5HILA

Crystal structure of glycine sarcosine n-methyltransferase from methanohalophilus portucalensis in complex with s-adenosylhomocysteine and sarcosine
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
244
structure length
240
Chain Sequence
DHYEEEYVLGFVDKWDELIDWESRAESEGDTIINILKERGVKKVLDVATGTGFNSVRLLQAGFDVVSADGSAEMLVKAFDNARDHGYLMRTVQADWRWMNKDIHDKFDAIVCLGNSFTHLFDEGDRRKALAEFYALLKHDGVLLLDQRNYDAILDSKHAHYYCGDTVSVYPEHVDEGLARFKYEFSDGSVYNLNMFPLRKDYTRQLLHEVGFQEINTLGDFKETYKEDEPDFFLHVAEKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Glycine Sarcosine N-methyltransferase from Methanohalophilus portucalensis Reveals Mechanistic Insights into the Regulation of Methyltransferase Activity
pubmed doi rcsb
source organism Methanohalophilus portucalensis fdf-1
molecule tags Transferase
molecule keywords Glycine sarcosine N-methyltransferase
total genus 86
structure length 240
sequence length 244
ec nomenclature ec 2.1.1.156: Glycine/sarcosine N-methyltransferase.
pdb deposition date 2016-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5hilA02
3EGIA 2OBFA 2O0LA 3KPWA 5LQNA 3GU3A 3G5TA 3PVCA 5D1HA 3TMAA 3P97A 4ER5A 3UJ9A 3EMBA 1N7JA 1PJZA 2VP3A 3EVEA 5CD1A 4B17A 4POOA 4OA5A 3P2EA 1QAOA 1SKMA 5E8RA 5EMMA 5K01A 3NDIA 4KVZA 4DKJA 4PNEA 3PFGA 3VC1A 2EG5A 1XCLA 1WY7A 5FCDA 3P9KA 1L3CA 2P3OA 3R24A 1D2CA 2G8NA 3R9XB 3EVGA 5K0EA 5DSXA 3IYLW 4QTTB 3EVZA 5C0OE 3QV2A 3M4XA 2AOXA 3SMQA 3MQ2A 3V97A 2ZIEA 3FPHA 3GRYA 4ATNA 4BLUA 4E33A 5ICCA 2BR3A 3EEOA 5IKMA 5K0NA 3U81A 1NW3A 2ZIGA 4FGZA 5HFJA 4E2XA 3FPEA 2PXXA 2P35A 3F4KA 4F84A 4ISCA 4YMGA 1QAMA 4M38A 3P9CA 3PFHA 2G1PA 2IH2A 2BH2A 1P91A 2XYRA 3IHTA 4DQ0A 1KIAA 5B1SA 4ER6A 3THSA 4F85A 1XDZA 5DTMA 1KXZA 2OPBA 5DWQA 1F38A 3EVBA 3GGDA 5EEHA 5HIJA 4MIKA 3HCEA 5KQRA 2YXEA 4CKCA 4YUXA 5FWAA 3HA7A 5GM2A 2ZWVA 3OE5A 3UJ7A 2EJUA 4RTOA 3DP7A 3K6RA 5EEGA 4R8RA 2IBTA 3GXOA 5FA8A 2YUIA 1QANA 3BWBA 5FQOA 5K0CA 5HEKA 3GNLA 1F3LA 5IH3A 5KS2A 3NVKI 2PX4A 3UJ6A 2C7RA 4GOND 2AOUB 3G7UA 3G2MA 4YUWA 5DM2A 3LDGA 2PXAA 4PGHA 1O9HA 3SX0A 3TLJA 3TRKA 2ZZNA 2AOTB 3MERA 4KDCA 4ER0A 5KYGA 4PYNA 3LDUA 1M6EX 1VIDA 2CMHA 4YUYA 2PY6A 2XYVA 4LWOA 1D2GA 5ICEA 2HV9A 2P41A 2ZBQA 3I9FA 4AUKA 5C1IA 2B2CA 4V0QA 1EJ6A 1L9KA 4FP9A 1JG2A 3BWMA 5E1MA 2AVDA 3VC2A 1U2ZA 3WSTA 3LDFA 2JJQA 1RI2A 2PKWA 4HH4A 4KWCA 2PX2A 5LR6A 3CKKA 3O7WA 4PGGA 1FP2A 1NE2A 1NBIA 1QYRA 2GPYA 2BM8A 3EMDA 2ZBPA 2IH5A 4C08A 1WXWA 3KPUA 1YF3A 1AV6A 1KP9A 2R3SA 3KQOA 2G71A 3LCVB 2OZVA 4P7FA 3UJDA 3EPPA 1ZG3A 2ORED 4BY9E 2HTEA 2NXEA 1R8YA 2NXJA 1PRYA 1JTEA 1BKYA 2B78A 2GH1A 3AXTA 3ANXA 3R0QA 2H00A 2Z6AA 3OPNA 4CXMA 4QQNA 1NW6A 1FP1D 3QOXA 4AZWA 2PX5A 5KVAA 3ELYA 2I9KA 1KR5A 2OY0A 2E5WA 4AX8A 1INLA 2I62A 5LSAA 4FSDA 4X60A 1NW5A 2IDJA 5DSTA 2PSSA 4X61A 1KHHA 1T43A 4YV2A 2AZTA 3TR6A 2BR4A 2AN3A 7MHTA 4GOLD 2VS1A 1TW2A 4HSGA 3LBYA 4E31A 4PONA 3DMFA 1MJFA 3FTDA 3OZSA 2CMGA 3R3HA 5EHIA 4CWAA 4G56A 5E1OA 5GP1A 2PV0A 2I6GA 3G2PA 5MHTA 5T64A 1YUBA 2FYTA 3G88A 2O07A 3BGVA 3H2BA 2B3TA 4EKGA 5DX8A 4RTLA 4HGZA 1D2HA 4MQ4A 3JWHA 3CGGA 1EIZA 3EGVA 2PVCA 2IDKA 3SGLA 4UOEA 1IM8A 3G8BA 4LECA 5EKXA 3MAGA 1NV8A 3LKDA 3RODA 2IH4A 5CCXA 3EEYA 4PYJA 3BWCA 1VBFA 3B3JA 4KRGA 3I5UA 5EQJB 4FS8A 3TFWA 2GLUA 3B5IA 3NWBA 4R6WA 5HILA 3FTFA 2A14A 1JSZA 2ESRA 4LWPA 5E1DA 3DUWA 2PT9A 3MTIA 2QRVB 5K0GA 3HCBA 1SUSA 1NW8A 3KPJA 3TM5A 2C7QA 3KQVA 5D1NA 1NV9A 2PT6A 2UYQA 5EIFA 3KQPA 3FPGA 4GC9A 2P3LA 3T7TA 1YFJA 4M7RA 5M5BA 3FRIA 3HEMA 3X0DA 5P8WA 5KQSA 5E9QA 3RIEA 1TPYA 2PLWA 4BP1A 5JUWA 4C05A 1FBNA 3ER8A 3BGIA 2O57A 4R05A 4RVDA 2XVAA 3C3YA 4OA8A 5LQKA 4R8SA 4P7GA 1VP3A 3FYCA 5DM1A 1ZQ9A 1ZKDA 2AOWA 1IY9A 2XYQA 3P8ZA 4PIMA 1VLMA 2P3QA 3BWYA 5FULA 2FK8A 1M6YA 5CCBA 2PWPA 3DOUA 3PT9A 1SQFA 3FYDA 3R6TA 4WXHA 2JHCA 3LGAA 4GUAA 1EAMA 2PWYA 5FADA 5EMLA 2ONZA 3M6WA 3JWIA 3BGDA 4GEKA 4IV8A 3P2IA 5EVJA 1Z3CA 3HCFA 4GOMD 2WA2A 3KU1A 3BKXA 5E2AA 3S68A 3FUUA 4PYOA 5DXJA 5EGSA 2CWWA 2ZVJA 4BP3A 3RW9A 5F2OA 4E2WA 2OB1A 4E2ZA 2ZSUA 4ER7A 3TQSA 5G02A 1JG4A 4KW7A 2WA1A 3I58A 1RJFA 3GRUA 1AQJA 2Q41A 5FHQA 1XTPA 3KQMA 3UJAA 2FHPA 1ORIA 3AWIA 3FRHA 4PIPA 3HTXA 2PXCA 5DM4A 1XXLA 2K4MA 1DUSA 3G2OA 1VPTA 2H11A 3UWPA 2V74B 4HTFA 4KIGA 1N2XA 2C7OA 1SUIA 1XCJA 4MWZA 5BW5A 2ZLBA 2ZCJA 3CCFA 4HRAA 5DRTA 4EKIA 3GRRA 1P1BA 4GBED 2G70A 2YVLA 5C9ZA 5CIYA 1EQAA 3FUVA 3LCCA 2ZZMA 3ERCA 4U7TB 3ER9A 4PINA 1ORHA 2AOUA 4RVFA 1BHJA 4IWNA 1IXKA 3MTEA 3THRA 3GWZA 3B89A 5EHGA 3VSEA 10MHA 1JG1A 3NJRA 3OCJA 5EOVA 3M6UA 3ME5A 5LQCA 2IFTA 1G8SA 3E8SA 3SSNA 3PS9A 1ZHFA 3DLIA 3O4FA 1QAQA 3ORHA 4PCAA 3SSOA 1RI1A 5E1BA 5DT2A 2OKCA 4GQBA 3HCAA 3PLAE 2VDWA 3KHKA 2ZFUA 4EMSA 1G55A 3HCDA 3HA5A 4X41A 2HMYB 4XUEA 1NBHA 2OB2A 1JTFA 4AZVA 2PBFA 2JG3A 3I53A 3D2LA 4BLWA 5GOZA 5E9JA 1O54A 3DLCA 4DF3A 2G72A 3PTAA 2O05A 1R18A 5T6BA 4MHTA 2IP2A 3OZRA 4RX1A 3CVOA 4Y30A 3TOSA 3UFBA 1L1EA 4RTKA 5CVUA 3UA4A 1RJEA 5BP7A 1L3IA 3MCZA 4FT4A 2ONYA 8MHTA 1AF7A 1G6Q1 3FZGA 3M6VA 4U7PB 3KKZA 3OU2A 1H1DA 4CTJA 4PWYA 2AOTA 1SVUA 1RJDA 4CKEA 1P39A 5E2BA 1O9GA 2JH9A 3HVHA 4A6EA 3FUWA 5LQRA 3LSTA 4PYMA 5DXAA 2UZ4A 5ICFA 1L3BA 1YZ3A 3AJDA 3KPYA 