3D2BA

Structure of 2d9, a thermostable mutant of bacillus subtilis lipase obtained through directed evolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASSNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKYLDGGNKVANVVTLGGANRLTTGKAPPGTDPNQKILYTSIYSSDDMIVMNYLSRLDGARNVQIHGVGHMGLLYSSQVYSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermostable Bacillus subtilis lipases: in vitro evolution and structural insight
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Lipase
total genus 67
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3d2bA00
1XZCA 3D2CA 2C5GA 4FBLA 2O2HA 5IVKA 3U0VA 1IVYA 1JU3A 5ALQA 5A7GA 1QFSA 2XMGA 1CUIA 3LP5A 2G5PA 3OC0A 3R3YA 4K6KA 2XUHA 1XZEA 4G9EA 3QPCA 2QR5A 2J3DA 2BGRA 5ALKA 4UBIA 1K63A 4S0XA 1K8QA 3VKFA 5C81A 2AJ8A 3R3WA 4YASA 4OD0A 2XLCA 1K6EA 1CUZA 4IH9A 1DQYA 2C0PA 1H23A 3O9VA 4WFJA 1AX9A 3A2NA 5HF6A 1XFDA 3ESDA 1CUAA 3D59A 4N5IX 4CCYB 1MJ5A 1R50A 1SCQA 1GQRA 3BL8A 4N5HX 3DOIA 4K6GA 5SYMA 5ALDA 4UBNA 5E4TA 1DWPA 3WJ1A 3KWFA 3WWCA 4G4IA 5IH7A 5F4ZA 4Q1VA 2OLEA 2DR0A 1DT3A 1GPKA 4OB6A 4W63A 3W05A 1ZIXA 5IVDA 5AOBA 1OXMA 1CPYA 4A5SA 2PPLA 3G7NA 3TEJA 2W6CX 5K3BA 1C4XA 3H19A 4U2CA 2GBIA 5JAOA 3BDVA 3DEAA 4J0IA 3E1GA 3AZPA 3FLEA 4BCCA 3CCCA 3C8HA 3IUJA 4HXEB 4J0CA 1EH5A 5DYTA 5DNUA 5JD5A 1XRPA 2WSLA 3PDCA 4BC1A 1XROA 3OM8A 2DQYA 1LNSA 4Y2UA 1ODCA 3D2BA 1ODSA 3FYTA 5CH5A 1LGYA 3WQHA 2VJCA 1N5RA 4B84A 1JFRA 1LLFA 4INZA 2XUGA 2BUCA 2PUJA 4PO3X 2D0DA 2WIGA 1EK1A 2WG2A 4EY8A 4N8EA 3ED1A 4Y2TA 4C88A 2HIHA 4X94A 5CH3A 5ALWA 2HA6A 1VXRA 3EIOA 5LZ9A 1XRLA 1QIHA 1VA4A 2ECFA 1MX1A 5EHNA 5ALGA 1WPXA 4JNCA 4B6GA 1X2EA 5AO9A 3SK0A 1QLWA 3FLBA 5EIAA 1BCRA 2XQGA 4RE5A 4BAGA 3QH4A 1CUVA 4BTVA 3D2AA 3WK6A 5AKLA 4FDMA 4FBMA 5E2IA 2FJPA 1UKAA 2Z3WA 2AJBA 1XZDA 5AI0A 1EI9A 4OYLA 4BRSA 1EK2A 3C43A 5K3AA 4BVJA 2AJDA 2Y6VA 5HKBA 4BAZA 3I2KA 3IUNA 4AXBA 5DTIA 5CH8A 3QITA 1JJBA 5AI9A 2WG0A 2JEZA 2JGEA 2WIKA 1M33A 1HLGA 4AO7A 4B0OA 4H18A 2XQKA 1XZGA 1IUPA 1X2BA 5ALFA 1G66A 1QJ4A 5EIEA 1XKLA 2WTMA 2PSDA 1YR2A 4E11A 1ZJ5A 4WDQA 1UXOA 3R41A 3LCRA 4DNFA 4EY4A 1HQDA 3DD5A 5AICA 4KRXA 3WKDA 2VJDA 1F0PA 3V1MA 1F6WA 1KU0A 2BAGA 3KD2A 5K3CA 3CCBA 4CG2A 2LIPA 4MEBA 4H7FA 1VOTA 4DMKA 3BJRA 5K3FB 4AX4A 5ALIA 2WTNA 2G5TA 2GBGA 2YYSA 1X70A 4CCWA 4YK7A 1PFQA 2DCMA 4IH1A 3I6YA 1VE7A 4J7AA 4NVRA 4KAJA 3GELA 3C6ZA 1FFAA 4G8DA 2XI4A 5HCUA 4B85A 3WKEA 5A62A 5DYWA 1ISPA 1ZD4A 4EZIA 3GFFA 3SC2A 1DWQA 1G5FA 4MXDA 3IB3A 4L72A 5KWIA 2PKYX 5HF9A 4HRXA 3QMMA 4B9EA 5JANA 4TVKA 4DGQA 1THTA 2WJ6A 4JEIA 4QA9A 1BN7A 3U1TA 5ALZA 5ESRA 5KREA 3HI4A 1TK3A 1ZD2P 4BATA 2OCLA 3DQZA 1WB5A 2H7YA 3M83A 1CUWA 4GWLA 4BVLA 3I2JA 4L9AA 4Q34A 1CVLA 1A8UA 1GKKA 1AURA 4C4XA 1USWA 1JJFA 5FRDA 1YA4A 1YS1X 2IIVA 3G8YA 2OG1A 3EBLA 4UFOA 4QE3A 5HFNA 4PSDA 4K6HA 5JIBA 4PF1A 3ZLVA 1KEZA 5AKGA 4RNCA 5K3FA 1QO9A 5LZ5A 3VJMA 1HDEA 1ZI6A 3G0CA 2C5FA 5AI8A 1HBJA 5LP1A 1CEXA 3RARA 3S2ZA 4ARBA 4K2AA 4CCYA 1QIEA 5EHXA 3QMVA 2WHRA 3STXA 1FFDA 3AILA 4HVTA 3WJ2A 1QIJA 2GYUA 1GT6A 3STWA 3MUOA 4XJVA 2JGFA 3HC7A 1IZ8A 4YX9A 4QNNA 4M0EA 5ALYA 5T4BA 1CR6A 2JF0A 5DNWA 3KSRA 1QIIA 3WL5A 5KBYA 3TGLA 4CI9A 3LS2A 4J0JA 2OQVA 2I3DA 5CMLA 4GI1A 4FLEA 1BE0A 1XQVA 1CUDA 4AMYA 2JGKA 5DNVA 4J3JA 1BRTA 1CUHA 2QRUA 4WY5A 1L7AA 5A71A 2JGMA 4MQLA 1UOPA 3BXPA 1H2WA 3ZWQA 1Z68A 1MX5A 4KAFA 4B81A 3FSGD 4UHEA 1ZJ4A 4HAIA 4CG3A 3QBJA 4PNZA 4MEAA 1CUGA 3D3NA 5LZ7A 1UFOA 4ARAA 1CUUA 3C5VA 4DMFA 2WHPA 5ALXA 4XX1A 2HFKA 1YS2X 5D6OA 1UZAA 3WYDA 5AK4A 5FPQA 4XVCA 3H04A 3O9MA 2UZ0A 3WIOA 2WFMA 4Y2SA 3G0IA 4L0CA 4BP9A 1MNAA 1JT2A 2QUBA 1TIBA 3STYA 5A7HA 3FAKA 1YA8A 2RAUA 5ALVA 4BVKA 3GA7A 3F67A 4TPKA 3UUEA 4UBOA 3R3ZA 1WCYA 1LPOA 4LXIA 3C6XA 2WFLB 2XDWA 3OOSA 3OURA 5KWJA 4FHZA 3HRHA 2P8SA 4K5QA 1CUFA 1CQZA 1P0IA 2BKLA 4B80A 4FWBA 2I03A 2QKYA 1GPLA 4B83A 2Z8XA 4X6XA 1FJ2A 1QTRA 4EUSA 3UMJA 4GW3A 3FBWA 2VATA 5AKKA 2ZVDA 4Z49A 1A8SA 1MNQA 2Y6UA 2XE4A 2YASA 1LPNA 1J1IA 1LPPA 3RKSA 4OSEA 4I4CA 2BCEA 1XQWA 4ZGBA 1N8SA 5LZ8A 2CBGA 2WU3A 2W22A 4B9AA 3H2JA 1LPSA 3CN9A 1RWQA 4M0MA 2PM8A 4HXGA 1ZD5A 1SC9A 2PU7A 1W4LA 4EA6A 3IBTA 3F97A 3O4GA 3LIPA 3KOOA 1XZMA 3AUKA 2OAEA 3WL7A 4G4GA 1ZOIA 3PI6A 1ACJA 4BZWA 4BYMA 4FTWA 2DSNA 4PSCA 5IVIA 1SFRA 2VTVA 3HACA 2O2IA 1QONA 3R40A 5AOCA 1TCBA 5CT8A 3WA6A 1MTZA 4QDTA 3OTQA 2GBCA 4IH4A 4H7KA 4X91A 4DMCA 4Q3KA 3M82A 3LIIA 1SCIA 4FFVA 4C01A 1EDEA 1R1DA 2PSFA 2XUPA 1RYYA 4W9RA 5CW2A 5AM3A 2QMQA 1W1IA 4EY6A 2ACKA 3FYUA 3AIMA 3I2GA 1F8UA 5BWBA 2Y2VA 5JAUA 1KU6A 2WFLA 4Y9SA 1A8QA 2Y1KA 2K2QB 2XQFA 4BCDA 3D0KA 4UFNA 1CRLA 3WI7A 4Y2XA 5JZSA 1H2ZA 1VLQA 2OQIA 3BWXA 6YASA 3FVTA 4Q82A 1VJ5A 3HEAA 1G42A 2QS9A 5DTJA 1A7UA 1WPRA 4WJLA 1Q0RA 1DX6A 2V97A 4AZ3A 3EQ7A 3CXUA 3MVEA 3N0TA 1TRHA 1THGA 4MYDA 5FP0A 3C70A 5JZ9A 2GYVA 1MN6A 4ZI5A 5JYCA 3B5EA 5EHQA 3DL7A 4GLBA 2AJLI 3FLAA 2Q0XA 5CRIA 4P93A 3WK8A 5DLPA 1RP1A 3MGAA 4KE9A 3IURA 1LPMA 2H9YA 1XZAA 1QZ3A 5LLSA 3WA7A 1JMKC 2X76A 5AKZA 4LXHA 3PF9A 4ZRDA 1EVEA 5AK3A 2V9ZA 3A6ZA 2C4HA 3C5WP 1UK6A 4AZ0A 1R9NA 4FLFA 4JYMA 4QWWA 4PSUA 4J03A 1GGVA 3ICVA 2OXEA 