5HILA

Crystal structure of glycine sarcosine n-methyltransferase from methanohalophilus portucalensis in complex with s-adenosylhomocysteine and sarcosine
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
244
structure length
240
Chain Sequence
DHYEEEYVLGFVDKWDELIDWESRAESEGDTIINILKERGVKKVLDVATGTGFNSVRLLQAGFDVVSADGSAEMLVKAFDNARDHGYLMRTVQADWRWMNKDIHDKFDAIVCLGNSFTHLFDEGDRRKALAEFYALLKHDGVLLLDQRNYDAILDSKHAHYYCGDTVSVYPEHVDEGLARFKYEFSDGSVYNLNMFPLRKDYTRQLLHEVGFQEINTLGDFKETYKEDEPDFFLHVAEKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine sarcosine N-methyltransferase
publication title Structural Analysis of Glycine Sarcosine N-methyltransferase from Methanohalophilus portucalensis Reveals Mechanistic Insights into the Regulation of Methyltransferase Activity
pubmed doi rcsb
source organism Methanohalophilus portucalensis fdf-1
molecule tags Transferase
total genus 86
structure length 240
sequence length 244
ec nomenclature ec 2.1.1.156: Glycine/sarcosine N-methyltransferase.
pdb deposition date 2016-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5hilA02
2HV9A 3EVDA 4CKCA 2AOUB 1XCLA 5BW5A 1N7JA 4ER3A 3PS9A 1FPQA 1RJGA 1D2HA 3FPFA 3GIWA 3SSNA 3UJAA 5DXAA 4ISCA 5DTQA 3TKAA 1EIZA 2O07A 3LPMA 3ORHA 4M36A 5HOQA 5K0EA 5FUBA 4P7KA 3TMAA 4GC5A 3TM5A 3UJBA 5E8JA 5CCXA 2ORED 3IHTA 5DM2A 1JR4A 2NXCA 3NWEA 3GRZA 1ZKDA 3S68A 2B3TA 3BZBA 5K0NA 4BLUA 1NW6A 2PT9A 3G7UA 1R8YA 3FUUA 4HGYA 4L7VA 4YV1A 3DXXA 4FSXA 3P71T 3EGIA 1NBIA 2PX2A 3DLCA 3GXOA 1RJDA 3I5UA 2PV0A 3DXYA 5GIPE 3UWPA 2PBFA 3HCFA 3M4XA 1X1DA 2GA9A 3KQQA 1JG2A 4RYLA 4BLWA 3PLAE 3I9FA 3CVOA 5DT2A 4DM3A 4C05A 4E2XA 3EVZA 2AOTB 4RSRA 3PT9A 5C1IA 1I9GA 4BP3A 3V97A 3KQTA 3L8DA 2PX8A 4QVGA 1NE2A 3FPEA 3MAGA 3UJDA 2I9KA 1G8AA 4QQNA 3LBFA 2VDWA 4CWAA 2ZWVA 1QAOA 4MIKA 5DSXA 3ME5A 3TRKA 3UJCA 3OCJA 5T64A 4RTKA 4PNEA 2O57A 3C0KA 3BGDA 2PT6A 5DTRA 2IP2A 3P2KA 2JHPA 3GRRA 2YTZA 1MJFA 3SGLA 5FQNA 3UJ9A 1M6EX 4HG2A 1XCJA 3IYLW 4RV9A 4C07A 4M37A 4E30A 3OE4A 3SM3A 10MHA 3A4TA 5DM4A 3E7PA 2PJDA 3HCBA 1AQIA 1XDUA 3LCUA 4YUZA 2QY6A 1NT2A 1EG2A 4YV2A 5E1MA 5FWAA 1L3BA 3VYWA 1YFJA 4LWPA 5CM2Z 1JG1A 3GNLA 4GUAA 3GRVA 4Y30A 5E9QA 3T7RA 2F8LA 1NKVA 2HTEA 3MB5A 2OB2A 3PFGA 1DCTA 3OU7A 2PGXA 3FPHA 3FUWA 2CWWA 1G6Q1 2I7CA 1SG9A 2NXNA 2XYVA 3DP7A 1HNNA 3HM2A 1G60A 4QDJA 5FWDA 3TLJA 1FP1D 3KPWA 1L3CA 4BY9E 3LL7A 3BWYA 2BR4A 1NW5A 3AXTA 4P7JA 3HVHA 5D1HA 5HIKA 1YB2A 2NXJA 3B89A 3HCCA 4NECA 4FS8A 3AWIA 2ZULA 3FZGA 5E2AA 2HR1A 4GEKA 5LSAA 1RI1A 2UYHA 4DA4A 2P7HA 2AOXA 5T6BA 1XDZA 4XUDA 2XVAA 4GC9A 2ZIEA 1VPTA 1JQEA 3HA5A 4GOOD 4EKGA 5B1SA 1JTEA 1VBFA 4YUVA 3G8BA 4C03A 1V39A 3EMDA 5ICEA 4LECA 5CVDA 1QAQA 5FHRA 2C7QA 4PYMA 1JSXA 2VDVE 4QQKA 4EK9A 2P41A 2P3QA 1L1EA 4MTLA 2IBTA 2P8JA 3BWBA 3HVIA 3O31A 4P7GA 3C6MA 4RTMA 4ER0A 5EOVA 1M6YA 4QVKA 5DRYA 4GQBA 3G8AA 4AX8A 4PYLA 2B78A 3MTEA 4X63A 4HSGA 2JG3A 3EGVA 1X1AA 4QTUB 5DSTA 5FA5A 4EQZA 5DM0A 3KR1A 4YMGA 2FK7A 2JH8A 3M6VA 3D2LA 3GWZA 5HIMA 2IFTA 1WG8A 3KQPA 3HVJA 3BGIA 3GCZA 3IEIA 4IWNA 5LQNA 5CIYA 5EMKA 2ZWAA 3GO4A 4R6XA 1KYZA 2QYOA 2EJUA 5CUQA 3HA7A 5K0FA 1X1CA 1PRYA 4RTLA 3EVBA 2JJQA 4ER6A 3CJRA 1JTFA 3TM4A 5C9ZA 4RTNA 1QZZA 3CCFA 1TW3A 3M6UA 5EHIA 3AXSA 1AF7A 3M70A 4GOND 4KVZA 5K0LA 4ER5A 2ZW9A 2FK8A 3BWCA 4CKBA 5CVVA 5LQUA 1KPGA 4X1OA 5HILA 4C4AA 2QRVA 4PCLA 2XYQA 2FHPA 3M6XA 5EQJB 4OQDA 2P3LA 5M5BA 2OY0A 3EMBA 4PINA 4X61A 1I1NA 3KPVA 3P9IA 4MQ4A 4YUXA 1ZG3A 1RI3A 2EX4A 2QM3A 3KPUA 3LKDA 3G2QA 1KYWA 2Q41A 2Z6QA 3PB3A 1KIAA 4FZVA 5U4XA 3KR9A 4FT4A 3SVZA 1JQDA 4WXHA 4KDRA 3DULA 3EVEA 3DMGA 3MCZA 3KR0A 1VLMA 5DX8A 3RW9A 3SX0A 2BH2A 4E31A 3KPJA 3HTXA 2IDKA 5JUWA 3C3YA 3OE5A 1X1BA 2ESRA 2IIPA 3HCAA 2O05A 3KQVA 1Z3CA 1JSZA 4LWOA 1YZ3A 5DRTA 1JG3A 4PWYA 4IV8A 4YUYA 3HP7A 5KS2A 9MHTA 1XTPA 2P3OA 2PX5A 3OZTA 4GOMD 4B17A 2GH1A 2VP3A 2Y1XA 3IV6A 5HZMA 3ER9A 4E32A 2ZZNA 1D2CA 1BOOA 3KQSA 3HVKA 2KW5A 3MCTA 5FULA 3I58A 5GP1A 4P58A 4K6MA 3A26A 4XUEA 1ORHA 5FHQA 3LHDA 4R8SA 5E1BA 3VSEA 5EMMA 3X0DA 4AZVA 3Q7EA 4F84A 1G8SA 4FGZA 3OFKA 4U7PB 5KQRA 1G38A 1AV6A 1B42A 3OU6A 4MWZA 4PYIA 5FTWA 2XYRA 1FP2A 3FUVA 2ZZMA 2OBFA 3DR5A 2B2CA 3JWJA 5DLYA 3NMUF 2OPBA 3ANXA 5EGSA 4QDKA 2BR3A 1O9HA 4HC4A 3UBTA 3GJYA 2NYUA 3QV2A 4DZRA 4ER7A 4OQEA 4YMHA 4C06A 5LQCA 2R6ZA 5EEHA 5E2BA 3E8SA 3ERCA 4Y2HA 1WZNA 2OYRA 1TPYA 2P40A 2ZBRA 2PXCA 2G8NA 4POOA 3BT7A 4EVIA 3NJRA 1SQGA 2PKWA 1KP9A 4QTTB 4C04A 3SR4A 2PY6A 2EJTA 2YQZA 2ZIGA 5K03A 3LGAA 1YFLA 1SQFA 4KIFA 2EFJA 2G72A 3BKXA 4YUWA 2XVMA 1VL5A 5DXJA 3KQYA 1UIRA 2P35A 4E33A 3BXOA 2PXAA 1O54A 4O29A 3O4FA 4HTFA 3B5IA 4LG1A 3AY0A 3B3FA 1RI2A 5K0GA 4RTPA 3NTVA 1EQAA 4HRAA 2H11A 1ZGAA 2ZFUA 3M6WA 5DM1A 5EC8A 3MGGA 5K09A 1NV8A 3LECA 2NNWB 3UA4A 2VS1A 4Z2YA 5F2NA 1AQJA 3Q87B 5K05A 1HMYA 3THRA 4CTJA 1NW7A 3V8VA 4E2WA 1RI5A 2BR5A 3GDHA 3DMFA 3REOA 5KYGA 4KDCA 5DPMA 2AVDA 5D1NA 2WA1A 3JWHA 1Q0SA 3EEOA 2UZ4A 3FUXA 5GIOE 5CD1A 4P7FA 1YUBA 5EKUA 5F2KA 5BW4A 3TKYA 1R00A 2CL5A 1SKMA 4E70A 2IH2A 1VQ1A 3A7DA 1BC5A 3DXZA 2Z6UA 3A25A 2NP7A 3LBYA 2C7PA 1R8XA 3EVGA 1ORIA 1WXWA 2LD4A 2ONYA 3LKZA 5EMJA 1NBHA 2G70A 2QE6A 2QRVB 2V74B 