5HILA

Crystal structure of glycine sarcosine n-methyltransferase from methanohalophilus portucalensis in complex with s-adenosylhomocysteine and sarcosine
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
244
structure length
240
Chain Sequence
DHYEEEYVLGFVDKWDELIDWESRAESEGDTIINILKERGVKKVLDVATGTGFNSVRLLQAGFDVVSADGSAEMLVKAFDNARDHGYLMRTVQADWRWMNKDIHDKFDAIVCLGNSFTHLFDEGDRRKALAEFYALLKHDGVLLLDQRNYDAILDSKHAHYYCGDTVSVYPEHVDEGLARFKYEFSDGSVYNLNMFPLRKDYTRQLLHEVGFQEINTLGDFKETYKEDEPDFFLHVAEKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycine sarcosine N-methyltransferase
publication title Structural Analysis of Glycine Sarcosine N-methyltransferase from Methanohalophilus portucalensis Reveals Mechanistic Insights into the Regulation of Methyltransferase Activity
pubmed doi rcsb
source organism Methanohalophilus portucalensis fdf-1
total genus 86
structure length 240
sequence length 244
ec nomenclature ec 2.1.1.156: Glycine/sarcosine N-methyltransferase.
pdb deposition date 2016-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5hilA02
3P2KA 4E2ZA 5EG5A 2JHCA 1KXZA 3JWJA 2AOUB 1DL5A 3I9FA 3HVJA 1AV6A 4ZTBA 1FPQA 1U2ZA 4HRAA 5IH3A 2NNWB 2JJQA 1YFLA 4F85A 1EQAA 3FUWA 3Q7EA 3FPEA 5EZSA 3EGEA 3GO4A 3OE4A 3UZUA 2FYTA 1RJEA 4GOMD 3TPZA 4POOA 1XCLA 3KR9A 4Y2HA 4OBWA 4DCGA 5FHQA 1AQJA 3CJQA 3DR5A 2O57A 1NV8A 4ATNA 3IV6A 3ELWA 4RTRA 1O9HA 3GRVA 1WG8A 3EGIA 1G60A 2HMYB 3ERCA 2ZCJA 2YQZA 3HCDA 4OBXA 5HZMA 3BWMA 1ZGAA 3P9NA 4C06A 2AN3A 3I5UA 3UWPA 4CWAA 4E2XA 1B42A 4E33A 4QQKA 2IFTA 5DM2A 1M6EX 4FT2A 2Z6UA 1XVAA 3DMGA 1XTPA 3LCUA 5EIWA 1D2CA 2XYVA 4V0QA 4CTKA 1KPIA 1G38A 1IM8A 2YX1A 4IWNA 3MB5A 3FPFA 1WY7A 2AOUA 1N2XA 4EK9A 5LQUA 1SUSA 4YUXA 5M5BA 3AXSA 5K0EA 3EGVA 3IEIA 1KYWA 3KKZA 3MAGA 1WXWA 3LX6A 4KVZA 3OFJA 4PYQA 3T7TA 3TKYA 1JSZA 3O7WA 3V8VA 4BLWA 3CCFA 2ZWAA 4E2WA 3VC1A 3G5LA 3UJAA 2EJUA 5EOVA 1SQGA 2DULA 5C1IA 1TW2A 2PX8A 3THSA 3NW9A 4R8RA 4WXHA 2H11A 5G02A 2JHPA 3BKXA 3BUSA 4ER6A 1AF7A 4M36A 1JG1A 4FSXA 5DXAA 2AVDA 3GCZA 3KPJA 3UA4A 1ORIA 3U81A 4RTOA 4DCMA 4C07A 4GOND 4OX9Y 2P3LA 3OPNA 4G56A 5DRTA 5E2BA 2ZFUA 3V97A 4E32A 3KQTA 1Y8CA 4QPPA 3HVKA 1VP3A 4QDJA 10MHA 4GF5A 3DTNA 4A6EA 1P1BA 3E8SA 3ME5A 3EEOA 3HCBA 4QTUB 3KQWA 1P39A 1L3CA 2XYQA 4IV0A 1UIRA 4KW7A 5JUWA 2IBSA 4FGZA 1JTFA 3SXJA 5LQAA 3P9KA 1XDSA 3CC8A 5EHIA 2EX4A 3ANXA 3CGGA 3BKWA 3P71T 3P9CA 1TW3A 2B2CA 3TOSA 4YV0A 3LECA 3KQQA 1QZZA 5DX0A 4C04A 1X1AA 5K0GA 1NW5A 1SVUA 3LCCA 3PB3A 3EVGA 3PTAA 3QOXA 3OZRA 1BHJA 3O31A 1RJFA 4C4AA 5KVAA 2ZLBA 4RTKA 3NVMB 1VL5A 4R6XA 3M6XA 3AXTA 5K8VA 5DWQA 3EVCA 5FQOA 1P91A 2QE6A 1KHHA 3G7UA 1QAQA 3EEYA 4C03A 1L9KA 3R0QA 3FUTA 3M4XA 3MCTA 4HGZA 2BR4A 4KDCA 5HOQA 2R3SA 3NVKI 1FBNA 3KHKA 1VE3A 1M6YA 1RI4A 5CVEA 3E05A 2DPMA 1UWVA 2ZZNA 3KU1A 5LQRA 3B89A 3REOA 1VPTA 2CKDA 1EJ6A 4OQDA 1NKVA 2YXDA 2BM9A 4CTJA 4YV1A 5ICGA 2P1DA 3T7RA 4PCAA 4DKJA 1Q0TA 3S68A 3UJ9A 3OCJA 3HTXA 4GC5A 3P97A 5DT2A 2C7RA 1JQEA 4DZRA 2OZVA 4M7RA 3C3YA 3DXYA 1JG2A 2PT9A 3WSTA 3DMFA 1D2HA 2HR1A 5E9JA 4KWCA 4LG1A 2XBMA 3GRRA 3GWZA 5FCDA 4K6MA 5D1NA 5EGSA 5GM2A 1KPGA 2PSSA 2AOWA 3G2PA 5FA8A 4YUZA 4E30A 4QTTB 4P58A 1MJFA 4RWZA 2NP6A 3G8BA 2P3QA 3P9IA 5E1MA 3FTEA 3DUWA 2QM3A 4OA5A 1ZGJA 3PS9A 2ERCA 1YFJA 4RTJA 1F3LA 5GP1A 3KR1A 1YB2A 2YUIA 3ELDA 2IDKA 2PJDA 4PGHA 5K0LA 5F2KA 5K01A 3OZTA 4XUCA 3SVZA 5CCBA 3PLAE 1WS6A 3MTIA 4CXMA 3R24A 5FWDA 3GU3A 4EKGA 5GIPE 4HG2A 1V39A 5E1BA 4DM3A 3BWYA 3UJCA 3ER9A 1Z3CA 2IH4A 3LBYA 4GOOD 4GUAA 1XXLA 2OBFA 2YTZA 3BWBA 9MHTA 1QAMA 5HEKA 2UYHA 2P40A 2XVAA 2YR0A 2EG5A 4PWYA 3FUUA 3OZSA 5CIYA 5CVDA 4AZSA 2CMGA 4JXJA 2VZ9A 1G6Q1 4RVHA 5FQNA 2AVNA 4PGGA 2PLWA 5CVJA 4ER3A 4QVKA 2IGTA 5E2AA 5EEGA 3SM3A 2PX5A 1INLA 2ESRA 3LDGA 3LSTA 3OU6A 1SG9A 4IKPA 5EIFA 1VP9A 3ORHA 3KR2A 3M70A 3HVHA 2FRXA 2N47A 3FRHA 3DULA 3DP7A 5DTMA 5DPMA 3FTFA 1PRYA 3A7EA 1H1DA 4RVDA 5GINE 5DX1A 5HIIA 2B3TA 2FCAA 3GNLA 5HIJA 3QOWA 2GB4A 3JWIA 5BXYA 2I9KA 3I58A 3KPVA 3OU7A 2G72A 5T6BA 3T0IA 2FK8A 2XVMA 5ERGB 4LECA 5CM2Z 3CJRA 5GOZA 3HA3A 5EPEA 3FPGA 2ZVJA 3HA7A 3HCFA 3THRA 3DLIA 3EVEA 3VC2A 5KS2A 2Z6AA 1R00A 2I7CA 4RSRA 3UFBA 2QRVB 2IP2A 4AX8A 3MHTA 2C7QA 2IBTA 3C0KA 3LKZA 1ZKDA 2VS1A 3GJYA 2H00A 4PIPA 2AOTB 5P8WA 2PBFA 4PCLA 3AY0A 3MGGA 3B3FA 1BOOA 1DUSA 2BR3A 1X19A 2Y1XA 2ZBRA 2GS9A 1JG3A 3A25A 5E1DA 1R8XA 2OPBA 4ER7A 5K0FA 2B78A 4RX1A 2NXCA 1QYRA 2NXNA 2ZZKA 1L3BA 1HMYA 2AZTA 2OB2A 3KPYA 3GIWA 4M37A 4U7PB 4CKEA 4E2YA 1BKYA 5EQJB 3TMAA 4L7VA 5EC8A 4GC9A 2JG3A 1HNNA 2WK1A 1XJ5A 2ONZA 4CKBA 3F4KA 5DTRA 1YUBA 4C08A 1VIDA 2R6ZA 4PYLA 4BP3A 4DA4A 4PYIA 4ER0A 1NW7A 3FPJA 1YZHA 1IXKA 3LPMA 5CUQA 3C6MA 2AN4A 3OFKA 4A6DA 2JH9A 1ZQ9A 4YUVA 4RTPA 3HA5A 1RI5A 3DLCA 3K6RA 5F2NA 3BGIA 2AR0A 1M0EA 5GWXA 2P41A 2YXEA 3CVOA 3DOUA 1VQ1A 3FYDA 3KPUA 4Y30A 5BP7A 5BW5A 3DH0A 2ORED 4IV8A 2ADMA 3KQVA 4MWZA 4DQ0A 1XDUA 2VDUE 4HSGA 3NWBA 3JWGA 3HM2A 3BGDA 1XDZA 4FP9A 4E70A 2UYQA 3E23A 2AOTA 2GAFA 5EMJA 2B25A 3TM5A 3EVAA 2IH5A 1G8AA 4P7JA 5DM0A 2FK7A 3PFGA 4LWPA 5EEHA 3B5IA 2BH2A 2IIPA 3LL7A 1ZHFA 1JQ3A 2OYRA 2FHPA 2CWWA 2JHAA 1O54A 1R8YA 2PXCA 3NDJA 2V74B 1FP1D 4KDRA 