3D2BA

Structure of 2d9, a thermostable mutant of bacillus subtilis lipase obtained through directed evolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASSNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKYLDGGNKVANVVTLGGANRLTTGKAPPGTDPNQKILYTSIYSSDDMIVMNYLSRLDGARNVQIHGVGHMGLLYSSQVYSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipase
publication title Thermostable Bacillus subtilis lipases: in vitro evolution and structural insight
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 67
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3d2bA00
3N2ZB 4K6GA 5CT8A 4DNOA 2HU7A 3F8SA 2VJAA 3S8YA 4J7AA 1BU8A 2BGNA 5YASA 5JYCA 5AI0A 2HDWA 4L72A 1QONA 4EY7A 1XROA 4BATA 3WL7A 1QOZA 3LP5A 2JF0A 2Y2VA 3D0KA 2WIJA 2Z3WA 4LKOA 4CI9A 1WPXA 5JZSA 2QVBA 1KEZA 4J0DA 1SCIA 1DQZA 2HA0A 1QIKA 5AI9A 4HAIA 5AKYA 5CTAA 1L7RA 3V48A 2XUQA 1OILA 1RWQA 1SCKA 2GZSA 1LPOA 2BUCA 1DU4A 2ACEA 2WFMA 4Q3LA 1QIEA 1UK7A 5LZ4A 4G8BA 3C6ZA 3DLTA 2XQFA 2H9YA 4G4IA 4TVKA 4RPCA 3WWOA 3BE8A 5CURA 4H7HA 5AI5A 5JARA 5K3FA 1XQXA 1GQSA 1LBTA 3MGAA 1HKHA 2RHTA 1QIJA 3C45A 2JEYA 1MTZA 3KWFA 4I19A 4KAAA 4EY8A 5D7BA 1MX9A 2IIVA 2XT0A 3PDCA 1LZKA 5LZ9A 1AZWA 1EHYA 2DCMA 3AJAA 2VJBA 3ZLTA 1P0PA 1IZ8A 4Q1VA 5FPPA 2CMFA 2PUHA 3HXKA 4OB6A 4F21A 4BDSA 3QPAA 4AXBA 5JD6A 2QJWA 1ODCA 1ZOIA 4HVTA 3GROA 4PQEA 4TPKA 2EDCA 3JYHA 4U2EA 1AGYA 4JNCA 4BP8A 2BFNA 3WZLA 4OYLA 2XE4A 1G42A 2OCKA 2QUAA 3ICWA 3M3DA 4UFOA 3ZLVA 4FTWA 1CUJA 1MJ5A 3KWJA 1GPNA 5LZ5A 5ALEA 1JU4A 1Q0ZA 5AI8A 2O2IA 1NU6A 3BIXA 2CEKA 4IQ4A 4F0JA 1DWQA 4BCDA 1BRTA 4Q3KA 5FPQA 1B41A 3PUIA 2HHAA 1YS1X 4M0MA 2X8BA 5IVHA 1ZGBA 4D9JA 5HQ3A 2ZVDA 4NZZA 4H7IA 4INZA 4HRYA 1GZ7A 5CXUA 1VZ2A 4UBJA 4KRYA 1MNQA 5HQ3B 2BUAA 3WA6A 3WYDA 1Y37A 4B81A 2FJ0A 2UZ0A 3IIIA 4G8DA 1WHSA 3F96A 1H2YA 3L1IA 4ITVA 3D2CA 2VT7A 1MNAA 3O95A 3OTQA 4BC1A 4C87A 4H77A 4CG2A 2GYVA 5AM2A 3I2IA 1EVEA 1MT3A 3DD5A 3QMVA 3ESBA 1DX4A 4HZGA 5JANA 1C7IA 2XMZA 2EEPA 4ZI5A 2QXUA 5DJ5A 1JJIA 4N8SA 1AUOA 5AI6A 1WOMA 2JGLA 3H04A 4QZVA 1MPXA 4KACA 1UK6A 2WUFA 3D3NA 4KEAA 1ZD2P 1QE3A 2XDWA 1SOMA 1FFDA 1X2BA 1CPYA 5FLKA 3STYA 2OCIA 3KXPA 2YASA 4QNNA 6YASA 4EA6A 5LP1A 3H18A 3OG9A 5JADA 2X5XA 1QGED 5AKHA 1YA4A 2Y6VA 4AMZA 3O0DA 2GBFA 2HA4A 3Q8WA 3OC0A 4DGQA 2XMSA 1U2EA 1CQZA 3BF8A 3MVEA 4KJXA 2H7XA 1MAHA 2OLEA 5KWJA 5EIHA 2RGUA 4KE8A 3FYUC 3RM3A 5D6OA 5AI4A 3DNMA 3VISA 4UFPA 1EDDA 1XKTA 5K3BA 3L1HA 1TAHA 1XRNA 1TIBA 3EIOA 4P93A 3I28A 1G4HA 3MUOA 3KDAA 4DSAA 1LPMA 1EK2A 2FX5A 2WG1A 1YAJA 5E4JA 3ZLUA 3QM1A 1WPRA 3PI6A 3M83A 4IH1A 5ALRA 1BCRA 4Y2UA 1CQWA 1MN6A 4FLMA 2AJLI 4X97A 4ZRDA 2AJBA 3K9BA 5EFZA 5LZ7A 4TGLA 2C4HA 3IUNA 1QLWA 4JYPA 2CJPA 3E3AA 1G5FA 3DCNA 4GBGA 1F0PA 2WIKA 3WL5A 1GKLA 3FBWA 4QLOA 2DHDA 3TRDA 3I1YA 4B6GA 3HEAA 1A8SA 2Z3ZA 4G9GA 2WJ6A 5AM0A 3C6XA 5DYWA 2I03A 1QO9A 5JZ9A 4U2CA 4AMYA 3C43A 5AKLA 1BEZA 1XZLA 2C5GA 4CCYB 5A71A 2QJRA 4FLEA 1N8SA 1CLEA 3STUA 2DQYA 4DNQA 3TGLA 2QS9A 5ALVA 3ESCA 5HFAA 4DSZA 3R3WA 4K6HA 2OQVA 3WQHA 4QE3A 4UHBA 4UHFA 2RI6A 1U4NA 4ARAA 1IZ7A 3AILA 2HA2A 2VT6A 1DWPA 3DL7A 3H19A 1GXSA 2PVSA 1HLGA 3G7NA 1XZMA 2QRUA 2ACKA 4GHWA 4H35A 5K3EA 1K4YA 1ZJ4A 2G4LA 1AX9A 3VXKA 4CFSA 2BGRA 1XQYA 1S8OA 1H2XA 3PICA 4BE9A 1ZD5A 1EA5A 1USWA 3R41A 5T4BA 3STVA 1XZKA 1B6GA 1ZICA 4GWLA 5T4EA 2WG2A 5JD5A 3HZOA 4K5QA 4KR0A 4F60A 4C89A 2OXEA 3ILSA 2XMDA 1CUZA 5T4FA 2J3DA 5K3AA 4N5IX 4RE6A 3WA7A 2OQIA 2QM0A 1QIGA 1ZIXA 1AMNA 1R88A 4G4JA 3WK5A 2GBIA 4X92A 3O9MA 1CUBA 1O6GA 1CV2A 2XMRA 3AIOA 4PF1A 1RYYA 2JGJA 5ALXA 5LZ8A 3HABA 4MXDA 2I78A 5A7GA 1A8QA 1UWCA 1THTA 1ODSA 2B4KA 2C0PA 4N8DA 5AKIA 4A16A 1EK1A 5SYMA 3MUNA 4Q05A 3W9UA 5ALMA 5F4ZA 4W9RA 1XRRA 5I8PA 5CT9A 1CUWA 1XZEA 3UUEA 3WJ2A 5LLSA 2CBGA 4BAGA 4QLAA 1H23A 1CUYA 3WIOA 2WKWA 2Y2UA 1KU6A 1PFQA 1XLVA 3TJMA 3IURA 3GELA 4DTCA 1M33A 3BF7A 5JAOA 2HA7A 2QOEA 4CCWA 4H7EA 3PFBA 3A70A 2HU8A 3H0CA 1ZJ5A 3E1GA 7YASA 2XUIA 5D3KA 4BTVA 2QUBA 3WWDA 4WDRA 4MEBA 4AX4A 3FLBA 5ALWA 3ED1A 1XZJA 4LXHA 1J06A 1A88A 1ODTC 5ALDA 4LHEA 2Q0XA 1UK9A 4H0CA 1WHTA 3DKKA 1CR6A 4PO3X 3B3QA 2YXPX 2WUEA 4MQMA 2QR5A 1BS9A 2H7CA 3I2GA 5ALZA 5AIBA 2JEZA 4X93A 1LPNA 1D07A 3AZOA 1K5PA 4G4GA 4MEAA 1R4ZA 4EY4A 2Y1KA 2YH2A 1I6WA 2WHPB 4LYEA 5EHNA 4AN0A 2ZJFA 1CUSA 3H17A 3ZWQA 4EUSA 4W1SA 2CKMA 4BZWA 2VF2A 5C8XA 1AC5A 3H2IA 2OGZA 3WK4A 1Q0RA 4B9EA 4F5ZA 2GZRA 3WK6A 1JMKC 5ALTA 3I2FA 2VSQA 2OAEA 3C6BA 4H18A 3D4LA 3FLAA 5DTJA 1AQLA 1UT6A 2GBCA 3CN9A 2HADA 5EIEA 4UBOA 1H2ZA 3WMRA 5BWBA 1N1MA 4X94A 2XQJA 3W2TA 5HK9A 1F6WA 1DT3A 1E8MA 4W63A 5AM3A 1QIIA 4AZ0A 5JAHA 5T4HA 5AKJA 1Q84A 1HDEA 1JT2A 5KREA 1NU8A 1XRMA 3KD2A 2ZSHA 3FCXA 4KE9A 5AK6A 1E89A 1P0MA 2VJCA 4DLNA 4JEIA 1X2EA 1YB6A 2K2QB 1QIHA 1PJAA 1MU0A 1YAHA 2XMGA 4MWTA 3A2LA 3S2ZA 2VA9A 4DYHA 3IUMA 2WG0A 1VE7A 5IVDA 4YPVA 3BDVA 2WTNA 5ALOA 4JUIA 1LPBB 4G1FA 4QDZA 2V98A 3FLEA 3CCCA 5AO9A 3FYTA 5FUMA 3IUQA 3LLCA 4FDMA 2WFLB 4UFNA 2D5LA 4B84A 3QMMA 4W1RA 2O2GA 2J3QA 4J3JA 1ACLA 1J1IA 4GLBA 5JD4A 1K63A 2VEOA 4LIPD 3M82A 3IA2A 3DYVA 5JALA 1A7UA 2ZSIA 3QZUA 3DOIA 4EY5A 4EBBA 3KSRA 3AUKA 