3D2BA

Structure of 2d9, a thermostable mutant of bacillus subtilis lipase obtained through directed evolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASSNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKYLDGGNKVANVVTLGGANRLTTGKAPPGTDPNQKILYTSIYSSDDMIVMNYLSRLDGARNVQIHGVGHMGLLYSSQVYSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermostable Bacillus subtilis lipases: in vitro evolution and structural insight
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Lipase
total genus 67
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3d2bA00
4KYVA 1EDBA 3O9VA 5JAOA 4NMWA 3Q0TA 1EXWA 4Y2VA 4BC0A 2XMRA 1PV1A 1WB5A 3WIOA 1WCYA 1M33A 5FV4A 1LPPA 4G9EA 4WFJA 3WWCA 2VATA 4UHDA 5AJHA 2BUBA 3H0CA 5EIHA 2FJ0A 3GUUA 3RKSA 4K6GA 1TIBA 2PX6A 5A2GA 3AINA 4KAFA 3V9AA 2WUEA 1HL7A 4HRYA 5AM1A 3IDAA 1C7IA 1XZCA 3C5VA 3PDCA 4AO8A 3G0CA 3WK6A 1XKTA 1KU6A 3B5EA 4OB8A 2DR0A 2BGNA 1AMNA 1LPOA 2RGUA 1EVEA 1YCDA 4G8DA 5AIBA 5ALTA 5AK6A 4N5IX 3HRHA 1A8QA 3DQZA 4BRZA 3KDAA 1DX4A 4AN1A 4B0PA 4BBZA 1U2EA 3I2IA 2YASA 4H0CA 5AI5A 4AX4A 1CQWA 2ACKA 2O7VA 5AI0A 4GHWA 2PM8A 4PSDA 4OSEA 4B9EA 2HU7A 4K2AA 5K3FA 5EHZA 5JASA 4TPKA 4P93A 4OUKX 1RP1A 4PF1A 3PF9A 4GLBA 2R11A 3I2JA 3VJMA 4H35A 3ANSA 5AM4A 2CZQA 2VSQA 5T4HA 1EINA 4CIBA 4Y7DA 3R3VA 5CBKA 1YB7A 3H2GA 3ESBA 4P9NA 5K5EA 1QTIA 1ZJ4A 5AICA 2XI4A 1XZEA 2AXEA 4HVTA 3BDVA 3DJYA 1GKLA 3H1AA 1BS9A 4N5HX 1JKMA 1SFRA 3DL7A 1RWQA 2VTVA 4RPCA 1CIJA 5CXXA 3BXPA 3D7RA 4UHBA 3O0DA 4EY4A 2C7BA 2XUPA 3V1KA 5AK4A 2GZRA 1MX9A 4IH9A 3GBSA 2GBCA 4BVKA 1YASA 4EY8A 4BVJA 1TCBA 2ZYRA 5I9IA 4IO0A 4U2BA 4WY5A 1XRQA 4X00A 3BE8A 3FLEA 3ZLVA 1P0MA 2HU5A 2G5TA 2OG1A 1F0NA 4B6GA 1BU8A 5AKJA 3CN9A 3VISA 5JZBA 1FFDA 3WJ1A 3CXUA 3HLKA 3OTQA 2PSHA 5D3ZA 4JYPA 5HK8A 1UOPA 4OD0A 1UK6A 2WHPA 2IX9A 2C58A 1WPXA 1R50A 5EHXA 1DWPA 1BEZA 3IUJA 3WL8A 1RYYA 4A23A 5ALGA 2GBGA 5JD5A 3L1JA 1ZD2P 1CRLA 5FXMA 1CUHA 3F8SA 4BRSA 5CH5A 1TAHA 1AUOA 4UFPA 3WL6A 4BTVA 5T4EA 1FFBA 1K6EA 2C0PA 2IIVA 3M81A 1CLEA 4WDRA 5A62A 4FFWA 1VZ3A 3ANTA 3WKBA 2HDWA 2E3JA 3FYTA 1VZ2A 4KRXA 1E8MA 1EI9A 1XLUA 3IVMA 1NU8A 1BE0A 5HF9A 1GGVA 1YAHA 1YSCA 4H7HA 4B81A 1XRRA 3FVRA 5J3JA 1JFRA 1CUJA 4QDXA 1XZHA 1XZKA 3D3NA 2G5PA 4NZZA 1EA5A 4G4IA 4DLNA 2VEOA 1W75A 1VE7A 1EB9A 1UK8A 4G9GA 4Q34A 3ESCA 4ARBA 1FSSA 3DLTA 4B80A 4D9JA 3G9TA 2GBFA 1EK2A 4ZGBA 2VJCA 4FOLA 1XRLA 1CUGA 1VA4A 4FHZA 1J2EA 4QLAA 4Y9SA 3IUNA 1IZ8A 3DD5A 1WOMA 1EHYA 1XZIA 3VDXA 1MTZA 1G66A 3D4LA 4KR0A 5IVDA 5AKYA 1CQZA 1BCRA 4Y2RA 4UHHA 3I2KA 3TJMA 4ARAA 2WUGA 3A2LA 3W2TA 2NW6A 1CPYA 5EIEA 4FTWA 2Y6UA 2XMBA 1GXSA 3QYJA 2XUDA 2WM2A 3JYHA 1R3DA 2QKYA 5LIPA 3G0DA 4AQDA 2XB6A 1WB4A 5CT6A 1UZAA 5ALOA 4U2DA 4OYLA 3W05A 2EDAA 3FNBA 3ZWQA 5AM5A 4BVLA 5AHXA 4NVRA 5SYMA 1YS1X 1H2YA 3K9BA 4C4YA 1SCQA 1CEXA 3C6YA 1THGA 2J3QA 3VJLA 3FCYA 2B9VA 3QZUA 1CUAA 3FSGA 2WJ4A 3D0KA 1GZ7A 1B41A 5BWCA 1R9MA 2RHWA 4F5ZA 1H2ZA 5AKZA 2X5XA 3KOOA 5HZGA 3WK8A 2PKYX 5EGNA 3ZV7A 3LP5A 2JEYA 2YXPX 3H2KA 4GBGA 4QDTA 4ITVA 3H04A 2W6CX 1LPSA 4EY7A 3T52A 4UBLA 4MEBA 1ZOIA 1CFJA 1X2EA 4MEAA 4CG2A 4G4GA 1JU3A 4BTLA 5AOCA 1CUBA 3BIWA 3WLAA 1W4LA 3VVLA 1SC9A 5JADA 1LNSA 2HHAA 4C4XA 4TGLA 5HFAA 3DS8A 4DMHA 5AM3A 3OM8A 3EBLA 4CCWA 2W22A 4JEIA 1XFDA 1OILA 4M0MA 1U4NA 3H17A 1XZBA 4ZRDA 3WK5A 1E66A 5CURA 1UOQA 1B6GA 1GPKA 5FPPA 4H7DA 5AM2A 5LZ4A 3QM1A 3IBTA 1JT2A 4J03A 5ALDA 1UT6A 1J1IA 3NGMA 4C4ZA 2PL5A 3U0VA 2PUJA 4W1PA 1JMYA 3AIMA 1U8EA 1ODTC 3T4UA 3ESAA 4J3JA 1MNQA 1MX5A 3MUOA 5BWBA 3AFIA 3UUEA 5KWJA 4ETWA 4BCBA 2XMDA 3I6ZA 2X8BA 2OGSA 5ALVA 1TRHA 4L3WA 1XQVA 4JYMA 5FP0A 2H7XA 3I28A 1Z68A 5A7HA 3UMJA 4Y2XA 1CR6A 3IA2A 4X92A 4DNPA 5CH3A 4DMCA 3FLBA 2WFLA 2WFMA 2QUBA 4BCDA 1A8SA 1QONA 1AKNA 3PFBA 4CIAA 4GW3A 1J07A 3D2CA 2Y2UA 1QIDA 2G63A 4UHFA 2ACEA 4X6UA 3AZOA 5EIAA 4MQMA 4LXHA 3D5EA 5ALPA 1AQLA 5JAUA 3M3DA 4E46A 1MAHA 1HLGA 3AZPA 4IQ4A 4P92A 2OPHA 1W6RA 4GECA 2OCLA 2YYSA 4GXNA 3WA7A 4QEKA 4BDSA 4KEAA 5ALKA 3STXA 4UHEA 4X95A 3E1GA 3MVEA 2XUQA 3LCRA 2QT9A 4EHBA 5DJ5A 1ODSA 3KWJA 5ALNA 2XMGA 2CMFA 1NU6A 4C6HA 2PPLA 4OB7A 5E2IA 2HFJA 1CUUA 2RONA 2GYUA 1N8SA 1TQHA 4E15A 1N5RA 4J0HA 1GPNA 3C87A 5DNUA 3RARA 1ZGCA 4X90A 1GQSA 2C5GA 3C43A 5ISMA 3WKAA 5ALFA 2V97A 4I3FA 3HEAA 2DQYA 1UXOA 1XRNA 3LIPA 5E4YA 5AKGA 5ESRA 1QIHA 2XUHA 2H1IA 1FFEA 2GZSA 4UUQA 2PSEA 4PNZA 4KACA 2HU8A 1ZD5A 1IZ7A 3EIOA 2OGZA 3VXKA 2WLSA 5ALEA 1FFCA 1LGYA 2V96A 5D7BA 1QO7A 5DYWA 2PBLA 1F8UA 4WDQA 2QZPA 2WHRA 3NOXA 1PJAA 5DWDA 1YAJA 5ALMA 1ZD3A 4B83A 1A7UA 5LYYA 3R3XA 1EDDA 4NS4A 3OOSA 3H18A 3H2IA 4ROTA 4X91A 1SCIA 2ZYSA 4BCCA 2XQJA 4KE9A 2Z5GA 3PUHA 3WWDA 1EDEA 3WMRA 2R8BA 1EB8A 4BDTA 4LYDA 4KE6A 4XWGA 5YASA 3DOIA 1Y7HA 4BE4A 4Y2SA 4XX1A 3A2MA 3HZOA 4FBLA 1HDEA 2XQFA 2J3DA 3K2IA 1OXMA 1SOMA 5FRDA 4CG1A 4X93A 4QE3A 4BP9A 2CBGA 3V48A 1H2XA 5AK5A 1TCAA 4X71A 3GROA 3I2HA 4MXDA 2DQZA 2OCGA 4GEGA 4G8CA 5LP1A 3D59A 4Q3KA 3GELA 1WB6A 3RM3A 3NUZA 4JH0A 5A6VA 1QIJA 5DYYA 4UFOA 1UK9A 2HA7A 5C8XA 3WK9A 4DMFA 4QZVA 1P0IA 4XJVA 5E4TA 3SX4A 5ALHA 2XUJA 3ZI7A 3TRDA 5AOBA 4YK7A 3DDUA 5ALUA 3E3AA 