4P7GA 3VSEA 4PYJA 5MHTA 2PX2A 3EVFA 1NT2A 3O4FA 3AWIA 1P1CA 1RI1A 5FTWA 2ZSUA 3G5TA 3TFWA 2PWPA 2OXTA 5EMMA 4RTLA 2PXAA 3VYWA 3I64A 2AOXA 2PXXA 4PYKA 2XYRA 5K0JA 2C7PA 4AUKA 2CMHA 1NW6A 2QYOA 2O07A 4X41A 2WA1A 1NBHA 3HCAA 4AZWA 1XCJA 3M6UA 4GEKA 5CVUA 5EMKA 4Z2YA 3GRZA 5DSTA 1EJ0A 2F8LA 4QPNA 5EZQA 3HVIA 1SQFA 5C9ZA 2PT6A 3HNRA 3SSMA 2NP7A 2HNKA 1JG4A 2BZGA 3EMDA 1AQIA 2UYOA 3QV2A 4O29A 5DM1A 3SR4A 2JH8A 1R6AA 1F38A 1I1NA 1D2GA 3ELYA 3KQYA 3MTEA 3P2EA 3KQOA 5E9WA 5E9QA 4OQEA 3BXOA 4RTSA 5H02A 5ICFA 3EVZA 4FR0A 4MHTA 3SSNA 8MHTA 2PKWA 3FRIA 1TPYA 2GH1A 4V0RA 4X63A 4DMGA 3GGDA 5FUBA 3NMUF 4MIKA 3GDHA 5ICEA 2A14A 4YUYA 3FTDA 4FS8A 3M6VA 5EHGA 5DRYA 3TQSA 2AN5A 2UZ4A 5K03A 2Z6QA 4BY9E 4GOLD 5F2OA 4PNEA 4RTMA 5FHRA 4MTLA 2HWKA 3OE5A 4PIMA 2G1PA 3CKKA 1Q0SA 4NECA 4RTNA 2PGXA 5E8JA 1O9GA 3PX2A 3G2MA 2OKCA 3C6KA 2PY6A 3B3GA 2YVLA 4E31A 5IKMA 2K4MA 1N7IA 1N7JA 3B7PA 5U4XA 1NV9A 5HIMA 3FUXA 5CCXA 5DM4A 1RJGA 5LQJA 1I9GA 2PV0A 5K09A 4EQZA 2G70A 3Q87B 2P35A 3DXZA 3EVBA 3K0BA 4YV2A 2OO3A 4HH4A 5LSAA 3PT9A 2ZIEA 1T43A 2P3OA 1QANA 2YXLA 1KIAA 2BR5A 1R18A 4KIFA 1YF3A 2O05A 1ORHA 5GM1A 5DXJA 1JSXA 3HEMA 3UBTA 3DMHA 1KYZA 3SMQA 2ZIGA 4EKIA 5KQRA 4ISCA 3FZGA 4FZVA 4AZVA 5LQNA 4WVLA 5C0OE 3UA3A 3BZBA 5B1SA 1FJXA 5ICCA 1NW3A 3B3JA 4BP1A 5K0BA 5KQSA 2NXEA 3RW9A 3MQ2A 5HILA 5T67A 1SUIA 1SKMA 3UJ7A 1G55A 4F84A 3NJRA 2ZWVA 2ZULA 4KRGA 3RODA 2GPYA 4FSDA 1JQDA 3ELUA 4HC4A 3FYCA 3HCEA 3MERA 1JR4A 2ZW9A 2VDWA 5DTQA 2P7HA 4QDKA 1KR5A 4RVFA 3LKDA 4BLVA 3L8DA 4DF3A 3G89A 4RYLA 1WXXA 3KQMA 4QVGA 5E8RA 5CD1A 4LWOA 1IY9A 3NDIA 3EPPA 2LD4A 3SX0A 5JR3A 4B17A 2ZZMA 7MHTA 3LHDA 5CVVA 3CJTA 1KP9A 4MQ4A 3NTVA 4ER5A 2PX4A 5DSXA 4UOEA 1MHTA 2P8JA 2B9EA 3A27A 2ONYA 3SSOA 3FTCA 3KPWA 4HTFB 4KIGA 3OU2A 4C05A 3G88A 2FPOA 3BT7A 5LQCA 2V7EA 3SGLA 3M6WA 5EKUA 5FWAA 3GRYA 4X61A 2H1RA 3E7PA 4YMGA 3UJDA 3G2OA 3IYLW 1RI3A 1PJZA 1WZNA 2OB1A 2Q41A 3GRUA 4XUDA 4X60A 4BLUA 1DCTA 5BW4A 1X1CA 2I6GA 1RI2A 2O0LA 2BM8A 2QRVA 3DXXA 3PX3A 4P7FA 4F86A 4FT4A 5GIOE 2WA2A 2KW5A 4GBED 3BGVA 1NW8A 2G8NA 3KQPA 3TLJA 2ZBPA 2NXJA 3BWCA 2EFJA 4P7KA 3KR0A 4H0NA 3I53A 5LQKA 3TM4A 4YUWA 4M38A 2ZIFA 3UJ8A 3D2LA 1R74A 2HTEA 4XUEA 1G8SA 2ZTHA 2ZBQA 3PVCA 1OR8A 1QAOA 4AZTA 1EG2A 1BC5A 2O06A 1VLMA 2AOVA 1EAMA 1EIZA 3C3PA 4EVIA 2NYUA 3LGAA 4YMHA 3CBGA 3IHTA 4HTFA 5DX8A 1VBFA 2GLUA 2E5WA 2OY0A 4CKCA 2HV9A 3R3HA 3FUVA 3R6TA 2UYCA 2G71A 4PINA 3ER8A 2GA9A 5DLYA 3R9XB 1X1DA 2CL5A 3KQSA 3P2IA 3G8AA 5FULA 2PVCA 3TR6A 3HP7A 3NWEA 3RIEA 5EKXA 5LR6A 1FP2A 3TKAA 4EMSA 4X1OA 3T7SA 1YZ3A 3LDFA 5FADA 4HGYA 3M33A 5EMLA 2AS0A 4R05A 2QY6A 4PONA 2IDJA 3MCZA 1KPHA 5FA5A 4U7TB 2C7OA 3EVDA 5K0NA 1L3IA 2IPXA 3A26A 3FPHA 5K0CA 1I4WA 2PWYA 3X0DA 1JTEA 4RV9A 4OA8A 3JWHA 4PYOA 2VP3A 3GXOA 3UJ6A 5EVJA 3AJDA 4XCXA 3LDUA 5K05A 5KYGA 3A7DA 3PFHA 4PYNA 1NE2A 3TRKA 1UFKA 2P7IA 3P8ZA 3LBFA 5T64A 3H2BA 3UJBA 2EJTA 3EMBA 3HCCA 4RTQA 4R6WA 5HIKA 4GQBA 2I62A 4PYMA 5E1OA 1NBIA 4R8SA 2Y1WA 2VDVE 4RVGA 1L1EA 4QQNA 2IH2A 1ZG3A 5HFJA 3LCVB 5D1HA 3A4TA 3G2QA 3ID6C 1X1BA 1RJDA
chains in the Genus database with same CATH superfamily
5JDCC 3OJLA 5EG5A 4BP8A 3IBTA 1DAFA 1G8FA 1JI0A 1ZL2A 2R8PA 2XDQA 1O6CA 3DUFB 5IEJA 4HRAA 4F9TA 1UDCA 2PRIA 2REQA 3BQNB 2I7VA 3RC3A 3DLBA 4M9CA 3GLRA 4EF6A 2JGEA 3I34X 2RHWA 3D6HA 4BX2A 3GO4A 3L77A 4X91A 5GJWC 5I3CA 2JI7A 4L8LA 4B3GA 1JWAB 4EG0A 3F7TA 4A03A 4GOMD 1V9CA 3KR9A 4UUNA 3F3YA 5IX8A 1RM4A 1BD3A 1ESEA 3H6HA 4KU4A 4TXMA 4PQEA 1IPEA 2O57A 2RGWA 3N6VA 3EXHB 4BBJA 4F6RA 4ZYVA 1WG8A 1JLHA 3B1VA 3TRFA 1O87A 2PRYA 4IXNA 5HZMA 1W96A 2DFLA 1ZGAA 3P9NA 2M6KA 4NEHB 5JD3A 4HYQA 1HETA 3RUPA 1LFAA 4MA5A 2V6FA 1TJ3A 1BEEA 4FT2A 3HDGA 3DMGA 3EHEA 1WB5A 3TGWA 5DNUA 4CTKA 3MGBA 4TSRA 3GJ3A 4OGKA 3JALA 1G0NA 1GFIA 2ZYIA 5FV4A 4N40A 4J7XA 4IFTA 4FC7A 5AK0A 1R4NA 5NLLA 1J8QA 4JHLA 4MI1A 1HRDA 1TADA 4HXEB 4ZDWA 1VMAA 4ARIA 1DARA 1T6ZA 4I8IA 2GBCA 4UAVA 1F20A 4WERA 5FI0B 2AN1A 2AWNA 2JGDB 1GUBA 2FKAA 5IC5A 4BNYA 4FB4A 3KYIB 4EVSA 5I7UA 5LKAA 1ZNXA 3FDFA 4RZQA 3NALA 1OC4A 4M36A 4YMLA 3JQGB 4CUZA 4U8GA 1G18A 1AMNA 5JPDA 1TO1E 4KDEA 1T1EA 2VJDA 2F1OA 4UTVA 4MWSA 4G5RA 2BDTA 4YRPA 4FM9A 2WJVA 1OXXK 4TV8F 2BDUA 3TVDA 2AE2A 3IXQA 3AUXA 4HBGA 1PJ2A 2LUOA 2X0RA 2WIGA 2JLUA 1ZNZA 3DTNA 4A6EA 3FGOA 5KBYA 2ORWA 3OY7A 3HCBA 4FXOA 1I7QB 1UIRA 2SECE 3RS5A 3OLZA 3RM3A 5B7QA 4XGRA 3ZY3A 4DV7B 4D26A 1Q7GA 3SE7A 1IN6A 1ZM3A 1NBMA 2IZ1A 3WIBA 4YV0A 4XVRA 3DNFA 5DX0A 3FWKA 4FYMA 2DLCX 3H2IA 4TS9A 1ZH6A 2OA0A 5A4IS 3KYDA 2Z2JA 4POAA 1JLLA 5JAZA 2ZQYA 1AKMA 1RJFA 4KRXA 3IT0A 3CLSD 1WDKA 2P8SA 4ZAFA 1AA9A 3M5WA 1MG0A 4DY6A 1T0UA 3CH5A 4KZPA 4IWYA 5BQFA 1NNI1 4JQOA 5ENDA 1HY3A 4BMZA 1UWKA 1YK1A 2ZK7A 3KLPX 1Q20A 1N8KA 1RWXA 5FIUA 2R751 4LF6B 2W37A 3COVA 4Z1OA 5IYZB 1M72A 2E4XA 1ZXLA 3EG9B 4ALJA 2FCRA 4NDZA 2JLBA 2P0YA 3G9XA 4D4IA 2JLCA 2RKBA 4HH1A 4K1XA 4JSRA 4YT2A 4NXNB 1Z6XA 2GD2A 3CB4A 1JIVA 4O4LB 3BEDA 4KX3A 2XCSB 3R6DA 4PLFA 3VRHA 2WP0A 4B6SA 1IBKB 2QLFA 2RIPA 1AB6A 1L5NA 3PDCA 4PCAA 1JI3A 2B5WA 2XRYA 4KWTA 3UJ9A 1EM8B 1U1FA 4JZYA 1ZN7A 1OPRA 4TMFA 2NX2A 5F1KA 1LB1B 3X44A 3GVXA 4IO1A 1OI4A 2F43B 2FSGA 1PO7A 2I03A 3I2GA 