4Y2XA 4BB0A 4Y2VA 1N5MA 1F8UA 5AOBA 1Y7IA 1DT5A 5I7UA 4AO7A 2ZJ6A 2B20A 1W76A 2XQKA 5K3DA 5EI5A 4B83A 5K5EA 4O08A 2RHWA 1FJ2A 1YCDA 3DL4A 4X6YA 2ROQA 4GI1A 4J0IA 5HKBA 3R3XA 2HRRA 4OB8A 1J07A 4GXNA 2G5TA 1QIDA 3G9XA 5ALNA 3X3HA 1Z68A 2EDAA 1LBSA 5DWDA 2CB9A 4KAFA 3AIMA 4G5XA 1LPAB 2ZYHA 1T4MA 1MO2A 3WI7A 1IMJA 1UKCA 3RKSA 1EB9A 3WWEA 3AIKA 4AQDA 4UHEA 4FFWA 3CXUA 3EF3A 3G0BA 4ARBA 1VOTA 3G0CA 4I4CA 5AOAA 1CUCA 3FVRA 4WFKA 3EQ7A 1JU3A 2PSEA 1ETHA 2JGEA 4X3CA 3SWWA 3RLIA 2WIDA 2DHCA 2XUPA 4XIIA 1GPLA 4HXEB 3D59A 5D3ZA 5JASA 4ZREA 1CEXA 5JIBA 3GZJA 4UPDA 3O4HA 3FNBA 1CVLA 1CUAA 3VDXA 4Y9SA 3A2NA 5LKRA 3HYSA 5IH7A 1QIMA 2OCGA 4Y7DA 1YB7A 2HL6A 5EHQA 1QFMA 2DFPA 1C7JA 2BAGA 5FV4A 1CUUA 3HRHA 3DYIA 3G0GA 4RE5A 1EDBA 2XLCA 5ALHA 2BCEA 5FP0A 4E15A 1XRLA 2DR0A 1FFBA 3V1LA 2JGKA 3JW8A 1T2NA 4UBIA 2XUKA 1GT6A 4BDTA 2HRQA 4CG3A 2JGFA 1O6FA 4RGYA 4UBNA 1GGVA 5IKXA 1YSCA 2JIDA 2RIPA 4H7KA 4FHZA 3N0TA 3WWCA 1EI9A 1JKMA 2ZJ7A 3IULA 1JI3A 4G8CA 4W1PA 5KWIA 5EIAA 4B0OA 1BROA 4DIUA 1BN6A 4C88A 3WKAA 3FCYA 1ZD3A 3R3ZA 1VE6A 2PM8A 2AXEA 3QMWA 2BUBA 2PSJA 2QXTA 3V1MA 2D0DA 5C81A 2PL5A 4OD0A 3I1IA 3F97A 1VA4A 5CT6A 2PKYX 4QA9A 3H2GA 4FKBA 5SYNA 5CBKA 1GPKA 2NW6A 1JMYA 1HBJA 1Q83A 4Y2SA 4B9AA 2WM2A 4PSCA 2AJ8A 3G9UA 5HF8A 4X6XA 3FVTA 5BWCA 1XZCA 2DQZA 4CCYA 3STXA 3DJYA 1W75A 4BVLA 4KE7A 1DX6A 1XZIA 5BOVA 2O7RA 5HK8A 2VQ6A 3I2JA 2P8SA 3B12A 4U2DA 4B0PA 1CUDA 4BC0A 2WJ4A 4Y2JA 2XLBA 1DINA 4Y2RA 1WB6A 5EHXA 3IVMA 5ALPA 2Y6UA 5ALUA 2W6CX 3LCRA 4WY8A 1UK8A 3CCBA 4FWBA 4M0FA 4H7FA 5LYYA 3O4IA 1NX9A 1LZLA 1R9MA 3OM8A 3FYUB 3LIIA 5AK5A 4HXFB 2WIGA 3G0DA 3KOOA 3H1BA 5FOQA 3D2BA 1H22A 3STWA 3TEJA 4G9EA 3P2MA 1ZD4A 1XZDA 4I3FA 3G0IA 3W9BA 1FFAA 4W1QA 5HF9A 1ORWA 3WK8A 3DKRA 4WJLA 3W05A 4UHDA 3A6ZA 3OURA 2B9VA 2GBGA 3ICVA 2OPHA 3I6MA 2QT9A 3BJRA 2OGSA 2WUGA 4Q34A 2WTMA 1LPPA 4BVJA 4BYMA 2PBLA 2R8BA 2V9ZA 4OPMA 4EHBA 1MX1A 1XRPA 4Y2QA 3AINA 1QTRA 5K3CA 2WUDA 4MJ3A 1XQWA 2WQZA 4U2GA 4DMKA 3D2AA 3ESAA 4B80A 1WCYA 1BN7A 1OXMA 2G63A 2XUOA 4OSEA 2PPLA 3C6YA 1R3DA 3C8DA 1J2EA 1E3QA 3V9AA 5AICA 2C5FA 4P9NA 2HA6A 4ZXFA 2JGIA 2WILA 2W22A 3AFIA 4BP9A 3E4DA 2XMQA 2VJDA 4IH9A 3PF8A 4PSUA 4J0JA 3B5EA 3D5EA 2XUAA 5E4TA 1CIJA 2XB6A 2GYWA 2VATA 5LKAA 4N5HX 4XVCA 1FFCA 3H2JA 1K8QA 5AK4A 2WIFA 3FOBA 3HSSA 3L1JA 5KBYA 3G9ZA 3BIWA 2J4CA 4HXGA 3NOXA 4IHAA 4L9AA 4OB7A 1YS2X 3WK9A 4E11A 5BV7A 4XX1A 1AURA 1GKKA 1XZFA 3HC7A 4X85A 5FDFA 3IB3A 3F67A 3PFCA 3T4UA 5C8ZA 1IVYA 3ANSA 3VJKA 4YX9A 1ORVA 4JYMA 4BTLA 4UUQA 2OCLA 2WHPA 1WB4A 2Z8ZA 5AKXA 1MAAA 4J0GA 3Q0TA 1P0IA 2JBWA 2V96A 3GA7A 4AZ3A 2XUHA 2VAXA 4C4YA 5CH3A 2PU5A 4AN1A 4NMWA 5HCUA 1UKBA 1QO7A 5AJHA 4EY6A 4KRXA 1DWOA 1E5TA 1VZ3A 2C0QA 1LPSA 5DNWA 5ALGA 4B82A 1R50A 2PUJA 5ALLA 5CH5A 2J4FA 1U8EA 3VKFA 4UBKA 4BCCA 1W1IA 2I3ZA 4FBMA 3NGMA 5FXMA 5H3HA 4DNPA 4UBLA 1K6EA 1WM1A 3WK7A 2YYSA 1ISPA 3RK4A 4IH4A 3ZI7A 1DQYA 1ZI9A 4OU5A 3QBJA 4P08A 3WIBA 2Z8XA 3E0XA 4PV7A 3SX4A 4IO0A 4GECA 3FWHA 3STTA 4QDOA 5AKKA 3WKCA 5AK3A 1F0NA 5A7HA 5AM5A 3BL8A 3O4JA 3BWXA 4S0XA 1LGYA 4DMHA 1L7AA 5ALYA 2BKLA 2VTVA 1L7QA 5A7FA 2PSFA 5A2GA 3SK0A 4QWMA 2G5PA 1EXWA 3BXPA 1BE0A 4LXGA 2WFLA 5K3FB 2Z5GA 1U65A 2ZYRA 1IUPA 5CH8A 4A23A 4OYYA 2HFJA 4A5SA 1W52X 2HM7A 4HTAA 4FLFA 4QDUA 3T52A 1VKHA 3ESDA 3UUFA 4LYDA 1LLFA 2O2HA 1ZI6A 1XZBA 1CUFA 3IUJA 1Y7HA 1UOOA 3U1TA 4OU4A 1IUOA 5CT5A 4U2FA 2OAGA 4B85A 1EDEA 4H7JA 3DEAA 4WY5A 2BJHA 2CZQA 4FOLA 5FRDA 2WHQA 5JATA 2CUTA 3C70A 4GDMA 2IITA 4ZGBA 5ESRA 1TKRA 1AKNA 4WCVA 1EINA 1GQRA 2ONCA 2XUGA 3AZQA 3JWEA 1XZAA 4J0CA 5ISMA 3WKEA 3GUUA 2PX6A 3QH4A 2WJ3A 1OCEA 1EVQA 1W6RA 3WWPA 3WKDA 2AJDA 1HPLA 1YA8A 4QDTA 1VA5A 3D7RA 4KYVA 3HJUA 1VXRA 4KAJA 4AB1A 3VJMA 1C4XA 1XLUA 3WLAA 2ORYA 4YASA 2PU7A 2OG1A 3K6KA 5E4YA 1EH5A 5AOCA 4BRSA 1XLWA 3QPCA 3DS8A 3I6ZA 3PUHA 4EB0A 4CIBA 2WU3A 2ZYSA 4PW0A 3H2HA 5DLPA 4X71A 1JJBA 4WFIA 1G66A 4J0KA 1MX5A 1QIFA 5ALSA 2XMBA 5HFNA 1JFRA 2X76A 1E8NA 3H2KA 5HF5A 1TK3A 3EQ9A 3IBTA 4CG1A 3NWOA 1TCAA 4B7ZA 2E3JA 1CUEA 2B61A 3VJLA 4BAZA 5AM4A 2IX9A 3DQZA 3VVLA 4FMPA 2JGMA 3BDIA 1YR2A 2WLSA 5CMLA 4XJVA 4ETWA 5AH0A 3WYNA 1JJFA 4WDQA 3WKBA 3I6YA 3C5WP 3U0VA 2HFKA 3EQ8A 3UMJA 4Z49A 4N8EA 4MWSA 4U2BA 5E2IA 1CUXA 4BZZA 3A2MA 1CRLA 4CIAA 4AO6A 1EX9A 4BCBA 3NUZA 4J03A 4WFJA 4ZV7A 3LS2A 3VVMA 4OCZA 2WFZA 1UKAA 3OPMA 4DM7A 5CRIA 5J3JA 3HLKA 3V1KA 1A8UA 1R1DA 4FFVA 3M81A 1ACJA 2RONA 2DSNA 3EBLA 2DHEA 4M0EA 5ALFA 2OGTA 4X90A 5HF6A 4BE4A 4MQLA 3OOSA 1CUIA 2VAVA 1EB8A 3ANTA 4BVKA 1YASA 1TCCA 3DDUA 3QITA 3ZV7A 5CT4A 4C4XA 4Q82A 4X95A 1UFOA 1X70A 1E66A 2ES4A 4QWWA 1DTEA 1XZGA 4UHCA 1QTIA 5ALQA 1H2WA 3R3UA 3YASA 5EHZA 2PSDA 4QDXA 2FUKA 4HRXA 4MYSA 4L0CA 1ZI8A 4Y2YA 4K6KA 3QVMA 1VXOA 1ZIYA 4H7DA 1ZGCA 4Y2TA 4BRZA 1XRQA 4UHHA 5DYYA 4KE6A 4DMFA 3O9VA 2HU5A 1CUHA 1TQHA 5AKZA 2C58A 5CXXA 5AIAA 3LIPA 4J0HA 1FFEA 1QFSA 3BJMA 5C7YA 2XMCA 3QYJA 4OUKX 2QTBA 3F9CA 3I2KA 1UZAA 3RARA 5JAUA 1P0QA 3FYUA 4HS9A 3WL6A 1XZHA 1UXOA 4QEKA 4NS4A 1CUGA 3G02A 3R0VA 5DTIA 2XUJA 3R3VA 4YK7A 1E8DA 2XUFA 3I2HA 3R40A 5CW2A 1BCSA 3FAKA 5LIPA 1QZ3A 1SC9A 5EGNA 