2FYTA 3FTDA 3LCCA 4EKIA 4GBED 2ERCA 4H0NA 4R05A 3BUSA 3TR6A 1IXKA 2IPXA 3UJ6A 1FJXA 3E05A 5DWQA 4PCAA 3KU1A 4PIPA 5GINE 3ER8A 3EVCA 3P2EA 3GGDA 4KRGA 5DTMA 5ERGB 5K0BA 2ZCJA 3PX3A 3UJ7A 1F38A 3RIEA 4DCGA 2AZTA 2BM9A 1EJ6A 1NW8A 2YXLA 1D2GA 3ELWA 1NV9A 2GS9A 3T7TA 1KPIA 1DL5A 2IGTA 2YR0A 2ZVJA 1Y8CA 5CCBA 3WSTA 2GAFA 1QANA 2IBSA 3NW9A 1P1CA 4M7RA 4HGZA 1L9KA 4CTKA 3UZUA 4FR0A 2YX1A 5HEKA 5GM1A 4E2YA 2AN4A 3G88A 5K0CA 5LQJA 2B25A 4RX1A 5GOZA 3UJ8A 5EIFA 3SMQA 2H00A 3LDGA 1M0EA 2C7RA 1P39A 5KQSA 5E9WA 1O9GA 5LQKA 5FCDA 3FTEA 5EMLA 4XUCA 2JHCA 4DCMA 2ZBPA 4AZTA 2DULA 3GU3A 4RVHA 3FRHA 4MHTA 3DLIA 4AUKA 1BKYA 4FP9A 1FBNA 3FUTA 5HIJA 4PONA 1H1DA 1R6AA 2A14A 2PLWA 3P8ZA 7MHTA 3C3PA 3PFHA 2B9EA 2PX4A 3CBGA 2GPYA 4GOLD 2EG5A 3ELYA 1Q0TA 3P9KA 3FYDA 2YXEA 2G71A 5FA8A 1SVUA 5H02A 4YV0A 8MHTA 3HA3A 1L3IA 4RVGA 1R74A 1VIDA 3DOUA 3MERA 3I53A 3A27A 3EGEA 3K0BA 2YVLA 5FQOA 3ELDA 4FSDA 2PWPA 3QOWA 4CKEA 2UYCA 3FTFA 2UYOA 2OB1A 3EEYA 3EVAA 1ZQ9A 1G55A 1R18A 3O7WA 3OU2A 5CVEA 5DX0A 5FADA 3GRYA 1YF3A 4RTSA 2HMYB 4RWZA 5CVUA 2CMGA 3LX6A 4DQ0A 3OPNA 1TW2A 5JR3A 4PYKA 2Z6AA 3PTAA 3ID6C 2IH5A 4F86A 4RVFA 2P1DA 4R6WA 2FRXA 3G2MA 1QYRA 2AOVA 2GLUA 4R8RA 3BGVA 3UA3A 2JHAA 4E2ZA 1P91A 4HTFB 2PSSA 5EEGA 3T0IA 3R6TA 4F85A 2ZLBA 5K0JA 3R3HA 5LR6A 4OX9Y 4EMSA 4V0RA 2FCAA 3JWIA 3I64A 1BHJA 3M33A 2CMHA 3CJQA 4FT2A 3U81A 3G2PA 2ZBQA 3DUWA 2AOUA 1SUIA 1P1BA 2OZVA 4KW7A 1DUSA 3KKZA 3OZSA 4A6EA 1EAMA 3TPZA 3OFJA 1IY9A 3P2IA 4PYOA 5MHTA 1WY7A 1X19A 2PXXA 3R0QA 4IKPA 1WXXA 2IDJA 4DKJA 3VC2A 2R3SA 1RI4A 3FPJA 4IV0A 1XJ5A 4OBWA 3MHTA 4CXMA 1N2XA 1ZGJA 3LSTA 1RJFA 2AS0A 5EVJA 3SSMA 4DMGA 3DTNA 5IKMA 1KXZA 3G5LA 3PVCA 4C08A 2O06A 2G1PA 4G56A 2I6GA 2NXEA 2ZZKA 3EVFA 3F4KA 2PVCA 1UWVA 2ONZA 4DF3A 5BP7A 2ADMA 1KHHA 3B3JA 5C0OE 3EPPA 3LDFA 4OBXA 3A7EA 2P7IA 3UFBA 4AZWA 2HWKA 3HEMA 4KIGA 4PGHA 2OKCA 4RTJA 3FRIA 2AN5A 5GM2A 3CKKA 5EPEA 1XXLA 1F3LA 2ZSUA 3MQ2A 4QPNA 1VP3A 5K01A 3HCDA 2AOTA 1RJEA 1WS6A 4HH4A 3E23A 1VE3A 3NVMB 3NDIA 4PYNA 1U2ZA 2PWYA 3HNRA 4AZSA 2VDUE 4A6DA 4ZTBA 5E9JA 4OA8A 1MHTA 3OZRA 1PJZA 4PYQA 2K4MA 3T7SA 5LQRA 3G89A 2JH9A 3KHKA 2GB4A 2YUIA 3NDJA 4X60A 3H2BA 4RTOA 3QOXA 3TOSA 1VP9A 4ATNA 3LDUA 1JG4A 2ZIFA 3K6RA 1OR8A 1EJ0A 2ZTHA 3ELUA 4BP1A 5LQAA 4BLVA 2WK1A 2OXTA 2XBMA 5G02A 1JQ3A 5EKXA 1KPHA 4JXJA 3RODA 2BZGA 5EZQA 3P9CA 2I62A 2AR0A 5E8RA 1I4WA 5F2OA 1XDSA 2AOWA 2YXDA 3GRUA 5BXYA 2Y1WA 1N7IA 2OO3A 3R24A 3LCVB 5ICCA 1XVAA 2N47A 3G5TA 1SUSA 1KR5A 3R9XB 2CKDA 3FYCA 3JWGA 3SSOA 3BKWA 3C6KA 3KR2A 3DH0A 4RTQA 4PIMA 4KWCA 3SXJA 3NVKI 5T67A 1NW3A 4GF5A 3FTCA 4U7TB 5IH3A 3NWBA 5HIIA 3THSA 5K8VA 1IM8A 4PGGA 2FPOA 3FPGA 2O0LA 3MTIA 2E5WA 5P8WA 3B7PA 3B3GA 4OA5A 3BWMA 3AJDA 3KQMA 4X41A 4WVLA 1QAMA 5E1DA 5HFJA 3TQSA 5EZSA 5KVAA 5CVJA 3G2OA 2HNKA 3KQWA 4M38A 3TFWA 5GWXA 3KQOA 2AVNA 4UOEA 4RTRA 2WA2A 2AN3A 4RVDA 4PYJA 5ICFA 4QPPA 5EG5A 3CGGA 3CC8A 4XCXA 4V0QA 1T43A 1YZHA 5EHGA 3HCEA 2H1RA 5DX1A 5ICGA 2DPMA 2C7OA 3DMHA 5EIWA 3VC1A 3P97A 2UYQA 1ZHFA 3KPYA 1INLA 1UFKA 2BM8A 3PX2A 2IH4A 2NP6A 2V7EA 2VZ9A 5E1OA 3CJTA 3P9NA
chains in the Genus database with same CATH superfamily
2PA3A 3ZCXA 4DSOA 2BONA 2ZTLA 1GG5A 1QG0A 4HDQB 1PW7A 2J59A 3AI1A 5J5AA 3RYHA 3OF3A 2QD5A 4KYUA 3WK4A 5B5SA 2DCUA 1RACA 5IKOA 2G6BA 3PYMA 1ETUA 1ZOPA 2RKBA 3IUJA 4HXGA 4NV1A 1F6BA 3ORHA 3P27A 4RA9B 5B7QA 3TM5A 3GZNA 4IDFA 1ODCA 1V47A 2PRSA 4YMSA 5B4UA 5BSUA 1XZHA 3BWVA 2C1ZA 3M4ZA 4O4IA 2XOKD 3LYLA 2SCUA 2WLSA 2VNJA 4PSKA 2Q6TA 4BNIA 1XTTA 3P9ZA 3LHFA 4X91A 1QZ3A 5L45A 3NWOA 2QXUA 4WY8A 1YJAA 3PNVA 2X9VA 1QKKA 4ZI7B 1E94E 1KZ4A 3DLCA 1CKEA 2PTHA 4LE0A 2QTGA 3N8HA 3QPCA 4RPKA 4Q12A 2X9QA 1RWOA 1U7ZA 4M9ZA 1M75A 3HP1A 2B94A 3A4IA 4CHGA 3I92A 4P38A 1KI3A 3WP1B 3ESCA 3L06A 2AI1A 1L5HA 1LCIA 4AJ9A 4ZDWA 4QELA 4B6RA 1NLUA 2QPLA 5TRTA 3EA5A 4HBGA 4JEHA 5ESDA 4L3OA 4UMFA 1FXSA 4AO8A 1N1MA 4JEMA 3FXAA 2MYNA 4B0PA 2Z30A 1IK4A 2ZVQX 2GUWA 5CG1A 3T7EA 2FEPA 5ESWA 3PIDA 3TWOA 3LY8A 3HUFA 1O87A 3GEIA 4BATA 1OI3A 5AJTA 4E2FA 3K5HA 1B0AA 1QZTA 1LKZA 4PO1A 2JHPA 5F33A 3CN7A 1FVFA 1MJFA 1VCOA 3K9NA 1YASA 5LIRA 1OIVA 5G40A 2ZUFA 1JFTA 1E66A 3OE4A 10MHA 3CA8A 1XWWA 1NLFA 1UKVY 4OXXA 2ET6A 5BYJA 4IJ6A 2C4KA 2H3EA 3PDIA 2Q4TA 3FVRA 3PUVA 4IJVA 2Z2XA 3VYUB 1NAHA 3OTOB 1L3BA 3D7NA 3W3ZB 4BB6A 4MKFA 4QICA 2WYWA 5EMNA 3K6JA 4HFNA 1JSRA 1R6DA 3GRVA 4QBTA 4ILKA 3CXUA 2WZCA 1IUKA 4Z9BA 1T6NA 4L5JA 2PLNA 3TW8A 1GPBA 5AOBA 4NP6A 5JFTA 1FFXA 2P3SA 1AV6A 1FYDA 3O21A 1PJLA 4BPRA 3ZG6A 3BWYA 3AJEA 2R00A 3BWDD 1R0ZA 5HIKA 2Q46A 4JI1B 3W5CA 2ZULA 3Q0IA 4GKBA 1US8A 2YJNA 5ER6A 5DCLA 3ZE0B 4O1MA 2AOXA 4WXMA 1M6VA 3K1ZA 4C5CA 3O92A 1ZMTA 4J03A 4DMKA 1IEQA 1QBGA 1T8TA 3FF4A 2G08A 1E1QA 5B1SA 4ZDIA 3IP7A 3IQEA 4FFNA 4MOWA 5AW3A 5JASA 4EL5A 1NR5A 1VMAA 5IDVA 4FDTA 1YZQA 1VI6A 4PZCA 3X1WA 1WO8A 1RRFA 1T4CB 4LZWA 3CO5A 4EK9A 4F2DA 2C7QA 4BNWA 3AM1A 3P9PA 2QN3A 1X15A 3RFUA 3EAFA 3BIJA 3WE7A 1I4LD 2EJWA 3EDOA 4FGSA 1OVMA 2CE2X 2R2AA 3D0KA 2C57A 3HZOA 4L4XA 1TX4B 4G4SO 4ZIRB 4WT7A 3ZDXB 3ZNNA 1IULA 4OATA 2FK7A 2G36A 1N0WA 3H2HA 1D2EA 2WWVD 3HB5X 4B45A 4P32A 3D0RA 1GQYA 3ZH2A 3AHGA 3ESXA 2AFHE 4NNJA 1XMVA 3PXEA 3GFVA 