2PFKA 3PNYA 3U7QA 3N74A 3UCXA 2OGZA 4O4HF 3V1TC 1KBQA 2E4WA 4MDFA 1IG3A 1R5OA 1XCGB 2MYTA 4P80A 3SICE 5JAMA 2WMYA 1XA3A 4M0FA 4MV7A 5FWNA 2WE7A 3RRMA 3SR3A 2A6PA 4DV5B 4UE6A 1OUMA 1JHUA 2QEQA 2COUA 4EPTA 1D4ZA 1TX4B 3ENNA 4GH5A 3WAJA 4LC9A 1UC4B 3PNSA 4PLPA 1WU7A 4QL3A 1W2HA 2VRCA 4JY7A 4OA5A 4BNDA 1UZAA 4UREA 3X1KA 1UXIA 1JILA 4RK4A 1CQWA 5GP1A 2VF8A 4X1YA 3RSFA 1DMRA 1X9IA 3KVVA 1UOQA 1ODFA 2PJDA 3B1YA 3K94A 4GZMA 4JENA 4L50A 4YXWA 5J5AA 1JWBB 4HP8A 2PUFA 2HA5A 4IICA 4C30A 4P4GA 4G4SO 3DE6X 3K1JA 2Q50A 5LDDC 4XTCS 1XZPA 3GZ4A 3N07A 3BXGA 5BPFA 2JRCA 3NIGB 2W2MA 2IYAA 5ETJA 2W7TA 3AFOA 4U63A 1V8FA 3CA8A 2LTAA 1CUVA 3UW3A 1YR7A 2LCQA 5HE8A 4KG7A 3SXUA 2AZMA 4JH0A 4QA9A 1FZTA 1J0BA 1G6Q1 2FR0A 2I2CA 3GF4A 3HCPA 4NOLA 5CXSA 4D9IA 3Q40A 5GONF 1KJZA 4EQ6A 1D04A 4JJ8A 3KWFA 1K4MA 1C7FA 4A23A 3NUZA 5LIPA 1KOGA 3I9V6 1NWCA 2NU7B 2JFHA 1NNSA 1BCRB 5LD2B 1L4HA 2R4TA 3A06A 4MX8A 5HIIA 5SICE 3WADA 3S29A 2GB4A 2I9KA 1YB6A 1MEJA 3E5NA 3ZCUA 4UC0A 4ARCA 2G72A 2NAPA 2PN1A 1VJGA 4OLFA 1NXQA 5ERGB 3SLKA 4DJFC 2H5LA 4PFQA 4RFLA 1XELA 5GOZA 2PH1A 2YHIA 3H9CA 5F9HA 5EIOA 1POWA 1UUFA 1CQXA 4JEHA 1NKTA 1U5CA 1QG6A 4FFLA 3D8RA 1LLCA 3ASYA 3HQ4O 3GNSA 4IAOA 4B3HA 3IC5A 4YT5A 4Z1MD 3EXG2 3RWMB 2EP7A 3UATA 1VHTA 4V0NA 5FOUA 3GJYA 3GMTA 2OO5A 3CWCA 2ALJA 4PHCA 5CNMA 4IHJA 5CT4A 2GPBA 1V1RB 2QZPA 3P2OA 2BR3A 3FLEA 4GD3Q 5DT2A 1JT2A 5A9SB 4KRFA 2FEKA 3L0PA 3MA0A 1EXNA 2NXNA 2ZR8A 3T34A 2OB2A 3Q9UA 1YONA 1WDMA 5LJLA 1QGOA 4HV4A 2AG0A 2HBZA 2GEFA 4GC9A 3VSBA 2O0HA 3EUFA 1K6IA 1WNFA 2C4NA 2PVSA 4LRYA 2BI7A 1N92A 3D7NA 4FMBB 3AM5A 1Q3HA 1A4UA 2ISQA 1A96A 3I5MA 3VPDA 3WG9A 4E6PA 4DMRA 5ADVA 5LIRA 5CUQA 2X5KO 2EBWA 1CUFA 4L7QA 3I8XA 3OFKA 2E3JA 4PR0A 2A2ZA 1TQ2A 5ELMA 2ONCA 2O8EA 4S0ZA 2WV7A 2HXYA 5GGYA 1RLMA 4KH1A 2X3YA 1N9KA 3NH6A 1CZKA 2DCMA 1YVUA 1RVV1 2IC5A 4CE6A 3EPLA 1VL8A 1JXQA 4HDMB 4JUCA 4Z4QA 4DQ0A 1FMTA 2IUEA 3CNQS 1Y5RA 2HEGA 4LC0A 4A7PA 4CF7A 3E03A 4FP9A 2EL9A 1E4EA 5LPNA 3MELA 4WZBE 2IJGX 5K3CA 4MNTA 4R69A 2C2BA 1KHTA 5A5DA 3E8XA 1QZUA 3GFQA 4L5IA 2LDXA 4AAYA 5TVGA 4CEHB 1PV4A 2ECPA 2V45A 4TWBA 1HDEA 2BRUA 2QUJA 1SQSA 2XOEA 3HXTA 4LGMA 1BGWA 3OQHA 4LJ4A 4C4TA 1B7GO 4D9EA 2VWHA 1Z0SA 4NBLA 4AY2A 2ZRJA 5C5CA 1YD7A 1GL9B 2WOJA 1JAXA 1WKCA 2DKNA 1AHIA 2HQBA 2Y05A 3HRKA 4FYIA 4CKXA 1AM4D 5JJBA 2XKKA 1GRRA 1D7OA 1YRLA 2XBUA 4K87A 3V33A 1OHHD 1ZVKA 2EQBA 3C3JA 3PJDA 1VJ0A 4BMXA 5K0JA 3WYNA 2QG6A 1Y1LA 1HE2A 4M9XA 5HPYB 1GGHA 5T8KC 3VQTA 4I5DA 1P1JA 3FPSA 3QKRA 1RAGA 3HVIA 1S7GA 2Z2KA 4TMWA 3BSYA 2CFTA 1I0IA 3IP6A 3EH1A 5KPJA 2XIQA 4UHKA 4GDMA 5FYDA 3S1LA 2E1PA 2W6OA 2GT1A 4BFWA 3FCOA 2CKMA 1KI9A 2IBMA 1S1CA 5F9MA 3JV7A 1J8VA 1S2IA 1GSHA 3PGJA 2IVFA 4G0XA 3ZIUA 1AMUA 1OX5A 5E9QA 2IEYA 2HSJA 5H02A 4L8FA 3QBDA 4H18A 5A5EA 4EB8A 2PNJA 3IUBA 2OCBA 2GH1A 5CLGA 4JGBA 4AKSA 2OBXA 3GEPA 1EDOA 5H4GA 2XMSA 4RJKA 2WD8A 1ORVA 2YIVX 3GDHA 5BN1A 1WD7A 2QTWB 1RBYA 4YUYA 2IITA 1DWUA 1IOVA 2ZAMA 1DZ3A 2QE7A 2FUKA 1Y1KE 2X0NA 4YJ3B 3RUCA 3O84A 1N2CE 4HS9A 5CT8A 1K2WA 2HWKA 2J3QA 1LQ2A 5E2IA 5F35A 2I4RA 4AJHA 2PXHA 4WJLA 1OAOA 4YX9A 1KEWA 2EKBA 4ZYYA 5ARBA 1MVOA 3EZ7A 2BZ0A 2CHQA 2OCGA 3NHPA 3PX2A 4OG2A 5DYIA 2ZQ5A 5ERYA 2PWBA 1WMDA 2C95A 1J99A 1IZYA 5JANA 3WZMA 1KJIA 1WNTA 2OHOA 5FNVF 5K20A 1B2LA 5FWYA 3EVBA 1OU0A 5BSEA 3QF4B 3TLCA 2EFEB 1OAAA 1GPMA 2PQ0A 4LV6A 1DQPA 4E88A 2ZSFA 3L0ZA 3MT8A 4GIBA 1GPAA 4FYWA 4WLVA 4WXRA 1H66A 1R9MA 5C5EA 1DMSA 2PL3A 2MSNA 2DUUA 1T2CA 4D0LB 4TXHA 1XN1A 4WKOA 2IOFA 5DXJA 4FEAA 1NXSA 4JLSA 2V7BA 1E62A 3T3MB 3W5UA 4UQPA 4L15A 2JGFA 3K73O 2UYYA 5IDXA 5ICCA 2QTLA 4X7RA 1UEXC 1QGAA 3H5WA 4LZWA 1CY4A 3D5TA 4FMDB 4BUJA 3EIXA 4HO1X 1HA3A 1MJ5A 2YXNA 1BOFA 4O2AB 3M81A 4RJIA 4JLMA 1ESDA 2ZR7A 1PR1A 2EZ9A 1ZINA 2ZI3A 4OTZA 4UJ5A 5DN9A 3VU9A 4F84A 3CZAA 4P83A 1G4AE 2FJUA 4TWAA 3AI2A 3DMTC 4ZANA 4LF9B 3MERA 5EP2A 2CDCA 5KZMB 4L51A 2AA3A 1REQB 3A10A 2P7HA 5EXEA 2FLWA 2B99A 4R51A 1C9EA 5EMNA 4RH3A 5BT8A 2NZ2A 3GQVA 4LHWA 4BRWA 4YEDA 4Z8YA 2P67A 3GCWA 2PQ6A 4XKJA 1E4OA 4RADA 5JR3A 4F12A 4ZQIA 1Q0PA 4MQ4A 5CD9A 4I4TA 5DW3A 4DIEA 4EI2A 5AVTA 5DV9A 1E9DA 1ZK2A 3EULA 4OI4A 3CEPB 4KIGA 3RYHA 4C78A 1M1YB 3QOFA 1X0VA 2F4NA 4FHZA 5ITVA 4YJ2A 2WKQA 5KOHA 5I6DA 4PPQA 3SJAA 2B61A 2VXBA 1J4AA 1H23A 4RDCA 3W8NA 1W4RA 2WOOA 3HZRA 1E4VA 1HEUA 1GQFA 2ZJ5A 3D6AA 1EVJA 2OV8A 5LXTA 3HUUA 4G65A 2HLNA 2HF2A 5JZ9A 1B16A 3FH0A 2A9OA 4BEBA 4FGLA 2X86A 2XTMA 3DEAA 1XNHA 4P08A 3DPSA 3QXJA 4PR3A 3V8EA 3NASA 1S2LA 4F3YA 5JSZB 3RYCA 5KJEA 2H7YA 2FZCA 4B1FA 3OQMA 3BXHA 2WWYA 2VJBA 1XZMA 4FXPA 4RIFA 1M3SA 2HF9A 5CXQA 3LU1A 5GQSA 4MRVA 2O8VA 2GN4A 3BWCA 3OIUA 5LUAA 5DXFA 4GYJA 4TMXA 4OB8A 1D9ZA 4WEOA 1XZLA 4JP5A 5AK4A 3AO0B 1NYQA 3SIWA 1Y4UA 2J9RA 2QHXA 5FPTA 5BV2P 5ESXA 2DWOA 3ND7A 4LDRA 4QFDA 2DKOA 3PIDA 1CLUA 5KNLA 1Q17A 3B20A 1VSUA 3HYRA 3N0WA 4KXYA 5IEBA 3D8NA 1LDMA 1WUTA 4M0LA 2JIMA 1R4AA 1VBFA 2HXGA 5A3SA 3VVBA 1KQFA 5IVKA 1QF6A 2HV9A 3B1XA 4DR6B 2H2DA 4K88A 5TGDA 5IDVA 1RMTA 4E15A 4DSAA 1DBPA 4GXRA 6REQA 5JNUA 3GJQA 5DLYA 1ISSA 2LR0A 1N0IA 3NUQA 3DE7X 5BNWA 2GAAA 1QP8A 1LRLA 2CNDA 2F7SA 1K6XA 2GYVA 2XTAA 2ZT8A 4L5JA 4MVJA 4P6VF 3TR6A 1ZIXA 