2R11A 4C01A 5A62A 3W06A 5JZBA 3R3YA 4MYDA 4LXIA 2C7BA 2LIPA 2H7YA 1TCBA 3WZMA 1UOQA 1HQDA 4FNGA 5HZGA 4Y2PA 2HA5A 5AKEA 4K2AA 5ALJA 5IVIA 1CFJA 3CN7A 4AO8A 3C87A 1N5RA 5C8VA 2H1IA 4XWGA 2XUDA 3WJ1A 5I9IA 3G8YA 2FJPA 1SCQA 1TRHA 1VLQA 3PE6A 4DMCA 1CUVA 4PNZA 4X6UA 5DNUA 4C4ZA 5LZ2A 2QKYA 1SFRA 4ROTA 1XKLA 5DYTA 5A6VA 3FSGA 1KU0A 1XFDA 1UOPA 5DNVA 4X7BA 4P92A 4V2IA 1WB5A 4FBLA 4BBZA 4PSDA 4FNMA 1LNSA 1PV1A 2WHRA 4ZV9A 1VJ5A 4L3WA 2RAUA 2XI4A 4JH0A 3F98A 3O4GA 3HACA 4EZIA 4X91A 2ZYIA 4X00A 5AM1A 3G9TA 3V1NA 3ZPXA 2I3DA 3QPDA 5JAPA 3DOHA 3AZPA 1HL7A 3SC2A 2ECFA 1RP1A 4GEGA 5IVKA 3WL8A 2QMQA 4DNFA 5AP9A 2XQIA 3HI4A 2XQGA 4Q3OA 4UBMA 2GYUA 2QZPA 4NVRA 4BAUA 3W04A 5HKAA 4C6HA 5ALIA 3K2IA 1QJ4A 4ZWNA 2HIHA 3C8HA 5ALKA 1FSSA 2HA3A 1XQVA 3C5VA 3IDAA 4RNCA 3GFFA 1R9NA 3GBSA 5AKGA 2O7VA 2WSLA 1IUNA 3FSGD 2WU4A 2V97A 2PSHA 2AJCA 5AHXA 4E14A 4GW3A 3H1AA 1THGA 1W4LA 5FKJA 3PF9A 1BEEA 4E46A
chains in the Genus database with same CATH superfamily
1T9HA 3PFWO 2WWYA 5IEBA 3I8OA 4UUNA 4KC0A 5CT8A 1U1EA 2H11A 3GNTA 3GQVA 3GUVA 4RL4A 1H4QA 3AEXA 2O1WA 3IAHA 4NYMQ 4C1NA 1DQNA 1EKXA 2IEGA 2LDBA 3LRPA 3S8YA 1BU8A 1G5TA 5A1JA 5YASA 4Q7EA 3CRW1 5C0OE 1YJ8A 1J7KA 1Z4LA 3N59A 5FB3A 3JU3A 2R97A 1T9KA 1Y6JA 2N0SA 4RXTA 4RZHA 1JHRA 4L72A 4YCMA 1N2EA 4PG6A 3L05A 3PUKA 1OFTA 4N3GA 4XYBA 4EHLA 2AZXA 2J3KA 3C6MA 4P3OA 5E3HA 3T99A 2DAPA 3N1UA 2GERA 5KI6A 4OBBA 4R41A 4XUGB 2WWWA 4MLDA 1LBIA 2P78A 1FU4A 3WRYC 3AK4A 4BLOA 2C5BA 2GBPA 3TTXA 1BX1A 1JSCA 3ZWXA 1JI0A 3DPIA 4EMBA 4EDHA 1KK2A 2ZXFA 4GYKA 4Y1FA 3SLRA 2J67A 4LKOA 1CULC 2XCLA 3GWGA 3PFHA 4KQXA 4C7OB 2AMFA 5JZSA 2CLEB 1SHTX 3NUGA 1OGIA 1FL9A 3D54D 5FHRA 2GTHA 2OZKA 3EXAA 4LDNA 4ZVNA 5A3QA 4YP6A 1XCBA 1T2EA 5CX4A 2BCJQ 3RBAA 3TXXA 1PS0A 3OEED 1QIKA 3HFSA 4IV5A 3FFWA 1KP3A 1LRLA 2HSGA 2VP3A 3SZGA 221PA 4C2AA 1L7RA 3NXSA 4TWIA 5B55A 4X41A 4PM4A 3IQFA 3SFZA 2D8MA 1MHPA 4JB8A 2ZUEA 2IPNA 2AFHE 1S2DA 2CZGA 1HE4A 2GEDA 3FNIA 2I22A 4TMXA 1M0SA 1YZGA 3O1HB 3TZQA 3HU3A 4CE6A 1RQ7A 3BCUA 4O4IB 5L3SB 1QGZA 4O8CA 4MW4A 3IQHX 4UTRA 3F7OA 3HA5A 4B7XA 3MHPA 2GN9A 3S0JA 2XR1A 2AC7A 3KR9A 3KWMA 5ILQA 1YDEA 5G1PA 3WYFA 2GESA 2QGZA 3BXZA 3VU9B 1A9XB 1P6QA 4H9GA 1CQIB 4QUKA 1WEHA 2P9EA 4ZU1X 4AL4A 3LBHA 4YT8A 2C2WA 4B3XA 3TLGB 4Q6WA 2L42A 3MM4A 2R47A 4RD2A 4DUYB 1VPVA 2P77A 2IYZA 4KNWA 4PHGA 3T3EA 4AIRA 3WRXA 1JPVA 3PPXA 4G4IA 4TVKA 5DXJA 3D7MA 4Q9KA 3WWOA 2R2AA 1YL5A 3EF1A 4WZZA 1MZVA 5HDBB 2QSYA 3BE8A 1H9AA 1V45E 1WUIS 1WR8A 5EYPB 3UYLA 2B6HA 4JBWA 4H7HA 5AW1A 1PW5A 3VAYA 3NKLA 3UV7A 3D8SA 5AI5A 2WEKA 2DH6A 2PMBA 4DLUA 1AXGA 2QZ9A 1TEZA 5K3FA 1XQXA 1GQSA 2WJVA 3OQNA 1LBTA 2DCUA 4A2PA 3QEJA 1HNNA 2OD9A 1PKEA 2WA1A 3FN4A 4BGUA 2P2YA 2YKGA 4LX0A 1MO6A 1TZMA 2EG5A 2XCUA 1Q0LA 3KWFA 5CBPA 2E6KA 1B0ZA 5EL0A 1X38A 3DHYA 4HUJA 5DB4A 2IIVA 2FY8A 2O48X 3K9QO 2RH9B 5LZ9A 3SKYA 3C1AA 1EHYA 2ZJBA 3DOJA 3ELWA 1NQWA 3LA8A 1ISSA 4DILA 1C9DB 2DQKA 4M55A 4MINA 1SVLA 3NYIA 3PU6A 2JRLA 3SIXA 3FCAA 2QTCA 4Q1VA 5EMHA 3WG9A 3ZZNA 4BRWA 3C1OA 4MW2A 2NP7A 1I4LD 2EJCA 1C50A 3HXKA 3WNZA 4F21A 5DOZA 1PVOA 4BDSA 2QM3A 1G6KA 4UUAA 3MHTA 1LLDA 3DV0B 2QJWA 3L82B 1JFTA 2C4TA 2HJSA 2GDZA 2P4UA 3OOWA 1UKEA 5T67A 3U48A 4Z1MA 1ZESA 1L6IA 4WN3A 2W2OA 2PLNA 1HUQA 1C3OA 2REXB 3OPXA 2H0QA 2P4EA 2EDCA 3JYHA 2I3AA 4EKDA 2TECE 3V8PA 2WKPA 1LVUA 1ODIA 1SIWA 4U2EA 5EMLA 5FI1B 3F46A 2HAEA 3QXHA 4D6XA 1Z33A 2X41A 4D80A 1UC9A 2BFNA 3M6AA 2BH2A 1NI4A 2A5LA 4WASA 3WZLA 2W8ZA 1G42A 3F2VA 3H5VA 4GMHA 4P22A 2QUAA 1GPMA 2IXGA 3EIUA 3FROA 4GZLA 4K03A 1RWPA 3M3DA 4RY8A 1LUAA 2D0PB 1OOEA 2WWHA 1LLUA 2GASA 1W9HA 3JQ8B 1UFRA 1F0YA 3LPAA 3TD2A 4FTWA 2HI0A 3OX1A 3GGSA 4R1UA 2G09A 4OHOA 1RYNA 1XA3A 2PMWB 4RHTA 2MSLA 3E7PA 3NOOA 5D84A 3L1VA 1JAZA 5SZJA 3RADC 1TPZA 2BHLA 5HG0A 5KU1A 1T9ZA 5LC1A 1GPNA 3P9KA 2GETA 2B0CA 1PFYA 1HQKA 4LX8A 1ZMBA 3UF0A 2QMYA 4A5OA 4E88A 1GNRA 1ZITA 2JAQA 3ZY5A 3UMCA 2Q6LA 1NFRA 3R7NA 1WTCA 5TC4A 4OKIA 3TOVA 3AVXA 3BIXA 2CEKA 2GLUA 5M3BA 2HIGA 3IPCA 5B2EA 5F3WB 3I0MA 4B43A 4Q3KA 3A6HA 3R4VA 2FK8A 5CB4A 3EF0A 4B2YA 2O9JA 3U6KA 2YFQA 3DJFA 4LOLA 5CFOA 4HEQA 3EVFA 1Y8RA 2HHAA 1BE1A 3EW7A 4YXWD 5A3RA 3LAWA 4EG4A 2YCLA 2GN1A 3MT8A 3QPWA 1Z15A 4MKFA 2R7LA 4YRZA 1W96A 3Q2KA 4H4EA 4OLHA 5IVHA 3KQVA 5JXHA 1W47A 2HNKA 3G88A 4LRXA 1W29A 2SNIE 3G79A 2E5LB 1OC2A 3E8XA 2W2VA 4NZZA 3VPFA 3OPNA 4RA6B 1GZ7A 4IFIA 2EYQA 1Z74A 4ALKA 1SBCA 3KOYA 1L4MA 4UBJA 4BQQA 1H1LB 1KVUA 1A5ZA 1MNQA 1ZKDA 2HF2A 3INNA 5I7EA 4KO4S 4P5DA 4PZUA 2D1SA 4S3MA 1GEEA 3QSGA 2XBLA 5IAGA 5BVHB 4D4GA 4C5BA 2BUAA 1MVOA 3BQ9A 4GP7A 3WYDA 4RZIA 4HC4A 1BS1A 2QE7A 3P2YA 4PGGA 1DV2A 4TTJA 2QDKA 5CIQA 4GI3A 1GPUA 2G72A 3R7DA 4HXYA 2IXBA 3W9YA 5E6UB 3KOUA 1UZUA 4L73A 3GRKA 3K5PA 1N3YA 3G3EA 3L8FA 3OFVA 5BNFA 2CJYA 2QA5A 1Q0PA 2IXEA 2P9YA 4KMSA 4MGEA 3F96A 3TLMA 3MAGA 4MQ4A 2GO7A 1JSZA 3H3JA 4JQYA 2WAYA 2HC9A 4Y0AA 3UT5A 4ZC8A 4R2LA 3VR4H 5HUQA 2Y0CA 1N0WA 1WBBA 4PG8A 3KUUA 3WGNA 3EZFA 3B2EA 4Q4AB 4EOGA 4K81B 4CG2A 2F1IA 5EJ8A 1U8CB 1MVNA 5GZ6A 4BFCA 1IBLB 1WWKA 1M6EX 1SXIA 5AM2A 4IDFA 4YJ2A 2X3YA 3B9RA 1KS2A 4CMEC 2ZSFA 