4DV6B 4WN3A 1H65A 3JWEA 2YWGA 1Z3IX 1AGXA 4REQA 3BA6A 1NUAA 4BTVA 2IC5A 2NZYA 1NDQA 2QUJA 3OD1A 1I33A 2V96A 4MVJM 4XJVA 4WBNB 3T4XA 3OOHA 4GOND 1RPAA 3E5RA 1BQEA 1OU4A 3RROA 3ZCUA 4J43A 2IQ5A 5A4FS 2KB0A 3GFTA 1AU9A 4H35A 4TWIA 3SR3A 1CUGA 3TPCA 5AK3A 4CKBA 1RAGA 4HVAA 5IC4A 2FW6A 3VXKA 3CW2A 4JV5B 3W2IA 3ZY5A 3ONEA 5JARA 4YUXA 3TR5A 5BV7A 2IIQA 3UMGA 5CFZA 1OBOA 4M60A 1YOVA 4HRXA 4TRNA 1ZD4A 3ILHA 1F51E 2HXYA 2XDQA 3CISA 4A5OA 4KO4S 1Z07A 2P0AA 1CR2A 4I2NA 4JSTA 1N75A 4OM7A 3KFVA 1QH0A 3VNRA 4D4MA 3C3YA 4JROA 4WY2A 2BF7A 5GZ1A 1P44A 2JIOA 2PZEA 2Z83A 3Q3CA 4M9XA 4WNAB 1YZ3A 1WD7A 3N2YA 1ZMBA 2A0FA 3KT3A 1SXGA 1NY5A 2SECE 3MJRA 3MYYA 3PUKA 4LC9A 3QELB 3MWDA 4FSHA 4RHCA 5DW3A 4OFWA 3FBGA 5BSTA 4C0QC 1A4UA 3RRBA 1UM9A 1E7YA 1P5RA 2VYFA 1EQ2A 3GA5A 4EO4A 3B9BA 3CNLA 1G5TA 1HDXA 3BEOA 2DFNA 1DZ3A 5JWOA 3I58A 2OV6A 4U02A 3SP1A 4B1FA 1Y5NA 3ZWMA 1TYZA 4R8SA 4S2UA 5DNVA 5EMMA 3X0DA 1JU9A 2OCKA 1QTIA 5LU8A 2O8EA 1T8UA 3E5NA 4LQ4A 1XE3A 3VR2D 1MJNA 4NH4A 4PO9A 5SZKB 3UG6A 3UMCA 4DBVO 4AMGA 2FW8A 4LDNA 4PYIA 5HSGA 5FTWA 1KORA 1RJ9A 4HLUC 2OBFA 4YQZA 1JFSA 1Z5PA 1DTWB 5MN5A 1CG6A 3CH5A 1TVEA 3OLWA 4GLJA 5ILGA 3RC7A 3W2EA 2C2HA 5G4KA 2HHHB 5AUQA 1N77A 3NAGA 4LFAB 4EGCB 1OZFA 2VT6A 2P40A 2GNOA 1SCQA 2WOOA 1UFVA 3EY9A 4XARA 1PV1A 1ORTA 1XVTA 2AG8A 4NMXB 3JY6A 4MPPA 1W34A 4Y98A 4IQFA 3S7TA 5ICSA 4MINA 1IJEA 3GLTA 1SVSA 1ZVKA 1PLJA 4RO0A 5M3BA 5FI0B 4LHXA 5C7IO 2OGUA 2W6NA 2ZUCA 3V00A 3RS7A 3LQFA 1XXHE 3IH5A 3SI7A 2P35A 4GMDA 3ZWBA 4Y2QA 4WKOA 1RHRA 4N3AA 2BELA 2EKZA 3GJ4A 2ZYUX 4G65A 3WNQA 3OJXA 3PSHA 5F7ZA 3CX4A 1MEJA 4C4XA 4NZOA 3UNXA 2YCBA 3OJWA 1NBEA 2I1QA 3ZXUB 1T2VA 3K94A 4FHDA 4WX2B 4YRGA 2I2CA 3TO5A 3Q87B 1B4DA 4GPIB 4B87A 2VAMA 2HL6A 2OHOA 1A5AB 4NJEA 1HMYA 2HV8A 5JAQA 3UCXA 4D8TA 3U3DA 5JSZA 4E2WA 3L6CA 4GP6A 4MQBA 1DDGA 1K4KA 2FSPA 4ZODA 4D9IA 4UEKA 1GVNB 1ZH4A 3QKSA 2VT2A 1X8LA 3ETNA 3MOIA 4IHKA 3KOZA 4MULA 4XX0A 4TLEA 1YR8A 3CH4B 3PQ4A 5HJ7A 1FTGA 1YBVA 3EGDA 3N2NA 1L6IA 3WDKA 2O1WA 2OQ2A 1SKMA 4Y6GB 1PVOA 4G0MA 2J3QA 3CPEA 3LXMA 4W7IA 3T12A 1OTXA 2H5EA 2R85A 2Z98A 3PDWA 4LDPA 4LIPD 4P3KA 3VOSA 5KTTA 3EVGA 5JU6A 1RNLA 3LKZA 2OAQ1 1GDHA 1VYVA 4HNUA 1FQJA 2KYRA 3FKSD 3L7YA 2A2ZA 3WGTA 1PGOA 1U4SA 2FYTA 4HS9A 5HKLA 4C4RA 4NBKA 1ESDA 1XCGB 2KBFA 3IE0A 2IU6A 4JL5A 3VKVA 4DANA 5FX2A 3WRXA 5KREA 2XIQA 2K6GA 3TOZA 3EVCA 4KMRA 1YR1A 5ERGB 2CHEA 2GXQA 1T15A 3ZD6A 2AZTA 2P2GA 1CQWA 1D04A 1KK0A 3KHTA 4J0DA 4K1XA 2QPAA 4B2YA 4J0FA 4WY5A 2IGTA 1DL5A 1L1RA 2ZVJA 1Y8CA 1Z06A 1VPDA 2AC7A 2AFHB 2GAFA 3C3XA 1JJVA 3OKFA 3QVGB 5ETJA 5B58T 1ARZA 2OA0A 4B5LA 5D6NA 5CNIA 2XJ4A 3LWDA 4E4YA 2DLCX 2GUGA 4RKYA 1G4AE 3ZIDA 2AN4A 2WF9A 5F78A 4NOLA 1XTQA 2JLSA 4OHWA 3RRXA 1WVGA 5IJ9B 2H00A 2ZI9A 1RC0A 3HG7A 1M0EA 1VM6A 2VNSA 4P0QB 1QK3A 2DG2A 5AKLA 4BMDA 2XD4A 4IUYA 1VFNA 5IBPA 3V2IA 3OJCA 4JLBA 1L4MA 2BI4A 5I9MA 4DCMA 2FSSA 5FORA 3RU2A 1MQSA 2C03A 3ZHRA 1GPNA 4XTRA 5B3JA 2HRDA 4BWFB 3GEBA 1O08A 1YVEI 2V45A 3RUDA 3PFHA 4MV1A 4N0DA 4OB7A 3TTTA 4D82A 1HOXA 4PFSA 2XIJA 2HSWA 3CPJB 1D1PA 3VTZA 2EG5A 3EDQA 4BVHA 1PSZA 2B4QA 2C61A 3R7FA 1ACJA 2VZ0A 2Q62A 1HNWB 4Q3LA 3TQOA 5CXSA 1UOOA 3NBQA 2ZQYA 4ARSA 4JFAA 1IJKA 2QUBA 3F5MA 2O7RA 1KQPA 2V1XA 1X74A 3FCEA 5EE3A 2X58A 4DLPA 5IYZA 2YVLA 4NHEA 4F6CA 1C14A 2WU8A 1KJYA 1PR1A 3EEYA 4JLOA 1QTNA 4JDPA 1CJTC 5IT4A 3OPYI 3GDFA 3W5BA 4KGXA 1IAVA 1LF5A 1XZEA 2NSLA 2W9XA 1RQRA 3A6GA 1TT5B 1YJ5A 3GFPA 4G41A 4RWZA 3S2EA 4CMGA 2IU0A 1TW2A 1M2VA 4K9MA 4N0PA 4LQLA 4CLHA 3TXXA 4DYDA 1EFRA 1ZJWA 1CJUC 1JMYA 1MO5A 2ZVPX 4GPD1 4J29A 4K1LA 4HK4A 3KZNA 1NAIA 5LDHA 1Y48E 4Y2TA 3PL1A 4PLFA 3QEMB 4OOEA 2EYUA 3LUFA 3F6YA 1FNMA 1ISRA 3FPBA 4Z0NA 2PM8A 1YZUA 4RVUA 3WQRA 1IZ7A 2GRAA 4D6YA 4W9MC 2RBKA 3MPUA 4WJZA 3NHZA 3CLKA 4LMRA 3I3SR 4YCAA 3DVAB 4NCXA 4LJKA 3GDGA 3LUKA 1TFRA 2FPKA 3QWIA 4RW0A 1J09A 1GNVA 3TPZA 2R7NA 5HPYB 2CVQA 3JRNA 4GMGA 2EAUA 1HKHA 4ZDJA 1ELOA 4D0GA 3DE1X 3T8YA 1E79D 4RLQA 4RXUA 4CDGA 2RI0A 4OHCA 3HJRA 4F4IA 1LWOA 1UODA 4JVSB 4EG5A 1XXHB 2AN9A 3NIWA 3NHYA 1FZQA 4ROSA 4KXXA 4DLVA 5C4GB 4O0MA 3UGQA 3MG9A 4KR3A 2RHCA 2H06A 5HUJA 1BD3A 3CX8A 5IK2D 3QLVA 5FPSA 2RH8A 1QE3A 3KVYA 3NGXA 2AZ4A 3PI6A 2BHNA 2OO5C 3K8OE 3HDQA 2HWKA 5EQDA 5BUSA 3GW8A 2OKCA 3N1UA 2BW0A 3QLEA 4BNFA 4UNRA 1U7TA 3T3EA 3DO6A 1DI0A 2QUZA 2WMOB 3IKLA 5B7GA 2O14A 2JGDA 4XSVA 4EPTA 2HCRA 3JQ7A 4L73A 5BQPA 4D3XA 3DL2A 3LK6A 4OHUA 3T38A 3NDIA 5TX7A 5DYGA 1VXOA 3TRFA 1G42A 1V5FA 2DPHA 3NOQA 4KFRA 1P62B 1IQPA 1L4HA 4M6WB 4Y2RA 5E9JA 1FFWA 1UBMS 4PS0A 1ZAKA 1PFGA 2A1UA 2CNDA 3COPA 4GZMA 3UO8B 5F9HA 3G89A 3LNTA 2OCIA 2YUIA 3I23A 4DLZA 1H2BA 3QUQA 1GJRA 5E6SA 5FPPA 4OOFA 1XZ8A 1TK3A 2JAQA 2J9ZB 2GRJA 3QUTA 2ZIFA 4UU1A 3OZXA 4FKZA 2R6FA 4KWHA 2C29D 3KK0A 2GK7A 3ZQUA 2AWOA 4S1TA 2BZGA 1CS0B 3UMMA 3KG2A 1P0QA 1KY3A 4EPRA 5BRJA 1RKUA 3P52A 1P8JA 1PYGA 3MELA 4FN5A 4LCJA 4MS1B 1KJZA 4PR3A 5IJXA 3WYFA 4GPBA 4F60A 5LIPA 2P6RA 4K2AA 3E3MA 2Z9CA 1KR5A 4MROA 1EFCA 3FYCA 5FBQB 5ADHA 1PFWA 2ONCA 3WQBA 3A04A 1H23A 2M6LA 3KTDA 2YHBA 2WJ6A 3I0ZA 4QRHA 4K2HA 3KTOA 3BXFA 3HU2A 2VF2A 2H29A 4BX2A 3W5DA 1UIMA 3GUZA 2YVKA 3EGWA 4MUIA 5BSWA 2FPOA 2J9FB 4D46A 