3PFCA 4DM7A 3EQ8A 2FUKA 3A70A 1WPRA 1H2WA 1X2BA 2I3DA 3L1IA 2Z8ZA 1A88A 3IUQA 4JNCA 4Y2TA 2XUOA 2RAUA 3WJ2A 1S8OA 4QDZA 4H18A 4KRYA 1G4HA 3C8DA 3H19A 4RE6A 1THTA 2OXEA 3C70A 1BROA 5DTJA 4HXGA 3ZLUA 3HACA 3STTA 1F6WA 1TK3A 4BAUA 1XZJA 1N5MA 2QVBA 3VKFA 3N2ZB 4J0KA 3U1TA 4FLFA 3WL7A 3R3UA 5EHNA 4AMYA 4G5XA 1VE6A 3P2MA 2QR5A 4JUIA 4BAGA 3SC2A 4C88A 4OU4A 1QOZA 4Q3OA 1TKRA 2BJHA 1UK7A 1XLVA 1ZIXA 1ISPA 2ONCA 3FLAA 3C5WP 1XZGA 4ZREA 4RGYA 4F21A 1MO2A 4KE7A 2O2HA 5A71A 1QIIA 2HA0A 3YASA 2QXTA 1UWCA 3G0IA 3FCXA 3FYUA 1DINA 5KBYA 5ALLA 2ZJ6A 5CT9A 4LKOA 3KWFA 1Y37A 5KREA 5IVHA 2RHTA 5HF8A 4EY6A 4X6YA 2AJLI 3O9MA 4AMZA 5C81A 2PU7A 3TGLA 1KEZA 3G7NA 2JF0A 2VJAA 3HABA 1W1IA 3STVA 4TVKA 3WWPA 5AKLA 4HRXA 4GDMA 5AKIA 4AB1A 1FJ2A 3FYUC 4E11A 5C8ZA 1BEEA 4BAZA 3CCCA 1AGYA 4AO7A 2OAEA 4N8EA 1MAAA 1XKLA 2CJPA 2HA2A 4UBKA 2AJDA 2DSNA 3W9UA 4B9AA 1HPLA 4LIPD 4DNQA 1BN7A 3WK4A 4BC1A 3BF7A 3GFFA 3AUKA 2HRRA 1O6FA 5D6OA 2H7YA 4U2EA 1QLWA 4KE8A 4FWBA 4KJXA 1ZI6A 4OU5A 2WFLB 2WJ3A 3FAKA 1ZIYA 5HCUA 4N8DA 3I2GA 1XROA 5I7UA 5EFZA 4WFIA 4DSZA 1HBJA 1EX9A 3LS2A 3QMMA 4Y2QA 2Z8XA 4OCZA 2GBIA 4Q05A 1ZICA 5ALXA 4XIIA 4X3CA 2BUCA 5BV7A 1DQYA 2HM7A 1Q0ZA 3KXPA 3C45A 2D0DA 2QJWA 1CUVA 1VOTA 1XRPA 2JGFA 2IITA 5LZ8A 2QS9A 2VQ6A 4H7EA 2WIJA 4HAIA 3WWOA 5HKBA 1YR2A 4B7ZA 3WK7A 2XMCA 2QMQA 2VT7A 1QIFA 2OQVA 2OLEA 4GI1A 1DT3A 2J4CA 1CUWA 5LZ5A 3R3WA 3QITA 2HA3A 2ZYHA 2CEKA 5LLSA 2HL6A 1H22A 1DTEA 2XQIA 3H1BA 3FVTA 4QWWA 1CVLA 4RE5A 3G02A 1BCSA 2XMQA 4K5QA 4DYHA 3R3YA 2JEZA 1Q0RA 5ALYA 4RNCA 5ALQA 2ES4A 2RIPA 5IKXA 2Z3WA 4CG3A 1ZD4A 5LZ2A 4UBNA 3ICVA 2CKMA 1AX9A 3HI4A 4W63A 1XQWA 2H7CA 3UUFA 3QMWA 3STUA 4X85A 1LPMA 4FFVA 1DT5A 4DNOA 1F0PA 5HK9A 1WHTA 2HADA 2Q0XA 4BZWA 3A6ZA 1T2NA 4ZXFA 4FBMA 3STWA 2PU5A 1K5PA 2BKLA 4Y2JA 4UBJA 4FNMA 2K2QB 2OQIA 4G8BA 4M0FA 2WJ6A 1E89A 1L7RA 3RLIA 4WY8A 3I6MA 4K6HA 5JYCA 3ED1A 2ORYA 2JGJA 1CUDA 3IULA 3I2FA 4ZI5A 1JI3A 4K6KA 4Y2PA 4B82A 1VKHA 2ZVDA 2H9YA 1JJIA 3MUNA 5H3HA 2BAGA 3QPDA 4AO6A 2VAVA 3JWEA 1DQZA 3FBWA 4F0JA 2EEPA 4H7JA 1CUZA 4MWTA 5DLPA 2XQGA 5CT4A 5F4ZA 1E8DA 1IVYA 4Y2YA 3PI6A 3O4HA 4MYDA 1CUCA 2AJ8A 5LZ9A 2I78A 1MJ5A 3I1YA 5JATA 3C6ZA 1MPXA 5ALJA 1FFAA 2FJPA 3VVMA 3WQHA 1CUXA 2BUAA 2O2IA 3FWHA 4LXGA 4PQEA 2QTBA 1LPNA 4A16A 5AP9A 4IHAA 3S2ZA 3Q8WA 3JW8A 3FYUB 2XMZA 5HQ3A 2XLBA 4QLOA 5CW2A 4Q1VA 3QH4A 1QZ3A 4UHCA 2BCEA 5DNVA 1BRTA 1ZGBA 5LKAA 2XDWA 2EDCA 3F9CA 3D2AA 1G42A 2HFKA 4B84A 1JMKC 3DYIA 3O4IA 5C8VA 1QIKA 4L9AA 3WL5A 2XUFA 1XQYA 4Z49A 2WHQA 1JJFA 1UOOA 6YASA 3NWOA 3QPCA 1LBSA 3L1HA 3BF8A 3V1LA 1EVQA 4UBIA 1I6WA 5ALSA 5K3CA 5HF5A 2O7RA 3I1IA 1VXRA 2ZYIA 3GZJA 5JAHA 1C4XA 5JAPA 7YASA 5C7YA 3HC7A 1IUOA 3O4JA 4X94A 1LZKA 2J4FA 1K63A 2JGIA 4M0EA 1WM1A 3OC0A 3DL4A 3KD2A 5FKJA 5EHQA 2GYVA 5CT8A 5FOQA 5AI4A 2WSLA 4QNNA 4OYYA 4X6XA 2QOEA 4ZV7A 1L7QA 3HXKA 4OB6A 1Y7IA 2V9ZA 3MGAA 3AILA 2GYWA 3A2NA 3F97A 2I3ZA 3IUMA 2UZ0A 1QO9A 3WKDA 1K4YA 2Y1KA 4I19A 4Q82A 4HXEB 1QJ4A 3D2BA 5BOVA 3W9BA 4PO3X 1W52X 2XT0A 5JIBA 2RI6A 1GQRA 5AI8A 4BP8A 1PFQA 4EB0A 2WIFA 4DTCA 4WCVA 1CUSA 1A8UA 2LIPA 2QRUA 4L72A 4BE9A 3C8HA 4OPMA 5JD4A 1J06A 2WILA 3LLCA 3O95A 4HTAA 1E3QA 4EA6A 3OPMA 2WKWA 3R41A 3DCNA 5AKEA 1ZI8A 5EI5A 4CI9A 5ALWA 3V1NA 3PF8A 3R40A 5KWIA 5FUMA 2I03A 3ICWA 2B4KA 3IURA 2HA6A 1GT6A 1ACJA 5CH8A 4DGQA 3HJUA 4FNGA 2QXUA 4J0DA 4FMPA 3O4GA 3BJMA 2WG0A 5JZSA 2WHPB 3B12A 4EY5A 3IB3A 4G1FA 1L7AA 2ZSHA 3WKEA 5AH0A 4QWMA 5AOAA 1CUYA 5D3KA 3G9ZA 2WG1A 4XVCA 4LYEA 2C0QA 4CFSA 2WUFA 2HRQA 3R3ZA 5CT5A 1ACLA 5JALA 1IUNA 2JGKA 1TCCA 2OAGA 3C6BA 5AKHA 2PVSA 3N0TA 2QJRA 1K8QA 1YB6A 3QPAA 4WFKA 3C6XA 4FLEA 3BIXA 3W06A 3F98A 4H7KA 5JD6A 1UKAA 5JARA 5ALIA 4DMKA 1DWOA 1R88A 4I4CA 5E4JA 3M82A 1W76A 2Y6VA 4W9RA 3BJRA 4DSAA 2HA5A 1QTRA 1YA8A 2WIGA 5K3AA 4LXIA 4J0IA 3G9XA 1MNAA 2HIHA 5AI9A 1XLWA 4KAJA 4H7FA 4O08A 1DX6A 3I6YA 4U2GA 3TEJA 5IVIA 3CN7A 1ODCA 5LZ7A 3E0XA 2WIDA 2VA9A 1VA5A 4C89A 5AKKA 3GA7A 4AZ3A 1DU4A 4U2CA 4QA9A 5AKXA 1QIGA 4LHEA 4YPVA 2B61A 1KU0A 2ROQA 3BDIA 4W1RA 1T4MA 3BL8A 4IH1A 1IMJA 1CUFA 1NX9A 2JGMA 5K3EA 3DOHA 1P0QA 2VJBA 1D07A 1QGED 1SCKA 3LIIA 1IUPA 2O2GA 5K3FB 2WQZA 1EH5A 3WZLA 5AI6A 4ZWNA 4MJ3A 4BATA 2WTMA 4YASA 1Q83A 1C7JA 1QE3A 1Q84A 3QVMA 3OG9A 3AZQA 4QDOA 1LLFA 5HKAA 4PSCA 2ZJFA 1XZDA 2WFZA 3R0VA 2AJCA 3S8YA 4MQLA 5DNWA 3H2JA 2XE4A 3DYVA 2QM0A 3FSGD 3EQ7A 4AZ0A 1JU4A 2DCMA 3WYNA 5LKRA 1LPBB 4A5SA 5HQ3B 5AM0A 1VLQA 2BGRA 1HKHA 1QIEA 4UFNA 2VAXA 1UFOA 2VF2A 1P0PA 3EF3A 1VJ5A 2ZJ7A 1HQDA 5T4FA 4BYMA 2JBWA 5AIAA 2WG2A 5CMLA 1E5TA 3KSRA 4FKBA 4J0CA 2VT6A 4J0GA 5CRIA 3DEAA 1QIMA 4PW0A 1WHSA 3DKRA 3B3QA 4DIUA 1UKCA 2XQKA 4C01A 2QUAA 3K6KA 1QFMA 4B85A 4UPDA 1XZLA 4IH4A 4HS9A 4L0CA 4MWSA 1XZMA 3WKCA 3BWXA 5HF6A 2DHCA 4V2IA 4X7BA 2WU3A 3AIOA 3WZMA 3PICA 3G8YA 3E4DA 3DNMA 3WIBA 5IVKA 4AN0A 4CCYB 4B0OA 4P08A 4AXBA 3W04A 1USWA 4G4JA 2JIDA 4EUSA 3SWWA 1LBTA 3PUIA 1XZAA 3AJAA 5ALZA 5CTAA 1AURA 2ZSIA 3IIIA 4ZV9A 4UBOA 4BB0A 3VJKA 1GKKA 3DKKA 1XQXA 3ESDA 5T4BA 1CUEA 2XMSA 2C5FA 4DNFA 4S0XA 5A7FA 5HFNA 1LZLA 4HXFB 2DHDA 4MYSA 3FOBA 1XRMA 1U65A 1XZFA 2OCKA 