1E5XA 1ZGJA 2FCAA 2P5TB 1A71A 5DEOA 5MFZA 3Q3JB 3DD5A 4ARSA 4CNQA 3ZDZB 1ODJA 1TUIA 1AV6A 1E6EA 1EE1A 2X4DA 2YFKA 3F6RA 1GARA 2IZ1A 3WGZA 4LISA 2O3JA 2I3GA 3TDMA 3ZXIA 3KKMA 2J6IA 1HG1A 1X80B 1GR0A 3UICA 3ND9A 1DXYA 1FPMA 4RIFA 1F4LA 4BQPA 1C7IA 4FHFA 1QSGA 4FMCB 1ZNWA 1KF0A 2BMDA 5KS2A 3FHLA 3W34A 3K73O 5EWJB 4P7JA 2O8BA 1WY5A 4RF2A 2XXAA 4EG5A 4ZI5A 1HETA 4HDCA 1T3SA 3MRVA 2BHTA 4PVDA 3DP7A 2EL9A 2J9ZB 3FCOA 5EAIA 4F04A 3KETA 2GN6A 3LA6A 1QHHB 5DU2A 1V8BA 3X1WA 2IEZA 1A2QA 4QZVA 3EA5A 3BTUA 1MPXA 1T5SA 4KACA 1UK6A 2MSEB 2W0MA 1RQGA 2G04A 3HKBB 5L3ZA 3NJRA 3GFVA 3MJSA 4W8HA 3LX4A 4LJKA 5L7YA 4RKQA 2IX3A 1Z28A 2FZWA 2VUTA 3CG0A 4AURA 1SO8A 3N2NA 2VPYA 1SA0B 2W6MA 4Z9YA 2BELA 2XDWA 3VR2D 5C7OO 2OFWA 1MVLA 2VF7A 3RTAA 2V8BA 4CQJA 1O94C 4AF6A 1O8BA 4ONEA 4TV9A 3KXDA 1CPYA 2ODTX 1PW7A 3STYA 4Z4GA 2TSYB 2IH2A 1KZ4A 1VC2A 4ENRA 1MBZA 4G5YA 4DLXA 2AFRA 3OHSX 2RJNA 4YCAA 4JSYA 1QRAA 3VR5A 2X5XA 5JADA 4TQGA 2R6FA 2PUAA 1ZUIA 1N2HA 1YA4A 2Y6VA 4HPJB 4E4TA 5EZYA 2ZRHA 3O0DA 4LMBA 5FAXA 4G0QA 4U7FA 3LTNC 1Y82A 4ZAFA 1E59A 1QYVA 2P2ZA 1AOXA 1US8B 1X7WB 2C3PA 2PKXA 2ZDGA 3BQNB 3Q8WA 1NVGA 4R8KA 4BIMA 4Z7JA 3LNCA 4FSXA 2YJGA 2C5HA 1H93A 2HZBA 3V2GA 3AM1A 4CDRA 5DP2A 4AYXA 4G3XA 1WUTA 1KH3A 2I1LA 3OCCA 2HKIA 4TRMA 4DZRA 5AI4A 4Y30A 4EG0A 5J5AA 2VPXA 1PZXA 1KK0A 1EDDA 1OBVA 3B89A 3HKCA 4KKXB 1SQ0A 1XDSA 2OOKA 1XKTA 4MUXA 1FFSA 1YQTA 2CMDA 2V4ZA 4HH3C 4GL2A 1W1UA 4EM6A 4IR7A 2IPAB 4P34A 1XRNA 3KHSA 3MWYW 4IIJF 4JJ6A 1GRRA 4US1R 4UU0A 1Z83A 3GJ4A 2G71A 1H65A 3CHYA 3PC7A 4P93A 2P6NA 5L4LA 1EEXB 1G4HA 3MUOA 1DWUA 2ZTUA 1L5GB 1KMHA 2EKBA 1VIDA 3A6JA 3Q2OA 2F55A 2WFAA 2P3QA 1I0LA 1EK2A 3IBGA 3B1WA 3GEDA 1SPXA 3MRXA 3T38A 3R9KA 2OECA 1KGSA 1GKIA 1YDMA 1YVUA 1PLLA 1WU8A 4Z6KA 3KAJA 2WTBA 3QM1A 5E1MA 2PQ2A 3PGVA 3VYUB 1XLTA 4Z86A 3LUPA 1HA3A 3IV9A 2ZT6A 2ZSJA 1WDMA 1CQWA 1UWKA 2GPWA 4Y2UA 3VPCA 3W78A 3WGGA 1G41A 4J1NA 4ALNA 4F8JA 4YUXA 3LM8A 4RPKA 3U7IA 2G83A 4ENQA 3QBTA 3GPIA 4F5EA 5CGQB 3RIMA 2L0XA 3TW0A 2HLDD 3F6YA 4JWKA 4C05A 2FRXA 4DIOA 1KJNA 3EEYA 1FQWA 4ZRDA 4JBGA 4LNHA 3I9FA 1RP7A 1H1DA 4A6XA 1E6CA 4CT5A 3ZDBA 1BW9B 1VI2A 3O93A 1F7VA 5G4KA 2ZIUB 3OOYA 2HUPA 1QS0A 1BX0A 2PWZA 3NGLA 2E82A 2G7MC 2YDYA 5DNEA 2C4HA 4R71A 2AKEA 3KVYA 2Z04A 1J99A 5KNDD 2XZLA 2CJPA 4EUKA 1LEHA 2HBZA 3E53A 1G5FA 4NTZA 1KL7A 1KORA 2WIKA 1E6WA 1JQKA 1VPLA 1YRHA 4JKIA 2PBZA 1E7WA 3FBWA 1EU1A 3HS3A 4BV3A 1BA2A 3L1UA 5BSFA 1NW7A 1YS9A 2Z6VA 3B8EA 4JENA 2DHDA 1N1GA 1YBAA 4RZSA 3I1YA 5C8YF 1XUOA 4KVFA 1A8SA 1ABEA 1TZKA 2J0UA 3N74A 3WLJA 2WJ6A 4A8HA 3L0ZA 3GLIE 3HJFA 1VG0B 2R1TA 4LTMA 4YBZA 4EB3A 1GZVA 2I03A 3SMVA 2O8VA 2J46A 2ZRKA 1IN4A 1ID8A 4AT1A 1UP7A 4PC7A 3LKBA 1IBSA 3C43A 4JI5B 4DREA 5C1PA 1J21A 2DBZA 4IXTA 5HIKA 1E20A 1XC7A 2JH8A 3BH7A 4YGYA 1Q20A 2J32A 2RHOA 3ZQJA 3T8YA 3VKGA 4G9BA 4UD6A 1FFWA 4HG2A 4DR2B 2XCRB 1XMVA 1CZHA 1L5RA 2NU6A 2Q3HA 4IXMA 4JLOA 4HNAB 4DIDA 5IM4F 3QK7A 3F7MA 4MSUA 4FLEA 1AKUA 3K92A 4ARIA 1YIOA 2P0AA 4AZWA 2QVLA 1REQB 1LW7A 3JQGB 1E3WA 4TOIA 4UARA 4DNQA 5JEEA 3TGLA 4BNMA 3PRKE 1Q0TA 1PK7A 2YMMA 2GWHA 2OA0A 2FZLA 3BIFA 3L7YA 1XCJA 2QS9A 2RK4A 4FGZA 2Q4BA 2X7HA 4P4SA 1VB3A 3ESCA 4QTXA 2HJ9A 3LUBA 3QX7A 4MP6A 3U0BA 4CMHA 1RZRD 2FWPA 2FZ4A 4ZI7F 5J59A 3R3WA 4M1EA 1L5LA 3T1QA 1O6ZA 4UC0A 4BVEA 4K6HA 2GD1O 3FF1A 4UHFA 4PN3A 4GXTA 2G1UA 2QRNA 3G2NA 5CYPA 3INYA 4Q3BA 2LCQA 3Q7PA 1U4NA 2H2IA 3Q7SA 1PNOA 3P45A 3AILA 2HA2A 4DMGA 1E3DA 1E4EA 1L7EA 3DL7A 4F4HA 3Q3IA 2MHCA 2ZWIA 3C7TA 3DZHA 3IRVA 5H81A 2L69A 1GV1A 2VSXA 1EK0A 1TE2A 4GSLA 4EFNA 1PD1A 1HLGA 4DLLA 3W5BA 1XZMA 3HFJA 1J42A 1T1IA 3LPDA 1II8A 3CWZA 2QN6A 1NN3A 3CUYA 4RMHA 4J16C 1FMFA 2W4MA 2C9YA 2JHCA 3D6NB 3SSNA 3ZHTA 3LT4A 5K3EA 5FI0B 3FUXA 4MS4A 2A3NA 2JKVA 3O21A 4KDRA 2AB0A 3HXPA 4D4LA 5BSEA 5B12A 5JO9A 4YBRA 5AW9A 4N40A 1AX9A 1TEVA 3VXKA 1GPAA 4MUEA 1VLJA 2NXWA 4L7QA 5KX5F 1G9TA 1WZEA 1I1NA 2H2FA 3PHJA 2TMYA 3PPWA 4M9ZA 1WS6A 1Z2EA 3G2LA 4RVOA 4OQEA 4EA8A 2JLXA 2IYUA 1WBDA 2B8JA 3R41A 5T4BA 4BFWA 3KQLA 3PRJA 2XIQA 4W7IA 2WG2A 2ERCA 1LF0A 3HZOA 4RVUA 4EJSA 3VDNB 5B6PA 4YDQA 1I2DA 4MPTA 5F78A 1IY9A 4KR0A 3K2EA 4C89A 4F60A 1U0FA 1OU0A 4LRYA 2CXPA 2JIZA 3LGAA 3SJZA 821PA 5JFTA 4B2IA 2LR0A 2CL5A 2R8OA 2NU9A 3ILSA 4ZCRA 1UR5A 4LWZA 1CUZA 2EHDA 5T4FA 4KK3A 5FA6A 2QZJA 3RAEC 3N05A 5BR8B 1AU9A 3A10A 2NSDA 4ERNA 4PG7A 5K6TA 1N2XA 1XEAA 1LDBA 1PRYA 2HXYA 3CURA 4KDFA 5TPWB 5TQJA 2C3UA 3FOZA 1CYDA 1QIGA 2B0JA 2BGUA 4R69A 3UKDA 2ZB7A 1AKTA 5LU8A 3OJWA 1XJCA 2R85A 1VMEA 1ZHHA 5EP1A 3IR6A 3WGYA 3EEFA 4EAQA 2P69A 3KZKA 4G4JA 1BXRA 4OEHA 3D1LA 4ZVVA 4NBKA 2PZEA 3N58A 4KXXA 4X92A 3O9MA 2BKVA 5ERYA 1ZEJA 2IYAA 2QI9C 3HU2A 3KV1A 4HN4B 4N01A 3SKVA 4ZEMA 1L1RA 3O7WA 1HNWB 1TAQA 1XJ5A 2A9RA 2IGBA 2JGJA 2KBEA 3BORA 4I3GA 4LWOA 5ALXA 5LZ8A 5K0TA 1RHKA 3S2YA 3MLBA 5CLLA 5A7GA 2ZATA 1NJSA 1BDJA 1F2VA 1UWCA 3F5SA 2GO1A 2HD4A 3VI3B 4FXOA 3V4SA 1THTA 2GAFA 4G6ZA 4U6QA 3SM9A 2YQZA 4Q9LA 4MUFA 3D4PA 1BTOA 3U7QB 3KFVA 3UFXB 4A16A 1EGQA 3PI7A 1VG9B 1GZHB 2V45A 2VNHA 4XOIA 5BSHA 5FEMA 1QWSA 3UTCA 3UZUA 3NRJA 3FF4A 2ZEJA 3MUNA 1FOEB 1ADJA 