4N5HX 3RIEA 1NOKA 2GFQA 5AVXA 1Z4QA 2FMXA 4G5SA 2O54A 3EXIA 2FVYA 1HTWA 3FLMA 4Z49A 1G7CA 1TB4A 2MT9A 1JAYA 2E4YA 2C83A 1DJLA 2I34A 4XJSA 4BNUA 4DRXA 2Q0QA 2IWRA 1GQ2A 4KMSA 1QZXA 3FPHA 3O7MA 3NDBB 5K0CA 1KDVA 4I46A 3CSUA 4RV9A 2CLOB 4ZO8A 2BVNA 5EHQA 2WM2A 4BKOA 2PU7A 2NTEA 4RA9A 1P8AA 1X1QA 2E4UA 1Q7TA 2X2PA 4YLEA 4ENUA 2DPGA 4EY8A 1Y33E 1JA9A 2EG9A 3K7EA 2EBFX 3FVTA 3G0IA 4PYNA 4KVFA 2JLZA 5BT9A 1QOZA 4HVCA 2L42A 5CLLA 3ES9A 2BAGA 2AF4C 4IZHA 4WKNA 5C80A 1P2SA 2CLEB 3UT5A 2R4UA 3B9PA 5BUQA 3HXMA 2QRHA 5F98A 3RU9A 3RHSA 4D82A 5CA0F 3KAKA 4Y2TA 1SBTA 3PGMA 5E6UB 2B6HA 2V03A 5HHTA 1HRKA 5AVSA 1ZLXA 1RRCA 1A82A 3LZCA 4ZEXA 1D1SA 2HXSA 1E79D 1TU4A 3EODA 3LW7A 2RGCA 5TEVA 3EIWA 4J0FA 4LF7B 2FR8A 1N6HA 1KZHA 2HNAA 1U8TA 4M8LA 2F00A 4RC9A 2H2WA 3IALA 4M1YA 3A6FA 1B26A 1D4FA 2FFAA 4IDNA 3K9QO 1TT5A 4HAYA 3DR3A 4MW7A 1U9IA 3QTBA 3UZUA 4BTVA 1XZEA 5I7SA 4LFBB 1TCUA 4ZU1X 3RFVA 4Q9KA 3X2EA 5LNK1 1DRWA 5C46F 3JR7A 1X94A 2DMRA 3ROGA 4V1CA 5KPDA 2DBRA 1O6GA 2O0KA 3OJCA 4AJ4A 5A5FA 3FYSA 1A2OA 3AY7A 1CS0A 1I10A 3D43A 2GBPA 2YQZA 3V8QA 4L85A 4D43A 5CRIA 3E9MA 3QLEA 3MWDB 4QREA 3I5UA 3UWPA 5K8UA 1KEEA 2HD4A 3C3DA 2CJWA 1WXIA 1HZZA 2RHBA 1VL2A 1MZPA 5AVUA 1M6EX 2K5UA 2AR9A 1EXVA 3BS4A 4BWVA 2NIPA 3VHXA 2I8CA 3L40A 1M9NA 2A59A 1R9JA 3D8SA 3I5AA 3ZQ6A 5K0EA 4YS6A 1ZBQA 4B83A 3GUUA 3HFGA 3GLFB 2X9GA 1WXWA 3ETJA 2ECQA 2PFSA 4JUIA 4KVZA 5CG2A 3PV0A 4ZU6X 2X8WA 4YCDA 2HGZA 2IEDA 5KNDA 2IXFA 2AI3A 3FD8A 5JCOA 1EP9A 5BVGA 4AZ0A 1GPH1 1OFUA 4WFJA 1HNXB 3OE7D 1UODA 3BKXA 1CR2A 5CPBA 4D44A 2Q46A 4TLEA 4F4FA 1SVLA 1W2WB 4HUJA 4UULA 2AVDA 1I01A 4RY9A 2H0RA 3ZOZA 1AK1A 2R48A 2Z2YA 4RK6A 4YPVA 1SHUX 3EC1A 1BAPA 1X7HA 3AR4A 1R5BA 3OPNA 3V1NA 5D7NA 4CM4B 2O5CA 5E9JA 3EIUA 3KJIA 5JWRA 2CLMB 1NASA 3WYGA 4EJ0A 1DTEA 3OEWA 1RPNA 3D0RA 2GEKA 1HE8B 3DB1A 4B6EA 1PJSA 5AWFC 1KI1A 1P39A 1V4NA 4QXAA 2DLNA 3SXJA 1PZFA 4MKHA 2H54A 3GFRA 4FE3A 3X2SA 4BBAA 1L5ZA 1W6RA 2ZUEA 3RPEA 3LECA 3OC6A 1QS0A 5T4HA 4IM7A 3I9MA 1IB6A 2AXEA 3VX3A 3LYAA 4CIDA 2R7LA 2O0MA 2ON6A 1J1UA 2YJ3A 2FP3A 1FLVA 4IIVA 1O0SA 1VL5A 1RYBA 1KC1A 2AHRA 4LDQA 1GCGA 1PDOA 1BSVA 2ACKA 2B82A 5DGIA 3ROQA 4LOKA 3W5DA 1M2EA 5MN6A 1DADA 1WMSA 3ENVA 2HIGA 2WYUA 3U3RA 4ROTA 1T25A 2H2GA 4KDCA 1U5BB 3WLFA 1VKZA 4LE2A 3TEMA 1HFWA 1TEZA 4F45A 2HPHA 3EIHA 2KQUA 4F2HA 1VGQA 1BX3A 2WFLB 5A9RA 1QO9A 1CQIA 5CJ2A 1E2JA 3EX7C 4BO5A 1MH1A 2QJOA 1NKVA 1P7CA 3KJNA 2GN9A 4IJ5A 1WQ4A 1S2MA 4TL7A 2FWBA 2J32A 5JSHA 3HTXA 4HDNA 1J9GA 1Z88A 1ZFNA 4ETMA 1E9CA 4D4GA 1W1WA 1FSZA 4BZPA 1RPZA 5AJYA 2GHRA 2I6UA 4XSVA 3UJ3X 2ZIUB 2RGDA 3KHSA 2P4SA 2OO5C 2A0YA 4K6MA 4QGGA 4LXIA 2H63A 1J8YF 3RYFA 1MQAA 2WTXA 3ANNA 1GPLA 4D0NA 1MJFA 4J4TA 1J22A 1C7QA 5JAQA 3HL0A 1DZIA 4DCUA 4Q1VA 3E7FA 2ZWOA 1HE5A 2HQOA 3SAJA 4M9QA 3IBGA 4LQCA 1YFJA 5KSWB 2C8JA 1T2AA 1HQCA 1Y6GA 4HAVA 3S2UA 3U44A 5CK5A 5KYTA 1XRSB 4AO7A 8ABPA 5B58C 1Z6AA 4PGHA 1VBKA 1JFFA 1CDZA 2QX6A 4HNVA 1BGVA 2ZRAA 3TQQA 3JPWA 1LK5A 2GJ4A 1I32A 1OGJA 1C7IA 4EA6A 3AESB 2WINI 2Z30A 2WWVD 3ER9A 1IQUA 1RQ7A 1Z3CA 3L7MA 2WAOA 5JXHA 1UBUS 3E7DA 4KR0A 2YTZA 5C7YA 1XVLA 3EBOA 4IEEA 1PBTA 2AWOA 3N28A 5DRYA 1CZRA 1QAMA 2CSUA 3W78A 4DJDC 5C52B 9MHTA 1H2EA 1XYVA 1HLGA 4L1KA 4NS1A 3VHQA 2G1KA 1XMJA 4R98A 4Q37A 4IIJA 4IVNA 5AKZA 4B3IA 2YZGA 1A76A 4ZZIA 1E1CA 1RHQA 2YYZA 4QVKA 1V25A 4ZQFA 3I28A 1NQUA 4B34A 4IMJB 4KK3A 4CLEA 1NZDA 3CR7A 2A0WA 5IW8A 3VH3A 4A26A 5LLDA 3UHFA 1ZI8A 4I4CA 2PSDA 4TTVA 1T2DA 2J9XB 5K6AA 1E3MA 4MUMA 1XYYA 2LW7A 3FYTA 3N76A 1MAVA 1SUFA 2ET6A 2R65A 2C3UA 1SQ6A 5IBPA 3T7CA 4A0QA 2JAOA 4P0TA 4KN6A 5JAIA 1O4WA 2BMJA 4PZAA 3R3SA 4OL9A 1R88A 5EJ2A 2EHJA 1QP7A 5IMBA 1C4WA 2RI0A 4B87A 4C5AA 1PFQA 5EZYA 4QYIA 1LPBB 4ZOLF 1H69A 1PNOA 1FNSA 1QO7A 3WXBA 1P5ZB 3ZDFA 2PANA 4RPKA 2QX8A 3NBMA 1WOYA 3KQNA 1Q1BA 5YASA 3FAZA 2II6A 2W90A 1P0PA 2ZWMA 1XROA 4PIPA 5CPFA 4E5SA 3K0FA 3SJUA 2I2WA 7MHTA 1UJ5A 5ALMA 4KWIA 4OBBA 5EJFA 1T34A 1J1IA 4FS3A 1BA3A 1A77A 1LNSA 2B94A 3HFRA 3O26A 3GIWA 3OFNA 4AMZA 3C1TA 3JYPA 4ZYXA 3IAS6 1HQYE 4H0FA 4N0PA 3HYCA 5SZJA 3G0GA 2EIXA 2JG3A 1ZOPA 1JLSA 2X8LA 1QM5A 4RZSA 2AW5A 2Z3ZA 4LXYA 4OHFA 5JSUA 3TNYA 3VV3A 3HSKA 1XV5A 1NW7A 2CVOA 2GBFA 4HUTA 5A3JA 1LSSA 1NXVA 5JTTA 4YUVA 1V3UA 4WLNA 1PSDA 1OAOC 2HF8A 3E5RA 1MW9X 4XGKA 2AR0A 4XVUA 3CVOA 3GVIA 5DTJA 2Q3JA 3BPSA 2RB5A 4URUR 4Y30A 5G4KA 3RF6A 2HJGA 5AI6A 3WL4A 4BNGA 1QIFA 1FMJA 1NUPA 2ZB7A 3TG2A 1A8SA 1SBHA 2WF8A 2W2NA 2JI8A 3NWBA 4FDVA 4WUTA 3L7KA 1EK0A 4F7WA 1N6PA 2YY5A 2VP6A 1VIYA 3QPBA 1Y9DA 4JDPA 4BZQA 4LZOA 3Q1LA 3F74A 4G1MB 4LYDA 2VDQB 2CNNA 1QRUA 1VTKA 3FOEC 1I51A 1G5QA 4DUPA 2EW1A 2XUOA 2Y6UA 2WJZB 4LIPD 4RL4A 4XM1A 3X1DA 1ANKA 4F5ZA 4KE7A 2XNHA 2VPXA 3JD0A 3PD0A 4Y2GA 3HG7A 3MUNA 1YC5A 1KYVA 4F93B 2PZMA 4F5WA 2VF7A 3GFVA 1J2TA 1A9PA 2WZDA 2XXBA 4OHCA 2VZLA 4M7OA 3MF4A 4BTEA 2BFEA 2B2NA 2JFPA 5IKOA 3P4UA 4MVJG 5TNXA 4A73A 5AJXA 4ZKEA 4NBTA 4XWGA 2B8WA 4MO2A 4QPNA 2XA1A 2UUBB 1AUOA 1SXJA 5FPQA 1NMZA 2Q7DA 1AQIA 1GZ6A 1EEHA 1VLLA 4MYCA 1OXUA 2PWAA 5LM3A 4S0XA 1X14A 2C3OA 1I1NA 1EDEA 1ISIA 2FSHA 4U9IS 4UXJA 3WKEA 5AM0A 3TR0A 1JDTA 3GT3A 5KYYA 1VI6A 4YT4A 5GTDA 4TVKA 4FR0A 8MHTA 1CY2A 