2AS0A 3SM3A 2HR1A 4GF5A 3FPFA 4L7VA 4XUDA 2Z6UA 3UJ8A 3KQQA 2YTZA 2B9EA 4QTUB 5K03A 2AR0A 3DULA 2EJTA 2JHPA 2V7EA 2PJDA 3PX2A 3VYWA 4A6DA 5FA5A 1I4WA 3B7PA 2GB4A 3LCUA 1QZZA 3FUXA 4MTLA 2NP6A 1XDUA 2PGXA 1YZHA 3A26A 5K0FA 3HP7A 2YX1A 5CM2Z 2H1RA 1YFLA 5T67A 1XDSA 3REOA 1VQ1A 2VZ9A 4RVHA 5BXYA 3C6MA 4EVIA 1JQDA 3HVJA 4XUCA 4F86A 3NMUF 5H02A 1RI5A 3ID6C 5LQUA 5DTQA 3DH0A 1I9GA 1XVAA 2KW5A 5JR3A 3HVIA 5EZQA 4C03A 3GDHA 4RYLA 4ER3A 3I64A 5GWXA 1ZGJA 4IV0A 3C0KA 2VDUE 1NW7A 1X1BA 3M70A 4RTSA 1BOOA 1HMYA 3CJQA 2ZWAA 5EMKA 2AVNA 4AZTA 4RTPA 2XBMA 3SSMA 3V8VA 2CKDA 2OO3A 3M6XA 4R6XA 2R6ZA 4M36A 3P2KA 1Q0SA 1WS6A 3TKYA 3OFJA 1RJGA 3G5LA 1EJ0A 4EK9A 3A4TA 3JWGA 4PYKA 3C3PA 2N47A 2B25A 1JG3A 3BUSA 4E32A 3G89A 5K8VA 1G60A 5EZSA 1AQIA 3DTNA 2VDVE 3KPVA 4LG1A 4RTNA 4K6MA 3HNRA 4OQEA 1I1NA 4OBWA 2P8JA 4O29A 3EVCA 2BZGA 1ZGAA 2FK7A 3QOWA 3C6KA 5EMJA 3CJRA 9MHTA 1NKVA 5GM1A 2AN4A 4NECA 3GO4A 3NW9A 3GRZA 4ZTBA 2F8LA 3AXSA 5LQJA 1BC5A 1R74A 1UFKA 2NYUA 3ELUA 5E8JA 5K0JA 5CVEA 5HIKA 1DCTA 3TPZA 4Y2HA 2QE6A 3DXYA 3G2QA 4HG2A 1KPIA 4HC4A 1WG8A 4DMGA 3UJBA 2XVMA 2GAFA 3OZTA 3UA3A 4QPPA 2JHAA 4PYLA 4DA4A 5DX1A 5FHRA 2FPOA 5CVDA 3GRVA 1FPQA 5CUQA 3B3GA 5HOQA 2ZULA 3DR5A 3KQWA 1VE3A 3BZBA 4FZVA 3UZUA 2P1DA 2Y1XA 5FUBA 4BLVA 3ELDA 4EQZA 4YMHA 3KR1A 5GIPE 2UYHA 2I7CA 4KIFA 3DXXA 4H0NA 4YV1A 3A7DA 1WXXA 2DULA 2HWKA 1V39A 2ZBRA 2BM9A 3T7SA 4JXJA 4M37A 3HA3A 5K05A 3K0BA 2GS9A 4YUZA 3BKWA 3OU6A 4HTFB 3KR9A 2ZTHA 3FPJA 2ADMA 3KQYA 1UWVA 4QDKA 2IGTA 3EVDA 5EG5A 5EIWA 2OXTA 3HVKA 3GJYA 2UYCA 3G8AA 1Y8CA 2BR5A 4QVKA 1TW3A 1NT2A 3BT7A 4FSXA 3E05A 2EX4A 2FCAA 1FJXA 2ZIFA 2WK1A 3ELWA 3SXJA 4QQKA 2YXDA 3P9IA 4AZSA 3SR4A 5K09A 4YV0A 5EPEA 4RTMA 4P58A 1WZNA 5FTWA 2ZZKA 3NVMB 5GINE 4RTRA 5CVVA 3LHDA 2NXNA 5DRYA 4DM3A 5HIMA 2YXLA 5F2KA 3LX6A 4YUVA 3P71T 2PX8A 3LECA 3PB3A 3EVAA 4OX9Y 3FTEA 3CC8A 3MGGA 3EGEA 1VP9A 4HGYA 3SVZA 3HM2A 4RSRA 4DCGA 4DZRA 5K0BA 2FRXA 3JWJA 3NWEA 1HNNA 4GC5A 4RTJA 2YR0A 4QVGA 2DPMA 3KR0A 4E30A 4RTQA 3T0IA 1SQGA 5BW4A 1JQEA 3LPMA 5DX0A 1VL5A 3MCTA 3B3FA 4X1OA 3MB5A 3T7RA 1OR8A 1X1AA 2QM3A 2C7PA 3MHTA 1YB2A 3E23A 1X1DA 2HNKA 2CL5A 3LL7A 2Y1WA 1R00A 3DMGA 1R8XA 4V0RA 5DM0A 2IPXA 5DTRA 2QYOA 2P7IA 1RI4A 5E9WA 3OE4A 1XJ5A 3O31A 4CTKA 5HZMA 3OU7A 3BXOA 4X63A 3OFKA 3KQSA 2NP7A 4C04A 3GIWA 1UIRA 1P1CA 2QRVA 2O06A 3GCZA 4OQDA 4DCMA 5EKUA 3A7EA 2UYOA 1KYZA 5EC8A 2JH8A 1KPGA 3KQTA 4RV9A 3UJCA 4FT2A 2IBSA 1G8AA 2AN5A 3IV6A 4WVLA 1EG2A 4RWZA 3PX3A 5CVJA 4Z2YA 1M0EA 1N7IA 4PYQA 3E7PA 2LD4A 1KPHA 4OBXA 2ZW9A 3DXZA 5FQNA 4KDRA 5FWDA 5U4XA 3NDJA 4C06A 3L8DA 3TM4A 5LQAA 1DL5A 2P7HA 2AOVA 3LKZA 5GIOE 1Q0TA 2NNWB 4QDJA 2NXCA 3EVFA 4PCLA 2Z6QA 2GA9A 3FTCA 5K0LA 1G38A 4E2YA 3P9NA 1SG9A 3DMHA 4C07A 4E70A 4P7JA 4RVGA 1RI3A 1JSXA 1JR4A 3Q7EA 1X19A 3AY0A 5DLYA 2QY6A 1KYWA 5ERGB 3CBGA 3KR2A 3M33A 4P7KA 3FUTA 4GOOD 4IKPA 5F2NA 3Q87B 4PYIA 5ICGA 1MHTA 1JQ3A 3HCCA 2P40A 2EFJA 3IEIA 3UBTA 2YQZA 4FR0A 3A27A 3TKAA 5DPMA 1R6AA 3LBFA 2OYRA 3CJTA 3NTVA 4C4AA 1X1CA 2IIPA 4QPNA 4XCXA 1B42A 3A25A 5HIIA 2ERCA 4CKBA
chains in the Genus database with same CATH superfamily
1QK4A 2F67A 2CD9A 4GMFA 4JWTA 1SU8A 3D2AA 4TKVB 3LOUA 4XTRA 2J45A 2NSYA 5BSTA 3N74A 1KSGA 3T6KA 5LQNA 5GADl 5D3KA 3KB2A 4BNDB 3EVEA 3IE1A 2QU8A 4IDEA 5BNTA 3PSHA 3URKA 2GKOA 2XWSA 4FPXA 4EY8A 2ARKA 4H7FA 1UPBA 4LC1A 5DMHA 4BV2A 4EF5A 3B5EA 4FBGA 1DV1A 3KJXA 4GGPA 4L16A 4GGOA 5F33A 5IP5A 4KQGA 1O03A 1HYEA 4D41A 1AKUA 2YHAA 5I9BA 4EY6A 4HQ0A 3SCZA 2P3OA 3N8KA 2P8SA 2Q45A 2QM0A 1ZX1A 4CHGA 1Z2OX 1Q50A 3E4DA 2QMHA 1PL6A 5CGQB 3ZWYA 3GELA 5EPOA 2RGNC 3NORA 4W1SA 3UUFA 4E6PA 1WMAA 1NLUA 2R97A 4K5QA 2FRDA 4RMNA 3G7NA 4BX9A 4F8JA 1ZUWA 4P22A 1OH5A 5K0NA 1T6YA 2WTAA 2ZJ5A 1KI9A 1KFEB 5FNVA 1P6XA 4RDIA 5C80A 4EW3A 2HM7A 5KYNA 4EHKA 5JIBA 3KYDB 4EQ6B 4MIYA 1OFTA 2BFBA 1Q16A 4H7JA 4ZHQF 4QTZA 4ZZ0A 4KDFA 4PLHA 3MMSA 5BN4B 1PTJA 3JQQA 4JFRA 3R3ZA 2KBFA 1V3UA 1XZNA 1RE1A 2OPBA 4CTOA 1OLUA 3X2SA 4S1VA 2X76A 5DNVA 4NEGA 3V1MA 3N5KA 2CW5A 4RA9A 3DP7A 1WKBA 5DYIA 3D43A 3K6RA 3NFRA 3TRJA 2XMRA 5LXTA 1TF5A 1VZ3A 5HEKA 3A2LA 1UCFA 1Z33A 5EHQA 5KNBD 1GHTA 3IPXA 3G79A 3UJ6A 5CXUA 3F8WA 1F0PA 4PV7A 3EY4A 5TE9A 5B6JA 3WWEA 1E8DA 3LLSA 1ECGA 1ADYA 2AOTB 3ZKAA 5P21A 1GZUA 4YMIA 1HG1A 1D09A 4O1IA 4A92A 1KKMA 3G82C 1YJBA 1KS2A 1TCAA 2J5QA 2VI5A 1DT5A 4TMVA 3ILXA 2Z09A 3JQ8A 5BSUA 3U80A 5KO2A 2D4HA 1TJ3A 3S0JA 4NPHA 3TAXA 2AMLA 4MAAA 4XYMA 4CM9A 1NUSA 2XIQA 5EJ6A 1OJ7A 5JSYA 4V0SA 1B00A 3VH1A 3OIGA 1ORVA 3FAZA 4J0FA 1X9HA 1E7RA 2BM8A 2PWBA 1FXUA 1GGNA 4HAYA 2E5FA 3IDFA 5THKA 2C0QA 3WRYC 1YF3A 3ICEA 1SZDA 1J39A 4OLAA 4BFWA 1WHSB 4TMXA 4KMRA 3UWMA 4D3FA 4D4LA 1JG7A 2NXEA 3JAMA 4U02A 2R96A 3V4LA 3HRHA 3ANXA 5BWLA 1G16A 3OPNA 5I48A 2WM9B 4QQNA 4KGXA 5K0TA 2XTZA 1C9NA 3GD7A 3T8YA 1NJ8A 1MEOA 3NHZA 3R2JA 1B73A 4D3YA 2VBGA 2IZOA 4WNAB 5AKYA 1VL1A 2BEWA 5DSTA 4I9UA 4CE6A 3PXAA 3CVVA 3O21A 2J0UB 2ZTUA 3CF4A 1DJNA 1KFCB 3L4KA 3M6LA 2OD2A 5DM70 2IYOA 3AESA 3P9RA 1ESDA 5FO0A 1LK5A 3S2SA 2XADA 1ML4A 4X7RA 4NBWA 3U26A 1B6TA 5CEFA 1ZJYA 4D8VA 5EHIA 1H9AA 3MLBA 4E07A 4ODIA 4MEBA 4OQNA 1LS6A 3ZWXA 1NQWA 3TGPA 4HYTA 3OQ6A 3CT4A 5F35A 