5HILA

Crystal structure of glycine sarcosine n-methyltransferase from methanohalophilus portucalensis in complex with s-adenosylhomocysteine and sarcosine
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
244
structure length
240
Chain Sequence
b'DHYEEEYVLGFVDKWDELIDWESRAESEGDTIINILKERGVKKVLDVATGTGFNSVRLLQAGFDVVSADGSAEMLVKAFDNARDHGYLMRTVQADWRWMNKDIHDKFDAIVCLGNSFTHLFDEGDRRKALAEFYALLKHDGVLLLDQRNYDAILDSKHAHYYCGDTVSVYPEHVDEGLARFKYEFSDGSVYNLNMFPLRKDYTRQLLHEVGFQEINTLGDFKETYKEDEPDFFLHVAEKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine sarcosine N-methyltransferase
publication title Structural Analysis of Glycine Sarcosine N-methyltransferase from Methanohalophilus portucalensis Reveals Mechanistic Insights into the Regulation of Methyltransferase Activity
pubmed doi rcsb
source organism Methanohalophilus portucalensis fdf-1
molecule tags Transferase
total genus 86
structure length 240
sequence length 244
ec nomenclature ec 2.1.1.156: Glycine/sarcosine N-methyltransferase.
pdb deposition date 2016-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5hilA02
2PBFA 2ZULA 3CCFA 4FSDA 5DXAA 5M5BA 2C7QA 1RJGA 1JG1A 4QQKA 5K0GA 3EVBA 2IGTA 2XBMA 1HNNA 1SKMA 4E32A 4A6EA 3MERA 2VZ9A 3IHTA 4RTMA 3FPGA 5E1OA 3MQ2A 4PINA 1R74A 4KDRA 2BM8A 4IKPA 4IV8A 5D1NA 2HR1A 5BP7A 5K0BA 5DRTA 4QTUB 3TR6A 5LQUA 1NV9A 2YR0A 1VP9A 3CC8A 3LDUA 5LQCA 4RTPA 3HM2A 2P8JA 3LECA 4G56A 3P2IA 4EKIA 1G8SA 2PSSA 4RV9A 1KR5A 2CMGA 2GLUA 3KQYA 1ZGJA 3PX2A 5EIFA 1BKYA 1WZNA 2OB1A 3LDFA 4PYOA 4C03A 5K0EA 1NBIA 1NW8A 2BM9A 2ORED 4AX8A 1EAMA 4C4AA 2ZIFA 5E2AA 4OQEA 2H1RA 3AWIA 4HSGA 4LECA 3S68A 3BGDA 5LQJA 3ER8A 1PJZA 1V39A 3M6VA 3V8VA 3BXOA 3HA3A 2JHPA 4KDCA 2NXCA 4FS8A 5EOVA 4EQZA 2FRXA 2IDKA 3G2MA 3EVFA 3IEIA 3KPJA 1WS6A 3PVCA 4F84A 3I53A 3HVJA 3OU6A 2PVCA 5CCBA 5ICCA 2CMHA 3C3YA 2QRVA 3DXYA 3A7DA 4XCXA 4U7TB 3UJBA 4CTKA 2AR0A 3UA4A 5KS2A 1AF7A 4R8SA 1DUSA 3EVDA 4QDJA 2AS0A 5FA8A 2Q41A 3KQVA 4RSRA 4X41A 1NW7A 4YMHA 2Z6AA 1X19A 2OKCA 2ZLBA 3KQMA 3DUWA 2NYUA 2C7PA 3D2LA 3EGIA 4K6MA 4P7GA 3UJAA 3BZBA 2ADMA 2V7EA 2VDWA 5FHRA 4YUYA 2NXJA 4PYIA 2O07A 1L9KA 2UYOA 2YUIA 4OA5A 3P9KA 4UOEA 1KP9A 4YUWA 1G8AA 2B9EA 3KHKA 4RTSA 4FGZA 5HIIA 3G8AA 3UJDA 4YV2A 3BWMA 4PNEA 3SSOA 2OZVA 2ZVJA 3MTIA 5GIOE 5HIMA 2AOTA 3HCDA 4Y2HA 3GO4A 5K0LA 4AUKA 1RI2A 4E2YA 2VS1A 1EJ0A 3KPUA 2AOWA 5E1MA 3F4KA 5IH3A 5BW4A 3E7PA 4RTNA 5FADA 2YXLA 3UJ9A 4PGHA 1SUIA 1M0EA 1NT2A 3LGAA 5HFJA 2Z6UA 3BT7A 4KRGA 3RODA 3DOUA 3L8DA 2P7IA 2H00A 3UJ8A 5DT2A 3T7RA 4RTJA 5HOQA 3BGVA 5GM1A 3GRRA 4RVGA 1NE2A 2V74B 1WXXA 3PFGA 3KQOA 4C06A 3LKDA 3ID6C 2PV0A 3HA5A 3MB5A 5C0OE 3QOWA 4PCLA 1NW3A 3R3HA 5E9WA 4QDKA 5FUBA 1P39A 3VC2A 1ORHA 3HVKA 1R6AA 3FPEA 3TPZA 2NP6A 4RX1A 1X1DA 3OE4A 3KKZA 4HRAA 1HMYA 4E31A 3JWGA 2ZBRA 2OXTA 1OR8A 3LCCA 3SSNA 2PT6A 3X0DA 4PYJA 1YZHA 2R6ZA 3FUUA 5C1IA 4X60A 2ZTHA 4BY9E 1BHJA 1IXKA 2E5WA 3DP7A 2HNKA 3B3JA 3LCVB 3O31A 1I9GA 3REOA 3LDGA 1I1NA 1RJDA 3R9XB 5F2NA 3MCZA 4HG2A 3FTCA 3GRVA 5ICFA 4XUDA 2JHAA 5K03A 2IH2A 3DTNA 2WA1A 2FK8A 2ZCJA 4QVGA 1H1DA 3EVCA 3NDIA 3NWBA 5HEKA 5CCXA 3C0KA 5ERGB 4PYKA 3BKWA 5EEHA 1NW5A 4PIPA 2P40A 5MHTA 3LPMA 2YX1A 4RVDA 4QPNA 1TPYA 4RVFA 2NXEA 5HIJA 3ELWA 3TKYA 2ZWAA 4OBXA 4BP3A 4ER5A 3UJ6A 1SQGA 1IM8A 5DX0A 4FZVA 5GP1A 4IWNA 4KWCA 5DRYA 4ZTBA 2UZ4A 4R8RA 5GWXA 1QAQA 2AN5A 2ESRA 3WSTA 1JSZA 5EMMA 4AZWA 1XXLA 2AN4A 3Q7EA 2CL5A 3P8ZA 4NECA 4YMGA 4F85A 2EJTA 5C9ZA 3HP7A 1AQJA 10MHA 2F8LA 3B3FA 5DWQA 1JQEA 2DULA 3M6UA 1P91A 2OY0A 4LG1A 3FUTA 1M6EX 4FP9A 4M36A 5BW5A 3FZGA 1AQIA 3GCZA 4C08A 3ANXA 4DZRA 1N7IA 3SM3A 3AXSA 3G2QA 3M33A 2I7CA 3AXTA 1YFLA 4E2ZA 2HTEA 1JG2A 1QANA 2P7HA 1RJEA 4AZSA 3TOSA 5EVJA 3HVHA 3OPNA 2EJUA 3VYWA 3CJRA 4DF3A 2AOTB 1P1CA 4IV0A 5EKXA 2PKWA 3FUXA 5CVUA 2Y1WA 1QAOA 4A6DA 4LWPA 1RI1A 2PWYA 4DQ0A 5FQNA 1F3LA 2YQZA 1O54A 4AZVA 4GOND 2O06A 2AOVA 3M6XA 2PY6A 2BZGA 5DX1A 3P9CA 3PB3A 5K09A 1VLMA 3NDJA 4AZTA 5EIWA 4KVZA 3KQQA 2IH4A 3T0IA 3BKXA 3GRYA 4U7PB 4QQNA 2C7OA 1IY9A 1ZKDA 3EVZA 4GBED 3T7SA 5E1BA 4E2XA 1ZG3A 2G71A 1N2XA 1D2HA 2Y1XA 4B17A 3BWYA 4RTKA 1JQ3A 3G5LA 3EGEA 2AVNA 3ELYA 3T7TA 3O4FA 1X1BA 2GH1A 2XYRA 2UYQA 2ZSUA 2IFTA 1VQ1A 3HCCA 3BUSA 5DSXA 3DMHA 3EEOA 2PX5A 2FYTA 1FPQA 4HGYA 3EMDA 4MWZA 4X61A 1BOOA 3LSTA 2PX2A 3DULA 3HNRA 3FUVA 5F2OA 3TM4A 1G55A 3ME5A 5DM1A 3GJYA 2KW5A 1U2ZA 3SVZA 1R18A 3O7WA 5K0FA 5JUWA 2B78A 1JTEA 3KR0A 3OFJA 5EGSA 4E33A 3C6KA 2ZWVA 1G38A 1KPIA 2ZBPA 2FK7A 3I58A 4EK9A 4PCAA 4KW7A 5CM2Z 2I6GA 2ZBQA 3SSMA 2QE6A 3RW9A 4MIKA 1L3CA 2XYVA 3FUWA 3ORHA 5FQOA 3ELUA 3FYCA 3GXOA 1R8YA 4YUXA 2Z6QA 2AOUA 2PLWA 5E9QA 3GNLA 3KR2A 4JXJA 4GC5A 2GA9A 2O0LA 4M38A 3TMAA 4CTJA 3R0QA 2VDUE 3NTVA 2H11A 4HTFA 5EKUA 3R24A 2NNWB 3M70A 5H02A 3SGLA 2OYRA 2OB2A 2CKDA 3FTDA 3KPVA 1ZGAA 3P2KA 4PYQA 3KPWA 3LCUA 2G1PA 4MHTA 4RTOA 5EMJA 3BWBA 1EG2A 3CJQA 3OU7A 4FT4A 1G60A 3HVIA 5K8VA 4O29A 1L1EA 1JG4A 1F38A 3I5UA 4GOOD 5T6BA 5FWAA 2O57A 2PXXA 3G2PA 4GF5A 5EG5A 4GEKA 3CJTA 3HCAA 5ICEA 3TRKA 5EHGA 4GC9A 5CUQA 4DM3A 4XUCA 2CWWA 3K6RA 3FPFA 1Q0SA 3IYLW 3P71T 4OBWA 5JR3A 3SXJA 3KR1A 2ONZA 3HCBA 1QZZA 1Y8CA 3GU3A 2FHPA 