5FPQA 4H77A 3G0BA 2WTNA 1R4ZA 1MN6A 1CUIA 2JGEA 2OCIA 5K3BA 3RK4A 4H7IA 3X3HA 1CV2A 1QFSA 2FX5A 5A7GA 4PV7A 2WUDA 3QMVA 2Z3ZA 2YH2A 3V1MA 5DYTA 3ZLTA 4FDMA 4J7AA 5DTIA 1AC5A 4UBMA 3AIKA 1X70A 1ETHA 1YA4A 2HA4A 2PSDA 4HZGA 3HSSA 2X76A 1BN6A 4YX9A 2PUHA 2PSJA 4INZA 4J0JA 5FDFA 5CXUA 2WU4A 3M83A 1EK1A 3OURA 4PSUA 4X97A 1MT3A 3F67A 4GWLA 1YS2X 1VXOA 3G9UA 1DWQA 5K3DA 3PE6A 2OGTA 2JGLA 1AZWA 3ILSA 4FLMA 3WWEA 2CUTA 4BZZA 3G0GA 5JZ9A 2XUKA 3ZPXA 5JANA 5ALRA 5SYNA 1GPLA 3EQ9A 4W1QA 2D5LA 4CCYA 2CB9A 1ZJ5A 4Q3LA 3CCBA 5IH7A 2ECFA 1MU0A 4Y2UA 2VJDA 1R9NA 2P8SA 3HYSA 1R1DA 3WA6A 1O6GA 3WYDA 2V98A 1ORWA 2XUIA 4KAAA 2XLCA 4EZIA 4N8SA 4W1SA 1LPAB 2XUAA 5AK3A 2DFPA 1E8NA 2BFNA 3WI7A 1ZI9A 4QDUA 5FLKA 3QBJA 4WJLA 3F96A 2B20A 2DHEA 1N1MA 4E14A 2PSFA 4EBBA 2AJBA 2Y2VA 1H23A 1ORVA 1UKBA 2XUGA 4C87A 3H2HA 1JJBA 1G5FA 2G4LA 5AO9A 5I8PA 4U2FA 2C4HA 3STYA 3SK0A 4F60A 1OCEA 2WIKA 1MX1A
chains in the Genus database with same CATH superfamily
3FPLA 2QLBA 3ZOZA 2DBVO 1QRTA 3DC7A 3TRIA 4BLWA 1NE2A 3MWEB 1RJ9B 1FDOA 4MB0A 3FJ1A 4YRLA 3RIMA 1VLHA 1BU5A 1JJAA 4JHXA 4OHXA 4RM2A 5FJIA 3I8OA 3I37X 3ZWMA 5LCXA 1S2MA 4HDRA 2BKAA 2ZBEA 2XZDA 1PV1A 1SCUA 1RYEA 1WF6A 2ZRJA 2LP4Y 1CF2O 4FGZA 4NAVA 1H0SA 3REOA 3KKLA 4CRWB 1TYZA 4G9EA 3PUXA 1NAIA 3DSRA 4MR7A 3PDIB 4WFJA 4WV3A 2VZ0A 4MS3B 3URKA 4JP3A 3EXAA 1DDIA 1G8KA 2BUBA 2XNSA 4B6RA 1GAJA 4IX9A 4BWYA 4DG9A 4EFKA 3IPYA 1T2UA 1OHHD 4Q9AA 1P91A 5FT9A 1EFVA 1YVDA 5JTTA 3ZVMA 1EEHA 1G6Q1 2IYFA 2WK1A 4KVGA 2WJVA 3OCYA 1RM5A 5TS2A 3TSOA 4TV8F 4P84A 3EE6A 3MAJA 4P0TA 3BWMA 5KJFA 1A9YA 2AR7A 3ZZTA 3S68A 4OKSA 3U7EB 1ZC3A 2P3LA 1BXRA 1UPAA 1HV8A 2CLSA 3AXSA 3ENWA 3HN2A 1UT5A 2CUNA 1WPQA 4HX5A 3UNXA 4YAGA 1U7TA 4TV9B 1OGYA 1IAQA 1WOYA 4A2QA 2GESA 4P38A 4ESEA 5J47A 3OLYA 4B3IA 4B1FA 3DCIA 1I4WA 1DKQA 3C5VA 3V46A 3WLLA 1DL5A 3PGJA 3PDCA 3WGMA 4AO8A 3LPNA 5F3RA 2JJ8A 2ZE5A 3HZRA 4MDEA 4LPSA 3RQSA 5KSPA 1ZG3A 1ZN8A 1OI4A 2DR0A 3SVLA 2QMZA 2PH3A 1NLZA 4O2BA 5B6PA 4EG3A 1YCDA 4G8DA 1AXGA 5AIBA 3MYYA 3VI4B 2Y0DA 3HCBA 5LVAA 3L01A 3OEWA 4N5IX 4G81A 2ZCJA 5IBRA 5FAXA 3ZHZA 3EA5A 5E6RA 4YYZA 5I7HA 1GR1A 4ACBA 3B1JA 1UMDB 1K0UA 4GOMD 3GAMA 4BRZA 2FPUA 4O4LF 4MIKA 5FF9A 4D9GA 1NVKA 4LHSA 1HMYA 3ABSB 3IYLW 4JNKA 3ITEA 5CM8B 5KNDH 3L7DA 2WQ7A 3AQIA 3I2IA 4R2JA 5F64A 3SSAA 4CLHA 4HWTA 6ADHA 3H83A 1J22A 1E9FA 1DCKA 1NYRA 1ZHHA 2ZWMA 4X1YA 4L76A 3OI7A 3A3YA 4NU6A 4FCWA 1CQWA 4FFDA 3DFKA 3HDGA 2HJWA 2VLBA 2X0FA 5DFAA 1F5NA 3KL4A 1U4SA 1YRWA 2MSNA 3FYHA 1NZDA 4PSDA 1ZX1A 4TX1A 5G2OA 3EIQA 1W46A 2DBRA 3NG1A 1SXGA 2I8CA 3DMDA 4LTMA 5B7QA 5EHZA 4LZAA 5CIYA 1TO1E 2EJBA 1QWOA 4TPKA 4MUGA 1BA2A 3U3XA 3WGKA 4BO3A 4IAOA 1L4BA 4P36A 5E38A 4XFJA 2ZIUB 3BGIA 2A67A 4GLBA 2B92A 2R11A 3I2JA 4EJSC 3FYSA 2B7BA 1SXQA 1N32B 2OWDA 4KOAA 2CZQA 1W5SA 2G9QA 1B0PA 2VSQA 4GI2A 4OHUA 2PJDA 2R1TB 1EINA 1AXRA 2WF5A 4HX2A 4V0LA 4ZC1A 2PYZA 1B8PA 2R8EA 3FHOA 4WLNA 1ZHOA 3PYXA 2TMKA 4IQGA 4DRYA 1QMPA 2BSQA 1T6YA 1ZMOA 3TDKA 4HFNA 4AF8A 5CBKA 1HNXB 4JFRA 3QUTA 4PC7A 4J29A 4FCCA 2R6GA 4G9BA 3OCCA 1C7EA 1FXWA 3QY9A 3JSAA 4KBFA 3QWIA 4Y8VA 4F12A 4PGMA 2C7RA 2W2OA 3PD7A 2PT9A 4NXNB 4FSDA 1QTIA 3QA9A 1B93A 1Z6QA 5CD1A 5A4JA 4NKRA 4N03A 1WPGA 1MQAA 1R6BX 3T3HA 3ZE7A 1G55A 4D79A 3MG9A 4NMHA 4HAUA 1JLRA 2ZTLA 2X1VA 3NZEA 1XMJA 3DJYA 5CDGA 2GPTA 2VKTA 3JQFA 3NHUA 1WDLA 3OZIA 4PR3A 3TL6A 3FI9A 2VTVA 4IZIA 5CXXA 1CIJA 4RYDA 1T36B 5EKUA 1S0UA 1SCAA 3BXPA 4LC1A 5LJIA 1XHFA 4WNYA 4RPHA 1PUJA 2J0UA 3DB2A 4R9SA 5ECDA 1YQGA 3VKVA 2CJYA 1NMQA 1DARA 3H42B 4E08A 4G1CA 4EY4A 1E3WB 3G89A 4TV9F 3WGVA 5DX8A 1KH1A 3DOFA 2PZLA 4IH9A 2HJGA 4D4JA 3O84A 5LU8A 1NI4A 4O2AA 2NZXA 4FJ2A 1H3EA 2J3KA 1U2DA 3KEOA 4BVJA 1QH0A 2H6EA 2V6GA 1LSUA 3LDFA 4G1MB 5A06A 1CK4A 1BWQA 5AW0A 1KIMA 2PV0A 1NW5A 1Y3CE 2AOUA 4NU0A 4F2DA 1W88A 4QYMA 4WY5A 3HV0A 3RSOA 2EFJA 4RZ2A 1XRQA 2P90A 4BRUA 1FYDA 4GYYA 2PWPA 3N2IA 2J9FB 4AUNA 3P9CA 3BE8A 4XWYA 4GAEA 4DV6B 5EAIA 3BKWA 3O8QB 1P0MA 2QTCA 2YJNA 2YX1A 3FWPA 2A4KA 3D3JA 4R9UC 2ISSD 4MI6A 2Q1WA 4F5DA 2LBPA 3EIXA 2OG1A 1J8DA 1F0NA 1MT0A 1WXWA 1JZSA 4B6GA 4AJ1A 5L4SA 3A8TA 1G16A 4RA6A 1QYIA 5DW0A 1FFDA 4RZUA 4DY6A 4I1IA 1GKUB 1IDN1 2Z3VA 2GEVA 1C41A 1NP7A 2C7QA 3ABQB 3GD5A 3ZHTA 3HJFA 3FHTA 5D3ZA 1GRNA 3A6PC 1U1IA 1XPJA 3HHPA 5HK8A 1ZR2A 1T24A 2CL0X 1K7FB 4KQ6A 3U4HA 2C58A 2VL7A 5EPOA 2IOQA 1FMTA 2H4YA 1R50A 2O3RA 3FNHA 1IEVA 4I6EA 4ER7A 1DWPA 4EITA 1BEZA 4XSGA 1HE8B 3WL8A 2F4NA 1IY1A 3H99A 2ZP1A 3U4AA 3A04A 4XPZA 4WIAA 3MCAA 3B1WA 3W5VA 3AY6A 5FEUA 4J9VA 3VBCA 2FNAA 4PFQA 4HYYA 1YB5A 5JPCA 1KZ6A 4N5NA 5DW3A 5JD5A 5GIPE 4EY3A 1NF2A 4DAOA 5B55A 1EUDA 4S0ZA 4R1UA 5B58T 3NAQA 3AF5A 4JJ8A 1EJ6A 2QROA 1KZ9A 4GX0A 1A8HA 2FUG6 1CRLA 3GNLA 3BSSA 5E3JA 1CZRA 3FSRA 1I01A 3TQRA 2R5NA 3N39C 4BRSA 2FKAA 4DWJA 2ZUSA 2OPHA 4BXOA 1PQYA 4J2TA 1H1DA 2Z56A 3U7IA 1F3OA 2C31A 3CX4A 1VSTA 4YV0A 1UKEA 3OFNA 1O0CA 1K8XB 1QHHB 1DKPA 4BTVA 5T4EA 3NOVA 4K40A 3ZH9B 1OBFO 2DKOA 3ZK8A 5A62A 4FFWA 4B43A 1VZ3A 1EQAA 2SKCA 2YBEA 4JROA 4L0DA 2HDWA 1Z4IA 3FKQA 3O8OA 2H00A 3TUJC 1UBEA 5A03A 3I73A 1DKOA 1E8MA 2HHCA 