1XMXA 1KZ4A 3OE7A 2CK3A 2H3HA 3PL1A 4EA9A 5B7QA 1RBQA 1MCZA 3I61A 2DPXA 2OTCA 3VPDA 4WKNA 1FB5A 1G4UR 3CX8A 5IK2A 3RI3A 4A0FA 3S2IA 1N4AA 1II0A 1EM8B 1MGOA 4W7HA 4D9MA 1XZBA 4UOEA 1NV8A 3LKDA 4ZXPA 2FX2A 2NZ2A 9ABPA 4ABTA 4QYMA 2R4UA 3CWCA 2IP1A 4EB8A 2GJKA 1E9CA 2G1UA 3EZ9A 3Q1LA 5KJEA 1ZR4A 3D8HA 4Q7JB 3FDXA 4IVNA 3F6EX 2O5RA 1OLUB 4LWPA 2IEIA 3WJAA 1PR0A 2KJQA 4N3NA 4F9TA 1YVUA 2Z5LA 1KMHA 2C8VA 4LOIA 4BFLA 4R8LA 4D46A 1TFUA 2DX7A 1MC1A 1IBKB 4CKBB 3RK4A 4UMDA 3KSMA 2FZKA 1JECA 1N0HA 2GZAA 1VDZA 3VU9B 3ZU6A 2EBHX 3HZOA 1WOYA 3Q7PA 5GONF 5TPWA 3MTJA 1HSZA 3S27A 5J1TB 4JKYA 1NX9A 3WSWA 4X8MA 1H23A 3E48A 5KZMB 4P7GA 5HF5A 1VP3A 4MMYB 4Y98A 2WLTA 3IULA 4MV8A 5FULA 2HIAA 3VKWA 2BONA 4V2UA 4WXYB 4BJ1A 4ZTZB 2C7VA 4RAOA 3BH6A 1DGQA 3RUIA 2QV0A 5EJ9A 3CN9A 3GOQA 3IOEA 1TZBA 1U8EA 1YV9A 4IIJB 3E9CA 4L1KA 4RH3A 4UHDA 4AKSA 6CHYA 1HRDA 3S2UA 3KSBC 1L5YA 1I7DA 5EXPA 3HO6A 4F38A 1YJAA 1POWA 5JNTA 5HOEA 4XX1A 1R8QA 1U8FO 2YWJA 4OQQA 1DG9A 4YAEA 1DZ3A 3H8SA 4IX1A 4ANFA 4C4SA 2GEDA 4A2PA 2LWIA 2P9GA 1TM7E 2YY7A 2FI1A 3W5VA 4LY0A 1CG6A 1ZZGA 3OH8A 1QIKA 2A5LA 2GTHA 2RJNA 1Q91A 2OILA 2B8JA 3AWIA 1ZOOA 1D2NA 1FPMA 3N07A 5DBEX 3VO8A 3IAM6 5LP1A 2J0VA 2X5NA 3TAUA 1NA5A 1R6TA 2QTFA 2XNCA 1BMFD 2DWQA 5EUMA 5I9TA 4DSAA 4YX9A 4I99A 1QUEA 4WT7A 2XYPA 4RHTA 3JTEA 1GN8A 1UC5B 3H99A 5LOVF 3C5CA 2B2NA 1NVKA 3ISVA 3O1HB 3AESB 3ZHRA 1QH9A 1EDDA 3H16A 4U2BA 4UEQA 3AM5A 4BMZA 2QXUA 1CTQA 4FCVA 1WRBA 3ZE7A 3ZX5A 2QT0A 4YMWA 4L27A 1UWCA 2DBYA 3LP8A 2J3EA 4B3CA 2A9QA 3UATA 2O2GA 3A05A 3KKOA 2DOKA 1OREA 1ZMOA 5EP3A 4PAOA 5J58A 4Y7DA 1U0SY 3L07A 1M5TA 3LVQE 3VR0A 4US0R 2AG5A 3ER6A 4QOGA 4RXTA 1CXZA 5BYBA 1JKJA 1CJUC 1E6WA 3DTVB 4HQOA 3FROA 3BMCB 2XAUA 4RZIA 4KO8A 1DZIA 2Z5VA 1ZVMA 4OI4A 2ZFUA 4KGVA 2X1VA 3GMTA 5HF8A 5AW7A 1P77A 2IDMA 4XUEA 5AW1A 2CBZA 4ERXA 1VRCA 2JAOA 3BRSA 1U0LA 2CY0A 4J0QA 621PA 1WUJS 1YRLA 3K2BA 1PVDA 3NEPX 4QAJA 2AMYA 5JYEA 2BP7B 3HP4A 3BWDD 3L43A 2AFRA 3FCSB 4EF6A 3OZRA 4EVSA 1T15A 4PZCA 4XDZA 3SJZA 1SU7A 2HSJA 4LY9A 1JR6A 2X14A 3MCAA 3M3DA 1JDNA 1K7XB 1ONBA 1RYEA 3QBDA 5A7HA 2AFIB 4CN9A 4UNQA 1F9EA 1F51E 3GVHA 3REQB 4ZI7B 5BP7A 4B3GA 1A8IA 1V1MB 5ALRA 3VUFA 1TUBA 1H0KA 2ONYA 2OOKA 4R8KA 1CSEE 4KITB 1BX3A 3KE9A 4WZAE 1D07A 3BJEA 2JEZA 2ALJA 3MINB 4YAJA 2YHIB 5T5QA 3SD7A 3U7RA 3W1VA 2XXAB 1T6ZA 5DYTA 3NDPA 1S1MA 4KACA 2IHYA 3TLKA 4DA8A 5L4LA 1KC3A 5KMGB 2AS0A 4A2WA 1RXSA 3WGNA 4F11A 4IGAA 1JDBC 1Z13A 1A2OA 4ZOEA 1VG8A 5TJHA 4CI0B 4ETWA 2EJTA 2V7EA 4H1HA 2E7ZA 1BFUA 3A3PA 3GUVA 3H6KA 5KHAA 3NHYA 1LDBA 1XDUA 2E4WA 2BCEA 2R00A 3RC3A 1YL5A 2BFCB 5CXSA 3LQRA 2FQXA 2VTBB 4RZ2A 3PDIA 1NOKA 5AM0A 3O5AA 1FNSA 1HFWA 1WX1A 3EARA 2G28A 4P80A 4JJIA 2Y71A 2A9OA 4UULA 1J7JA 1XEFA 3QKWA 3AEUA 3WYCA 2XUAA 4YCAA 1Y34E 4RJJA 1FDIA 5JECA 2GILA 1YQDA 3HU2A 3SQOA 1U7ZA 2QKYA 2V5UA 1T24A 3EQ8A 4RYLA 4UHBA 5GWXA 5B2EA 3TIFA 1ZGJA 3FRHA 5DZSA 2GCOB 5EJFA 3ZI7A 3L7CA 1A69A 5CPBA 4EHLA 1NW7A 1Q0PA 2ZJ3A 5HE8A 2HWYA 3UKDA 2A2ZA 4HZGA 5CA1F 1H4SA 4G86A 1XI2A 1L4LA 2A1IA 3MJ4A 2ZBGA 5C5CA 4I9HA 5CA1B 2W83A 1TZ2A 2P68A 3LZ6A 4BV8A 2DLCX 2JCXA 3TYXA 4DA7A 1NXVA 5D01A 1WCIB 2F2TA 5KX5B 4LXHA 2X1HA 4F7DA 1A97A 4OHBA 5C4IA 1GRCA 3JWGA 3OFVA 4RFSB 3IOBA 4C2TA 4L50A 3AQ4A 3CO5A 5BURA 3O9ZA 3DW1X 1TM3E 3PCRB 3O03A 5A9TA 1PFVA 3EOZA 3VKUA 1W75A 2YNMC 4OQEA 1PEYA 2QYTA 1OX4B 3AEKA 2SKCA 2XTMA 3H1AA 3X2EA 1PG2A 2ZSEA 4Z7QB 4NZYA 4ZVLA 1QP4A 3URMA 4TZKA 3VSCA 4CR8A 1QH1B 2Q3EA 2XRFA 1JX6A 2I7XA 2AN4A 1D8AA 4OJKA 4YXWA 4DMFA 4JWKA 3ZIUA 3TQIA 3U16A 3HJHA 2A30A 1UDAA 1BC5A 1H0SA 4E09A 1T2NA 2OO5A 3K1ZA 1P1IA 1GQSA 2AX3A 1CWUA 3AEQB 3EXEA 5CTJA 3VZQA 4BEBA 2J8ZA 4H3HB 1P0CA 4WUTA 4G8DA 5BMVB 5KQLA 1U8YA 1WG8A 3T9FA 1IB0A 4G0YA 4MV6A 4DA0A 4UVEA 4ZOQI 2QJWA 1EAYA 4IIUA 1YXMA 3SYLA 3NC4A 4PO1A 4B3BA 4BDTA 5HOQA 4BO2A 1CY4A 1E3MA 4BLQA 4YP0A 2A1UB 4BNWA 3TQRA 5GIPE 2DHQA 5HIAA 3MT0A 1ZJJA 1UWKA 5CFRA 1JDBB 5IKPA 1FOEB 2ILTA 1I0IA 1V39A 2NZUG 2W8ZA 1XJ0A 2ZBRA 1RWXA 2BM9A 4YI3A 1UPXA 3EVNA 1P4JA 3EWAA 3MINA 3QLTA 4U9HS 3RVSA 3ZWQA 2PS9A 3EY9A 4GXTA 1CQJB 1XF9A 2O2XA 2XY4A 3FPJA 3AEZA 1X7DA 4U0KA 3A6FA 1RRMA 1X1QA 5IUJC 2QAGA 5JWRA 1UPUA 1ZAKA 2I2WA 2M1XA 3JZFA 4GICA 5B1HA 5CBPB 2QB5A 3FHOA 2NUPA 1O4VA 2V7BA 5KI6A 4MINA 1TTHA 2J5KA 4ZT6A 3EIWA 1CLUA 2P9TA 3IBCA 4YV0A 3R7WA 3BE4A 3UOWA 2E85A 5AJTA 2Z8YM 4I55F 5FOXA 1AGPA 4B33A 4XD2A 3PPIA 3U3RA 4RTRA 3QVJA 1Q21A 2MMGA 2PMBA 4XOIA 1DSSG 3FIJA 4IVPA 1QIEA 1TKRA 1UZNA 3OLZA 5EP4A 1B8UA 1KJZA 4IHJF 2ZRKA 1VP9A 3U4CA 3R7LA 5IMSA 2REXB 4DCGA 1BVYF 3RS7A 4ZICA 4E7OA 1G21A 2FRXA 2HC9A 3MWEA 2HBRA 2E49A 4B4KA 2JLXA 3S8MA 1S0UA 4L9WA 3ZIDA 4BJHB 3U1VA 4D8WA 2RH9B 5G4KA 3QUQA 3QE9Y 2GCOA 3MWJA 3RBZA 1TTPB 2PPVA 3CNEA 4B71A 1WHTB 4M0PA 4RD6A 3AI1A 4RH1A 5ESWA 5DI3A 4C20A 4M4SA 1SVMA 1YB2A 3TW0A 3E23A 5LYJF 2KYRA 1I7QB 3I39X 1PJ8A 2PCJA 1XZJA 1CUVA 3LXRA 3MWFA 4JC0A 1UFRA 2JCBA 5DM0A 4YP9A 2P7IA 1EQ2A 3H3JA 3L4JA 2CCKA 3UMJA 4RFSA 2ZSHA 3OLVA 2AR7A 2GT1A 3OJEA 4MMZB 3WK8A 2O8EA 2WTMA 2I4IA 2QUHA 1U94A 4EJMA 2FZWA 1W0JA 2BLLA 5KMGA 1PFUA 1JYFA 1UBKS 4QEKA 5COBA 1ZONA 1A5BB 2QRVA 2XKAA 5K3BA 2FJUA 3WWCA 4EG0A 4EHHA 