1JG3A 1QYRA 3KPYA 4HGZA 3B89A 4WXHA 2AOXA 4P7FA 1DCTA 1X1CA 2HV9A 3G7UA 4XUEA 4PIMA 3UZUA 3G5TA 4R6XA 1ZHFA 3LL7A 5DXJA 2A14A 1R00A 3A4TA 5LR6A 2C7RA 3H2BA 1NBHA 5EHIA 1YZ3A 3VC1A 5DSTA 5E2BA 4GOLD 3CBGA 1YB2A 1YF3A 1BC5A 3JWJA 4DCGA 3FTFA 4E70A 1MHTA 4X63A 3MCTA 5DPMA 3I64A 2PX8A 2LD4A 4QVKA 1SQFA 4C04A 4KIGA 4HC4A 4E2WA 4L7VA 3G2OA 1KXZA 2VP3A 1XDZA 3NVKI 4OX9Y 5LQAA 2OO3A 3A26A 5DLYA 3THRA 4EVIA 1JSXA 1N7JA 3BGIA 1ZQ9A 2P3OA 3V97A 1RJFA 3ERCA 3ELDA 3R6TA 4FT2A 2QM3A 2G8NA 5FTWA 1VP3A 2YXEA 3KQSA 1JTFA 2EG5A 3P97A 5FA5A 3PX3A 7MHTA 5IKMA 1RI4A 2PT9A 5EEGA 3DLIA 2PXCA 1R8XA 1SUSA 2PGXA 3DR5A 3AJDA 4HH4A 3UA3A 4CWAA 3NJRA 5T64A 5ICGA 1NKVA 3KQTA 4RVHA 2PX4A 2JJQA 3JWHA 3M6WA 2HWKA 3DLCA 2XYQA 1FP1D 4H0NA 1JQDA 3FRHA 3DXXA 4CKCA 1XVAA 3SX0A 2P3LA 2P1DA 3FRIA 4DCMA 1ORIA 1RI5A 2NXNA 4RTQA 3FPJA 4LWOA 3LBYA 4RYLA 2JHCA 5EQJB 2N47A 3RIEA 1VPTA 1WXWA 3E05A 3EPPA 3CGGA 3PS9A 3OCJA 5P8WA 5U4XA 1PRYA 1KYWA 3Q87B 3OU2A 5CVEA 3MGGA 2AOUB 2VDVE 4PYMA 3B7PA 2PWPA 3M4XA 2K4MA 4ER7A 3E8SA 5G02A 3HTXA 5FCDA 4HTFB 3GGDA 2BR5A 4PYLA 5FULA 5KQSA 5KYGA 3I9FA 3NMUF 3GWZA 1D2GA 2AZTA 2ZIGA 3OFKA 5BXYA 2WA2A 2ERCA 1NW6A 1XDUA 2GPYA 1L3IA 1XCLA 4RWZA 3MTEA 2YVLA 5CVJA 5GOZA 1L3BA 2OBFA 2IIPA 1D2CA 2FCAA 3P9IA 2XVMA 1KHHA 3FYDA 1KPHA 2JH9A 2ZW9A 2G70A 2QYOA 2ZZKA 3SR4A 2BR3A 5HZMA 5F2KA 4OA8A 1KIAA 1XDSA 1M6YA 1KPGA 3UJCA 5KQRA 1YUBA 3QV2A 4CKEA 3DMFA 4CXMA 3MAGA 4V0RA 4BLVA 1UIRA 3B3GA 3SMQA 4C07A 4YUZA 4YV0A 1FJXA 3AY0A 5E8RA 2FPOA 4R6WA 4P7KA 5DTMA 4RTRA 4MQ4A 2ONYA 2O05A 2PJDA 1I4WA 3VSEA 4V0QA 1B42A 3E23A 4M37A 5KVAA 4ER3A 2NP7A 3KR9A 1NV8A 3EMBA 4ER6A 2IBSA 3G89A 2EX4A 1SG9A 4C05A 2EFJA 2XVAA 5FWDA 5CIYA 5GIPE 3OZSA 3C3PA 3UWPA 2P35A 3EVEA 2B25A 4PGGA 4E30A 2GS9A 3TLJA 1FP2A 1VIDA 5CVVA 4PWYA 5DM2A 4GQBA 3A25A 3UBTA 3PT9A 2B2CA 3NWEA 8MHTA 3NW9A 3DH0A 3ER9A 1VE3A 3THSA 5DM0A 4X1OA 5EZQA 1FBNA 2R3SA 2AVDA 4BP1A 2ZFUA 5K01A 5LQNA 1XCJA 2G72A 2IP2A 3PFHA 5HILA 2QY6A 5CVDA 4ATNA 3PTAA 4MTLA 5EZSA 1TW2A 5K0NA 4BLUA 1AV6A 3QOXA 4ISCA 1YFJA 5GM2A 3TQSA 3CVOA 3OZTA 3U81A 1TW3A 3FTEA 2JG3A 1O9HA 2IBTA 2YTZA 3A27A 4EMSA 5GINE 3HCFA 3LKZA 3NVMB 1XJ5A 5DX8A 3A7EA 5DTQA 3P9NA 1VBFA 1RI3A 4BLWA 4P58A 3GRZA 5E8JA 3B5IA 3IV6A 5EMLA 5T67A 1QAMA 3KQWA 5E1DA 5DTRA 3UFBA 4FR0A 2I9KA 3KU1A 5FHQA 3FPHA 4Y30A 2DPMA 2BR4A 3G88A 3GRUA 3EVGA 2PXAA 4ER0A 5B1SA 3HCEA 2I62A 3EEYA 4M7RA 3UJ7A 4YV1A 1WG8A 3TM5A 2IPXA 4DKJA 9MHTA 2IDJA 1P1BA 3OZRA 1UWVA 1XTPA 2WK1A 4PONA 3TFWA 5EPEA 1EIZA 1X1AA 4Z2YA 1EQAA 4DA4A 4FSXA 4R05A 5K0CA 2HMYB 3TKAA 2UYCA 3LHDA 4OQDA 5LSAA 3EGVA 4KIFA 2P3QA 3DXZA 5K0JA 5HIKA 3HA7A 4P7JA 3DMGA 3EVAA 4QTTB 3MHTA 1O9GA 1MJFA 2B3TA 2OPBA 3CKKA 2ZIEA 3JWIA 5D1HA 5CD1A 3HEMA 4WVLA 1UFKA 1VL5A 3GDHA 4PYNA 4YUVA 2UYHA 1JR4A 4QPPA 2JH8A 2GAFA 3BWCA 1WY7A 5K05A 5DM4A 4DMGA 5E9JA 3G8BA 2P41A 4GOMD 4RTLA 2YXDA 3P2EA 1KYZA 2AN3A 3KQPA 4CKBA 2IH5A 5EC8A 2BH2A 2ZZMA 2ZZNA 3PLAE 5EMKA 1INLA 2GB4A 1T43A 4GUAA 3K0BA 3OE5A 1G6Q1 4EKGA 3C6MA 4F86A 5LQRA 1Z3CA 2QRVB 1EJ6A 1SVUA 1Q0TA 4POOA 3LBFA 5LQKA 3GIWA 3LX6A 1DL5A
chains in the Genus database with same CATH superfamily
2FF7A 2X86A 1R0CA 3PBKA 1D07A 3KSAC 3CMMA 4R2LA 4UCXA 2C7QA 2HK9A 1V1MB 1GL9B 4FYHA 5TVGA 4N7JA 2MSKA 2AR7A 3U5TA 3JAWA 1DBVO 1GA1A 1QV9A 3ROTA 4TV9B 4DY4A 5FL7A 2QW8A 1BXRB 5SZKB 1ZI9A 4E3WA 1YIDA 1PWEA 2HFJA 4J2TA 4BV3A 1QX3A 1HX7A 4Q1FA 1OU4A 1HORA 2PSSA 5TPZA 3R9XA 1C3OB 2OR3A 5JZ9A 2PNJA 4XWTA 1I36A 3QX3A 2GPAA 3PQFA 4HAXA 1BJKA 4DLUA 2J1LA 4HSGA 1ZWLA 1EAYA 1Y4ZA 1CSEE 3S68A 2GXAA 4L3WA 4Q12A 1SBTA 1E9RA 5ARBA 3V8VA 1VG9B 1XTIA 4O4HA 2ZJ6A 4ZO9A 5K45A 1FU8A 4C4PA 2EF1A 1CUGA 2J4FA 3O47A 5EWLB 3B1YA 5FPPA 5IDVA 2RAFA 3PD1A 3A4LA 2H8KA 3H86A 1K92A 4IM7A 4JGIA 4B34A 2X1MA 5KYNA 4P4SB 1RCTE 5MFZA 4XCXA 3I76A 1YRAA 5AKYA 5L3SA 3WGZA 1JGTA 3WNCA 4YMHA 5ALVA 4NZYA 5KNDD 2Z6AA 1NW7A 3T3DA 1Q7EA 4AECA 4GYWA 5BN4B 4AJKA 3THWB 4IZIA 5DI9A 3IVMA 1M75A 3EGIA 1SUEA 3WA7A 1QG2A 1RKBA 2ZP1A 2AE2A 3QVTA 4GXTA 4MS1A 3I9OA 4P98A 3RKUA 1VHWA 2V7BA 5E3HA 4NE7A 4RHTA 4GX2A 2O52A 1NF2A 1NQ5A 3R6WA 5ADWA 1JW9B 4KI0A 1EUZA 2ZE6A 4PVDA 4C6TB 3Q3GE 4HGPA 2IEAA 2JGLA 3CQ9A 4FW8A 1WWKA 1AUQA 3DBOB 1RKVA 1J42A 3ANMA 2R25B 4ALNA 5JH7F 2AK2A 1YJXA 1WETA 2AOWA 5E1MA 3G7NA 1S1MA 2GZDA 4NSNA 1FFWA 2R7MA 1P7PA 5IXJA 5A4IS 4NJEA 2RSLA 3L7BA 1QQTA 2JVJA 3DFFA 3PHCA 4HPWA 3KWFA 4KN6A 4OYRA 1Q0HA 4PNHA 2PEZA 2VH1A 4HVCA 4H15A 1O5OA 1DIRA 2QN8A 4KHPB 2OYSA 4C3OB 1RC1A 1U1GA 2O7VA 1ML3A 3BERA 2BGNA 3TS1A 5J58A 1U0NA 1SVKA 3T0FA 1UBMS 1QWOA 3BZUA 4FYVA 4PG7A 2GEDA 2PS1A 3DFUA 2FZCA 3K16A 1L5QA 3GJ8A 5HJ2A 4FDUA 2R87A 2XNDA 1E6WA 1F4VA 1N9KA 2MR6A 3VC2A 3NBZC 3FPEA 1YZQA 3JAWB 4Q4JA 1Z5UA 4WIAA 2LGJA 4JP3A 3UVEA 4D56A 1AT1A 5ERYA 1LQTA 4YDHB 1SAYA 4ZOBA 4DDTA 3L6OO 3URKA 1GRQA 4KXXA 3R76A 2QRKA 3A0RB 1FCJA 3KT6A 3SC2A 1T2UA 3NIBA 4QU8A 2B8TA 1XIVA 5BN5A 5KC8A 3DTVD 2ZIAA 3VVBA 4BO4A 5BYBA 2IELA 3R9XB 3PRKE 3R3XA 1QUEA 3KHSA 4HWTA 5HQ3A 4PLTA 4HQNA 5CU7A 3PWKA 5KYWA 2X15A 3U3ZA 4JUAA 2V7VA 2WMYA 1UPFA 3KLNA 3C0KA 3FZEA 1C0KA 1PI3A 1PGQA 3WAKA 1U2DC 3KWMA 4PYKA 3UAZA 5I5EA 2R6HA 4J0JA 4O4HB 4HGNA 1UJMA 2YWJA 