4KPUA 1PS0A 1AGRA 3U40A 5CDFE 4XA8A 3C16C 1XROA 3Q6MA 1CUFA 4OLBA 1DSSG 4GR5A 2F3TA 5GWXA 4X44A 1IHDA 2AVNA 3L7AA 1O5OA 1TF5A 4PYJA 1OU0A 3BICA 3ZR4B 4KQGA 4IGFA 4Y1EA 1N2ZA 3EY4A 3BBPA 4CV1A 5BR7A 5HNKA 1QIEA 1T43A 2FEKA 5G0TA 1J2TA 4D9MA 2B99A 2XMGA 4OU4A 3HB7A 3CTPA 1GZHB 1U9ZA 2OCLA 2UYQA 4PZDA 2DQYA 3FCCA 3OQPA 2BM8A 4EJSC 1OX6A 2EJVA 2W6JA 4KOAA 3TIVA 3KYIB 2O8DA 5LXTF 3DKIA 4D9JA 3DZKA 5HCNA 4X41A 1Z75A 3DE4X 2PGDA 3DZDA 2WNHA 1CEYA 4V3BA 1HG1A 3H4VA 5CW2A 4CPDA 4XIGS 1NG9A 4B43A 3WZMA 4AY5A 1QO9A 2BGNA 2IA5A 1LNSA 3N2KA 1E18A 3K3PA 4OXQA 3D4LA 2I5PO 2XBUA 2H3HA 4XM1A 3X2EA 4DB4A 5JCZA 5G1OA 3NTRA 5I4KA 4FDVA 1Z4LA 2EKPA 1SQ6A 1W46A 3UTCA 1YHNA 2HEGA 3VAZA 1ZOLA 2ZE7A 1G7TA 3HMQA 4OAOA 4B32A 4RQTA 3IA7A 1W19A 2P4QA 1ECLA 2GMWA 2A86A 3AF1A 1Q17A 1C3VA 1KI2A 3KETA 1NE7A 4LF4B 3I5UA 1YZTA 3DXYA 5PGMA 2P2YA 4HAOA 2PAFA 3VISA 3WHIA 2DTEA 3V33A 1LSSA 4X7RA 1SZPA 1CUXA 3QTLA 4R41A 5EXXA 1TC2A 4HAYA 4L85A 3GEHA 3G6KA 3CVOA 1UFQA 2IJGX 2VATA 4MRRA 4OI4A 1E3TA 2E4XA 2ZI6A 2ZRJA 4QLAA 1BX0A 3DZJA 3PT9A 1B3BA 2I9PA 2V7XA 5CX1B 4D8YA 4DDKA 1EFPA 4TQGA 1SC6A 4D96A 1DJOA 2QKYA 3K8QA 1I3KA 3M89A 2H51A 1TMGE 3JVDA 4TMTA 3F6PA 2F9LA 4GNRA 2UXBB 1DHTA 2PL9A 3MAGA 2I9KA 4Q1BA 3KFXA 4D25A 3UCFA 4FZ3A 4A8TA 3M5WA 2Q5JA 4RANA 3AR9A 1RFLA 4M99A 4N47A 2IP2A 1XJ0A 3T0FA 1G9TA 1QH9A 4X20B 4DV4B 4LGCA 4KLAA 4C0SA 1E1LA 5IXYA 3UGKA 2F8SA 1QR2A 1ZQ1A 3L8FA 3LVBA 2VYVD 5JFOA 3AG6A 5ARCA 1BXGA 1HEUA 1Q7RA 1U1FA 3HCBA 2YV5A 4JY7A 4J3JA 1JDJA 1F8GA 1JLRA 1LDYA 1T9GS 4GW3A 4BX3A 4G8DA 4KAAA 3B36A 1KFBB 2C99A 5DTJA 4MJ3A 2RC5A 3WNBA 1J24A 2MSNA 1JXMA 5HQ3B 4EGQA 1SELA 4P3XA 4OFBA 3HLYA 2AMLA 1WBJB 2PGXA 4US2R 1O89A 3E1SA 2NZ2A 2CWWA 3KUUA 4PAWA 2YIJA 3DP7A 3F9RA 5G0SA 3RGWS 4D9CA 1PUXA 2D0IA 4TL8A 3TLJA 1M73E 4CZ2A 1L3CA 1R6BX 1SZCA 2B1QA 3A6LA 1L5GB 4AJNA 5A0VA 1Y4AE 1CJKC 2WM8A 2PUWA 3VOTA 1KQFA 1YB2A 3B89A 3QXCA 5KSOA 4KL8S 3L1UA 3AWIA 4KKXB 2HGSA 2V8OA 3U7JA 1BJRE 5LSAA 1WMFA 3QWBA 4RF3A 3FKJA 4XUDA 5KWEA 4NBVA 3SS7X 1WKBA 1J0DA 4E94A 1VPTA 1SZJG 3LYAA 5FOTA 5BPHA 4OL0A 3UAGA 4ARUA 5KOYA 4GHWA 1WMDA 1XLTC 2C2YA 2JGAA 2P8SA 3L8ZA 2JJYA 1RAHA 4JXKA 2IBTA 3BIFA 3WNCA 4EG3A 3O31A 121PA 5IULC 1VIVA 5ES4B 1JSLA 1M6YA 4IJKA 4BQPA 1C9DB 5AW6A 4LZAA 1K97A 1RZRD 2H1LA 4MW2A 1E1NA 1MRSA 2L82A 3QA9A 4R1PA 5AHKA 1S2IA 1H42A 1RP7A 5A5GA 3VJKA 1VCNA 3DPUA 3EQ8A 4NBWA 1B15A 3D2LA 3QX7A 4ACBA 2BFCB 3Q41A 3SDZA 3PCRB 1BU8A 2VR1A 5LQNA 5JNWA 4DA0A 1NP6A 3K7EA 2Z1NA 4BFXA 1BWQA 3RBVA 1QHYA 5L3VA 5EXTA 3QYAA 4TVSA 2DX7A 1JP7A 1O03A 2ANCA 2PGOA 1DPGA 1EGMB 1JG6A 2D2EA 1NMQA 4RJKA 3H5RA 5GOTA 4H7JA 3S4YA 4JNKA 1AF7A 4I66A 4YT4A 2R1ZA 1PUIA 2YHSA 1QB8A 3QPDA 1T4BA 1Y6JA 3BE5A 4Z0PA 5BWLA 4EA9A 2RHHA 1PBNA 3OHPA 4OHPA 4GP9A 3N8GA 1ZM3A 5LLTA 4PINA 2WF8A 4GXRA 5LP6C 5BNTA 1XF1A 3DS8A 1BSVA 1R8JA 3ISTA 1FYXA 1QE0A 1U28A 3IPLA 3RSZA 1EFVB 3A6HA 5A71A 2W2VA 1FJHA 3KV1A 3DL7A 2GPBA 2QG6A 1FNSA 1SQ5A 4ARZB 1M34A 3L8HA 1WLSA 4DIUA 3ZUPA 4ENVA 3OE5A 2AG5A 3G2KA 2EYQA 3RD5A 2IEYA 4N48A 3EXIA 2ZUWA 3QSGA 5DRTA 1GCUA 3AETA 1XU9A 2HK7A 3H5NA 4BX0A 1N1GA 2ZRFA 4J8PA 1E6EA 4P4LA 4QJ5A 1Q91A 3STUA 1C4OA 3UC9A 4I4IA 5KOJA 4YAWA 3MCUA 3ETHA 3LCRA 4L3WA 1KEVA 2HTFA 5DN6D 3GN2A 5FULA 1BOOA 4KRYA 5CFQA 2GCEA 2HMVA 5FHQA 1MW9X 3R7SA 4C14A 5H9WA 1V71A 1JLLB 1LDBA 5DHFA 3DNMA 4FGZA 4MWGA 1YZVA 5J2TF 4CI0B 3ANMA 2CNBA 2NUTA 1J97A 2OHFA 1XNRB 4UCXA 3HKDA 2IYZA 5IT5A 1K66A 3A10A 3E1KA 1W48A 1IZZA 3OKAA 5KJEA 3EIEA 5C7YA 2VDMB 2BGRA 4RM3A 2IUSA 1H94A 1R4NB 4QREA 3T5AA 5DLYA 2QMHA 3BRSA 3AEUB 3H7IA 5JNUA 1N0VC 2H2DA 1V3VA 1G21B 2CFTA 3RUIA 2VF8A 4G5OA 3HCNA 1N33B 1OT5A 1IJFA 4YBRA 2IUUA 3G9TA 3T0GA 1LFDB 2NVOA 2YJTD 4LGYA 4UDOA 3KDPA 2QRLA 1ODSA 3EULA 3T9CA 1C1YA 1HXHA 4W6ZA 4KYIB 1W88A 1XF9A 3QBTA 2YQ4A 4XVHA 5IBCA 5DNWA 1EXMA 4Y1GA 1T36B 2AX4A 3JYQA 2GHIA 3IAM1 3O8CA 4KQCA 4Q34A 1U3VA 2P9QA 2VZ8A 4XPZA 3PD1A 4B81A 4I50B 3RUCA 4CQLA 4KK4A 4C6HA 4F97A 4RTPA 4JLVA 4RY0A 1NV8A 3TQRA 2DGDA 4Z0TA 3NHKA 3WMRA 2I3BA 2GXUA 1QUFA 2FQQA 3A8TA 4RGQA 1VA5A 2GSWA 2F6RA 4DW8A 2IXTA 4HQOA 4DR3B 2OQRA 3AILA 2CJYA 1J8YF 5G41A 5JO0A 1TM5E 2Q6OA 2XH8A 1NKSA 2YFKA 2PWAA 4NCNA 1SB9A 3S2SA 2C9BA 1E0JA 4BCBA 3DFUA 1OGJA 1WBDA 5KMGB 5DP2A 3P2OA 2CFSA 1YK0A 1ZUNA 3VPFA 5ES3A 1XPUA 1SUFA 5CD1A 3CF6R 1MDFA 3VNSA 1NNSA 4QXMA 4RHFA 2IE8A 3FGOA 4IQ8A 1DKPA 2CV2A 2PYDA 3JXEA 5F3RA 3I9JA 1S3IA 1QOZA 1TDJA 2GOYA 3KEGA 5E4FA 1UOEA 3GHHA 1Z6TA 2BFDA 4EGJA 3HWWA 1P75A 4KUEA 2V74B 3GPCA 4PTZA 3OPQA 4KK3A 3WO0A 4BVJA 4BMCA 4UMVA 1OYVA 4ZAGA 4H17A 1TK2A 2IPXA 4M1WA 4RV5A 1PG5A 3HBAA 5TJHA 4WASA 5FNZA 1AY0A 1PEAA 5L40A 4NH0A 2H1FA 3OLQA 2HLDD 5CPFA 1BQ4A 1U5BB 2YXLA 3L7MA 4F91B 4G3XA 1BE6A 3ANNA 4FW8A 1H5QA 1YBHA 3THOA 4M49A 1FLDA 4CTKA 4LHEA 2ZUTA 2O3SA 3N74A 3AU8A 1E4EB 3BQNB 3TTVA 4HYEA 3KHUA 1T9HA 4IHJB 1DAEA 1ID1A 2QY9A 3LV8A 1QDEA 3HJNA 1DX4A 3ND6A 3MT9A 3FTEA 4IQ0A 1VL0A 3FBWA 3VR4A 5JW6A 1FFDA 5KHOC 2A9RA 4RIGA 4B3GA 5IVDA 5H8WA 1L7QA 5FFFA 4L4YA 2R6JA 4MTCA 3WK8A 1E6UA 3CPSA 2NSDA 4PHFA 4RXMA 2C7GA 3DLAA 2PKCA 2A14A 2UDPA 1RM4A 2MYTA 2CEAA 3EUFA 3PUHA 2H4YA 4HQRA 1YGYA 4JP2A 4YHBA 1E59A 2GR9A 2XX3A 