1CJKC 4L75A 4IAOA 3M4JA 2HGZA 3OCCA 4WBSA 2IV2X 2D2IA 3KJZA 4WVLA 1IZYA 3DE0X 1K2WA 3LMKA 5CVJA 3PEFA 4Z2YA 5EHNA 4EO4A 2R84A 5LJIA 1J1UA 4D1YA 4A8TA 3BULA 1NVXQ 3COPA 3EZXA 3RSGA 4Z1MD 4MVYA 4URFA 5DEIA 2QMZA 2WAMA 3LLVA 1PEKE 2GCNA 4TTQA 1VM6A 3A9SA 3VOTA 2Z6QA 2ODWA 3K8QA 3U48A 1F8UA 1DV2A 3DMHA 3P9NA 3TQCA 3RWBA 4ZU1X 4LWQA 5JXIA 5CU7A 4AJJA 5DLYA 3TEJA 1WO8A 1H0RA 3NNDA 3QSGA 1E0KA 1KAGA 2GEBA 4BNDA 4QXMA 3BICA 3EDYA 1H0HA 1JQ3A 1NHGA 2J9FA 2P40A 4JVLA 4MYTA 2I1QA 4CRWB 3LBFA 1NQXA 4MYUA 1Z0UA 3RKSA 5JMTA 4OCZA 2JGNA 1H1LB 5LL6P 4FX5A 1OYVA 2IIPA 4QTXA 4V2IA 3GAAA 1RWBA 2B69A 2QAGB 3IUYA 1OA1A 3QXXA 4LVOA 4I1UA 4DUPA 3K6SA 5AW5A 2I29A 4QPJC 1TZMA 3DDZX 5D5HA 2VUSA 4RD1A 2H2HA 5A4JA 1ZQ1A 2V65A 2ZIXB 3EMVA 1BVHA 2ZGVA 4Z9YA 1W5TA 3I8OA 4LZOA 2XNSA 4D3ZA 4DJEC 3NAMA 1FRNA 2XA9A 4QWMA 1B74A 2GJAA 4AS3A 1DIGA 4R01A 5A3RA 1M5UA 1GADO 2A0FA 1VJ0A 2Q3FA 2WAAA 3GX1A 1H6BA 3ENQA 5FNVB 4ECEA 4C1BA 3PP8A 4HXEB 3G2NA 2VBIA 1PT7A 5E6SA 3OEEA 1D2CA 2UZIR 2WT9A 2HADA 3MVEA 3RARA 1GG9A 2W90A 2EKPA 1Q7RA 4WK2B 5DSXA 3CURA 1T9KA 3IYLW 4PG7A 4YRKA 5CFMA 2PMCA 3DO5A 3VKHA 1MW9X 2HRQA 5G4KB 4H77A 3LRXA 1KAOA 3PX7A 1RYZA 5IKMA 4RKFA 2WSIA 3DAGA 4N5NA 2IYQA 4MKZA 3KKLA 2PXXA 2C29D 2FW9A 3E2MA 1XTKA 4RORA 3TO5A 4M38A 3OQ1A 1MO3A 4I36A 3R9XA 4YRIA 3R3SA 4D6XA 3C43A 4ER6A 3FYTA 1R6UA 3N0WA 4NATA 3TLCA 5FLKA 1RLOA 4EUNA 1G2PA 1YBMA 4QXOA 2CVZA 4YJ3A 1I0LA 3OIWA 4O2BF 5KCMA 3X1XA 4AJLA 1SXPA 4A36A 4RCVA 1DJLA 4NOLA 2UZ1A 3O93A 1E2MA 2WIFA 2X5KO 4GPEA 4GZ3A 4FVTA 4YT4A 4R8RA 3KLMX 3PQFA 4L6CA 2PH5A 2VJPA 5JZ9A 2RBKA 3V9AA 1MT3A 4DIEA 4WJLA 2QRHA 5DNUA 4AAYA 3G0DA 4AQDA 5GJBA 3WYDA 3C3JA 3GCWA 2HJHA 3BXHA 4UDYX 1RXUA 3CB2A 1R10A 2HRZA 1L8LA 2NO9A 1ZUHA 2V3WA 3GFRA 2OQVA 3TLGA 2XUFA 5DBIA 2A5GA 4OHKA 2L17A 4NWIA 1PK9A 1PD0A 2PY6A 3CBQA 4PANA 5AJZA 1B6SA 4LF8B 3GY0A 5FWNA 3H9CA 2R7MA 2UZ3A 4FONA 2RC6A 3ZHUA 1XRSB 3ZOKA 4BLRA 3ZE0B 3L2OB 5K6AA 5CCBA 4LV8B 4CEJA 5EAIA 2EJCA 5FBHA 1RWPA 3GVXA 3VHLB 1SURA 1O97D 2QG9A 3M82A 4WGFA 2VO1A 1KU6A 4GLLA 5I8WA 2FSUA 1N78A 5CW1A 3VGPA 4ZAZA 2Q8PA 3W9SA 1F2UA 1GEGA 1RMQA 4NV3A 4WNAA 1T26A 1Y4UA 3EMDA 1DBWA 3JQFA 3V1NA 3CZAA 2J0UA 4L4XA 4YRNA 1NBAA 2XMPA 1FFEA 1HT0A 3Q5DA 3V7FA 3WR5A 5JO0A 4KPGA 1PWXA 2O1XA 4QHTA 3TGLA 2CEAA 3UHAA 5CFOA 2FZEA 4UNSA 1CVLA 1S2OA 1BKYA 1NASA 2B78A 1CBUA 2Y1GA 3GGPA 2OZPA 1XALA 3F9CA 3GV0A 4MPTA 3O90A 4JYBA 4LDZA 4PTZA 4ZI3A 5B6IA 1FP1D 3RH0A 2AI2A 2ZPAA 3N53A 1GY8A 3G1UA 1SVOA 3OJOA 3PUJA 2H9IA 3CRW1 2FUG6 2Y2UA 2PSSA 3O2NA 5J2TB 5TARA 2WJ6A 3HLTA 4IVRA 1QMGA 1KHHA 3A10A 5TSDA 4YAIA 3NEYA 4A26A 3A9UA 1N8TA 4S1WA 5MFPA 3PUZA 2JBWA 4L9SA 4GOLD 1HT3A 5LPNA 3I28A 2RBGA 4JUIA 4WQMA 2BEUA 3QXCA 3NOVA 4GECA 4TRRA 1N0IA 1DO0A 1KI4A 3O0DA 3P9SA 3FPSA 3F6RA 2DQYA 4O1MA 2O6LA 3T5CA 1OFVA 1T10A 1SIBE 2WJ3A 3PIIA 4YCJA 3TLEA 3C1OA 1XEWY 2HSWA 5IDQA 1CS0B 3JQ6A 3ZE9A 2ZJYA 5AI8A 2X0JA 1CZKA 3I6BA 3QMVA 5EKXA 1U3VA 1UXGA 3ET5A 2M9MA 4K3VA 5JJIA 1VKRA 1EFKA 5DOZA 3QEBZ 1VXOA 5K3FA 5C34B 2KQUA 2BKLA 2RKOA 1MJNA 4QUIA 5TQ2B 3SIPA 3WB1A 2P9BA 1BAPA 2C5SA 2HK9A 3MGKA 4HAOA 3TR5A 1EGAA 2NTEA 2V7UA 3CLTC 2HHLA 3OUZA 4HNTA 5KPJA 1JN0A 5GV7A 4XGRA 5A02A 3OKFA 4RJIA 3ZHBA 3HKDB 1J22A 3S1SA 5TPZD 2BI8A 2UYQA 2XEXA 1E6UA 2XVZA 3OTWA 3D0QA 1LBHA 2B5WA 1BD4A 1N2CB 1Q0UA 2AN1A 4QLAA 3KTFA 3ORSA 3FCYA 3FRIA 4MI1A 5J1SB 4Z9FA 2ZR8A 1FBNA 1TC1A 1K5DA 3TL2A 4DMRA 2XB2A 2YDYA 4KO3S 3P2OA 4JHLA 4O4JB 3T9AA 2EU8A 4HVCA 4HY3A 2XYQA 1BOFA 1MHPA 4RAQA 4HO1X 1HZZC 2GF9A 3H18A 4B81A 2O4UX 5ALLA 4ZIRA 2JIRA 4IDCA 3R6TA 1EZ4A 1V3TA 1OH8A 2ECQA 2DP4E 3EIXA 2WWWA 3LSYA 4LF4B 1A3CA 3W9BA 1JDVA 2YWFA 2WD9A 4LYDA 5JJLA 4B6PA 4TWBA 2X7XA 3DVRX 2H1CA 3QI2A 4IOKA 4J07A 3IXLA 2XWBF 3QJ5A 2J4DA 2OYCA 2AEEA 4DSTA 3QQ5A 1UM8A 5DXJA 4U5QA 4HR7A 4XWTA 2CWWA 1ZBQA 3HEBA 1ZO8A 2H1LA 4IDHA 3CUTA 3MJEA 2F43B 2G3YA 5F1PA 5JSZA 2Z3ZA 3E3NA 4R2JA 1RJFA 3JS5A 5KOHB 3SZGA 1IK6A 1T34A 4PIPA 3L7NA 2XRZA 5H3CA 3W6UA 4F06A 2QOEA 1N9ZA 4JB0A 4RLFA 2VPZA 3C6ZA 5HQ3B 3HJRA 3WIBA 4LF7B 2FQWA 3NU1A 4YDSA 4HNUA 1G20A 3ZXSA 3HB4X 3RT1A 3ZBQA 2K7FA 1XXHB 5FLYA 4DR4B 1KDTA 4EJFA 2VTEA 1M5RA 2ZREA 1QX3A 5F5NA 3ZQKA 2OFOA 1THTA 3MAJA 3VDNB 4QRDA 1NPYA 1K3TA 2HU7A 2JDID 1EUDB 5FHRA 1U7PA 2MSDB 4ZCRA 5HKAA 2CNKA 2BEUB 1EUZA 2XOEA 3X44A 2BLNA 3VNSA 3RLFA 2O2ZA 2G82A 4KN8A 4YP6A 1QVAA 1T0HB 4EITA 1D5WA 2GZ3A 3ZV6A 1J2RA 2WHPB 3HJUA 5AXBA 1QZ3A 3H04A 3RVOA 3A1VA 1D6MA 1KYYA 4BX8A 4CLOB 1RSZA 3QPDA 1MO4A 2W2MA 3ZTWA 5F3WB 3AGQA 3PS9A 2D8MA 3QX7A 3WGGA 1U2EA 2WE8A 5EZYF 5KYXB 3E9DA 4BMXA 1STOA 3PYMA 1YE5A 3HYNA 4FFOA 1UUFA 1SCJA 4Y2VA 4I5GA 1IJEA 4L0QA 3MZ0A 5FPYA 5G0WA 4LRXA 3DLCA 2JS7A 2ZCVA 3IALA 1QVRA 2XJ9A 1SC1A 2ZUWA 2I3BA 1RNLA 4JODA 1JLSA 1KQNA 1NLYA 1BFDA 3UH0A 3UFBA 3HR7A 4R51A 3ZU3A 2PUTA 4WNIA 4R2MA 2ATCA 2CLLB 3DL4A 4B45A 1RJEA 2OFWA 1P5FA 4PF1A 1H2XA 1XRPA 3Q12A 3DT8A 2XMZA 1CUGA 1ZP6A 3OU2A 2HHCA 3W5HA 4JI8B 3WGYA 2MU1A 1KAEA 4TKZA 3IXQA 1K7FB 3OWHA 3N2IA 4Y9UA 4YJDA 3P5SA 4H7KA 4P4NA 4X84A 4A6EA 1QCYA 1DBPA 1G8FA 2C54A 2HXGA 3CF0A 4X62B 4X0EA 1DKPA 1HZZA 1U1CA 2C9BA 2COKA 5J5AA 4FB5A 4RHUA 5G40A 5C1PA 1Q0RA 4MUIA 3R6LA 3EISA 