4XLTA 1X8LA 3KZ1E 4RHYA 4QC2A 4QDTA 4I19A 2H2FA 1VOTA 3TKYA 4MKXA 1LPNA 2PUCA 1YR1A 1IM8A 4DBLC 2QJTA 5DX0A 3M2PA 1JIXA 1OWPA 4KWCA 1RADA 1DGQA 4MIYA 2AG1A 3IVGA 1W93A 5JCJD 4RDHA 4KWEA 1SCAA 1ZVKA 4BQPA 2XZTA 5C9ZA 4U7GA 1GZ4A 1I9CA 2GPSA 4KVGA 2GF0A 1QHSA 4D5GA 5HF9A 3D7KA 1PIWA 2CJFA 4MS1B 3FSJX 3IJPA 5BR7A 4KG7A 1Z39A 3T35A 1PLLA 2QAIA 1XQXA 1MH1A 1YZLA 1VB3A 1KEPA 1AHHA 1DBPA 2G80A 1WB4A 4HRXA 4US2R 5IDWA 4GIBA 3PFBA 2ZYDA 5AHXA 5ENVA 3OWHA 3H99A 2BGIA 2G67A 1A2QA 1N6OA 2OV2A 2I6FA 4M60A 3NQ41 3FWHA 1SGWA 1NUUA 3NIGB 4NJEB 2VAPA 2I34A 5T5QA 3NT5A 5KWJA 3ABSB 1HF3A 4TT3D 2VQEB 1F51E 3BOSA 2BJVA 4GD3Q 4I81A 3UK2A 3ADKA 5U1PA 4C1NA 2BZGA 2GWRA 3SI7A 3WWDA 5FH9A 1GUAA 3D2AA 3PF9A 4KXQA 2K2WA 4DLKA 1T3TA 3ILYA 4IS2A 3LY5A 4FYYA 2RE8A 1P31A 5ALKA 2O2SA 2OZPA 3SIWA 1RYFA 4O8CA 4RTKA 3TTTA 4KRFA 3FSGD 1NVXQ 1X7DA 5KWIA 3BGWA 4Q4JB 4R71A 4B4KA 3BUSA 3KKOA 4M21A 3ZU2A 1EJBA 1XZFA 5FFMA 1E1QD 1O97D 2NG1A 3LSTA 3W4KA 5I7UA 3QUTA 3KEQA 4B7AA 5F7OA 1TT5A 2DY0A 1VDMA 2H4YA 4ZYUA 3Q3IA 5J47A 3V55A 2XW6A 5COAA 5BN5B 4XM0A 2X9GA 4HNAA 5K3FA 3LW8A 3TOZA 3MWDA 4TWJA 5EZ5A 1JR3A 4IDPA 3NONA 5HQ3B 1KPIA 1RJ9A 1WVMA 3OLCX 2CBXA 1ADJA 4N6OA 3ND8A 1YB6A 2FH5B 3IOMA 4JYBA 3IUBA 4ZT4A 3MBKA 4ZZ0A 5J23A 1L3CA 1G8PA 2FEXA 3FUWA 3ORHA 1NLFA 3OQMA 2QGZA 1NN1A 2WYIA 3VH4A 1XRQA 1PL6A 1FDVA 1PR5A 4IYRA 2ZIZA 3PQDA 3VR3D 3DOIA 3QF4A 1R0BA 3WFZA 5EKUA 5IRCD 4MWBA 2DR2A 1VPVA 3OE1A 3SM9A 2NNWB 1S3FA 3FTDA 1LC0A 1M6VA 3FHOA 1RMTA 1BWRA 2C4NA 4NCJA 3MT9A 5BRAA 3C1AA 1J8MF 2Q21A 1DDIA 4G1UC 5IK2D 4EAQA 2A4MA 1GQSA 5T4EA 4WZAE 4ETMA 2ZS7A 3CE9A 4BBJA 4OHXA 2NU6A 3CJTA 2W6JA 3HCAA 1M67A 1QDLB 4FXPA 5ITZA 1Z5GA 4N4AA 2CWWA 5TRTA 2GAJA 4IEFB 4LI3X 3QX7A 1YNSA 1XCGB 2E21A 3UMYA 5C1PA 2YJ3A 5ER9A 4ABTA 2CDAA 4R0NA 3EPHA 2AMVA 2YJ6A 5JE8A 1QYRA 1UOPA 1AUPA 1EE9A 2FHPA 1URPA 3B89A 5FP0A 3HWX1 1Z8NA 2YJNA 1SKAA 1WW2A 3TD2A 1K4KA 1EE2A 1TMYA 2V97A 3BXXA 3OKCA 3OY7A 3FRJA 4JLWA 4M8LA 4CV3A 3DYBA 1QNLA 1ZGBA 2HI0A 2I5PO 4HNSA 4DN6A 1R00A 2IYYA 2VJNA 3H2BA 2X1LA 3B3AA 3E03A 2PMDA 1YA4A 4UTNA 3A1CA 5LMCA 3CBGA 4EDFA 1X3LA 2ASVA 4AMZA 8ADHA 2OO7A 3H5WA 3AYZB 3ZXUB 3F47A 1J5PA 2FSIA 4HBGA 1LU9A 1OKKA 1PDVA 1HURA 4YJHA 2RIPA 3ZBPA 3ZIAD 3ED1A 4F9TA 1K6IA 3EXG2 1R4AA 1Y7TA 2DBVO 3HRKA 2JCYA 5F7XA 1D2RA 3W05A 4C0LA 1KF0A 4RJJA 1WCIA 3KVOA 4NCKA 1DB3A 2A33A 1OBCA 1TUEA 2F3PA 4H1VA 4IOJA 3ZY3A 1WUYA 3QU5A 1SFRA 3CEPB 3R6TA 5BNTA 3PJFA 4A0SA 1CUIA 1K89A 4PZZA 5B5SA 3HGQA 4AIRA 1J70A 4KXUA 3QEMA 4XB1A 2VSYA 4C5BA 5HJ7A 3TW4A 2FFAA 2X8AA 4DLYA 2ZRIA 4BMVA 5ABPA 3EOBI 3OCWA 1SHJA 2PLAA 1RAIA 1UT8A 5C1DA 3PRHA 5D3KA 2JIQA 1FXWF 1NYQA 1TO6A 4IUYA 1LWNA 4HNAB 5K3FB 3SYRA 5GIPE 4M46A 1ZJJA 4K6CA 3MWDB 4KGDA 1A95A 2MSCB 4GLFA 1RI5A 2AJLI 1RJ9B 3L3BA 1QFMA 4D3FA 1CBUA 4FQ8A 4QOSA 3TXYA 4CODB 4E5DA 1UINA 3E05A 1FRVA 4TMZA 3TZEA 5P8WA 1N9GB 2AR9A 1WAMA 2VJMA 4ENTA 2WKWA 2WINI 1C3LA 2OXRA 2YYSA 4ZI3A 2Z2ZA 5KNBA 1JS1X 5GZ6A 1SHTX 2CUKA 2K4MA 3CEMA 3F7TA 2XOKD 2W8BA 1ST2A 2COEA 3FWYA 3GGDA 4PYLA 1J06A 4TKVB 1T1GA 1EHYA 4F04A 3PC2A 1K0FA 2R6GA 4N3NA 4BE7B 6NULA 2X9VA 5J4VA 3T7EA 2H0QA 2PQ0A 3F90A 4MYUA 3ZZMA 1TC1A 3HR8A 1M6VB 3PNSA 3WLSA 1D1TA 3UAGA 1PBNA 3ESQA 1Y5RA 1MFZA 2KJQA 2FCAA 2VHJA 1EGMB 4YCMA 1KPHA 2ZRFA 1VI2A 2ZZKA 4GI5A 2FW9A 2FGJA 2NU6B 3TW6A 3HYNA 3JD2A 4PS0A 4E4RA 2CK3D 4IFTA 3LBNA 1R4NA 2GZAA 3N39C 3W5SA 4QZVA 4A10A 3Q9UA 5KTRA 1U7WA 1CIJA 4BNKA 1OFIA 4V0RA 4X54A 4KITB 3AHGA 1K7FB 2EHJA 4PZPA 4RJ2A 5AI9A 3UV6A 2X40A 2W00A 1HE2A 1QHXA 1EP3B 4N9WA 5E6UB 4TTAA 3WL8A 4KR3A 1NURA 4QFMA 1QBKC 2XRYA 3DOJA 1ENPA 1GILA 1Z12A 5I48A 3G89A 2EX4A 1OH7A 2ANCA 5EMNA 4X1YA 2CVFA 2OD9A 1HYQA 4UCFA 4G5OA 4U3JB 2P6MA 4RVNA 2WLTA 1NPDA 2P35A 2PSHA 4LXYA 3ZE0B 3STWA 1YAHA 1PQUA 2DU8A 3NT4A 2AYYA 3GUYA 1C0LA 4NONA 4YJ2F 4XB2A 1ZVQA 4FFPA 3UBTA 1A97A 4QX6A 1DPGA 4WZBA 4KI7A 3ABIA 1M8JA 3C5HA 3E6AA 2QDXA 2G0TA 3OPQA 4R7TA 4HJRA 1XAHA 3ER9A 4QYSA 1JDBC 2PGNA 1Q0LA 3PUJA 3WLAA 5AI5A 4OI0A 2GTPA 1LUAA 3MT0A 3P26A 4L5CA 1DG1G 1NUSA 1ZMXA 4M0DA 5ALWA 5IEBA 1WBBA 3QEMB 1H4TA 1LS6A 3B36A 4F5DA 1ZRMA 2CDRA 4FBMA 4RKRA 5IXYA 3NTOA 4RESA 5K6RA 2GN9A 5EXEA 1OREA 4FEEA 2X2FA 5AM1A 4LRQA 4MARA 1MJGM 1NRIA 3EA5A 1E0AA 1H5NA 4EUFA 4KXVA 1PZXA 2FA9A 3T3HA 3WWZA 4CKBB 4PZDA 4UZSA 3W3AH 3KWLA 5C81A 2CXSA 2HCRA 3EXG1 4NQZA 2UXBB 4MLDA 4MEAA 5E8JA 4ONEA 1DCKA 4TL8A 2FPRA 2II6A 4ZA2A 1KZHA 7MHTA 1GNPA 4X20A 1X9IA 1HC7A 4GG1A 5C32A 4AULA 1NT4A 3DW3X 1IC6A 5AP9A 3KU1A 4F2WA 5FA6A 2DPMA 3G88A 2VJMB 3EVGA 5B1SA 1L7AA 4I4CA 2W93A 2GD2A 2A5FA 2KWIA 2IPXA 3OPYI 4DAEA 4UNRA 1P1BA 4QEKA 1UWVA 5T4FA 2Q7XA 1WMSA 1PFGA 2W8BB 5P21A 3OIUA 4FSXA 4J0IA 3IA2A 4KRYA 1M1YE 4G84A 2EZUA 5TMBA 3DAOA 1L2TA 1K08A 2XCTB 1NAIA 1NVMB 3EEFA 3NVDA 4CYMA 1YDWA 1H1LA 4K0RA 3UAYA 1UBKS 2WVAA 4YJFA 2SECE 3GGJA 3IDOA 4FC7A 4LMAA 3RJZA 2P1RA 1W581 2XGOA 3DOHA 3LWZA 3PZBA 4B7UA 1YMVA 2AQ8A 1R4NB 3VHQA 5JNWA 3BWCA 5T4HA 3PK0A 5B30A 1LF5A 3FHJA 3MAAC 4R69A 4P2GA 1HZZC 4DRXA 1NMXA 1ELOA 5TLSA 1PEYA 4KWHA 3V2UA 2KQUA 2EW8A 2HKIA 4MUIA 5F73A 2PR7A 2Q7OE 3JAKA 1GRVA 4IIVA 2BH2A 3CSSA 4ND4A 3VDNB 1BHSA 1H4QA 1XVLA 3PT5A 3R0VA 5FORA 