2PLAA 2W8BB 3FW1A 4ID3A 1EI9A 1UBJS 1Z26A 2HSZA 2WVGA 3QHQA 4G5GA 4H3HB 4JYBA 5LQSA 5A1TA 3PEYA 1E7SA 3F7MA 5WRFA 1BE0A 1E7QA 1WMFA 4E5YA 3VQTA 3NLLA 1ZH6A 1GGVA 1U6KA 1BHSA 1PL6A 2RDMA 3CS3A 1YK1A 5ILQA 1DTWB 1RRVA 4OF4A 4ZICA 4GKBA 3FVRA 3UOAB 1VHDA 3B5IA 3L9XA 1PR9A 3ZZMA 1G6KA 1JFRA 4RTOA 1PL0A 4QDXA 4E22A 4Q9DA 5JJBA 2P4EA 3LM8A 3MWGA 4IUDS 1U2PA 5CHEA 4NY1A 5LP6A 3HK2A 3HVJA 1TLLA 3L46A 2CLLB 2EKQA 1KNXA 3L7JA 1ZCZA 3D3NA 2G5PA 4MX8A 5BSUA 2IWRA 2X6QA 4NZZA 5KYXA 3I5YA 1KP3A 3PNVA 3GLFA 3P19A 4D74A 4Y18A 1PJBA 3Q5DA 2Z04A 2VJKA 4LYJA 5FA8A 2Z9BA 4G4IA 4IIUA 1KDOA 4LV8B 3AHGA 3IT1A 4DLNA 3OX1A 4TQAA 1AB5A 1UEJA 2VEOA 4G23A 1VE7A 1W75A 4BNUA 4DSTA 5KNBD 1XAGA 2MSDB 3FMVA 3G3EA 4QHTA 5EJEA 1Y3HA 1V8FA 3G2MA 1NULA 2OBFA 4MW1A 1P4RA 3CNBA 2HHLA 2VCHA 3C7TA 1JTFA 5HDQA 2Y1LA 4CL3A 2TS1A 1NBIA 2F59A 2H18A 2NU9B 5K6AA 2QM3A 3SJUA 4LTDA 1EK2A 2BFEB 4RFSA 4A6XA 1L3IA 3DE4X 3W5HA 3DE3X 2P91A 1E2IA 1PK8A 3R1IA 4UVEA 5CNMA 1CS4C 1CUGA 4Y6PA 4BMZA 3O47A 4JKOA 4H16A 1JDVA 1QPBA 4QLAA 2P67A 3L0IB 5FFFA 3W1VA 1AA6A 1YQTA 3D1LA 4HEJA 1KDZA 3UCEA 5AVWA 1LWOA 2Q4RA 3H9JA 3N1UA 5IJAA 1I4LD 3UQYS 1WOMA 4WOCA 2AFIB 3BTVA 3E15A 3DPSA 3IP5A 1A8PA 1GL6A 3Q2KA 2D62A 1N9GB 1YNSA 4KWCA 3BCUA 4LE0A 1ZS9A 1G66A 1TADA 3CUUA 1KQPA 1PWZA 3D4LA 3JR7A 5IVDA 4ZVKA 4LVNA 2YZKA 5AKYA 3HN6A 5C5EA 5JJ5A 2QNBA 4FUTA 3GRCA 3PQ7A 3GJRA 1KBOA 3NT5A 2X15A 4UUNA 3I2KA 5E1BA 3TJMA 4GUDA 4IWYA 2ZJOA 4BNJA 4FDLA 1XRJA 2I3AA 3KR2A 2JD0A 1JDTA 4LJYA 5C35A 2ZROA 1CIPA 3DAFA 4JUCA 5FLEX 1X8JA 2J8ZA 2OK8A 5EQFA 4JI5B 1X3SA 4BMDA 3AY3A 3GUVA 4JOCA 4FTWA 4IIHA 3GVIA 2XMBA 4HEA1 4KQGA 1QU2A 4N54A 4KXWA 3NASA 1JQBA 1ORTA 3DKIA 1SUWA 1W6UA 1T8YA 4HDCA 2Z95A 2BJVA 4IGFA 3WVNA 3KQUA 3M0EA 4A26A 2FSGA 2H1RA 2JLXA 1SVKA 3NYIA 1J0DA 1R3DA 2B99A 4NFYA 1PT8A 1VKRA 4DVJA 1JH9A 1RZRD 2ONYA 3F8WA 1FFYA 1JBEA 3QXGA 2DFNA 2XB6A 3IRUA 2WVAA 3KYJB 3K9QO 1UZAA 4OXNA 4C5BA 3REFA 2BW0A 1OBHA 5ALOA 1JHDA 1HO3A 2X40A 4OKIA 3BXEA 1YO6A 3L6OO 2EDAA 4RKRA 4D8VA 1VCMA 1CEQA 1UBLS 2JGDA 2XSZD 4G63A 5AM5A 1OI2A 3VYTB 3ZIAA 4BVLA 4F3KA 4WZBA 2XUZA 4MQEB 1SC6A 1LW7A 5SYMA 1A4IA 3VR6H 4K6MA 4KFRA 4D9NA 3GBPA 5GADl 3PJDA 1XQ6A 1BFDA 1XA3A 2C83A 1THGA 3T3MB 1E2PA 3FCYA 3OCWA 1IQ0A 4FI3F 3VJLA 4F92B 3FCSB 3QF4A 3T5BA 1ZN2A 3U19A 4IJWA 4LDNA 5FUVA 1C1DA 2GZMA 3SDSA 1HWYA 2E9SA 4ILKA 1FP4B 2OGWA 1GFIA 2QN1A 2F55A 3D02A 4TRRA 3WBFA 4RVGA 3GN2A 1AG9A 1B76A 1R0SA 3UJPA 1UMCA 2F48A 2C4MA 1FTSA 2I34A 1PQWA 2RHWA 3FFBA 4UXHA 1Q74A 5CGQB 3ZJUA 3I9FA 2F6RA 5AKZA 4OI1A 1C80A 2CY0A 1OLSB 3TIXB 1CQJB 3AV3A 3KOOA 1UUFA 1CRWG 2YVLA 4JC8A 2JI6A 2FG7C 4R0VA 4EA7A 5BR4A 1P60A 2GKOA 5DLEA 4RESA 2FMUA 2R6CA 3C5HA 1L1RA 2BH9A 1P7CA 4I14A 3RSQA 1NMEA 2W4MA 1AIPA 2ANBA 2QTGA 3ILXA 4CM4B 3E3LA 4GBGA 2IOYA 3BMOA 4ITVA 1XEXA 2W6CX 3K70D 3EY4A 4FOOA 3ZTWA 5I48A 1GCOA 2WD8A 3PXCX 4KDCA 5H70A 3M33A 5HHTA 3VC3A 5AUQA 1VPEA 4YAWA 1OY1A 3MELA 1RZRA 3O8RA 1G8AA 1KO8A 1OW3B 4KWEA 4MW5A 4BGEA 4JB2A 1JRLA 2FWBA 1HFEL 2EKBA 4WOKA 3DLAA 4OAOA 1H5QA 4YAOA 4DHEA 4Y6QA 4PZDA 1X2EA 2AG8A 2YBDA 3DBRB 4Z1MA 4G4GA 4YR7A 2IX3A 4BTLA 5LN1A 1MEOA 5AOCA 2A8YA 4LRWA 3V97A 2I3GA 3CEJA 3WLAA 3I76A 1W4LA 3EFHA 4Y1RB 3R77A 4X6LA 3GIDA 1LK0A 3QKUA 2J07A 5DH9A 4JLPA 4BNGA 5JADA 1V1MA 1QS0A 2ZANA 1P1JA 2QI9C 2GO7A 2E82A 3D7LA 4DCNA 1PS8A 1E1KA 4L1KA 3KKEA 4UASA 4Z9BA 2VUHB 3AR8A 4W7IA 4YQYA 4EFMA 4B6PA 2NN3C 2JAXA 3HP1A 4ZO9A 1GU7A 2GD1O 4CLXA 4NJEB 2HWKA 4DTIA 4DY4A 3EBLA 3ADPA 3Q98A 3ER9A 1MH1A 2VC2B 1EAYA 4CMIA 1J70A 2VDJA 1HSOA 2H9IA 4YRDA 3BBLA 2YVKA 3HR7A 2FA9A 4XB6B 1KAQA 1E96A 2KB0A 3HBAA 3ITKA 4DVGA 1A5ZA 4ZYTA 3U48A 3C39A 3WK5A 4JB3A 1LEHA 1E66A 2DU8A 2VPQA 1UOQA 1JLSA 4CM1A 4KQJA 1GUYA 1RT9A 2TMGA 4LRXA 4E13A 3IUYA 1E5QA 4TLCA 4X8LA 1U0FA 3DVLA 1P1HA 2Z1DA 5KDLA 1KK3A 3GT4A 3K5IA 1I80A 1E58A 2QPLA 3SZUA 1QQ7A 1G8GA 1T4CB 1IH8A 3IBTA 1PJ3A 3JARB 2WYHA 3OPQA 4YT5A 3U9SA 1AKQA 4UUOA 4HVLA 5JRDS 3PV0A 2UUCB 4IDQA 1N5LA 1T43A 2D74A 5FA6A 4PCAA 4NXMB 1E4OA 2AXNA 1I2MA 2AZ4A 3CUKA 1TO6A 1DIBA 1MDBA 1Q7BA 2HF2A 2N42A 3LQFA 4MCHA 4UU8A 4ND6A 2R68A 4C4ZA 5A0FA 2QP9X 3N6RA 1NKVA 3QELA 4DHWA 3Q0IA 4UMDA 1L1FA 3AIMA 1U8EA 4FFMA 2I6GA 2XZTA 3PD0A 5J2UB 2JKVA 1A5AB 3FNGA 3GJTA 4NJMA 5DBEX 3AHHA 1L5NA 1YBVA 5ES3A 3RS8A 4EKYA 1RVV1 1IG0A 4HWRA 2QM8A 5E6SB 5B3JC 1ODJA 1SXJC 3SN6A 4P32A 4PZZA 3RRZA 1QE5A 4Z9FA 5MN5A 2IS2A 4BMVA 5J23A 4F91B 3EXFB 3O3OB 4LYAA 5CHYA 3KALA 2FGKA 2XMDA 3HWX1 4AP5A 3GCGA 5J4YA 1YI0A 5DX1A 3TZ6A 4EW2A 3RI3A 4RORA 3IQXA 4KIUA 2YHIA 1SULA 1XK6A 3AUTA 4GLFA 4UDYX 2D1FA 3L18A 5FI5A 4RHUA 2C4KA 3DONA 5IDWA 4EQZA 4R7TA 5JY6A 3G23A 1XQVA 1Z08A 4G1EB 1QX3A 4BLVA 1V16B 4S1WA 4NZMA 2VP0A 3UMJA 3HFJA 3IA2A 2ASEA 4X92A 1F1BA 5F4BA 1EJ2A 3HCRA 1A2KC 1SG9A 3FLBA 1ZGAA 4XR4A 2C4NA 3D8NA 1MRSA 2XF8A 3LHDA 4F4HA 4NDNE 5F9MA 3RFXA 1A8SA 1TF2A 3DOOA 4LNUA 3PFBA 3H9QA 4DXHA 2XZLA 1BDJA 1Z7EA 4PYMA 2PO7A 2XMPA 4Z4CA 5DK4A 3L6RA 3D2CA 1TVKB 3TOCA 2G63A 1ZD8A 3JU3A 1XD8A 3N5KA 5JAUA 3KQYA 3LECA 2A14A 3M3DA 4TMTA 1J4AA 3DEFA 2IYTA 2IY8A 3H16A 1H05A 2IC5A 1SRRA 1DAEA 1HLGA 1XP5A 