1LPBB 3STUA 3WZLA 1CQWA 4W1RA 1IZ7A 2WHQA 2R11A 5AKYA 4NZZA 5BV7A 2OGZA 2PSJA 5I9IA 4X93A 1Y37A 3RK4A 4JYPA 5AIAA 4J0GA 2ROQA 4H0CA 3JYHA 1MPXA 3F8SA 2VAVA 1EDBA 5E4YA 2QZPA 1GZ7A 5AM5A 3EQ8A 3NUZA 3V9AA 3I1IA 5HF5A 2WUFA 3H2GA 3L1JA 3H17A 4E46A 4J0KA 3STTA 2JGJA 1XZKA 3I2IA 3PUHA 4X97A 4P9NA 3HYSA 5CBKA 4G9GA 5CT5A 1N5MA 1QIFA 3AINA 3OG9A 5FDFA 2ZJ6A 3RLIA 5EFZA 4OB8A 4DTCA 1J2EA 4PW0A 4DYHA 1JJIA 4WFIA 3ANSA 3H1BA 1XLWA 4EBBA 2O2GA 1BS9A 5EIHA 3M3DA 5ALMA 2HA3A 2DHEA 2QJWA 5HKAA 2RI6A 1ZGCA 5ALJA 2JEYA 1E8MA 4C4YA 2PVSA 4GBGA 4BRZA 3AJAA 3O95A 3M81A 1ORVA 1JU4A 1LBSA 3GZJA 1PV1A 1XQXA 4AMZA 2VEOA 3FOBA 2GZSA 5AM2A 5D3KA 3ESBA 1FFEA 3D4LA 3I28A 3A70A 2XQJA 3PFBA 4ZXFA 3D5EA 1E8DA 2XUKA 4PV7A 4OYYA 5C8XA 2WJ3A 3FWHA 1DWOA 3A2LA 4ROTA 4FLMA 3YASA 3UUFA 5HK9A 5ALPA 1XZIA 4BC0A 2XQIA 2ZSHA 1BN6A 1BCSA 3WZMA 5K3EA 4KYVA 3WIBA 5K3DA 1UK7A 1I6WA 1YAJA 3I6MA 4DSZA 5AP9A 4X95A 4ZREA 2B4KA 1QO7A 5K5EA 3O4HA 1FSSA 3E3AA 1E66A 4X92A 3ZPXA 2J3QA 2WJ4A 3QPAA 4X6YA 3WKBA 2E3JA 4FKBA 5IVHA 2FX5A 5A6VA 5DJ5A 1BU8A 2WKWA 2DHCA 3F96A 3G0DA 1MO2A 2XUOA 3VVLA 4N8SA 5DYYA 2WU4A 4UBKA 2WHPB 3PICA 1XZHA 1QOZA 4BDTA 3QZUA 1DT5A 1QGED 1J06A 5FPPA 4P92A 2XMCA 3K2IA 3O4IA 1DQZA 4EY7A 3H0CA 4UHCA 2HM7A 3DKRA 1L7QA 4Y2RA 2WILA 2G63A 4Y2YA 1GQSA 3ESCA 3PFCA 2VT6A 5LYYA 2DQZA 4AB1A 4BP8A 3HLKA 3TRDA 1XLVA 3WL8A 1WB4A 5JARA 2B61A 4XWGA 1Y7IA 4CIBA 3ZI7A 4PQEA 7YASA 1XKTA 2XMZA 1MAAA 1QE3A 4RGYA 1CV2A 2WUDA 5D7BA 2I78A 2OCGA 4LIPD 4G5XA 1S8OA 4UFPA 3GUUA 2CMFA 5IKXA 4B82A 2Z3ZA 3G0BA 1AC5A 1EVQA 3PF8A 2PX6A 3FYUB 3HABA 2XUIA 1E3QA 1WM1A 1T4MA 3HXKA 3Q8WA 2OAGA 1WHSA 3STVA 1D07A 3WL6A 4QDXA 1TKRA 3FVRA 5JD6A 2B20A 4MYSA 4EY5A 3KXPA 2V98A 4QDZA 1XZBA 2QTBA 3I6ZA 2ZJ7A 2XMDA 3I2FA 3ZLTA 4GDMA 2PL5A 1AQLA 3WWPA 5FV4A 4NMWA 3WWDA 1QIMA 1VZ3A 4FOLA 3VJLA 2BGNA 2O7VA 2Z8ZA 3V1NA 4U2BA 5CT6A 4BE4A 1P0QA 1LZLA 3V48A 5JD4A 4H35A 4MQMA 4ZWNA 1WB6A 3WWEA 5A7FA 1EXWA 1ODTC 4J0HA 1VKHA 3IA2A 2JBWA 1AZWA 1HPLA 3BDIA 4O08A 4Q05A 4DM7A 3DLTA 1YASA 4I3FA 4WDRA 4RE6A 5AKHA 3AZQA 4FNGA 5FOQA 1TCAA 1QIGA 2NW6A 5ISMA 1N1MA 4Y2PA 1XZJA 5JALA 2EDCA 3QM1A 1U4NA 1GPNA 2VAXA 2QXTA 4BZZA 3WKAA 4U2EA 3BIWA 2FUKA 1ZD3A 2WIJA 5CXXA 4QZVA 4UPDA 5AI6A 5LIPA 3I1YA 4V2IA 5JADA 4B7ZA 3FSGA 4H7EA 3S8YA 1W75A 1QIKA 1CUJA 5AM0A 1UK9A 2D5LA 5FXMA 2H7XA 3TJMA 1R9MA 2ONCA 1E5TA 1XQYA 3B12A 3L1HA 1BEEA 4I19A 2XB6A 2XMBA 3VISA 2PSEA 2VJAA 5LKAA 2HU7A 4KRYA 4X00A 4QDOA 1W6RA 2ZYIA 4Y7DA 4GHWA 4G8CA 2QVBA 1UOOA 4W1SA 1CIJA 4QEKA 2VF2A 1XRMA 2GZRA 1AGYA 5AI4A 4IHAA 1SOMA 4LHEA 2HA2A 3W9UA 2IX9A 4KE7A 4HS9A 4BDSA 1EHYA 3K6KA 2C0QA 1FFBA 3O4JA 2WFZA 3R3UA 1XZFA 3BE8A 5CT4A 4G4JA 5EI5A 1EB8A 3P2MA 5DWDA 2PSHA 1H2YA 4C89A 4KEAA 4GXNA 3DYVA 1CUBA 1MT3A 3C6BA 1CUCA 2XUJA 2DHDA 3WK9A 4ZV9A 2XMRA 1LBTA 1E8NA 5T4EA 1FFCA 2HU8A 5FKJA 4UBMA 2HL6A 1W76A 2OPHA 1AKNA 1EA5A 2FJ0A 3WYNA 3HJUA 1EB9A 3G9TA 2O7RA 2VJBA 2ZYHA 4X6UA 5AM4A 1YB6A 2CUTA 3V1KA 5EHZA 3GBSA 1U8EA 1TCCA 1VZ2A 3FNBA 4MJ3A 1EDDA 5D3ZA 1Q84A 4AQDA 2RIPA 2WIFA 5HK8A 1HKHA 1WOMA 2XUFA 3BJMA 1ZI9A 1NU6A 2H7CA 3W04A 5HQ3A 4C6HA 5ALHA 4H77A 4P08A 3RM3A 5HF8A 4HZGA 4H7IA 1P0MA 1XRNA 3KWJA 3QVMA 2XMQA 4ZV7A 3WLAA 1GKLA 1BROA 3N2ZB 2I3ZA 3ANTA 1JMYA 2BUBA 5C8VA 3V1LA 1T2NA 2AXEA 1P0PA 1C7JA 4M0FA 2C58A 2ZJFA 3H2KA 2CB9A 4HTAA 1VA5A 1CUSA 5ALNA 2WUEA 5CTAA 3JW8A 4Y2VA 1EINA 1CUEA 5A2GA 2YXPX 4GECA 5AKJA 3T52A 2CKMA 4UHBA 4LKOA 4Q3LA 4OCZA 1VE6A 3R0VA 3HZOA 2BJHA 4JH0A 2HA5A 5AKIA 5JAHA 1BEZA 5FUMA 4X3CA 4AN1A 4CFSA 2GBFA 4IO0A 5JAPA 1LPAB 4DNPA 3QPDA 5C8ZA 3A2MA 4DLNA 3T4UA 4G1FA 2WIDA 3F98A 4E14A 4W1PA 1UOQA 2HFJA 4H7HA 4F5ZA 5ALSA 4HRYA 1DINA 4X90A 1TAHA 4D9JA 4UBJA 3ILSA 1OILA 1U2EA 3WK4A 1C7IA 4ETWA 3VDXA 2QUAA 4BB0A 4OU4A 3WK5A 4F21A 2HRRA 3H2HA 1CLEA 3DDUA 5FLKA 5BOVA 1HL7A 3ESAA 1XZLA 2WUGA 4UBLA 3OPMA 1G4HA 3R3XA 4DIUA 1ORWA 3X3HA 4XIIA 4TGLA 3WK7A 4BAUA 4FMPA 3G9ZA 1OCEA 2HDWA 2ZYRA 4X85A 3DL4A 1R4ZA 5LZ2A 3PE6A 2CZQA 4OUKX 4AN0A 4E15A 2DFPA 2ACEA 2QT9A 5HZGA 1O6FA 3G9UA 3ZV7A 1MAHA 3SWWA 3IUMA 2Y2UA 3BF7A 4B0PA 3O0DA 1UKBA 3AIOA 3HSSA 2VA9A 4DNOA 5LKRA 3LLCA 4Y2QA 5EGNA 3NGMA 4Q3OA 1DU4A 1GXSA 3I2HA 2ES4A 4BTLA 2J4FA 2B9VA 1DX4A 1H2XA 1ETHA 2EDAA 2XLBA 4X7BA 5AKEA 1TQHA 5AK6A 2JGLA 3IULA 2QJRA 3C87A 4A23A 1K5PA 4UUQA 3QMWA 3CN7A 3IVMA 3DNMA 3DYIA 2WM2A 3DS8A 4BE9A 4OU5A 1EX9A 4OB7A 2VSQA 1YCDA 5AI5A 3IDAA 1U65A 3FCXA 4DSAA 3ICWA 1YAHA 1K4YA 2EEPA 5CT9A 4EHBA 4FNMA 4QLAA 4C4ZA 3F9CA 2ZYSA 3DOHA 3GROA 1AMNA 4MWTA 4H7DA 4KAAA 5JZBA 5I8PA 2HRQA 1A88A 3DCNA 1XRRA 1MU0A 2R8BA 2HA4A 4EB0A 4YPVA 1UWCA 3DJYA 4QLOA 1PJAA 1W52X 4CG1A 3VJKA 2X8BA 5AKXA 2CJPA 1IMJA 3H1AA 2OCIA 4A16A 4C87A 4N8DA 1JKMA 2HA0A 5LZ4A 1O6GA 2WG1A 3C45A 4U2FA 2HHAA 5ALLA 1UT6A 5J3JA 3NWOA 4G8BA 3QYJA 5AIBA 1QTIA 4NS4A 3VVMA 2G4LA 4WFKA 1R88A 2XT0A 4U2DA 3G9XA 4LYDA 1IUNA 4UHHA 1Q83A 5AHXA 1CFJA 1CUXA 2CEKA 4H7JA 2Z5GA 2ZSIA 4KJXA 4U2GA 2PUHA 4X71A 3W06A 3G02A 1B6GA 1JI3A 4QDUA 5AM1A 2IITA 5CURA 4F60A 3NOXA 2HADA 3SX4A 4QWMA 4GEGA 5AJHA 1ZI8A 2RONA 2VQ6A 3AIKA 3W9BA 2XUAA 1YSCA 2V96A 1Y7HA 2RGUA 