2P41A 4PS0A 3T7JA 3MIIA 2GK4A 2BFDB 2HQBA 2IIQA 3E03A 3OOJA 4HYQA 4IILA 4MR7A 4WKCA 1GCGA 3W9UA 4MUBA 1TIKA 1XRRA 4ZAWA 3CZCA 1A9QA 3A8TA 3MOIA 4WCFA 3A4NA 4P5PA 1NYQA 3CPJB 5L7TA 3TQFA 5LLSA 5IBCA 2V0GA 1ZDMA 4LEIA 3UJCA 2WC1A 4LDJA 1PR5A 3A3KA 2FPUA 3PIRA 5ICEA 5FUYA 3A9RA 4LNUA 4POAA 3PNSA 4LC9A 3RV4A 3KR2A 1G16A 2NT3A 4XDYA 3ZD7A 1PFQA 1XLVA 2JJ2D 2O1XA 3DB2A 3IURA 3MQ2A 2P7IA 1ST3A 5ECWA 4DTCA 1RC8A 2XYVA 1HEIA 3ZU5A 2F43B 1F8FA 3IGFA 1U3TA 3RQSA 2G9RA 2PANA 3O1IC 1AKWA 1Z4QA 1RI2A 2X3UA 1ZU4A 2QOEA 5F33A 4NE7A 3WICA 3WWYA 1C1HA 3SXPA 3SIRA 5C34B 2BHSA 2FEOA 1FJHA 1NUQA 1XU9A 2C9MA 2WNHA 3TLYA 3PZRA 1RZ3A 4YRKA 5IT4A 4DR4B 1KH1A 3F6PA 1ZJ5A 2VR1A 5EPOA 1UJCA 2JHAA 3E1GA 3ECSA 4G5FA 4B35A 5AW8A 4E1AA 4P54A 7YASA 1FSFA 2HK8A 3LNTA 1JDTA 4WXHA 3L84A 3IBCA 1C30B 1YBVA 5D3KA 3V8BA 3BAZA 5E1BA 4PLYA 1O03A 4KQHA 5FLYA 3GDWA 5KKAA 5LQRA 1P9RA 4ND4A 2FSHA 4NOMA 4AX4A 2J6BA 3ICOA 2AOUB 2O2DA 2HLPA 1KA9H 5KSOA 3OOEA 1PS8A 3FWNA 1O5OA 3ZI0A 4LAFA 3LXMA 2X8LA 5LQAA 1RKXA 1J06A 2H1VA 3G2IA 3K16A 4E94A 4V1CA 1PHRA 1U2DC 4PAGA 3AEUB 5IYZB 2H0RA 1KQFA 2H9IA 1T1SA 4MWDA 2HDHA 4QYWA 3Q1KA 4AJPA 2FDCA 3D31A 4AROA 2EU8A 1QLHA 5C7IO 1MF7A 3OT4A 4OFXA 1QRUA 3DKKA 1J8MF 3JSAA 2JNWA 3FWKA 5TQ2A 3R5KA 4FDUA 4B7UA 4DHEA 3OIDA 1QNLA 1V8FA 3HCOA 4TYQA 1PFVA 2BKXA 3L8ZA 4YIHA 1H2BA 4GWGA 3EXHB 3AW9A 1ISJA 1Z35A 5AD1A 1BS9A 5LM3A 1XTPA 4PRYA 3EYWA 4QNMA 2A8YA 4TS3A 1NJ2A 1OE0A 1V43A 3QTTA 2JI9A 3O3OB 4BHTA 1JFVA 4X93A 3PR1A 3VNAA 1BFUA 3FAZA 1KHTA 1MJHA 3AZOA 1K5PA 4PPGA 2V0CA 5IF3A 4RVNA 3IAEA 5HM6A 3ETLA 1BMDA 4RIEA 4PBSA 4UM9D 1Y6FA 5EIBD 1PVDA 2O23A 4R1PA 3H83A 4LRUA 2IPLA 3PWSA 1RYMA 3WB0A 3RO7A 4D4IA 2O0LA 2IK8A 3AYZB 4CW7A 1Y8QA 3T3IA 2C4MA 3LL4A 4H17A 2II6A 2B94A 2ZZNA 2VJYA 2H48A 3N0WA 4HJRA 2V7WA 4OGLA 3UAGA 3ZCTA 4EUSA 4W1SA 1KFCB 1VKRA 4G97A 2V6GA 5EMJA 2YR0A 4B3DA 5KVSA 4G56A 1MRNA 3FSEA 4JCCA 1WMSA 3MZ0A 4WZ6A 4KN6A 3JASA 1O3YA 2E87A 1O2DA 4UATA 1K8YB 4E5KA 1Y4UA 5JZOA 2QIPA 2W37A 2FFQA 1FDIA 1Q0RA 3GRZA 1CZUA 4BFXA 2ZW9A 3R5XA 3J81k 4DR1B 1WEKA 3HCRA 3NEPX 4ZFNA 4MWEA 3QP9A 4PWYA 4X8OA 3IV7A 1C8VB 3CSSA 3LVRE 4KMMA 3I2FA 1V48A 5E6SB 4Q18A 3JRWA 1TAGA 1TF5A 4DRXB 2Q6TA 2P2LA 2PY6A 2FG7C 1IN5A 2OAEA 2VJKA 2FN8A 3ZE6A 1N2IA 3OM0A 1BRMA 1P19A 1RXCA 4I5GA 4OQ4A 4ESVA 1T0HB 5KJEA 2DC1A 5DTJA 4OMCA 4DSUA 1K75A 4GZ6A 4JR0A 4GMFA 4XH9B 3CZQA 4CCSA 4QVIA 4QQFA 4LQDA 4RGQA 4DBZA 2DQ4A 3N86A 3TRFA 5FCDA 1M0TA 2BFEA 4N47A 1RXIA 3OCUA 4KOAA 4CWAA 2Z2KA 1KFKB 3HY6A 4RD4A 4UBOA 3HR7A 4IKOA 4J6EA 5ESXA 2GSDA 1H2ZA 3JZAA 4MW7A 5T6MA 4CKEB 2NUTB 4KTTE 4HP8A 2PHZA 4J1SA 4LHXA 3VPDA 4JX9A 2O54A 4ESEA 3RYCB 5A0VA 3NMUF 4RDXA 1AD2A 121PA 1XCOA 4NMHA 2YN0A 5CVTA 3D3EA 3ZNPA 5HK9A 1Z6TA 1IN6A 2GTIA 4EQ6B 4G0MA 2VA8A 4D57A 1GFIA 1T5DX 3FCUB 4W63A 1FB5A 5THQA 4B3IA 4JI2B 2PXHA 1KNXA 1U7HA 2P5UA 1Q84A 3K9NA 4MUAA 4EA9A 1DG3A 1W581 4QGAA 4ZIRA 2W2KA 2DBQA 1G3RA 3IDFA 4KNVA 5FI5A 5K0NA 1LVGA 2BMFA 5B3JA 2VTEA 3NIBA 3PPYA 2FLKA 4NXNB 1J2YA 3HU5A 4GPIB 3V55A 3JY6A 2CUKA 4YXWA 4UTNA 5JQGF 1RJEA 2OZPA 4KE9A 5AK6A 1E89A 1BQEA 1F9EA 1OZ0A 4TROA 1MQ8B 3MS2A 1J5PA 5HBRA 1YFKA 2K2QB 5FF9A 5JPCA 1IQPA 1DO0A 1FQJA 2GLTA 3H99A 5HCNA 4HI0E 2AC2A 2FLWA 3N2YA 4F4CA 1RABA 1JBQA 1QVAA 4IDQA 4EHAA 3BMXA 4X1KB 1SVUA 1YAHA 2FEAA 4JQOA 4MO2A 4CMJA 1H4TA 1G5PA 1B8VA 4O4LB 1B1CA 3AUXA 4AZVA 3A2LA 3G8CA 1X14A 3S2ZA 3SC6A 5EJFA 2B83A 4LYHA 4ZZ0A 4I4TB 3FZEA 2H31A 5AW0A 1R3UA 2YW9A 3P94A 1D6NA 4KSBA 1P7CA 3RYFB 3IUMA 1ZK2A 5KQSA 2JAHA 3KKPA 2E5WA 1E79D 3T12A 3WLEA 2FF5A 3BVPA 1N2SA 4BU1A 2A30A 4D9FA 2GZ2A 1D0VA 4YPVA 4OGGA 3LLSA 3PDHA 1PG2A 3H87A 4OKNA 5ALOA 5KWSA 1J8QA 2DBVO 4NOJA 5FBVB 2YWDA 4JUIA 2A0UA 2A5DA 1W0CA 3BBPA 1LPBB 1UT5A 2AYZA 3BCSA 3E2IA 4G81A 4HSGA 3W5SA 1ZCFA 4QLBA 3LWNA 1FPQA 4Z0PA 4D3SA 3D6TB 4EYOA 1N3BA 1P44A 1KO5A 4F38A 4F91B 1JWBB 1N0IA 3FMIA 4FKZA 1ENZA 4FDMA 4K9MA 4TWRA 3TTUA 2WFLB 4F11A 2J85A 1YVEI 5SYAA 1S7CA 2FEPA 4LKRA 4UFNA 3JWPA 3CVXA 4WA7A 1JVNA 4IW3B 4CMIB 4RJJA 4ZTBA 4HZUB 3U7GA 3LXXA 2O2GA 4I1UA 2J3QA 5AVZA 3AU8A 4YTEA 2NAFA 4Y2HA 5HXAA 3RS9A 2VIIA 4II7A 5DIFA 4BB5A 3A4MA 4TQAA 3EC1A 1KFJB 2N46A 4LIPD 3ZDCA 2I6QA 3M82A 1SOUA 3DYVA 2OGUA 2QD3A 4TKZA 4GM0A 2QVCA 2JH9A 2OL4A 1M1YA 2B4QA 4MRAA 5T8KA 3HP1A 2JKZA 1XAHA 2PRKA 5AW6A 4Y2XA 1ML4A 4AJ4A 3W7VA 3H5WA 1XPJA 1Y3BE 2FJUA 4F3RA 1HDZA 2QIOA 1J24A 1TJNA 2LKCA 3KQTA 3MT0A 3VO1A 1Y7IA 1MRSA 2QROA 4CQMA 2VP6A 5BWOA 1NNEA 1HOXA 1ESCA 3LBAA 1W76A 4AP6A 3T4PA 3B5JA 1QH0A 4MH0R 2X86A 4YC7A 3PC6A 4BWVA 1SZDA 3PFGA 4N7BA 2FMXA 2Q2WA 2VCYA 4NNOA 1UC8A 4UQOA 3PKIA 3G85A 1D4OA 4X6YA 3KT0A 3EQ2A 2WKQA 4GI1A 3GL9A 2JGRA 4QYIB 4EW3A 4IMIB 2FMFA 8MHTA 1YIDA 2BONA 2GZ3A 2HRRA 3B7WA 1JQBA 2PL1A 3C3AA 1U7OA 4IRUB 5CYGA 1J07A 3JAKA 5KVVA 1E1DA 3EH1A 1P7ZA 3IFSA 4UDYX 2PXXA 3X1JA 1G38A 1GG2A 3X3HA 1EUCB 1SQ6A 2ZOSA 1WXGA 1GRCA 5IHXA 2CB9A 1NXXA 2YNMD 1FFGA 5G02A 1DJOA 3GT7A 4B6EA 5FH9A 3REFA 2NVUB 5JWRA 1N5JA 2IHNA 3ZHXA 1KJ8A 5JISA 1G7TA 4FN5A 2J33A 1DHRA 3QTLA 5FT9A 4YAOA 2COEA 5CD1A 2F17A 1PAUA 3NW9A 1ZCJA 4TN5A 2ZYHA 5TVKA 1WBJB 