3OA2A 3R7BA 3W5CA 5DHFA 3E8MA 1X39A 1QHEA 1FBTA 3TTUA 5JI2E 4YRNA 5TPZA 1SD5A 3ENZA 4P92A 3ISVA 5BRAA 3X1YA 1XFAA 3GEPA 4FI3C 4S2UA 3WX0A 3VVBA 5BQXA 3JS5A 2C4UA 3TQHA 3MGBA 2W2TA 4JAVC 3STXA 3UBMA 5JI3E 1QRSA 4HDAA 2WAAA 1ZJJA 1M83A 1VIYA 3WRWA 2AOTA 4YRBA 3LUPA 1WB9A 4B17A 4L07A 2YDXA 1NVXQ 4YJGB 3BQ9A 1T8RA 2IQ5A 3JXEA 1L5FA 5JCJD 3DT8A 3ZKAA 1P5RA 2O2DA 3OFSA 2J0QA 3W2FA 5DJ5A 1ODSA 3KWJA 5K7SA 1SCUB 1Q3HA 2XNDA 2ECKA 5ALNA 3GP8A 3L02A 1FUUA 1SKQA 1G8FA 3ZCUA 4PANA 3C4QA 4C6HA 3TQQA 3ON5A 5E2IA 2B9EA 2NACA 2VNHA 3HFSA 3OCXA 4MS3A 1C7QA 1TIKA 2VCEA 2R00A 3MXTA 4CWAA 2WJYA 5T8KA 4ERXA 5ICGA 1ZK0A 1RADA 1Y1RA 2QVGA 3LBHA 1TDJA 3ORFA 1F8YA 3CVWA 4WJZA 4REQA 2V45A 1TQHA 2XE7A 1RJFA 3PQ4A 2VYQA 4QODA 3R76A 3P0RA 2CXSA 1KOFA 8ATCA 4JUBA 4DSOA 1OC4A 2W58A 5E9JA 1T6XA 2JANA 2ZS8A 2WC1A 4Z7NB 1MDFA 1OIVA 3KOWA 1ZGCA 4Q02A 4RD6A 1WXGA 2PWBA 4XYBA 5EJ7A 4JWTA 4KBGA 4MWBA 4LS3A 2C5GA 5ISMA 2FRDC 2H06A 1Z2EA 3QNWA 4KMSA 5ALFA 4IOKA 2V97A 4II7A 3E6AA 5IJ9B 1L8QA 4TL8A 3I61A 3HEAA 4PYIA 2EFEB 4PPFA 4B2IA 2ZIXB 3L6BA 2W2KA 2WICA 1VLMA 4GQBA 5LQJA 3RVBA 2F9FA 2Q8PA 4YRZA 1YK0A 1S3SA 4FIZA 4CM4A 1W9MA 1L4EA 3LIPA 1W2WB 1A50B 1IHYA 1L6IA 4L51A 1TPYA 2GEJA 4LDJA 4AXXA 1I8TA 3AR6A 4E46A 2ZBFA 2FPRA 5K4GA 2G7ZA 4DADA 4M89A 4M1SA 4RS3A 3BM5A 1L2TA 4OGGA 1ESZA 4FB5A 1DIAA 4JC5A 4IPTA 3T7TA 3O1JC 4ZI2A 1VHTA 4FYXA 2HC9A 2V7QA 5K03A 3QEMB 3PPWA 3I9V1 1W44A 2HYDA 4IGIA 4AJPA 4DZRA 3EIOA 2JHPA 2NZWA 5KDOA 5TNXA 2GF2A 1NURA 2WLSA 3QHAA 3H0EA 4AWBA 4LV6A 1PZMA 5ALEA 1FFCA 4Z9YA 1JB9A 2WNHA 3KPJA 2UXDB 1KMNA 3GT7A 3KFVA 3MJVA 2ZSEA 3WDKA 2V96A 2OYSA 1W96A 3LT1A 4MQEA 1OV6A 2CSUA 2OVFA 3CB2A 3MGGA 5DYWA 1RDFA 3VDRA 3JSXA 2QYSA 1ZNWA 2W4QA 4LC0A 4FFRA 2QZPA 4CJXA 1NTRA 1M6VA 1YD7A 5BPHA 1P2TA 5KAMA 2IWHA 4QT0A 4IIBA 5ALMA 1ZD3A 1FNNA 2KHZA 3F49S 4EPVA 1ZMXA 4KB5A 3TGPA 4P22A 1KFKB 2PR2A 2QY6A 3GGOA 4QYWA 1EDDA 1YE5A 5CVCA 3FIJA 1N8NA 1E4VA 1PO7A 3H2IA 1HFJA 2QUJA 4C30A 1CZKA 1X80B 5HIKA 1I36A 2XQJA 1N2CB 5K6AC 1MAWA 3ADBA 3PUHA 2HEIA 3WWDA 3IELA 3U3JA 3SEQA 1QGOA 3PLAE 3U7GA 1W35A 3IMKA 1T5BA 5DBFA 1GN8A 4MGEA 3WR5A 1EB8A 5BSFA 1U81A 5EJ6A 1FU7A 2NPOA 4UE6A 3JD0A 5YASA 4DQXA 2P4HX 1XTRA 3P32A 4NSNA 1W93A 1QMGA 5JVDF 3H5LA 3WB1A 1Y7HA 2Q3DA 1WY5A 1S3GA 3IV6A 4HSEA 1G1MA 4KU4A 1Y81A 2P1ZA 3LE8A 5TF0A 3JQQA 4IQ8A 5DNYB 3HI6A 3CLTC 3RG2A 4A82A 2P2GA 3BJEA 4UTZA 1P7WA 3IA7A 4ZA2A 4E5DA 4PC6A 1HDEA 4M8IA 4CKBB 2FSVA 1I7DA 3P9XA 3NIGB 3ZQUA 1E7MA 2VPZA 5H7XA 2KJQA 1MIOA 3K2IA 3PU6A 4KZPA 1XZ8A 1NOKA 4AF6A 1FE8A 2Z5LA 1ZUNB 1KMHA 2B3TA 5CX1B 5BR7A 2EGUA 2RH4A 1T2DA 1PSZA 2FEAA 3V48A 1H2XA 1Q91A 2QG6A 3I2HA 4MXDA 1JHUA 2ISQA 3CZAA 4EGQA 2L69A 2BCGY 3AJDA 1L9KA 3I52A 3OCJA 1D4ZA 4IGKA 4LJLA 4O63O 5H59A 2H1OA 1CZLA 4GEGA 5DTEA 3HKEA 1CEEA 5LP1A 5MN6A 1NN0A 1ZVKA 2O2CA 2ZS7A 3LHFA 5F3DA 5GQSA 3O75A 2ZR8A 1UBTS 2QMYA 3WNCA 4L4UA 5ELXA 4HK4A 4PC1A 4ZPXA 2FRVA 1V8ZA 3H2ZA 1YJ5A 3P9SA 4MLCA 2HNKA 2QNRA 4JLAA 1P1IA 1I1NA 1DEXA 3O8QA 4PZLA 4FFLA 3S5UA 1JXOA 3LYAA 1F9EA 2E85A 3JZIA 5FUYA 2RI0A 4CN8A 3TPCA 3LUHA 4YO7A 3MRVA 3I2YX 2IV3A 5KHAA 5LB4A 4DMFA 4F6RB 2NVOA 5C8XA 1P0IA 3S99A 4XJVA 4F8JA 1IULA 1M76A 2Z1NA 3AVYA 3MCWA 2W6MA 5ALHA 3RS3A 5HKLA 1Q7CA 2UZ1A 3EC1A 3LPLA 4U8GA 2BI8A 3CRNA 5JJCA 2RD2A 3SKVA 1NW6A 3QTLA 3JWHA 4HMQA 1T9GR 4K8RB 3CINA 4M0KA 4QUDA 4XPIB 4CF5A 3KHUA 4ABTA 2QL7A 1M34E 1NKTA 3DZJA 3N8HA 3SE0A 4MUYA 3T1OA 3TSAA 3D8UA 1PVDA 3KUCA 3ZHQA 1NXXA 1XEWY 3D4OA 4KQ9A 3AUJB 4BPRA 4BBPA 2GPYA 4PICA 2VN8A 5EFOA 3A70A 1YQDA 4FU0A 1R2QA 2VQSA 4PX9A 2GZAA 2D2VA 4ND3A 1SBTA 2A0WA 5ENVA 4GM4A 3PCTA 1JA9A 2OV8A 2ZCUA 3V8VA 1NWCA 5CP8A 3AHFA 3IUQA 1VB3A 1KRHA 5D3QA 2XRMA 3OZCA 2ACVA 3LX8A 1PD1A 4TKZA 5TXGA 3LT2A 3HXPA 4J91A 4CKEA 3EEIA 2ZE8A 2RAUA 2QVXX 1TAUA 1UBKS 1S8OA 2JASA 2ODAA 1NUPA 4WCDA 4HWGA 3NFRA 2IZZA 4RFVA 3OZXA 3KQVA 2FTKE 2AFRA 1O8BA 3KYBA 1YJXA 3AFHA 4M4SA 3ZZ1A 3RVLA 1S2OA 5HQTA 2BGUA 2HSEA 2W8ZA 3MF4A 3GNSA 5EEGA 2B34A 4MAFA 1THTA 4QEZA 3VYUB 1UJ6A 3C70A 2R5FA 2NXJA 4QECA 4UM8B 1MABB 4GU5A 4D44A 4CF4A 1GG2A 1K5HA 3MA0A 1XCMA 1V8DA 2H0RA 1UMBA 3M6IA 2ZIWB 1V7CA 1XZJA 1C0PA 3M1IA 3SLRA 5JDCA 2B5VA 1DJPA 2FH5B 3VKFA 4BFYA 4J0KA 2NVWA 2GBLC 2HREA 3LNTA 4OSOA 3INTA 3U1TA 3JQEA 3WL7A 3SG0A 2JLSA 1XLTA 1VSUA 4COOA 1T8UA 1FVXA 1EWRA 1GWNA 2ZTUA 3C8UA 3NHPA 1FX0A 4A0QA 4R01A 1FDSA 4HYTA 5I6DA 2JFXA 3D6UA 1LDGA 1VG1A 3OQJA 2I4IA 4LKRA 2AFVA 4PXSA 2EYQA 4OHPA 2H1FA 1LB1B 2M32A 1ECGA 4C88A 4URZR 5CPFA 4CDGA 2FPPA 3CVJA 2O0JA 3PNOA 1LI5A 3RABA 1B8NA 4TS9A 3M3HA 4DLRA 3HYLA 2J7PA 1T6NA 1TKRA 4OQXA 3LOQA 2BJHA 1YE8A 2AF4C 4OMCA 2O2EA 2YJ3A 4C7XA 1EX1A 1YZVA 4YP0A 3OEED 2ONCA 2Y66A 3HU1A 3IR7A 3Q6MA 1V3UA 4RGYA 2GVNA 4F21A 3VSAA 4JHLA 3K9FC 3ID6C 3U7RA 2O2HA 1VBNA 2YN2A 4PINA 2DWCA 3ANNA 5A71A 3QFTA 1FUIA 1AVTA 2HA0A 8ABPA 4IHQA 5E8RA 3CH4B 3EQZA 4BFTA 1K97A 2P9CA 3TLBA 3GRZA 1JMVA 1DINA 5REQB 1BMQA 3VV2A 5P21A 5HNKA 4YAUA 1RJ9A 4LKOA 5DF1A 3KWFA 4NQRA 1SQFA 1IXKA 2YUIA 4JI0B 3HS3A 3UKDA 3T4EA 3Q8XB 9MHTA 1CF9A 4ZOEA 2H54A 1USIA 3HR8A 1FVHA 4PZCA 5HF8A 1IY0A 4OEHA 3ENNA 