3DUWA 1N7IA 3G7UA 1BOOA 4Y30A 4V0RA 5E1BA 5FWAA 3EMBA 4X1OA 4PYJA 4KIFA 2AN5A 4Y2HA 4P7FA 4EK9A 1IY9A 5EHGA 2AR0A 4E31A 1JTFA 5GM1A 4HTFA 3OU6A 2AOUB 2ONZA 4AUKA 1BC5A 4WXHA 5DWQA 1KPIA 2C7QA 5F2NA 5E9WA 3KR1A 4GF5A 2ZVJA 3BGDA 3B3FA 4PYNA 3BZBA 3KPJA 5GOZA 5KQSA 3CJRA 1XTPA 4LWOA 1TPYA 1VL5A 3E8SA 4IWNA 1KR5A 2R6ZA 2PXXA 4HGZA 2UYQA 3EVDA 3T7SA 3UJDA 2GPYA 3BWBA 4WVLA 4MQ4A 2YR0A 3GRZA 4PIMA 1XJ5A 2YVLA 5E9QA 3LDFA 5BW4A 5KQRA 3PS9A 2P1DA 2VS1A 1RJEA 2YXDA 2VZ9A 4X61A 1PRYA 1L3BA 5GM2A 3KPWA 3EVFA 3HVJA 2PJDA 1ORHA 1EAMA 3UWPA 3E05A 3LX6A 1JQ3A 4OBXA 5DTRA 2QRVB 5DM0A 1KYZA 2AVNA 1M6YA 1U2ZA 2IDKA 2PY6A 3C3PA 3CJTA 5GIOE 2ONYA 4MIKA 4RTSA 2NXEA 3LBYA 5DLYA 5DM2A 1SQFA 3JWHA 2FYTA 1OR8A 3KQYA 3SM3A 5BXYA 4ISCA 3CVOA 1FP1D 2GS9A 2PWYA 3KKZA 5DX1A 4EMSA 5GINE 2CMGA 2Y1WA 3FPGA 5E1MA 3UZUA 1EG2A 3PFGA 5FA8A 2EFJA 2O06A 3TMAA 2PT6A 1VE3A 1XDSA 3MCTA 1ZGJA 2AOTB 4QPNA 1EQAA 3BWCA 3B5IA 4GUAA 2IH4A 2ESRA 1JQDA 2ZIEA 2UYCA 1L3CA 2NNWB 5FWDA 1NE2A 1QAOA 4MHTA 1P1CA 1R00A 3P71T 5EPEA 3HP7A 5G02A 4DQ0A 3FPEA 3QOWA 1MJFA 3M33A 4HRAA 2AOUA 3FZGA 5E2BA 5CVVA 2PXCA 5JR3A 3DMHA 4ER7A 5CVUA 2OB1A 3DOUA 2G8NA 3EVEA 3HEMA 3TM4A 3BWMA 3HVIA 3H2BA 4GBED 3UA4A 1HNNA 3LBFA 2P7IA 2YX1A 4CTKA 4DM3A 2ZULA 1I1NA 4YUWA 3K0BA 1F38A 4H0NA 5EZQA 3EPPA 5JUWA 3HCDA 5KVAA 2ERCA 2P3OA 3LCCA 3TKAA 3UJAA 1NV9A 5EMKA 1NBHA 5DXAA 5KYGA 3DH0A 2G1PA 1IXKA 3SXJA 4YV0A 3U81A 1XDUA 1EJ0A 3FYCA 2EJTA 2H1RA 2QRVA 3EGVA 3M6WA 4FZVA 4KIGA 5D1HA 4P58A 4ZTBA 5LQJA 2IBTA 5EC8A 3SGLA 4F84A 1KPHA 3UBTA 3EMDA 3GU3A 2HR1A 1XVAA 1IM8A 2AN3A 1H1DA 1ZG3A 2P8JA 3BGVA 2R3SA 2ZIFA 3DULA 3G2OA 4HTFB 3GRRA 4KDCA 1O9HA 3D2LA 4OX9Y 3LGAA 3MHTA 3OZSA 2Z6UA 3NDIA 3AJDA 4RTMA 3PLAE 2ZBQA 5LSAA 2DULA 4M38A 2P40A 3IV6A 1N7JA 4U7PB 1F3LA 3I53A 3KHKA 2IBSA 2P7HA 2V7EA 1BKYA 2YXLA 2AOTA 5K01A 5ICFA 3I58A 3PB3A 5EKXA 4HC4A 3IYLW 1JR4A 5EMJA 3SMQA 2KW5A 1NT2A 5EIFA 4C03A 1XCJA 4DCGA 5T6BA 4C06A 2ZCJA 5DRYA 4FT2A 3NMUF 3O4FA 4PWYA 3C6MA 5P8WA 5HEKA 5EHIA 2PVCA 3ORHA 3SSNA 3OZTA 2AVDA 2JHCA 5F2OA 3G88A 2PKWA 2E5WA 4QVGA 3VYWA 3Q87B 3JWJA 1G8SA 1M0EA 5CM2Z 2OZVA 2C7RA 3PX2A 3UJCA 3HTXA 1DUSA 4M7RA 3PFHA 2CMHA 1ZGAA 5DM4A 5DTMA 1WXXA 4M37A 3LCUA 3SVZA 2XYVA 2QY6A 2IH5A 1YB2A 3SR4A 2GAFA 4FGZA 1FJXA 4JXJA 4FSDA 4RTOA 4IKPA 1VBFA 1KXZA 5DSXA 1X1CA 3HA5A 3GDHA 2ZW9A 1R8YA 1D2CA 4PYIA 1SG9A 3P97A 4HH4A 4C4AA 2Z6AA 2PXAA 1ZHFA 3NTVA 3BKXA 5B1SA 3DTNA 2HTEA 4GOND 4QDJA 2IP2A 5EMLA 3RIEA 4BLWA 4CWAA 4CTJA 2NXNA 5KS2A 2HNKA 2JHPA 1WXWA 2PX8A 3DLCA 4BP3A 3B89A 2LD4A 4KVZA 3E7PA 4AZSA 5HIJA 8MHTA 3HVKA 2FRXA 5K0BA 4PONA 3BWYA 5LQUA 4GOOD 3R9XB 3UA3A 2YXEA 4BLVA 5HZMA 1KYWA 3AWIA 3KQWA 5EIWA 5CUQA 4UOEA 2B78A 2QM3A 2O07A 2P3QA 3R3HA 2HMYB 3B7PA 3JWIA 2A14A 4ER3A 4HG2A 2PWPA 3GRVA 3A4TA 4EQZA 1WS6A 1SUSA 1X19A 3OU7A 1FP2A 1QAMA 4P7KA 3TPZA 4XUCA 2BR4A 3PT9A 1NKVA 2VDVE 4PGGA 4RSRA 2Q41A 4PNEA 1T43A 1L1EA 3KPVA 2P3LA 2XYQA 5LQAA 2XBMA 3NVKI 4DF3A 1Q0SA 3P9KA 5DT2A 4RTNA 3MB5A 3DMFA 3TFWA 3UJ6A 4RTJA 2IH2A 1RI2A 4FS8A 5C0OE 1RI4A 3GCZA 1XCLA 3ELWA 2I62A 3CGGA 2YQZA 5F2KA 3T7RA 3LKDA 2AS0A 2ZZMA 2HWKA 5FHRA 5CD1A 3PTAA 3R0QA 2PX2A 3OFKA 5DX8A 1L9KA 5K0JA 2OO3A 3M4XA 3A27A 3G2PA 2JHAA 3F4KA 3KU1A 5DTQA 4X63A 5M5BA 2I9KA 1R74A 5EEGA 4CKCA 3T7TA 1JG4A 3KQTA 4DKJA 3AY0A 2YUIA 2JH8A 2O05A 4RV9A 4AX8A 3TKYA 2FPOA 2UZ4A 3NJRA 2VDWA 4OA5A 1VPTA 3HNRA 3B3JA 2ZBRA 5LR6A 2NXCA 2PV0A 4Z2YA 2PSSA 2JJQA 1B42A 1X1BA 2FK8A 2UYOA 3HCAA 4DA4A 5IKMA 3FYDA 1SKMA 3G5LA 3V8VA 4GOLD 10MHA 5FULA 2QYOA 3FUWA 1AQIA 2V74B 3HCFA 2K4MA 3ME5A 4ER5A 2OPBA 3EVBA 1Z3CA 1R18A 3B3GA 4E33A 5CIYA 2O0LA 5CVJA 5BP7A 3LDGA 3R24A 3EVAA 4OQDA 5E1OA 2Y1XA 3FUTA 5DX0A 3GNLA 1M6EX 2H11A 2FK7A 4QVKA 5K03A 3K6RA 4C07A 5LQNA 1YZ3A 3TM5A 3SX0A 5U4XA 3DP7A 2VDUE 3S68A 3TRKA 1ORIA 3KPUA 1RI1A 3OU2A 4QQKA 4FT4A 3TR6A 3KQQA 1WY7A 2GB4A 4A6DA 4QQNA 5LQRA 2BR3A 3C6KA 1ZKDA 2C7OA 4FP9A 4BP1A 1NW7A 5K0CA 1NW6A 3GO4A 3LPMA 4FSXA 2OBFA 5ERGB 2BM9A 3IEIA 3FUXA 4P7GA 1Y8CA 3P9NA 4KDRA 5CCXA 4CKEA 3MCZA 5C9ZA 1JG2A 1V39A 3MTIA 2IDJA 3EEOA 2XVAA 4EVIA 1VIDA 4BLUA 2Z6QA 1JG3A 5HFJA 3CCFA 1UIRA 1RJGA 2I6GA 2EJUA 3BGIA 1P39A 3G8BA 5ICCA 5CCBA 3P2EA 3HCCA 4V0QA 1NBIA 1KHHA 3EVZA 3ID6C 2WK1A 3DR5A 3FPJA 1NW5A 2ORED 3NVMB 3HCEA 1R6AA 4QTUB 5CVDA 1G38A 9MHTA 3VSEA 2CL5A 2WA1A 3DXYA 3M6UA 4C04A 1DL5A 3ELYA 3AXSA 3A7EA 1O54A 4U7TB 3A25A 3G2QA 5K0NA 2AOWA 3ELDA 5HILA 4KW7A 2BR5A 3GIWA 2VP3A 3I9FA 3HVHA 1D2HA 3R6TA 5CVEA 3VC1A 1PJZA 2JG3A 3C0KA 3LDUA 5K05A 2OY0A 5H02A 1SVUA 3DXXA 3FUVA 4DMGA 4EKGA 1G6Q1 1YZHA 4YV1A 4YMHA 3I5UA 3UJ9A 3LSTA 3GRUA 3ER8A 3OFJA 2IFTA 5E8JA 4RTLA 1KP9A 2BM8A 2ZSUA 2JH9A 3G8AA 3ERCA 3TOSA 1VP9A 2NXJA 3KQVA 5FQOA 3M6VA 4KWCA 3NDJA 3DXZA 5FA5A 2ZWAA 2HV9A 3OE4A 5ICGA 1BHJA 4R6WA 1YF3A 3WSTA 3LECA 4RWZA 2OB2A 4LG1A 3PX3A 4YMGA 4RVHA 2EX4A 3CKKA 3JWGA 4G56A 3GGDA 