2QM0A 2J4CA 1Q0ZA 4HXFB 4UHFA 4DNQA 3FYUC 4WCVA 3DKKA 2WLSA 5ALOA 2C7BA 4BCBA 5ALTA 4LYEA 1ZGBA 5H3HA 4W1QA 5C7YA 3E4DA 1E89A 5AK5A 3EQ9A 1R3DA 4IQ4A 1IUOA 1LZKA 5T4FA 1QIDA 1WHTA 4UHDA 4F0JA 2ORYA 4KR0A 2PBLA 4AO8A 4MWSA 3KDAA 5ALUA 4RPCA 5ALEA 1CUYA 2JIDA 3MUNA 4WY8A 1VXOA 4KE6A 4KE8A 1UKCA 3H18A 3C6YA 2PU5A 1ZIYA 2YH2A 5BWCA 4FFWA 3IIIA 5HFAA 3D7RA 3R3VA 1DTEA 1YB7A 1F0NA 3L1IA 4KACA 3H2IA 5YASA 1NU8A 5T4HA 1QFMA 3FCYA 3BF8A 5SYNA 3VXKA 2HA7A 4JUIA 2X5XA 4J0DA 5JATA 5JASA 3IUQA 5AOAA 4ITVA 3B3QA 5HQ3B 1MX9A 3AZOA 2OCKA 3BIXA 5CXUA 1ACLA 2BFNA 3C8DA 3WKCA 4LXGA 3EF3A 3WMRA 2XMSA 1NX9A 3Q0TA 4Y2JA 1SCKA 5E4JA 2AJCA 2XUQA 1J07A 4AO6A 3ZLUA 2OGSA 2WQZA 1L7RA 3W2TA 1ZICA 1H22A 4BBZA 2OGTA 5ALRA 2BUAA 3WWOA 4DMHA 5AH0A 3AFIA 4CIAA 1AUOA 1UK8A 2QXUA 1XLUA 2JGIA 4OPMA 3G0GA 2QOEA 5I7UA 2GYWA 3K9BA 2XUDA 3JWEA 2H1IA 2VT7A 3PUIA 2RHWA 1XRQA 2HU5A 1B41A 4L3WA 3E0XA 2RHTA
chains in the Genus database with same CATH superfamily
1IOWA 2D2FA 4QD3A 3D2CA 5KYUA 3VPBA 1TJPB 1N3BA 1EM6A 3QKSB 4V03A 1TPZA 3LZDA 3SYLA 4FM9A 1Z2NX 4D99A 3ND7A 4QARA 5TQ2B 1IVYA 1JU3A 1PG0A 2WW8A 1PK8A 1GSHA 3CT4A 5ALQA 3TW8A 3K09A 3ND9A 3PQ2A 4CTJA 3M4XA 2HQSA 3G8AA 2E9SA 3NX4A 1OLUA 1EE1A 4YA6A 5A7GA 2G70A 1SQ5A 1BNCA 1P77A 1KJNA 2ODTX 4TLMB 4EEKA 4ARIA 2QGZA 3OPYB 4DIFA 4LV5B 2VRCA 3G2OA 3IS3A 4OHPA 4Y0NA 5BMVB 2Y1EA 1UBMS 2ZQZA 3B6MA 2FDCA 1X7ZB 4K6KA 2MTBA 1H9AA 3PGKA 4UVHA 1PR1A 3O2SB 4CKBB 1DOZA 4BMXA 1O54A 2X15A 5BN3B 3BFVA 3IXLA 4BQSA 2WINI 4U5XA 3GVCA 4RA9A 2O2DA 3GYBA 1K63A 4DOMA 5I6DA 1T2FA 5KYWB 3OZVA 4W9NA 1G1AA 2PXXA 2WMDA 2J0UB 2O0KA 3G88A 4I50B 3VKGA 2N0SA 4HS4A 4UZEA 2F9LA 3D3WB 4QVIA 2JHFA 2OBLA 4Y6GB 5C53B 1Q6ZA 1EDZA 3PBKA 4Q3EA 4P98A 4KK3A 1U1IA 2XLCA 2ZBGA 3QXCA 4U39A 1UADA 5JPCA 1LF0A 4ZGGA 4RQBA 3LPDA 1YIDA 2IUSA 4DCSA 4EQ6B 2Q4DA 4K7JA 4D44A 5JEEA 4O2LA 4RVOA 4UAGA 1YGYA 4TL6A 5D3MA 1BXRB 3ZV6A 1OC4A 2HLNA 5HF6A 1XFDA 3ESDA 1XJWA 3BMNA 4E5NA 3ZDQA 5KOJA 4E07A 2Q5JA 1Z2PX 2G1KA 2I1VB 3C3KA 4ODIA 2O3SA 3X2FA 1O8CA 5JWRA 1GZDA 2OZLB 5DN6D 4ARCA 2R4TA 2X0IA 1U9CA 1Q7BA 4YALA 4JVLA 3TZBA 3ORSA 3SPXA 1E3LA 1DLIA 4QUHA 1KS2A 2WOOA 1UZLA 3CZ9A 3RTAA 1Y3IA 2JLXA 2ZTVA 2IPXA 3FM9A 4KREA 3TQFA 1GCGA 3INRA 1MH9A 4LHVA 5E4TA 1RP7A 3VPDA 4PYNA 4H1WA 3FMGA 1VLLA 1AH2A 3W3AA 3II6X 1N9ZA 1XCBA 4GI7A 4DF3A 2OT3B 2CLMB 1YHNA 4G4IA 3SHOA 5TQ0A 4KR6A 2P78A 5JZOA 4Q1VA 1JDBC 1GKYA 3ZJTA 1DT3A 3LUGA 2EFGA 5BWNA 3OQNA 4QHTA 2C20A 4C0BA 1GPKA 4YRFA 5H02A 3T7SA 4CKYA 1XI2A 4F4FA 1Q0SA 1Q1BA 1KKMA 4GL4A 4IX9A 1MAUA 1PWZA 3GEGA 2PGNA 4IG4A 2CLOB 3EXIA 4JBLA 3HN6A 3L7KA 5CJJA 5GONF 5K03A 3ZEIA 2GNPA 2R00C 3L7MA 1XGKA 1YFJA 2QYOA 5EYPA 4YYEA 4EB3A 4I50A 3A28A 3IVCA 1ESZA 1LQTA 2GBIA 3P2EA 4JD5A 4JSRA 2DPGA 3K9LA 4F72A 2FV8A 1L1QA 4OYHA 3AZPA 3FLEA 3HMKA 2ZRBA 2IGTA 4YQZA 3L46A 3CCCA 4JQYA 4A8JA 4Q9NA 1Q3KA 3BQ9A 2BGLA 1PGPA 2QN7A 5A4MS 1X7XA 2PMWB 5F51A 1F4LA 2BV3A 2HIAA 4IWXA 5JSQA 4H3SA 2FUCA 4JJEA 2W6ID 3AJ8A 2FF5A 1E0AA 1QQ5A 4QU5A 2VYNA 1EH5A 2JLRA 3KTAB 4D3DA 5DYTA 3OTGA 3G5MA 3GLVA 3G89A 1XRPA 1FOEB 2VO1A 3HEBA 2FFJA 1OAOA 3OM8A 3BMXA 2PK3A 3GLHB 3HR7A 5C1IA 3GNSA 4LXQA 1ZR2A 3BXEA 1VBMA 2DWCA 3WIUA 3GCWA 3EC1A 3E9YA 2YOHA 4MVJP 2HO4A 5D1HA 1QWSA 4YC7A 2MCFA 3DHEA 3PI7A 4CUKA 1O5OA 3SF8B 2I71A 1ODSA 1IN8A 2LCFA 2ZE5A 1SKQA 4YH1A 1JSRA 3Q87B 2MDTA 3RVSA 2AH5A 3KR1A 1TUGA 3CTPA 4N3AA 3WQHA 1L9KA 4UARA 1G8SA 3I30X 4B84A 2EKDA 4ZYZA 4INZA 2XUGA 2OXTA 4E09A 2PUJA 3IRUA 4B44A 2DTDA 4HN2A 4JR1A 4CR8A 2D0DA 4YRTA 1ISRA 4XYGA 2E6KA 2QRVB 4A6PA 2O8NA 4RKFA 1A4XA 1GPWB 1T8RA 4N8EA 4PO1A 1PGJA 3ULKA 1OBFO 2EFJA 4DA6A 1PT6A 2NU7A 2VPWA 4Y2TA 1OWLA 4FKZA 1USVA 1P1BA 2BCGY 2FEOA 2HIHA 2IL1A 3BWDD 4XWTA 5ALWA 1OWNA 2QA5A 3F2VA 3RRZA 1HT3A 4N5MA 4E6PA 3AVWA 3G7UA 3ZGOA 1SM4A 1OFHA 3FAZA 4LYFA 4JI2B 1R4MA 1XRLA 3K9CA 3QI7A 1NXPA 2E4VA 2DTEA 2AR9A 3GJ0A 4FEGA 4NP6A 1OFUX 2PGAA 5EHNA 4DCGA 3SJAA 4CRWB 1GPH1 5JTTA 5L3QB 3NHPA 4FXOA 5J1TB 4X62B 3ADCA 3TZHA 4B6GA 4NZOA 5CA1F 3GGSA 2ATIA 4C7BA 2DWUA 1HLPA 1PL8A 5E6SB 1YQWA 5AVKA 4BKUA 3ND8A 4PQRA 1AN9A 4EL5A 4ZOLB 1QLWA 3A3PA 1A9PA 4KUGA 1PZFA 3DAOA 3FCCA 3KXDA 4ICIA 5EIAA 4X3OA 1WNFA 2E2WA 4C30A 5GVRA 2K2WA 3T3PB 2HBZA 4BEVA 4X66B 1QQAA 1ZH2A 3CNOA 1CUVA 2HHLA 4R0MA 4ZV4A 5B37A 5EQDA 4MB2A 4YI5A 3D5TA 3QTTA 3WIEA 1TM4E 1R0YA 2LW7A 2DPYA 2LE0A 3GEMA 3QKRB 3UEOA 5KUTA 5LYJF 2VOEA 4URHA 3QVWA 1U3CA 2IXGA 3AY3A 3CH5A 3L2OB 1KYQA 2QPTA 3A4LA 3C1TA 3D5QA 2MJLA 4MI9A 1UBCA 4Q15A 4AJ1A 1EA7A 4A0RA 4MMZB 3SR3A 1NJ6A 4WBNF 1XEXA 2IPAB 3H42B 5HX7A 1UKAA 5TLSA 2FZVA 3ZU3A 4FS3A 3ZNOA 3ZVRA 4GBJA 2IEZA 2VTEA 5GJVC 4EHHA 5JFGA 1GZHB 4G89A 4WHMA 4BRSA 5BMVF 4MQUA 5H82A 1AHPA 4P4SA 4RM3A 2YY6A 4URWR 1WHSB 1KMQA 1KY5A 3R3HA 3JQ8A 3UTCA 2HJVA 2R6ZA 2C4KA 2A1IA 5DTQA 5DTIA 4W5QA 2TMYA 4KYIB 2WG0A 4QOSA 4JC8A 3F6CA 2EYQA 1NF2A 3FPFA 4L78A 1ZVJA 2X8JA 5DYNA 3EGEA 5DV9A 4ZT4A 6LDHA 3FNIA 5L7YA 1RLOA 2WRZA 2BHSA 2C5SA 5JLAA 3K2EA 1GP2A 5DWVA 3NTRA 2EZ9A 1WD7A 2WJZB 1Z74A 4Q4LA 1TM7E 3JVVA 5IXSA 2Q6IA 2WYVA 3JZAA 1WW2A 2HREA 4X54A 2YNMA 4NCHA 4L8LA 3N05A 