2H1OA 5D2CA 4K6GA 2YXEA 3FOWA 1VOTA 3NHMA 3BXXA 3H84A 3HA3A 3AVUA 2XAUA 4KLCA 1J42A 2BEKA 4MA0A 1JECA 1FNCA 2D5BA 1VJ0A 3GNSA 4TTJA 4LRXA 3WK9A 1XMOB 2PWPA 4QPCA 3NOVA 2AWNA 5CJ2A 4X6UA 4DG9A 2J8ZA 4OKSA 5IVIA 3W2FA 1OI4A 3DBHA 4GI3A 4M1QA 4V0SA 1O0BA 4OSOA 3QUSA 3PGA1 2O2JA 2B4KA 4Z54A 1EX6A 2CMGA 4DQ0A 1KU0A 3TLAA 3HKCA 3EQZA 3V3KA 1TVCA 2QM8A 3B13B 5KIAA 3MMNA 2ASVA 3EXHB 3ID6C 3T15A 3TH5A 1OKKD 1BVHA 4NK4A 1WETA 3E7DA 2B1JA 2GF9A 2YJZA 3R3JA 1EWRA 4ZREA 4N5IX 3WQSB 3OQOA 1DAKA 4LGMA 4QOJA 3WJ7A 5JC1A 3MTDA 1LXCA 2AUMA 2PKEA 2W0MA 3NATA 2Q4BA 3X2FA 2VQ6A 5CFOA 5K8UA 2G04A 2BKUA 4CVNA 4PXYA 1YBFA 4YP9A 2NV2B 5D3MB 2EGHA 4XR4A 1NUQA 5I7HA 4ZQGA 2UZAA 7REQB 5LOVA 1QHIA 4DIFA 1C1XA 4A6EA 1XRPA 4DOMA 4EIWA 3QBVA 4OU5A 4LPSA 4P6VF 1IPHA 5H59A 3TRHA 1WB9A 4RA6A 4HWPA 3A28A 3WS7A 4X1KB 3OX3A 2QQFA 2WD8A 1Q1GA 4YLGA 1LQ2A 1JBQA 3GEDA 3RM3A 3MHTA 3UAZA 3N05A 4RPIA 2YNMD 1N2XA 2ODAA 2W0SA 1RJFA 1VI2A 2Y1DA 1RPTA 2PNFA 2OHHA 3DAOA 2VBCA 2VTDA 4TTVA 4EKDA 1W5FA 2GPSA 1X0VA 1IBRA 4B35A 1KDOA 1OUMA 1VLJA 2M6SA 4X1YB 1DQSA 1TYCA 3CX6A 3V9PA 2ZZKA 1LTQA 2HQSA 3LT2A 2ZIZA 4FMDB 3H1BA 4Z4GA 1XRLA 1F5NA 2O0KA 2QTNA 3EPPA 4PX5A 5C0OE 4V39A 2BYTA 3FOBA 3I4FA 4L2IB 1V4NA 2XOKA 3R0IA 2IU4A 1T2AA 2OXRA 4YCLA 2IS4A 3LHIA 4BRSA 3RWOA 3UMJA 4BVGA 4YXFA 2F43B 5BWMA 4XIIA 4NK5A 1F3LA 3ET4A 2VYNA 3KKMA 2ZYRA 3VZBA 4BBJA 2CXSA 2P9ZA 1DQZA 5K01A 4WAUA 1A71A 1LPOA 4X1IB 2PGJA 4HH4A 3WO1A 2PT7A 2O52A 1KI1A 4G5SA 2IPNA 4UXJA 3OZUA 4U6QA 3BYZA 1J0CA 1PW5A 3AUJB 4G5HA 3B1FA 4UFNA 4ARAA 1SC1A 3L01A 3M3DA 2PMFA 2QUAA 3ZI7A 2NW6A 1SBQA 3LDUA 1ZSVA 4RENA 5JQWA 4HUQA 5K8IA 3C4VA 3Q8WA 1Y1TA 4QTYA 1JKJA 4UNQA 3QJ5A 3PBKA 3T94A 2CDCA 1ZZEA 3EF3A 4J1NA 3JPYA 1TKBA 4X7BA 5I9NA 3OM8A 4Y9SA 3DJYA 4QOGA 4TMWA 4XFKA 4BO4A 3S28A 5CGQB 1PCXA 1BEUB 2Y0PA 3HY4A 3DAGA 3ORQA 2Y1WA 5KTSA 2VN8A 1VB5A 3H17A 1CUSA 4QSMA 3U17A 2BMEA 5ICCA 1XVAA 1RMQA 2C20A 2CBZA 2Q3DA 3EASA 5J59A 4BRUA 4IJWA 2IW1A 1IY1A 1JEAA 2D1QA 1W8DA 2AL7A 2GPJA 1YHZA 3BKWA 3NNSA 2A0KA 3QFCA 4HAWA 1RXIA 5EERA 2XCIA 4M9RA 3OX1A 4EUNA 2W83A 2BGGA 4QYMA 4QBFA 4YRIA 4WWHA 1EXNA 4YQEA 2WVHA 4JOBA 4HYQA 3WKCA 1YI1A 4Z1MD 2VHUA 3D4PA 3TGLA 4KU4A 3FPGA 4C0JA 3SJBA 5A3QA 4M8LA 5DP1A 2CNOA 1Y1PA 1I4DD 4IYJA 2BDTA 2ECOA 3ZGYA 2H1SA 1SHJA 4B75A 3OQMA 1X7ZB 2V0CA 2WA2A 4R1OA 3V3TA 1XMSA 3RSQA 1W87A 5JI2E 1Q7TA 3NBYC 4BBPA 2IZ5A 4IFEA 4TQUS 2WYUA 3M6MD 1JKXA 1T2DA 3WI7A 3DMHA 3EH2A 1W2WB 4OXNA 4XSGA 2NPFA 3H9QA 3KPYA 4FFSA 2K2QB 3TD6A 5AT1A 2IH4A 1O6BA 2DBRA 3GJZA 3U80A 3L0DA 1R0RE 1EB8A 1I7SB 2IITA 3A4MA 3I3OA 4LSZA 5D5HA 5ADUS 1AUVA 1QYCA 1C7IA 3C4QA 4ZZ2A 3K4QA 4QHSA 2O7SA 4QU8A 4ALJA 1OXVA 5JZOA 1BH6A 4DZZA 2GFQA 3HMKA 2JKZA 1IHXA 4MLCA 1K9VF 3AKEA 2OZPA 4AS2A 1TIPA 1KEUA 1HPLA 2DWQA 2GXAA 2GHTA 3UJBA 5JBIA 2ORED 2V6BA 3IHTA 4FE7A 2ZWMA 4JFRA 4MITA 2VUUA 2OILA 2EQAA 4ZOEA 3I6YA 1PR2A 2PUFA 1T9KA 2HO5A 1I14A 3D7MA 4H6XA 4TKVB 2IYPA 4JLUA 4C7VA 3QVMA 4Y1FA 3JAMA 1QMPA 2VPYA 2VI5A 1KEEB 1NN3A 3B1YA 4KI7A 4MRAA 5ALXA 3WNVA 2V3VA 2PSHA 2YV1A 1V16A 3AZPA 2J3JA 1L8AA 3QW4B 1DV2A 3G8DA 2Y27A 2JJ8A 4LVCA 3OTHA 1QWSA 2XMSA 3SC2A 4Q00A 5LKRA 1ZA1A 3INGA 1IBCA 2F3RA 1QIFA 1ISIA 3K9BA 4PPQA 2ZWPA 2BFBA 5L9AA 16PKA 4ESHA 2P79A 3HP4A 4YJFB 3IQHX 1LBEA 1VL1A 3AP3A 3LQRA 6REQA 4JQYA 3TRJA 3UJNA 1M6WA 1QYXA 2F7SA 2XWJI 3TTUA 2BFPA 2VJKA 3FPEA 3UHAA 5IJ0A 2ZYAA 5IZ4A 1UMBA 1CC1S 2YN0A 1HYBA 1RZVA 1YCHA 3IB6A 3JAWB 3L8EA 1JBKA 1K2VN 4OAPA 5FUMA 5H80A 4I5IA 4P98A 4EO7A 2YN2A 4YJGB 3MM4A 4V3CA 2EEZA 4FCWA 1Z0KA 1Y1SA 3WYBA 2QVLA 2O48X 3HN6A 4I99A 3A2KA 5BWNA 4PAGA 3QNMA 5B12A 2B1RA 2R751 4E30A 1JE0A 4MVJP 5E7QA 2X3FA 1EDZA 3FZNA 3WK6A 5JHGB 2DLDA 1RBQA 2R48A 1NR1A 2FP4B 3BE8A 3LCUA 4MJ7A 2IRWA 2X0EA 4BO6A 4YUZA 2QY6A 2FGJA 1H2WA 2C4WA 1SM4A 3F1KA 4N6NA 1JDUA 4MV9A 4RCYA 3I9LA 4HOYA 1ZK3A 1RYDA 1V7QA 2F8LA 2XRYA 4G84A 1XG5A 4EPXA 3W4IA 1T0HB 2GN4A 2I7CA 1N6IA 1KFCB 1Y1KE 3D43A 2PWBA 1JJBA 3F6SA 5LUBA 3IBGA 3AKZA 1TZKA 1NJ8A 3JQAD 3WP0A 4BNNA 3OTQA 1JWBB 3M82A 3VR2A 1XVIA 3HVHA 3WIEA 4JVMA 1A04A 1IK6A 1PLLA 1G17A 2B98A 5JRZA 2DEUA 4YEDA 3U3RA 1PEDA 2P7HA 3THWA 2IF2A 4AF6A 2AHOA 1WTCA 4CV2A 3ROZA 2ZIXA 3E15A 2VZEA 4WADA 1XO1A 1WMEA 2PSEA 3QU5A 2W2KB 1J0BA 4LNAA 3GY0A 4M87A 2PZGA 4H1TA 4PHCA 1DCKA 4TM7A 4ZI5A 4CMHA 2QN1A 3MZ0A 4B6JA 3F74A 1EDOA 2EC5A 4KSYA 4P22A 1FX0B 3TUJC 3BWBA 1Q0QA 2A59A 2XJ9A 2F4VB 4DMMA 2RBEA 2J48A 1BHQ1 4DCJA 1OLUA 5IMSA 5LXTA 3PJEA 3LDHA 4X63A 4D98A 2PS3A 2VPWA 4GT1A 4FVTA 4PHTA 2H4ZA 1ORDA 3FWNA 1E3DA 4UPVA 4YAUA 3C5CA 3NH9A 3B9PA 3OPMA 4QTXA 5DSTA 2IKQA 2G83A 3B3QA 4NARA 4QBHA 1E9AA 2FLWA 6REQB 5CIWA 1MX3A 1MB3A 4LE2A 1F4PA 2EIXA 5K6TA 4QNRA 3NTUA 3GZNB 2HWYA 4YAFA 1PQWA 3IB3A 2Q50A 3ISVA 4O4IB 2SCUB 1UZMA 2WG2A 4WZZA 2JJQA 5IAJA 1RRKA 2DF8A 4WQMA 4KFSA 1Q95A 1R0BA 1FLAA 2HDNB 4ER5A 4MV6A 1YDEA 4TWAA 3GMTA 3SZLA 1N8NA 1NSYA 4CIXA 1UXGA 4Y2UA 1QV9A 4EF4A 4AP9A 4IGKA 2PSFA 3VPHA 1L4FA 1QGAA 5DHRA 2QSUA 1VG1A 3FCXA 5I5GA 1X0XA 4XM2A 5IVHA 1ETHA 1DAHA 3KPVA 1L5HB 4XWTA 4LJ5A 2ZS7A 1BVYF 1GARA 3LKDA 3PD0A 4R2KA 4BB0A 1TEHA 4GXTA 5ARBA 5BT8A 5C52B 5JLJA 4H6WA 2ZYWX 4FT4A 5KDLA 4LQDA 5JDCC 1I01A 