1XG5A 4BYMA 3LLUA 1FSGA 4Y6QA 1PNVA 5L95A 2P2SA 4CDGA 1I4WA 3B7PA 3QA9A 1EWYA 1XL1A 3EDOA 3FG9A 1ACLA 2PA3A 2Q5FA 5DNCA 4HV4A 4OQMA 3REOA 3LTNC 1HTWA 3DP9A 3IUNA 3ZHZA 1ZNQO 1UC9A 2C20A 5JE8A 3E1SA 1NYLA 4F6LA 3WI7A 4ZI7F 221PA 1C7RA 1HI9A 5IJAA 1X39A 1F06A 2A88A 4KAJA 4K9LA 3C3EA 3M9LA 5REQA 1IG0A 2H2WA 3ONWA 2OO7A 2KW5A 1ONOA 4O4LF 1IMJA 1ZJ6A 3S6JA 3IAS6 4C03A 3X1DA 2Y8EA 3QLEA 1MMFB 5A1JA 4O4LB 2Y6VA 5JI3E 1NQAO 1QGED 4WLFA 1WKVA 1CJSA 4EEXA 3OX1A 4MQUA 4DLUA 5HX7A 3THXA 1D6NA 1USKA 3ONVA 3LZDA 4ARUA 1JA0A 1FLNA 5P8WA 5C8XA 4PX5A 2REOA 3G5LA 1PV2A 4FD2A 4IO0A 4C0WA 4CLEA 3VR6A 1G60A 4BNZA 2G5TA 2GM9A 2G80A 1UJBA 1NF3A 3VU0A 5AW6A 4PR0A 4CUZA 3HFSA 1I1NA 1QKIA 2C4UA 3NI2A 4KXMA 2XNHA 1MRNA 3QOWA 3SDSA 3RADC 1U28A 3V48A 1B1AA 2Q3MA 4BZXA 1U0FA 5JNLA 4HDSA 2BDTA 1ZA1A 4JLMA 5MN6A 2H5LA 4ITUA 1SXJB 3D54D 2XMDA 3KC2A 5A4KA 2O5CA 1NBMD 1IN1A 1C9YA 4TSKA 1YQ9A 2R6AA 2A1UA 4MJLA 3BIJA 3MJSA 821PA 3KT6A 4DC1A 5CMLA 2QY9A 3I62A 4D42A 1KQPA 3AU9A 2F9FA 3U13A 4DMGA 2GAFA 3EIHA 2QTRA 3ANNA 3BH0A 3HU3A 3JXEA 1YU9A 5DTEA 1GRQA 3KKMA 1KY2A 5WRFA 3A70A 5JQGA 2B1GA 2VN8A 3GDOA 1T4CB 2QTCA 3GRVA 1Q5PA 2ZULA 1ZCBA 3KQWA 4CM6A 4H1WA 5KWEA 4PPGA 3HRKA 3X1KA 1C3VA 2GFIA 3VYRB 4KIFA 4Y2QA 4XKJA 3KVRA 3T38A 4BB0A 3MOGA 2V7QD 1T0UA 3EAFA 5D51S 3C5VA 1TQ2A 1CX9B 4XVRA 3ZWVA 5CB4F 1CUAA 1G20E 1MZVA 2HF9A 2OL4A 1O6ZA 4JJGA 3A1DA 4BJ3A 4UZSA 3RU2A 1VA4A 2IGTA 4IHJA 4B3HA 2HCJB 4JJ4A 4FS3A 5ALJA 1EHCA 1MV8A 3PRHA 1EZZA 1RWMA 1Y7HA 4UDNA 3ZCTA 4DPKA 3EUEA 5HZKA 3ADPA 3BT7A 3H1TA 3TDKA 3I9OA 5L7YA 5LZ4A 2VHQA 3IC5A 3C6BA 4RS3A 2H7XA 1JQBA 1LX6A 2D7JA 2PLFA 2C5EA 3MOIA 3UT6A 2D7DA 1FX0A 1MIOA 4KN9S 4IIXA 3GEDA 4M1KA 3OZXA 1QZTA 4HGQA 1BXGB 4JVSB 3CNOA 3INRA 2FA9A 1U6KA 1K7SN 3P71T 2PFSA 4M0LA 3RK0A 5DGCA 1R5OA 2I7TA 1O9BA 3I1YA 1NXPA 3HGQA 3O95A 2XUGA 4JSYA 1FS6A 4A9AA 4EVQA 4IFTA 1NAIA 3PCTA 1W4RA 2Q6LA 4YROA 3N2LA 1XFAA 1VYHA 4BP9A 4EKDA 4CEIA 1Q1QA 2D5CA 5JAMA 1XAGA 2XDQA 3B3FA 1BCSB 4JITA 1QYXA 3MB5A 2JKYA 1X1RA 2YZ2A 2QSZA 3EW7A 4JGBA 5JJ5A 5TQ0B 3W4IA 4M54A 5LP6F 3WNBA 1LFDB 3AR3A 3A11A 2IPOA 2AZ4A 4NEHB 3U3KA 3A0UA 5E4FA 1J70A 4YAFA 4BKRA 2WZBA 1CUZA 1DEOA 3M5DA 4OB7A 1GKKA 2OGTA 5CFQA 4FWTA 5TLSA 3BREA 3KOYA 1FRZA 2VXYA 4DR5B 1YAHA 4BLPA 1W6RA 1NYRA 2JAPA 3ZNOA 3I2KA 4FZJA 4Y1RB 2QAIA 2WIJA 3PHCA 4Q37A 3E3MA 3IBGA 3V3KA 1P31A 2F1JA 3V8PA 1VJ5A 3VOSA 3LBHA 2HBYA 5EKUA 1ADFA 5BV1A 1P9LA 1YA8A 4W6ZA 1KEEB 1XN1A 3TIXB 2FEAA 4BV9A 2IYVA 4XWKA 4MPJA 1RKXA 4L2IA 1KTVA 4UUMA 4ARSA 5K0ZA 1JIXA 4BQFA 1Y48E 5JCZA 2MINA 2ZUSA 3MXTA 4C4RA 4D74A 1Z62A 1Y3FE 5AOAA 3GRAA 2AQKA 1GPNA 4B4DA 2NZYA 4Q16A 3VYSB 3G6WA 4AECA 4CQMB 1T3LA 2Q3DA 4YRMA 4NOKA 4IZOA 4CF7A 1MRZA 1U28C 5IK2D 1YS6A 1Y4ZA 3HU5A 5BMVF 1FA9A 3L06A 1XAHA 5LJLA 4ZQEA 4ILKA 4CV3A 4G1FA 2W7TA 4ZAGA 3B3AA 3ZDQA 1U8UA 2ZR0A 3A6LA 3E7XA 4CODB 4OFXA 1K9VF 3KJQA 1RLMA 3DXFA 4TL6A 3Q87B 3V34A 1C7FA 3O2JA 1U81A 3VU1A 5F2NA 1JUDA 3BAFA 4Z51A 3I2GA 3TKAA 3T1TA 1GPMA 2EL7A 2QA5A 2C3UA 1O77A 3PITA 4JL6A 4K6FA 4JJ7A 5CW2A 3AETB 5CDTA 2ERCA 3OBIA 4N1AA 3X2FA 5F7XA 2V7GA 2JJYA 3ICVA 5JBQA 1YKSA 3D4OA 4R41A 3PL5A 1U0BB 1ZN7A 1U7DA 4G2TA 5I8PA 1AN0A 1FYFA 3DMNA 2YIDA 3IMKA 3VR3D 3HY3A 2KI5A 1MIOB 1G2IA 5AI5A 2WIGA 5E8RA 1PQ4A 2GHRA 4C78A 3FCUB 3NDIA 1MB0A 1SU6A 1WXEA 3EYAA 1C0EA 1FTNA 3L7OA 1V47A 2FEWB 3TE6A 1M2KA 2W42A 4Q3AA 1XAIA 3O75A 4LSZA 4KQIA 5HJ2A 3WQSB 1I94B 4AN4A 2ZPTX 3H6GA 1TCBA 3MQ2A 3QWAA 5FOTA 1UADA 5D7NA 4BO7A 3FZEA 3ED5A 1ULAA 2Y2VA 2ZIGA 4G8CA 5FNZA 1X2EA 4GZMA 2R8BA 3GJRA 4BVHA 4D92A 3L8CA 4DLRA 4IXNA 2ZG6A 1DMRA 2WM2A 3V4ZA 4DQ0A 1XTIA 3JAWA 4J43A 2CKMA 4FMDB 3BQ9A 4BBZA 2ZRLA 3RO7A 1SUDA 4QPDA 3TVDA 1BIFA 3M1LA 4CKCA 4HX2A 4N40A 5AVWA 1EK1A 4LFCB 1WMBA 4WN9B 1TQDA 4DSOA 3DT9A 3GA5A 5LBIA 3GXOA 5FA8A 4V1CA 1H93A 2WWHA 2GD6A 4RBNA 8OHMA 4YTEA 4AJHA 1M2NA 4I0WB 3RTBA 3LVRE 3E8MA 4CEJB 1QM5A 1WNTA 2BF7A 2DFKB 2X0IA 4K87A 4PBRA 1VLLA 1QOQB 1KDPA 4CKWA 2H0AA 2JGDB 4Y2SA 1ZWKA 2JKZA 3IELA 4O02B 1Q92A 3BFXA 4WSOA 3SF8A 4HAUA 3VBCA 2VFAA 4E94A 3IDSA 2B5VA 1MA0A 3I9FA 4BUZA 5M34A 4LTDA 3AKCA 5C1IA 3GZNB 5BUQA 4MVCA 3IP8A 1X8KA 1JG2A 1FYDA 5D86A 2IXEA 4ETIA 2AVDA 1VPEA 4BVBA 3ENVA 1U9ZA 4HH4A 1OXBB 2HL6A 3DMTA 4Y2UA 1MUUA 3VKGA 5JBIA 4HQKA 2V3CC 4TLBA 1GCUA 3NX4A 4HDNA 1E3JA 4C08A 1RJ9A 4MS3B 4MDHA 2F3TA 3WNCA 4MDFA 1LB1B 3I2JA 3AR4A 4EO9A 3JSAA 4H4CA 2GZ2A 1N0WA 1EVIA 5CP8A 2FLWA 2O50A 2TMDA 3BHMA 1QHHA 3QELB 1XK7A 4UATA 4WD3A 4EECA 1P4RA 5ENZA 3ABSB 2X2PA 3BCHA 1YRAA 1H5UA 1Y82A 3WMXA 4RSMA 1CRLA 1EXMA 5KVAA 4KWTA 3FH0A 4QL3A 3S1AB 5C7YA 4JDPA 5FUQA 4XASA 1N5IA 5H1YA 4PG8A 1VIMA 4CU2A 4PEVA 2NO7A 2PUWA 1B0AA 1RHUA 1CRPA 5H80A 5KHOC 4DG5A 4RESA 2GVDC 3T3EA 4KJXA 5DEOA 5KSZA 4L8FA 4S0XA 5E3IA 4AY5A 3PKJA 1U7XA 2NUBA 4Z1MA 4DR1B 1YWGO 3ASVA 1MAHA 4AJ4A 2O8BA 3B6JA 5K3FB 1DRUA 1T8RA 4Z99A 3PU6A 1QTQA 4EHDA 5A4AA 5MHTA 2CNDA 2C9OA 4YCLA 3GH1A 1ZESA 1HOTA 5C4MA 1F3OA 3QVKA 4KXFB 4I6JA 2XGJA 5AVTA 1XL0A 5GTDA 4R69A 2HJSA 4B4WA 5L7TA 2JFFA 3EGCA 3JWHA 1IH8A 1UK9A 3PICA 4DLLA 3SS7X 5JYCA 1W0JD 1XE3A 4ZN6A 2GD1O 3RODA 3DVQX 1OVMA 2YBEA 4XXHA 3H8WA 3IAFA 1HF3A 2R65A 4XA8A 4R1LA 5D6OA 