4M46A 221PA 2CD9A 3B1VA 1V1RB 4G36A 3ZDYB 1JPJA 2TMYA 1VLLA 1EU1A 1MG5A 4AMZA 3E1SA 3ZD9A 2QN6A 2PFGA 1HZJA 4ERNA 3UJ7A 3AUFA 2FDXA 4ZEWA 5BT8A 2ET6A 1ID1A 4X63A 3GFVA 4ZTBA 3WSTA 4TXNA 2IXAA 3ZLTA 4BO4A 1S8FA 1XT6A 4JGIA 5FOTA 3G5UA 2Q6VA 1IB0A 3B5JA 3KXKA 4JVNA 4TKVA 5AKLA 3OIUA 2FP3A 4KPUB 4JOBA 2QL5A 5B3JA 4A10A 3ZD6A 1U0OC 4QHYA 4WT7A 4HNRA 1QRAA 3SHWA 3BXOA 2ZJ0A 3DVAB 4QUKA 1AGYA 1IM2A 3B60A 2OAEA 4RVNA 4BQPA 4R69A 1J2RA 3C5CA 2A7QA 3SC3A 1MAAA 3O2SB 1U0TA 1LRJA 2HRBA 3C3MA 3CNOA 3LQ2A 1FY2A 4ZT5A 1RXWA 4RCZA 3B85A 5GGYA 1M6EX 2HA2A 2PG3A 3BWEA 1SHUX 3MWJA 4W5QA 5D7NA 1NG9A 5DRYA 3CF4A 1GPWB 1Z73A 4JVLA 1G5RA 3PFFA 1QANA 2WM8A 3EARA 5KVQA 1HPLA 4M36A 4NENA 4CUJA 3I6BA 1BN7A 3WK4A 1W8IA 2X0JA 2H1SA 4QBTA 5LC1A 3SR3A 4DBVO 4ZZIA 4O4JA 3AUKA 3VHLB 1AUQA 3AGQA 1JP7A 3MPOA 1GTVA 1XVVA 2FFBA 2JBAA 5CFZA 5CB6A 4J16A 1P2DA 1ZK1A 4IDGA 1O96A 5EL0A 5G1PA 2PDAA 3UFXB 3DE5X 2P4UA 5SY4A 3I64A 1QPZA 1C29B 1Y8RA 1SCBA 1ZD1A 2HO4A 4G2TA 1W29A 4OJQA 4PHHA 1DQSA 3OSUA 2NU7A 3LGSA 4BP1A 4DUPA 1PDVA 5HKKD 5KWSA 5SZHB 5HCUA 3PNBA 4LVCA 4PLZA 4N8DA 4RY0A 2JGDB 2ZT8A 3R7WB 4BE7B 4D46A 4QGAA 4QSHA 2OC4A 4WFIA 5KYNA 1ZSNA 2JHFA 2W0SA 3NWEA 4HNAB 4B2PA 4HTFB 5FUXA 1XP8A 2MDTA 3EUAA 1HBJA 2BCJQ 4DWVA 2GFHA 2P4SA 1TTHA 3K32A 1Y42X 4Y2QA 4H3SA 3CT4A 4TV8A 3S8MA 4PLWA 5AW2A 1SBIA 3BRWA 3MLBA 5CM9C 4YLEA 4CYMA 4JBWA 4C1BA 1NVMB 4KGZA 1ZICA 2B1JA 1ADGA 5ALXA 4XIIA 5E7IA 3DVSX 4KXYA 3E22A 3TCKA 3CVYA 4F97A 3ZD8A 1H8HD 1PT5A 5BV7A 4N3GA 2PD3A 4PEVA 2D0DA 2TRSB 4QDJA 3HDJA 1DBVO 5LZ8A 1VOTA 3HCCA 3KM0A 4L8WB 4BRWA 1YBHA 3NONA 3H4IA 3O8LA 2PZKA 3F9RA 3DOJA 1FEZA 2AEFA 3H5OA 3HGTA 2QS9A 3GFSA 5K0NA 4R16A 1E1RA 2X0RA 3IMFA 1W88B 3U6BA 4NEQA 2E55A 1X7HA 2RHOA 3BXFA 4KSYA 4LSWA 1MF7A 3VHXB 4KITB 1V9LA 5HKBA 2WZDA 3OZEA 4F9GA 3B2EA 3O4FA 4OX9Y 3LO5A 1G4AE 1YR2A 3RU7A 3ORSA 2YRWA 3GJ5A 3MT0A 2YJGA 3EDMA 1RJWA 5C7IO 1P72A 4LW8A 2R85A 2BR4A 1YCFA 1ELOA 1LX6A 5GY7A 1KJZA 2VT7A 1Q95A 3LI2A 4MS4B 3I09A 1E3LA 4FGJA 3RS9A 5IH3A 5ITZA 4PWZA 2PSSA 2IKQA 3AKEA 1DT3A 1EXMA 2GF0A 3E18A 3R5XA 4IGAA 5TQ0A 1KS2A 3CR8A 3VM6A 1AS0A 4IZOA 1Y4DE 3K1YA 3U3OA 3KOXA 4BNDA 3UMMA 4LHZA 2D54A 4C20A 2H65A 5BV2P 4JGGA 4I5FA 1I4DD 4UHKA 3H9BA 3OZTA 4EKEA 3CTPA 4FHFA 4Y6GB 1L5OA 3ACCA 3EDOA 4G85A 4LUCA 5K8TA 1PWXA 2BELA 3QIAA 1PR1A 1ULZA 2C9CA 4GWGA 2CXXA 1BXGB 4QU5A 2AFIA 3GWGA 2FXVA 5TMEA 5ADHA 4PX2A 2J9FA 2XQIA 4YUXA 4CMEC 1PG0A 3FVTA 3DEJA 2WAMA 3VSEA 3GLGB 3FOWA 3PEUA 1FX0B 4GE3A 3LRPA 3RRXA 1XOIA 4Z1OA 2J9YB 3A4TA 4L9SA 1RPJA 1BCSA 3CPHA 4QREA 3I8SA 4TMYA 4LGMA 1WLSA 5DEIA 2E4VA 1ZRNA 1XNQB 1J5PA 2GCGA 1R7RA 3OWXA 3T5GA 1O9GA 2VYND 4DLUA 2JEZA 1U3FA 4RNCA 1KK1A 2FSSA 3GGSA 4GX2A 9ATCA 5ALQA 1M1XB 2P9TA 3GGPA 3PPXA 4BGUA 1RHJA 1BW9B 5IKXA 1HF3A 3MWYW 2Z3WA 4RJJA 3K2EA 3V8BA 3O31A 3WYFA 5C8YB 3L0DA 4M7RA 3WP0A 1Y9ZA 1UP6A 2ZSDA 5TVGA 2P77A 1WBDA 5KI6A 2QN2A 1ZDMA 2K5UA 5EWMB 2BBWA 3RLFA 2CKMA 3MJ4A 4B35A 3HR4A 5I5GA 3S2IA 1XDWA 1XMIA 3AM5A 3HI4A 1XQWA 2H7CA 2IY9A 2I29A 1BQ3A 2P6UA 3EK2A 3HH8A 5KYYA 3G2HA 2F2TA 2C3UA 5HIJA 3KKPA 4TRJA 3U44B 1NBOA 5EE1A 3VDNB 1IK6A 1P9LA 4NV1A 3HM9A 4FFVA 4RGBA 3I62A 4D3FA 4DNOA 4OJNA 2F90A 1F0PA 3U9TA 3CX8A 2R97A 1WHTA 3QNMA 3C98A 4C4SA 2VDMB 3E84A 3I53A 4TLDA 1L8OA 3PRYA 1AV7A 5P8WA 1NFRA 3BEDA 4M21A 2NIPA 5TSDA 4A2CA 3EPLA 2D59A 3E82A 4FYMA 5FHRA 1L4HA 3PNQA 1DFHA 4UOZA 2ZUCA 1P9WA 3A36A 4B3XA 2BKLA 4UBJA 4UOEA 2PE5A 3CSUA 4DM3A 4RDXA 4FNMA 2P5YA 5JFGA 1KVTA 3WRYA 4JKYA 2BM0A 4MAMA 5ER9A 3NT2A 3L0CA 3TR5A 4G41A 2WSSA 3WGUA 3DR3A 5MF6A 3L05A 8ADHA 3VSCA 4M1YA 3ZNNA 3ZQJA 1OFVA 2C9BA 3RADC 1ZEMA 1VSVA 3HU5A 3N8GA 4E12A 1X7GA 2VDQB 1P2VA 4IIEA 3TIVA 2JGNA 1Z63A 1O0SA 1SVNA 1W4BA 2Z4SA 4WY8A 5JYCA 4EG8A 1E3DA 5L7TA 3OOHA 1MORA 4ZI5A 5KHOC 3GRYA 1O97C 3KPVA 2IYUA 5GJCA 4GZ3A 3DO5A 3DCYA 5BN3A 4MZDA 4NHEA 1NT2A 4KI0A 4ZJUA 3NDJA 3LY8A 2V03A 5EOVA 3A9RA 1VKHA 2IJGX 2C3YA 3EEOA 3B3GA 3OTGA 3KZMA 1E1LA 3UCFA 2JAHA 2ZVDA 5EXDA 3C6MA 3K1TA 1JBKA 5DGHA 4Q5IA 4JVOA 1C0EA 4HQRA 5H3HA 2Y77A 5IDYA 4RTKA 2FWIA 4G67A 3DW3X 3KKOA 3QPDA 4R0NA 4R3NA 3E9RA 5FO0A 3SYLA 4A2PA 1I3CA 5FJJA 4Q00A 2GD0A 3FBWA 2ZDHA 5PGMA 3WY9A 4F0JA 1CTQA 1YZFA 1V11A 2PQMA 3KUKA 4RHYA 4QVKA 3PGA1 5EUMA 3K6RA 3S27A 4KUEA 3W7AA 3DDWA 3HCNA 3HJHA 2X19A 2DR2A 3I39X 1UM9B 1XL1A 5JPIA 4LK2A 3CWZA 4WRRA 2YFHA 1DKNA 2JI4A 4Y2YA 1F4VA 4KXNA 5MGNA 3PIIA 3PSHA 1OAOA 4PPNA 3PX2A 4UEQA 4UU7A 1E0DA 1VJGA 3IP1A 4WZ6A 1I1HA 4MDFA 3V7NA 4GRDA 1JS1X 2ZRQA 3EZ2A 1R15A 1MPXA 1Z0UA 3AFOA 3NNNA 3OICA 1E3TA 4V24A 2L42A 4CT4B 1K89A 1TMOA 4KH1A 4C7KA 5ALJA 4NDAA 1KFEB 2BKUA 2VH5R 4ZAXA 3R7AA 2YXLA 3D3EA 3FSEA 3KJHA 4H0FA 1J09A 3OPVA 1ZK2A 1I51A 1SHLA 1NATA 4B7AA 1CUXA 1N7GA 4URVR 3HB1A 2IYYA 2O2IA 2R44A 1T9KA 2PGIA 3R5KA 1CSEE 4KPUA 4LYGA 4JMPA 3PKJA 3UGTA 5EVCA 4LXGA 3CPSA 1I7PA 3A1FA 4CMJA 1LPNA 4ND8B 4JA2A 3WB0A 4KQHA 2ZXFA 4WXEA 3UQZA 3S2ZA 4N82A 4LA4A 3QJ5A 1NMZA 1RBMA 5LQKA 1HYEA 1PG5A 2GZ1A 1OUMA 3JYQA 4YJFA 2YQZA 1EBUA 2QJOA 2B6NA 3I4LA 2PTHA 5KYUB 1WMEA 4FX2A 3HPRA 1QZ3A 1RM4A 1IXZA 1ITZA 2CNBA 3DOUA 1ETUA 3RE1A 