2PKWA 1DWPA 2ZPUA 1U5AA 2CZGA 3FRIA 1HE1C 4MH0R 1IOWA 5CJPA 4DWWA 4NBVA 1PNVA 4YWHA 4JD5A 3H2SA 3AEUA 1CY0A 2NT3A 2W6ID 4PF1A 4V2UA 5TX7A 3TQSA 4ZGWA 1A9XA 1CUGA 1MO6A 3KT6A 3O2QB 1EUYA 1ZR4A 1P44A 3DCNA 3QXCA 4PNEA 3T7EA 5CEJA 3TTUA 2NTVA 3OE5A 2INGX 4BAUA 1MABA 4FOPA 2JCYA 4TM7A 3U7IA 1DS6A 2XAAA 1KH3A 3JQ7B 3VI3B 4HUQB 4OO3A 3LC1O 2X2EA 2HM7A 4MCJA 2R7MA 3QY0A 2RC6A 3FMFA 4KR2A 1OIWA 4KFUA 1SMKA 1ECCA 5HGXA 3B48A 5EJIA 1E69A 2J31A 2MJLA 4YV2A 4BKUA 4PRLA 4TSFD 1ID8A 2IHZA 2VDNB 3DZJA 5LQDA 4LXQA 2P3OA 4OATA 3K72B 1U0SY 2BSXA 1QANA 1QHYA 1R18A 1ZD8A 2QTZA 2YFHA 3BFPA 4EATA 4QATA 3R5SA 4EDFA 1RJ9A 1OWNA 3HWX1 4MUIA 3AP3A 1M54A 1R64A 1KYZA 1C30B 2ZIGA 1T9ZA 3BF7A 3I6IA 3BZBA 1PAUA 3VV2A 3PDJA 1L8LA 5DISB 3NCTA 5I9BA 3U5ZB 2MSEB 1FX0B 3RW9A 4BV8A 1IRXA 4BN4A 3PGVA 1B8OA 4JUAA 1BD4A 3UWDA 3S2EA 4GM4A 4WN9A 4J75A 4JEIA 1CIPA 1Y3IA 1RPTA 1BFDA 2Z04A 4GQIA 1JHYA 3ROTA 1JR4A 1BFUA 3THOA 4D8XA 1KVTA 4KUHA 3BSFA 4D4HA 4LYAA 4FDMA 1ECLA 3RIMA 5DFAA 2JA2A 1WXXA 4CT5A 5TIIA 3S2GA 4F91B 1GG5A 1P7ZA 4BMCA 5LMCA 3WGTA 5KTPA 3LT1A 3F5QA 1VBMA 4JC0A 5EN4A 2ECFA 5JS8A 4ETNA 1FB5A 2YS6A 1XU4A 1LLFA 4FD2A 2C96A 1YDEA 3B1ZA 3VPHA 5CXUA 8OHMA 2BCEA 1ODKA 2JANA 3WV4A 2XB2A 1TYCA 3V9AA 4DLUA 4J94A 4E1BA 3O3MB 2QWXA 4O4JA 4LYFA 3ITKA 2OV3A 4UTOA 4CKCB 1MZVA 1K3FA 1K7SN 4AKIA 4RY0A 5EKUA 4PHGA 4J1QA 5LWQA 2HDNB 2JLXA 4QE3A 3H3JA 5AKGA 1A98A 3R3XA 1DCTA 3FZQA 4F9GA 2QP4A 2YJ6A 1N2HA 2Z4TA 4J07A 5EUMA 3HWSA 5TDHA 1ICIA 2NU9B 1D3AA 4PW0A 4DPKA 1C29B 2FR8C 2FPIB 5L95A 3T3OA 3OUTA 1ENZA 1FFXA 2G8NA 3IFSA 3KAPA 1ZIOA 4HJXA 3K0EA 5C18A 1OAKA 3CX3A 3A05A 1CT9A 1DUVG 3NBQA 4DHWA 4EYKA 1YKSA 4Q4AA 1AQNA 5EL0A 3OQOA 4KMOA 4UCQA 1U7TA 1U9IC 2DFDA 3WVNA 1R74A 2HTEA 5ARDA 3FF4A 4EI9A 1E64A 1IBSA 3H97A 2F4VB 2O06A 4U02A 1D6MA 5FUXA 5CB4A 1RRFA 1AURA 2X5OA 3GAAA 1GAJA 1HEYA 1LRKA 2QSYA 5DX8A 3GP3A 1FFBA 3MUFA 4GNRA 3W2IA 3ZWKA 5JFOA 5DM60 3QVJA 5EFOA 1BRTA 1HYHA 1TF2A 1Z0DA 3F6EX 4DV0B 3R4CA 2QLMA 3DO6A 4ALLA 2ZM6B 1V8BA 5ELXA 2PTGA 5E0KB 2AEJA 3L8MA 5CB0A 3C6BA 2H57A 5DEIA 2WIKA 2ZJYA 2DY0A 3S40A 3SQDA 1YZ3A 4LQDA 2POQX 4P22A 4WOBA 4D45A 4LDPA 4YCCA 2JA1A 3COPA 3FWYA 3IA7A 3VZRA 1OC2A 1U80A 2BFNA 2PLFA 3JPYA 3NC1C 1R6TA 5AKHA 2IPXA 1RHJA 2Z5LA 3NTQA 2L19A 3EW7A 4LMPA 5FNZA 5B5SA 1KQGA 1NLZA 2YICA 2NO0A 1DG3A 1OKKD 4IIHA 3K0KA 3M2PA 5JCOC 3O4RA 4WZZA 3UB3A 5HUJA 4G9BA 3ZDQA 1CQJA 3SHOA 5DJ5A 4IRXA 4ERXA 4ZJYA 4RK7A 5MFZA 3P8ZA 3PTLA 1V11A 2ZJAA 2RGBA 3GROA 3OCXA 3H7IA 2DT8A 3VR0A 4CM3A 1WY5A 5JH7F 4JLPA 5HIKA 2X13A 2JFZA 1GU0A 1MX3A 2FUG6 2PFGA 3I39X 5D3ZA 3VX4A 3W9BA 2EEZA 2XMCA 4UOZA 1ZG3A 2Y92A 3WLTA 3PUHA 2PGJA 1NR5A 5L6LB 1FP4B 1GDDA 1SCDA 1JIXA 1S96A 1BCSA 2FJ0A 4MRMA 3UAYA 2E4VA 4E2ZA 1CQZA 2H52A 2ZJ2A 3N2IA 2G9NA 1AV6A 2IUSA 5CEFA 1FYWA 1IVYA 1KFJB 1QOQB 4CMGA 1QBGA 1WU8A 4EELA 4HWRA 1KSFX 1F6WA 3IMCA 1WIWA 1BE0A 3MXOA 4XARA 3MN1A 4KVAA 4J0IA 3X3HA 4ZYZA 5KJ1A 1QWOA 3WK8A 1CP3A 3RQSA 2A1UB 3I4FA 1XCLA 4F1KA 4DCGA 2A0KA 2F1JA 4D9FA 5B53A 4DIFA 3C8HA 3QHQA 4DA9A 1MNAA 2X7HA 3DLHA 2HUNA 2OQ2A 4KI0A 4CCAA 1UMBA 4LRQA 4QOJA 1GUDA 1IBCA 5A9TA 4ATNA 1H4TA 2AMVA 2QLLA 4LCEA 4EZBA 2IEIA 5I3ZA 4ZTUB 3BMNB 3WTBA 4DARA 1XUOA 1AU9A 5ITWA 3P20A 4CM1A 4D7AA 3CN9A 3SQWA 3T54A 4JLJA 4DC1A 3D6FA 1EFPA 2ZPAA 1XRJA 2CZQA 4TUYA 2IZ0A 3HVRA 3M6IA 3ISVA 3BMOB 3U7GA 4J0GA 4ZA2A 1BXGB 4L78A 2R5WA 3BWDD 1X7ZA 4ZQHA 1X38A 4L3WA 1A50B 3A4YA 1IWPB 2I6QA 3IEIA 4DKXA 4I81A 3KB6A 2CHVA 3RT7A 4E2WA 4DMFA 3GZNB 3BORA 1XJWA 4EG1A 2ZT7A 3PXUA 4CFZA 2PBZA 4ZP1A 1ZOLA 4QD3A 5PGMA 2JAWA 4NMLA 5JWHA 3M83A 4AURA 4ZAXA 1GZHB 3JQBA 1E3EA 4BC1A 2MYUA 3TIGA 1A2KC 3KJEA 3LKBA 2AC2A 4X3CA 4ARZB 2B4RO 1HZJA 4FONA 4AY6A 2QUAA 4DQKA 2XA9A 2QVXX 1O96A 3O9ZA 4LFCB 3U81A 4BMOB 3KFLA 2PUBA 1B0AA 1KTVA 3V97A 3T7AA 3KQTA 4D4KA 4QPPA 5JQGB 1OXBB 1NATA 4BNZA 2O6LA 1T6NA 1PYGA 3W6OA 4A5OA 5AI8A 3NM6B 4URYR 4S04A 4FEYA 1XTBA 3KQWA 3C98A 1G5RA 1K98A 3LWDA 2X9LA 3Q2OA 1T6XA 4KQJA 4KW7A 2W8BA 1XNGA 3W2GA 3T4PA 3WLOA 2IYUA 1XDSA 3FZNA 3ZV7A 1Y3HA 4XGNA 3T5TA 3QLVA 4GM1A 2A0UA 3PRJA 1KTIA 1BS9A 1QJCA 3WLLA 3DGFC 1U3CA 3W06A 1AK9A 4ND8B 5KVAA 2ZCVA 4H1UA 1E1DA 3KQHA 1V1MB 1FFYA 2AC7A 2BBOA 5DWQA 3NATA 4HDSB 4IG4A 2I2DA 3LDHA 2XGMA 4ZQCB 5IZCA 4L75A 2ANCA 3FUTA 2RHCA 2FPPB 4KX5A 4J76A 1Q0UA 3PQEA 2WJIA 2I5PO 4GP7A 3A3YA 4QDXA 3WMXA 3VOTA 1V3QE 2FSFA 2B83A 3AQ4A 1EJ6A 4OQDA 3UCFA 3P2JA 1F2UB 5ICGA 1QH1B 5JSQA 1KJJA 2EJBA 4CUKA 3LFUA 4DLYA 3C70A 2YQ4A 3JZAA 3LQKA 4IWXA 5F9FA 1S9HA 4TWRA 3ZWMA 4FVTA 1NNEA 4L0QA 4YRKA 4P0PB 3VJMA 3TTVA 2GCNA 1ZWKA 3LWZA 3U4CA 2NYRA 2DBQA 1VSVA 2OHJA 3FLBA 4KWCA 4PSVA 1XJQA 1ZJYA 5GJCA 1Z75A 2I76A 1JE1A 5CFPA 1PEKE 1SC1A 3TF5A 1T3TA 3I9OA 3MOSA 2QVGA 2NP6A 3WGKA 3FDZA 4ZOQI 4HEA6 5E1MA 4MGIR 2FWRA 3UMBA 3AHEA 4YR9A 5FR1A 1SZCA 3PS9A 1CDOA 3DBHB 4D5GA 2FW7A 3OICA 2GHQA 4KQIA 4NYMR 2BSQA 4BZZA 4FE7A 5K0LA 5THQA 2PVPA 2KS6A 3PFWO 4LBZA 4WDQA 5CA1F 3I5YA 1S3GA 1L8QA 1RSZA 1W34A 1QHHB 2CDBA 4V3CA 3W90A 3QWBA 2XMGA 2F9LA 1RXEA 3GNQA 1A69A 5FWDA 5BSRA 1V39A 4UU7A 3QU4A 1ZBDA 3EDRA 3FPLA 2ZRIA 3VNRA 3PPWA 4WOCA 5JTUA 1JIUA 1RQLA 1XXLA 4TOIA 1B4DA 2WFMA 3IDOA 3KS9A 