1LNQA 4HWOA 2Y0BA 4CEHA 4GI7A 2ORWA 4NCNA 5DGIA 4ZJZA 5SY6A 4N0QA 3KKNA 3UAGA 3HCBA 3T3HA 3JVUA 4LE1A 1VMIA 4FU0A 4CLDA 3ZCSA 3FYHA 2XWPA 2Z0MA 3KL4A 1YDEA 1ZH0A 1GCOA 5JD5A 2P3LA 1Y3HA 4I1SA 5BSEA 1TAHA 2WP8J 3EVTA 5AVKA 3T7TA 4HQFA 5I9LA 1YFJA 3DJFA 2WU0A 1TA4A 1RKBA 4FW9A 5TF0A 3UAWA 1E61A 4KNVA 4LZWA 3KXLA 3NPMA 3PD0A 5SZHB 4FFBB 3UWSA 4AJEA 3DL2A 4BP1A 4D6PA 4I14A 5H9WA 4JLBA 1F0YA 2WKRA 1GNQA 5EE9A 1SBNE 3SF8B 4Y9DA 5LQKA 4IDBA 1SAYA 2HY7A 5DM1A 1ZKDA 1QQBA 1YRYE 3U4MA 2ZSIA 3FSRA 5IZCC 3I2FA 1NVTA 1GZ3A 3QFTA 2XZOA 3RQSA 2JCVA 4JMPA 1L7AA 1V8FA 3W78A 4CCAA 3FPAA 1YA4A 1GUAA 4DSUA 3ZV4A 2DQKA 2F64A 1WP4A 4MYDA 3V4VB 5ALPA 4ZYWA 4BNYA 1DDIA 2PMKA 5ES4B 4X8HA 5KINB 1JPJA 4ARZA 2NYVA 1II9A 2WA2A 2WNIA 4LJ4A 2I33A 3KAQA 5G0SA 4MP8A 2IOFK 4GL4A 3FPCA 1PWYE 4B3MB 1RVV1 3IMGA 4HRVA 4Y2YA 5THQA 1V7QA 2FW0A 3DKRA 4WV3A 1MENA 2G5CA 1QHHB 2Q41A 2QAJA 2R7KA 3AI3A 2Z4SA 3OQBA 2AQ8A 5D84A 4FLFA 5EJ8A 4DFDA 3AYXB 3MJFA 4KPYA 1CFJA 1K7CA 3RSOA 3FPBA 3S1AA 1E1RD 4TQGA 4TT3A 4B85A 1GV1A 2PV7A 2B83A 3IQDB 3PC8A 3K73O 3OCVA 4JUBA 2HMAA 4QWWA 4U2EA 4B75A 4BNTA 5F77A 2D59A 1Z18A 1YR6A 3EHEA 1FDSA 2OBXA 2W6ZA 3CPJB 5C3UA 1W5SA 5B3JA 1Z4IA 1Q1AA 2W6CX 3TNDA 5CJ2A 2DGDA 3FBGA 3WK7A 4Z4GA 1ISPA 4P4SB 3JY6A 1SUCA 3IR5A 3ENKA 2QQFA 4NOJA 1JB1A 2B1IA 4D7AA 2I1WA 5A9SB 2Y1OA 4ZVVA 5DNDA 4ZAXA 2NVUA 4ZVRA 1HYHA 2BSQA 3MYRA 4LPSA 1T5HX 2GCEA 4INPA 3SSOA 3TD2A 4A73A 4RK0A 1M8PA 3SI7A 2DH6A 2BFMA 1IHOA 3DE2X 3T9DA 3NGLA 1K68A 4HFJA 2EXXA 3PDCA 4EMSA 3JQAD 3TUZC 3WP0A 2OB2A 2JG3A 4B4UA 4X71A 4ZA2A 2Q5JA 3OO1A 5FBRB 4R68A 3VNAA 4E03A 3RC7A 2DR2A 4AKGA 1PZNA 1O54A 4M9XA 2O05A 1R18A 2VJOA 2X6RA 1A0OA 2C77A 3VTFA 1ZSNA 4YMUA 5JQWA 1CIPA 3WA7A 5A4IS 2ST1A 2CUKA 3AUTA 4EGCB 3U44B 2BFOA 4RTKA 1Z29A 5BSKA 2HDWA 3UAXA 3VO1A 3UGQA 4BQEA 3L0DA 3I4CA 3UA4A 1PR4A 2JFNA 1ORWA 2JIZD 3Q9UA 3GJ8A 1IUNA 4FE7A 3WGZA 4RVCA 1TI7A 2PDAA 3I0ZA 4TRNA 1TT7A 2LCIA 4UUOA 1QBKC 4E51A 5H7XA 2V5AA 3FVQA 3JTMA 3TLXA 4CVNA 1TJ4A 4XWOA 5HW0A 5JCOA 2CJFA 3P32A 4QO8A 5ALGA 2ACVA 1ZSYA 4F4DA 1W49A 4BWFB 1W7AA 5DWDA 1Z8NA 3NXKA 4RMJA 1RXWA 2WB2A 3JALA 2AR0A 3GFOA 2E6UX 3FYUB 3GCGA 1YDGA 4GM1A 4A6DA 1FVFA 2QN9A 4DRXB 4F04A 1R27A 4O4JF 2D1QA 1DI0A 4WNCA 1BN6A 2EJBA 3CZ9A 5ERYA 2PMEA 1OGIA 3ASZA 3KTAA 5PGMA 1AA9A 4D9GA 3RTAA 2YUTA 5CJPA 3KETA 1DCFA 1W4BA 2FH5B 3BEOA 1WVIA 3HVJA 4KBGA 3WLNA 5DN6A 4JBIA 1J07A 5ELXA 1RI5A 1XROA 1NY6A 2RHJA 4NMMA 1XXHE 1HL3A 1M1UA 1QGYA 3I9KA 4HNQA 4OIFA 4YDHB 3SMVA 3KOZA 4YO7A 1YCHA 5JZMA 4ZPJA 4CQJA 5THXA 5IEBA 4AO8A 2QE7A 1XA4A 1A4IA 1CYEA 4RTSA 3CJQA 5JFTA 2XBMA 5EMKA 2AVNA 4D0RA 1E9SA 4LY6A 2ZSAA 2CJPA 2QTHA 3A2NA 4HDMB 1L2TA 3M6XA 1V43A 1Y7IA 4RD4A 4WA7A 4W9NC 3I2IA 1GSIA 4GEGA 4XIYA 1EP1B 1MAVA 1YGPA 2YN0A 1EJ0A 1V7PC 2WWTA 2R6FA 2Z2JA 3A4TA 4J91A 4MUAA 5EFOA 1LRLA 3G68A 2JFHA 1HM5A 5AVZA 4ZXFA 3VUEA 4JS0A 5TMBA 1YS2X 2VIIA 5EZSA 3ZCVA 2BJHA 1TT5B 3LC2O 3OM8A 4EFNA 5JSUA 3U60B 2P4EA 3HNRA 4RGQA 3MGBA 1U80A 4O29A 4RWEA 2EEZA 2GQ0A 3KXIA 1Z5PA 3VZCA 2FZLA 3C6KA 3IGFA 3S2YA 1KYTA 1O58A 2HHHB 4GU5A 5IJWA 3MWDB 1YO6A 3HPRA 2WFLB 3LC0A 5LZ9A 1WSBA 5LQJA 3VJRA 1VL0A 4BXOB 3TLMA 1EXDA 4KFUA 1Z22A 2CFRA 3GRFA 5CVCA 3WIEA 3O84A 3SQXA 3WIUA 4EKYA 4IDQA 1G3IA 3BA1A 4HLUC 1E2GA 2HPHA 4IIEA 4B2YA 2VQ6A 4S0ZA 4CLRA 4XSHA 1BMFA 3OLWA 3B3GA 2X0EA 1XOIA 3QG5A 3CNQS 1ODIA 1ZIXA 3UMCA 2H1OA 1PVOA 4GDFA 2J3IA 3TZQA 1SA0A 2F4VB 2ZI9A 3DF9A 4ZHQA 1LTQA 1W76A 2RI1A 1Z0ZA 2GI4A 3AU8A 3L6DA 1US8B 3T7SA 4P92A 1XLUA 1CQZA 4KXLA 4M37A 3K0BA 3PFCA 2Y92A 4L8VA 4TL8A 2GBIA 3CLUC 1NJ6A 4L08A 3AF6A 5AI0A 5LXTB 3IAAA 1DKQA 1XZEA 3C2QA 3T4EA 4EPVA 5AFSA 1NG9A 2OD7A 4LSGA 1U3UA 2IZ6A 2AG0A 1DAFA 3UCFA 3G9XA 1J20A 3E05A 2FCAA 4UD6A 4OM8A 2YXNA 2XVXA 1IXSB 2YXDA 3B8EA 1LNSA 2FP3A 3GJQA 4MR9B 5ALYA 4AZSA 3ZCQA 1E6LA 5CLJA 4BXOA 4MRMB 3IAEA 1RQRA 1REQB 3HFJA 3Q7RA 2XI4A 4LQLA 1UEIA 3S28A 2ZZKA 1YQXA 5KWVA 1LDNA 3VTKA 5JJKA 2F6RA 3PI6A 2Y1FA 5BV8A 1Y3CE 4ONEA 1BCSA 1PK7A 2CMKA 1YNSA 4QFMA 4AMVA 3EVAA 1ZK4A 3CC8A 3W2FA 3EGEA 3QLVC 1GTSA 4RDCA 3DW3X 4OGWA 3KJHA 2G07A 2DPGA 4U6NA 3CLSC 1VJ1A 4CMEA 3NBXX 4FIDA 1TCUA 1IN7A 1SZPA 3KBOA 4G0MA 5B6PA 1C8LA 1VIAA 2MR5A 3RVJA 2ZI3A 3FMGA 3ZXUB 4EENA 3H1EA 2IYEA 4C0AC 1ZUNB 4HLDA 4I4TA 1WF6A 3ABQB 5KKCA 3O94A 1NUAA 5KNCH 4O08A 1MF7A 2ID4A 3WMEA 2EERA 3G8DA 1BEUB 3TW8A 2ZB3A 3IUPA 1VIVA 3UMSA 1YTLA 1ZD2P 1TYEB 3VR1A 2QRUA 4CGZA 1KTIA 3JU3A 3EDMA 4MXDA 4UD2A 3IVGA 4N82A 1U1EA 3M6IA 1MR3F 2R1TB 2Z5GA 4CFZA 3TIIA 3QGMA 1ISRA 1J1ZA 5AUQA 3AQIA 3B7GA 3TH5A 3UN1A 2CDAA 4JH0A 4D0GA 5IC5A 3ED1A 1ZEJA 3E7WA 3TI9A 3WLMA 3WLSA 1XTVA 4QO7A 3HYLA 4B3SB 1HDXA 5JPDA 3RT9A 4IQ0A 2VQ3A 3H5AA 3KE8A 4EELA 3VHXB 1XELA 1K6XA 2BFFB 2D8AA 2QEQA 3OE7D 1G8AA 1ZVKA 3IV6A 4FFWA 4RS4A 1M1XB 3CNBA 5IAKA 3E81A 1GVNB 4CEIB 1QU3A 2KWIA 3ZN2A 3LY7A 4D6YA 3B1YA 3K4QA 2Q3BA 4CIBA 3JQRA 3HADA 2C2MA 3IEUA 4TLAA 3BN3A 1SBIA 4INJA 4N12A 5JTUA 1TAQA 2HIMA 1AMOA 1MQAA 2JFUA 3D3QA 4YA6A 3VSAA 4G0VA 4K9RA 1YB6A 2JAWA 3QXJA 4OJTA 3E35A 1SG9A 2XCUA 1UWLA 5ESRA 1NXSA 5EE3A 2PG3A 3AETA 2D5IA 5IN5A 3IX7A 4LRTB 3U7EB 5DCWA 3CBGA 1YACA 3M89A 2CF5A 1Z6TA 1CF9A 1SHJA 2GNOA 1Z5NA 