4BNVA 2GBLA 3AG6A 4TTPA 3ROPA 1L3BA 2XDWA 2EDCA 4TUYF 2Q0HA 3IHLA 5EIBD 1PK7A 4DV3B 4E21A 1GTZA 5JO0A 1G98A 4B84A 2DBZA 2GZHA 3M49A 3LG2A 3AQ4A 3O91A 3H65A 1JMKC 4X1IA 2E49A 4RPJA 4XEHA 4Z7QB 2BFBB 2G7MC 4ZJZA 2JAWA 5DTMA 3WL5A 1XQYA 2WHQA 4MO2A 3KXLA 1T5DX 3EBPA 3ULKA 2YW2A 4QPJC 4FN4A 3GLQA 2IYWA 1T5IA 2ZRGA 1HQCA 5CNJA 4NOJA 4PIMA 1WNTA 3GARA 4EAAA 3BF8A 1YQXA 4ILEA 4JXJA 1SKYB 1VI6A 3CUWA 3JQBC 4NG4A 3V1LA 1A1VA 1EVQA 4OP1A 4UBIA 4AW9A 1I6WA 3IKTA 1V6AA 4LRTB 2VPPA 3BSYA 4A73A 2IOHA 2VSXA 4C0JA 5I7AA 3GVHA 4K9KA 4LGYA 1BKYA 2HQOA 5HF5A 3U6KA 4V3BA 1NVVR 4YJ2F 3I1IA 3WMXA 3MWKA 3PQ5A 2G67A 3BEOA 4ER3A 4MKZA 4Z7JA 1PGJA 4Q1FA 2WOJA 4B3GA 3GZJA 3L43A 1NX6A 4LRQA 4N3CA 4XARA 5DLQC 4U00A 2W2LA 4IJQA 5GJWC 4BKPA 4G5YA 3QVGA 4NARA 4EEZA 5JAPA 3AB8A 1IJFA 1GQQA 4MW6A 2BI7A 3E8XA 4GL2A 1NG1A 1PDWA 3EGXA 5CBPA 1T5HX 4PBTA 1R6XA 1T3LA 3DYBA 1NJ2A 3RBVA 1VFPA 1IM8A 1I10A 2EF0A 2IU3A 3NJ4A 1Y80A 2J4FA 5EIOA 3PDUA 5IJWA 2AN4A 2Q9UA 2A0FA 3X1ZA 3FCCA 2OR3A 1MFZA 2EW8A 3HJAA 2H4ZA 1JG2A 1RXEA 3JWJA 2BLNA 1YOBA 1E9VA 2BWJA 2QUHA 3DDCA 4L4RA 4B6JA 5A3SA 3HVHA 3U9LA 4YXWD 3U7HB 4MPPA 2A0UA 4HZIA 5IASA 4I08A 2C7OA 2GYVA 1YDWA 1KI1A 1L5YA 1Y48E 2VQDA 3E2IA 3N8IA 4WZBE 1J9ZA 4HS4A 2D2EA 1NN3A 5CFNA 4RH3A 4PVCA 5AI4A 2WSLA 4QNNA 4J3FA 5FOQA 4OYYA 4PE5B 2Q0QA 2QOEA 4NOLA 4YPFA 3TI7A 1U2RA 4EGAA 1Q57A 1HX7A 2ZRIA 3NTQA 1WD5A 3OZSA 3HXKA 5FEMA 2GN6A 3UJAA 1AKEA 4GZ5A 3O26A 2VP2A 3VMMA 1Y7IA 2GEUA 4CKEB 1K27A 4HJRA 1KE1A 3LA6A 2MT9A 2GN2A 2X7JA 4YO8A 2QIOA 4XDYA 1EPUA 3ZVKA 2OP1A 1I0ZA 3OAAA 3R09A 5TMPA 2Q7XA 3UPTA 4YUZA 1YJ8A 1JEQB 3IVAA 3IUMA 4Y0AA 4AS2A 3ZDDA 2J30A 3RC3A 4NR0A 4TVSA 1H3NA 4JI8B 1A9XB 3NX4A 2Z09A 1LVUA 4XYGA 3I8XA 1SPXA 2HLDA 1DIHA 1QJ4A 1RWNA 1FQJA 1UBGA 3AMVA 3L8YA 3BC1A 1II9A 4J07A 3SJCA 2PANA 4NNJA 1PKXA 3G7SA 5JIBA 5GVSA 4ZVNA 1HTBA 2HTFA 3E5NA 4BP8A 2XF2A 4J16C 4JEHA 4JJEA 2JIRA 5B4VA 3AX6A 1PFQA 1ZJYA 1Y3DE 5MFZA 1BWSA 2CEAA 4C0SA 1YGPA 4EB0A 3V3TA 1GLGA 4JIMA 3FFTA 1S4MA 2PWYA 4TTJA 5FOXA 3K0CA 4PXYA 2DMRA 4WESA 3VYSB 3WGIA 2PL1A 4WCVA 2XYGA 3D6VA 1T1RA 2OO3A 1NPDA 4ZODA 3H11A 1A8UA 4MS1B 5J1TB 4QOSA 4P2BA 3UA4A 1GNLA 4DPKA 4N39A 3HKEB 3IDFA 5AW4A 5IJ0A 1V48A 2B2CA 9GPBA 1WMAA 3T9DA 3E7DA 1BMFD 3BMCB 1J06A 3SQWA 4XGKA 3TSCA 1X94A 3LLCA 5HUJA 1LQUA 5FULA 3O95A 1VJCA 3M5WA 4HTAA 4M8SA 3B9QA 4KDRA 3B6IA 1O5TA 5AKEA 5EI5A 3DUFA 3INRA 4EJFA 4K03A 3P97A 4DJTA 5LOVA 1O03A 4RENA 3J81A 1ZM7A 3R40A 1XTSA 4LZZA 1JKXA 4PTYA 3OEYA 1Q3KA 4IFBA 4I8XA 5FUMA 5E7QA 2I91A 3ICWA 3WGNA 2G28A 5AYVA 5JW6A 1XYGA 4LOAA 4F3RA 2HJRA 4JB0A 4AJ9A 4QTZA 4NI5A 1GT6A 1ACJA 2NPIA 2Q07A 2VYNA 2VP3A 5HE8A 3SIPA 1UEXC 3SJZA 1Y6RA 3K0AA 2FZGA 2CLOB 4OHOA 2ZI5A 2XW6A 3GLHA 4XRRA 1H65A 5KX5B 4ESVA 3IPRA 1XELA 2RARA 1QGUA 2ZQ5A 5C1IA 1UKYA 3FNFA 3OLCX 2QXUA 1ECPA 1G21E 1TAGA 4N7RA 4Q1EA 4XDZA 4A7PA 1YR1A 3P0HA 3B7PA 3EDYA 2X58A 2PNFA 1D9XA 1G2OA 2FMXA 3EH1A 2AK2A 3GXBA 3K4PA 3NIFB 4FMPA 3E7WA 1Z7GA 1MABA 2R48A 3PC2A 5E0KB 3I45A 4BFZA 4TKUA 1YCGA 3FSJX 1MX3A 1AKYA 3D4PA 4G1FA 3IBSA 1S4QA 3OMXA 1T4CA 2FI1A 4LJ8A 4MW9A 1SZCA 3KS9A 3HMQA 5AH0A 4D4MA 3BORA 3VTKA 1HE2A 2OO5A 2P9JA 2PHZA 1CUYA 3P1JA 4K2HA 4QWMA 2ID9A 2WG1A 1A82A 1EVKA 2FWPA 1MQSA 2ZWOA 3G2PA 4UZFA 4XVCA 5ICEA 1NJ1A 5LDHA 1F17A 3A26A 4RBNA 4IJKA 1DAPA 4MUNA 4NATA 4OYRA 1N2EA 3HYNA 3QVJA 4Y0VA 4TYWA 3HKDB 3HUDA 3DAHA 1M6WA 3K30A 4AURA 5A5FA 3PWZA 3R3ZA 1GYRA 2C4WA 1SBNE 1VLVA 3UZUA 3PFWO 3W77A 1W4RA 4TT8A 5CT5A 4L4ZA 1RAHA 2BEWA 4EDFA 4XIFA 2IYZA 3Q40A 3AR4A 3ZWKA 2JGKA 3TQTA 4XYLA 3LSYA 2GN1A 1HMPA 3ETNA 1TCCA 3F3YA 4XASA 1CS0B 2HMYB 2OAGA 2PWAA 4RSHA 4RQAA 2H1VA 3C6BA 3VDQA 5C8DA 4ICIA 3I4CA 2YWJA 5AKHA 4KH0A 2YY5A 1D8AA 2Q1UA 2QX4A 3BL6A 1P1KA 3QPAA 4RK5A 3G85A 3C6XA 1YHZA 1EQUA 1TZ2A 2JZOA 3DD1A 4RA9B 1UQTA 4ETIA 3HY4A 4HDKB 3TN7A 3W06A 5KU7A 1CQPA 1KP9A 2V7UA 3PVSA 3I4FA 1Q15A 1EGQA 1T5TA 3LH5A 3HNOA 3JQRA 3OQBA 4CQJA 3LK6A 4RETA 4EPWA 5HIIA 1IEQA 2B98A 2I8LA 1EAMA 2D5CA 4HVCA 4TYYA 3GOQA 4I66A 4ZHQA 1DBRA 2AR0A 1O7JA 2WAOA 3KT6A 5JHHB 1UKAA 2ZBQA 3NM5A 3TLYA 4RZHA 4WKGA 3UN1A 4RVCA 3GWZA 5JARA 1VHLA 4DC0A 4CMKA 4BNWA 3KWMA 3R4CA 4AT1A 5JC1A 1CJMA 3LY7A 4I4CA 4HD8A 5KDDA 2MIIA 1B0AA 3M82A 1W76A 2CHGA 3WSVA 1U28C 2UYHA 1OKKA 2D5BA 2HF8A 3DMYA 4J6FA 3RJMA 5DGTA 4I4TA 1CC1S 4EHIA 2HA5A 4JLBA 3BWDD 4YMVA 2CLEB 4UAUA 1YA8A 2NWQA 4WWHA 2J45A 2JH8A 3V4PB 3AJ9A 2NAPA 3C1TA 2GVDC 3QBEA 5FI1B 1PV2A 1L5HA 4RLSA 4EJMA 2OILA 2ZRKA 3G9XA 1R0LA 2HIHA 1F60A 4IIFA 5AI9A 3S6JA 4BKMA 4J0FA 4XW2A 5C32A 4L95C 1I32A 3OJLA 4GOJA 4C2BA 1RS0A 4TL9A 5KCMA 1U04A 3IEPA 4O08A 4B7CA 3RSHA 2OZVA 4ZIRA 4YGXB 4FFPA 3O6VA 4F71A 4C0HA 2ZU6A 4H2DA 1H4SA 4MR8B 1GD1O 2PLRA 1C2TA 5E2AA 5HM8A 1X80A 5IWCA 1UZLA 2WU0A 3CN7A 3GRFA 3QNUA 5HRAA 3K0HA 2N47A 5A4AA 4IQFA 4CM7A 2W7TA 4LF7B 4QPZA 3LBIA 4XD2A 1XZQA 5SICE 5LYJB 2CUKA 3JRNA 2FX2A 3LXMA 3ZDRA 2VP4A 4BEVA 5EIXA 1ODCA 2VRNA 3OOYA 1A76A 3MK31 4ON9A 2PK3A 4KFCA 2XCUA 1AMUA 2VK2A 2YJ6A 2G08A 1FYEA 2H1WA 4P3XA 2RB4A 2NO5A 1O9HA 4R1TA 1R5BA 1OKKD 4U63A 4NH4A 5AJXA 4AZWA 1HC7A 2HMTA 3BJZA 1EK0A 3HJNA 