3SYKA 1XB2A 1JHRA 1MNQA 3A1CA 2P40A 4J0CA 3PNPA 3DP9A 4EW1A 3PRHA 2RHDA 1T91A 5HM6A 1I30A 4RLHA 4ACAA 1PWYE 1JKFA 1M1NA 2LNDA 3C4VA 4B80A 1FNDA 4OV6B 3G02A 3ZGOA 4JSYA 1Y4ZA 4QBGB 5I4CA 3ZDBA 4DXAA 3M0EA 4RPJA 5C8DA 4UTRA 4Z7OB 4X6YA 4H1TA 3EWNA 1N2CB 4L57A 1KO7A 3B9BA 3QWAA 3JAKB 4GGPA 5EQDA 4ERNA 1I94B 3CLUD 2IV3A 1N9GB 3OQBA 3BF8A 4KEAA 5TT1A 3E8MA 2AUTA 3DULA 4FLMA 4FZ5A 2KE5A 5AYVA 3PQ5A 4PHHA 3H65A 4ZVNA 1Z8HA 2C1XA 3UJPA 1M2WA 3KSZO 3OAAA 4L5YA 4O6VA 1DJPA 2WYHA 3QOWA 4NJOA 2P91A 3KV3O 4OXIA 5G1NA 3TLAA 1JV2B 5FO0A 5M29A 2FMHA 5C7LO 1N6NA 3ON5A 2DFPA 3BERA 3NHRA 4LRWA 1U0FA 4MARA 2V6BA 1WBDA 2ZBVA 1X39A 2ZITA 1MOZA 3JSXA 3MRVA 1KAHA 2C5HA 1RLIA 3ESRA 3T5CA 2WB2A 4ZCLA 3DWGA 3MPUA 5EPEA 4Q00A 4BX8A 5KWIA 1POXA 3C8DA 4M21A 1QE5A 4RH0A 3HDQA 1TXGA 1NVGA 3PPYA 2YZMA 2YASA 2HDWA 1SXJC 4FYVA 1P1RA 4S1OA 4AUNA 3DC2A 2H8GA 3WY9A 2IIQA 2C9YA 3CLTC 4IDHA 4RE5A 4BO4A 1BOOA 1X3LA 1R1DA 2OBBA 4XR9A 1P3DA 2OPBA 3AR7A 4K8RB 5TMEA 5SV2A 1ESCA 3GLGA 1JHDA 1YCGA 3AZOA 3PPXA 2VTKA 4OFWA 4PZCA 4R2IA 3VPXA 1W48A 3VR3A 1QPZA 1GNLA 3OBBA 1MO3A 2VBIA 3HI4A 3U09A 3C7DB 3SJCA 3A2LA 4IMRA 5IJ0B 4DUGD 1ZM2A 2DQZA 3O8LA 2QSUA 3DE5X 3DMDA 4LK2A 4CMIB 3EGDB 1ZX1A 3L1VA 1GUYA 5AVKA 1I4TD 1C3OA 1MB2A 4MITA 3PCXA 3D81A 3E61A 3OJFA 4HNTA 4QUJA 3DXFA 5EE1A 4JYMA 1A9QA 2XB4A 3LKVA 5EIXA 3NHYA 3DFUA 4P9NA 4TKUB 4AG6A 4N9WA 2PJZA 4Q9AA 4Q66C 3PEWA 1WZ2A 2V59A 1CLEA 4MS1B 4P53A 1SCKA 1YRQA 1X70A 2X0FA 4EITA 4HDAA 1FYFA 4E70A 3CTPA 3M4JA 2D0DA 4XTRA 4BQOA 3U4MA 3RUIA 3TM5A 3RVLA 2ZM5A 2PZKA 2J5RA 5K6RA 4DG5A 4DV3B 3DD5A 2LP4Y 4PZYA 1GD1O 4RZHA 4Q12A 2C04A 4KRYA 3BJEA 2I8LA 2B4QA 2BEVB 4KDRA 4WHMA 2IHTA 1LTHR 4P7GA 4A2CA 2QZSA 1Z5UA 3OCZA 1LSJA 1WF3A 3AETA 2IS1A 3FIUA 3H4IA 1XL0A 1DELA 2E5FA 1URPA 1HG0A 3LOPA 5ENVA 1YNSA 2ES4A 2P9QA 2RGYA 3ZXYA 1ELOA 5JW6A 3ESCA 5FTWA 2GDJA 3ET4A 1P9LA 2GAJA 2P3SA 4OI2A 3SKXA 1E60A 1ZMOA 4CIYA 5BR4A 3FOZA 4AG3A 4NOMA 4ZJPA 1MOSA 3OM8A 3TRDA 1N6LA 1NBHA 3FBWA 1FFDA 1K75A 1ACJA 4TLAA 1NMSA 3KXKA 3RCBA 4L8VA 1I1OA 3LNTA 2GD1O 2CFIA 4OU4A 4B0PA 1MX9A 1PWEA 3TH5A 4MPRA 4IOMA 3KZXA 4CQLB 5EXDA 1AGPA 2BBTA 3OSZA 3SR4A 2BUCA 2G63A 3FYUB 3M8KA 3DDWA 2VAWA 2IY9A 1C4KA 4X20A 1WKVA 1Z17A 1DQSA 3S0JA 4D74A 2GYWA 4F5EA 3BXOA 5ALDA 3ZZTA 1QKJA 5F76A 2O5RA 3DO5A 4TXJA 3PWTA 4OVKA 3BA6A 2ZE8A 1FRFS 1M2JA 1S9DA 3D3NA 4GP9A 5CBPA 1LW7A 3IGFA 5HTOA 5HWSA 1OASA 4DY4A 1QDLB 1ZK4A 2UZ4A 4DUYB 1PJ4A 1PUIA 3NNSA 2FZGA 3KSBC 4BY9E 2P2SA 3FOBA 2N1BA 3VAYA 1E9EA 4WTOA 4RTMA 1L5SA 3Q8KA 1WHSA 5TQ2B 4QLBA 2ZBEA 3CKKA 3LCMA 4RTNA 5IKPA 1GARA 3TG8A 4XQ0A 2FZ5A 1Y9AA 4QPZA 4ZCRA 4EO4A 1XAGA 1WRBA 3IO5A 1XDBA 3NM5A 3RI3A 3VVMA 3I05A 4AJLA 1L4MA 5HIMA 1UOEA 2Q3BA 2QG4A 3NHLA 4EFNA 5CDGA 1H5NA 3MJSA 5EWMA 2VYVD 1RS0A 1WCYA 5TMBA 2GHIA 2OO3A 4K0KB 1IU9A 1ACLA 1T43A 4QPCA 1HDXA 2BR5A 2HRBA 4JBYA 1PLKA 1TUGA 5IM5A 4ESVA 4FFBB 5DU2A 4QGAA 1VRWA 1I2CA 2C2GA 4LZNA 5LL6P 1GQSA 4J3FA 4D8WA 3RS4A 4BYMA 3U1BA 2QRPA 2TMKA 4I1UA 4BFTA 1USIA 1X7DA 3H5LA 3KDAA 4DRYA 2EOAA 2GCEA 2YYSA 3X43A 4EHIA 2I6XA 1EGVB 3K15A 3TAXA 5JXGA 2AFHE 3HDYA 3KKEA 4YCMA 1TQ8A 4B32A 4V24A 1DIAA 3MTDA 1QZ3A 4J91A 5A1TA 2EKPA 3CT4A 3WL3A 4BBPA 4OQLA 2HO5A 1NU8A 3ICPA 1Z4IA 1R0RE 3AEKB 2I22A 3M6AA 1Q14A 2VDWA 4NAHA 2BM1A 4OP3A 3KT8A 4Z9AA 2Z57A 2NUPA 4BLVA 5J43A 1ZCFA 4DF3A 5C5IA 3SHTA 4YRNA 3F71A 3E9RA 2AV6A 3C7KA 2A7QA 1XXHE 4QQ8A 3LUGA 5EJGA 3D3WB 3L8GA 3OF3A 1VL6A 1GZ7A 2OCAA 5HGJA 4CLRA 5C81A 1AD2A 3EN0A 2NYVA 2PX4A 3GW8A 3RHTA 1RKVA 3QK7A 3KPWA 4B45A 1OFUX 3DYIA 4C05A 1HM5A 1CNFA 1UWLA 3CG0A 3NTLA 3QHAA 4MR8B 4OL0A 4TTSA 2R6JA 3VKHA 2PHZA 3E48A 1A1VA 1RDFA 1ZZEA 1PJZA 2Q41A 3ZZMA 4BO2A 1X1CA 4GFDA 3OLXA 4KO3S 3NBYC 1KEPA 1AGXA 4KWHA 5CLIA 1VG0B 4M8KA 1U2QA 2GK4A 4EG7A 2B6NA 4HADA 5KUTA 2Z4RA 3Q7TA 5IABA 3QU5A 2HK8A 3NANA 1YE8A 3W1EA 5K8IA 4MYDA 1VYTA 2PT5A 5ICSA 4G4SP 2QTGA 4BNFA 1Z4NA 2CXOA 2GYUA 3I30X 4XUEA 2QUBA 2ZTHA 2XUJA 2BGKA 4AL4A 3BK7A 3FE2A 3X1JA 2R4QA 4EGAA 2V7WA 3K9FC 2WVAA 1X7GA 3MINB 1GG8A 2X0IA 4LF5B 1AKUA 5ANRB 2XKJE 3BMQA 1II8A 4C0JA 5IJAA 5KHAA 1KVSA 4KQ2A 4AS3A 3PHBE 4FFDA 2WZBA 1Y42X 4N8DA 6YASA 3C5WP 4Y3UA 4EB6A 4GWLA 3UJNA 1U8AA 2XDAA 4KXFB 4WESB 2ATVA 1SB8A 1XVUA 1XTTA 4KN8A 1B8VA 2CL5A 4BHTA 4BDTA 2RGNA 3DVLA 5GOTA 4GSKA 1CKEA 3T0GA 5L3QB 2O8EB 4DUZB 4ZCPA 5DHRA 5IKEA 2I80A 1NC1A 2XDQB 1SKYE 1G8MA 1WR8A 1ESZA 2REQB 4UTZA 1WEKA 3UPTA 2J9YB 1V3TA 2J5XA 4JQCA 1MOQA 4BEJA 4D97A 3ENKA 1IUKA 2JCGA 4MPTA 2X1LA 2CYAA 1KFKB 4N54A 2AZXA 1QG2A 2FLKA 4MAFA 3GPIA 1I1QB 1KEVA 1KJNA 1LBIA 2FUNB 2XVZA 3H2GA 3HUDA 3JQBC 4Q4JA 1ADGA 4JK3A 4WLOA 1TTHA 5FD8A 1IXZA 3W5BA 5THKA 3LP5A 1PT9A 4F6RB 3AKYA 4ZVKA 5KNBD 4D8TA 4TLCA 5JAHA 2ZIWB 5T64A 4P0QB 4ZT4A 4G23A 1P2GA 1A7UA 2HLDD 2BE9A 3EMBA 1CUJA 1H2ZA 4AFNA 1HQDA 4YT8A 3ETGA 1P33A 5JV5A 2J48A 3HR7A 1ENYA 3R9XA 1Y48E 3M9WA 1JDSA 3D4LA 2FU5C 1DAKA 1EBBA 4RVGA 5F77A 3HA2A 3SZRA 2F17A 1J2JA 3WL7A 1ILEA 3A4TA 3DGEC 3V4OA 3SIPA 3ID6C 3UHPA 1U3UA 1Q50A 3IT2A 3URMA 3JALB 5JMWA 1KXZA 1X9GA 3IKVA 1CYEA 1GTJ1 4LSGA 3GJ7A 4ZTBA 4HFJA 2CNKA 3L82B 4UCXA 1WCWA 3QXXA 3D3QA 3QPWA 4HTAA 5KYUA 2JJQA 1MQ8B 4TS3A 4Y2PA 1BU5A 4J0KA 