4TYQA 2HV8A 3WKBA 3P0HA 4MCIA 3L40A 1VKHA 3CR7A 3H7IA 1JHAA 2R1VB 4P3XA 3ECSA 1A8UA 1AMUA 2IODA 1YZFA 3PDUA 3AMVA 4K9PA 2H7CA 4IO1A 3T3OA 1FW6A 3RAEC 1YJ8A 1YJQA 2I2DA 2MDTA 2O0LA 2B4RO 3FI9A 1KI2A 2Y1LA 2OXIA 2CE2X 4BQQA 3TXAA 5KSYA 1DP4A 5FDFA 2FN3A 4AMGA 2FR0A 4NU5A 1PLJA 4P86A 4B6JA 2Z56A 2C4TA 1G63A 5LYYA 5H16A 5K01A 3C97A 4ENTA 3WBBA 4BFCA 1CW2B 1JDPA 1L3CA 3A6GA 5HCUA 4AO6A 4BKOA 3CUKA 2Q6OA 3N2KA 1JHRA 2VTDA 3F3KA 3TJRA 2OG2A 1TMOA 5AKEA 5FKJA 1FTWA 4QTTB 2A33A 5C46F 1D03A 2H29A 1T2AA 3B1WA 1PK8A 1Q7TA 3GT4A 4XM1A 1EM6A 1W2GA 4CKXA 4EHJA 2BTQB 2QMQA 3KXPA 4DPMA 2VJQA 1P7CA 1NW3A 1J0AA 1EFUA 2ZJOA 1NVMB 2OGZA 3A36A 2P35A 3KSDO 4CLHA 4F84A 3W06A 1C3EA 1TCCA 3CNNA 3LUBA 4R0MA 1KSJA 2VHCA 1YHYA 2Y0CA 3TZLA 5AW2A 1QVVA 3OC0A 5AIAA 5ALHA 3K0FB 4QYTA 2G1AA 4J7XA 3GGDA 1MAWA 5EEHA 5HF9A 2P6OA 4MIKA 3WJ2A 2C3OA 2PANA 3CF6R 3D3WA 3TX2A 4CKWB 5C7IO 4O0MA 4LV6A 1YI1A 8ADHA 3CE9A 5FJIA 4BNHA 3UV6A 2Q1YA 5EVCA 3I12A 1SB9A 4BZPA 2IA5A 2NMVA 3PF8A 4DL9A 3BD9A 1TIPA 4X00A 3TE7A 4FMPA 1AKVA 2H2AA 3O0TA 4JEHA 4Q05A 1ZH8A 3KV3O 3SAJA 3PJEA 3AIOA 3B1KA 5GQSA 4AZ0B 3PNKA 3LDUA 3VH3A 2BFEA 4H2DA 3NBMA 3DTVA 4KNYA 5JATA 2WD7A 3SJBA 1JEYA 3OG9A 4MDEA 1OQAA 2JPDA 2ZBQA 3AGPA 3HFGA 4D4HA 3AZOA 3L1VA 5FUMA 5E1MA 1CUFA 4KR9A 5IABA 1GRRA 3I6QA 3QELA 1R9GA 1I2AA 1PJQA 1RHMA 1PFGA 3EXHB 1JI3A 3JPYA 1NI4A 4B76A 4DREA 5UKDA 4DAEA 1FYXA 3L77A 3MA0A 4JV5B 1Q20A 5BSMA 4LYJA 3KQOA 2X7JA 5EJMA 5CX4A 1JVBA 4P7FA 1PD1A 3GFBA 2OR3A 3K9GA 2ADFA 3RVLA 4D56A 3GGJA 2OHGA 1PZFA 2IHKA 5JTTA 4II7A 4IEEA 2NO4A 2BUCA 3CRMA 4LYAA 4YRLA 3THOA 1KK0A 4B79A 1XNQB 5KB3A 5KTOA 4G97A 2JCGA 3GT7A 1LQ2A 3NHLA 4JL8A 4DIMA 2ZM6B 4I4TF 3VA7A 1E5QA 1W1UA 3ZOZA 1LPMA 2QM8A 5CH3A 3RV4A 3AONB 1O6FA 1YC2A 3K32A 4YNBA 3ZJVA 4IOLA 4GR9A 4HSGA 1Z5VA 2QTLA 4YJGB 1L8OA 4KH1A 5IXSA 4D9NA 3KQHA 1L5MA 3W0LB 4C0SA 3A6EA 4IRUB 5HPYB 5JAUA 5KYKA 3Q72A 4RANA 4WFQA 3WFJA 2R60A 3ZWBA 1QE3A 2OAP1 3H8VA 5TQJA 1EK5A 3G0IA 5JSKA 5EIHA 4GKAA 3EDQA 3U56A 3JQAB 6LDHA 3GJSA 3ABIA 4WY8A 5KQPA 1NYTA 3RFXA 3JYHA 4N7MA 3OC6A 1AN9A 3ZDAA 1DNPA 4IRMA 2KE5A 3PBKA 5A1TA 1E59A 1P0QA 4KRGA 3ABOB 4JOBA 3UTCA 1TK3A 2FX3A 2ID9A 3CX6A 4K88A 4QJBA 1EFPB 1KZGB 1UBHS 4IXWA 1TJ5A 4FYXA 4AICA 4AJPA 2H51A 5F9FA 1DQYA 4R40A 4Q4LA 1H2BA 1YRBA 5EFZA 3N58A 1VBKA 1PLKA 5HTOA 3ESCA 3PUVA 1T36A 4M0FA 1Z26A 1P4GA 1ZPDA 2ZU6A 1UZUA 3AVWA 4L0MA 2BMDA 4M7RA 3QVLA 1BW9A 5KVVA 1CKEA 2QRGA 1T5TA 1THGA 4DDWA 1HLFA 4FK8A 3S4YA 4CIYA 1IAVA 2ZSFA 1JAZA 1JFRA 5FXMA 1NMQA 3KUUA 4LRQA 2B8EA 2VA8A 3ZWNA 5KU1A 3NIBA 1KJNA 2HA5A 2JANA 1AXRA 2OV2A 2FEOA 2WD7B 3A6JA 3JARA 2BZ0A 3BILA 2C57A 3BWYA 1JEYB 4XCVA 1SXJC 1NJ2A 4DJ5X 1KKUA 2NUTB 3LGAA 3ZWCA 2XCTB 1GGHA 4KOAA 5GZ6A 1MX5A 4ILEA 3PFFA 3VHRA 1M0TA 4ZT3A 2FLKA 1IN8A 2AFHB 3A2MA 4JU8A 3DKPA 3SFZA 3PHIA 1U02A 4YT2A 3CUUA 3LXXA 2VP0A 3HH8A 4NFSA 4BIMA 4E11A 2IWHA 1MG0A 2ZYIA 1E94E 3IIKA 4GOMD 1V8ZA 3IKLA 4UOQA 5DYWA 3S68A 1Y1TA 5EMHA 4PYOA 4NYJR 4B6RA 7AT1A 3RFFA 2ZJ2A 3IURA 2WJHA 3F5QA 2ZSUA 4RGYA 3TQSA 1AURA 1MQ9A 4KQ2A 4JVOA 3ZUPA 4KW7A 3ZHVA 5F78A 1NRIA 4QECA 4J6FA 3WLHA 2ZVPX 1UDCA 1ECLA 2D4AA 4OL0A 3DLBA 1E5DA 4U7JA 4CMIA 4C4ZA 5KWSA 3F73A 3AVYA 5EIBC 3GLUA 2FW1A 3CVXA 1TU3A 2V74B 1YBHA 4MWZA 1SIWA 3T35A 4M0DA 4BWYA 4YGYA 2XQGA 4DV5B 1HLDA 4IMRA 4ITRC 6ABPA 3UJPA 1AGRA 1PG0A 4ZVUA 3UGKA 4KWHA 3SBXA 3ZV5A 2NV2B 1LWOA 2Z2XA 4V0ME 1MFZA 1ORHA 2PZFA 3DC7A 1ZS9A 3HYRA 2B2XA 5CITA 2HLHA 4NCXA 3MGAA 3WMWA 1XPOA 2YYYA 1FQKA 2OXRA 3GQBA 3EF0A 2GCIA 3O83A 3CKYA 3NC0C 3U9LA 4XARA 4JP1A 3GA0A 4WKGA 2Q07A 3M6UA 1PJSA 2VZ0A 2A0WA 2G40A 3E8SA 4MUXA 3F90A 3RFUA 3UVEA 2JFVA 2W8BA 2TSYB 2JBAA 3U44A 1LW7A 5HCIA 2CCJA 2VYCA 2XHZA 3KX2A 1GIAA 1O0CA 3HCAA 1DFIA 2B6HA 1EFRD 2NU6A 3O3MB 4G24A 2Q1TA 2BFDB 1UBFA 2CEKA 3ETNA 1Y9AA 2VVTA 1E1MA 3I53A 1BHO1 1O5IA 4BLWA 5DBHX 2RAVA 1L4NA 1OWPA 3LUJA 1VHLA 4DF3A 1TU4A 2L69A 3ESBA 4DY6A 2ZROA 3QWHA 4N8SA 4OAPA 4ZOLB 5CCEA 3O8RA 2Z43A 5ALQA 3VRHA 4Y30A 4MVJG 1EX6A 5K4HA 2IYUA 1DEHA 3TNJA 1ECFA 1Z28A 1XJQA 4BNXA 5F98A 1V8DA 2QZ4A 3CW9A 3H1FA 1OHHA 4FC7A 2OV1A 3JALB 4JBNA 3ZGNA 4JU9A 1M7GA 2GEFA 1DTEA 2YHSA 4FN4A 5K8LA 3FR7A 2FDRA 3TL3A 2AOTA 1SVUA 3PNLA 4X64B 1SVNA 3O9MA 1GQRA 5JNUA 2VYFA 3G2LA 1XVUA 2EJVA 2HR1A 4GE0A 3SM3A 3JARB 1R0RE 3EW9A 3K0AB 3H4VA 4M8KA 4GLOA 5DGTA 5DTIA 3NYIA 2ECFA 1QFJA 3AUYA 3V1UA 3B8HA 3L0OA 1PGNA 1C4WA 1FU4A 1MX9A 3UB3A 2AFHA 3G2HA 5ERXA 4UTPA 4QPCA 2Y0PA 4UOZA 1ZISA 6NULA 1UPCA 2B6NA 2Q62A 1JLKA 3DDCA 5CBKA 2ZI7A 3UENA 1KOGA 4TZ0A 3EJWA 4RVHA 4F21A 2NXWA 4FGLA 1JIKA 4YO8A 3QQPA 3USZA 1PNRA 4XUCA 1HL7A 1WU8A 3OESA 3NCHA 5F21A 3EC1A 4UTXA 3WLAA 4I1RA 3R7BA 4BNJA 2ACKA 3CF2A 2OXFA 4R5HA 3TTWA 1YB4A 2BJWA 1XQ1A 4HDRB 3WWZA 1CJTC 2CKDA 3SXPA 4NYJQ 4Q4AA 4GMDA 1YZUA 4H3SA 2ANBA 1M0WA 2C07A 3BK2A 4DIUA 2C59A 3DG9A 3KXDA 5GVRA 1X7YA 3O4VA 1C9EA 2B25A 4V0OA 3GWGA 4RADA 3SC4A 2AUTA 2DBQA 2HPAA 3PQ2A 2OZLA 5A9RA 1EH5A 2O3RA 2VDVE 3QZUA 4Q3CA 4QFCA 5EWLB 1BQ4A 4K6MA 5I9MA 5SYAA 1OAOA 1X1TA 2X7HA 4QU9A 1HMPA 4B47A 4HNGA 3H7AA 4OB8A 2XB4A 4CW7A 5LZ2A 4G65A 1ETUA 1EM8A 4LRUA 1KVSA 4QYSA 2LGJA 4ZTBA 3M6MD 4BNVA 1B3RA 2CDBA 2ODAA 2HMTA 