2JAWA 1T24A 2MIIA 2ZRHA 2J6CA 3PL5A 1UJ5A 4GICA 1MAHA 2GEKA 4X1YB 2MCFA 1EZZA 1V8PA 4E46A 1TMGE 2BKUA 4QAJA 1RQGA 3PXAA 1P5HA 1SR8A 4JYAB 2A4KA 3SU8A 1CR2A 2INGX 1HDCA 3X43A 5KJCA 4P1ZA 2OGUA 4DDMA 1GFIA 2XBMA 4RLSA 1JU4A 1L9XA 2R6R1 4MVJD 4NJOA 3MERA 4ZCIA 2PA0A 2VWQA 4WZBB 3WGHA 4DDKA 3LUPA 5G2OA 4MHOA 4DMKA 1ACLA 1PG5A 2BM8A 1Z82A 2FUKA 1F6WA 3HSYA 4FHZA 3ZLUA 3VJLA 4C01A 1FSZA 1ND5A 2CB9A 2C9ZA 2IXEA 2W6ID 4WKCA 5DGIA 1TQ4A 3G0GA 5CFQA 1AU9A 1J2RA 1GCAA 4G8JA 3B85A 5E6RA 4WN9B 1QFZA 1ZA2A 3JVIA 4N76A 2VNAA 4HP8A 4X93A 3JTEA 4ZOCA 1YDMA 1XD2A 5EIXA 4Q4DA 2WWYA 1NBIA 1G5IA 4UHDA 4DIUA 1GTVA 3OLWA 2RGYA 4RM2A 2WY2D 1T1EA 5AOCA 1VL6A 2PD4A 1RRGA 1AKMA 2CZCA 3U49A 2K87A 3GUVA 3NH9A 1NVUQ 4OJTA 4MWDA 1HLDA 4FFDA 2HHJA 3K32A 2JHPA 2RCYA 2HMSA 3DXFA 3TH5A 2IDKA 2Y71A 3WRWA 4X20B 3IRUA 2KLBA 1LV7A 2ZPAA 2ZI9A 2FOIA 4MKFA 1UMCA 3MJFA 1A4UA 3MILA 4F4DA 2FN7A 3S2YA 1YC2A 4X71A 3IX7A 4WKNA 2LPMA 4MS3B 2ZBEA 3K2EA 4DXDA 2AR0A 3HJBA 3UA4A 1Z4LA 2AS0A 4FYJA 3VKVA 4BCDA 4RSRA 1CUDA 4H1WA 1YBMA 4DB2A 1LLDA 1QH9A 2NTVA 2KLHA 2ZLBA 3ZHBA 4BQRA 1RHRA 3GJZA 5B53A 2IQIA 1N4DA 3T95A 2G9VA 1C4OA 2Q8QA 4KXYA 5AVWA 4L2IB 4DEVA 3UC5A 1P9NA 1H1LB 4RGBA 3BM5A 4LNHA 4P36A 4YJFB 1YBVA 2CVZA 3VNQA 2ID9A 4HAYA 3QSYA 1CYDA 1R10A 4ZYYA 1MMFB 2GFHA 4QDXA 3HPQA 5A1TA 2RGWA 4YQEA 2AJCA 1Q92A 1Z4IA 4EYSA 2JHGA 3FSRA 5LLTA 1TK2A 4BZQA 4RO0A 2ATIA 1VTKA 3IQGX 3A3NA 3W4JA 2FZVA 4NCHA 4DRXB 4R8KA 5H80A 4BFLA 1HKUA 1BRTA 4XSHA 3I2IA 4P83A 3JAKB 3OX2A 3IKLA 2HLDA 3LDAA 3QKUA 4RSHA 4D4MA 4E5NA 4LJ6A 3R5XA 3L8DA 1MC1A 2FY8A 4PLCA 1MJ5A 3EMVA 5LMZA 4DANA 4MYDA 2OYCA 3HWRA 1F8YA 1S02A 2V74B 3DO6A 4IMJB 4MWCA 3VNBA 4ZICA 1TVEA 3IULA 3AUYA 5BPHA 4F4CA 3U4GA 1DP4A 3NAMA 4MP3A 5G3YA 2CUTA 2GWHA 4EF4A 3CTMA 1NFQA 4JBGA 1E66A 1ENYA 2X22A 3RYFA 4EW6A 2TS1A 2JLXA 1Y89A 1HM5A 2GSDA 1YJAA 1KERA 2RGEA 4GNRA 1ETHA 1YZHA 2YXPX 2R6ZA 2Q5OA 3FNGA 4KXMA 4RZ2A 3LY9A 1XPRA 3MWFA 3VKUA 1N32B 3IQFA 3WA6A 1AKVA 5E6RB 3QVJA 3BFJA 5FWYA 2OPHA 4N0PA 2FEKA 3IT3A 1KS2A 5FF9A 3V2GA 4ZJPA 3V00A 3D4BA 4E4YA 1XD2B 5ES4B 4LW8A 3JD1A 3EW7A 3THOA 1PFWA 2PT5A 2FZ4A 1JA9A 3C7TA 4JCCA 1V37A 1V7PC 2D4AA 2WM3A 4NG4A 3TKLA 5IAAA 2TMGA 4IDEA 4LSGA 4B73A 2XCOA 1ZMTA 4RF5A 1FQKA 3HXTA 3T5MA 2IZZA 4PNZA 5A7FA 3C3WA 2C7GA 2ZAGA 4MV3A 5DBFA 4RVDA 1Y9JA 1GGKA 5TV2A 1VLVA 3DLAA 3FAZA 1PSZA 2FWNA 5JU6A 2BSAA 2XA2A 3CH6A 4DDHA 4ES6A 5H5JA 1QONA 9LDTA 4FFBA 1JJBA 3LWBA 2OM2A 4FYKA 2FSUA 4NECA 2G1UA 4LN1A 4F85A 2YFYA 5IUKC 2C2MA 2HQOA 1AKEA 1I3MA 1XYGA 3QYFA 3J7AC 2BBOA 4LG1A 5BVHB 1C4WA 2ZIXA 1M7BA 3D8RA 3EOZA 1BMTA 4QODA 5IM5A 3TLBA 5F23A 5KSZA 3LPDA 3ZZUA 3SM3A 3AXTA 3P0FA 3RQSA 2XT9A 4Z4EA 1FZTA 3RUEA 1JG2A 2J3QA 4AZSA 1EDZA 2WABA 2O50A 2MSNA 2ZRJA 3PITA 4JL8A 1WCXA 3TZQA 1KRHA 4UNQA 4WCFA 3P9YA 1G3RA 4F8EA 1I7DA 1MV5A 1N0IA 4EJSA 4CTOA 4LQCA 3OWXA 2EATA 4PF1A 3THYA 4AY2A 4JMLA 2PWYA 3LVRE 4TXJA 4ZEXA 1JBEA 3ZHQA 4EENA 4OLBA 4L74A 1YRQA 3BORA 3GI1A 4G1BA 3HJFA 3A58B 3QBTA 4EY5A 4AG6A 3FGZA 5A0TA 1T9HA 1FMJA 1NBMD 2GZMA 2C3PA 1UDRA 2BLLA 1LFDB 1AS3A 1VLMA 3ANLA 4FE4A 2P9ZA 1CZLA 3ONDA 1YVUA 3SS7X 3K1YA 3WKBA 1YMUA 2P6NA 2OCXA 4QGFA 4PN3A 4IICA 4FR2A 5KX5F 5U9CA 2ZSEA 5FIUA 1VCMA 5J43A 3EBOA 1T9BA 2FJUA 1HE1C 1E4VA 3WMGA 3GRAA 2OG1A 2ZSUA 3NUGA 1BRMA 2FQXA 2PM8A 3PIDA 4HGYA 3RYFB 1Y8AA 3SZ3A 3VH1A 1Z56C 3C48A 2YWBA 3GJ7A 3FCYA 4FGUA 4R54A 1W5EA 4YROA 5D2CA 1U1EA 5F77A 3TO5A 3TQQA 3B52X 3I0NA 3UW1A 4O2BF 2YFKA 2X5OA 4MV7A 3D3QA 1R18A 3M3HA 3NYQA 5DBHX 2ZQYA 5FWYB 5JTUA 2GCPA 1B26A 1G7RA 4TS9A 3DYIA 1NXSA 1JUDA 2ZKLA 3P1JA 3PQEA 1EUDB 4LZNA 4DCPA 3N8GA 4OK6A 4YCJA 5COBA 4EI2A 4BIIA 2ZBQA 4X6UA 4E12A 4TTIA 4ENWA 5DKFA 2XB4A 4BMPB 1EGQA 3K6SA 2GXSA 5TF0A 1YB5A 4CV0A 3AVVA 1DIHA 4IIJB 5AVRA 1DXYA 4M38A 2AZMA 3DOOA 5LBIA 1W1UA 2QQGA 2C1ZA 4B85A 1Q1ZA 4GMDA 3D4LA 3GD5A 5AM2A 1EESA 2EL7A 3D81A 5BSUA 4IMIB 4UATA 4YQFA 1O7JA 3LCUA 4FFBB 4G89A 2F3TA 3FGPA 3U7IA 2J0EA 1R12A 3C5EA 3HVIA 4LE1A 1CZHA 2DKFA 4OIFA 5JSZA 1AN0A 5KO2A 1C1XA 3EWSA 2BL4A 2QGFA 3QJ5A 1L4HA 1OI7A 4L95C 2I8CA 4EUNA 3SY8A 4KMSA 1XAIA 1TOAA 4TLBA 1MD9A 1PU2A 1EWYA 1TO2E 2ZIXB 5A6SA 3LBHA 5CUQA 5J2TA 1E77A 4M1QA 2NLOA 2W6QA 1E1RA 1EDEA 3P71T 3PD7A 2Y3IA 2QX6A 5BYJA 3P32A 3SS9X 4BZWA 3NGMA 3BQNB 1UBLS 2HW8A 2IXAA 2YZKA 2WDZA 4WCFB 5CJJA 4IDAA 1QG6A 1X3SA 2DQYA 4GMKA 2I6QA 1OBOA 4EJSB 2H57A 4AP9A 2IYNA 3GUCA 3I9MA 4HSEA 1A2BA 2DM6A 2XNJA 3THYB 1L7QA 1BIFA 1WXEA 3W8RA 2C7RA 4W1PA 5IXSA 1XEXA 4TTJA 1YF3A 7YASA 1XMSA 4H4EA 3GLFB 4FYPA 2B30A 4E51A 2DUNA 5JPCA 1BS1A 4GLBA 4N5LA 1KSGA 1D09A 2YW9A 4KPGA 5JDCA 3OO1A 5JWHA 3VKGA 5TMEA 4C04A 2I6XA 2BRUC 4A8PA 1NPTO 3A1WA 2EBFX 2VLBA 4G9EA 3JQ6A 3KQNA 2JIZD 2ZTSA 3K9CA 3SC4A 4ZV9A 3RSQA 3ZVLA 8AT1A 3CUKA 3ZZTA 4B3DA 3CRQA 2EL9A 1FXSA 1CQPA 4Z9YA 4WNAA 2RK6A 2WUWE 5EJAA 3RFVA 1M9NA 4J0QA 3N0XA 1NXTA 1M8KA 3PX3A 4WFJA 3ILHA 2X3FA 1FX0A 4BO6A 2VF2A 2L19A 3NEJA 3PUZA 1T0BA 3TQTA 2RGRA 3B2NA 4FX2A 2QJFA 3NC4A 1DG3A 2CFSA 1HEUA 3CBQA 1W1IA 4ZU1X 3NHPA 5BYKA 1P4RA 2O0JA 2FN9A 1L1RA 2PYZA 3IERA 4OGKA 4OQMA 4ZAYA 1MTZA 3RG8A 1IXZA 4EEZA 5KQPA 1U63A 3FRHA 2B0JA 4FJ1A 1U5BB 4KAXA 5FL7D 3SIRA 1CJTC 1PNVA 