3VR1A 1NJ2A 4HYYA 2XKBA 1P4JA 5AI0A 1PZXA 1AK2A 1TYEB 4O3FA 4Y1GA 4ZXPA 5HFAA 1Z7EA 2HUPA 3A70A 1JVNA 3DEHA 5I8ZA 3RABA 2P9YA 3U26A 2OHIA 4M87A 1WSBA 4DTCA 1E63A 2HPVA 3BVPA 3AGQA 3NHWA 4F3CA 2FPUA 4QU9A 4W5NA 2AJLI 5FOQA 1RAFA 2BFBA 4C87A 2PCJA 5DIZA 1H3EA 3AL0C 2Z5FA 4U6QA 5DVZA 1O9HA 4H15A 1A8IA 4C1BA 4Q82A 4XX0A 4E13A 1VYVA 2BKEA 2C84A 1Z2PX 4OY3A 2IY8A 3KZVA 4G07A 4UNNA 4D9BA 5JADA 3SM9A 1B42A 4IINA 3RUEA 5MF6A 2FVXA 2GESA 1YRAA 3JVEA 4XB6B 5I9IA 1ZRNA 4CFSA 2VEOA 1I3LA 4WJKB 2WUDA 3W79A 4FILA 4AJ9A 3Q98A 5COBA 3VU8A 3F1KA 3AXSA 1PJQA 1SD2A 3NHUA 2HH9A 3E3NA 3ORRA 1TM7E 4FYKA 5DK4A 3WGHA 3MAGA 1DU4A 3CCCA 4H1VA 3T7TA 1DOZA 1R9GA 1RMQA 2B4AA 2XADA 4RFSA 4UDOA 3BCHA 1QZTA 3KYDB 1CDEA 1DPFA 1AHHA 1JLLB 1R0WA 4I19A 4ZRDA 2EZ8A 1PR2A 2R11A 2NPFA 2Q3FA 5M34A 1XT6A 1JG1A 1ADYA 1YJAA 3G0DA 4IDBA 1VXRA 1NUSA 3KPJA 4DLVA 4IIXA 3ZHYA 4NS4A 1RZ3A 1FVXA 3UJHA 3C3EA 3OQ6A 1RXSA 2W2VA 3KBOA 2DHRA 4F4JA 4M3NA 3CIFA 4FDUA 4GL2A 2F3PA 5ALLA 4WL0A 3E8SA 1V26A 3ME5A 4HVAA 3VDNB 3WQHA 3AHCA 1A4XA 4QGSA 5H3CA 4J2TA 4QT4A 4K7JA 3D59A 1T5TA 1H8EA 1XFDA 3DZIA 3F3MA 2C8KA 2J0VA 1ODLA 4GBJA 3WGIA 2BHRA 1BMFA 2J3JA 2ZUCA 1R6DA 1XK6A 3U7QB 4Z4EA 1U8XX 2WHQA 3OZIA 3QH4A 1IUNA 4K3UA 2RH4A 2D1RA 3K8QA 5H3HA 3EPHA 1D03A 4R01A 2MCFA 3WAKA 3DM5A 3FHLA 3AJEA 1NZFA 4G3XA 4EG3A 1YI8A 2SCUA 3MZ0A 1G3MA 4KODA 1UFQA 1BXRA 1BX0A 3D02A 2JJ2D 4F4IA 3D7RA 4W5QA 3G7UA 2ZYDA 1Z0IA 4NCKA 4C03A 1UK9A 1L9KA 4BNDB 3HS3A 4DLBA 1TLTA 3KD2A 4WECA 3QM1A 2O1SA 4X1YB 1FBNA 3GBPA 3OECA 3HDTA 3RGWS 1PV1A 3MTGA 1ADFA 3V6MA 3UT6A 2GILA 2DLDA 4S05A 2JLYA 3IVGA 4FKMA 5MFPA 4I6EA 2PA0A 1BRMA 5FLKA 1U9ZA 1UKBA 2WTNA 2QTHA 3RUHA 1QRSA 1X1TA 1XEXA 1FMLA 3HI6A 3MGKA 3QUQA 3I04M 2ZYRA 3VBCA 2I71A 3VMFA 1YBVA 2ZJZA 2C7RA 1JR2A 1Z45A 2ERXA 3LM8A 4RD2A 4LZPA 4UOQA 3C3YA 4UPEA 4RD0A 5CNIA 5DHTA 1DO8A 2GCGA 3K0HA 4HLUA 1PKXA 3LRXA 4AYTA 3QU7A 1Q0ZA 5HQJA 3FCUB 3G2PA 3AHFA 3LF1A 2LKCA 4XQ9A 3CPEA 2VXYA 5AOVA 1W76A 1WVMA 1B8UA 5BSMA 1TFRA 3UTCA 1NP3A 2HC9A 3NHAA 5DHUA 3QVSA 4BPBA 5IARA 4HNAA 5B2FA 1CHDA 3EBLA 5EUCA 5EJ8A 2GD6A 1OGYA 3NEAA 4NU6A 1A9RA 2A1IA 1KMMA 4P84A 4NRDA 4PV7A 4XUCA 5F2KA 4DSNA 4ND7A 5JBQA 2ZUSA 4IKOA 5BMVF 2H2AA 4TPKA 2IYEA 2PSFA 4YRLA 2BJWA 1Z16A 4N5NA 4XSGA 3QI2A 5TS2A 4F06A 3BICA 2YHIB 3AUKA 4NXMB 3RFFA 3WJ2A 1N8NA 1P7VA 2YN2A 4PC6A 3F49S 1FTYA 4BO6A 4C6TA 2QTAA 4CNBA 1P4AA 1PNQA 2VHXA 1N6OA 2PRSA 4IDPA 1TQHA 3FNHA 5CIYA 1IN4A 4DC9A 1KZ6A 4IHJB 4MVCA 4A82A 1H2YA 2IXBA 4FJ1A 4MDYA 3AHIA 1T2UA 4UUBA 5EIBC 2W8ZA 2IS4A 4ZI7A 3UV7A 3IQXA 4Q9DA 1L4NA 2WSBA 3IBFA 2PX5A 1RYMA 3OU6A 4ZYWA 1GZUA 2PS1A 1XALA 2JRLA 1LF5A 4KVGA 5C3UA 4ENVA 1PFVA 1OWPA 3AM3A 4UQOA 4W63A 1JPJA 3RARA 6Q21A 2O50A 4HWGA 1JJBA 3TZ6A 3AU9A 3GNLA 5DP1A 2J0UA 3ZE2B 5CBKA 1XI2A 1NJ5A 2V8BA 3NAMA 3VDMA 4W1RA 2Z5GA 1NOJA 3PENA 3GVHA 3VM6A 4DABA 5D5QA 2FFBA 1HFEL 1W4AA 2YRFA 2XTZA 2FK8A 3EJ6A 4KPUA 4LMBA 2I4MA 5EHNA 2ZYUX 4WCVA 5K51A 3RYIB 4NG4A 3OZFA 1O89A 2CLIB 2R62A 2BBSA 1B0UA 1T5SA 4IHKA 4WQMA 4E1AA 2F62A 2HI0A 1ZR2A 2JFYA 2Z6AA 3R6GA 2CMDA 1MRNA 4G81A 4GKAA 3BMCA 1UKZA 4KQFA 3UFBA 4BDSA 1M10A 4MMYB 3LKZA 3OEED 4I9FA 4B4VA 1E4EB 3B12A 3G49A 1AG9A 4DXDA 3ONFA 3OKFA 4HBZA 3DVQX 3L05A 5CW2A 2ZI6A 5ALKA 5DO9A 4H7EA 4MRNA 4U7PB 1HMYA 1LDBA 1Z8NA 2ZVQX 2ID9A 4DEYA 1BKYA 2C9BA 3SIXA 1IRIA 3HCWA 3ANMA 3RS3A 3HCOA 1HGXA 5ER6A 3UMSA 3HJGA 3LPNA 3LT4A 4ZCTA 2WK1A 1YDMA 5K4GA 4C0HA 2R79A 3P52A 3ZV3A 1RQPA 3BWVA 4WXPA 4IDDA 1UMKA 1GU1A 1QE3A 2ZRGA 3FPJA 1E59A 3GFTA 4MLCA 3IDSA 2DAPA 2D2EA 1SB9A 1YO6A 2ODAA 1GSIA 3F0TA 3A9TA 3OPVA 3OTQA 3ZXXA 4BIIA 4DIBA 4EHLA 4XVCA 4AJOA 1W0JD 2VNIA 3W5IA 5ADHA 2JLRA 2ZU0C 1LQUA 2KPOA 3CRQA 4Q21A 2P41A 3QKRB 3RIYA 3WNQA 5D01A 1JHMA 2ADMA 7GPBA 1PFKA 4K9MA 5JU6A 1JL3A 3FWPA 4A8HA 2QRQA 2X4GA 1YVRA 2E87A 1TZ2A 4TKLA 4ZI2A 1WB6A 1LXCA 2QF7A 4NU0A 5DLPA 1Q92A 5DOZA 1PTJA 1CY6A 1W1IA 1IIBA 2IIPA 2KB0A 2OG1A 2ZI4A 4KE9A 1W5EA 1XZDA 1J2UA 1ZC3A 4JBWA 4KQGA 4BX0A 3LZDA 4XLZA 5DK6A 4J1TC 1FP1D 1I7NA 1MC4A 1JKMA 3H2JA 4XUGB 5K99A 3A4LA 3WK4A 3EVFA 3DBOB 4N01A 1HE3A 1KY5A 4DR5B 1VHJA 3H86A 4AKEA 4YRSA 4MV1A 4Y2XA 1MAHA 4BB5A 1V5WA 4RTLA 1L5OA 3BB3A 3O3OB 1R0ZA 2QM8A 1E6UA 3K8YA 3PUZA 3D1LA 4R68A 2UDPA 2ZSEA 3N6RA 3R8XA 5DNVA 4QRHA 1YB5A 2R0QC 4Z2YA 1XMSA 2F8LA 3OOEA 5EZQA 5IKXA 1L7RA 1Z3IX 2YV5A 4NPHA 6PFKA 2PBLA 4INJA 4AULA 4PGFA 1U7ZA 1ZC4A 4OQXA 3THXA 3U9LA 4BV9A 4C0WA 2PYZA 3HDHA 3HJCA 5IK2D 2DQ4A 4AU1A 1GOTA 1TD1A 1W44A 1I7LA 3ABZA 3PVZA 2YS7A 5FWYB 3KQOA 5BSHA 2ZXUA 1KE1A 1YQ9A 3DHVA 4UPVA 5CAEA 1U2RA 1DHRA 2XNKA 1YZLA 1QRRA 1TEHA 4UCWA 3MCUA 1UT6A 1F51E 1MX5A 1FDVA 2AI1A 1Z0FA 2VT7A 1SCQA 4G5QA 3RAFC 1Q3TA 4LNAA 2Z43A 2J6CA 2PU5A 3AHDA 1QGYA 3NRJA 1EMDA 4PQGA 4RQBA 2B0CA 3HJNA 1PL8A 3OUUA 1NUQA 4PSDA 5EPOA 3SZOA 4RJLA 3U7JA 3FHJA 1R4ZA 4GGMX 4RKRA 3VU9B 2FN8A 2QT9A 3PHLA 2C61A 2IQ5A 1FLNA 4NECA 2QMOA 1YMUA 2VT2A 1J5PA 2H65A 2QD4A 1P62B 2IKQA 2IU6A 1IY1A 4LISA 2IPNA 3BIXA 1IN1A 3QYJA 3WRVA 1IAQA 1PR9A 2OK8A 3QRWA 2Q5HA 4K46A 3OVMA 3D7MA 5F78A 5KWSA 5LQJA 1TYZA 1WCIA 1EM6A 3BSSA 4N3AA 1VL0A 2WD7B 2XWBF 3L0SA 5HKBA 1AQ6A 3DZBA 3RADC 4TV8A 4EHNA 5AUOB 2BP7A 