3OTIA 1VLMA 2H0RA 2JJ1A 3EOZA 4TQAA 5AVSA 3U60B 4NE7A 2VEOA 1UJBA 3U5TA 3PEVA 4GGPA 2IXDA 3SR0A 4RFSA 1KYXA 1N2IA 1FE8A 4HVTA 4B3RB 2ECKA 4BEBA 2Q2WA 2R44A 3I42A 1CUVA 5U4QA 3HEBA 3JR7A 1B3RA 4Y6SA 5EE5B 4B17A 3WLPA 5BVHA 3QNWA 2YW2A 3ER9A 3CE6A 4JX9A 1KJ9A 1T0UA 1Z7YA 2GN8A 2NGRA 2Z43A 1MRNA 3BQ9A 4RUKA 4IDQA 5GP1A 3RANA 3O3MB 1GCAA 1U0LA 2QA5A 1QHNA 1F0KA 2WM3A 2XMPA 3B7WA 2HH9A 4K6MA 4EUEA 1U81A 4OUDA 2HW8A 2WQZA 3PDIB 4F84A 3Q7EA 3TTYA 1G8SA 5K2MA 3WYCA 3ZS9A 1ECFA 4BZXA 2XKBA 1MN6A 2ZRQA 2SKCA 5KNBD 5KQRA 1FVXA 3WSVA 1H2EA 2ENWA 3CFYA 3BORA 3KT0A 4ETIA 5CB8A 3DF7A 1XFDA 1Q15A 2GLXA 3IFSA 4HWTA 5AOVA 3TW8B 1IJBA 3IO5A 3MJ4A 4IRMA 3V7NA 1ODIA 2HXSA 1FFXB 5FTMA 1RHUA 4R71A 3LC0A 4YRSA 4JB3A 3E0QA 3V6LA 4PO3X 4QM7A 1V9SA 4ITRC 5KU1A 2YJGA 1FYWA 2O6LA 5I9LA 3WTCA 3DZGA 3DTVA 3VJLA 4GPAA 1DJNA 2OYRA 2A35A 2BRUC 1US8B 4I4LA 4MZXA 5IAAA 1ND6A 2J4CA 1A9SA 1M6VB 2O2GA 3PI7A 1CYDA 3R3YA 4REOA 5BQ3A 3FSGA 3JQFC 1EXVA 2OHVA 2I91A 1SK9A 5HW0A 2ZR8A 1JG7A 2WUVA 2G9VA 4DRZA 2I8CA 4EG4A 1C9NA 2N75A 3CS3A 2DBQA 3FX2A 1Z5OA 2FJUA 4TVOA 1HT2E 1M72A 2P9FA 4HTFA 3B5IA 4N7MA 4NYJQ 4JP3A 5BMVF 4M55A 1R6VA 2FUG1 4N41A 4MS4A 1QORA 1NJGA 3RU7A 2XNJA 1XMQB 2DHDA 2Q8QA 1RC1A 2OTCA 5GGXA 3U31A 3W7BA 4RD4A 2OV4A 4N1AA 1PG2A 4CCAA 1DRJA 3THRA 1S2GA 5CA1A 1JQBA 1P2FA 2QD3A 4EW6A 5KYGA 1Y63A 2PA0A 2F1IA 2WWRA 1L7RA 2XNDD 3DMFA 1YGPA 2AVDA 1H6DA 4KN5A 4TTRA 3PR2B 1TXGA 5D1NA 4DBZA 1F9AA 1ZCZA 4FHGA 4R83A 2XUOA 1T91A 4REQB 5ALWA 1B8PA 4BO9A 2OHGA 1CQJA 3W5SA 3VHXB 3BMNA 1H2HA 1HZZA 2D4AA 2XUHA 3OQBA 4BE4A 1RLTA 1MJGM 1PQ4A 1CSEE 2AYZA 4CKBB 4LXHA 4EGSA 2BN4A 3COZA 3O5AA 1MAWA 3AGPA 1O57A 2X41A 1E6KA 3CZ4A 3LCCA 1KF0A 5EMJA 4WLVA 3L40A 1TT7A 2JFXA 2ERCA 3NEJA 4FK8A 4UJ5A 1GAQA 3MRXA 5EJ4A 1IIBA 3PFNA 1PSDA 3AUYA 1ZPDA 1X7DA 1C29B 1UBHS 1YOVB 3PJRA 3P2EA 2EATA 1SOVA 4AULA 2HJRA 2VHVA 3UJ7A 2XDQB 1U0NA 4C4YA 1JXQA 1PYDA 3V1TC 2GS9A 4EI8A 4TS4A 4Q37A 4US1R 2XTMA 1P74A 3G7SA 1RLUA 1VCIA 4UD2A 3G49A 3DWEX 2GJKA 5FIUA 1UXIA 4OAQA 4QOFA 3AEXA 3TSYA 5AVZA 1FVOA 4GD3Q 4P4SA 4DARA 3WZ2A 5K0CA 1DRKA 3MWDB 4XEHA 1UDAA 4JGGA 2CYCA 1ZS9A 4B44A 2WAOA 5EIFA 2O8FA 3BERA 4PXSA 1UM9B 1ZMRA 2QR2A 5E9WA 3DMYA 1QTQA 4QNMA 4TVKA 3T7KA 3MUEA 3H9UA 4ENPA 2DY1A 2XB9A 3QHAA 4GS5A 3W04A 1C8BA 2AEEA 3PWZA 4ZYUA 1E3JA 4LZLA 1WXFA 3A2LA 4JR1A 2TSYB 3FRHA 1KIMA 1CR4A 2O8EB 1UEJA 4FP9A 1GZVA 2KE5A 4OQFA 2UZ1A 3HDTA 1JAZA 2UVDA 2CVPA 3MFYA 4J0HA 3U48A 4EMBA 2PX4A 4CKZA 3FPAA 2J3EA 2QJRA 3CBGA 4G26A 5CD9A 3HE3A 4M8IA 7YASA 2QT1A 3CRZA 3K09C 1EZZA 1RJ9B 2HA0A 3A58B 5T8KC 5ALVA 3MQFA 1CDEA 5AI9A 5FA8A 4B3BA 1WY5A 3M4YA 2C7BA 3RC9A 3HJUA 5G4KB 3SIXA 4HQ0A 4C4ZA 2FJ0A 1KVTA 1NYTA 1ZH0A 4N0EA 4OQYA 1KDYA 2BE7A 3BOSA 5A3JA 4IKEA 2R6HA 3ELDA 4BV3A 2DHQA 4P1ZA 3GUVA 3S2FA 6LDHA 2H65A 1E1KA 1NN0A 3LRXA 3N6VA 3D8HA 2F55A 2AMVA 3GJRA 1A5SB 1GL9B 2X2FA 1L6RA 1LLFA 3I1JA 3Q7QA 1YA8A 2ALJA 4N82A 2WSIA 4HH3C 3ROQA 5JR3A 3B48A 1M8FA 1GPMA 2RHGB 1BX1A 2NSYA 2PZAA 1I7LA 1L4UA 4RVFA 4EJ2A 3MJCA 2NUAA 5K8LA 3SBEA 3BGVA 4K87A 2BV3A 1GGMA 4N8DA 5L3SA 1Y1RA 2PSSA 4M0UA 1BFKA 2Z5LA 1K8YB 2V5UA 5ECGC 5HUQA 4FYHA 4QDZA 3S8EA 1BW9A 3T4EA 1TYDE 1CX9B 1ZZGA 2MYUA 2A5DA 2QLLA 2Y9MB 1A9TA 2VNHA 3AHCA 3KRTA 1UC9A 3R1IA 5AICA 3O4IA 4NE2A 3DZFA 3IIJA 5LJIA 2PQ6A 4NJEB 4EYQA 5JSZB 1P17A 4G0XA 1MJ5A 2YIDA 2Q2OA 3K96A 4ZFNA 2WU0A 4W8GA 1H6CA 1T6ZA 1MGOA 2I33A 5C1BA 4QGSA 3RPEA 3QKSB 1WY7A 2PXXA 4XX0B 1EM8A 4FLMA 3VZRA 4K5QA 3EGDB 4ZTZB 4KR2A 4B6QA 4CXMA 3KZCA 1GPKA 2Q1YA 4MARA 2WVGA 4COOA 5FJIA 5I8PA 2JAHA 1X3SA 3H19A 4G0YA 5HQJA 3ZNQA 5CFPA 4C08A 3VO2A 2I65A 3W9UA 1KIFA 3O0DA 2W8BA 3CR3C 4QEKA 2WB4A 5HE9A 2HF7A 3EHDA 3QWHA 5FUWA 2Q3MA 3D5EA 5EIOA 4AZWA 1KK3A 3EWSA 3ABOB 3ZHTA 4BGEA 3TIFA 1KR2A 2PS9A 3C8ZA 4X94A 3W05A 3H3JA 1QP7A 4DMLA 1A77A 1W7AA 4A2WA 1BXRA 1IU9A 3QHPA 1C8VB 1J06A 3E23A 4YRPA 2EHJA 1GPDG 3DKRA 3PQ8A 1K1EA 2Q1UA 5DJ5A 3L8GA 3SLKA 3PFCA 4G8BA 2G1JA 1DXQA 1GP2A 5FL7D 5I9SA 5AR1A 2YRWA 1Y3IA 4ZTBA 3RABA 2OE2A 1UDCA 2QNRA 4TSRA 1EGVB 3PGVA 4E5MA 4X84A 1RT9A 2EDAA 4HZGA 4OPMA 2EBHX 5MDHA 1XEXA 3MTJA 4J9UE 4JT4A 4DV2B 1XTBA 1DBPA 1JWLA 2OBNA 1XQXA 2LPMA 3DDUA 2VG8A 3FA2A 1OAKA 3OEYA 4YT8A 5G02A 1ZGGA 1Q77A 5EUQB 1I9CA 1KPHA 1QM5A 1RBMA 4UVGA 1T0IA 4YJ2F 2GZDA 3UQZA 1AHPA 3NKFA 2O19A 4N65A 3USZA 1PS9A 4PC7A 1ENYA 3JQCA 3OAAA 1NPYA 1G7CA 2QAJA 1MNQA 2W8ZA 2YICA 3FWPA 3GRPA 2A6PA 2V4MA 5F2OA 2Z57A 5T3YA 3IKTA 3R8FA 1PTJC 5BN4A 2OO3A 4OJYA 4ED9A 4B8YA 2W22A 3AR2A 3UUGA 1CULC 4LY3A 5EL0A 3KKNA 1U99A 4TV9F 3SJZA 3PA6A 4EHAA 2GT1A 1TQ2A 3AIKA 2WIDA 2I4NA 1EVIA 4N8SA 4XDHA 5LWQA 1T2UA 4Y67A 4LF6B 5F1YA 5IYZB 3SJCA 5JALA 3UW1A 1QLWA 4K3VA 5H3HA 5HIIA 4BZPA 2PG3A 5A06A 2QJOA 3CSSA 4BAZA 1LW7A 2O7QA 2E5WA 2AHRA 3E5MA 1M0WA 4C0AC 1WF3A 3B3GA 3PGLA 4PO8A 4FYXA 5A4AA 5KVAA 4D97A 3TQSA 4G0UA 4UUAA 3E5HA 3QOYA 2W00A 4J1QA 2B4YA 2CVZA 1YCGA 2FZWA 1YDMA 4C5AA 5K7SA 1M2VB 2HCBA 1U4NA 3A4YA 7GPBA 5ICFA 4O3FA 1BRTA 2Q5HA 3KQKA 4LSWA 1XWIA 1BWPA 1L7PA 3TCNA 3IAAA 4Y6PA 1XOIA 1TUGA 3RVPA 4HDMA 4EYGA 2FHSA 1NQ5A 2V7EA 5F5LA 3ZVMA 4M8NE 2ROQA 4OLFA 2YWJA 3CR7A 3EVDA 4GPTA 1VIMA 4BV9A 4DVGA 1EP2B 2Y99A 4PFJA 