4PSAA 4H27A 3MT7A 4BP8A 4H7IA 2IOYA 4L16A 4AS3A 4CPDA 3LBYA 2IITA 5AWFC 2GPNA 2N47A 2ZYGA 1QMPA 2JFNA 2W58A 1X7HA 2XF8A 4P3OA 4D8YA 5TPZD 4P4NA 3OCJA 4ZDIA 3F6RA 1XA3A 4CCYB 2X8JA 3A6EA 2VHZA 3K6SB 1YC5A 3OU2A 4RK7A 5LUBA 2QI9C 3M4XA 2QTGA 3E8SA 3BWVA 1XNGA 5CDFE 1E96A 1XDDA 4J0CA 5IP5A 3RSSA 3V5NA 121PA 3TB6A 3B1FA 2OFFA 2D13A 2BGKA 3Q72A 1D2GA 3ZQJA 2ACKA 1FLVA 5FLKA 2IC5A 1FYXA 2GTHA 2H0AA 2WW8A 3LX4A 3IVRA 1N75A 1NTOA 4K8OA 4MROA 3RIGA 2GTIA 1ZGGA 1BTOA 2OBFA 2VHXA 1D2CA 3AESA 3SC6A 6REQA 1C1XB 1Y4AE 4GKVA 1XI2A 2C2GA 3OPMA 4PZLA 3TI7A 4B5LA 4LZWA 5DMXA 2HBRA 1L5SA 2W4QA 1MXFA 4K2AA 3O21A 3UJCA 1K5HA 1OA1A 1DINA 2J9YB 4DR7B 2QRUA 821PA 3CRNA 4KDEA 4PCVA 2FWRA 4R9UC 4DR5B 2OQVA 2NZ8A 1LTQA 4MCHA 1P6UA 5A3VA 2AMJA 3I32A 4HV4A 5AOVA 1Y48E 3BD7A 3D5EA 3L2OB 3WKEA 1HNWB 4HPXB 4E5VA 1C3VA 4RKEA 3KR9A 3ANYB 1MLDA 1U8XX 1Z25A 1NIJA 1W75A 4QFCA 5ICSA 1SG9A 5C8ZA 2E0IA 4G1VA 3DLHA 1XC7A 4GX0A 2HRCA 5HCUA 1E9CA 4M89A 4AIIA 1FFBA 1I6KA 3ED5A 3K72B 1L7DA 2I8LA 4MR8A 1QHFA 4RGQA 4U7FA 3STTA 3O5AA 1E64A 1ZJZA 3L6DA 1AM4D 4MO9A 4U6NA 5ALJA 3RR2A 4EB6A 1AGNA 1OWNA 4N7BA 2VATA 4RL4A 2PXHA 2OT3B 3QA9A 4EM6A 1B8VA 2GPJA 3NW9A 5KQGA 2G77B 1PGNA 4IDGA 4UXIA 2OEPA 3I9V1 3KOWA 4H59A 2XVZA 4D43A 3PGA1 2R4QA 4JBYA 4BX9A 1MTOA 1VL8A 2J0VA 3E22A 4LOKA 4WNAB 3BSFA 4XEUA 3TJMA 3BMOA 4EPYA 4DMRA 3DEIA 2XB6A 1YB7A 3IXQA 1R9GA 3NRBA 3CMCO 4RAOA 4UE3S 1FX0B 2GCIA 3SZLA 4YCLA 2Y2UA 3N3BC 4MV9A 1R3DA 2V7XA 4MAMA 4JFRA 4M98A 2XNDD 4KQMA 4Y2TA 3TTYA 3DS8A 3EEIA 3EHDA 3IAS6 3UKDA 3H9BA 4W6ZA 1IL0A 3TLEA 4XYEA 1DTSA 5HRCA 1Q0QA 2WAAA 4NBUA 1VBFA 3COYA 1DARA 2F9MA 4X1KA 4QT0A 3WQQA 3C7CB 3LO5A 3PR2B 1CVRA 2OL4A 5I4IA 4IVQA 1UZUA 4Y1RB 1E1NA 2XBLA 1Q7CA 4B7CA 1DV2A 4OB6A 3TSZA 5B4TA 3KEFA 2X8JB 3L1HA 3GOHA 1L5VA 2Q9CA 3PUHA 3Q5GA 3QVWA 4J3JA 3W5JA 3LO8A 4D3SA 4F4UA 4GUDA 1D2NA 1BHQ1 3VOAA 3EGWA 1G59A 4I3HA 2PNFA 2FPGB 5H70A 4NXNB 4FMCB 4ZXFA 1ISIA 2CV1A 2Z1NA 3RUCA 2C04A 6AT1A 1EUQA 3FVWA 3G2LA 3R75A 5TDHA 3ZG6A 4D3ZA 3IQXA 4NX2A 2LVBA 1WU8A 1RBMA 4EHBA 1ZXXA 3L0PA 4O1IA 5BWOA 1PZMA 3E9MA 1U1CA 1SMKA 2AZDA 2FWIA 2W48A 2WTAA 1A8HA 1UBEA 2WVGA 3AESB 3QK7A 6REQB 3H5TA 3C6YA 4QTTB 4WT7A 1OFGA 2JIBA 3GGCA 2WV7A 4HH1A 3GLIE 4PRKA 3ZIUA 4OM7A 4MP8A 1I4DD 1XL0A 4I66A 2I4TA 5JVDA 4LYHA 2C3YA 1CETA 2AZXA 1TAUA 4WEOA 3ZU6A 4S3MA 3VSBA 1W4AA 1QX4A 3PSHA 4ENPA 1ODIA 5EE5B 2J32A 4FTWA 4URVR 1UZNA 1EFRA 3H2YA 1E7WA 3HE3A 5EC8A 4EJ6A 1W6UA 4YMWA 1GEGA 3O2NA 2C3UA 3S40A 2ZZNA 4X0EA 3HKEA 4QELA 1YQQA 3E1SA 3FYUC 4YFVA 4KE7A 4EKGA 5JFOA 3P20A 4B8WA 2QMEA 3T12A 1OCEA 2I22A 3AUXA 3CWCA 4BVGA 3RSZA 4AG3A 1YIAA 1N2SA 2A9RA 3I9V6 4JJZA 3SXPA 4B6SA 5CEFA 2IW1A 4QOEA 1XMXA 4XLLA 4MJ7A 3CLKA 4EB6B 4LYFA 1DQPA 3REGA 2OCYC 2OK7A 4MI6A 2HRDA 1I2ZA 3RV4A 4B81A 1WA5A 2PX0A 3PR3A 4D80A 3Q2IA 1VSVA 4WNYA 5IZCA 2GCNA 1KDZA 3H5OA 2OESA 3LIPA 3VZBA 3A8TA 2JBAA 1J7JA 4DNPA 2IOHA 3H2KA 4DRZA 2W6PA 2W7TA 4S1WA 2W2PA 2DKOA 1DPFA 1C1YA 1V26A 2CXRA 1VP9A 4WZAA 4QYMA 1U9YA 1RTKA 2BDEA 1KOJA 1U4SA 2GBPA 1EA7A 2QRJA 2NSHA 1CF9A 3BMOB 3KDAA 3O82A 4G67A 2JCVA 3T7KA 4BTLA 3T5AA 3B1KA 4F3TA 3PX2A 4ZRNA 4G4IA 5L95A 1EFLA 1H9BA 1T5HX 2E87A 3Q15C 3RS4A 4UUNA 2JEYA 3LGXA 1KY5A 2CL6X 1P62B 3HA3A 1Y7IA 1JG6A 2O2GA 2X23A 4X1KB 1DT5A 1X7ZB 3IP6A 4LV6A 5JD5A 4W9MC 1RQNA 2RJ3A 1A9QA 1DUIA 2GI4A 3QUQA 2Q8PA 1DRUA 2CEKA 2CMHA 2PO5A 2REQA 2X6RA 3F98A 4FYWA 3W0LB 2BYTA 1PX2A 3DXYA 5AJTA 4FFOA 1X77A 2H0RA 4OK5A 4DM7A 3SQOA 1MW8X 1DUSA 3HHEA 4JLOA 4MRNA 5AKKA 1Q7GA 4UFPA 1AMNA 5E4YA 3QIAA 3ETNA 1P1RA 3QVMA 1XK6A 4GXQA 4QIHA 4MHSA 1DJOA 2PS0A 2VDWA 4AJOA 1AJEA 1C50A 2P2CA 1CJBA 1ORRA 1I4LD 2RHDA 4YASA 3GDFA 1VSBA 3GT4A 3AYXB 4FJ2A 4I55A 2FHSA 3AW8A 4DKXA 4ZAXA 2R7LA 4O1MA 3P0JA 1IHDA 2ZVJA 1FNCA 3T8YA 2AOTA 1R6DA 4MI9A 4EJ0A 1XU9A 3FH0A 2VYVA 3NBQA 4G01B 1YA6A 2F64A 1QKIA 2XYGA 2YASA 3DVLA 3QUBA 5JZMA 4HJXA 2VL7A 4XX1A 1Z63A 2YXLA 2W6JD 2J3HA 3D54D 3H0EA 3N0TA 2WZBA 4AJ9A 4UTRA 4FLMA 4UM5A 4CFYA 5FO0A 5GPBA 2H5LA 4EUSA 3HKEB 1Q44A 1NKSA 1A82A 3KFXA 2OCPA 1D4OA 3BHNA 3BWXA 2N42A 4W5RA 1NQAO 2V7UA 1L8XA 1BDJA 4W7IA 4GPZA 3KLMX 3QELA 3MTGA 1J20A 2PV0A 3BJMA 1FEZA 1EJ2A 2ZUFA 2R4UA 2FXVA 1S1CA 1N6RA 2G83A 2GN4A 1YFKA 5FFNA 3DC7A 4C3UA 1RCFA 3TQRA 5JJKA 1Z06A 2ERXA 2ZJ5A 4F1KA 1H0SA 1RM5A 1Z6QA 2PMEA 4O8ZA 3W5IA 3B53X 4B2IA 5IVDA 3SSAA 3ACDA 4IX1A 5TQ0A 4D02A 2EFYA 5E4TA 4YPVA 4MGZR 1D4ZA 3FDJA 5ES3A 4WZAB 1ULBA 3LCVB 4C0BA 3VTZA 1RJDA 5F2NA 5JJLA 3C98A 5IM4F 1DRWA 4I1UA 5D8DA 4I3GA 4QICA 2G0AA 4MWTA 1MX9A 2FMFA 3PC4A 5LBUA 4D1YA 5IU6A 5JAIA 3CV3A 3LJKA 5LUAA 2P4EA 5DTEA 2BISA 5E7MA 3N53A 4TRRA 4LVNA 4UM8B 2NAPA 4Y1EA 5TX7A 4NCBA 1I0ZA 1UXKA 5EEHA 5LWHA 2OFWA 1QOPB 4ADSG 4FFWA 5E4JA 1D5WA 1ONBA 2IXDA 4JHLA 3VPCA 1T5SA 3VPGA 5AICA 4DSTA 2QTBA 3ELWA 4FMBB 3VC7A 1D2AA 1UPAA 1TDJA 1J9EA 2QD5A 2REQB 4UCWA 5GP1A 5I4KA 7REQA 2BFOA 5M7EA 2WG0A 4DC0A 2QQEA 1KK1A 2I4IA 1MNAA 3V3KA 1ZSVA 4U9HS 4UBJA 4ABYA 2NPIA 4AZWA 3M81A 3DBRA 3KJHA 4QUGA 4F2DA 5KJ1A 3JQAA 4R01A 4HADA 4UDNA 2WUGA 3LYUA 4I36A 3SQDA 1JQEA 4H3HB 2RHLA 1Z0ZA 2Z8ZA 2JZNA 3FDIA 5DK6A 1ZU4A 5AFSA 5KNBD 1WNTA 1MAUA 1S8NA 4KGZA 2QNRA 3KLPX 4NULA 3VR5A 