4JLSA 4HNHA 4WZBB 1FP7A 1GSIA 3RRYA 3VHXA 5B7PA 3IMCA 4HWSA 4OOFA 4FYIA 3QUQA 1U8AA 4I9UA 4L3OA 4AZ3A 2PZ8A 3FRHA 3VR4H 1DU4A 3L4JA 2FOLA 4R51A 3KL2A 3UKJA 3WOVA 4MI9A 2OBMA 2OZEA 1QIGA 4AJOA 3CLKA 2JATA 5H16A 4E94A 1KQFA 3LJKA 3JWPA 1Q7TA 3SEFA 1R18A 1YCHA 5JNLA 5FLXA 2IPMA 1R5OA 1FDIA 1T4MA 2VOEA 1Y9DA 2G4CA 3C3EA 1PE0A 2YMPA 4CV3A 4CW7A 4R84A 5K3EA 3HCWA 2ZEJA 3K0FB 3UT5A 5M2QA 2O59A 2O48X 3DOHA 4GBED 2IYSA 3LC1O 1EWQA 4MEJA 3LIIA 1QGED 1SCKA 2YJTD 1IUPA 1TQ4A 2I62A 4LRYA 4MV7A 5AVJA 2E4ZA 1CNEA 2DWPA 2OHJA 3AW8A 4PAMA 5F52A 2WQZA 4D9HA 1SC4A 2VDLB 3JQGA 4DJDC 3TQFA 2BEJA 1ZM3A 2JFOA 2QE7D 2QRHA 1TYAE 1TYBE 4KNWA 5CPBA 5GONB 1UWKA 1QOQB 3PJFA 2Y99A 3WIDA 1H93A 4QU9A 1E2NA 4CF6A 3QVMA 2WZCA 2V7WA 4XJXA 3LUBA 3CC8A 3G17A 1QU3A 2C29D 3ITNA 1H5UA 2XCOA 1P18A 4JBIA 5IAOA 5IKMA 1U8CB 3AZQA 4QDOA 2EBHX 2JCBA 5CLGA 5DASA 2KMLA 1XZDA 3RU2A 3QVWA 4JYCA 4LV5B 3VO2A 3AEUB 3WLFA 2J7KA 2P2ZA 4LG1A 3ST7A 5KO2A 4YJHB 2O2YA 6CHYA 1VIAA 2Q2OA 4JYAB 1R4NB 1F6BA 2HH9A 4MWOA 3OQVA 1NYTA 4BVBA 1G5TA 5FI0B 2LXNA 1Y4SA 2PLWA 1BHJA 2C03A 3T3OA 1XTBA 1J0CA 1XN1A 2B7LA 2DYKA 2OHXA 1Q12A 5TV2A 3FUUA 4J0QA 5ANRB 2VSFA 3VRHA 2ZAMA 4IDOA 4ONEA 3N0VA 5IMBA 4YT8A 4UHJA 4KPFC 1RYZA 2VDWB 3CYFA 5CYOA 4WA8A 3RF6A 2JHAA 1OSNA 4A5SA 5DVZA 5HW0A 4EJSA 3WHLA 5CXQA 3USES 3B70A 3QVKA 1UL1X 2YFQA 3PEVA 1GV1A 2X77A 4TSFA 1HH4A 1O0BA 1E1QA 1YZHA 2Q49A 3DQQA 4HBZA 1RYFA 4MARA 4UFNA 3TNJA 2GBPA 2YQ4A 3E5MA 3ND7A 2BOVA 1IG3A 1R0ZA 2EZ8A 4LCEA 1WCXA 3E9MA 4IJ6A 1P0PA 1RMYA 3IE2A 1YONA 1J23A 3FWZA 3A7EA 3NJRA 1PIWA 3F2VA 3IT0A 2C84A 4OX9B 2ZOSA 2ZJ7A 4X7MA 5T4FA 3AL0C 2R8XA 1DO8A 6REQA 4BYMA 2G6TA 4EJ2A 4K81B 5AIAA 1ODIA 2IXDA 1NXSA 1XALA 4F8YA 4C3ZA 5JMPA 1E5TA 2W42A 5KB3A 2C0CA 3DXYA 3IHKA 1DZIA 3LUJA 1OH6A 2BFWA 1AK9A 2FEWB 4PW0A 5DOZA 4ANFA 1WHSA 2IW3A 3UWPA 3OQOA 4LJRA 3R8CA 2OPBA 2NVUB 3RB8A 5K8JB 3M4JA 1DOHA 3G5TA 3KLBA 1RRCA 4C01A 3ETEA 2H4XA 2QUAA 3RV4A 2Q4DA 3G8CA 3LO8A 4X41A 4AZTA 1MXHA 1R4MA 3HO6A 3DM9B 5IAKA 4B85A 1XD2A 1XZLA 5ECYA 3EVTA 3NEPX 1R6DA 3FROA 4BLTA 1DEHA 4M87A 1Z4QA 5EUQB 3D1JA 4L0CA 1U7XA 1IFXA 4MWSA 4TUYA 4X3PA 4HUJA 1DFIA 5FBKA 3BWXA 4O3MA 5TEVA 1KYZA 1U2DC 3FCAA 2XITA 4X7BA 5J58A 4MUEA 3UMGA 3SGLA 1RIIA 1BFKA 4JU8A 3B3AA 4YA6A 1IDOA 4D98A 3CSDA 2PH7A 1QCCA 2WT8A 4LY9A 4BZXA 3LQRA 4QFDA 1QF9A 3U44A 1FZQA 4IIDA 1NP6A 3TTSA 3G1UA 2FEKA 3E2PA 1E61A 1JHVA 1GU1A 2OGUA 1W9HA 3T1VA 4B0OA 4D4KA 2PH5A 2H11A 5EWLB 1YB1A 2OUIA 2V6JA 1DRKA 2PZJA 3CLHA 3RASA 4PQGA 2PZBA 4KIWA 3PNPA 1VBFA 1Z2NX 1U2ZA 4RW0A 1AO0A 2BR5A 1P33A 3KVRA 1ULSA 1NL3A 4ZV9A 3DEZA 3GG9A 3JZFA 4OO3A 3T5MA 4ZV4A 5BUQA 1L8LA 3NI2A 1S1CA 5FHQA 3T9FA 3OTOB 1DC4A 3EWAA 1P2FA 2K7FA 2DY1A 4QJ3A 5TT1A 1YKFA 2VRBA 2VJMB 4X0EA 1CUEA 4Y9DA 1NWHA 1PWYE 4OH7A 4XYMA 1OTYA 3HCDA 1T9CA 3N75A 1X92A 5FTMA 4DNFA 5A7FA 5BV8A 5A3RA 1O6ZA 4D0SA 2X0DA 1V37A 4XB1A 1XL0A 3E35A 2DHDA 3FDJA 3HKCA 1QLHA 3JRWA 4HXFB 4YDHB 1V6CA 4WNAA 4K9PA 1YBMA 1XZFA 2FPSA 5TPWA 3AY0A 3VA7A 1GSOA 2GI4A 2ZZNA 3ZXUB 2WF9A 1T6ZA 1MQ8B 4HQ0A 1QDUA 4D25A 3DEKA 4P3NA 3D6NB 3N0RA 3LRTA 1PFWA 2IODA 2WTNA 3UK2A 1MO5A 1R4ZA 4O1IA 3MYRA 4EMSA 5K3BA 3N2LA 3O3CA 3RK4A 2WWWA 3FPAA 4HQOA 3V8RA 5DN9A 3X3HA 4DZZA 1VJRA 3O8DA 4Y2GA 3HTXA 5E7MA 2W98A 2WJHA 5CX4A 4P4NA 3K6SA 3OM1A 3NDIA 4OJMX 1XNHA 3TNLA 4DCCA 3SF8B 4N7MA 2WY2D 4W4TA 2Y1GA 3D6FA 2YVUA 1ZW1A 3K8OE 1NNSA 3ETLA 5SY9A 1OVGA 3R7NA 3THSA 2AH5A 1HRKA 1QV6A 5DNDA 5KTSA 4DIEA 3RKUA 4D9KA 1H6DA 4OIMA 4CM8B 1NI3A 4ZFNA 5AVXA 4XX0B 5BN4A 4L22A 4O25A 3FCOA 5JJKA 3PX3A 1MLDA 1DVRA 4XFKA 1C9NA 2G5GX 1L7NA 1HT1E 1QYVA 2CLFB 3FRIA 1QO0D 4FDMA 1MG0A 1KH2A 3A0RB 2Y1XA 3A6FA 4EW1A 1A27A 4ZO6A 1AC5A 4BN4A 5K45A 4LYYA 1YA4A 3KV1A 1UC4B 5REQA 5JDIA 3EOBI 1ZR4A 2ZPAA 3GUYA 1ZM4A 2QW0X 2K7ZA 3QOWA 2DUJA 4JLOA 1FW6A 2X76A 1Z0DA 1OYWA 4A3SA 4FC7A 3IO5A 2QSZA 2JJQA 3PJEA 4I1UA 2PSJA 3BMQA 1G5IA 4G0OA 1IOWA 1B8VA 1K06A 3LKDA 4BWFB 1XVIA 3KFLA 4G0XA 1BKDR 1QK5A 2GM5A 5JFTA 1EJ0A 1HG1A 3FZEA 1GILA 2WU4A 3M83A 5CA1A 1XPUA 1FP1D 1QUEA 2O8CA 3I9JA 1V1RA 4ARVA 4RTMA 3BIOA 1YFZA 3VU9A 3FUXA 2DH5A 4AG3A 1SOVA 3NUGA 4N40A 4WUTA 4G0YA 5F5XA 3WDSA 5A4IS 1TIPA 2B83A 3Q4GA 3HJGA 3IXMA 1ZGHA 3LP8A 4AMUA 3TF5A 1XGKA 2Z2ZA 1YRBA 3ZY2A 1I6MA 1CFZA 5KPDA 4DJEC 5L45A 2ZJ2A 4NE2A 2V4UA 3Q2IA 4YP6A 2GWHA 1ST2A 1S2IA 4FOSA 4RD3A 1EFLA 2C00A 2QK4A 4JL5A 4YRFA 1ZISA 2XD9A 1QCYA 1FSFA 4WBSA 1QC5A 4V0QA 2RIRA 4CV2A 3OQMA 1YACA 1KOLA 2QRQA 3CGGA 4GRAA 4Z6KA 4HX9A 4YJHA 1N2SA 3H2SA 4KMRA 3WLJA 2SCUB 4WUVA 5MFPA 2P40A 3C85A 4GI7A 4LHYA 2LE0A 3TBFA 5JPDA 1NNUA 1U3CA 4J3NA 3ZEAA 3CWCA 2JGLA 2OO5C 4FP9A 4NBUA 3WWEA 1CRQA 1GDDA 1AHNA 1Z5ZA 4OJYA 2XUKA 4J76A 1E5LA 3TWOA 5K8IA 2IEBA 3EDCA 1M75A 1H6BA 3GEBA 4URFA 2PZMA 1T4BA 3EQ9A 3MJTA 4RVSA 4X8HA 1F38A 5TY0A 1H0KA 3TIIA 2AWNA 4GSKA 1A9PA 4MVJM 4YCDA 5BRNA 1OZHA 2CB9A 5H0IA 4V0RA 5AVZA 1ZJ5A 1U3GA 2D0IA 2CJWA 1ZN7A 2H1LA 2IZ6A 3M5CA 2Q5HA 4O4JB 4XUDA 5B57C 1GJRA 3MWDB 3BRCA 1Z33A 1MU0A 2G3YA 4Y2UA 4MVJI 4M0DA 2VXBA 3OSZA 4RH0A 4EH1A 2VJDA 4ML3A 4NYIR 2FG5A 1R9NA 2NNLD 2P8SA 2QG9A 3CR7A 4K9RA 4Z9AA