3FPFA 5FUBA 1JSZA 4GEKA 4MTLA 1ZQ9A 3UFBA 1JSXA 3KR0A 3HA7A 3G5TA 5LQKA 3P9IA 4OQEA 5HOQA 1Q0TA 3EVCA 4POOA 2PGXA 3EGEA 4L7VA 5FHQA 1RJDA 4RTKA 3CJQA 3V97A 4PCAA 1DCTA 1AV6A 2CWWA 4K6MA 2ZLBA 2ZTHA 1MHTA 4E2WA 1P91A 5FTWA 3G2MA 5FCDA 4O29A 4GC9A 3THRA 2BZGA 1INLA 3CC8A 2ZZKA 1WG8A 3GJYA 4PYLA 3EGIA 3T0IA 1RI5A 2ZBPA 1RJFA 3P2IA 5ICEA 2FHPA 3LCVB 2PBFA 3E23A 1UFKA 4IV8A 4XUDA 5EEHA 2BH2A 1X1DA 5HIKA 1KPGA 4NECA 4AZTA 1WZNA 4HGYA 2O57A 2F8LA 4XUEA 4E2ZA 3FPHA 3FUUA 4CXMA 4IV0A 4E30A 2G71A 1G55A 4LECA 5EMMA 2XVMA 4RVGA 3G89A 3REOA 3UJ8A 3FTDA 2H00A 5K0LA 3NW9A 3QV2A 3FRHA 2ZIGA 4XCXA 4YUXA 1QANA 4E2YA 4X41A 5T67A 2EG5A 3KR2A 5EVJA 4PYQA 2OYRA 5E1DA 2OXTA 2P41A 3FTFA 1QYRA 2IIPA 4R8RA 3FTEA 1NV8A 5EOVA 2AZTA 2ADMA 3O31A 3X0DA 1N2XA 2I7CA 1EJ6A 4M36A 2P35A 4PYOA 4PYMA 5HIIA 4B17A 3VC2A 5LQCA 3L8DA 2AOXA 3P8ZA 4AZVA 5EGSA 3HCBA 1RI3A 1FBNA 1VLMA 2PLWA 5DXJA 1QZZA 5D1NA 3A7DA 4OBWA 1NW3A 4RTRA 3RW9A 5DRTA 4GOMD 4FR0A 5EKUA 4YUVA 5BW5A 1TW3A 5K0EA 5K0GA 5GWXA 4C05A 4RYLA 3ER9A 4HSGA 4X60A
chains in the Genus database with same CATH superfamily
5AKKA 4UJ5A 3UFXB 3DCJA 4MUIA 4TX1A 2NYAA 2A5LA 3REFA 1YBMA 1R64A 4OPMA 1DAGA 2O4CA 1X92A 2WP0A 3C6BA 4LCBA 4H1HA 4RX1A 1Y9EA 1I2MA 5SICE 5BV1A 2V0GA 2DH5A 1HLPA 3L3BA 5CPBA 5DXFA 1FTYA 5DBEX 2QLLA 3EZFA 3QVMA 2EKPA 2PCLA 3LFTA 4A6EA 4YP9A 2B25A 3FYUB 3IDFA 5P21A 4F3YA 2XRZA 1DG9A 2BL4A 3TE6A 2X5XA 4FZRA 3AF2A 1XZLA 4RH0A 5LJLA 1OTHA 2AN4A 2GGSA 4G5RA 1FDUA 4LOLA 4Y2UA 4Z9XA 1ZVQA 4TYNA 4YUYA 3HU1A 3IT0A 1JDZA 1HE8B 1SEPA 2YHSA 1V8FA 4PHHA 1AUOA 2FR0A 4LPSA 4F6RA 2XT6A 3I9NA 3KLOA 1YR1A 1ISFA 2AWNA 5FTMA 3KV3O 1XD2B 3TLZA 1PSZA 1KDYA 4NCXA 1D09A 4MUHA 3NHRA 3OIGA 1ODFA 1PQUA 1UBLS 1WLYA 2IYEA 5D3ZA 621PA 1NVUQ 4KWTA 1OJ7A 5GADl 2AUMA 4MQ6A 1ISHA 1ZJ5A 3AGQA 3UUGA 1YUNA 3DFFA 1BGVA 1ZP6A 3IUBA 4ZU1X 4CQMB 4LZPA 2Y1OA 4PSDA 1P1BA 1Z5OA 3LV8A 2PMKA 1UJ2A 2FR1A 4BGIA 2CXHA 1BQ3A 1X1QA 3NWBA 4OO3A 3SZOA 4L08A 5MGBA 2QTAA 2QL9A 4LWPA 1DZ3A 4JUDX 4LCEA 3GP8A 3UK1A 5JY6A 3KQOA 5A02A 1EG7A 2OGSA 3ED5A 3MIZA 4DCCA 2V6JA 3AP3A 2CNDA 3VSBA 4C0QC 5IANA 5HF9A 3W79A 5FADA 5L45A 1JHAA 2PS3A 4A23A 1PUIA 3LZ6A 1T6BY 2I8LA 1JG1A 3V55A 3KCNA 4J6EA 1R4AA 5EXXA 4N03A 5LOVF 5LOVB 5ALLA 3I76A 5HTKA 1SWVA 4HDNB 2HCJB 2VQEB 1VL1A 4CNBA 3VNAA 1QO9A 3L92A 1WZIA 5J5AA 3N86A 2HY7A 2YFQA 1YZQA 2Q5QA 2Z57A 3O83A 4W9NC 5FQNA 4NCBA 5D3KA 3OPYA 3NC0C 5DNVA 3MTBA 1JLKA 2NP6A 1KI6B 4NRDA 2G6BA 3H4VA 3ZE8A 5K8UA 1GTRA 1RYFA 3UKJA 1M8KA 221PA 1KDVA 2O4UX 3PWTA 1BOOA 4RK0A 3JARB 1U9IA 3ITKA 4V0RA 5A6VA 4HPWA 1QIJA 2PWZA 3JVDA 2JI4A 1G17A 3TUJC 1O0CA 3LRPA 1DRKA 5K8TA 4OU4A 5CFQA 2VLIA 3EK2A 3KJQA 4XWKA 1EAYA 4FCVA 1BA3A 3Q1KA 1BC5A 3W77A 4DMFA 3RHZA 4JYAB 1QLJA 5JFGA 2WJGA 2ZVJA 4MYTA 2PSEA 2ZRQA 5HFAA 2OVFA 4ID9A 3CJRA 4IIXA 4D9EA 4AY6A 3D8HA 3OO1A 1JZTA 1TUGA 5AXAA 2IEGA 5HWSA 1JFSA 4UVEA 4Z4GA 3JPYA 3ZVKA 1V35A 5FI1B 5E3HA 4UVGA 3HVJA 1ZLYA 4OHOA 4K9QA 4ENVA 4YR9A 2VYQA 2VAXA 3PJEA 1RM3A 4OBXA 4ZV9A 3HRKA 1KYZA 4Y6RA 1M6YA 2MSDB 5SZKB 3RREA 2FX5A 4YRSA 1DMSA 3O74A 5ALEA 4P84A 3N3BC 5EQTA 1OR8A 3RYHA 2XMRA 3IAM6 4PZEA 1Z2NX 2V7TA 2W58A 1OTYA 4MQUA 4R0NA 4CLOA 1JLRA 1XZHA 3EOAI 5F1OA 3EIXA 3CW2A 4HN2A 3TSAA 1HE4A 1J2JA 4WJLA 4DZZA 1A8IA 3OIVA 4D6XA 4MCIA 4GR4A 2WNSA 1GYQA 2ZB8A 3DR3A 5C8YA 4O4HA 1ORDA 5DTJA 4ZCIA 5AM2A 4J0CA 1KKUA 1MXHA 3B1WA 1QWOA 3ZJ4A 3I5XA 4P0QB 4JJFA 5F9HA 4Y2GA 2AJCA 3CINA 4YRBA 2NVWA 1R0CA 2XDQB 1MJ5A 5FTLA 2GCPA 3BXEA 2ZVPX 1D0VA 1JLHA 1KZGB 1U7TA 3DSRA 3PDWA 1E2UA 4CG1A 4LJRA 1VHTA 3F9IA 1Y3AA 1FFXA 1ZUIA 1Z4QA 3SC2A 2AF3C 4LOAA 4GRDA 1IJKA 4Q00A 1DPGA 2YOFA 3HVIA 1XU9A 1HNNA 2VQDA 1Q95A 3AEQA 2NYVA 4MS1B 4NHOA 4H1WA 4NNJA 2A5DA 3DW1X 4WRRA 4EHNA 4JN6B 4CL3A 5I5GA 2FF7A 2TMGA 4ZJPA 2O5EA 3TKAA 2DCMA 3EODA 2XE4A 1EXVA 2ZB3A 2PL5A 4HZUA 4EQ6A 4UPDA 1NVAA 1YOVA 4W6ZA 3WL4A 5EVJA 1OWOA 3HA2A 1EFPB 5EZ6B 2FA9A 3ZE0B 1B8OA 3RK1A 3NKVA 3WLQA 4F84A 3MEQA 2XHZA 2O50A 3C39A 3I5MA 1GSOA 2VYVA 1ABEA 3OM0A 3Q10A 3VDMA 4TOIA 1RJWA 3KOZA 1D7AA 3ORYA 2NZ2A 4DEVA 1EFVB 4QUAA 3VDRA 4QDOA 1PK7A 2Z6UA 4PQEA 3IVCA 4D9IA 4OGFA 3LWZA 3O3OB 4F4JA 3PJDA 4BFYA 3H2YA 3BERA 1VYVA 4R71A 4GVPA 1WL8A 3I53A 1NKTA 3D81A 3BMOB 4U63A 1KSFX 2DE0X 2YXLA 2QNRA 3HHPA 4GMDA 1WDLA 4L5YA 2IV7A 3MLAA 1SPXA 2IK8A 3NHLA 3A6DA 2P9BA 1U31A 2OQ2A 4OREX 4BAUA 2AKYA 4FT2A 1WRBA 1NTRA 1SD2A 4LIPD 4PWYA 3S1AB 1EE9A 3C6MA 4ENWA 5CEFA 2DPYA 3D2BA 5EHIA 1PWYE 2RGAA 3MWFA 2J0QA 3DL0A 3FNFA 4L15A 3NHAA 3ZDRA 4UTRA 5KJ1A 3QX7A 4QVGA 4R98A 3TZKA 3QJYA 2D0OB 1IFXA 1T6XA 4OHVA 4UASA 3B6ZA 3VYWA 3HMQA 4H35A 1DTEA 1LW7A 4DR1B 3LWNA 1O97C 5KYTA 3PFHA 4F5ZA 4KO2S 3T9EA 1RMTA 1DKMA 4FZJA 4RADA 3C3WA 2B98A 4YYEA 3CX7A 4QL3A 1XK7A 2AFIE 3BIWA 3H0CA 2PMDA 3HBFA 4MROA 5BQOA 5T8KC 4BNFA 4E6EA 3SR4A 1RBMA 3PXDA 1UWCA 3BULA 4JXJA 1J2UA 1Y7IA 3LT4A 2YWBA 3MT7A 1PEKE 3I4CA 3REQA 