1PW5A 1H23A 3DCIA 3X2FA 4ZK6A 3UJNA 3T3MB 4BASA 4R40A 2PZGA 3S2IA 4LF8B 5FXMA 2JFZA 2D5LA 2RB4A 3EXHC 4I55B 2YN4A 4KODA 2I99A 3NC0C 4JA2A 1QH1A 1GRNA 2YZMA 3CJRA 1ODFA 5LOVB 2AOTB 4E5MA 3T9DA 2HH9A 1DIBA 3OD1A 2PKWA 5JG7A 4XFJA 2Z09A 4L5BA 1CZRA 4ZREA 4EITA 4FM9A 2VN8A 1G6HA 1MGPA 1U2PA 4A6DA 4UEJA 5EINA 2LBPA 5FOUA 2IU3A 2MSLA 3QU9A 3H9JA 1HT2E 2B0CA 2OMKA 4YHBA 3X1JA 4NNOA 2RHWA 4Y2QA 2O06A 2PY6A 1M74A 1TVCA 3EEBA 3NDJA 4HATA 1OPRA 4RK1A 3GG9A 4X64B 2GK7A 2OSBA 4XIJA 4ZDKA 4P22A 3BGSA 1W59A 2BPOA 3QELB 3SEQA 1Y3CE 3N7AA 3ET4A 2V4ZA 1A7JA 3EGEA 1T6YA 2D5IA 2RKOA 4XWGA 3QEAZ 4HMOA 3O4FA 1D2EA 4LRXA 4CMGA 1M1YA 2IXTA 5D87A 1C2YA 4KOAA 2XR1A 2R8XA 1YVRA 2PWAA 2AF4C 2CY0A 3P9QA 1OSNA 3GAAA 1SXIA 3DULA 3A6DA 1K8XB 4LRYA 3HLYA 1F8UA 5TQ0B 5TEVA 5CTAA 2JLBA 4LY3A 3NNDA 4QULA 2POCA 3Q6MA 5CEEA 2TRSB 3TYXA 3SVZA 4DJ5X 3ZD9A 1CUYA 2B1GA 2I3GA 1ZJ5A 5COQA 3OQNA 3O7WA 1VPWA 3DONA 3LW7A 2B78A 4H6VA 4B3FX 3N8NA 1P44A 1ODLA 3FPLA 4N03A 4Q4AB 3TPFA 1NQOA 1JEQA 2JLQA 3EZYA 4NAUA 4QDZA 1FRQA 5C8YA 3QKWA 3PVSA 1L5GB 4EI7A 1V1JA 4C20A 4C6RA 5AM3A 3CLUC 3RWBA 2NUPA 3AB3A 4GQIA 5EZYF 2WFLA 5KPJA 4Y2SA 4IJQA 1R8YA 2Q0QA 4E0BA 4XRRA 1NULA 1HDZA 1P7YA 4WOCA 4TQGA 1H6AA 1OTHA 3M1LA 3ZCQA 3QWHA 4G85A 2W4MA 4NP6A 4DGSA 1Z4QA 1E2GA 2GJAA 3U0BA 3T3PB 2VDRB 5IUNC 4KR6A 1G19A 4XYBA 2P5SA 3M5WA 3UYLA 2E4ZA 4BGEA 3NBKA 4NYJR 7REQB 3LX5A 2QY9A 3P2KA 3BXHA 3KPWA 1IWPB 4PX9A 2J3DA 3HN2A 1RQLA 4FT4A 2HSGA 2VJYA 3FMOB 3L02A 3JQAB 1KEVA 1YBAA 1MB3A 3ABQB 4K05A 4KB5A 3BE5A 4GOOD 4O4IF 4QUDA 4ZV7A 1E9SA 2A0YA 2QLLA 2X4DA 4QDOA 4R68A 3UWSA 1Y3FE 2HBYA 4DJFC 2HHHB 1AKRA 1S3IA 2WWWA 4UAJA 2PX6A 1AD2A 1FP6A 1VYUA 2WUDA 4XUCA 5AJWA 5E0OA 3JQBA 3U37A 4QG3A 3IYLW 4H7KA 1DBRA 4CMJA 5LP6F 4O3MA 1N5RA 1IBRA 4NPHA 1FXUA 3TAHA 2A9OA 1VL1A 2VP6A 2ZB4A 4AW9A 4MVJH 1NOIA 4W1SA 3JYQA 3EQZA 2YV3A 1ODTC 4P7FA 5FYQA 1CUZA 3TGPA 1NBEA 1G4UR 3WRYA 2V6JA 2BE9A 1A9RA 3FE2A 5DHAA 4FPXA 3OCYA 2RHRA 2C97A 2ZATA 4QQRA 4R9VA 5DFAA 4ESVA 4Z4FA 3DA8A 3KE9A 1Z07A 4O02B 2HHCA 1QZ3A 2YHUA 4NS1A 2OVBA 5HE8A 4PLVA 3VZSA 1QOQB 4KYIB 5AW1A 1PQYA 4M2LA 3O4RA 5KYYA 1IEWA 2MINA 2P6PA 5BSFA 3ESAA 1J1ZA 3UF0A 3ZJ5A 3WC4A 1AB5A 4WOBA 1M66A 1YCFA 2B69A 4L4RA 1SVNA 2DERA 1SQFA 2ODWA 1UK7A 2IEZA 1MOQA 2Q5CA 3P7MA 4DSOA 3RAEC 3ZYCA 3GPIA 4D99A 1S5PA 3RSCA 1F5SA 4KMOA 4TQUS 4R1MA 4J49A 2G5PA 1M1YB 1G17A 5HZGA 1Z6PA 1JTFA 2QTLA 3PFKA 3M5CA 4RIGA 5DLQC 1TRKA 2DUWA 3IAXA 1IXRC 1GSAA 1LI5A 4QE3A 1OH5A 3LBIA 2BHLA 1T2NA 1QGAA 1R8XA 3DR5A 3UPTA 4OMUA 4ML3A 2P0AA 2TYSB 3FWZA 4E1AA 1K66A 1O58A 4IHJF 4KUGA 4GKAA 3SFTA 2JLUA 1YHYA 4GBMA 5LJIA 1FJ2A 2BTOA 4BJ6A 2L17A 3GD7A 1VGRA 1NNI1 1TIBA 1JEQB 2HIMA 5C8YB 3NNNA 3TDNA 4BNDA 1I3OA 3EA0A 5DNCA 4JQOA 4QM6A 2GZ1A 3C3KA 3LVBA 2PTGA 4ZHQB 4MNTA 4GXNA 2WFLB 2WG2A 3C8ZA 1MEOA 3GXBA 1JVNA 5I6DA 1L4KA 3TMKA 1NVDA 2DY1A 4JUIA 5LYJA 1J1IA 2CDNA 2E9SA 1KP3A 3B6IA 3X1ZA 4ZDJA 4J0HA 1EVIA 4P82A 8ATCA 5HZHA 5C51B 2Y1KA 4F7DA 3BJZA 4BATA 1JIJA 1PR9A 1SRRA 3L8FA 3LU1A 2YIJA 4YQYA 1GNLA 1CRLA 4KAJA 5A05A 5J59A 3UK7A 5AKJA 1CEXA 3P9ZA 5M29A 4LF4B 2O8BA 5B1EA 4U4AA 3V8BA 1Y3IA 1F06A 2X13A 2IV2X 3FYDA 4DLPA 2YRFA 1TEHA 1H2WA 1YQUA 1GPWB 2WM8A 1KBOA 5BMVF 1T9ZA 2FV8A 3DMNA 4Q9NA 1NLUA 1QF7A 1YCGA 3I6YA 3SZUA 3WZ2A 1BSVA 5HKBA 3ZH9B 3SHVA 1NNLA 1YJ8A 2AW5A 4NAVA 2IHNA 1CDEA 1Q1NA 2B61A 2DQKA 2O7RA 4WLFA 1DC6A 3RF6A 2SKDA 4YONB 4BLVA 4BMYA 4DPLA 3AHJA 2FPOA 4R6WA 5C46F 1XJQA 5BV2P 1HLFA 3NZEA 4CEHA 1NLMA 1XQ1A 3USZA 3A2LA 3STHA 1T3GA 2G76A 3FFWA 3ODGA 4R2JA 4ER3A 4Z9FA 1ZHHA 1QFXA 1U8AA 3BAFA 1I7SB 1K5DA 1N6HA 1TQDA 2Q3DA 2SCUB 1X80A 4GW3A 4AG5A 5ADUS 3EZFA 1ML4A 3O8DA 4K6GA 1E3MA 5KYYB 4J16A 4G2TA 1YRHA 5CFMA 1AXRA 5CVVA 5A03A 5EJ4A 3IMFA 4Z4HA 4DBZA 2BUAA 1M8PA 1LFAA 3S0JA 1XRNA 1WPRA 3MC1A 4I4TA 3VR4A 1ZPDA 3O90A 3AVPA 2HLDD 1QQ5A 4MLPA 3SDBA 3T5CA 1PO7A 3GDWA 3QW2A 2IL1A 4OQFA 4YT5A 1KOLA 3WNQA 4D4IA 4J91A 5FBZA 3ESCA 4JYMA 4Q7QA 2HXGA 3A04A 1ZNZA 3CVVA 3RS2A 5K01A 1USWA 3IQZA 1JKMA 1PJ3A 4M1WA 3UW3A 3ANNA 4H7FA 4HPJB 2RC5A 2QN9A 2WICA 3JQFA 5FNVF 5KJ6A 2X5XA 5FOSA 2WD8A 4WBXC 5GM2A 3IMCA 3CVOA 3PPXA 5EMHA 4YRJA 3H5IA 2AXNA 4NYJQ 4RDCA 1L4GA 2BSXA 3K6JA 4BYGA 3U7EB 1PZEA 4TQAA 4XB6B 3VU0A 4JBXA 2N75A 2Z5VA 1IZ7A 1YKSA 3CVYA 2Q4TA 2PSFA 4DIEA 5F5NA 2B8JA 4MZXA 1MKYA 2OBNA 1OGIA 3H4MA 4MMZB 4IH1A 4LHEA 2OHHA 3IAAA 2UKDA 3QLUA 2GOYA 3BFKA 5ECWA 4BNDB 4RLFA 1EB9A 1YS9A 1KC3A 2V7GA 2X0FA 3C2QA 1YH3A 3VR2A 4YR9A 3AKYA 3ESZA 5H1YA 1R64A 3HCEA 3IT0A 4Q1DA 4GAEA 2HDWA 2SKCA 3B78A 5FI5A 3E9RA 2J0QA 2ZJ2A 1MW9X 4EHAA 3TCXB 1XAJA 2PUVA 1EIZA 1H69A 1V25A 3N6VA 5AW5A 1CZKA 3GJ5A 2Y99A 2H1SA 1ZZGA 3ROPA 1L4FA 4PAOA 4NY1A 2O8BB 3HU5A 4DV2B 3GRPA 1CK4A 2GN1A 3Q1KA 3NDRA 1PK7A 1B74A 3UNXA 1PKXA 5CRIA 1NU6A 3BJRA 3JVDA 4HCJA 4U7JA 4RK6A 3R5SA 2JH8A 3AF4A 4RZSA 4HNTA 5I9MA 1AO3A 1HTBA 1ZZEA 2ZAYA 1K27A 4BLOA 2EQBA 1TYDE 1V35A 2JK0A 3AY3A 2RGXA 2IEGA 3QBEA 5KYGA 3Q8LA 4XGRA 3J80A 2IH5A 3PGXA 2GAOA 4CEHB 3DBHA 4OB7A 3F5QA 3ZWVA 2IS4A 1BEEA 2GLTA 2GB4A 5IHPA 1DC3A 1LLFA 1OI2A 1X7GA 3L0SA 4BN5A 2CFOA 2E7ZA 2CVQA 2UXDB 3QE3A 1MVOA 1XF1A 3GQBA 3C6XA 2ZRBA 1NGSA 4MGEA 4P0TA 1ZN8A 5KWEA 