1RXEA 1PYOA 2H1FA 1J70A 4DA9A 2GHQA 3BAZA 3ZLBA 1ZM9A 3RU7A 1XD2A 2Y1GA 3OESA 1A4UA 3Q88A 4H18A 3ZE0B 2XQKA 1Z4NA 4FONA 4RW0A 2D00A 2ZIFA 3KSUA 1IUPA 4Y0AA 1WQ4A 4XYLA 5ALFA 5IT4A 1EVJA 4D8TA 3THRA 3NYRA 1ZW6A 1QJ4A 4AY3A 2CT8A 1JH9A 1E9FA 1KDRA 4PHGA 3H5RA 2PL9A 2OYRA 1P9NA 3OCJA 4FFBB 1KK2A 2CNDA 1IEVA 1QHFA 4E11A 1FFSA 1G6KA 3Q40A 3OJCA 1NM5A 1ZJ5A 3FPCA 1FDVA 3R2JA 4WDQA 2GKGA 3BA6A 3G9QA 4US0R 4GOND 2Q2OA 4L0DA 4QGBA 2I67A 3KOYA 1HT0A 2G06A 1E6EA 1TFRA 1W59A 2AWOA 2VPXA 4MWZA 5K6RA 2WSIA 3LW8A 2J3JA 2VJDA 1F0PA 1ZXBA 3JVUA 1NHWA 2FWNA 4QASA 2O0MA 3RREA 2V3CC 4LZOA 3KD2A 4UTOA 2BI8A 4PE5B 4UD6A 1CYDA 1JI0A 2FQXA 3KFVA 4CG2A 4ALNA 3KSZO 2YYZA 2LKDA 3MA0A 5D51S 2DH5A 3QNWA 4P22A 4ER3A 2MSKA 1XTUA 3OA0A 1QPZA 4DMKA 1JP7A 3TX6A 1P3JA 5LB4A 4CU2A 1U7OA 3BFKA 2D8MA 2FPGB 2XADA 3RSCA 3RT9A 4G0MA 1GCOA 3DHWC 4L02A 5EHIA 4CMEA 1ID1A 4QTUB 4IH1A 3SBOA 3ER8A 1FXSA 3I6YA 3L7NA 2APJA 2BISA 3AV3A 1WUHS 1Y81A 3LO5A 4JLPA 3PU6A 3U3XA 3SBDA 1RRGA 3TDMA 2CXNA 1OZAA 3GELA 3L6OO 4PPFA 4ZDWA 3QVOA 3U7QA 2V54A 4CI0B 3UOAB 3WOHA 1E2IA 1WXQA 2PS9A 3C6ZA 4FW8A 3KETA 3LGSA 2XI4A 3ZXUB 1BCSB 4B85A 1KZ1A 1Y9JA 3UHFA 4CKEA 2B6NA 4PHHA 3N2GA 1ZOSA 2J59A 1PK9A 5HBGA 4BMSA 3KFLA 3UMVA 5A62A 1Q5PA 4PX5A 2FSGA 2YUTA 4CM5A 4EZIA 5J43A 3GFFA 3BWYA 3OLVA 5TB5A 4P0PB 1YL7A 3OCCA 3AHHA 3BJEA 3IVAA 2ZE8A 3DZ8A 5IUJC 2H5EA 3GRCA 4RK1A 4POAA 4TM8A 2V7QD 3EVNA 4B9EA 1E3SA 1FA9A 2C9BA 3V8RA 5JANA 2UXDB 4WOCA 3O2NA 2RGNC 2BJWA 2NIPA 3ZWVA 1GG5A 1J33A 3SZLA 1SUEA 3IILA 4NDZA 5E3JA 1H8EA 3KT3A 2E0IA 4PVCA 1L8LA 3QLJA 2W11A 2Y1OA 3ICOA 3NWEA 5EKTA 2IH5A 2XKJE 4TZTA 1GUZA 3VHQA 4DLYA 1QHHB 1DDGA 2W00A 2YL2A 3U1TA 3ZZUA 5ALZA 1SBYA 2H1HA 3HZHA 3MAAC 5ESRA 1ONBA 4BNFA 3UA4A 3OMXA 1TK3A 1ACMA 3ZQJA 4DT1A 5FOXA 5EXTA 4PTYA 1ZESA 3QUAA 1ISSA 5COQA 2H7YA 4ITRC 1TMOA 2J46A 2PYZA 1FZQA 4YEDA 4C76A 2WYIA 2RGWA 1XTBA 2B4YA 3F4KA 4HSEA 3UFXB 1SVOA 3ENWA 4J90A 2PZGA 3PSHA 4OH1A 5B6IA 1FF9A 1Q2UA 1CVLA 4FDVA 2H4HA 1Y5RA 2N3ZA 2RJNA 1LB1B 1GKKA 1QH1B 4D8UA 1WMAA 4O2BA 1XD2B 3HWX1 3VR6A 1QV9A 4D5GA 4PPQA 4AU1A 1LI5A 1GDTA 4C4XA 1D2CA 1GG8A 4NQZA 3EUEA 2A5YB 1SWWA 4ENSA 1NVFA 3NHUA 1YA4A 3QVGB 1YS1X 3EQ2A 1Y5MA 2IY8A 4TLEA 4EG3A 1N36B 4JUDX 4BV3A 1XEFA 2QJOA 2QL5A 3ENNA 2GUGA 2CW5A 3WBFA 3EBLA 4DLXA 2BEVB 4RTKA 3QV2A 1X3LA 1M1XB 1FDRA 1XAHA 2OB2A 1Z3IX 1P9WA 2B7CA 4PWZA 2JRLA 4UFOA 1UQTA 3SMVA 4MHTA 4PF1A 1TAUA 3ZLVA 2BM0A 2R48A 4R2WA 1CIPA 2QSYA 4IKPA 1GNQA 2CEAA 3WWZA 4LVOA 5K3FA 1C41A 1JR3E 1P1HA 2AJTA 5LZ5A 2XZTA 1IB6A 2V6MA 1U3WA 2R7LA 3N2KB 1U6JA 4R5MA 4KK4A 3LGAA 4E08A 3U3OA 3MMZA 4BJHB 2XNDA 2H18A 5MGNA 2WJYA 3CX3A 5KYYA 4Y0VA 1NR1A 5L3ZA 3RARA 1CZNA 4ML3A 1JAIA 2VXOA 1ZK2A 2SICE 1RJGA 4ARBA 2WB2A 4UNIA 3DWFA 3QMVA 3IP3A 1UPUA 1G4AE 1B2LA 2AHOA 2G0TA 2VNAA 4MDYA 1YBMA 3R9IA 1AKMA 3AILA 4MWBA 1ZN2A 2E4XA 2PKXA 4G5GA 1A8IA 1OIVA 1NUAA 3MCVA 1X7YB 5J4VA 4MWCA 2NO4A 2JGFA 3O8RA 2HU2A 3GUVA 3R5XA 5A0VA 3GDFA 4N7JA 1N0UA 1YONA 3JZFA 5FFNA 3CW9A 3LXXA 4WEQA 1CR6A 2JF0A 2L0XA 4ZDJA 5AOVA 3IQWA 3VTZA 4CTOA 2PQMA 1JLHA 4F8JA 2C8JA 5IM5A 3M70A 1QIIA 1DIHA 1OI7A 3FVVA 4L3VA 4BLOA 2PJZA 4HLDA 2GVZC 3PRHA 4BU1A 4TMWA 1JPNA 1RSZA 3OFND 3DW1X 3FUUA 5KBYA 4FILA 1KNQA 4MX8A 2Q1XA 4OKNA 4YRQA 3KUXA 4FSDA 1BS2A 1UBLS 1RI4A 2OQVA 1LUAA 2Q8PA 3DE7X 3T9AA 3V7UA 2TSYB 1OHHD 4GI1A 4FLEA 2GFHA 1JBKA 2W6JD 3CH6A 3RV4A 4ZOEA 4M9UA 2GAJA 1PJZA 4GMDA 4OQFA 1I36A 2IW1A 5IDWA 1G9SA 2I80A 4L16A 4A6XA 4O4IA 1WTAA 3EIFA 1XTIA 1F8YA 2ZUVA 4J0QA 4J3JA 4TT3A 4ISCA 5FX2A 1BRTA 1YK1A 3F3YA 4Q7KA 1CUHA 4O8ZA 3OM9A 4HO1X 3B9PA 3RS2A 3A3NA 4M9XA 4EFNA 2O3TA 3RYFA 2A92A 1N2HA 3K70B 4YP7A 4RH1A 1PCXA 3ANMA 5AVSA 3F49S 2GN4A 1JHVA 3NJ4A 3ZIDA 7AT1A 1PQYA 2FCAA 2GCOA 3VUFA 4OI0A 2SECE 1FUEA 1N3YA 3FZGA 4FUTA 4PPNA 5KYVA 3DCIA 5K09A 3FKQA 1MX5A 3E9QA 3G2JA 3KE9A 5CDFA 3TLKA 4QM7A 4BOYA 1PVDA 2JJ1D 2A6PA 1EUCB 3NQ41 3AF0A 3FCOA 3KVNA 3K2QA 2AQ8A 4C2AA 3I5UA 2QRJA 3W5VA 1WDWB 3FUWA 2CNOA 1KH3A 1U1EA 1ZK0A 2AD5A 4HFNA 4DY6A 5IWAB 1D9ZA 3EVGA 3AEQB 3F9RA 4R0VA 3AUJB 3BCRA 5KSWB 3ND5A 3QBJA 3I8SA 1ND6A 2OVFA 2MHCA 3CSDA 4WVLA 3ZWMA 4LYYA 3D3NA 5LZ7A 3EEOA 1S02A 2QRMA 4ARAA 3INGA 4F11A 2BFEA 4RU1A 1DEOA 2QL6A 2RH4A 4PANA 3V33A 4UU1A 4XX1A 1NA5A 1TC1A 5JNVA 1XZNA 4Y67A 3DEKA 1KOLA 1JHUA 5FBQB 3KKLA 1FLVA 5IS2A 1I01A 1XD8A 4NYJQ 1CZHA 4GP7A 2JKYA 4QYTA 4E2FA 5FI5A 1Q7RA 3ZWOA 4FT2A 3T7IA 1GD1O 1YWGO 3CLUD 3O9MA 121PA 4JB0A 5FORA 3ZW8A 4QT4A 5DB4A 4ZYTA 4ARZA 4N7RA 5IC6A 3PG5A 1G19A 1MNAA 2QUBA 1KY4A 2D5CA 2VP5A 3K0CA 1ANKA 1B7GO 2EIXA 1MRNA 1Y3HA 3GFSA 3O31A 1VSVA 1ENPA 3FAKA 3GMTA 2JAXA 4MV3A 3SXUB 1Y9DA 2WTAA 3TNJA 4AK9A 4GD3Q 5GGXA 5EJAA 3B8EA 1UMDB 2VP2A 3LLMA 4BVKA 3QFRA 4F7WA 4GKBA 3SY8A 4R01A 1C1XA 3LC0A 4TPKA 2XGSA 1L4NA 4UBOA 1K2VN 2O4UX 1U8ZA 2YCLA 3R3ZA 4HLUA 5LOVF 5HW0A 1SCAA 2GCEA 1C81A 1HDZA 4LOIA 5EE0A 3N8HA 3RS8A 3SQNA 1PG5A 1KQFA 3KTAA 4LN1A 3BX1A 2F59A 2GRJA 2Y3IA 4TYWA 4NBVA 4EW6A 2V3VA 4BJ3A 1MJGA 3LVRE 4G23A 2IDZA 1TQDA 4R2HA 2RK4A 3SU8A 3WGUA 1UOEA 4QPDA 3QEBZ 3OOSA 4UDXX 1GRVA 2P8SA 4KZPA 5C1DA 3L01A 2IOHA 4K5QA 1CQZA 