1GN9A 1U3FA 4N18A 2Z3VA 3CNLA 1EFDN 1JAIA 1NURA 2YXLA 3GQBA 4EO7A 1I14A 3R2JA 4GI2A 2EFDB 4C29A 4IOKA 1V2HE 1T4MA 4I4TB 3AH8A 3DFIA 3N1UA 2GEVA 2YVKA 4R9VA 3UBTA 2ZUUA 2EWWA 1P6XA 2OFWA 1IOLA 3A9SA 2AEFA 4YJ2B 5KOHB 1RTKA 2O7NA 5JFTA 3N59A 3FN4A 3AFGA 2TECE 3KXIA 4CG3A 4LEIA 5I8WA 1GQOA 1WXFA 5KC9A 2VEDA 3IIEA 1XLWA 4UFNA 2EGHA 2ZOSA 3C7TA 3MQ2A 2C2HA 4US1R 5JHHB 2OEPA 2WKSA 4XD7D 3VISA 5LXTB 2RGNC 1H2AS 5AHWA 2JIZD 4ZDKA 3CF4A 2XVYA 2AFIE 2Q3DA 3E9CA 4HC4A 3SX4A 3BRQA 3RYCB 3O5AA 4ML3A 4BRZA 3ZDAA 4BO1A 1KR5A 1FXWF 1NBOA 1VKJA 1E0SA 3KQMA 4NV1A 5M04A 2WJYA 4KXQA 2PJRA 4KV9A 5LYYA 1OIXA 2FMUA 4F8YA 3HO8A 3S2FA 4NE9A 2B1RA 5EJMA 3EWIA 4R84A 3WLKX 3FZYA 2ATCA 3CX7A 2HNBA 1PNTA 3QVLA 3QYAA 1CK4A 4I6GA 1L5GB 3GLSA 3ZCRA 4W5RA 1F6BA 1ADBA 1UKYA 2I3ZA 4JIGA 2ONYA 4GZLA 2FXIA 4M9SA 3VPSA 5H83A 5A4DA 3SNHA 1TI7A 1FFSA 2HMSA 2HIHA 5F3WB 4R9RA 1ZD4A 2SKCA 4PZ0A 4FYHA 6REQB 4IGKA 4UU1A 2PD6A 2M98A 2XQIA 3Q6IA 4LYEA 2RI6A 4G89A 4CG1A 2MIIA 4EHHA 2K2QB 4EHJA 2AR7A 3ASZA 1Y63A 4UEJA 4MVXA 4RO0A 4I66A 4KTVE 2JZOA 3C1UA 1FFEA 1Q1ZA 1HE4A 3EXIB 4R41A 4GBED 4ZEWA 4CLDA 3MSCA 2Z58A 4L5AA 4DRXB 5K2MA 5TQVA 3KQPA 4BBZA 3TLJA 3Q3IA 1MFZA 2PGAA 2EFJA 1KYTA 4YQYA 2QI9C 1YMVA 4M0MA 1OBVA 3IIJA 4KXVA 4PAQA 4D41A 4RA9B 1IN8A 4LGCA 1FDSA 1JDUA 1I0LA 2ZYTX 5LQSA 4KHZA 3LQQA 2FZLA 4IRUB 1JJAA 2AOVA 1VLMA 1C3XA 1ISMA 1QTQA 1NAHA 5CITA 3ZQ4A 4QJ3A 3OM1A 2IYLD 1KORA 5MGBA 3VTZA 3OIFA 5HKKA 1Z62A 3E3LA 3ER8A 1K88A 4R9NA 3AV0B 3ZV5A 4P5PA 4F3NA 1J70A 3P2IA 5G0WA 3GDFA 2AKEA 1VCMA 1E2LA 1NJFA 4OHOA 4P5EA 3NOVA 4ARBA 3EAFA 2JFFA 4NQRA 1E8DA 3OX1A 5GONA 2WSSA 3R76A 1GFSA 2QNIA 2YNMC 2GZDA 3A6LA 5EMLA 1N78A 2AK2A 1XEFA 1U9CA 1SVOA 2QLBA 3TQCA 2YV4A 1YOBA 1JALA 1KI6A 1O95C 3N2LA 1KPHA 5HKLA 1XX6A 2BF7A 5LQMA 1G20E 1DT5A 1GT91 1TT5B 2I2FA 3DDUA 2GTHA 2B4YA 1NLFA 4DPLA 4J16A 2PMDA 4M46A 5KYWA 3PCRB 4K05A 1NKSA 4JB2A 3UJ6A 3LX8A 5K3EA 3M6LA 3C39A 4KKXB 5INTA 2Z1MA 3F2IA 5K05A 1QTRA 3U7HB 2I6SA 4PPFA 1GPNA 3LSYA 3IP1A 4B75A 4FCWA 3SOPA 1YJQA 5ALEA 1CS0B 5F21A 4UM9B 4O4IF 3O73A 2GK3A 3D6VA 4D99A 3GLKA 1UBMS 2JLSA 3K2IA 4KPGA 1I2ZA 1ZMRA 2HREA 2RHRA 3KKQA 3R8FA 4M49A 4RTQA 1UAAA 5JSKA 3FJ1A 5BNZA 4KPEC 1SVWA 2CJWB 1K7YA 5HFJA 2WBLC 1J09A 4EPVA 1E0JA 4PLZA 1P9RA 1UAGA 3ZUGA 4CEJA 4OMFG 3R6LA 4JVLA 3TTYA 3R5FA 4KNWA 1Z7GA 3I9FA 2X0DA 1I80A 4N8EA 3N0XA 5FI1B 5KAPA 3D3KA 1PZEA 1EZ1A 4LSWA 4DAOA 1YDFA 2MOKA 1M6WA 2HLPA 4AD8A 1K4KA 4F8JA 3FPEA 4YAFA 3ODGA 4IDGA 3E22A 3OT1B 1F0NA 2O5VA 4F38A 1Z33A 2D7DA 4ZU3A 1DXOA 1XZNA 4AZ0B 5BVGB 4TVSA 5IXYA 4ROSA 3G1TA 3L6OO 4CKWB 2Q3CA 5IPFA 1KI8A 1NMYA 1GZ4A 5ERXA 1SQ5A 1ND5A 1DEHA 3PJGA 3RK1A 3UAZA 1UM8A 2V3VA 5BW6B 5F1PA 3J81k 5JCJA 2AN3A 1PVVA 3MLEA 5B7PA 1TJ5A 1QFMA 3KTOA 2WNSA 4IOLA 2X7XA 3R3YA 4C7VA 1IY2A 2APJA 3WGMA 5HIAA 4DB2A 1UDXA 2CXQA 1BMTA 4DR7B 3JYQA 5J40A 4B6RA 2Z8ZA 1OH8A 1UQRA 2GR9A 2GAOA 1W47A 2JIOA 2Q4BA 1ATIA 3O1LA 2P68A 1DPGA 5JVDB 3VYRB 1KYWA 4CMAA 1EFAA 1CRPA 1QS0B 2AYZA 3NDPA 2YKGA 3KOXA 1M34E 1C9YA 4I5EA 2H1IA 3VC1A 3L0BA 4IGAA 4AJEA 2JGMA 2GSDA 4DCPA 5JO0A 2B3DA 3FDJA 4HLUC 2G06A 1QIIA 5KTYA 3OSUA 5AXCA 2AFVA 1JMYA 3MJTA 4JJ7A 1G7SA 3S70A 3UG6A 1TD9A 1MG5A 3FNRA 1E6MA 1BDMA 4IVRA 4ZVSA 4PO8A 3GCZA 1TT7A 4H1HA 2JFGA 4PNZA 2DR3A 3TIFA 3R7LA 2FZ4A 1RZRD 3GVPA 1SO8A 4ND2A 4OX9Y 1VDZA 4U39A 3RKUA 4QBHA 4KQ6A 3Q8MA 2CVZA 2Q2VA 2VJAA 4UBNA 4Z7JA 3BHIA 4B3DA 1SAYA 1J24A 4EIWA 1CQIB 4M0UA 1ULBA 4FR5A 3WYFA 2BFDA 2HZBA 3I9JA 2Y1KA 4QTUB 1QFSA 4JI4B 1XTUA 2O2DA 4MDEA 3TLGA 1JDPA 2V4UA 4DN6A 4HDNB 1J0XO 3FWHA 4QRIA 3WMRA 1UR5A 1L4GA 1TOAA 2ICAA 4D92A 5JLJA 4DCTA 5AW8A 3NRBA 1QZZA 4LHVA 3IPRA 1X1AA 5B3LA 1RTTA 2O9JA 3CWZA 3ZHQA 2C8LA 1XOIA 5AKXA 4JA0A 5ALXA 4FIZA 1XPRA 4HGRA 3RYFB 4CM7A 4D9CA 4QUHA 1U3TA 4X6UA 4A10A 4BUZA 3C5HA 3Q8WA 1DJNA 3DTTA 2QRUA 5AXAA 3UPUA 1N0HA 2PUVA 2VCHA 2VJCA 3EEYA 4FMPA 4NBUA 4UAJA 2L0XA 1UBOS 1L7VC 1N5KA 4DMMA 4YDRA 2VYFA 4AK9A 1GRNA 1T1GA 1XMPA 4UHBA 3RC7A 3U44B 2XEDA 2CVFA 2CHEA 4J4HA 4NZZA 2GTIA 3MHPA 1ABEA 1DKRA 1JFFB 2VOJA 2HDHA 1SK8A 1G6KA 2FEWB 3KU1A 3B89A 4R8KA 4RWEA 5FNVA 5SYNA 2GN0A 4G97A 4CTJA 4ZV9A 1KEKA 2VDOB 4BFCA 1J0EA 4RV5A 2B8TA 1DRUA 1Q0TA 1GP2A 2PM8A 5EUBA 2QTBA 4YP7A 1GGVA 4EYSA 1DKMA 1KYXA 1QK5A 1XIVA 2J4FA 3L8EA 3QJYA 4CHTA 4BRUA 2QL7A 5J1SB 4RF4A 1H2HA 4M7RA 1FUIA 2GK6A 4FI3F 5EQTA 3II6X 3RS2A 5AW9A 3UGJA 4IIJB 4KB5A 1JRLA 3TOXA 3AF4A 3IELA 4IDQA 3ZE8A 2BJVA 2EWMA 1E1CB 2VNJA 1L6RA 3FPCA 4GVLA 3U7FB 1Y82A 1GQRA 1BW9A 3EY4A 3S44A 1NRJB 3GMDA 1T2FA 1MKYA 2XNJA 1JIJA 1MCZA 2WIFA 3GJRA 3PPIA 3N8GA 3L8ZA 1R8SA 2EYQA 3PCTA 3W04A 4P98A 1NFRA 3I9KA 2OQRA 1JJIA 2WHXA 3BTSA 3LK7A 2H4YA 4C5BA 4CV3A 4H1WA 2G25A 1KQ3A 2C4KA 2HJWA 1JQJC 3D1JA 4JUFA 3UC5A 4JX9A 1P61B 4B3MB 2IA5A 4OQQA 3R24A 2C7VA 1K0UA 4MSUA 4HG2A 4QBFA 2V7TA 3JVIA 3T9AA 3TKLA 3IBSA 1RR6A 3FTQA 4MW4A 1PGPA 1XDDA 4QYIB 4RAQA 5EZYB 3W2EA 5AOBA 4DXHA 4LBYA 1Z0ZA 2IL1A 3C6YA 2LCFA 2DYKA 1S02A 4GXNA 1E77A 1XZIA 4EMUA 2QX7A 3VR5D 2P5YA 2RHGB 3K0FB 5JNTA 1XRLA 2XQFA 4IHQA 2QRGA 1FFGA 3O94A 3OFSA 1F0YA 3A1DA 4NJEA 4RVHA 4DBZA 1MTOA 2J3EA 2E18A 3HYTA 3IP3A 5A05A 4JOQA 1J21A 5EIFA 2F3UA 2J0QA 1QIDA