3OY2A 3PRJA 2QXUA 3JQQA 1FP4A 2L2QA 3GIWA 3X3HA 2X5NA 1USVA 3GFGA 5EKDA 2PBFA 2AUTA 3DZCA 4FSDA 4TVBA 4XXHA 3D6NB 5DLDA 2B5OA 3N2ZB 1W0KA 4I4TB 4OJNA 4BC1A 4BKRA 4R2XA 5HA5A 4BFYA 3IOYA 1MENA 3BIWA 3DZDA 4JODA 5D51S 2L69A 2AGVA 4KDRA 5KSPA 2W11A 1PYOA 1WUKS 3WGIA 1Y1TA 1NV9A 2DQSA 2YR0A 3PI7A 5FEMA 2AXEA 2EWVA 2LIPA 3SOZA 3LDUA 1Q0RA 1U94A 4J1SA 2WFAA 1PJAA 2O7NA 4EKIA 4EO9A 4YRAA 5L53A 2G63A 2PMFA 3RBAA 1U28A 2UZIR 3HZOA 2BFMA 4KV7A 1OZ0A 2X42A 4KLZA 4M8IA 2IY8A 1Y6RA 2H1RA 1SVIA 1V8BA 1YS7A 2XB9A 1ZD3A 3BGDA 2BHTA 1BO6A 5LQJA 3RS9A 1AN9A 4QUKA 3EHEA 1TI7A 4JYCA 3G0BA 2WPDA 4M9ZA 5B1IA 4AP5A 2IVFA 2Q4EA 3BGOS 3BXOA 3OOYA 4HAVA 1U2GA 1ZBDA 1XMVA 4JP1A 4MICA 4OQQA 4AY5A 4E5SA 5JXGA 4OP1A 1CB7A 4NK5A 4EH1A 3AEYA 3B9RA 3G2IA 2IYAA 1I3LA 3KDPA 2RG1A 4ACBA 5BT8A 2UDPA 2DH6A 4HGRA 2PZBA 3GYGA 4JNKA 3ULKA 3UTCA 5JSHA 4PU0A 3G9ZA 2C0PA 4TV9F 1UZMA 2QRVA 1E5LA 3A7DA 3A14A 4EEKA 2B2XA 3PHIA 3HMQA 1BFUA 1KAEA 2IIVA 3A6ZA 1DHRA 3HRIA 5IC6A 1GQOA 3KQMA 3KFLA 1GKYA 2I03A 1RWNA 2C3OA 3OLXA 4XH9B 5J4YA 2C7VA 3WGTA 1Q6YA 3GVPA 4R8LA 4LJ5A 1R6BX 4G5FA 2ZRGA 1KJ9A 2JD2A 4ZQEA 1CR0A 1RVDA 1U7HA 2O07A 4QXPA 3E9CA 1MJNA 3U7HB 4LISA 1N5JA 4PO8A 1OV4A 4Z9AA 4YUWA 5DBEX 2H7XA 1DJNA 2IYUA 2E37A 1ZMOA 2ZCVA 3LA6A 4L15A 3RUDA 5KYXA 2GYUA 1TYEB 2K5UA 4TLCA 4UBIA 2AJBA 3Q7TA 4NMHA 5LLDA 3OFNA 3ZCRA 3COSA 3EF1A 4L5JA 1S7CA 2VK8A 2LTAA 2QM7A 1V95A 3CLVA 1R6UA 3AP1A 3ZHRA 5IAGA 4DMHA 3E7PA 5AW9A 2DHEA 2ZUEA 4RENA 5I8WA 2WLSA 4PGHA 1D2MA 1ULZA 2PA3A 1C81A 5DB4A 4KR9A 3ST7A 5LFAA 3DBHB 4KRGA 1PQPA 1N2BA 5HKLA 2P7IA 4RQUA 4E5YA 3H8WA 5EJMA 1B2RA 1LD3A 1K6XA 4MGIR 4OI2A 3ZKAA 5JAUA 2XKBA 1T5LA 2H9IA 3GQBB 5IVHA 2HJRA 2GRAA 1NUQA 3QHPA 3OOJA 1FP4B 3V46A 2I65A 3BF7A 4JL6A 1P45A 3FOBA 5SYNA 2OFXA 4FE7A 1LDGA 1P39A 1BN6A 1U80A 3FPAA 1E5TA 1E0KA 3V1YA 5B12A 2O14A 2R1VB 3DVSX 1WOYA 2CE7A 1Q0PA 3DAFA 3H1GA 3LCCA 2PL9A 4YCBA 1KTIA 2DGDA 3L9XA 1N8NA 2A5LA 4RVOA 2CC2A 4NKRA 1QRUA 4JIMA 5ARDA 3H6GA 3E81A 1JQLB 1S2OA 4RKYA 3FWNA 1M33A 1LPPA 3O3OB 5LU9A 2PH3A 1EK2A 2E2WA 3GLKA 3MCZA 3ZVNA 4MIEA 2X3YA 1PJ4A 3SWWA 4JGBA 4LDJA 1JP7A 1JSRA 4JELA 1M1NA 5CT6A 3WKCA 4B3XA 1IOWA 2EJWA 3T1TA 4GGMX 2C99A 4GI1A 3FHTA 1CKEA 1EK5A 1X7YA 4C1BA 5CB4A 5J3JA 1IZYA 2ST1A 4NMWA 2GO7A 5MHTA 1GPYA 3RAPR 1GGMA 3HJRA 4ZDWA 1SC9A 2IPNA 3OZIA 1G0NA 3G85A 1S0UA 1Z37A 4MWGA 4FZVA 4PPQA 1DXHA 5JFGA 1SUCA 3BF8A 3K8OE 5DLPA 2ESRA 1V8DA 2X0DA 1NWCA 2G08A 4AN0A 1JAHA 1FDOA 1Z36A 4FHEA 4L8WB 4PS1A 1OXKB 2BH9A 2EJTA 1RJWA 1E2JA 3K3PA 4QBGB 3AZQA 3RNOA 3SKVA 3K0EA 1GFWA 4K9QA 2XGMA 6PFKA 3M6UA 4AK9A 3K70B 4ZQIA 3DHEA 3PL1A 4JVSB 4LGYA 1WHTA 1KBQA 4NCAA 1CE8A 1GLGA 3CZQA 4CTNA 3NJ4A 3IHKA 5KYXB 5ALDA 4MDYA 1QOZA 3DM9B 3GH3A 4W7SA 3QXJA 3RK0A 4O4HF 1G8JA 1R9MA 3FHLA 3G5MA 4A23A 4K0KB 4ZKDA 5DGCA 1P6XA 1WRBA 1GUBA 1NJ8A 1TYZA 2GNAA 2AOVA 3AFNA 3AM4A 4N0QA 1NP3A 1U11A 4RK4A 3N8DA 3P9CA 3TGWA 2BVNA 4AZTA 4I1PA 4ZTUB 3WRXA 3C15C 3T3EA 1NDQA 2WT9A 2Z8XA 5IJZA 5FO1A 1G2OA 1WMAA 2IZOA 3ZWYA 2CCKA 2PGJA 2R7AA 1T9GR 4G0ZA 3VYTB 2W2KB 1TFUA 1ZP6A 2J3KA 1YOBA 4Q9LA 2QRNA 4BZXA 4DR4B 5IAKA 1YGPA 3IXLA 3D8UA 3ZBUA 1E59A 2NSYA 1QO7A 1XTZA 4UMEA 4A8TA 1SCNE 5ED4A 3EEOA 1ZC3A 4YMTA 4GSKA 3L8EA 3VR6A 2EF0A 3MGKA 3EMDA 3UTDA 1H0KA 1BOOA 1EBFA 1UBOS 3GJ4A 4BVAA 1FFCA 1LPBB 3H0KA 1DWQA 3E2IA 3RJ9A 1XKQA 1X14A 2VZ0A 1C8KA 1KQ3A 2DC1A 4D8XA 1QVAA 5BSKA 4HI0E 4JBIA 5JAZA 3VMFA 3K5WA 1HSOA 4E33A 2Q4RA 4FEAA 5AESA 2ZWVA 5FTMA 1B14A 2E5FA 1WCYA 3NEYA 4AI6A 5F9MA 1M1NB 4N7MA 3ZWWA 1P8AA 1AKUA 1P61B 3WXMA 3E1GA 3RW9A 4JNCA 1DC8A 1X7YB 5CB4B 1JVSA 4MI1A 3IBTA 4NV1A 2JANA 2PLWA 2FMHA 3M1IA 3NYRA 2ZT6A 4Y6SA 5JNRA 4LY9A 3QTTA 3D1JA 2ZG6A 5GVRA 2X14A 4E2FA 2R8BA 4M8KA 4B45A 4EJSC 5CDUA 1QE0A 1RYHA 2GNPA 2Z8YM 1V6CA 1LTHR 3AR5A 1P33A 3UMRA 3PHBE 3CCCA 3HU3A 4LWZA 3CNNA 1JHAA 3EIOA 2YJ4A 4DZTA 1F38A 1N25A 3D2CA 2QAGA 3GAZA 4YAKA 2VSNA 2WKRA 5ICEA 2V3VA 1NJ2A 1LK7A 3HYLA 1XPUA 3K6RA 1WHTB 3LPCA 4I9FA 4RWEA 3EODA 5K4HA 5JR3A 1CYEA 1CE8B 1EFAA 1PT8A 2BZ1A 2WU1A 4Y2PA 1Y8CA 3QPBA 2QYHA 4E08A 3DE5X 2WJ3A 4PQFA 1UBGA 4S12A 4BVKA 2PUFA 2ODPA 3JATB 5C8DA 3A4TA 1JHYA 2WVJA 1PR1A 1BFDA 3JQDA 3HJAA 2VUTA 5EHIA 3STXA 5C3MA 1XRSB 4NBLA 4J2HA 2AG8A 5IAOA 3R1IA 3R5FA 3ZDAA 4IPTA 4X63A 3R74A 3MCTA 4C88A 1E32A 4KGXA 1EFRD 4S1OA 1RMYA 1NBAA 1J23A 1VMKA 2B4QA 4NS4A 4L7VA 4UNNA 3UWKA 5JCOC 4Q3LA 4FOLA 3NVKI 4OX9Y 1XZDA 3BHMA 4WK0B 3HBFA 1NN3A 3LMKA 3V97A 1VMDA 3RU7A 2XB8A 3U31A 4DMCA 3IPLA 3NHSA 3VFDA 3CYFA 3TDMA 1TTHA 2CXQA 2PD6A 2VUHB 4F2GA 3KQSA 4RF3A 2VRNA 5K8TA 5ELXA 2HT1A 3UAWA 1T5TA 5EEGA 3O1JC 1H2AS 1OLXA 1TM5E 3E3AA 4FGLA 4AYXA 4JHXA 5A62A 1ACJA 2XUJA 3HB5X 3PF8A 1AHPA 1E58A 1Z4MA 4F3NA 1H2HA 3TCNA 4RD0A 3ZCSA 4KLAA 4C7MA 3TNFA 3WNDA 2F00A 2WMNB 4G6ZA 3M5DA 5JIBA 2D1YA 4E6EA 4DJDC 1MCZA 2N1MA 2YV5A 5E2IA 1UXJA 1AZLA 1TZ2A 1ZLYA 1WVGA 1CERA 5FX2A 3NYIA 2D5BA 3N6XA 3R3UA 3STYA 2OCDA 1VZ2A 4OQPA 2R8ZA 1P0MA 2ZEJA 5FBQB 2C54A 2FP3A 3T4EA 1MZVA 4JI4B 3H0CA 4J7UA 2JGRA 4ER7A 1P4SA 1NVBA 4Y6RA 3V2IA 1XP8A 5A9RA 1P2VA 3DBIA 3VA7A 3ZLBA 2AZTA 1NVTA 2ZIGA 4Q3AA 2ZQ5A 3R3JA 5AK4A 4C87A 1NVFA 1PF7E 5CVJA 5AKZA 5GOZA 4YYEA 1TK9A 2FEMA 