3A0RB 3HXOA 1MQ9A 2QJTA 4B80A 1V16B 1GPDG 1F2TA 1W8IA 3NASA 1NUTA 1XJQA 3AOGA 2V9CA 1GPLA 1O94A 1W5TA 4HEQA 4REQA 4B83A 5EJEA 2G8LA 3ZHBA 4DV2B 5DIZA 1JW9B 5EWMA 3UJ6A 8OHMA 4X6XA 4EUSA 2XZLA 4P3KA 3UMJA 3RWBA 1C3OA 1H94A 1FVOA 1RVV1 2VATA 2QLMA 2ATCA 2ZVDA 5AKKA 5FUBA 3VO9A 5C37A 4DA0A 1PNRA 1KARA 4Z49A 1M6YA 3OFKA 1T8WA 1GUAA 3LVQE 3MTJA 3R5SA 1TW2A 4ZTUB 2YASA 2ZTLA 2X0DA 1Q3TA 1HE5A 1J1IA 1YQGA 3SEQA 5I3ZA 1LPPA 5EYPB 1ZQ1A 3ZK9A 3EDQA 4I8XA 5CDHA 2H2IA 2NTJA 3IVXA 3NTXA 4JZKA 1H05A 4OF4A 1L5SA 2JGAA 5K4GA 2NO6A 1OH5A 1GNVA 3F7MA 3IR6A 2B1JA 4AVYA 3AP2A 4WCFA 3B9RA 1SELA 5LZ8A 1P6UA 2UYOA 2V5AA 3SJZA 4MDFA 4DZRA 4YMLA 5JFOA 1I10A 1LK7A 2XYQA 4FCTA 4JXXA 1LPSA 3VX3A 4I1IA 5BUSA 2O5VA 4WBNA 1KSJA 1XELA 1ZD5A 3DMRA 4EWLA 1GHTA 1PHRA 3HR8A 3LU1A 4NRDA 3FTFA 1G5TA 4EA6A 2QNIA 5A3QA 3RAPR 4A8HA 2FK8A 3F97A 3O4GA 4MGIR 3LIPA 5FBZA 3KOOA 1SWVA 1T5TA 1XZMA 4M1TA 1Q15A 4XIGS 2RAVA 3X1MA 3AM1A 1U3FA 3WJAA 3CRRA 4JT8A 1CJCA 3NB0A 2WHYA 1Z2AA 3DXZA 4KSBA 1DOAA 2IPOA 4BEJA 3IAM1 1XALA 1MB0A 2JD2A 3T3NA 1JFTA 4EK9A 2YY7A 1JG3A 1SFRA 2GEBA 4R41A 4FI3F 4NU6A 4S12A 2RHCA 2PMKA 2O48X 1T5SA 5EOVA 4JP3A 3TECE 1N7HA 2KBEA 2R8OA 4QU0A 1TEHA 5AR1A 2G09A 1ZN8A 5FTWA 3FMOB 4DJ5X 1QVVA 1ORDA 3IVGA 2RGRA 1N6OA 1ZJ6A 2LTAA 3GGOA 4IG9A 4R1NA 1ZS9A 1MTZA 3GAZA 4LMAA 4CKBA 1NQOA 1JQ3A 3S7ZA 3U1VA 1E2MA 2EWMA 4HDKB 3AOEC 2Q2VA 5COAA 1WV1A 1MENA 2NT4A 4FVTA 1DFGA 4LI3X 3DFZA 4JX8A 4RPKA 4CLEA 2IKSA 1FX1A 3OOHA 2NYUA 2ZYTX 2WQ7A 4NQRA 4BLRA 4MPDA 2HWXA 3F2IA 4MQ4A 5K6TA 2P2DA 2YOGA 4LVNA 4ZI7B 3PPVA 5FPHA 3TQQA 2GJAA 4GUAA 1XV5A 4CPDA 3DE5X 5IKPA 1ESMA 3K94A 4KXFB 1EDEA 2Q0SA 2Q5FA 3F6YA 4BP1A 4BFLA 1OH6A 4NXNB 1HETA 1Z15A 3LYAA 1ID8A 5JROA 3FYHA 1Y48E 3DFIA 1O9HA 3P45A 1QWOA 4HH0A 5CW2A 1AO3A 1W4CA 2QMQA 4DVJA 4G85A 3E0XA 3E3NA 2BFBB 2IU3A 1KRWA 3C3AA 4N0DA 1S1CA 1NPTO 3CZ5A 1YJBA 4RZHA 3FYUA 4F6RB 1GGEA 1MABA 5FHQA 1F8UA 4HH1A 1E9DA 3H5AA 3PIDA 3CHYA 1CY4A 4DIEA 2Y2VA 4M83A 1FP1D 3OZDA 1YJ5A 4EG8A 5JAUA 3CX8A 4Y9SA 1Z29A 1L5NA 1U0TA 2Y1KA 3FR8A 3TAXA 3ZWDA 2VHUA 1R27A 2CN1A 4FGZA 2KLHA 1WW3A 4A36A 2C04A 5BR1A 1MEOA 2Q62A 1O94D 4EHNA 4OHVA 5L4NA 4FYPA 2GVNA 4ZEOA 2OHHA 3BGWA 3P0IA 2JLUA 3FVTA 1GUYA 2I76A 4Q82A 1E60A 1T8YA 1VJ5A 2PD4A 3HEAA 2BTEA 2VBIA 2DUJA 1GO2A 4R9RA 3M6AA 3IPYA 5DVZA 1PJBA 3BS4A 1WPRA 2YY5A 1OBVA 1WNTA 4NJEB 4TXJA 3SXUA 3GLIB 4X9XA 1Z36A 1DX6A 2PRZA 2V97A 2ZYAA 3HU1A 1O96B 2ZIXB 4RKWA 2O8CB 1M5RA 4UAUA 2P3LA 4K3VA 4O2AA 3L8CA 3TZ6A 1L7NA 2RAFA 3DFUA 4G41A 5B5SA 4COOA 2YV3A 3U7HB 1CZLA 1THGA 3HKEB 2IHZA 1RTKA 1BU5A 2VHTA 4L51A 3QVLA 3GN2A 1JLLB 4JJZA 1U6KA 3K0EA 2AE2A 3OD1A 4KX3A 3D6MA 1M54A 4DCTA 4JFAA 2CLCX 4YFVA 4ZI5A 2QW8A 3PKZA 1YTLA 5EHQA 5AYVA 2J3MA 3FLAA 4P93A 3WK8A 2ZUUA 3TEFA 1NQAO 2CVPA 4LNHA 1KEVA 5IKEA 3EBOA 1REQA 1OXTA 1UDXA 3GLHE 2GERA 3L02A 2WK1A 3EAQA 4MI6A 3RFXA 3HVJA 3ZQ6A 2W0MA 5L95A 3IT0A 4R7GA 2FNAA 4I4TA 2C7OA 4KE9A 5TS2A 1NOIA 3L0OA 4P36A 3B1ZA 3IURA 3RYFB 1S8FA 5IJAA 1LPMA 3FOCA 5LWHA 1PSWA 1FDSA 3CIFA 4O5OA 4WGFA 3QOYA 5G53C 4AJPA 2J07A 1MGOA 3BILA 4RCZA 3UIEA 4JEMA 1DCFA 1GT91 4ZYWA 3K9NA 3Q7PA 2R2AA 4H7PA 4UNSA 5KVSA 5LLSA 1U0RA 1N32B 3H0EA 3PGVA 4IPTA 3H9EO 3VPAA 4TMFA 4HDRB 2PZEA 2YWFA 2OMKA 5T8KA 4PC6A 4C03A 5DHRA 1J22A 2H00A 5EKDA 1EVEA 1X7GA 5P21A 1X94A 4OYRA 4PRZA 1RPTA 4WZAB 5TQJA 4XQGA 5CFZA 1JDPA 4OLFA 3QKUA 4CLXA 4E2ZA 3SEZA 2FLKA 3ZJVA 1LX6A 4DSUA 1AKRA 1RHMA 3AR7A 4W6QA 3HNPA 3SM9A 3GLGA 3LY7A 4D0GA 1OE0A 1Y7LA 2BMAA 4FLFA 4MK4A 4R6WA 3TYXA 1CR4A 1LI4A 4MYUA 2YJ3A 2ZW9A 3PPIA 3HCNA 3KALA 3R44A 4X20B 4F5YA 3QXJA 1JSLA 2I55A 2C2XA 3AUUA 1MO6A 2HK8A 3HBNA 4AAYA 1LPBB 1V9CA 3OT5A 4IVPA 5BQ5A 1WWKA 2QPLA 1HYQA 5EXPA 1XDUA 1N0IA 3EGVA 3KKEA 4K1LA 4NE2A 4ZHQF 3C8MA 1IHOA 1KQ3A 4JENA 4MKRA 4Q5IA 4XR4A 3FNQA 5KTSA 3HGMA 3AFGA 2HCRA 5CGZA 2OK8A 4YRDA 3UANA 3L0CA 3MTQA 4M8SA 1HQCA 2NV0A 4WFQA 5BV7A 5JSKA 4K88A 1L5GB 1Z5NA 1TD9A 4HX9A 3F4LA 3MWEB 1K27A 3OICA 1LVHA 4YB8A 2PSJA 3RYHB 3LUHA 3UHJA 2FWJA 2H59A 5I9IA 3E22B 1JMVA 3TQSA 3RK4A 5HJEA 3RUCA 3ZNPA 4ZN6A 5AIAA 2JFNA 3EZ9A 4J0GA 1MW8X 1ZUWA 1NXVA 1YR3A 2UZAA 2PS1A 3AIIA 3HCWA 2RHGB 1D5WA 4BGIA 3DBRB 3JYHA 5L6MB 3G2LA 2ZI7A 4EYSA 1S3FA 1KO7A 2MU1A 3IYLW 4ES6A 2PAFA 3HFGA 2VAVA 4LE2A 1EDBA 4G5RA 5E4YA 3UT0A 4LMRA 1NN1A 1TW3A 2ZRJA 2GXQA 3EY4A 3URMA 1CZOA 3HKCA 4C29A 1V2GA 3BCSA 5M5BA 2BMDA 4M1EA 3I1IA 2C7VA 4JELA 2BGIA 4EITA 2R4UA 4O29A 2FMIA 4NCXA 1FJXA 4RXMA 2V0GA 1YJXA 2H85A 2YWJA 3ME5A 4AICA 1ISIA 3KQMA 5JXWA 1JHPA 4NENB 5K8TA 1XNRB 4EA9A 4EJ6A 2A8YA 3MTGA 1R8YA 4RMGA 3KE8A 4NG4A 1BFKA 1X8LA 2V45A 3PUHA 3CF4A 3HXQA 1KXZA 2F62A 5K0BA 3DMPA 1RCFA 1ZIDA 3DXYA 1YDFA 4LPSA 1OBCA 1X1SA 5GM1A 2D54A 5JFTA 3GRVA 5KZMB 4J1TC 3DMGA 1RIFA 2V7QA 3N58A 3O90A 3RTEA 1XB2A 1E2LA 1N5MA 2H16A 2R6DA 2VLBA 2LVBA 1DCKA 3AINA 3BHNA 1MORA 3G7SA 4YXWD 4YP5A 2HRDA 5FDFA 3CG4A 3E8SA 3RLIA 5BNZA 2Z9CA 2O8FA 4U3JB 5HKOA 1M3SA 1B23P 1BKYA 3JD1A 1KFBB 3FW1A 4BQNA 3NTUA 5GIOE 4IGFA 3CJTA 3GEBA 1RAGA 2PN1A 4N12A 1SAYA 2A4KA 4M37A 1P2TA 5LFAA 1LK5A 1HTWA 5KJ1A 4O4LF 2HF2A 5I7OA 3EPJA 2ESRA 