5HKLA 4QOIA 1I6WA 3FA2A 1WD7A 2ZW9A 3HR4A 4OJNA 1YZLA 4PZUA 2HUPA 4UDYX 3WWEA 2F9FA 4EELA 5A5VA 3SWWA 1CEEA 3GLQA 3JD2A 4BLWA 3RPEA 4TV8B 2QG6A 4TV8F 1BS9A 1H5NA 2E82A 3GGGA 4W5HA 1UKEA 1FK8A 3ZQKA 5HZHA 4DJDC 2QMOA 4LF9B 3KLPX 1MW8X 2H1CA 1YAJA 3WNBA 1LSUA 3D3KA 3IC5A 1R9GA 1RQ7A 1VYHA 3AWIA 3GLKA 3O75A 2XA1A 3O93A 1VSVA 2FG7C 1T5HX 1ZAKA 5IHPA 2FLWA 3FDIA 4A6PA 1ZSVA 3K2EA 1WS6A 2ZYHA 4Q02A 4ZO6A 5ALWA 1FP6A 4UUNA 1CUSA 3H05A 4H7JA 4HAYA 5KSWB 4Q24A 1NN5A 2F1KA 2FPGB 3L4EA 4LV6A 1DQPA 3DE2X 3IMCA 5CXXA 1DAOA 2G4CA 1SXJC 1C1XB 1O96A 3ODGA 4REQA 4AN4A 4N01A 3PFKA 1P1KA 3WLKX 3ILHA 3WGVA 4D7AA 1YS1X 4CKEB 4KXMA 1Q0HA 1XAJA 2AS0A 4KSCA 4E4TA 3QQPA 3GT4A 2GYUA 3LFHA 2EV9A 4QOEA 1GARA 3I4LA 1CUJA 1L9KA 2AQIA 2Y1FA 1E9EA 2JHAA 1KI3A 1S2LA 2FSFA 2QQ5A 3B85A 3EWSA 3K1TA 4PG5A 4ZVMA 2ZT5A 3L84A 1I4DD 4B34A 1T6ZA 4ZJUA 1ULHA 1CQIA 4TTVA 2RGNA 5JSYA 3R8XA 1SG6A 5LNK6 3SBEA 5AM4A 1CYEA 1J90A 5JOQA 1Z6ZA 1M9NA 3ENZA 4RV5A 3UPDA 2N42A 3HCAA 1UPTA 1B41A 1A5BB 1Y6JA 1RP7A 2G1JA 2XUGA 2O0MA 3AFHA 3QWBA 1I1HA 2GM3A 3N05A 3A14A 4IH9A 4DNPA 3RTBA 4KDEA 5C32A 2XPCA 3PDUA 4LKOA 3THXA 2O8EB 1OPXA 1FE8A 3CB2A 1UC8A 2CDRA 1QF9A 3ZJTA 3LDGA 1H2FA 5E1OA 5LB4A 1FNBA 1OBCA 2HMSA 2GERA 1QP8A 2Q1TA 5DX0A 3RYFA 1JFRA 4F5WA 1AQNA 1XUOA 5FTNA 5F76A 4ALLA 3WC4A 4I2VA 2VDUE 3KL2A 1U0LA 1WMSA 3RRFA 4DAOA 4A6DA 3IXQA 4QU5A 5SZIA 2BIFA 4X65B 3JZDA 4G81A 1OX6A 3V2GA 5G4KB 1J00A 1MTZA 1FQJA 2FWRA 3IBYA 2YXNA 1NW7A 1AQUA 1HM5A 2A0KA 4ZP1A 3MWGA 1NN3A 4Z7QB 5K0SA 5KWIA 2AKEA 1DMRA 3HJUA 3L8EA 2Q3DA 1WO8A 3DV2A 3Q7TA 2FSPA 4P7GA 3O91A 1E32A 2PZBA 3TD9A 3ENKA 5LYJB 3RS2A 5LYJF 2CK3A 1KETA 1XEXB 1J9GA 1GXSA 5C9ZA 1E6UA 1JG2A 1I5RA 1V39A 3SJAA 2OBMA 4KCGA 3VOAA 4E09A 5BOSB 2X0IA 3JQAA 1N57A 1VIDA 3GJ8A 4NY1A 1YJBA 2VUTA 4M1SA 4QNRA 4C6TA 3M3PA 1ECCA 2QTVB 3INYA 3HMKA 2GPSA 1P62B 2QN8A 4PSCA 3KCQA 4V24A 3SP1A 4C78A 1NBIA 5AVTA 1PZEA 2MSLA 2Q3FA 2GFHA 1UZUA 2QPLA 4LYGA 4JBYA 2FWIA 4BIIA 5J4KA 3VO9A 3W7VA 1SCQA 4CQNA 1DJNA 3FWZA 3NHYA 5KTMA 4N48A 4MLDA 3ZD7A 4OLHA 3O0DA 1JVBA 4LNUA 5K45A 3TI7A 4JWTA 3V8RA 5K0NA 4QTYA 1T2UA 1JAXA 2BR5A 3D3WA 3GIWA 1LVHA 3QE3A 2R84A 5AHOA 1UDAA 2XNCA 3M3HA 4UTXA 1H5QA 2WYIA 1XCBA 2Y1KA 3RT9A 3WRXA 4EGJA 3WLLA 1DEOA 1IULA 1TVKA 1LX7A 1YZHA 3L82B 3QSGA 4CN9A 4R8KA 4KH1A 1Y6RA 1LQUA 1VMIA 1TMYA 2G83A 2UZ1A 3CLKA 1JLLB 1OAOA 2YJ3A 3KELA 2JH9A 3QLJA 2HDOA 3COWA 3HCOA 3TOSA 4BATA 4H27A 3VYUB 4B84A 4FHEA 3DXZA 1NONA 1IQPA 3AL2A 1S3FA 3D6FA 4XM0A 5AM3A 2OWDA 3SF8A 4QYIA 3KKMA 5F51A 5K5EA 5KKNB 2PLNA 2BI7A 2Q5JA 2QTNA 1SXIA 1E2FA 3DVQX 3JQEA 3WL7A 3GARA 4EMBA 3DJFA 5DCWA 1EWYA 1E5DA 4RW0A 2X8AA 5IKOA 3TLAA 1GPWB 2YFHA 1RAHA 1SK8A 2GZRA 2PPLA 3OH8A 1JXQA 4U3JB 3WGMA 2OESA 3E9NA 4US0R 3V4LA 5TDHA 3IUEA 3UPUA 1PBNA 5I3CA 3ACCA 1TZ2A 3I2HA 1GQRA 3B1ZA 4LYDA 4M1EA 4PAGA 2I03A 3GBVA 5D8DA 4ZCMA 4PX5A 4KDFA 4ACBA 2QZPA 1DIRA 3NIGB 2WDPA 2QDKA 3BG5A 1YB7A 2QMHA 3K0EA 4OIFA 1Z6QA 3ROZA 3AEKB 2BMDA 1AC5A 1J5PA 5BNTA 3CX8A 1H8HA 2YCLA 1UMCA 2ZZKA 1WG8A 3N2GA 4KAJA 1JFVA 4KFSA 1P2BA 4YQYA 3T1YB 3T99A 4N47A 2XMDA 3AJRA 1ZK3A 2A9KA 3KD3A 3O4VA 1B16A 1ZBQA 3I39X 4R9NA 4X1YA 4CM6A 4C2BA 5EEHA 4IX1A 1MJGA 2DG2A 4B8WA 1NF2A 1MABB 3DAYA 4HNVA 1M8PA 2GRUA 5I7AA 2QIOA 1P5RA 5JAPA 5D85A 1L4EA 2GN2A 3R3VA 3E2IA 2PZ8A 4Z9BA 4AQDA 3MWYW 8OHMA 1R8JA 1E5VA 3BK1A 2RAPA 3REOA 1I8TA 2G63A 4LXGA 3ZDDA 2G67A 1UP7A 1M6NA 1A4RA 5K1ZA 2YUTA 4XCXA 4W7IA 2O1XA 3CEMA 4L5JA 2V59A 2NAPA 5HK9A 5HOEA 3CPSA 1SMKA 3I6BA 3ZHOA 2F7SA 2E5FA 3LQKA 4AO8A 2FUG1 1OU0A 3GRFA 4HDAA 3I6QA 3ITDA 4CI9A 4ERNA 1V6CA 4G85A 1W29A 3ZWXA 1P1IA 3F5QA 3ZXXA 5ELLA 3JQ8B 4C2AA 1T6NA 2DZDA 3Q2KA 4F4DA 4H7IA 5IVHA 1N6NA 1CSEE 4JQCA 1Q83A 1JE0A 2C4VA 3GVCA 2AN1A 2H1SA 2XMCA 2XUZA 2QGNA 4JIMA 1U0RA 4L4SA 3NH6A 5FFMA 4C3UA 3CXRA 1YBAA 5L3VA 2WF7A 4X8HA 1XLTC 5EKUA 4HLQB 3TZQA 4EHLA 4F93B 4AP5A 5IBRA 4B43A 3FPCA 1OKKA 4YBRA 4TVSA 1GRVA 1KOJA 2EAUA 4JY7A 3DF7A 1X7ZB 1H2AS 4UATA 3T6KA 1Z5PA 4DBLC 4DGSA 2NYUA 5FO0A 4CF6A 1D4FA 2VK2A 4MWZA 2FP4A 2D1SA 1SBTA 2P2NA 3KVVA 5TT1A 3C4JA 1A2BA 3GLGE 3E1GA 4WFQA 1TZBA 3E8XA 2I3AA 4C08A 2SECE 2Q2VA 1KVSA 1V5IA 1EX7A 2GO1A 1RBYA 3KYIB 3GUZA 3HYCA 4AF8A 4JLKA 2XR1A 3MGGA 1EUCB 1P7YA 1Q11A 2ZJBA 3LQ1A 3UW1A 1MIOA 3CUWA 4EYOA 5BR1A 1XELA 1YQ9A 3KZNA 4PTYA 5HJEA 3IHTA 4DS3A 4MUKA 4IIEA 1TRKA 1H0KA 4FYVA 4EYQA 4G1FA 3WAJA 1HQDA 1R6BX 1NJ1A 2VBFA 3T3DA 1PQYA 4GPAA 1KMIY 3RSZA 3TWOA 3I05A 4J91A 4Q19A 2HCRA 3LW7A 3FRJA 1S01A 4HDMA 3GNTA 1QJCA 3LC2O 2B6NA 1Y9DA 2QX9A 5IW8A 3C24A 1ZINA 1GNRA 4RNCA 3WIVA 4M54A 4EW1A 1Q16A 3FPKA 3L49A 3WXMA 3OEHA 1PEYA 1JLMA 4YUZA 5BSMA 5TLSA 4OQZA 1QIMA 5LMNB 5A71A 1SCBA 1XC7A 3TQHA 4CEHB 5IUKC 4EI7A 3RUIA 1F51E 3PUIA 1B8NA 1CKEA 5KINB 1SU7A 4EGFA 4UHJA 3NNDA 2C20A 3BX1A 2IPMA 5H59A 2WJHA 4C4TA 1DAMA 1GR0A 2FOXA 4FOOA 3DHEA 1X1AA 4B87A 2OE2A 4KXLA 4TMKA 2D3WA 