2QX4A 1WNTA 1ECJA 4HOYA 1GHTA 2P3OA 2YOGA 5SY6A 2VQEB 1KZ9A 1I7QB 3F6BX 4EGCB 4NS1A 3HB7A 4MKXA 1UKCA 3LLVA 3RKSA 4CVNA 1WF3A 2IELA 3KX2A 4R1MA 1UADA 1Z0DA 1YO6A 2OUKA 1MJGM 3RYIB 4AQDA 5KU7A 3HXQA 2QD2A 5C1DA 3IEMA 1TTPB 1V6SA 1VKZA 3W3AA 1XLTC 4WVFA 1VOTA 3FRIA 1OLUB 1KR5A 3DC7A 2ZE5A 5DSXA 3ME5A 4DCSA 3G0CA 4MDHA 4MR9A 1M54A 4J7UA 4XD7D 3GVHA 5HP4A 4CG0A 1KI4A 3GVXA 4LE2A 1IEQA 4TSKA 2CVPA 3EQ7A 4EPYA 4US2R 3ZOKA 1BZYA 2ZSEA 6ABPA 4XWKA 4ZOBA 1ETHA 2JGEA 1JH9A 3TSAA 5F77A 1EBBA 1G3UA 2XEDA 3RFUA 3CM0A 5ITZA 4FJ1A 1NPDA 2XUPA 1LX6A 1G8FA 3UK0A 3ETDA 3OE5A 1IZ0A 1B93A 1PZEA 1AHNA 1UBLS 3OJEA 4UNQA 1V16B 2HV8A 4M1SA 4ZREA 4EF4A 5JIBA 2KYRA 4D97A 3IIMA 3NEJA 2WNIA 1GVHA 3K70D 1QO0A 3LYLA 5JVDB 2OHFA 2V6IA 2X5OA 2ZB3A 3HV2A 3OFNA 4Q4HA 3WL4A 2QXYA 5TMEA 1DFGA 1TTHA 5KNDA 3MWLA 1C4KA 4KWEA 3W90A 1MW8X 2ETVA 4FHGA 3SEAA 4A73A 2HX1A 4ID9A 5LKRA 4RS4A 3HYSA 4B8WA 2B3DA 1MIOB 1VDZA 2X13A 4URYR 1U94A 1UL1X 4ZCQA 1FYWA 1GL6A 6NULA 1P1RA 1YB7A 3JQDA 4ARZB 3CS3A 4KGXA 1JIUA 1FLAA 4N76A 1TU4A 3ZWAA 4YMLA 2DFPA 2BMEA 2A35A 1Q3TA 1IC6A 2AWNA 2P35A 3GJXC 3PEVA 2IDMA 4PCUA 5FV4A 1HXHA 2VYVA 3L7KA 3DMFA 4L2IB 1EDBA 2BH9A 3NIDB 1Z2NX 2XWQA 2BCEA 2NQ2C 1Z9BA 3FYHA 4L5YA 4CXMA 3EUAA 4BFUA 4G89A 1SVSA 1PR2A 2FG5A 2KLBA 2VQ3A 2Z9BA 3D4OA 4HNQA 3LPMA 4JJFA 4A2CA 4OMFG 3R7BA 1KBOA 4UBIA 1RAEA 5SZKB 2OZEA 5E1DA 5J47A 4M7RA 4NF2A 3DYBA 3GLHA 3COJA 3GLFB 5BN3A 3ADKA 3EXIA 2VZ8A 4S1NA 3GVCA 2ZCJA 2HRQA 4WT7A 1N1EA 2JGFA 3QE3A 2FQWA 4IWNA 4EHFA 1O6FA 2J9RA 5JNRA 3VYRB 2R8XA 2DLDA 3N2GA 1H94A 1QVRA 4Q7JB 4RHEA 2QTMA 3I0NA 5CFPA 1H8ED 3E7DA 5IKXA 5A5FA 3V4RA 1T0PA 3BWVA 4F2PA 3VU0A 2ACWA 4JOBA 4GQIA 3WWCA 5BUQA 1SUCA 5FA8A 1RZRA 1QFZA 1OWPA 5BOSB 4OUDA 4RK5A 1PJZA 3KVRA 4FKMA 4Q93A 1NY5A 3EEQA 4R9RA 1R74A 2ZJ7A 3PWZA 2I8LA 4BZXA 3L6DA 3N07A 4IQ0A 3KT3A 2C2HA 3LW8A 4G8CA 1YQ9A 1WW3A 3MPUA 3NX4A 1UPFA 4YCBA 1ZOSA 5DSZA 3LDUA 4G0YA 4LC0A 4LOJA 4TSRA 5KWIA 4EG1A 3KOXA 1V8OA 1V3VA 3AOEC 4M98A 2VJLA 4BNKA 1CX9B 1HV8A 2FH5B 1UBKS 2LTAA 2QW8A 3INGA 2C5LA 1T4DA 3C24A 2C88A 5F7JA 3TTVA 3S1SA 2HXGA 1B0PA 4QAJA 4UVDA 4A03A 5M7EA 3QKTA 3QEBZ 2AXEA 5LN1A 2VC2B 3L6OO 3MMZA 3L7BA 4WESB 2BUBA 2YWXA 4XDHA 3IL2A 3B70A 3LP8A 1EXMA 4ZZ2A 2DPLA 3ADCA 4I7EA 1JHUA 2NTNA 2QXTA 3A06A 5DRTA 4EJSC 4OFZA 3EZLA 3HCWA 5ERGB 1X9IA 2DRIA 2ODNA 2EBFX 3I1IA 3QI2A 4TTVA 2UZ1B 4DLPA 3DAHA 2HOQA 2YDXA 4FKBA 5GOTA 3SQDA 4C2BA 4F5DA 1SR8A 2QHXA 5LUBA 4EY3A 1DAMA 1KI7A 1NV9A 2R60A 1W0JA 5DBGA 5JUWA 2FN7A 3LC0A 2PGDA 2YJ3A 1XD2A 3DAPA 3NTOA 4YJ3A 1EBFA 4NG5A 5LDGA 4V02A 3DMPA 4BNUA 2VP0A 5AVSA 4W5NA 1C7RA 3KB2A 1D6MA 5K51A 1K66A 1PR4A 1VECA 4YAIA 2IF0A 1ORIA 4KFUA 1Q77A 2HWXA 5HF8A 1T9GS 1A9PA 2O8FA 2DQZA 4CCYA 1YDWA 4CLRB 2Y66A 2R6R1 1TOAA 3INRA 2ZYTX 1NSYA 3KPYA 4TM7A 5ER6A 1W75A 4E2XA 4DLYA 1UANA 4BVLA 4EUNA 1CJVC 2O0HA 1GVNB 4Y67A 2UV8A 1HQYE 1LTKA 2NACA 5CK4A 3KAQA 5HK8A 2X0JA 2VQ6A 2PKQP 1P74A 3PT9A 4C7KA 3BS4A 3MAJA 1CJTC 1DDIA 1YACA 1VPWA 2B34A 4BMSA 4K0KB 1Z29A 4NPCA 1J39A 4RVSA 4B0PA 5H7XA 2BEUA 3MMPA 4BC0A 3WGUA 4IF4A 5B7NA 3PPVA 1U0GA 4PVCA 2GPBA 4URFA 2I4LA 4D4HA 4WXMA 1PR6A 2JFQA 3LY8A 2W43A 4FDVA 4QXQA 5E95A 2WU1A 2QP4A 3HGTA 1M34B 3KXKA 4YPFA 5ALPA 2XOEA 1X1BA 3NNDA 5KQLA 1C9YA 1Z0UA 3LVFO 3SVZA 1U6JA 4ER0A 4WIAA 3W8EA 5JMTA 2BT4A 3DE3X 3R1IA 3TFOA 2VOJA 1ZAYA 1XEXB 1Z4MA 2X0NA 4KXMA 4UUMA 4Y8VA 5DWQA 3PL5A 1F17A 4MCHA 3ZCXA 4E4YA 2H4JA 3QWFA 4MAAA 5KO2A 2QF7A 1GTZA 2XA9A 4KQKA 4HDQB 3WO0A 4D96A 1B43A 5ER9A 2HMTA 3OT5A 4JUAA 4FIDA 2DT5A 3M1IA 2O7QA 2Y1CA 4RETA 1X7YA 2VYQA 4B2LA 1LZLA 1HRKA 5GP1A 2OR3A 5HE8A 13PKA 1D7OA 2PZAA 2BVNA 3A36A 3OZFA 4G5RA 5AK5A 5ECGC 3BD9A 1CXZA 1HTBA 4L4UA 3AF5A 4EKEA 5A4KA 3I01M 5IS2A 2A59A 3G0DA 4FS3A 4F2GA 3CUEF 4TTPA 1OH6A 3RHZA 4B3SB 1E7MA 1GA4A 2KJQA 3H1BA 4BIIA 2WHXA 5C7LO 1UUFA 3TG2A 2HGSA 3NT2A 1POWA 2VAMA 1GO2A 2NWQA 1H22A 2AYXA 2KPOA 2N75A 1GFZA 1V96A 4BASA 5LMZA 1KMCA 2G6TA 3HDGA 4YJGB 4FINA 2NVOA 4JR1A 3TEJA 1K4MA 1HDRA 3IAFA 5FBKA 1ZHFA 1TX4B 2X5JO 4G9EA 3RTCA 1FSGA 3MWEB 4P3PA 2WT8A 4X0EA 2AFVA 1QC5B 5C80A 1Z17A 1I2AA 2YINC 3LDFA 1HT3A 3FPEA 3NANA 3Q12A 4W1QA 1LA2A 5GMOA 3RS3A 3SJCA 3QUCA 1BCSB 4AS3A 4D3YA 4WN9A 3CZ4A 3QUTA 1BVHA 2VPWA 4E5PA 2OSVA 4LMRA 4LFAB 3HQ4O 1YZFA 2JBAB 4KQ6A 1HQCA 2X22A 4OHXA 3AQ4A 3QX8A 3OEYA 1MV5A 2P2DA 2P8JA 3ZJUA 4EYQA 5G0VA 2YQ4A 1MKYA 1QOPB 4KH0A 4I50A 1DUVG 1BYUA 1U63A 3BJRA 2WUGA 2PD3A 4GP9A 2ZIWB 3UJNA 3R09A 4IIFA 3LYAA 4BYMA 3MCWA 3PB3A 1IY2A 3EIWA 4EHBA 1MX1A 1FMJA 1QZUA 4WNAB 3S44A 1XRPA 2REQA 2ZJZA 4LXXA 3H8JA 4Y2QA 3K94A 2IU0A 3AM5A 3WAKA 5K6RA 2X8JB 3T5PA 3DE1X 1P4GA 3OX2A 4GX2A 10MHA 1QTRA 2WUDA 1RCFA 3UXEA 4B7AA 1GYPA 4KBFA 2F1RA 3S28A 4U2GA 2GUWA 4X66B 4P84A 4AULA 1MZPA 2R0QC 2XNHA 1V25A 1X3LA 1TQ4A 3Q6NA 4XM0A 4DA7A 4B80A 3I6BA 1JLMA 5J2UB 2A0XA 2IIPA 1C7ZA 1QP4A 1C0KA 1R16A 1FYVA 1MMFB 2ZJ4A 3WNCA 3AY7A 3CLSC 4LZAA 3VV3A 2QZSA 3I34X 3K6RA 4OSEA 1N2ZA 2PPVA 3QU5A 3SE7A 2H57A 4FFBA 1R37A 3BGIA 2BZSA 4OI4A 3UHJA 4MW1A 1OLXA 5F3DA 3O2QB 1R6XA 4TRJA 4RVDA 4DMMA 1HLPA 2I34A 4ZGGA 1NG1A 4OXXA 1I3LA 4LFBB 