2PH3A 1KJ9A 4MYTA 2IIQA 4L7VA 3ZHYA 2QJWA 4FEYA 4MS3B 5SY9A 3ZZMA 1KJIA 2RI6A 5HS6A 4TS1A 3WYAA 3MC1A 3OY7A 5BWLA 5ALJA 5FPKA 3DVQX 1KHTA 3I04A 3WGMA 1N1GA 2XEDA 4US1R 3AETB 4BRZA 3UMYA 1HORA 4YJ3A 1CIVA 2FN9A 1A77A 4OHZA 4LCJA 3QE9Y 3PEYA 2HQ1A 1IZ0A 2XCTB 1HFKA 1JU4A 3KKNA 2PGIA 3WRYA 3ZXYA 1PV1A 1J97A 3UT6A 3EE6A 1KIFA 3KNZA 4K9SA 4DAEA 1KXJA 1TYAE 5D3KA 1F17A 4BQRA 2WT9A 2WVGA 4YJFA 2XQJA 5HCNA 3SNKA 4ZXFA 5FA5A 3C0KA 1TZJA 1M1NB 1SD1A 1B6RA 3OZGA 1OX5A 2K87A 4OXQA 1JG7A 5J4YA 3MBIA 2NZJA 1DWOA 2PTHA 4HYTA 2H17A 2C5BA 2Y27A 5DSZA 4JXZA 4C4OA 3OI7A 3LLUA 1XZIA 2GN0A 3NWJA 3DPIA 4LXUA 2ZB4A 2SKEA 3KJEA 4RIHA 1DC3A 2WC1A 2XQIA 3H5WA 1G8KA 3HKBB 4L8VA 4EVIA 4MS1A 1BN6A 4DA8A 1Z8DA 1W9MA 5PGMA 1BCSA 2FPWA 2AOVA 2PMDA 5TT1A 2ZE6A 3SYMA 3LQFA 3VNRA 1YQTA 2ADMA 3TD2A 3V4FA 1Q0TA 4WIAA 2XZPA 4RZ3A 4V0NA 1SIWA 4K9MA 3JQ8B 3IO5A 3WIBA 1BA2A 4DM3A 4MW5A 1UK7A 3Q0EA 1QTNA 3ZCRA 4BO4A 1H2HA 1ZUHA 2P9EA 2R7MA 3GIDA 3B9QA 3BVPA 3NH9A 4IDPA 2AEFA 2GRUA 4DSZA 3X2SA 3GPIA 1TC2A 3KHKA 2O2JA 3PHBE 4KXQA 3AHFA 3I9FA 1NDUA 4CQNA 1QO7A 2CLFB 5J2UF 3LYUA 3SKYA 3UWOA 3VAYA 1ZA2A 3VU3A 1E7SA 3O4HA 4B48A 4OGKA 2RC6A 3NATA 2ACWA 3PGA1 3ZPXA 4J6FA 4TRMA 4YCDA 3CBQA 3OWHA 2WIAA 3L05A 4HT3B 1G38A 2O14A 3E53A 2WJ4A 1ILWA 2NXCA 3R0XA 3AWIA 1A2BA 1IEWA 1T3TA 1T4CA 4YR7A 3KV1A 4AWXA 4ARUA 3I76A 5DF1A 3VR6H 1KVSA 3V4SA 5A4JA 3GPBA 5AUOB 1V95A 3ROGA 2ZJOA 1CY6A 2IDJA 1K08A 1PS9A 2PWYA 5LN1A 2XEXA 1XAJA 4D8XA 2NTYC 1C8VB 5J2TF 2DHCA 3F96A 1W88B 1KYTA 4KYTA 3WQQA 4Z54A 2G9RA 4I5GA 3MZ0A 4P7KA 3VDNB 3W5HA 3MJCA 4HEJA 1KKLA 2JLQA 3U56A 1HFWA 3JQ7B 2WU4A 5EJ8A 4UBKA 1Z17A 1RXSA 3PICA 4OJYA 4DLVA 2GTPA 4NMHA 3RVNA 4E70A 3S1AA 1UFRA 3IKVA 5IJXA 1M34E 4BFVA 4B7XA 3QZUA 1E1DA 1AXRA 3FZYA 2CJXA 4M7RA 3KAJA 3PEFA 4U7PB 4Z7QB 5JNWA 3FCAA 3IMKA 1B1CA 1YVDA 3GJQA 3ZDYB 2GEFA 3EOZA 1QFZA 3PD7A 2R47A 3W8DA 4ZQEA 1G8MA 2OCAA 3W4JA 3HY4A 3I45A 4TKUB 1PLJA 3HBMA 2D1TA 5FPPA 4HR7A 1ISMA 4N65A 5TPZA 2NPOA 2BJVA 2XMCA 3KJZA 4A2WA 4A0HA 4XB2A 3VFDA 1HZZA 2N42A 3FN4A 4I5IA 3O4IA 3OQPA 1Z82A 2UXBB 5BY2A 4EY7A 2GCOB 3NYQA 5H4HA 1ULHA 4YUYA 2WJHA 3CNEA 3WBBA 4B4WA 4CKWA 2KX7A 1R4MB 1EFAA 1U9IC 2IYQA 4V3BA 3S7TA 4J3NA 1JYFA 3V2HA 2IBTA 1NTRA 1UDCA 1ABEA 2J6BA 2JBAB 3NC4A 4BKQA 5MF6A 4P1ZA 4RL4A 4O4JB 2CY0A 4XASA 4AB1A 2ZRAA 3TIXB 5B12A 4WOJA 5K0GA 2Q6TA 4NAUA 4O4JA 2QTWB 3LPMA 1XLVA 5TMDA 2VRBA 3TRDA 1TF2A 1ULZA 2J9RA 5G3ZA 1QM5A 2R0QC 1PI3A 1WB4A 1BX1A 2P7HA 2B61A 4QYXA 2ZDHA 4RIEA 3QP9A 3ZHSA 4CF6A 1KFEB 3GR6A 1XF1A 3PS9A 3ZI7A 3UHOA 1RS0A 4KZKA 4CM9D 4D8WA 4LHXA 1XKTA 2BDUA 2Q50A 3FDIA 3L8DA 2WUDA 1F9AA 4F45A 3PRKE 1JJ7A 4Z5XA 4PPYA 3N0WA 3S8EA 2XITA 3JQ9A 3N76A 4ZVLA 1Q95A 4MHSA 1SCUB 1G291 3AJDA 4GKAA 4G5XA 4N3NA 3WOVA 2DR3A 3GUUA 4PGFA 5EE1A 4C78A 5JRDS 3LK7A 1ZNQO 2B35A 4QL3A 4DEVA 3PZRA 4B82A 1Z28A 2FRDA 2Z3ZA 3USES 1Q1ZA 3ZIAA 1MC8A 1EVQA 4ZI7A 1I4OA 2NX2A 1E6CA 4R3WA 5B55A 4OMUA 4QQNA 2RGGA 4HQRA 1KOFA 3D0RA 3OPXA 1JZQA 4JXKA 3BCHA 5KPJA 3MB8A 1FS4A 3HYCA 5HBRA 3PNKA 3ZC3A 2R86A 4ZDKA 3IXQA 1O4VA 3W2FA 3T06B 2NPFA 1WXIA 2ZRNA 4UM9D 2SKCA 4LDZA 4NICA 2YRFA 1A71A 5EPOA 4NOLA 4E1BA 1NKSA 3DZBA 1VL8A 4R81A 1JKIA 1M5UA 4HUQB 5ESWA 2ISQA 2YV1A 3KQTA 3W3ZB 3DOUA 3UXMA 4EJSB 3EIQA 2EP5A 2B20A 4YRBA 2WZDA 4B4VA 3KXPA 2IVZA 4JLWA 3R8FA 1Y8RA 1EUZA 3KUCA 3DP7A 3GRFA 1G8HA 4LDAA 4Q3CA 1XZBA 3MT9A 4JKIA 3ZCXA 3I6ZA 2JVKA 3Q3VA 2UYGA 3UOWA 2P0EA 4KRFA 3EMBA 4RBNA 1TTPB 3I2FA 4AJIA 4I9GA 4DWJA 3B48A 5KPDA 4XCVA 1KWKA 3ZNNA 1H3EA 1JRLA 1J25A 1GQ2A 2JFVA 2L69A 1JQDA 1G4UR 2CL0X 5FV4A 5A5GA 1POWA 1QH1A 5G40A 3UAGA 1VZ3A 1JSCA 2QTHA 4FOLA 5AUQA 4D74A 3PQ8A 3KKQA 4BFYA 2ZPAA 4R2IA 2CYCA 1BOOA 3PNVA 3AR8A 4XDZA 2IXBA 2O59A 2NU8A 4U2BA 2FZCA 5CT6A 4M98A 3V48A 5LMZA 3HXPA 3GVXA 1VPEA 2C3MA 1PEAA 1JPUA 3DQPA 3B38A 1WB6A 2HCJB 2PLFA 3Q5DA 3GFOA 1H6CA 3GIWA 1JECA 1EFTA 1XFAA 3WWEA 1JGTA 3HB1A 1DTWB 1EXWA 4BMPB 3V4LA 4BRWA 3GW8A 2YWCA 3HA2A 1FVFA 1SH7A 4DMLA 2OV8A 2JBWA 1AZWA 1HPLA 2EHJA 1YZLA 2J08A 1GAEO 2ZPUA 3BDIA 1Q7GA 4O4IF 4Q05A 4UUBA 1SN7A 5FBWB 3K8YA 5IARA 2RH9B 4MS4B 4WK4B 4H6VA 2VAWA 3A3OA 4C6TA 5HDQA 4A91A 2P91A 4WDRA 3WB1A 4XQ0A 5EXXA 3E5HA 2WSBA 3M4ZA 5AKHA 3ZI0A 4Z1MA 4CV2A 2YXNA 1K97A 2WYOA 5C34B 3TAUA 4TOIA 3RC9A 4XIJA 2XPCA 5KOHB 4KLNA 4X7RA 4YBZA 4YREA 3OO0A 5KJEA 2ODBA 3EIWA 4RJ2A 2AC7A 5EWMB 2HSEA 3IUEA 1I5OA 5EXSA 4Y2PA 3M6WA 5JALA 2DSTA 1CQJB 3T7RA 3AWDA 5EZSA 3QM1A 3ZBQA 1FLDA 4OQPA 3Q1KA 4TXNA 4NZMA 5HIJA 1DHRA 3OPYA 4GF5A 4AFNA 1GAWA 2QXTA 3GPCA 3ITEA 1RADA 1KYWA 5K4AA 4YN3A 3WKAA 1RLTA 1SXJD 2FZLA 3BIWA 1LLCA 1ZD3A 2YCBA 4JI4B 3G5UA 4NDNE 2GDJA 5HSGA 5D5QA 1JA1A 4QU8A 3GLFA 5BN5A 1K88A 4RL6A 4ISBA 5FUVA 2F8LA 1XMIA 3OQBA 2XVZA 2X9QA 3SQDA 4ZO8A 3V1TC 4AKSA 1TNDA 3G1TA 1M74A 3MCZA 2RKWA 4JR0A 2C8LA 4PYJA 1NAIA 5L8VA 3RJZA 2QTZA 4NI5A 4DB2A 3FSGA 1FYVA 4H7EA 1TF7A 3WO1A 2VP6A 3S8YA 1W75A 3ELUA 2YQZA 1ODLA 3OT4A 1C1DA 4PZUA 4EUEA 1JSZA 1P8JA 1DTWA 3NDIA 3NW9A 1Z0AA 2C82A 4HZUA 1PZHA 1L8QA 3AR5A 4Q4AA 3C1OA 4YCAA 3TJMA 5T57A 3B78A 4FDAA 4EQ6A 2QVGA 2JGDB 1O8BA 2Z5LA 1E5TA 4GYKA 3T0FA 