2UYHA 1SA0B 1Z25A 4A8JC 2WIGA 3Q7EA 1AK2A 4LJ6A 4OQPA 3PPVA 3G85A 3M70A 4GPZA 4HGOA 4WCFA 4JBWA 2WF8A 4C0BA 3P2OA 2ZBGA 4OP3A 3A9CA 4DR5B 2VHJA 4TXJA 5DYWA 5E2AA 3ZU5A 5K2OA 2OSBA 2RHJA 4TTPA 3LBHA 4ZVKA 1W85B 2HL6A 3FNIA 1R9JA 2HLDD 4KQIA 5A2GA 1TD9A 2Q21A 3MAGA 4WEQA 4ZRDA 2C4MA 3S27A 4MV5A 2BFWA 4RTPA 3NEJA 1ZI9A 4GRAA 1Y8RB 2IWRA 5JNUA 2O5CA 3TEFA 4AURA 3TIIA 4I9FA 3MINA 1QVZA 1ZPDA 4DJTA 3BSYA 3EFHA 2F3UA 3NI2A 3FZYA 4ND7A 1UDBA 3VR0A 4GPIB 4UOZA 1IY8A 4WX2B 3VHLB 3MTQA 2GBIA 4NS4A 2VK4A 4L3OA 1B73A 2Y4OA 4R7TA 3DFZA 3PYMA 2IZ1A 3SQXA 2JAOA 1N0IA 1GTZA 4Q4CA 4LFBB 5M3BA 2Y0EA 1F7VA 2YRFA 5A5FA 1MO3A 2VRCA 4XWYA 4W5RA 3OKCA 2CFRA 3WSWA 5DWQA 4EJSC 4ZIRB 5F2NA 1AT1A 4NCAA 1ZN2A 1I3OA 3EY9A 3HBLA 1FY2A 4V3BA 3E8SA 4KXUA 2WAXA 1WM1A 3HV0A 4W7HA 3T7SA 3TRDA 2BJVA 2YVLA 2Q27A 3LDFA 1C7IA 1DT3A 2J46A 3A1TA 2AW5A 2C8JA 4IUYA 3KOMA 1L3BA 5B3KA 4OK5A 5D3QA 4I4CA 3OWXA 2AR9A 2HH9A 2ZUUA 2LTAA 3E7FA 2VP6A 2YIMA 4I55A 4R1TA 3QLUA 5FBZA 1CR2A 1L1FA 1DJPA 5CLJA 4UU8A 2BF4A 2P11A 3C4QA 4KO8A 3L6OO 1FSPA 1SU8A 1P29A 1T0BA 3H8JA 2JLSA 3HDVA 1QRRA 3PUWA 3TUZC 2IEZA 4A8HA 4CT0A 3Q3EA 2DSNA 4YT5A 1KOLA 3RS8A 4GXQA 3G7NA 4UCWA 3UQZA 3D5QA 1KOFA 1O89A 4JU9A 2HYDA 4XOUA 1PFUA 4R1SA 3ESXA 2ZSFA 3GLGB 2YY7A 2ZXEA 1BU5A 1YE5A 4BO4A 2JRCA 2ID4A 1JAYA 1ZGCA 2CHQA 1QHHA 2K2QB 2X1LA 5IZCA 1QPZA 5E7JA 3VNRA 1NDUA 3BWCA 3DONA 1UH5A 3ZJYA 1M83A 1ZVJA 1U7OA 3LPLA 5DASA 2ZRCA 1L3CA 1N2HA 5DI3B 4DLTA 1KQ3A 3IR7A 4IO0A 5CB8A 3K8ZA 3RVOA 4MW9A 4NOKA 3PBKA 1KYQA 4DANA 5C1BA 5LQMA 2CV1A 1C3XA 3HNOA 4P5PA 4F3NA 1R9NA 5TJ9A 4EB6A 1CFZA 4P4NA 3PXUA 1AUVA 2R4UA 3DMHA 5EIBC 3VH2A 4EF5A 2RGDA 3QEJA 4RUKA 4DUZB 2PG3A 3L1HA 2G8NA 4UD6A 1EVQA 3MAAC 1KO4A 3EMKA 3UA4A 1VB5A 5ES3A 4C6RA 2B69A 3KAPA 2EVWX 2A35A 1UK9A 4KN5A 1I1NA 4NTZA 4X1IA 3RRXA 4F1JA 1WVIA 3IAS1 2VYNA 4RULA 3GUHA 1ZUNB 1EXWA 1NBHA 4TXMA 3OQIA 2WIJA 4DSOA 3NDBB 1RQPA 1E1KA 5GMOA 4LK2A 2DU8A 2KS6A 1U8CB 4C4XA 4HXGA 4RMNA 4FZVA 3AEUB 2AC4A 3UUWA 3FROA 2Y3IA 2IBTA 2FEAA 1IK6A 3GFSA 3OT4A 5KU7A 1IUPA 4CEJA 1M7BA 1PKEA 5FUWA 4ZEXA 2I66A 2V58A 2ZIFA 5LBTA 1GNPA 3DE3X 3TD2A 4V0SA 4RHFA 1MOPA 1GFWA 3U09A 1V3QE 1M1XB 2PGDA 3CPHA 4IHJB 4IHJF 3SU8A 3STWA 3V80A 4TPKA 3WB9A 4EEZA 2E89A 1U6IA 1WE2A 1VIYA 1JR4A 1NQVA 4IEIA 1QH0A 4PZZA 3UV6A 3GD5A 2ZBFA 3CVWA 1T9HA 2H5IA 4LZNA 3EPKA 3WKBA 3BMCA 4NZ9A 4R5HA 2GWHA 5JT1A 3K4QA 1MORA 2O2CA 2I0FA 3LS2A 1IEWA 1E1RD 2OR3A 4LMAA 2XQKA 3LI2A 1L7PA 1UEJA 1YGYA 2Q07A 4NV1A 5BN3B 1XO1A 1Y7HA 1ECPA 1YNOA 2FEOA 5FNZA 2CMHA 5HMLA 2OCGA 1JEJA 4UAUA 2ZJ1A 3LCUA 3TAXA 2XYVA 1P1FA 4FYHA 4IQ8A 2Q5IA 3NB0A 4LHSA 3TZBA 3LM8A 4XSVA 4JJGA 2J5BA 4HVLA 2IH5A 1NQTA 4O5OA 2W2VA 4B44A 3TJMA 1HTWA 1UEXC 1WUYA 1L5HA 3ZV3A 1K98A 1Z8FA 1IL0A 1R8YA 1D2CA 3I52A 1SG9A 1ZD4A 3N6XA 1T2NA 3Q7RA 3CTMA 4OXNA 1FBTA 3UBMA 4OQXA 1XPUA 3RAJA 3U7RA 2J3KA 1C50A 1T36B 4XYMA 5IM4A 1JAIA 4K81B 1WZEA 4PS1A 1WXWA 4EENA 1Z0ZA 1PJ4A 3KETA 5CXQA 1TMKA 1I2DA 4HQNA 1QQ6A 3ETJA 3X1ZA 1KR2A 2Z58A 4U6QA 3UN1A 2QZ4A 2YXEA 1BYUA 2GFIA 1ZM7A 4FLFA 1NNLA 1UAGA 4YEDA 4UOEA 1QHNA 2PFSA 4JR1A 1NM5A 3A1WA 2AH5A 3GRVA 2FWPA 4HG2A 4IJ5A 2IHUA 2YINC 4WXEA 3H86A 3DQPA 5ALNA 4II3A 1CEQA 2Q6TA 2Y1LA 3UMFA 3OCXA 1M3SA 4ZT5A 3UT5B 4DQDA 2AGVA 1Z22A 1K9SA 4DMCA 1PFVA 3P9KA 5CD9A 1N32B 4WBNB 3DMFA 4WBNF 4LXUA 1IM5A 4GKAA 4X90A 3MT9A 5B1DA 3NXSA 1ANKA 4JFAA 4RH1A 2JVIA 3N2EA 2VSYA 2V45A 3DC2A 2PX2A 4UD2A 3GI1A 4PLYA 1CUXA 2VOJA 1K27A 1ZRSA 1JEQA 3H11A 3IBCA 3L04A 5LBUA 4DSAA 1T4GA 1GCOA 4GHWA 1CP2A 5GJWC 1ODKA 1YXMA 2YNMA 1A9QA 4QUDA 5EWJB 5DGXA 4JLMA 5EINA 1QV9A 3S2IA 4YMIA 3JVUA 4LSMA 3DYIA 1N2EA 2IYTA 1JJ7A 1PF7E 3GNSA 4GI1A 4OQMA 1HY3A 4C20A 2QE7D 5KQPA 2UXBB 1UJ6A 2RK3A 1QTRA 3LDHA 2GETA 1HNWB 2EXXA 4IRUB 2R4QA 4K9PA 4Q7QA 1OT3A 3NBQA 1ZWLA 3OUTA 5GJVC 2QYOA 3V7FA 2PZMA 4F6LA 2OCKA 5C1DA 2XJ9A 1B0UA 1J9EA 3OX2A 1JR3D 5TS3A 3RIXA 3TINA 1F3OA 4JXXA 2M1XA 4FDVA 4J7UA 4AKTA 4DSUA 1UOEA 1Q1NA 5COBA 5IP5A 3DS8A 2BFNA 2BP7B 3ZXUB 4MVJF 1E5TA 4NG5A 1MB2A 1O77A 3N8HA 4PLZA 4HUTA 1IQ0A 1KO8A 3B6IA 3LRXA 2VTKA 1QK5A 3SX0A 2PRJA 2CXRA 3CISA 3HS3A 2WSSD 2WWGA 2JH3A 3H9JA 4MWBA 1J24A 2IY7A 4HYEA 3PGA1 4RLFA 2J8ZA 3C6KA 4H4CA 1R4MA 4LYJA 3JD3A 4BP1A 5LXTA 1BD4A 3SN6A 2OK8A 5I9NA 1N9GA 3NEAA 4KE6A 5K9ZA 5JATA 3GLIA 2H59A 3NYQA 3DQZA 3RTEA 4ZOLA 3FHCB 1L7EA 2WAAA 4QPDA 1AB5A 1DJMA 3SZ3A 1JUDA 1YFKA 4KDRA 1OYVA 1QIDA 3GJ3A 5LDGA 3UXEA 3IUSA 2Z9BA 4E5PA 1SCNE 3ESAA 4U2CA 2XMGA 3EEOA 1WB5A 2OO5C 4J4TA 1H0SA 1N8SA 2DQZA 3GCWA 3ZI4A 1VKOA 3IB6A 4WKBA 3SJZA 5KYXB 3Q0EA 4AK9A 4CG0A 1NJ8A 1VDMA 1GO2A 1R6TA 2C78A 3A9VA 1GEGA 5CDHA 3KAQA 3VPSA 1EESA 3AR6A 3ZVLA 1HE5A 3NVMB 2IIBA 3GZNA 2BJWA 1U8YA 2I99A 3LX8A 4FFVA 5TS2A 1G8HA 2WSBA 3VVMA 3WGUA 2XB2A 4U7TB 4WDRA 2DXIA 2ZQYA 1HZJA 3UOGA 1E58A 4L16A 4M0CA 4BWYA 3B1YA 3ELDA 3W6NA 5D6NA 3UMGA 3R0ZA 1BE6A 3VA7A 4N41A 4WFKA 