1WULS 1HMYA 3N75A 4PQFA 3FCCA 4YUWA 3HKEB 3JATB 2W22A 1I3KA 1E9AA 3SX2A 4FE7A 2VJDA 2XJ9A 3ZE9A 2D1QA 2W6QA 4FMBB 4IL5A 1MQ9A 2PFGA 1E32A 3A0UA 4J0JA 3TZLA 4PLZA 4YMUA 2XUAA 5DNYB 4YAGA 3C7CB 3E0QA 1OZHA 1NW5A 4XARA 3RVQA 1T5LA 4BNHA 3GUCA 4QBGB 1FQKA 1CIJA 1ZNQO 2I33A 2GYWA 1BE8A 1F20A 3EWNA 1IXZA 3VH4A 4N0EA 1XRSB 5K0GA 3EMVA 2PQ0A 3JD2A 4R40A 3HXOA 4IDOA 1PO7A 2QBYA 2GEJA 4UMEA 1XBTA 2FFHA 3QNMA 4HEJA 3LUKA 1PG5A 2QQGA 2XPCA 2C9BA 1J2JA 2BGIA 2QRVB 1U7TA 3QEMB 4J94A 1NMQA 3ZV5A 4EGAA 2WIFA 3FOBA 2QAGB 3RK0A 4RHCA 3VOAA 1IWPB 3ZQKA 1EGMB 4XWYA 2QTVB 1HEYA 2YFHA 5KBYA 3G9ZA 1RDFA 3BIWA 4YRIA 5F9MA 2BTQA 2XJ4A 2L2QA 4HXGA 1SVKA 1I5EA 3L8HA 3AEQA 2ZBGA 2XVZA 5EPUA 3KWLA 2FUNB 1Q57A 3EEOA 1R6AA 1M7BA 4PLCA 3SR4A 1GKKA 4KHPB 2R2GA 4HPXB 5HX7A 3O83A 2PNFA 3A4IA 2XTNA 3L0OA 3RSGA 4B3BA 3JYLA 3UQZA 5DIZA 5F52A 5FDFA 2FU5C 2MSKA 4MQBA 2PZKA 1DXQA 2EATA 3L8YA 4C1BA 2V7TA 3AP1A 1IVYA 5B3JC 4N4AA 3OP4A 1ZJWA 3IKLA 3PSHA 4L1KA 3BXEA 4JYMA 3WB2A 2X9GA 1H2EA 3BERA 4GGMX 3OLCX 1X7DA 4OQYA 4LSGA 3ZU3A 4DLAA 1NW4A 1C7EA 1T0UA 1ENOA 2YHIA 5FQOA 3PCTA 4EVIA 4QT0A 2WHPA 1WB4A 1CY6A 4B3RB 5EIOA 1THMA 3WAGA 4LHYA 3HM9A 2Z8ZA 3RASA 3SJAA 1EWQA 1FDWA 4FR0A 3PGXA 2MTBA 3PNKA 1Y7PA 4DA6A 1IQUA 3LX8A 3SZMA 2ZU0C 3RAJA 3FGPA 3GA7A 2V96A 3HCPA 3HB9A 2OT3B 3JVIA 2AH5A 2AEFA 4AZ3A 3L77A 3I92A 1K0UA 2VAXA 5IXYA 2CDRA 4C4YA 1EUQA 3H5IA 4DADA 5EJ5A 5D7NA 1I10A 3AJRA 4AN1A 3ZX4A 2E4ZA 2FP3A 2I66A 4OJMX 3SHTA 1RRPA 1P6UA 4LK3A 1W8DA 2V3WA 4U0JA 3IDQA 1LC0A 1LS1A 3U9LA 3ZE2B 2LE0A 4LBZA 1QGOA 1U7ZA 4Q1FA 5F2EA 4WKNA 5HCUA 3VR4D 3VX4A 3H9QA 4ZVLA 1DXOA 4F9TA 1GV0A 1XELA 2ZK7A 4PPFA 5AHOA 3HPRA 3T0IA 4BQNA 5I7SA 4ZI2A 3IMKA 3BRWD 4CMBA 2WVGA 5H16A 4HNTA 1PD0A 2C0QA 3DDZX 4N12A 4JP5A 3ZBTA 4BJ6A 3NXKA 2JDID 5CJ2A 4CM1A 1NBOA 4QTYA 4GD3Q 2XTZA 5ALGA 1LF5A 3S1AA 4B82A 2FLVA 2Z95A 1KY4A 2BL4A 2ZI4A 2EYUA 2BTOA 1JHZA 2ECQA 2XDQA 1QHEA 4UMVA 3IT3A 2YY5A 3TL2A 3GRFA 1SOAA 1X8XA 3B5IA 1IM2A 1LQTA 4ZQFA 4K87A 4FU0A 3LF1A 3AGQA 1KOFA 2FDXA 4CL3A 3H13A 3M6UA 2X3FA 3GLQA 4WLUA 2YZNA 2FW9A 4MA4A 4CFZA 1CZOA 4D9KA 5L40A 2CNWA 2O8CA 2HU2A 3IPLA 2GUGA 4CF4A 5T8KC 4DCOA 3UPUA 1DAKA 1Q44A 1T25A 1WM1A 4EENA 4BYGA 2YYSA 1ISPA 1R5BA 2CHGA 3C41J 5LB2A 2ATIA 4NECA 2J0VA 2PR2A 1AMUA 4RIGA 2IPXA 5AJZA 2PMEA 3VR6A 1HRDA 1ZI9A 1N5DA 3K0HA 4XM1A 2XGJA 5EKUA 2EW1A 3QBJA 4EO4A 1X9GA 3ADOA 1ATZA 1W6UA 1AKYA 5F3RA 2BGJA 3EZ6A 5AT1A 2WM9B 3E0XA 3DE5X 1QKKA 2XOXA 1KYIA 4B73A 5B1SA 3GZ4A 4ON9A 4UE6A 1PUXA 4HLQB 4MZXA 4P3XA 3WKCA 4GKKB 1B8OA 2JCXA 3AR3A 3GJYA 5A7HA 4ALMA 1FXWF 1O54A 3NHPA 4WEQA 3B1ZA 3Q0IA 1U0NA 4FZ3A 1TNDA 2HEGA 4LSWA 4H6VA 4BS9A 1HLFA 1YT5A 2H9AA 5EJ4A 1Q19A 3GGPA 5LQNA 1ZK1A 1LJ8A 2A3RA 3D7SA 3GJZA 5BUCA 2GYYA 4MGHA 4DMHA 3AV0B 4P58A 2ZE8A 3SE0A 1GJRA 3GJRA 2IE8A 4JQCA 2P4HX 1PWZA 3L8CA 1L7AA 2QP9X 1SXQA 3L7LA 5FOSA 2A58A 1L7QA 3LFHA 1TF2A 3U4QA 2WSSA 4LNAA 2QTAA 5BMVB 2GHTA 1PSZA 1WKCA 1YH3A 1YZUA 1ZZGA 2HZ7A 4KQFA 4CR8A 3HJTA 1H4VB 1JHPA 3SK0A 2W9XA 2G5PA 4LBYA 4P80A 2R7MA 1BE0A 2A9FA 4JEMA 1SOVA 3F7NA 3HXLA 3EMBA 1UMKA 2OBXA 1OVGA 2FF7A 2IBMA 3MFYA 1USKA 2ZPTX 2O06A 3ASVA 3F90A 4YRDA 5K3FB 5E6RA 5ADVA 5JROA 3K2BA 2ZYRA 3LY7A 1N92A 1YF3A 1Q7RA 4OYYA 4A5SA 2JW5A 2FHSA 3N7TA 4FM9A 4CLDA 5CBPB 3ECCA 1KOLA 3KAKA 4FLFA 2Q8PA 1VKHA 3AX6A 3RBZA 2BSXA 1W8IA 1LLFA 3DZDA 5FNZA 1RVDA 2Y92A 1TZ2A 3OP1A 4OHVA 5MHTA 2XWBF 2I99A 2CT8A 4FEYA 3BXXA 1RS0A 4BNJA 3OZVA 3F3KA 5EMNA 4EHIA 5IDYA 5EXEA 4OU4A 4ZO8A 3OIGA 1J2TA 4DCGA 3GNLA 3GFTA 1K9SA 3IH5A 5B4UA 4M6WA 1U3UA 3CC8A 4QM6A 4IDPA 4H7JA 1ZVKA 2IZ5A 3ND5A 5AVVA 3AI7A 3DFIA 2Y05A 4WY5A 3CNQS 1DAIA 3DZIA 1ZLXA 2V7BA 2JIPA 5FRDA 2WHQA 4BJ3A 3SVTA 5JATA 4HB0A 3C70A 1C3OB 2NM0A 1UFQA 3PJRA 2CLDX 3I5XA 2IITA 3B1FA 4GM4A 4I5IA 3SYKA 3TTYA 4E3WA 4ZGBA 1UXHA 2DUNA 1TVEA 5JNVA 1G7RA 1JF8A 4L9RA 4F3CA 3ELDA 1A2BA 4BFSA 2VTKA 1NI4B 4RABA 2XD9A 1XNQB 4BP3A 2JD2A 4M1OA 4G1EB 1FVOA 1E92A 1Q92A 2QT1A 1RM5A 1Z2AA 2YHBA 4R3UC 3T9EA 5J63A 3ZTYA 4JEUA 1LI7A 5HQTA 3JWEA 4IEFB 4WI1A 4FDAA 1HORA 3OH8A 4RPIA 3V80A 4L27A 1P2FA 3MXTA 6LDHA 1AKMA 4AKEA 3PEWA 4BWYA 4PZYA 3BK1A 3VC7A 3L2OB 3ZWCA 2OO5A 3DDWA 4BZPA 4POOA 1GTRA 2G9UA 4RD1A 1NJ1A 3G1UA 1U0BB 2AJDA 2X0RA 3RJTA 5CAEA 1HPLA 5CLGA 1N8NA 2FG6C 1FS6A 1D4ZA 3ZWKA 5L7WA 3IUPA 2GJ4A 1Q12A 3D7RA 1VBMA 3QLUA 4M9CA 3HJUA 2PUDA 1XFAA 1GYQA 1KERA 3NH6A 3HJRA 3WLAA 1CRQA 1NLFA 2AMJA 3ENQA 5CB4B 1NJ5A 2OG1A 2VJOA 4XSHA 4ZJZA 4C4AA 4DIBA 4FI3C 1Y8RB 5KWEA 3UJ8A 4C14A 4Z9XA 5KTNA 1O0BA 4BRSA 1T5TA 1B15A 1MORA 4XVUA 3GUZA 3DMYA 1JHXA 3QPCA 2NV2B 1J2UA 1EAYA 5C5IA 1YOVA 2O3RA 1MPTA 5CDTA 3ZN2A 2WU3A 4O4IF 4ZVKA 2VF4X 3P9NA 3ZZUA 1U9ZA 1ZPDA 7ADHA 4IZOA 3H2HA 4TSFD 2D1YA 4BMNA 4CKWA 2PS0A 2O8NA 3BSWA 2UXCB 1K92A 4X71A 3W5DA 1JJBA 3RUEA 1QMGA 3EFOA 4J0KA 1V4BA 5BXYA 2JAUA 3GH3A 3QE4A 3ZVMA 2EIHA 3BWYA 1PQUA 3BZBA 3V4PB 4QG3A 1I7LA 1OZGA 2XMBA 3FM9A 4NH0A 4RMIA 2X9QA 4O63O 3U7JA 3RVNA 2JCBA 3BULA 5HFNA 5B4VA 1OZAA 3EJWA 2DM6A 1W36C 5HF5A 1GKYA 4U02A 2M6KA 3QE9Y 1MQSA 2XB4A 2XD4A 3ZV3A 1K27A 4OL0A 1DZ3A 3JVEA 3SEFA 1FXSA 3LHIA 2Q3MA 3TXAA 