4L9AA 4UPDA 3RSOA 1G21E 1WZIA 2EAUA 5AKIA 2JAOA 2QAGB 1ISPA 1T3HA 1VL0A 3A2NA 3AHDA 4D98A 5HZMA 2BTEA 1M6YA 1VHQA 5CXSA 4NBVA 4DCVA 1JJ7A 3CR7A 5SY4A 3E15A 3N76A 5J63A 4D4KA 2CGEA 4ZVTA 2NZJA 3KXPA 1RYYA 1OX5A 2VKTA 3AY0A 4WLVA 4X00A 2YH2A 4K1XA 5H0IA 5L7TA 4BNXA 2F90A 3TF5A 4ZAFA 3QIVA 3FOZA 2HJGA 2VJKA 2O8DA 4PSDA 1J49A 3NEPX 1NBOA 5BSEA 1A7AA 1W25A 3VNVA 1RAEA 2H7CA 4Q34A 3I30X 1CFZA 5I5GA 3EN0A 3QRWA 5LBTA 3WL6A 1AA6A 3LQKA 1ILEA 3ZDZB 1LW7A 4I1RA 4JWTA 3UT6A 2VYVD 4BFVA 5L45A 4Q6WA 3SBEA 3V1TC 2QTFA 2VTBA 3DEJA 3TX2A 1WLYA 3Q2KA 2Q3HA 4P33A 2CUNA 3H9CA 4TRNA 4HLUA 4LHVA 3VNUA 5E4FA 1S9HA 1LPAB 1B3RA 2XUGA 3HTXA 3GF4A 4U7HA 5B2EA 2IQ5A 1CZNA 2KBEA 3THSA 1XLUA 4RH3A 3NTUA 2EC5A 3PUVA 1WB6A 2QB5A 3BB3A 4LQDA 2G9ZA 1BYUA 3IEVA 3FMIA 3A9CA 3QVSA 1QRRA 2QY6A 1ARZA 1L4YA 2QG4A 3LQ2A 3UUWA 3CURA 3VH2A 4TYQA 1OLXB 3E18A 3TNDA 4LRTB 4TWIA 4F5ZA 3OZTA 3R8XA 1CEEA 1C7JA 3D1VA 4L28A 4OMFG 3EPLA 4BWVA 1DXQA 1FX1A 2CXPA 3AG6A 5FUWA 2NT4A 2P5TB 4IF4A 3NVMB 2ZYRA 721PA 2LKCA 5DTQA 3FFTA 2VHYA 4BLWA 3VAZA 4EW1A 2I3AA 5KNBH 2QPAA 3LH5A 2VYNA 2PBZA 3CUUA 4D8WA 3LD9A 2O2CA 1UBRS 4DCTA 2VTKA 5JARA 4GDMA 4OOFA 2P9EA 1KJYA 1MO6A 4MV4A 4G0UA 5H3HA 1HNXB 2OHGA 3V8QA 2CLMB 2F7SA 4M54A 3F2IA 3G6WA 2XB2A 4I9GA 4CJXA 1SXHA 5ECGC 1W85A 2BJWA 1NC3A 2QPLA 1V47A 1EQAA 3L1IA 2JJYA 4I5GA 3ZX5A 1KR2A 2I80A 2NO5A 2HMYB 3ZQUA 2O3QA 2PRSA 1P8JA 2ZSDA 1XBTA 1EP9A 4RJTA 2P6RA 1E2FA 1NVAA 3VDRA 1LBQA 4N5IX 4FOOA 1QYVA 2GN2A 2H1OA 2FEPA 3CZMA 2A94A 2RJNA 1YAJA 2H5IA 3MHTA 1BWSA 3GVXA 1K7YA 2HCJB 1SHZA 2RGDA 1TTTA 2YUTA 3UCXA 3MB8A 5GV7A 2GAFA 1I2MA 1IOLA 2N3ZA 3BC1A 3GCDA 3JQAD 3OC6A 4WVFA 1XNQB 3P4XA 1BMQA 2QLMA 1DDOA 3H2JA 1FYVA 2IS6A 2NU8A 3VR5D 2C4TA 3ZQKA 5B3JA 1SB8A 1Y9DA 3I6IA 1IHYA 3JX9A 4QLBA 1INLA 5KYVA 2O8DB 4O2AA 2QA5A 3QHQA 3C6MA 2ZRLA 3DZFA 2QD2A 1JQJC 4CEIA 1UBJS 2PH7A 4I50A 2XNSA 1BXKA 5EE9A 4CIYA 3AR9A 1JA1A 1AQLA 3FYTA 2DHDA 2EZ8A 4QRIA 4ALJA 3GJ3A 1EYZA 4JSRA 1VKZA 4R1TA 1F2VA 3FPKA 1YZUA 3KOYA 1J5XA 2VTBB 1R27A 4DQXA 3M7IA 5BSVA 3ZZ1A 1B2LA 2BV3A 3EVBA 3OKAA 4BEJA 2YWRA 2X0KA 1IB0A 2I3DA 1OC2A 4OUDA 4TL6A 4YBZA 4BLRA 2BGJA 1R5OA 3FWPA 3L7MA 3W6OA 4B2LA 4R0MA 4E7PA 4D41A 4NCNA 1FVHA 3QU2A 3GAMA 2JFUA 4BV9A 1L5FA 2C4HA 1XMOB 4K9NA 4EPXA 1X8JA 2HPZA 1IJBA 2P8JA 5BWLA 1TKRA 4KN8A 4NF2A 5KTKA 4ZC1A 2IUTA 3KQYA 1ZGJA 4PTLA 5ILGA 5A5EA 2J5BA 1D1QA 1QFSA 3U3MA 4OATA 4JSYA 1UBUS 3EISA 5G0WA 2GM3A 1E2LA 4LECA 3SFVA 2A1IA 1GPNA 2CV2A 3KTOA 3C8HA 4NARA 1GZSA 3CZCA 4YO8A 4LGCA 1MT0A 2ZWMA 3JVUA 1MDFA 3H4VA 4L08A 4LOIA 2I2FA 2VC2B 1U0GA 1V16A 4Z7QB 1KYVA 3LUCA 2EVWX 1OUMA 1CZUA 2RG7A 5B6IA 5BR8B 3CB2A 1R4MA 2H4ZA 2B1RA 1R16A 4HH3C 3S2SA 4B76A 2H2AA 1W8IA 1SVMA 4U7TB 1UZLA 1F0PA 5JAOA 1SZJG 2JA2A 1W36B 3TTWA 2YZGA 4GRIA 1KSFX 1W85B 3TECE 1HG0A 1CLEA 2RGCA 4MTCA 3WQRA 2RHBA 3HB0A 5EIHA 3U40A 1D6MA 1A9YA 4NLLA 5KQLA 1T9KA 4XSVA 1JKIA 1MAVA 2QQFA 3D4OA 4EFKA 3BL6A 3DNPA 1JJIA 4QBIA 1KAOA 4OA5A 2WZQA 1M5UA 3MTAA 4M83A 4TMKA 3V4VB 4CIAA 3WLJA 3MTQA 1MRNA 3I6ZA 3WK5A 4LCJA 1G1MA 3HKCA 4WXEA 1NMYA 3IR7A 1QP0A 4NC9A 5AVZA 1L7OA 1LI7A 3C97A 4X7MA 1RI2A 3M3DA 5IZCC 2WSLA 1GITA 5AVXA 1VE1A 4JUBA 3IKJA 2QZSA 3NNSA 2X2OA 1RWKA 2XD9A 3OQVA 3VTFA 3H3FA 1SCUB 1P2TA 1OFUA 1EGAA 1XJ0A 1BWQA 5FADA 3RG2A 3PQ5A 1SUIA 2NU8B 2F3RA 3EFEA 5DW0A 1JDPA 5GZ1A 1T4MA 4G9GA 1SN7A 3ZOKA 2H54A 3ZU3A 5JECA 3QENA 4CG1A 1G42A 1K2WA 1N78A 4JKIA 4CEIB 1RKUA 2GJ4A 5AKGA 2Y93A 4I50B 1GZ5A 2I4OA 2V54A 3PHHA 3U4QA 3DW1X 4CM9A 5SZIA 1D6JA 3B6JA 3FOEC 5F51A 4AM8A 5CPFA 3SZGA 3BICA 3QLJA 2FUEA 4JJIA 1VRVA 3ENNA 5ENDA 1P60A 1DKLA 4MAAA 1M72A 4U6QA 4KSBA 5EJFA 5DYGA 3BRWA 1TVMA 1ZXBA 4OXIA 4E31A 2OXTA 5B7PA 2HUNA 3C41J 1EX1A 3AFIA 3TGLA 2FQ1A 1IXKA 3TCKA 1OXVA 3N8IA 3EAFA 2COKA 5IAEA 1I1NA 2PFKA 2P30A 2YINC 1UBCA 3G17A 1NUPA 3FTCA 4OUKX 1PZFA 4OQXA 4RY0A 1J8QA 4IBOA 5HK8A 3LKVA 1EVQA 1ACMA 5CTJA 4QVGA 5HEKA 5CCXA 1UC4B 4R3WA 2FN8A 1RACA 4I6GA 1MN6A 4B6RA 5LN1A 3VOBA 2HYIC 4PWZA 2I4MA 2AFHA 4MW1A 1KQNA 4UVGA 4BFCA 1ZQ1A 3FNQA 3ZD8A 1V16B 4PFJA 4RCYA 1O0BA 3JRWA 1M5RA 4UNSA 4Z3KA 1TPYA 3Q0TA 2NXEA 3A4VA 3I2JA 4DQKA 4HKTA 1R4MB 1SQGA 4HO1X 2GXQA 5BPFA 3V42A 2MDTA 4ZT2A 1HYEA 4IWNA 3KL2A 3VPBA 1R9JA 2ZJOA 4PPYA 3NUZA 1EB8A 1IRIA 1DBSA 1RABA 1JSZA 1DSSG 2HRQA 2JZCA 2GLXA 1RNLA 3P8ZA 4E5KA 4JI5B 5K1ZA 3HDTA 2H16A 4EJ2A 1ABEA 2XD4A 4D4JA 3EVNA 1M6EX 2CN1A 5EVCA 5HF8A 4EDHA 3L41A 4JLBA 1E3WA 4EJFA 3BD8A 3L6UA 3R7DA 2FX5A 3AJAA 4BMSA 2PMBA 4RQAA 3K96A 2D7DA 4J0GA 1RXSA 2BFFA 2HTEA 3G2JA 4MCIA 4P5EA 4P4UA 3RCBA 2VF4X 2JCSA 1H42A 1FTQA 3NM5A 4CKZA 4TS4A 1P1JA 5JT1A 3KRTA 1KU0A 1QIDA 5EKXA 1RHQA 2OKGA 1GZUA 5H7XA 521PA 3MWGA 2Y1WA 1CQJB 2R1UA 4OGWA 2I1WA 3OOEA 3W3AA 1D0VA 1LGYA 3ZGZA 1FJHA 2BFWA 1M2OA 2HSDA 3GK3A 5FQNA 4Q4CA 5JMWA 3EMKA 4JCOA 4GOND 2CXUA 1GO2A 4ZO7A 1X9GA 3EFHA 1UP7A 1N2JA 3K8QA 4AJ1A 3AM3A 5CYOA 3I5YA 4ECEA 3EPRA 3IUYA 3N74A 4O5OA 1UFRA 1ZKDA 4ZVUA 2XWQA 3KUUA 2V58A 1ZG3A 4DWJA 2G71A 1KA9H 4YRKA 3LHIA 4L73A 4UDXX 2JJ1A 2IWRA 3ICPA 1L7VC 1WW8A 3UWDA 2D54A 4CU2A 5FYDA 5YASA 3DMHA 3LHKA 4XJTA 3AILA 5HTKA 3BE8A 2UU9B 2FETA 1B7GO 3FFBA 5JI2E 2D2FA 1LDNA 1TU3A 3RD5A 1JEEA