3ZWCA 1V9SA 4QFCA 4Q7EA 5JV5A 2FOLA 3SQWA 3A9SA 3ZDYB 1NBAA 3OCCA 5AI6A 4C76A 2H5EA 2Z5FA 1EBUA 2DP4E 1YQDA 3OJCA 3ER8A 4TTJA 4BX0A 1UBEA 1X7YB 1KP9A 3G0CA 2OCXA 3GQBB 3P26A 4N54A 5D00A 3RAGA 3N8KA 1W9MA 4J43A 3L43A 2GXSA 1W5SA 3QXCA 2IXGA 3HBJA 1B26A 4DR2B 5EUCA 2DY1A 5SZHB 3VTKA 2Y0BA 2GLTA 3BHNA 4ZRMA 3CKMA 5B7PA 1KZ1A 4OD0A 1A4IA 3IKLA 4OFZA 4F1WA 3UMJA 2JLZA 5FUBA 5LKAA 4G1MB 3NAMA 4D25A 1VLHA 2GHQA 3HDTA 1ZONA 4OVKA 1SBQA 3IP6A 3VPCA 1XMSA 1HORA 4JDPA 4JC4A 5AHWA 1Q0TA 1G8FA 1Z6TA 3SFTA 3B6JA 4R51A 2CWWA 3ABOB 5AW1A 3NEPX 2G9UA 1J8FA 1SCUA 1XVVA 4FYJA 3WTCA 1WSBA 2IYUA 2POQX 3A1DA 1C7RA 5HK8A 1FFBA 1A9TA 1R16A 4JI5B 4N5LA 4BO8A 3ECCA 3P9YA 4BO0A 2X8LA 4PHTA 4UBKA 2C97A 1JR2A 3LZDA 4PZAA 4IFTA 3P2IA 2CVZA 4KPUA 2XUQA 1K08A 2PBFA 4F97A 4R9UC 1G3UA 4MDFA 2C2HA 1XQYA 1L5OA 4G5OA 5CFOA 4B7ZA 4N3BA 5F52A 1OX4A 5K99A 3QOYA 1E3WA 2AWOA 3HCPA 1FA9A 3QELB 4E08A 2AXPA 3FUUA 4B4WA 5I5EA 1G3RA 4LJ9A 4B2PA 3WZMA 3AWDA 3MWDA 5EMMA 1UMBA 5CB6A 2HRQA 1XVIA 3FOAA 4GM4A 4DDMA 4KODA 1DELA 1XYYA 4YJGB 4TKUA 1EVZA 3KSUA 3N0XA 3ROMA 3GLFB 1JS1X 1US8B 1F20A 1I2AA 4HXEB 1EB8A 1NXPA 2J9FA 4LHZA 3ULKA 1CVIA 1XEFA 5BYJA 4BFCA 3U7QB 2PV7A 2V6IA 3OZ7A 1BVYF 3FTFA 2WJVA 3AKZA 5EOVA 4WGFA 1GRNA 2J7PD 3T4UA 3M4ZA 4F91B 5J5CA 3DOCA 3CVJA 1U2QA 4R54A 5FORA 5D1NA 1MEJA 1U2GC 4P0PB 3ZWNA 1YGPA 2EZ9A 2FCRA 5DRTA 2HZ7A 3ANYB 2UUCB 1YZFA 2KHZA 1E1LA 4AY5A 1UJ5A 2I67A 4AJIA 4D3SA 3GAMA 4J90A 4ZOCA 3RYTC 3DNFA 4WACA 2X1HA 1CNEA 1OXVA 1EB9A 3SIRA 3HCNA 1E1CB 4GLFA 1H8ED 1DJQA 3QKRB 2I3DA 1J7JA 2C03A 2RGCA 2WAMA 5SZJA 1H65A 2ZIZA 1HFJA 2ZFUA 2QVGA 4ZVOA 5BSFA 3OQPA 1CRPA 5ALDA 3A70A 3KBBA 1CUDA 2YHBA 4ENRA 5JD4A 5AVRA 1PEDA 2CDAA 1E6WA 1PCXA 3TLJA 3VJLA 3KC2A 2ZB4A 2ZYTX 4LZAA 4HQ0A 3FTPA 3RSCA 3ZW8A 2FSUA 5DOZA 1J0AA 3TLYA 4ZT3A 3KR9A 5REQB 5L7WA 3FIUA 3OE5A 1F8YA 3UJBA 1Q15A 3MUFA 4ABTA 3I6YA 1OLUB 1E9AA 3NAQA 2YMQA 5E9JA 4JGIA 4UHBA 1W2HA 1GKLA 1Z5NA 5ALYA 1A9OA 1RYDA 1TTQB 4XFDA 4DCMA 1VHWA 3TLMA 2CEAA 5AJVB 5EFOA 1U5CA 5CR9A 1XA0A 2GD0A 1K8RA 2YWCA 3CW8X 1IJEA 2A0YA 2CW5A 2WZDA 2B82A 2DQSA 3OZFA 2E7ZA 4Y1FA 5IHXA 4TMYA 2QTRA 1UOQA 3CF4A 3ML1A 4KAAA 2ACEA 3W9SA 4ZGGA 1Z2PX 2WU8A 4J07A 3UCFA 3NZEA 2VBIA 3DEJA 2W6JD 4K6HA 4G0UA 1KJZA 2QJRA 5JYDA 3AR8A 1K6XA 3NTUA 1BCRA 4Z3DA 2BT4A 2Q8NA 1LQ2A 5EQJB 2PT9A 1BWSA 3O8DA 1PG2A 1NAHA 1UT5A 2QSJA 1IY0A 3SY8A 2GJ8A 5B1YA 4B40A 4ZK2A 3ETGA 3L8HA 1KFEB 1YMUA 2H1IA 3PXEA 3RT1A 4BMZA 3FCSB 5C5EA 2LUOA 5JFTA 2UVPA 2V4ZA 1G20A 3JAWA 3BREA 1WPGA 4YI3A 1JG6A 5MGNA 3EIHA 3FCAA 4JMPA 1LU9A 2VBGA 5JVDA 3H2ZA 2Q3LA 4S1OA 1L2TA 2VPYA 1TF7A 3NHWA 4FDUA 3ZDAA 4L1KA 2QORA 4K8OA 2JLUA 4A82A 4B3TB 1QHYA 4XSGA 5GP1A 1AHHA 3CRRA 3CRNA 5BN4B 2YMPA 3W5SA 4AJ9A 4M9UA 1GPH1 3T4EA 1UBJS 1HFEL 2IQIA 5B7GA 4P1ZA 1YAHA 4X1OA 5AMXA 2WMOB 5T5QA 2YRXA 4GX0A 1RCTE 4FBMA 4WLFA 2CVQA 1IN6A 1R10A 2JHGA 2NZWA 4EABA 1M2VB 4BXOB 3W2GA 2H57A 3JYPA 3VZBA 2DPXA 2EBUA 5EWLB 2AYZA 4OHRA 5ECGC 4UXHA 5C35A 3DM5A 1G1MA 3AJAA 3EEFA 4PQGA 4YWJA 4FKMA 5IUNC 3I42A 2O1SA 3CPJB 3I12A 3JASA 3KKNA 4LNAA 5DFAA 3ROKA 5K3CA 5KQSA 1F8FA 4XOIA 4I7EA 5CT5A 5DNEA 4RD1A 2OM2A 1K8YB 3PSAA 5F7XA 2H16A 1C3JA 2VAVA 3U80A 5JDIC 1G7TA 2GK7A 3PS9A 1UBMS 4YJFB 1BFKA 1ZM4A 1T5SA 2VS1A 3T7AA 3O4GA 1QKKA 3FPAA 5DT9A 3WYAA 3WAKA 5KC8A 5K4HA 1VI5A 1X0VA 1XCMA 2HRDA 2NXWA 3QNMA 1XJCA 4BOYA 1MCZA 2FW8A 2R2AA 3C3PA 2AVNA 1UZNA 5M04A 3MPOA 2VNKA 4ZI7A 1P8AA 3L1KA 4Y67A 1JBEA 3UWMA 4W9MC 4CGYA 2NXEA 5GV8A 5ED0A 1FDSA 1XZQA 1SM4A 3H2SA 3KQYA 4IINA 1Q1AA 4MQBA 4TTIA 1FQOA 2H85A 3AX6A 4RA6B 5BQ5A 2A78A 2Y1WA 3OE1A 4MV0A 4A8TA 4KLAA 1EG2A 2YJ6A 1V6AA 2I29A 1V43A 3QW4B 3JQ9A 4QXMA 5HGJA 1QDEA 4G8DA 2ODWA 4U7GA 3GLFA 2H0AA 3I2FA 5DHQA 3MS7A 3DHNA 3JY6A 1F0YA 3VO8A 1V7PC 4P3NA 1REQB 2IKSA 4MOWA 2ESRA 3Q72A 4LOKA 4DR6B 4ZZ1A 4CV2A 1KAOA 3THOA 1U5BA 4MHTA 1ESZA 4DIFA 3IE0A 1FP4A 3NKLA 1BJKA 2O7QA 4M4SA 1H69A 3URKA 3H7IA 1PTJA 1V1RA 3HUFA 5HXAA 4GZMA 1WW3A 4WQMA 3DQQA 2IWHA 1KJQA 3BICA 3V4VB 2AHOA 2RD2A 1USKA 1N0HA 1C41A 2ZE5A 4ENPA 4PIVA 1HH4A 4TXHA 4ZVSA 2XB9A 1V8PA 4M1YA 3W5VA 3BGSA 2MINA 2GM4A 4URFA 5FUXA 3S2YA 3T4XA 4BN0A 4BPBA 4Q9AA 3U9LA 3S2SA 3RJZA 5F23A 1IIBA 4AKSA 2MJLA 5B3JC 1NV9A 1JYFA 2I6UA 2W2KB 4LJAA 3EGCA 4BRWA 1JB1A 2RE8A 1U2EA 2AUTA 1PGNA 1R0LA 2C77A 2JIQA 2R6HA 5ALXA 3ZIUA 2DOKA 5I7EA 4M99A 3QBTA 2GCGA 4IDDA 4L75A 1RM5A 4F0JA 3K05A 3QXGA 3PHHA 4OYYA 4JR2A 2RHTA 5ABPA 1BU8A 5DE3A 4JLAA 3TYXA 1J97A 4P3OA 5DGTA 5EJ2A 4YX9A 3BGVA 2V03A 1VJ5A 2BHTA 3GRRA 2WKRA 4MUYA 2HRZA 3EXHC 3S40A 1EP3B 3CIFA 3KOXA 4B5LA 4EUEA 4IR7A 3AEXA 2WD8A 2H2GA 5LUBA 4BGDA 1UQRA 1EVKA 1PYDA 3CUKA 1GY8A 1TECE 2F64A 4Y0AA 3HXPA 1NW9B 3VSDA 4RQAA 5K01A 1WDTA 4J1SA 3AF5A 3FNHA 1DC7A 2ZCJA 3HQ4O 4MYUA 3BFKA 2QU7A 3DLTA 3P27A 4BNKA 5M29A 2VH2A 2X4IA 3NO4A 1UKCA 4ZU3A 4ZV4A 1QHXA 3ORHA 3U6KA 1QZUA 1P60A 3PGXA 4YFVA 2OQIA 