4LC9A 3T9BA 2Y68A 5KNDD 4MV1A 3V4RA 1MO5A 3AVUA 1ZIOA 3IQHX 5ALXA 4H18A 3SSAA 3ZZ0A 3UJBA 2UUAB 1VCIA 4JCOA 1KP3A 3L7AA 4OX9B 5AVXA 3PPVA 4C7OA 4WK0B 4DA4A 2R6R1 3L6BA 3HUEA 1PU2A 1RQPA 5LD2B 4OTZA 1ETHA 4OSPA 2BHSA 1COWD 3BVPA 4UDXX 1QF9A 3OZ7A 2W70A 1SXHA 1MKYA 1C7ZA 4BL5A 2V9PA 3VU9A 2DULA 2HWKA 3OLXA 4QJIA 4ZODA 4OY3A 3FKSA 3MOSA 4FX2A 5BNZA 1TGYA 1CF2O 2QQ0A 3R5HA 4ZV7A 4Z4CA 3N7AA 1DIBA 1WULS 2EIXA 5IYZB 4Q1FA 3GJYA 4QVKA 2BR5A 1KAHA 1L4EA 1V7ZA 5C51B 4KSYA 4JLNA 2MYNA 2FXVA 1N3BA 2PVSA 2ZRIA 4ZCIA 4B3DA 4MO2A 1TIKA 1LQTA 1D4AA 2PGLA 4KVGA 1RM4A 2ZUUA 5EPEA 1L7XA 3A3NA 3LC7O 1QDEA 2LKDA 3U4HA 1AG9A 3I73A 3RRMA 4A23A 4EKNB 3W2HA 1OLXA 3EZFA 4RF4A 2RH8A 4Z4IA 5JZVA 1HX7A 3M5CA 1E1YA 3ZDDA 4B43A 2VSXA 1XZCA 4PFKA 1JQ5A 3BIFA 5FF9A 3UAYA 3SWWA 3IODA 2V0CA 2ORYA 3W3AD 1U6IA 2K5UA 1DQPA 1MTOA 2IT1A 4E14A 3BXEA 3KR0A 2QS9A 1PT5A 3N9IA 4B4OA 1BMTA 4S2EA 4DHEA 1FNDA 3FOFC 3MCTA 4I1OA 4N4AA 4DLBA 5K4GA 3KEFA 3AB8A 2JGEA 1C9DB 1GUBA 4YT8A 2C7PA 1NOJA 2YFYA 2Y4NA 1T1RA 5DLDA 1GU0A 2OLJA 2CL5A 2YASA 1NNEA 1NU8A 3KZKA 3HA2A 3OUTA 4L6AA 3W2IA 3VNUA 1RTTA 4CF3A 1FTQA 1I51A 5IVKA 4OP2A 4N5HX 5E9WA 1YGYA 2EL9A 3VFDA 3U9TA 2PZEA 1UKEA 4CCWA 2G77B 2PRKA 4D9CA 4QXPA 3E5HA 3H5TA 4BMDA 5MGBA 2UUPA 1QQ5A 1IEQA 2EFCB 2QMYA 2NGRA 4N7JA 1RJWA 1VRVA 2I71A 5A06A 3A7EA 4G3XA 2GWHA 3LPDA 1ZD4A 1Z4JA 2CFOA 1D6SA 2GBCA 5BUSA 1FU7A 2J46A 1C29B 3HKEA 3PENA 4DDKA 3D6HA 3ZVKA 5ITZB 4ITVA 4PYQA 5TGTA 2YVUA 3UW3A 2E1PA 3ONFA 2GPNA 5ECDA 2HK6A 2VDOB 4FKBA 3QG1A 4CMEC 3JASA 4ZALA 4HEHA 2J9RA 4IVQA 2HJRA 3WOVA 2IDZA 2D13A 1K66A 3EZNA 3FTCA 4DLAA 1U0OC 3RS5A 4KMSA 4WOJA 4DUGD 5HUQA 4TXMA 5IH7A 1WABA 1XVLA 4IZHA 2LCFA 4P2GA 3QWIA 4F60A 3I2YX 3IVRA 4HGNA 3E9ZA 1CRWG 1MOQA 3REQA 1ICEA 1GEEA 5JS2A 5CB8A 2HTFA 3ZCPA 2VRCA 4PQRA 2PK3A 1JZSA 1E96A 1AOXA 2BSXA 1VKOA 4KYTA 1HNXB 2GN2A 1P1HA 4Y2XA 2FMXA 2YQZA 3CLUD 5JCPA 4Y18A 3ITKA 2OBNA 3O92A 2AEJA 3MLEA 1I3NA 4K28A 4JGIA 2I3ZA 2IHBA 2J30A 2VG8A 5K2OA 3OQMA 5F5LA 4Z3DA 1Q15A 3FY4A 3PE4A 3KQKA 2F90A 2GTPA 2OBFA 4US2R 1YQWA 1JAYA 3EPHA 2QN8A 1ILEA 2I6UA 3C5WP 4EKEA 4RPKA 3RSQA 2NG1A 2I4OA 2VP3A 3EMBA 1BN7A 4NARA 2QK4A 1J0DA 4EJSC 1GG2A 2G5PA 2I2BA 1A5AB 2PTHA 1AKQA 3PGMA 4NV1A 4C3UA 4NPAA 4YAKA 2VT6A 3UCXA 2Q0QA 4M8IA 3C7AA 4M1ZA 1GL7A 2A4MA 4WY5A 2R2AA 3PWSA 2HIHA 1C30B 1J2JA 4ZIRB 2DBZA 2Y1DA 4YRSA 4IJMA 5JPCA 4DB4A 4S24A 3FM9A 5AI9A 2DERA 1NJFA 3FNBA 4YEDA 1OKKD 3EVZA 3LDHA 2YIMA 2IV7A 3SMQA 1JU4A 1NMYA 3U3MA 3ND9A 2EYUA 1QHEA 1ZNXA 2MT9A 2OQIA 2ZSDA 4C6TB 4EYQA 1PDOA 4RW0A 1QHIA 2C3MA 3CV3A 1IE3A 1Q7EA 3KKPA 4I08A 5FA6A 1OH6A 4X6LA 4I9FA 3SHQA 4Q93A 4WDQA 5BRAA 3TXYA 1BJRE 1TTTA 1I13A 5C2JB 4A0QA 1X7XB 2DCMA 2X8JB 2XE6A 3IHTA 3KJNA 3R1IA 4JP8A 1YRWA 1KIAA 4DUYB 2J7KA 1UXKA 3IT3A 1PR2A 1E6CA 1S4QA 3P9PA 5K0FA 5HIJA 2WJWA 3QYJA 2DAPA 1XYGA 2FW6A 4KH0A 4UMEA 4RM3A 1G59A 2PZGA 5E7MA 5GM2A 5EIEA 4Y1FA 4RTOA 1NFFA 4D43A 5EEGA 1TYDE 1KY3A 1JIJA 3ORYA 1IATA 4YB8A 2YUIA 1CR0A 1JJFA 3IUJA 4XDGA 3WG9A 3PQ7A 5FTKA 4XM0A 5KAPA 1EI9A 5M29A 4N49A 1Q0LA 1NBMA 2ZJ6A 3LX5A 2BFNA 3A6KA 4OXKA 4EGSA 3G7UA 1FUEA 3QM1A 2A9RA 4X1IA 2DHDA 2DZDA 3IIMA 2PXAA 2WSSD 4B6FA 4D8XA 3MERA 1M6EX 1RM0A 2CMHA 4KUEA 2K2QB 4KIWA 4NESA 2G6TA 1GZHB 2QPOA 3L41A 3IKMB 4AYTA 5KKNB 1Z4NA 4G26A 5TDHA 2BISA 2C99A 1SKYE 4PYRA 3TQFA 1QG0A 4KWCA 2JJQA 2ZI5A 2P65A 4E0BA 1R3UA 4MRRA 3R75A 1SXGA 2ZYHA 3OFSA 4MWOA 1RC0A 5BR1A 1TVKB 4NAHA 4REQA 1NE2A 3FDJA 3DL7A 1KEWA 4B0PA 5KYWA 3NIWA 5B64A 2IHTA 4KQXA 2WYIA 3N87A 4AMBA 3THYB 5DOVA 3W9YA 5B7GA 2CXQA 1DIHA 3T06B 3PPXA 5ICSA 2RD2A 1OSNA 4BY9E 1DELA 1FCJA 3KNZA 3O8LA 3F5FA 1PEAA 1CUDA 5KJ6A 1H2WA 1R0WA 1OZGA 1ODLA 4FJ0A 2X19A 4AZWA 3PPYA 4IH9A 4INOA 2EGHA 3LLCA 3NNNA 4HN2A 4K9QA 2H5JA 1KXJA 1Z0DA 2I62A 4GUDA 1KIMA 1LC3A 3UK6A 4R8MA 3EPKA 1U9IC 4P81A 3LC1O 4CT0A 2RHLA 1PWEA 3EDRA 4JN6B 1U3CA 2A1TR 4O2RA 1PBNA 2C03A 4R71A 3HJFA 4J3JA 2B0JA 1PS9A 1XD8A 3BSFA 3T5GA 3I34X 4TKMA 4KGDA 4BDSA 1U6JA 2P0AA 3FWYA 4G0NA 2FCRA 2Q28A 5TNXA 3RYCB 2FPIB 4KJZA 5KPDA 3WADA 2Y1KA 2CMGA 1VECA 4KZPA 4NF2A 3PGXA 2WV7A 5KREA 2XCRB 2XGMA 1JXOA 3FGNA 1B8VA 3N2GB 1RYNA 4U2CA 5DYYA 4MKGA 4BJ5A 5B2FA 5CDGA 5CJJA 1EFPA 1Z73A 2VHVA 1UR5A 4ZEXA 1T2EA 1CY0A 2XUQA 3D6FA 1WDTA 1X8LA 1A04A 1D2HA 1V3QE 1O6BA 4CETA 5DB4A 1ND6A 4IP0A 5LLDA 3RR2A 4LF9B 3UHFA 1T36B 4IL5A 1X7XA 3DDOA 1J56A 2PT5A 2R5WA 1A1SA 1QV7A 2H2GA 2Q3HA 1P61B 2IOHA 4GT1A 1CFZA 3MMPA 4HB3A 1J1IA 4O4LA 4CMCA 2GLUA 5B4UA 3COSA 2CGEA 1ZEMA 1JLLA 2H92A 4BZQA 3DAYA 2CUZA 3O1JC 1Z6ZA 2QRVB 3UXHA 3ZKWB 3E03A 2ODTX 2IXFA 2PS0A 1QSGA 4I55A 3QXGA 2OCDA 3DE5X 5J43A 5EIFA 2NWQA 4MWGA 4R1PA 3OY7A 3B6KA 2WRZA 4JA0A 2XJ4A 2Z1DA 2P4UA 4R1UA 2NUTA 2H6EA 2QTGA 4UBMA 2H1IA 2I8LA 1CUHA 4C05A 2IBMA 2ZBFA 3RPEA 1U1FA 2QRLA 1UM9B 2J07A 3AV0B 3GG9A 4O2BA 3KZOA 5HGJA 2P67A 5C7LO 4L85A 4M9RA 3IO5A 4DRYA 5AK0A 4BC0A 1OV6A 2WYVA 2FFRA 2X8LA 3MJHA 2Z58A 3O73A 4D5GA 3DOUA 2FPRA 1C9KA 3RF6A 1H2RS 4L3OA 4FLMA 2A0KA 1T2VA 3EDCA 1QRSA 2QR2A 4KPUA 2V96A 3GLHB 4JI4B 4EABA 1U1DA 3WYFA 3R7FA 2Q8QA 4M49A 4PZPA 1N3YA 3ZQ6A 5JSQA 3K9FC 4KI7A 1XZMA 1CUIA 1U8CB 2X0RA 5B1IA 3K2QA 1MORA 1S3FA 2WUWE </