1VJDA 2V6FA 2ZI6A 5LYJB 1XQYA 1KEEA 4GVPA 4P3OA 4YAOA 5GJWC 3GEIA 4FSHA 4L9WA 2IYWA 1BEEA 2PT5A 3BXFA 3ANYB 2QG4A 2XB6A 4KGXA 3ZHUA 1KI6B 2XMBA 3T7EA 3VISA 1P2GA 3AU8A 2PSEA 4MP3A 2H6EA 2GKSA 2YWGA 4NYJR 3W3AH 5LKAA 1H5NA 1QF7A 2HU7A 3H97A 1CP2A 1XQ1A 4PAMA 2W2LD 1A72A 1OBHA 4X00A 1ZLXA 2HUNA 3QOXA 4UASA 5TVKA 5E3IA 1P1CA 2V4ZA 3LCCA 4M38A 1A2OA 4G8CA 4JJ7A 5AVWA 3QPWA 2QVBA 3ZGNA 1UOOA 3BDAA 2H63A 2HLDD 4JZYA 1A9XA 2VF2A 4HWKA 3EBPA 3UAVA 2ZAOA 3P4UA 3KOWA 4BB5A 1L5KA 2R5WA 5LMNB 4NCBA 5A3SA 2H3HA 2QMHA 2I4RA 3FB1A 4GYWA 2HA2A 2VYFA 1EE2A 3K5HA 4MV1A 3S3TA 5BN3A 1QBGA 4CKZA 2Z3VA 4OEHA 1I7SB 2G72A 2PUFA 5LIRA 5MGBA 4KE7A 4FUQA 4XW2A 4FCVA 1S2OA 1RYZA 3NEYA 1WJGA 3NHZA 4U7GA 4JLVA 2BFEB 3O4JA 4O1MA 4TTTS 5KCMA 1Z56C 1Y8CA 3V2IA 4C05A 1NT2A 5DRYA 3ZV4A 3DB2A 2VDNB 3CVWA 1H42A 3QPVA 1O5TA 4GZ3A 5EUCA 3KKMA 4G4JA 4GYYA 4BLUA 4M87A 3GAFA 5B53A 5D87A 2YXLA 3L7OA 5JQGF 5DYIA 3JZIA 5DWDA 1B8VA 4HB4A 1KJ8A 5LDDC 4Z7NB 1BW9A 1H2YA 1SOAA 3QHAA 1HSZA 1T0IA 2JA2A 3KC2A 2C7PA 2ZR7A 4NJMB 3I01A 1TA9A 4G81A 4AJ2A 3ZCSA 1EFPB 1Y4SA 5EMHA 1U0FA 4PLTA 5KSPA 4EA8A 1H4SA 1ARZA 2VWHA 1EK5A 2WI8A 4C6TB 1MT3A 3UXHA 5B1YA 1F5SA 3CONA 3RIYA 1KI8A 1CUCA 2BEJA 3H4VA 421PA 4QJ3A 4RQAA 4J1QA 4NBSA 4OSPA 3WNZA 3I8XA 2VUHB 1DIBA 1OGJA 1PR6A 4FYWA 1EP1B 4LBWA 1PE0A 4JC0A 4F4UA 1DCTA 2BMWA 1OFVA 1E8NA 5T4EA 4M46A 4KXLA 2X23A 4UBMA 4QC2A 1KJZA 2JC3A 3M6VA 1PDOA 1HQYE 1HQKA 1I6MA 1L4LA 4H15A 4CMGA 2BGMA 1N8NA 3RB8A 3SKXA 3AERA 1Y6FA 3D0QA 1WZCA 1JQBA 3EFOB 4M0UA 3QMPA 4XEUA 4OY3A 7ABPA 1FNDA 1Y5IA 4PZZA 3O47A 3I0NA 4QDJA 1I51A 1ZUNB 3WADA 2GZDA 1PQWA 5TY0A 1FP4A 4EPRA 2L18A 3FD8A 1F2UA 3ZUPA 2RD2A 4HDRA 2YWHA 3B89A 3RUPA 4B32A 1M76A 2GN8A 5AM4A 1KYXA 3VR5H 2IV7A 1QKIA 2CHGA 2AWNA 4QUJA 4IMRA 2HR1A 1A7AA 4UEQA 3VDQA 2PUEA 1AV6A 4LG1A 4IEIA 3GPDG 3O94A 3GBSA 1EP9A 1N75A 3EG9B 2QPOA 1TCCA 2ZT5A 3KS9A 4GS5A 1EG7A 1VZ2A 1PD0A 3TJRA 3HM9A 2WPDA 3QXSA 4MJ3A 1EDDA 4OQMA 4Y2HA 3KU1A 1QHNA 3QG5A 4X1OA 1O9GA 4JP1A 1R6VA 1M2NA 2A0XA 2OC4A 2QX4A 4LHYA 1SB8A 4HKTA 1WOMA 3RASA 3BJMA 1J0BA 1PTKA 4WPGA 4DC1A 6REQB 9ATCA 4JYAB 2W4QA 5HQ3A 1P5HA 1UH5A 1W5SA 3K0AB 4ZOLA 1XJ5A 5BW8A 4H4DA 4S2EA 2HMTA 3PWKA 4O4IB 1NE2A 4OHFA 4ZO7A 1M2OA 4ON9A 4P08A 2VKQA 2OP0A 3S44A 4BNYA 1YK0A 4RELA 1V5EA 2RGEA 1PR4A 3KZ1E 1B8OA 5E9JA 2GFQA 2Q3LA 1P72A 5A5FA 1A97A 1AE1A 4XSHA 3PYLA 2BF4A 1O97C 1YCFA 2QZJA 5HF8A 4PRKA 4PR0A 5A4DA 3L07A 1IRXA 1XO1A 3PXXA 1XRNA 2R6GA 1DJOA 1VE3A 5HEKA 5IAEA 5K4HA 2A30A 2G0AA 5F33A 1EHCA 4ZV7A 2R97A 3WLAA 1B6TA 3GC6A 2IC5A 4WVFA 1FSZA 3GZNA 4DLUA 3ZBTA 1KRXA 3QW2A 2BUBA 5C8VA 4XTCS 1QJCA 5JYDA 3DGEC 1LVUA 1LLUA 4GPAA 4ZT3A 3SX2A 4QO8A 2QUJA 1NW5A 3OQVA 4M0FA 4JI8B 3L77A 1V1MB 2OK7A 3KYDB 3NR2A 2COUA 2Z58A 3SHTA 1XCMA 2RGYA 4WN3A 1KI1A 2GA9A 2CB9A 2QHXA 3ZE7A 5ULLA 5JYEA 2PT7A 3OKPA 4UU7A 3AEYA 3IJEB 3B3FA 2VI5A 4DBLE 4RZXA 2WUEA 4KVGA 4BUCA 1MO4A 3W5IA 3ZWXA 2O0HA 3IALA 4CL8A 2OXFA 4ZOQI 1E96A 1P2FA 2YFYA 3JW8A 1UMKA 1EINA 1X7XB 2NZ8A 4Y2VA 4ERXA 3COWA 3H6HA 1T3SA 1FU8A 2OHOA 4OHRA 3HHEA 3DOFA 5EG5A 2W6OA 4ENRA 5CBPB 1H66A 4NWIA 1S2MA 1KKUA 5FAKA 3DZCA 3GLHA 3WYGA 2WF6A 4BVGA 3G2MA 2OO5A 1ZRNA 3E7WA 5AKJA 1WBBA 1VJRA 3DKIA 2PMCA 3NOQA 4U4AA 2B1IA 4OAQA 2VTKA 3VC1A 3AV0B 1A9YA 4B3SB 1GR0A 4RLFA 3CR8A 4AJ9A 1IN7A 3TKAA 1M1NA 3TD9A 3EWNA 3ZWWA 4YGXB 4DQKA 3N2KA 4RPGA 4Q3LA 2Q99A 2XTMA 4CMBA 3ZYCA 3O92A 1QLHA 3CINA 4E30A 4TZ6A 3E4CA 3UAXA 5F9MA 3QOWA 4OUDA 1JEJA 3BGSA 4KLRA 3ZWYA 2BJHA 2C2HA 3ZW9A 2BL4A 3NVKI 1IULA 1E1QA 4JH0A 3MCAA 4H2DA 5A2QA 1AA6A 1EVLA 2I2WA 5AKIA 3UNXA 1NNEA 5I4KA 3NIDB 4F4CA 4D3FA 4AN1A 3AC0A 3GG9A 3JQ6A 2R7KA 4NBLA 4Y6LA 1P80A 5DGCA 2BMJA 3N7TA 3ONVA 5DGDA 5F7ZA 4B3XA 4DNPA 4UXJA 4MV8A 2G9VA 5GMOA 4BKMA 2IYYA 2JI4A 3EYAA 3WLPA 3I8OA 4ALKA 5C8ZA 4ZANA 1LRKA 2Z1NA 3GT3A 2SCUA 1I5EA 3WLHA 3CKMA 4G1FA 1Z7BA 4GE3A 4A92A 3FPKA 2XKBA 1YZGA 3F98A 5NULA 4E14A 1U8TA 4PBSA 1WQ1R 1PJ8A 2VJMA 3T3HA 1MH1A 3D4NA 3BL5A 2XGJA 1Z34A 3H6KA 3COVA 4HEHA 4GZ5A 4JL5A 4R9UC 4KLAA 4QJ4A 4Q9DA 4WLVA 4RK5A 1AKYA 5AXBA 3SM3A 3GGCA 1UBRS 4H7HA 5ALSA 2GO1A 2AZXA 2BTOA 1Z25A 3CLRD 2G25A 4KTTE 4RADA 3H1PA 1S89A 4X90A 1UJNA 4D9JA 2QUHA 1OR8A 4P82A 2PO5A 1Z06A 2NO5A 3CFYA 3KJFA 1TJ3A 3RG2A 5EFOA 2FWPA 4NATA 3CLSD 3T94A 1PJ2A 2I6TA 3HUDA 3ITNA 1Q1GA 2VRNA 4D43A 1UKEA 2L2QA 2QGNA 4UBJA 4CUZA 5JHHB 3ECAA 2EARA 5IN4A 1GTZA 1JDNA 5JO0A 1I4LD 1U2EA 4OGLA 1U2ZA 4KQFA 3VC7A 1C7IA 4EKYA 3UB2A 2ZUCA 4EG5A 4ETWA 3GMSA 4I6EA 5DHQA 4CKXA 2IEGA 2QUAA 1ZM4A 2CXOA 1RZ3A 2Q5CA 3NYIA 4OU4A 3W6NA 4DPLA 1ABBA 2HRRA 2XNJA 3H2HA 2Q5EA 1OFIA 3O74A 3EGWA 3P1JA 1SQGA 2HJSA 5A3VA 4F1WA 1A9ZA 1MXHA 1QHYA 1UJ5A 4U8GA 1NUHA 4E4TA 2VTBA 1RHRA 3LDAA 2WWIA 1Z4QA 4CHGA 4YYZA 5BOVA 4UBLA 3URKA 1Z6YA 2AC2A 2DGDA 1P4AA 2G82A 4NENA 2IHUA 2O57A 2PNFA 1K4KA 2Y68A 1HTBA 3DT9A 3O21A 2VK4A 3OPMA 3R23A 3W2TA 3BH7A 3HY3A 3JQCA 4ZCIA 1MGPA 1YRAA 4ONEA 5HKLA 4YRIA 2A5JA 3QSYA 4MV0A 1BXZA 1C1HA 1Q7CA 2YXBA 3LDGA 2JJMA 3HFJA 4FMPA 1XVIA 3SG0A 3SS8A 5B7GA 3RS9A 4TKVB 3RBZA 4RTQA 4YAUA 1H0RA 3R7WA 5TMEA 3DL4A 3U4GA 4BLTA 4Z2AA 1T13A 4C3UA 