5ALHA 1FFCA 3M5CA 3IOCA 1VPVA 1MTOA 3FPFA 5A7GA 4Y2VA 3FJOA 5KCZA 3RFCA 3BX1A 4PHGA 4BUCA 3TKAA 2FSUA 3PQFA 4C01A 1XV5A 4D8XA 3DW3X 1GGVA 5TARA 4P7KA 5CCXA 4GC5A 3BSSA 1JX6A 3GIDA 4IH4A 5ENZA 3K0HA 4OX9B 1C3EA 2J0EA 2Z2JA 3WAKA 5K0NA 2H1VA 4BLUA 1LTKA 4WOKA 4HGYA 4L7VA 4EA7A 3DXXA 4JUFA 2VZLA 5BSMA 1BO6A 4RMHA 1KERA 2CKMA 5THQA 4RE6A 3SFVA 4F45A 1E9DA 1WUHS 4Q7JB 2WY2D 4DY6A 4J7AA 3IEXA 5DHSA 1XR3A 5BYAA 4OKNA 1KEZA 4U4AA 3BD6A 2XVXA 1JI3A 1JKFA 1W85A 1W35A 3KJFA 1W5TA 3FPSA 2JGDB 4MCIA 3AW9A 3QFFA 4G0ZA 3JQ7B 3QPVA 3L04A 1R88A 2BI7A 4MAAA 2QVBA 3NBAA 1M83A 2C4TA 2FZLA 3QENA 4BP3A 4N0MA 4RH3A 1TQ8A 2G07A 2H2FA 2PX8A 3KQTA 1Z0ZA 3L8DA 1ZXLA 1Q1ZA 2PU5A 2R8ZA 3BL5A 4JB8A 1VZ2A 5K4AA 3JTEA 2V7WA 3WRYA 5B1EA 2XT9A 4QQNA 2A1UB 3KEFA 1ZRSA 5L7TA 3VU0A 1H1TA 5EFOA 4E14A 4KJXA 4LDRA 5E6SB 3SBOA 1VE5A 3QVOA 4NU8X 1R3UA 1GGEA 5H5JA 5B6IA 4JIGA 2WHPA 5EVCA 5T5QA 4IX1A 4Q4DA 3H1TA 4DUPA 2QI9C 4HG2A 4CDMA 1DCFA 1RE0A 4UU0A 5AW5A 5KCMA 4HP8A 4DDHA 4MGZR 4POAA 2CL7X 1WRBA 2PD3A 4OHKA 4W5RA 4ZYWA 4GMXA 5LLSA 4BVLA 4PN7A 3AL3A 2H1HA 1NLYA 3CEAA 1XDDA 1GEGA 1H5NA 4LBYA 3RC8A 1ZM2A 3AHIA 5COAA 5DN6A 4KB5A 1HK7A 4B33A 2HBYA 4OMUA 1VSQA 5GAJA 1JL3A 1DBQA 2OM2A 4UATA 3I12A 2ICAA 2SHKA 2J5XA 4JL8A 2JZCA 3EDMA 4ZO4A 1TQDA 4LYHA 4KPUB 2QIOA 3SN6A 5EMHA 5KX5F 2ZYGA 2Q0SA 4R2IA 4IO0A 4IX9A 2QYHA 1M2WA 3O8OA 3KM0A 3LUDA 3JWPA 2RGAA 3IEKA 4JBWA 4M89A 4Z7JA 5IN5A 1ZJJA 2WSSD 4IIFA 2B7CA 3Q72A 1H9CA 4F1WA 2WIFA 3PNOA 1PQYA 3AF5A 4ISBA 3DLBA 1GY8A 1WU7A 2CB0A 3I4LA 5KO2A 2NLOA 5ICEA 3GFFA 2IYVA 5CVDA 3USES 1Q11A 4PYMA 4MKXA 1VLQA 3DV0B 2RK4A 4R31A 2ISSD 2LKCA 1QVAA 2P8JA 3L7CA 2O8DB 2JBAA 5IS2A 1YONA 5UKDA 4IVRA 1W75A 3CRW1 2BFMA 5ITVA 4C3OB 4XDZA 3KUXA 5EIBC 4MX8A 4A8HA 1I30A 1JE1A 4M1TA 4ZKEA 4BXOA 4Q39A 5ESRA 1CZOA 3D6JA 3E3OA 3NJ4A 1CB0A 3N2KB 4QOEA 2FA9A 4ZQHA 3BGIA 3HZHA 1M34E 3B8HA 4LV8B 1J49A 4RGYA 4U2EA 4LGVA 4COKA 2WZQA 3GO4A 3R0XA 3U4IA 3HWSA 1PUJA 3ZLTA 5CUQA 1PZXA 4Y2PA 1BZYA 3HWRA 3LU1A 3K0SA 4J1TC 1WMAA 3JZIA 3BGWA 1DXYA 3BRCA 1R3DA 1Z29A 4EENA 4AJ2A 4XWKA 1SURA 1HGXA 4PZZA 5FO1A 5LBIA 3TM4A 3W2HA 1DXHA 5K0LA 1BRMA 4BE7B 2E55A 4AMZA 1SOAA 3OEWA 4FYMA 4H4CA 2YCLA 1ULZA 2VJLA 4Q7EA 5CXQA 4C4AA 2OECA 1O8BA 4DQVA 4KR6A 4B34A 1TUIA 3A6EA 3AFGA 5B1IA 4Q93A 5EQJB 4ND7A 2BEJA 1NHGA 4OQDA 5TV2A 4X61A 4Y7DA 4ZMBA 1CHNA 4IGAA 4JC0A 4KXFB 4NYMQ 4PLHA 1B0PA 1U0RA 2ZR7A 2JI6A 3GGOA 3PDHA 3PEWA 1KIAA 4KMSA 2JK0A 1EFPB 1SUAA 3F6CA 1M66A 2OORA 2RGEA 2PDAA 3WC4A 2I80A 1Q3TA 1WZ2A 3SYKA 1KI7A 1ZL0A 3IP8A 1PWHA 1JQKA 3ITDA 3RT1A 3T06B 1E2UA 1Z3CA 3VI3B 4ZZIA 4QDOA 2E48A 4G36A 2P65A 1UQUA 1WX1A 4NYJR 3DKKA 2PX5A 5KNCA 5FLXA 4QVIA 3KCQA 5AJVB 4DR7B 3AVYA 2IYUA 1W2GA 2CXTA 2E4ZA 1ODJA 3NVAA 3T1OA 1K5PA 3L4BA 2Z2IA 5BSKA 5KQPA 3UPTA 5FO0A 2O23A 1J5XA 1BXGB 2B8JA 2BKAA 4P58A 4ERXA 2BFAA 4L51A 3ZI4A 5KVSA 2DBZA 3UMVA 3U9LA 2H18A 2VC2B 4LSGA 3Q11A 3W6UA 5EP3A 3U16A 2HHJA 3U1TA 1EA7A 4GL2A 4NESA 4V0MA 5LQDA 4OHYA 1RM0A 1O95C 4M0LA 4NEHB 4TMKA 1H4VB 2OZLA 5A5VA 1PX2A 3N9IA 4RZXA 3ZXIA 2PUBA 4MVJF 2WMYA 1MORA 3V4RA 2NZ8A 1R9MA 4HB3A 8ATCA 5AOCA 1XU7A 3DO5A 3STHA 1IWOA 1OFHA 5EEHA 3AEYA 1MMFB 3WLMA 3ERCA 3X1JA 2PXCA 4JXXA 4POOA 4AC9A 1IY8A 5DNDA 1KGDA 4K46A 3K6SA 5KPDA 3SR4A 3RWBA 3HFSA 3GLKA 4DV3B 3NGLA 3AJ8A 2VF7A 3PK0A 3P26A 1GCOA 1VL5A 2V1UA 2I6SA 1NQWA 1UIRA 4JKYA 3AT1A 1BIFA 2QQGA 4LYFA 1FFGA 3M1IA 1H4TA 3V9AA 4RYDA 1JJ7A 5DHQA 3SHQA 1VMDA 4MR9A 4EHDA 4RZHA 5IP5A 4D5EA 3O95A 4O4LF 5BV1A 1R5NA 2W6ZA 1U8YA 3PIIA 1KJNA 1TM7E 3U56A 4ABYA 1NFFA 1G9SA 2JFYA 4NXNB 3NC0C 3R20A 4IXWA 2HF8A 1EI9A 3TX2A 1ESMA 1ZITA 3OCVA 1KETA 4NNPA 2WM2A 1PF7E 2PU7A 3OBIA 3JQ9C 1NUUA 5EWLA 4ZANA 1ZD5A 2R6CA 4JL6A 1DMRA 3D2CA 3QVWA 4G81A 2WP8J 3CWQA 2HO4A 4NICA 2XOXA 4NCKA 3OX4A 4PRZA 2LNDA 3WGMA 1MQ9A 2COEA 4PW0A 3IUNA 1SCDA 4B3JA 4EITA 4A23A 4MIEA 5EKUA 1GAXA 2FPPA 3TKYA 3VC3A 5ECWA 4MHOA 1KKUA 4GLOA 3DE3X 4Y0NA 1VQ1A 4GL4A 2NP7A 3RFXA 1AXGA 4J16C 1GU0A 1IQUA 1PZNA 4XQEA 1SBYA 5AI4A 3UKOA 3V8PA 2N46A 4C78A 4P8RA 4AMBA 5FP0A 2OGTA 5IM4F 5K3CA 5HRUA 1NBHA 1U0HC 3PQEA 3IT2A 1K75A 5F2EA 5JI3E 5BORA 2YNMA 1GPAA 3T41A 2MWMA 2M2IA 3BUSA 3E35A 3DO8A 4B4WA 4DLXA 3KE8A 1UK9A 3U1VA 1PJTA 3V4PB 4XLLA 4FUTA 4PBSA 3VSDA 1CY1A 2QM7A 3PXUA 2BM9A 4BO5A 1PHRA 1MVNA 2WYHA 3R76A 4YQYA 4YLYA 4CIBA 1M34B 3AQIA 5HK8A 2REXB 3MWKA 4CQMD 2WTUA 5IM5A 1P61B 2C31A 3MRTA 3PZRA 3F3KA 4RD6A 3STYA 4ZGBA 2PQ2A 1X1SA 1P1CA 3BMXA 3BTUA 2EWWA 4YAJA 3EXIB 1XYVA 3CT6A 2QRHA 4MKZA 1Y9AA 2RGBA 3AETB 4LRQA 5GGYA 4M54A 3QE0A 4DXHA 2C9DA 1G64A 5LNK6 3D59A 4MUHA 4LVOA 1ZVJA 1LJ8A 2VQSA 1J20A 2DSNA 5ESXA 2XF2A 3IAS1 5KOJB 3QKRA 1JZTA 3SY8A 3VX3A 1EE1A 2Q5CA 2ZRAA 3KOMA 1PFUA 4KXWA 1E32A 4NCIA 2RMKA 1XRSB 2BZ1A 4WOCA 1O6CA 3ONDA 5BWCA 4UM7A 1LPNA 2NUTB 4PONA 2Q0QA 1SPXA 4IM7A 2O7NA 3HKDB 1M9NA 5BW6B 2ATCA 2V7QD 1CYEA 3NORA 4LWQA 4O8ZA 1M8KA 1DC7A 4QYIA 3ELYA 1T3GA 1XK6A 1R8QA 2PYZA 3P9KA 4M9SA 4R2JA 5C4MA 3DZIA 4HDSA 5A05A 2VT3A 1V37A 4MEJA 3HXPA 2AFIA 1ZHOA 1VIDA 3KQLA 1Z4MA 4EOGA 3RRJA 4YMTA 2JJ2D 5HZGA 3EGEA 3K0KA 5EINA 2IX9A 2JJMA 4P5DA 2O7VA 1FMJA 4YRDA 4HNSA 4B3FX 4KFUA 4RPGA 1OLXB 5C1DA 3I5XA 4ZVRA 1G16A 