1HDZA 2EGGA 2VHZA 3B1KA 2PKWA 4KTVE 4U1RA 3VOTA 1Z33A 4D79A 4F2HA 3ESZA 1AS0A 3O8LA 2XUPA 3EULA 1RZ3A 4H18A 4L5AA 1QQ7A 4PSKA 5CIQA 2FI1A 3BL6A 5ED4A 5G2OA 1NBOA 3PHLA 3TSWA 4B4OA 3O1HB 3UOAB 3VUEA 4YRIA 5A9SB 4QOGA 2J7KA 4LJ8A 3WX0A 1VE7A 4KQWA 4TLCA 3ZZTA 2CUNA 3C5HA 3ESQA 4IKPA 2ZIXA 5AWFC 4IIHA 5CFRA 1X1CA 2F90A 1XVTA 5IWAB 3DBRB 3FGNA 4Y0NA 4B33A 3VVLA 2HPAA 2MR5A 4C4AA 2QN6A 3FTNA 3NTVA 4R40A 1E4YA 4QDJA 2EF0A 2BGKA 2XSZA 3I9KA 4ROTA 4LDAA 2HQ1A 4DRZA 1AQ6A 1XDGA 1SUWA 3ZHYA 4GVXA 2VPIA 4GXTA 4MUJA 4ZT2A 3VPAA 2PX8A 5BMOA 3GA7A 1G5QA 4AWXA 1OLSA 3QKTA 4RMJA 3KYBA 1FEZA 1CWUA 1ILWA 1RW4A 4E5MA 1XB2A 1A04A 2IUEA 4JAVC 3SE0A 3I8SA 3Q0IA 1KYWA 3GJ6A 3IXLA 3SM9A 2QPAA 1OBVA 3TQFA 5JLAA 4ESOA 4CTOA 4R4JA 1W8IA 1HYHA 1IBCA 2CZQA 4YPFA 3EA4A 1MVLA 1RFGE 2NLOA 2ZKIA 1LI4A 4KIJA 1NJ2A 1NSTA 4QTXA 2GCEA 5ILQA 3N70A 4P7KA 2QSYA 3M82A 3T3PB 4KXVA 4V39A 4BVFA 3GF4A 3SLRA 3UMBA 3T95A 2NSLA 3BA6A 1LQTA 1KYIA 2C0CA 4J0EA 1Z6PA 4B45A 2Z9CA 2VI5A 4R1PA 4LXQA 5EWMB 2XGJA 5JD6A 4QDTA 3DBLB 3INTA 4HAIA 4HQFA 5ENZA 5FBWB 3TFOA 1Q17A 1T1GA 5FBHA 1XU7A 2FUG6 1HQYE 1RI2A 3EIOA 4QJ5A 4B3SB 1YU9A 2I62A 1S5PA 4LHWA 4IDHA 4R7GA 2GD6A 2KLBA 1TYAE 3EFOA 2D4HA 1RXEA 4PGMA 5F2KA 3WLEA 4B32A 3PE6A 1RQNA 4QQ8A 5DB4A 1U0SY 3G2IA 2ZRFA 4QHTA 4YQEA 5KSOA 4X63A 1TM7E 1IIRA 3HCRA 1EE1A 1ZH6A 2GJ9A 1U8TA 2RB5A 4C7XA 2OXRA 3DBHB 3UHPA 5IEJA 1U0FA 1G42A 3R7AA 3PHIA 3JSAA 2FY8A 4IXNA 4XW2A 4KLZA 3FF4A 3SYLA 3JZMA 1E7YA 4C4SA 3ZTYA 4FNGA 5LR6A 1Y1SA 1MMFB 2VXOA 3K7EA 2A4KA 1LV7A 3O38A 1NYLA 1Q3KA 1ULZA 2R9VA 1P74A 3U13A 3U0BA 3U9SA 1FC0A 5FULA 4OMDA 2MYPA 3OJLA 2ZYRA 3LUFA 5CDUA 4JZKA 1XQVA 4D4HA 4Q9NA 3D8TA 4OFWA 5B58C 5C5IA 4W5TA 4YPVA 2OWEA 4Z7JA 2GNOA 3KXLA 5T6MA 4UCXA 1FL9A 4AJJA 3SZMA 2XNHA 2NU7B 3A28A 1TT7A 4JQYA 3Q88A 2ZANA 3HADA 1YJQA 1W34A 1ETHA 4YRGA 2PX6A 4WWHA 3O47A 1CW2B 4U39A 1WY7A 1Z75A 4QQNA 3RJ9A 5AW8A 1FTGA 1BX0A 5F1KA 1MH9A 1ZKDA 1FMCA 1N77A 5EXPA 2RGBA 2VDNB 3NHMA 3DV9A 3M4YA 2A5GA 2PQMA 5K0CA 1QBGA 1ST2A 1ZM9A 4FNMA 2I34A 5JJBA 3F7OA 3R3YA 4FFBA 4F3KA 2BM9A 4KBGA 3ZW7A 1POXA 5EHXA 2WM2A 4H1TA 4BB0A 5FPSA 4NKRA 4UVIA 2F1IA 3LXMA 2ZYUX 3HUEA 2IBSA 4MKRA 5DLPA 4NIMA 4IPTA 3OZEA 4UU1A 4LC9A 4NH4A 3R7WB 2ZYIA 3ZLUA 4GSKA 3UKDA 1I2BA 4GMHA 2KE5A 3UIEA 4E5VA 2OCIA 3DOIA 4GU5A 2O8FB 5HKKA 4XQGA 5HFJA 3ZQJA 2AG0A 5BSTA 1EK2A 1ZC3A 2VSNA 2PGLA 4C2TA 1CQWA 2RH5A 5C1PA 1MH1A 1WF6A 3IPYA 2QN3A 4KTTE 3GJZA 4C7JA 1N1DA 5DHRA 1ZVMA 2HF2A 3TIXB 1QVVA 2PO7A 1C7QA 3GQVA 3HCEA 4WKGA 5EIXA 9MHTA 4KMMA 3DM9B 5JAOA 4G1BA 2JKZA 4K9LA 2HWUA 4QE3A 1VRVA 3N75A 3KHTA 4UCQA 1FX1A 2H17A 3I1YA 2KWIA 2E85A 4P3XA 1ONSA 2ZBUA 4CIAA 2WWWA 1W76A 2OLKA 1DC3A 3D6HA 3DFMA 4LYFA 1XVLA 1B1CA 4I1UA 1P2UA 1XZ8A 4DTIA 1G6Q1 2CUTA 2Q46A 4YMHA 4YRDA 4LMBA 4P4SB 4HJRA 3GDOA 2IFTA 2PL1A 4EY4A 3BA1A 2ZSUA 2BFFB 3GUVA 4BMOB 4F3TA 2FEXA 1DO8A 1R3UA 2W6CX 2BH9A 3OTQA 4U2BA 5F64A 4D5GA 5L6LB 1A1VA 3DYBA 3GLVA 2EFHB 3HRIA 3MWEA 2AQKA 4KKVA 4BO6A 5LZ7A 5HUHA 3HJHA 5KNCA 1UKZA 4K6OA 1BHJA 1QDLB 2Q2OA 5FDFA 1LTQA 3GLRA 3M9WA 2Z3WA 3LWDA 4RZ2A 6REQA 3N8DA 3Q3VA 4M86A 2H07A 1I94B 1G5IA 1IHYA 2I4NA 3O4RA 3VDNB 4QYSA 4FGWA 2W6PA 2O6HA 3A6GA 4G41A 5GZ6A 3D6TB 3R9WA 4KYVA 1FLNA 3CEJA 2GCNA 2ZYSA 3GLHB 1KZ4A 5DLQC 3QENA 2QD4A 4O6VA 3EVCA 1R1DA 2PGXA 2JBWA 2QAGA 4A4DA 4U0KA 4C3ZA 3ZJVA 1AV6A 3P2JA 3ZDBA 2BUAA 5E38A 4BNLA 3BYZA 4E2WA 2J09A 4AVYA 1Q57A 4D81A 3G2MA 2YASA 4CUZA 3FETA 2YWDA 2WNIA 3AJ9A 4U5XA 5I9SA 3RS0A 4LF5B 3KYCA 2XT0A 4LGVA 2ZT6A 5CBKA 4LJKA 1C2TA 1YRWA 1VL2A 1IQUA 5IN4A 1RE1A 2ARKA 4IIDA 4AB1A 1XTIA 1W7AA 2HSDA 1EBFA 3G79A 4QUJA 4PN3A 1I13A 4IV8A 5C8YF 5KZMB 4R1MA 2O3SA 4N3AA 3RWMB 4AF7A 2MCFA 5I47A 4JJ4A 5D87A 1YL6A 2HRRA 4QQRA 1H6CA 5HRCA 4RLQA 2ONCA 2C29D 1GAQA 3TN7A 1Z2CA 2FJUA 3D6AA 1EXNA 4OI1A 1NN0A 3T1OA 5LQSA 3QBJA 4XYLA 1M76A 1PT5A 2CNWD 4FTWA 4AYXA 5KU1A 3KP1A 3SHVA 2OV3A 1BW9A 1HDCA 1MENA 3T8YA 5AR1A 2WIKA 3SC3A 4F6RB 2CBGA 4F45A 1OA0A 1ECJA 4K2AA 3FHTA 2J59A 3KALA 1ZLXA 1X77A 1VRWA 1ZIOA 4NJEA 1Y80A 5HKBA 3PQ2A 3ZNNA 4JJ8A 1O6ZA 2WUEA 3HZOA 3PDHA 2JIRA 2CNOA 4X1KA 1CBUA 1GT91 2WV7A 3VC2A 1E2HA 2H2FA 4BX9A 2QYTA 1EUZA 2HQOA 4JA2A 1T3SA 1J8VA 3X43A 1NVXQ 3GMDA 2A1UA 4PC7A 3CO0S 4BFVA 2VHYA 3RW9A 2QPOA 4BO1A 3EC2A 2I4OA 1PZXA 2ZVDA 5GWXA 4OSPA 3JAMA 1RPNA 3KZXA 2NVUB 4JBIA 5B64A 1AHIA 1P2DA 1WDKA 2XGSA 3I9JA 4Z86A 1KZ6A 5KIAA 5MFZA 4LE0A 3DMYA 4RKYA 3L1JA 5HZGA 5A7HA 1L4YA 1V1MA 3FNQA 3FF1A 4H7DA 1X1RA 1YZKA 3EY4A 5ALIA 5EMHA 4Q3NA 3NCTA 1B2LA 5HRUA 2W48A 2FPKA 1TGYA 2ETXA 1PAUA 1SB9A 4AS2A 5H8WA 2B61A 4EPVA 1WZUA 3QMVA 2Z1NA 4CMJA 2ZZNA 2NUTB 4F7WA 1WCXA 4A1OA 4FDLA 2IBMA 3EYAA 1EWQA 3P0JA 4BNNA 1USVA 2CCGA 1DDOA 3P0FA 3OPYB 4KQ1A 3E15A 4EAQA 4FEGA 5AKEA 4Y6GB 3N2KA 4YECA 3RSQA 2OUIA 2RSLA 3AQ4A 4EMTA 4C14A 2J5KA 4LKRA 5B12A 1UL1X 3QKIA 4LOJA 3U4MA 3VR2D 3I34X 2BKVA 1QFMA 3CF4G 