2CCJA 2JK0A 2W9XA 4UUNA 1KC3A 2BGJA 3CVVA 2PUVA 1SXGA 4IUYA 3JR3A 2DWPA 4MW7A 4DEYA 4OUKX 3TMAA 1MKYA 2WWVD 4ASUA 4AN0A 3TRIA 4CF7A 1RHJA 2CXUA 3A1NA 3L4BA 1JX6A 4H08A 2PGLA 3TVYA 4XUCA 3NUQA 3QGMA 4J7XA 4UE3S 5IDYA 3TLJA 1JR3D 3ELYA 1U3DA 1RI1A 3UK7A 4M2LA 1SIUA 3IUMA 5F4BA 4KRGA 2ZIVB 5CFNA 3BF7A 4B0PA 4BNDB 4UE2A 1LBQA 4D80A 4F1KA 1TYDE 3QELA 5CNMA 2XIJA 5DP2A 4DIBA 1U02A 2NZWA 3AIOA 3GA5A 3HSSA 3M9XA 4P81A 2VA9A 4A82A 4DNOA 5A4FS 4ZI3A 1CR0A 1C30B 3DLIA 4KN9S 4DR4B 3TKLA 3A6PC 3FA2A 4YV1A 4N3BA 3P2JA 1OYVA 3PUJA 1WKBA 3IV9A 5BWMA 1QZTA 1YJ8A 2J4FA 5CFRA 4FR5A 4AKTA 4ZK2A 1B0AA 1P5ZB 4FXPA 5ECDA 3RH0A 5CNIA 1DX4A 1Q0UA 3E1SA 4KWCA 2FRDC 4U6QA 1DS6A 2DFDA 4DJAA 1XU4A 4IIEA 2EGUA 2XLBA 2H06A 3K1AB 4BBAA 2ZJBA 1PYDA 5KTPA 1WXFA 1ZM3A 1NUUA 1J1ZA 3FGNA 1IJKA 1TQHA 5AK6A 1ICEA 4PAQA 5ILQA 1R3UA 5LBTA 4WACA 1DJLA 2MYPA 4MVCA 4HLQB 4L07A 1ADBA 3BD6A 4RZIA 3X2EA 4MGKR 3SXJA 1K5PA 4FYYA 1Z4PX 1K6JA 3QMWA 2O2CA 3DNMA 1HT2E 5J40A 1PEKE 1QQ6A 3T3OA 1MZPA 3I4CA 3DS8A 3VTKA 1UXIA 3I53A 1NAHA 3FIUA 1VG9B 5IDVA 5DSTA 1SRQA 2V4MA 3M1IA 2PPVA 3S5JA 3ZEAA 2Y77A 3CYFA 2F4NA 3F6EX 3IDAA 2Q49A 3WHIA 5EHGA 4UULA 1N9GA 3KBBA 1N2IA 1EUCA 4C1NA 2ASEA 3EDOA 2NYAA 3MIIA 3ZWCA 5IMSA 2H51A 4RDXA 1NZDA 2O8CA 2GB4A 4QLAA 2CD9A 4UUPA 1ZG3A 1VL2A 1GITA 3MNFA 4PYLA 3WRXA 3MLEA 5F64A 2D5AA 3DOOA 3DOHA 1ZPDA 3GROA 1MG5A 3DL2A 5LQNA 2C61A 1YR1A 1XHFA 5JJBA 3H9BA 3EDMA 221PA 4H7DA 3D43A 5ITZB 4DARA 4LJ9A 1SKYE 3LC2O 5FOUA 5CFQA 4GXQA 4FD2A 1PJSA 2I3AA 4YRPA 1XEXB 1EIZA 1G5IA 1T1RA 1A88A 3PR3A 2O3UA 2OXIA 5EIBD 5JJCA 4RHFA 5L6LB 3KUUA 4IHJF 2FUG6 2PYIA 2VDWA 2PWPA 4G2NA 1U2TA 2HA4A 4NU0A 5I01A 2C29D 2JBAA 4X1YB 4LY6A 2V1UA 2AHRA 4PLVA 1XCLA 4XIYA 1VG1A 4ZMSA 1MA0A 3RFFA 2QPAA 4TTPA 1WF3A 3WHLA 2SKDA 2AEMA 2XGGA 1W52X 5G1OA 4DXDA 2PVCA 3R5HA 4QBFA 5AKXA 3HDTA 1M6WA 4PCLA 2VDUE 4RFLA 2J5BA 4JI5B 2PZAA 1U7PA 1L4GA 2ZM5A 2BP7A 3UJ9A 4DDMA 1RXYA 1IMJA 3D7NA 4ASUD 4C87A 1R0WA 1DIRA 1MW9X 1VE9A 3D6AA 4JR2A 3RT7A 1NW3A 1CY2A 3GZNB 2WG1A 1SD5A 1Z7GA 4YUVA 3GPLA 4MQ6A 4PSKA 2H9IA 4XB1A 1XBTA 2OZEA 1UT6A 2B1RA 3WR5A 1HKUA 1AMOA 3AEUA 3NWOA 4H59A 2W70A 1Y4AE 3GNQA 3HJNA 1ZVMA 1CDEA 1PT8A 2G4LA 4QRDA 4WFKA 2XT0A 1LFAA 5HIIA 1JPJA 4D26A 2Y92A 4UC0A 1Q83A 2A5DA 4Q66C 5HUHA 2BGKA 2FSIA 1UPFA 3EPRA 4D3XA 3THXA 1DKUA 2NUPA 1KJWA 1MEJA 4M0LA 4HWOA 2CEKA 1Y89A 3DMFA 3DV0A 3QF7A 4QTXA 5BWOA 1L7EA 1WVIA 1GQFA 2Z5GA 4L4XA 2FPLA 2ZSIA 3S29A 1Z73A 3IDQA 3GFPA 4QPNA 5J4KA 1P7YA 1XX6A 2DLCX 3VAZA 1A5AB 4KJXA 4E0BA 4LXXA 4KL8S 1L4UA 3U9LA 5HP4A 5HHTA 1CC1S 1DJMA 4II3A 3V97A 1B6GA 1XVVA 4NL4H 2GXAA 1XA0A 2ONKA 1F6DA 2QRQA 3BWCA 4WTOA 3QKTA 5K8LA 1BRMA 2P62A 1TTTA 4YS6A 2XD9A 1P2SA 2AMJA 3O93A 5CURA 3I0MA 4M9CA 4Q1BA 4F60A 4GLFA 1PS8A 3PRYA 5JCOC 3WHPA 1LC0A 1T26A 2PRIA 3NOXA 3R77A 3VPXA 1DARA 1LWOA 3U4QB 2H1CA 5BPHA 2WR8A 5AJHA 3A6EA 3U6KA 3AIKA 3TOXA 1PD1A 2W2MA 2PZLA 1D6NA 3NBXX 4UZSA 5EUMA 4BNUA 3ZN2A 3LQRA 1OI2A 3H9QA 2I6UA 2VPZA 5BOSB 3KSAC 1R6UA 4IP0A 3TH5A 3NHRA 3OLWA 3PR1A 3SC3A 1YSCA 2IZ5A 3LY8A 1VSUA 4ID9A 1GGJA 5DTEA 2W0SA 4LHSA 1DZ3A 3PQ7A 3E81A 4KWTA 1TOAA 3IHTA 2H3EA 2I2AA 5DHUA 5IAKA 1LA2A 2FSSA 5D2CA 1EXMA 1NBEA 3IVRA 3EWIA 1Q0ZA 4HXFB 1SZDA 2B30A 5FI0B 1GEGA 4WCVA 1RAHA 1VTKA 2CB0A 3NPMA 4MV4A 2WLSA 4FCWA 5ALOA 2C7BA 1NLFA 3FR7A 4BCBA 2R1UA 2VS1A 3L0ZA 2PQ0A 4K40A 5FADA 4Z6KA 4ZYXA 5AQEA 1FE8A 3ET4A 2ZRCA 5H3HA 3R8XA 2FMXA 1UC4B 4Q4DA 1UWVA 5G41A 2XUZA 3VU9A 5LXTB 3H9GA 1E89A 1PIWA 1PR3A 1YRLA 5AK5A 4K1XA 5DBFA 1MB2A 1R3DA 2JFBA 2GCIA 1N5OX 4IQ4A 4QXPA 3TTUA 3U4HA 1ZMBA 5T4FA 3PNLA 3FJ1A 1QIDA 5H5JA 2H54A 4PFQA 4PSVA 1OJ7A 4MAFA 4N41A 4E7OA 4F0JA 5CFOA 3UFBA 5KIAA 1KMMA 1Z0JA 1A9SA 1NW7A 4KR0A 4AO8A 1F1JA 3PKJA 4B4KA 3K6SA 3CNHA 2PZJA 3DO8A 3MJHA 4RPCA 1WBJB 3KUKA 1CUYA 2JIDA 1ZOLA 2AXPA 2QQFA 4LDRA 2FPXA 4RUKA 4BO8A 3B51X 5BQXA 3O5AA 1XN1A 1EWRA 1UKCA 2NVUB 1JHDA 1V39A 2ZPTX 3B7WA 5EY5B 5BWCA 2J41A 3IQHX 2GESA 3MPOA 3D7RA 1OSNA 2TECE 3FETA 1DTEA 2O06A 3O8DA 4KC0A 4PINA 4QBGB 5IBQA 5BMVA 2W42A 1Q0HA 1ZWLA 3FROA 3JALB 5IAAA 3JQDA 1XPUA 4TSFA 1X1RA 2UUAB 3H11A 1L4FA 2GJ4A 3SVZA 1U2DA 1OZFA 4OLBA 1PYGA 3H2IA 4IZ6A 4ZAFA 2ET6A 1VSQA 3W2IA 4ZYLA 3QYPA 3RYCA 4HN9A 1E1LA 1LW7A 2AW5A 3A37A 5T4HA 3B82A 4JBIA 4QUDA 4RTLA 2G1PA 1MX3A 3EZ2A 2W5UA 4OJMX 4YHHB 3FFXA 3VXKA 1GCUA 3HCBA 4QSMA 5D3MB 5KKCA 2GR9A 3RVDA 3P0HA 1WA5A 2GCPA 5JATA 4J0DA 4I8DA 3ZYZA 1II9A 5ER9A 1SD2A 1FLAA 2VL7A 2FPIA 3BG5A 3IUQA 4GWGA 2IZ6A 3SYKA 2QTMA 4UHJA 5LXTA 1XD9A 4A73A 2DBVO 3TG2A 3QBTA 4RDIA 2O8BA 2JB9A 1K5HA 4PCUA 4FZ3A 5LNK1 4ITVA 1TU0A 3BERA 2XCIA 4KX5A 4LE1A 1JIXA 1N1EA 4Y6PA 4YQEA 2OCKA 3PNSA 1IQ0A 3BIXA 5LQAA 4IHJA 4OHMA 1RHKA 3WKCA 3KQNA 2AOUA 4ZEWA 2C5EA 3UJ3X 5T3UA 3I64A 3R5FA 5E4JA 3AI7A 2VDPB 3H2YA 2JGDA 1VFPA 4L5JA 1DB3A 1SZCA 2Q3FA 1NSTA 1U11A 4FR0A 2CLIB 3B2EA 2IOFK 3OD5A 4OGWA 2OFPA 1U8YA 1PFGA 2PGOA 4S1NA 4XCQA 2IYNA 3ETDA 5EJ9A 3RYCB 4I1VA 3WZ2A 1ZGZA 2QMUA 3FJOA 1FMFA 1FDTA 8ABPA 3BIOA 5U1PA 3U3ZA 3PXDA 5B3AA 3ZLUA 1CR1A 2VYCA 2X9VA 1YIOA 2O2EA 1L7RA 1MMFB 3B3GA 2VKTA 3PGJA 3JQFA 4PC3A 3DBVO