3LT1A 3DVRX 3RF7A 1YB4A 1E7SA 3LPCA 1ONPA 1W88B 1BYUA 1U8EA 2JFWA 4QZVA 4B80A 1WQ4A 4Z1MA 5JZMA 4QAJA 5CFLA 3EOBI 2PRJA 5KYVA 4X6XA 2EL7A 4QT4A 1P2DA 1QYRA 3I5YA 2J45A 2NO1A 5EQFA 2H5JA 3KJXA 2WUDA 4L5AA 1NW9B 1UKEA 4QKQA 3J7TA 2CUKA 1YRLA 3HR8A 3RDPA 4CQLB 1Y3HA 5BMVA 4M1SA 3THYA 5LR6A 2WLTA 4RZSA 4EMSA 1I5OA 3G0HA 2F62A 5BY2A 1WDMA 4AX4A 2B6NA 2WUWE 2XUFA 4Y3UA 1HSOA 4B7AA 3N8DA 4FT2A 1JR6A 1UFOA 2IPLA 4HEA1 3R7NA 1X8XA 3MHPA 4LWZA 4TT3A 2QV0A 3ZKWA 3OURA 1LLCA 1JVNA 3KJIA 1UOPA 5K6AA 4EZBA 1YRHA 5MN4A 4HDKA 5CW1A 4BLRA 2B69A 3MT8A 4G4SP 1NY6A 1P2BA 4H0FA 2R5WA 1ZUNB 2XB4A 2R3SA 4GGMX 4XAQA 4DRXA 3U39A 2PJZA 4PPNA 3SS9X 3UC5A 5CBPA 1WVMA 5EVJA 2ZU0C 1NVAA 2J3LA 4FOLA 3TQIA 3U3XA 5IKMA 4AYTA 1KXZA 1CFJA 1V5GA 2VP5A 1DBVO 1KXJA 2BFDB 3EVFA 3IAHA 3IQDB 5PNTA 1D0IA 4DTCA 1Z33A 4QXAA 3P5BA 4FI3F 1RYHA 1JH8A 1UZUA 4KHZA 3U7RA 3WWEA 1GTL1 4LTMA 2ZT7A 3WFIA 3RB8A 4UM9B 1BDBA 1NUTA 4ND8A 1FMTA 1XNHA 1IOWA 1AK1A 3QPWA 1ONSA 5GV7A 2BMWA 1CQZA 1CT9A 3GOHA 4CM4A 1U02A 2ZDQA 3HCDA 1CQIA 1Y82A 3K35A 3MC1A 3PRHA 4N7RA 2JLXA 1Y6QA 1E4YA 1DTEA 2WJGA 4CKXA 3I76A 2FOLA 3QE9Y 1VDMA 1B6GA 3AM3A 3K4PA 4P0PB 2H57A 2GM5A 4MJLA 1AGNA 3TTWA 2C8LA 1JEYA 2D4HA 4GI1A 4JP1A 2JH9A 4NBUA 2GAIA 2CZCA 4KRFA 4PSUA 1QYVA 4KC0A 4KE6A 5CEJA 5AKGA 4I46A 4ZZ3A 4MPJA 5KDDA 3CF4A 4ML3A 3SFTA 4UPDA 1F1BA 2GEVA 3OJLA 3TSZA 4CE6A 3B6KA 4RPLA 2QIPA 3R40A 1R5BA 1U0TA 1Z15A 2IS6A 1U6JA 1SVKA 4I1RA 1QGZA 2JHGA 3B3AA 3DZ8A 4FOPA 5TGDA 3CUYA 1DRUA 1RQNA 2FFAA 4QGBA 5ICMA 3HM9A 1T6BY 4Y7CA 3FDIA 1HEYA 4PLZA 4BZWA 1GLVA 1TF2A 3FCAA 1JAIA 2PZJA 2YBEA 3H4IA 5T67A 3SXJA 5KWSA 3O2JA 4GF5A 4BE9A 4LXQA 3LBNA 3MUFA 4LZPA 2GVDC 1K0FA 2HDHA 3BVPA 1J70A 2QRMA 2J08A 3R7AA 1JB1A 3DBHB 2M6RA 4QUKA 3V4FA 4JK3A 2HNKA 1N6KA 1JH9A 5EWMA 2P9JA 3HKCB 5TVKA 1W5EA 3BA1A 4MZDA 4CFZA 2VNIA 2DKNA 4BJ3A 4LJRA 4QL3A 1AJEA 2JKVA 2BUBA 4DDTA 5C8DA 2VDLB 3UB4A 3P97A 5JCJA 1UBKS 2F1HA 1OW3B 2C97A 1IYZA 2E5FA 3L8MA 4BEJA 4ES6A 1OMOA 5DSXA 3OE7A 3UOAB 3VR6A 2IHNA 1N2GA 3KOUA 2QDKA 2G9UA 3W5VA 4C6SA 3SSNA 4C4PA 4CLDA 3WDMA 3RC2A 1C1XB 5LOVB 4B6SA 4BGIA 3DMRA 2P68A 3AX6A 3BH0A 4X92A 4RA6B 1WULS 3C15C 4DUYB 5K0EA 1TYAE 1Z35A 2D5AA 1NXSA 3F6EX 5AM1A 3ZWYA 1ENOA 2BJWA 4PPYA 3NR2A 3D4NA 1DMSA 3Q98A 3NWEA 4K7JA 2O54A 1WWKA 4C4TA 2I3ZA 4D02A 3ABIA 3SZOA 4R9UC 4FJ0A 3UK7A 4DEXA 1XELA 5AM3A 1JFLA 1OCEA 1E2GA 3UXHA 4C9BA 3VPAA 5KOHA 4BFZA 4LCBA 2YVAA 1Y4ZA 5JS8A 1E2EA 1Q74A 1LRKA 2PV0A 3KSAC 1G2IA 1FU4A 4K9OA 5C8YF 3HCFA 2C92A 3DDSA 2BCGY 2DFVA 3TEJA 2HBQA 1JAHA 2DR2A 2P5UA 1G8PA 1JDVA 3I6IA 1D09A 2QG4A 2PPLA 3EIWA 3GLIA 1G8HA 3KHSA 3KJHA 3FJ1A 4B6OA 3NDBB 1U04A 3D6FA 4RSRA 1ZJ4A 2J7PD 4PC1A 3PLNA 1UJ5A 3O94A 5DB4A 1RZUA 3PNSA 3C70A 1P80A 1Z37A 3SIWA 1RXCA 2WJAA 2X7HA 3CYFA 4ESVA 3OWXA 3F7MA 1N78A 2F3UA 2H4WA 2OCYC 3OI7A 3JD4A 4GKJB 2X15A 3PQ3A 1IATA 3L02A 2IYSA 1XD2A 3I9MA 4PANA 2YOGA 1D4AA 4HUQB 4MWOA 1JKJB 4D3FA 3WGGA 4OP2A 2R00C 1RM3A 2VUSA 5T57A 4MI1A 3UN1A 3AIMA 1E96A 3SM3A 3UAOA 1T4GA 2P9GA 1M7GA 2I3DA 3L77A 3LUHA 3T9FA 1Z88A 1DQYA 1S96A 1T8SA 3F6RA 4BFYA 4CJXA 4TYNA 2OSVA 3T6KA 2AG1A 2ODEA 4U2KA 3NALA 3OE1A 4FHZA 4MW4A 4TV9A 5FWXA 3SKVA 1DELA 1I2AA 1U2RA 2DXIA 4YFVA 1EVJA 2W6MA 1T5OA 3L82B 2M1ZA 3ZIUA 2WT9A 1XCBA 2NIPA 3INYA 3ITKA 4MMYB 5JOQA 2VSOA 1LPMA 1KH1A 4P53A 4CQNA 2HA4A 3NKLA 5KNBA 4IGEA 1OE0A 3KUCA 4H7DA 1JV2B 3ACCA 4Q4HA 3VV2A 5L4LA 1XNQB 3IV7A 1RRGA 3NHRA 4IDPA 3QVVA 4WRRA 5HBRA 2CCKA 2A9OA 4HAXA 4J7XA 1WVIA 5TGTA 3PKJA 4BKMA 4DA4A 2QEQA 4UM5A 4MRPA 4Z2AA 4QFBA 1L4YA 1JQEA 4NYMR 5EIBD 4L72A 3U3MA 4D26A 2C2ZA 2JARA 2R2GA 4GBMA 4GVPA 1WXEA 2YWHA 5L7WA 2L18A 2OUKA 2JLYA 1H1LA 4NQZA 2DFDA 4LOHA 3ZZUA 3DQPA 3ECAA 4HAZA 4XQ9A 4MQEA 1Y5RA 2YASA 4Q3NA 4WW0A 4MLDA 5AIAA 4A0QA 1OC4A 4BJ1A 1QIDA 5JZBA 3H9BA 4X71A 2OOKA 4DSUA 3ZJTA 3UICA 1YZNA 4YH1A 4GWGA 3OG9A 4A92A 3WWYA 4ZJYA 1BEZA 3MMXA 2WHRA 4RJ2A 3DUFA 4EJ6A 1DKQA 1U7PA 1E3MA 4RQUA 4RPHA 3O2QB 4ND2A 2VXBA 4M0DA 3CZ9A 5JNLA 5KJFA 4W5JA 3T5TA 4C6RA 2IFTA 1CJCA 4MPDA 1IPEA 1BDIA 3HVJA 4EF6A 2KPOA 1QU3A 4BU0A 3OUTA 3EA0A 5TQ0A 1UPBA 4KXQA 1QYDA 2Q7XA 2QYOA 3HADA 3S2IA 4F93B 1YQ9A 2CNWD 2B4RO 3KZ1E 3ZY3A 4RD0A 3RVQA 5JNVA 2B92A 1BJTA 4MWBA 4IVQA 3NASA 4TS3A 3G85A 2GHQA 2A1TS 1CIJA 1L4GA 1TW3A 2X5OA 4KKVA 5IVPA 3T3NA 1Z8HA 2DT5A 3ZWOA 3CE9A 2ZW9A 3CX3A 1V7CA 1V16B 1W8IA 2JC3A 4YI5A 2WBLC 1NOIA 3L6DA 5LQUA 3WLQA 1R50A 3NQ41 3T5PA 4FE4A 3D8SA 2V0GA 1EUCA 2X7XA 3SC2B 2GZHA 2ORIA 1MPTA 4TOIA 3JSXA 1I1NA 1ZCBA 3CUVA 5DGDA 2JG3A 3L4KA 1SEPA 3QEOA 3U0VA 3UEOA 3DAYA 2BFBB 4UDYX 5EP4A 3GUYA 3IP3A 2D2IA 5TT1A 3MRVA 3CF2A 4HMOA 1JQDA 1KO8A 2J9GA 3DOEA 3MCZA 2ZRCA 3C3JA 4GBGA 2ZRKA 3RVLA 1C7EA 5IJ0B 2P2LA 1UMBB 1GTMA 3DBOB 1MX5A 4TLLB 4UBKA 2RGNA 4W63A 2MSDB 3HCAA 4LWOA 1AQYA 2OBXA 2C04A 3E7XA 3DL0A 4YUYA 4OFXA 3NYQA 4PICA 5JJ5A 2VQFB 1QVRA 2Z09A 1FSSA 1XTPA 3HK2A 9MHTA 1SBCA 1O95D 4U0JA 3FNHA 3CZQA 4UUNA 1HX7A 4BHTA 1E5QA 1PL7A 1NMZA 2CW5A 4Q4LA 4UBIA 5FFNA 2XZTA 1P9RA 2ZUSA 2HFJA 3ACDA 5A5EA 3IUBA 3RIMA 4GEGA 3KB6A 5DWVA 4L0DA 4ZAYA 2QTRA 4DMUB 4L6AA 3TB6A 1ZEMA 5CH8A 4EARA 3NUGA 2X22A 2EGUA 2XB8A 3KVVA 2BLNA 1E1RD 4FJ1A 3RIXA 2PJRA 3PNL