4A16A 3EB9A 3ZLJA 2PJZA 2PZJA 4LQLA 4Y6SA 2DBQA 1A69A 2PMEA 2V3WA 3TRIA 4A1FA 2C4HA 2I78A 3IQIX 1EP2B 4L50A 4B2YA 5I45A 3MWKA 2R47A 4LRXA 4WDQA 3TIFA 3A6FA 2REOA 4OB7A 5BVGA 5BR8B 1T9GR 5FNVB 5FNVF 1ACLA 4YRAA 4DCSA 1LPMA 2FR8C 3ZE1B 3LL7A 5EA2A 3PDIA 2H2HA 3OECA 1SOVA 3DDUA 3ZTTA 3LPCA 2VC2B 3IHLA 4XIJA 5JW6A 3ESYA 3JCZA 4HH3C 4W1QA 4JLUA 2JIZA 5TVKA 4P7JA 1BFUA 2IYPA 4ZMBA 1RRGA 2RB4A 3M6XA 4DM7A 2A3RA 5LN1A 4IJQA 4MJXA 4BBAA 2ZBVA 2XWSA 1Z17A 1N4DA 4TMWA 1RC0A 1GVNB 5DWDA 1WJGA 3CFYA 4AS3A 4AL4A 5F98A 3A1EA 2EKBA 4IWXA 4Q9LA 5G1NA 4E0BA 4HKTA 3RYHB 4E14A 4HL6A 3ZQ6A 2BFOA 5KNBH 1T0JB 3CM0A 4CM7A 5G3ZA 4CLOB 4WW0A 1Z3IX 1L8AA 1KY5A 3BHMA 4GG1A 4S24A 3LPDA 4RYDA 3CBGA 1M1ZA 3E7XA 5G41A 3GA5A 2FPIA 1GQQA 1ZX1A 3Q8XB 3IL2A 1AXGA 1QVWA 4HGRA 1SXHA 4M88A 3EQ7A 4MA0A 4O4HB 4O4HF 2AE2A 1MOZA 1IOWA 2OCPA 2VNJA 1T29A 2ZAYA 2OCAA 2ZE8A 5EJAA 5GY7A 4B3CA 1S02A 1I6LA 3HWRA 1KSJA 4FIDA 4P7FA 4AY2A 2P90A 1QFXA 3HLTA 1P2VA 1MA3A 4JASB 1CR4A 4E31A 2G1KA 1SVLA 1YI1A 3KEFA 2NO9A 4MPJA 4NLLA 1HDGO 1W30A 1XAGA 3MGKA 1JZQA 3OZVA 4PGAA 3SC2B 4E88A 3FMPB 4ETNA 4EW3A 1LZKA 4W6QA 4BMNA 3QVOA 3WQSB 4EHIA 1USIA 3VPXA 5DNWA 5KPJA 4IFIA 3QEKA 3ISJA 1XTPA 2ECQA 1KR5A 3D7NA 2VCHA 2PR7A 2PXXA 3L2OB 3NWJA 4US2R 3DOHA 1KA9H 2X5JO 4U2DA 2YY6A 4V0KA 2AB0A 1IB6A 1YIOA 1J49A 3BWEA 3MM4A 4YAUA 5HTOA 3CBQA 5DEIA 2ZREA 4DCVA 4L8VA 4B6JA 4XQEA 3WYCA 1Y6FA 3U7GA 1ISSA 5EIEA 3ADCA 2HREA 3U49A 4EQ6B 2ZG6A 1EAMA 1KDPA 3FFBA 5DTRA 4C89A 3T3OA 3KZ1E 3WQBA 3BK2A 2WOJA 3CMCO 4CHGA 5HR5A 4TL8A 1U0OC 3CW9A 1J0DA 1GZUA 2GAJA 4MGIR 4MVJM 1QGUA 2IEYA 3L6RA 4PRLA 3LBYA 3STYA 3VR6H 4RTSA 1XMOB 4MW4A 3TB4A 2GEFA 2BMWA 3VR4A 4Z2AA 5KPDA 4IDPA 4BQRA 4EF4A 4KR6A 4MO2A 1SUCA 4D9NA 1EFTA 1O4VA 5FPQA 5LMUB 1N36B 3KUKA 2MMCA 4PAOA 5BYKA 1M73E 4OKIA 1D4AA 4KNWA 3TMAA 1FNNA 3I1JA 3I04M 3N7UA 1KEEA 2W6ID 2FAXA 2BRUC 3P0RA 1GNSA 4HD8A 1J07A 2LDXA 1C0PA 2Z0MA 3HYNA 3AVPA 4PBSA 3ZHBA 4HLNA 2NVOA 3FBWA 1KJ9A 1WU8A 2WJIA 5EJGA 2ID8A 2XB6A 3N2NA 3G8DA 1JFLA 2NYRA 2LCIA 2C5EA 2JIPA 2D74A 2GNAA 3QV1A 1AUQA 2HRBA 2J3JA 4CDMA 2C1XA 1TCVA 1IHPA 4Q3OA 3C8HA 4CM5A 4S2EA 4F12A 5CRIA 5JR3A 3IJ5A 1MRSA 1SCJA 2WE7A 3DAFA 3LTEA 3IPXA 2G5GX 3LNTA 2QG9A 3OIFA 4QU0A 1Y4DE 1FNMA 3ZY5A 4W9NA 4G8CA 4W8HA 4OH7A 3CRQA 1VE6A 3LLSA 3UF0A 4O0MA 1ECBA 1I51A 1ZH8A 4EHKA 5K20A 2X5NA 3OEED 3F1LA 1AURA 1DX9A 1TCCA 1VE9A 3EW7A 4LE2A 4ODIA 5EMKA 3W90A 4FB5A 1E1QA 4JCOA 1GA6A 1KI4A 1BMDA 4B3XA 2EJTA 4DZTA 1ZXBA 1YJXA 1U8AA 1G2QA 1OUMA 3DT8A 3L77A 4R1QA 3ZV7A 3FVQA 5DGDA 1MFZA 4CMIA 4OLJA 1KVRA 1GRRA 3D2LA 1Q21A 2C3OA 3PQCA 3AFIA 3KL4A 2W0SA 5CX4A 1E4VA 3X1KA 4ZGWA 2HW8A 2D13A 4I19A 1PZGA 3KB6A 2ZUCA 1S1MA 3EPLA 2XKKA 3KRTA 2GFQA 3NNSA 4EA8A 2ZTVA 4XX0A 4A0SA 5I8ZA 4EIWA 3H9CA 4KQ6A 4DV5B 4BAGA 4RZQA 1RBZA 3BCSA 4IMJB 4TL6A 2P4UA 5A4IS 4BNWA 2BHLA 4I9NA 3IQDB 3IT2A 3ZKAA 4DT1A 1R4NB 3QMPA 2I65A 3JQQA 1CF4A 4REQB 3H6KA 1OFTA 4W63A 4URHA 2H1OA 1IMJA 1BX3A 2JHCA 2XE8A 3QXSA 3MYYA 4COOA 4R0MA 5IABA 4JITA 2HJ9A 1DKLA 4NF2A 1SBHA 1J06A 5EP3A 4N12A 3RFTA 4CTNA 4HNHA 4BZPA 2P77A 5DTMA 4MCHA 4AJPA 1TD1A 1XMXA 3HH8A 3FWPA 4Y2SA 2EL7A 3PGMA 3EEIA 5EE3A 1YR6A 4BNIA 3OA2A 1PR5A 3ORQA 2OHXA 3IS3A 1CQIB 1OLXA 1SKUA 1JQAA 2XOEA 4TWRA 1NJ6A 3HG7A 4H7PA 1YJAA 2GAOA 4BJ5A 1OLOA 2I4LA 4Q21A 4GWGA 3UH0A 1WMEA 5IJ0A 3W4IA 2HTEA 4JNCA 2VQ6A 5KS2A 1DGQA 3WOVA 2JRLA 4C43A 4X7RA 5IT9A 3TQRA 1T26A 3O8NA 4WNIA 5C52B 1OZGA 2XBUA 3T5MA 1RYYA 1E98A 2HBYA 1ZK2A 3HVKA 1KZHA 4A5OA 3MT0A 3U2QA 3DGFC 4J2TA 4M89A 1GKKA 3ROXA 1ZOIA 3A2NA 3TI9A 3UWKA 4IIJB 4IIJF 2VR1A 3H4TA 4NCNA 1M34A 1M1NA 4PEVA 5K8LA 2FXIA 3QHPA 4H0FA 5H3HA 2WM3A 4PFKA 5JHGB 3UMMA 1EXMA 4XQCA 4B47A 2WWXA 4ZCPA 1N1EA 1FCJA 3OKAA 3M3DA 2B8TA 4GKBA 4GW3A 3X1WA 1CJSA 1V8BA 1BXRA 2BGUA 1OZAA 2XYQA 3EIFA 1LD3A 3C3DA 3ASVA 3OUZA 5ANRB 1MB3A 4P33A 3ZCRA 3FN4A 4YAJA 2NPIA 4XARA 3LUHA 3L41A 3D0OA 2NQ2C 2QRHA 4KQJA 3PLNA 1WTCA 1AD2A 1GA4A 2FN7A 3JQAB 3OPVA 3R0QA 1JU4A 3A27A 3ZWDA 1YS7A 1BMQA 3KU1A 4XB1A 1KVQA 4C6TB 4GPBA 2NPFA 1R74A 5DU2A 4G0MA 3FX2A 1OF1A 1VHLA 3T7TA 3KQTA 2R5FA 2HLPA 2O05A 2FPOA 1ZNQO 2NTEA 1D1PA 2QTBA 3QTBA 4OMFG 1Y1QA 4QHYA 3ST7A 4KNYA 5AOCA 2D3TA 3L8CA 2YW9A 3DV0A 4QDXA 2JJQA 1B42A 3M6AA 5JC8A 4L02A 2HK8A 2F55A 3V8VA 3QE4A 3D3WB 4YHHB 1YASA 2M9MA 3NTXA 3PNMA 4M0PA 1JDPA 2HBRA 3A1VA 5DF1A 3W5IA 3SR3A 5JEEA 3SJCA 4TQGA 4RF4A 5ESWA 1TVKB 5DYIA 4QGFA 3ZZUA 1AIPA 1X7GA 2FK7A 1QCYA 4M1WA 1EUYA 2DUMA 1UK7A 2D7CA 2UZ1B 5T8KA 4EEKA 4LF4B 3CT6A 3TM5A 1ZNZA 1U7XA 3V33A 4EGAA 1EFRA 5D2CA 3FJ1A 4YT4A 3IMFA 2ZSKA 3ZY4A 2XADA 4YGXB 1ZGBA 2ODBA 1JQBA 3CLUC 3IEKA 4LI0A 3SF8B 4ZODA 2C1EA 2GZHA 2J30A 2WTMA 3H5RA 3LVFO 1U2SA 3NX4A 1R0BA 1T2VA 4QYIB 3S7TA 4A0RA 4CKXA 3IEIA 1RAFA 2Z04A 3FLAA 1Z5WA 3KJZA 4PXYA 3U3RA 1N3BA 1Z62A 5A5DA 4FYWA 2FZVA 1GSAA 1F5SA 5DP1A 1E0KA 2V9PA 3DLBA 3INGA 1Y0BA 3WV4A 1V3UA 1TYBE 