3LKZA 1ZR2A 1ZM9A 3EZNA 4HWPA 2Q6IA 3KOMA 3ZIUA 1RBMA 3I09A 1OI3A 3UT5B 4W7HA 3W7AA 4BAZA 2BGWA 4NZNA 1P3JA 2C2OA 3OZTA 2RH8A 3DTTA 1OD6A 1W88A 4L51A 3GLRA 4KI7A 3OESA 1YR2A 2IUTA 2EZ4A 4L6IA 2JKYA 1YVDA 3NBKA 2D1RA 2EG9A 1W87A 4YJ2B 1CQPA 4XJVA 1FP4A 1JSRA 1CB7A 3X0DA 4ETWA 4WOJA 4IM7A 5AH0A 3WYNA 4CQLA 1X15A 2CDBA 4OXQA 4WOCA 1E1MA 3U0VA 1QDEA 2W2LA 1XT6A 2O3UA 2PCLA 1JGTA 4XDGA 3UWPA 4CUKA 1MOPA 4MUIA 4N7MA 8OHMA 2GLXA 3R6LA 4MS3A 3UMJA 5F9HA 1WD7A 4YRPA 3CEMA 1JAYA 1TD9A 2O8BB 2RE8A 1V7CA 2XXAB 1GFWA 3IP7A 3PR3A 3RWBA 1I14A 4GX1A 4LRWA 2RGBA 4A1OA 3RT1A 4YUAA 1GKUB 1DC3A 4RF3A 2QL5A 4N9QA 1T6XA 1P91A 1QGAA 2BBSA 2G8LA 2WYHA 4EARA 5JXIA 5KHOC 2LVBA 4BLTA 3PS9A 1KGDA 5C5EA 2XGOA 2B92A 3IDSA 4PRKA 2NPFA 2AQKA 3ZDDA 4D25A 4K6OA 4WFJA 3IMFA 4FX5A 4AY3A 2X1LA 4ZV7A 4E33A 1LVHA 4ZOLF 4JXZA 4JJ4A 1DAGA 4ZO7A 1I3MA 5K0SA 4REMA 3I9NA 3FOEC 2WFZA 1Y42X 3SZUA 4DV2B 5CVEA 3NHJA 4TV9B 1TADA 2ZRFA 1KJJA 5TT1A 4KR9A 1E69A 3AHJA 4P3KA 4MUYA 4DM7A 2NLOA 1RRCA 5HRCA 2GPJA 1U7UA 2VQFB 3WB1A 1N6LA 2Q3EA 1SCAA 2C4NA 5IN5A 1U98A 4IIVA 5EZYB 2GJ8A 3B52X 4M0EA 5ALFA 3LHKA 1VLHA 1ZC3A 3RIHA 2CHUA 1HDCA 4H4CA 1E18A 2RDMA 1BD4A 2Q7XA 5JECA 1CZNA 5KPDA 1D6JA 2IYTA 3KB1A 1FNMA 3KYIB 4IRMA 1FRFS 4QQNA 3D3QA 4RTQA 5M29A 4ARCA 3FSRA 1OYOA 5KINB 4BV9A 1FLNA 1ZN8A 3NDJA 4DCUA 4EA7A 1TCCA 4RENA 4LYGA 3HKCB 4OQXA 3UMMA 1AJEA 1G6HA 5D87A 1HDGO 3CNNA 4GI7A 2FN9A 3K5WA 4HFJA 3RG8A 4S2UA 4XGRA 4C2UA 2PVCA 3I37X 1O1YA 1Y6RA 1W4ZA 2ERXA 2HO4A 5AESA 2NZUG 3ABSB 5K7SA 2XRMA 4NENA 1VMDA 1X70A 2X58A 3NIGB 2MCFA 1A5AB 1E66A 3AP2A 4Q4LA 4BNFA 1KMHB 4ILKA 5HRAA 2ES4A 1B8PA 4QWWA 1CEYA 1JA1A 3IE0A 1Y63A 3G2KA 5G0SA 4IG9A 4HPWA 1P8AA 4BQOA 4L8GA 3WGQA 1MO5A 2XECA 4UOZA 1YVRA 5JHGB 2WYOA 1NBWB 1JVBA 4NDAA 2NUBA 1H1TA 2Q4OA 2ZBFA 3FR8A 1L4FA 4GPEA 1XALA 2DB3A 1R8JA 2EWVA 1T2UA 4NBTA 2ZUDA 1SY7A 4QELA 4QDXA 4L15A 2WI8A 3H9UA 2WDPA 4HT3B 3KHKA 5FBHA 2UUPA 3OD1A 1JEAA 2NO9A 4HRXA 1XVTA 4V0OA 3TBFA 2WJWA 2FR8A 2VKQA 3DL0A 2CE2X 3CUUA 3HR4A 2A78A 3EULA 4L0CA 1YJBA 3DT6A 1PL0A 3ASYA 4HGYA 2O3QA 4X60A 3WP0A 3D6MA 5FAKA 3FPJA 5G4KB 1PU2A 1QS0B 1G6OA 2QUIA 4O2BA 3V00A 1HTTA 2YY7A 3QBVA 1VXOA 2X4GA 3P71T 4BQSA 3GJ7A 4H7DA 4K1LA 5G40A 4G5SA 4W8GA 4XIFA 3V46A 3KUCA 4PS1A 4ILEA 4UHHA 3CNOA 2XNKA 1JIKA 5DYYA 5G2OA 3U81A 1ZYUA 1PF7E 4KE6A 4L28A 1Q74A 3HJCA 1R0CA 4GNRA 4YQZA 5U4QA 4BN4A 4FMCF 4II2A 2X19A 4CLHA 3TAUA 4I1RA 2J0UB 4UZEA 2HU5A 5DGHA 2VHWA 5IBRA 1QHXA 1XCMA 1TQ2A 2GEFA 1H8HD 1M1ZA 1TQHA 5JXWA 1CNEA 2R1TB 5AKZA 1BGVA 2C58A 2WJHA 1HT1E 2H3EA 1TLTA 1HURA 3KYDA 1K8XB 3BRCA 3RV3A 3N6XA 3OCVA 3HK2A 4J0HA 1QFSA 5FFNA 1T3GA 2XMCA 3FD8A 2OHOA 3F9CA 3QYJA 4A0HA 1IPFA 5EIBC 3VMFA 1CR0A 2A9VA 3FYUA 1A9OA 4NFLA 1D1TA 3IVCA 4OJNA 5DGDA 2BE7A 4MQ6A 3QJ5A 1XZHA 3C3YA 3HA3A 2PV7A 1N6PA 3N39C 3NDBB 2J5XA 1ZMXA 2W6IA 4RCZA 2FB9A 2FWMX 3ETCA 5D85A 1S2LA 2JFHA 1TVKA 1ZIDA 2FKNA 3G02A 2ID7A 2VAWA 2UXBB 3SP1A 4AECA 4KR2A 1MXHA 2BM0A 2OV2A 1E8DA 1KI3A 1LQUA 2FQXA 4FFDA 4O1IA 3BREA 1JEDA 4UEOA 3U17A 4NL4H 2WYWA 2C03A 3WBFA 3OCZA 4B7CA 4UTVA 3AVWA 4P4SB 1CS0B 1Z4NA 1VE5A 3I2HA 5FQNA 5KYXA 3A1SA 2XA2A 3TJZA 1OIVA 4TWJA 2VVTA 4O33A 3ZLJA 2F6RA 1E0DA 5SY4A 1SC9A 2YWEA 4C01A 4F6RA 2W48A 3WDKA 5KNBD 2E18A 4H1WA 1ETUA 2WICA 4FT4A 4ZT2A 5A62A 4KVZA 3RVKA 4WCFC 3O38A 4Q9HA 1VLLA 1E4EB 2CMGA 4MYDA 2ZU6A 1IDN1 1XTVA 3ODGA 4YP9A 1WV1A 1MXFA 1KZ7B 2ZAMA 4MP8A 1ODKA 2H4HA 2OQRA 3NRBA 4J2TA 4QPCA 3AFNA 4UEJA 4ZYWA 4ZMSA 2IYNA 2LIPA 1II8B 3I9V1 3FPCA 4DLBA 5CDFE 2AN4A 3SNHA 1ESEA 3WLHA 1UOQA 1FTQA 1GGMA 1HQDA 3PSAA 4Y2PA 521PA 4KX3A 4MS4B 5E38A 1AKEA 5BORA 3IEXA 1N25A 1Z36A 3A6FA 3GD7A 3WV4A 4BEWA 4O1HA 5HBGA 1RAGA 1K08A 2EAUA 3DMNA 3FWZA 1JVSA 1GSAA 3G17A 3QVVA 4ZARA 3SLKA 5C5DA 3HJBA 4M9XA 3ACBA 1A50B 1E0KA 3DKIA 4TTTS 4AJLA 4F5YA 4P83A 2VRNA 2QRLA 1Z0SA 3HKDB 4YACA 3P9QA 4L0DA 3E9DA 4LOIA 1I6LA 2BGTA 1I7PA 4NZPA 3ITDA 4EJSB 1SG9A 2H1FA 2W4QA 1V1RA 4AWBA 3AUFA 2QX7A 2RC5A 4TWZA 1J22A 3L7OA 1SRRA 2XUDA 5ESWA 3O8LA 1I30A 2A86A 4WNYA 2P3SA 2NU9B 5HGJA 1Z0KA 2PH5A 4Q1BA 1PSWA 1VLQA 1NVDA 2ZTSA 3GC6A 3R23A 4YVFA 3B48A 1CUVA 1PJSA 2ONKA 1NZJA 4DV0B 5ARDA 2GEVA 1UIRA 5LQMA 3DE7X 1WDWB 1R6TA 4FCVA 4G84A 3AFMA 4N39A 4RD0A 2FPLA 4BLRA 1RRMA 2JVJA 2Q29A 3BWBA 4JKOA 4N65A 3P5BA 4X6UA 4C4ZA 5DNUA 2QKYA 1BXRB 1XKLA 3CXRA 4GOXA 1B42A 1VMIA 2JFNA 5EJ7A 2ENWA 4C0QC 5A6VA 1B6TA 2HCJB 3ZVNA 1RYEA 2Z0MA 3LX5A 3L7CA 2B1JA 5AVYA 2MR5A 3DHWC 2ZQ5A 5DLQC 2VNIA 3RSCA 5MGNA 2R62A 3H4TA 4Q6BA 2EKPA 5DNVA 5MN6A 3VSDA 1RMTA 4BBZA 1OASA 2OMEA 4Q4DA 4RDHA 4U0KA 1DMRA 2WHRA 2Z6AA 1JDSA 1PR3A 1T1EA 4YI3A 3BHIA 1GNQA 2IFTA 3VOBA 2IYEA 1QPBA 4L3WA 3H1TA 3F49S 1LDMA 2IP2A 4QUIA 3X1ZA 5DM4A 4BGDA 4JP8A 2AZTA 5GGYA 2FEMA 5E4FA 3RYFA 3UOGA 3TLBA 5J58A 4KWCA 5JLJA 5F2KA 5EUCA 1BWQA 4IHKA 3FMFA 2AX4A 3TVDA 5AXBA 5IK2A 1VRCA 3UXMA 4NHEA 5AM1A 1W4BA 4DBLC 3G9TA 1MB0A 1TPYA 2X4LA 3PJGA 3V1NA 3USZA 3W2HA 3ROQA 3X1XA 1Y34E 3ZPXA 5KNCH 3QPDA 2QR2A 5KMGB 5J4LA 3K71B 4MR7B 3VZDA 3QW2A 3BRWA 3ENVA 1DRWA 5DLEA 5F9FA 3AUAA 2P0EA 3MB5A 3KZNA 3R6DA 4JLKA 1KSGA 4WCFB 4ABYA