1Y37A 2AMFA 1BQ4A 2F62A 3I92A 1DAIA 1JKMA 4EYSA 2QTHA 4WOBA 2JKYA 2EJUA 4ALIA 1WVMA 2GJAA 2I7DA 2V6GA 2ZT8A 3C74A 3P2EA 4WOKA 3W4JA 3EVZA 1UXIA 1VDZA 2WK1A 4JHXA 5JC1A 3EAFA 4MDHA 5DM60 4CE6A 4J0QA 5JS7A 3S3TA 1W4RA 1UJMA 4MRPA 3WSVA 5TMEA 4C04A 4DFDA 3FOZA 3V4OA 3A25A 1N5DA 4X1YB 2R6CA 1KMMA 2OGWA 5F4BA 3G0BA 3K70C 3CH4B 3Q5DA 4DLVA 5J1SB 1T25A 4FEAA 4L78A 4S0ZA 1RRVA 16PKA 4RORA 2X8JA 3A0RB 2XUKA 2XBMA 3FUVA 3ISTA 2ZXFA 4PLWA 4QDZA 1MAHA 4IXDA 1V8ZA 2G5TA 3DL2A 5E8JA 1N5MA 5CB0A 4OYRA 1V8DA 2NXJA 3A9UA 4OTZA 3UFXA 1KAGA 4C0LA 3HY6A 2QW8A 3LQYA 2ZWOA 2JPDA 4EFNA 3FKSA 1LDGA 2RHRA 3GAAA 4TRMA 3FH0A 3U37A 1WUKS 2ZAMA 4MS3A 5KNDD 1WZCA 2JAUA 3ROQA 3KQHA 3EEBA 2JIMA 1IJFA 2HV8A 3EHEA 3P1JA 3ZZNA 3I3SR 2DH6A 1XBTA 1IZ8A 3QWHA 1TIPA 3VJMA 1DG3A 1FUKA 2PXHA 4OFXA 4URWR 1GZDA 5CNMA 4QRDA 4E5UA 4WCDA 1CE8A 3M34A 2H31A 4OQEA 3DVRX 1PDVA 2R7LA 3BC1A 2ODEA 1KFKB 4RK7A 1EH5A 4B7XA 1RLMA 1DCTA 1WCYA 3RHSA 3AR3A 5F9FA 4RFLA 5TQ2A 3AM3A 3KT6A 5JAMA 4PY2A 2BZGA 2HO4A 4P3YA 3IOYA 5HDBB 1E2KA 1E60A 2DQYA 2Q5FA 3N5CA 4KR0A 1X13A 3DZCA 3EHDA 2I1VB 2ZRLA 2FP4B 1WUTA 2TRSB 1Q7CA 2ZBEA 1GTSA 3AVYA 4E07A 1ZY2A 3RVLA 5JS2A 1FSZA 4G8BA 2VXBA 4E1BA 2XUHA 2C07A 4Q3EA 4BFXA 2B4TO 4CQMA 2QX6A 821PA 2XUIA 5I4BA 4BMSA 2Q49A 4U9IS 2SKCA 1MIOB 3HYLA 3M5CA 5G0TA 2TYSB 3JR7A 1R5NA 1IK4A 4G5HA 3OQ1A 4S0XA 1JDBB 4XVHA 4BB6A 2Y1DA 2B99A 4JODA 4HNRA 4GD3Q 2ZTMA 3SIPA 4F9GA 5IF3A 3U31A 1GGMA 3QSYA 1Z6XA 1PWEA 3C5WP 4UUBA 4J16C 1N2BA 4RMGA 3I83A 3N39C 4NONA 2G88A 2Q29A 3OC6A 5FIUA 4PTLA 3ZK9A 2C5HA 2H65A 1R0RE 1ZSYA 1Z0AA 2WV9A 3KWFA 2C2GA 5K3EA 5BWLA 1ZCJA 1JKJA 1IDOA 1X80A 4R8RA 1YS9A 3IOBA 1AZTA 2QR2A 5CAEB 2EZ8A 1OWPA 3R75A 3ANLA 2J31A 4IDEA 3VGPA 2I3GA 1EVLA 1EJ6A 1P5JA 3NUGA 4M36A 4HDNA 4B6RA 1JT2A 4Q3KA 4A92A 5LQCA 4BX3A 1Y3CE 1RPJA 1RJ9A 4S1WA 3A1UA 1DQZA 1T5IA 1TOAA 1J0CA 1U6JA 2GOYA 1UMKA 4UPVA 4X7PA 5L51A 4OK3A 1KSHA 5DBHX 4G01B 4P9NA 1TW3A 4UNIA 1T35A 4C4YA 5LDDC 2FMXA 2GN9A 3SQDA 3QY9A 1NQ5A 4JP3A 4M9QA 2ZUWA 1U6KA 1XT6A 5A9RA 5FUYA 1VSBA 3CLTC 3K5PA 1N8KA 2PRIA 1EGMB 3OE7A 1XDZA 1NXQA 1RYZA 2FPWA 3HJFA 2IIVA 3PHCA 5L4LA 4UBMA 2JLWA 1P4RA 3UYLA 3RRBA 4XFKA 3OX4A 4I6EA 3RF6A 2R8XA 3SHFA 4G97A 4D8UA 3ND8A 3GRKA 1E63A 2AE1A 3FWKA 3WISA 2XZPA 1EHIA 2GO7A 5LL6P 2BM0A 2UV8A 1FTWA 1E3IA 4BKQA 3A2KA 1FS6A 3LCMA 2QM0A 2CJXA 1EU1A 4IDOA 3MINB 3H75A 1TT5A 3O9VA 2W2PA 4XZ3A 5HQTA 5J3JA 2IPXA 3Q0TA 3TTUA 1QP4A 3AI3A 2DX7A 3K20A 4GOJA 4GYKA 2O19A 1D6NA 2KBFA 1II8B 4C88A 5K0TA 4ZEOA 4L51A 2EWMA 4DA9A 1NPTO 2F9LA 2UKDA 3H9BA 3KSBC 4KO3S 3B1XA 3Q8LA 2IYLD 3GEHA 4WZZA 3THYA 2C54A 1QRTA 3VAAA 3NGXA 2YS6A 3M4NA 5E0KB 5JS1A 1L8OA 1P0CA 1J39A 2H1FA 2QG4A 2RK4A 4TUYB 3RSLA 4TUYF 3QYPA 4PCUA 1NF9A 4BY9E 5LU9A 3IRVA 1RHRA 3LBNA 4KOEC 2XD4A 2ONJA 4PU0A 4D4KA 3NBXX 5FPKA 3GROA 2QUIA 5G1PA 4M0MA 5CFZA 1EM8A 1QK4A 3TF5A 1JEOA 2NP7A 2Q2NA 2WJ6A 4A9AA 5BWOA 1BXKA 3UC9A 5EE1A 2OYSA 2QVLA 3CEPB 3DEHA 2L82A 1W36C 1I4WA 1M0WA 4RM2A 1C0EA 3FYSA 5AVWA 2QVBA 1KYXA 5ALJA 5J47A 3KPYA 1QPGA 4ZZ3A 3NC1C 5J2TA 2J3QA 3BFXA 2X0DA 1WB6A 2YXPX 3HP1A 2IYXA 3E5NA 1PT6A 1V3TA 4G89A 5K8VA 4Q18A 1A2OA 3B12A 2OHJA 1ZCFA 3NT5A 3U7HB 4JS0A 1JV2B 3H1GA 5AOBA 1GPJA 1I9GA 2NTJA 1JHQA 4EB3A 4QKQA 3F3KA 2O8CA 3AF1A 1J0XO 2XE7A 4LY9A 2BUCA 4B6GA 3OLZA 1XLTA 3ANXA 4JEHA 4KHZA 1G8AA 1QHHB 1Q7TA 2HTFA 3DTVB 1SZCA 3MJFA 4CODB 4DMKA 4CT5A 3WP1B 2WICA 3RCBA 3UWSA 3UATA 5AESA 5SY6A 2AF4C 1TMOA 2D5AA 2EZTA 3EMBA 1P2SA 3ELBA 3H1FA 2YBDA 5JZSA 2PZGA 5ICSA 4WGGA 1ZC4A 1NQWA 1NY5A 3L8FA 2EEPA 3UAXA 4C4RA 2FEKA 2WY2D 1SKYB 3VI3B 4OM7A 2B92A 2XW6A 1OC4A 1Y4ZA 4EPRA 1ZD3A 2YWRA 3G8CA 4YTEA 5EJ8A 3RYCA 2O59A 4WZAE 3R3JA 2AXEA 3LW8A 4P2BA 2JFBA 2RHWA 4WLEA 2VYVD 1VL5A 5DLDA 1SOWA 4LBVA 3ETNA 1G2IA 2IGBA 3OMWA 3QBEA 1XJ5A 4X1IB 5BW4A 4RHCA 1YS6A 2R7MA 4B0OA 3TNDA 4DYDA 1V5WA 2B83A 2YMMA 3DWFA 3OQIB 2WE8A 3D4LA 4KFUA 4HDSB 3UVEA 4F6CA 1Q1BA 2NSDA 3I6IA 2ALJA 3S1AA 2NACA 1GAXA 3W8FA 4JYMA 3T9BA 1HLGA 3ZE6A 4MA4A 3GFGA 4ENTA 4LZLA 4BN5A 4DA7A 3SDSA 4OJMX 1YS4A 1OFUX 4N5DA 4JI8B 1MEEA 3KHUA 1ZU5A 4FFSA 5ETJA 5GTDA 4EFMA 1NY6A 1KDZA 1G7SA 2NUAA 1WPXA 2IOFA 4FNAA 1LZLA 4FYPA 2OZLA 1Q0QA 4HBZA 4BB5A 4BE7B 4PC3A 1TL7C 3UGTA 4XB2A 1N0VC 4LX8A 1EUQA 2I80A 1B6TA 2WU1A 4YUAA 2X2OA 3R5SA 3WXBA 3GLIE 4UDXX 4PS0A 4EG5A 2C0QA 2O48X 4WTOA 3WO1A 1WXHA 3B5IA 4U2KA 3L4JA 2VT7A 1E1RA 1YTUA 5T57A 4LY3A 3OOHA 4RXUA 4A8JA 3AUYA 1QAOA 2CL7X 1CS4C 1H9AA 2ECFA 3BMCB 5LJIA 4Z4CA 5BURA 1TQDA 1WHTA 2OHVA 2WZBA 3HP7A 4Z0PA 4CNQA 2BV3A 2R8ZA 4HRAA 2C5GA 1Z4MA 1RRCA 3UAOA 1LBHA 2GCIA 2PXCA 2O5VA 2ZRBA 2Z8YM 1II9A 1LX6A 2BTQA 1NUTA 2MIIA 1BEUB 2OB1A 3EXG2 1NR1A 2F1OA 4HQRA 4YRTA 4YP7A 3N2YA 1WW2A 4S3MA 4ETMA 2P6UA 3CZAA 2WJZB 3HFSA 3RIHA 3W06A 3NVDA 2W6NA 2P7IA 2O9JA 3J7AC 4F4CA 2NU9A 2DFVA 4H0NA 1UANA 4BCDA 1RRKA 4RY0A 4DEXA 2C4KA 4YRJA 5KYGA 1L5HB 1CF9A 1YS2