2RBKA

X-ray crystallographic structures show conservation of a trigonal-bipyramidal intermediate in a phosphoryl-transfer superfamily.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
261
structure length
261
Chain Sequence
b'MTKALFFDIDGTLVSFETHRIPSSTIEALEAAHAKGLKIFIATGRPKAIINNLSELQDRNLIDGYITMNGAYCFVGEEVIYKSAIPQEEVKAMAAFCEKKGVPCIFVEEHNISVCQPNEMVKKIFYDFLHVNVIPTVSFEEASNKEVIQMTPFITEEEEKEVLPSIPTCEIGRWYPAFADVTAKGDTKQKGIDEIIRHFGIKLEETMSFGDGGNDISMLRHAAIGVAMGQAKEDVKAAADYVTAPIDEDGISKAMKHFGII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title The catalytic scaffold of the haloalkanoic acid dehalogenase enzyme superfamily acts as a mold for the trigonal bipyramidal transition state.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Unknown function
total genus 91
structure length 261
sequence length 261
ec nomenclature
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 2rbkA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2rbkA01
5ALVA 3ZVNA 4CE6A 3N8GA 2B0CA 1FEZA 1Z5GA 5IS2A 5AVUA 1F5SA 2IOFK 3SLRA 3ED5A 3QU9A 3ZUPA 3KZXA 1LVHA 1XP5A 2IA5A 1Q91A 1NF2A 3U7GA 3QXGA 4BEVA 4EZEA 4F71A 4PNHA 3F9RA 4CNQA 4B6JA 5AKHA 4KYTA 4UM7A 4HGRA 3ZTWA 2YY6A 3I1YA 1J97A 5AHXA 1ZD3A 1S8OA 2W11A 1Z88A 3FPBA 3EF1A 3KBBA 3QLEA 4GXTA 3OPXA 4HGQA 5AKJA 4UMVA 3WKCA 5ALQA 1L7OA 4F72A 1TJ4A 5AM2A 3WGVA 2OM6A 3N5KA 3SMVA 4C4TA 1L7MA 2G06A 4NABA 5ALGA 4RETA 2FPRA 5ALNA 3DAOA 4DWOA 2YJ3A 4Y2PA 1ZRNA 5ALZA 1EK2A 3ESRA 2I33A 5ALLA 4UMEA 3OCWA 5ALMA 2G07A 3AR6A 4YCNA 1WZCA 2AGVA 3A3YA 5AM4A 3WK4A 4DW8A 2B1QA 3SF0A 1YDFA 2FUEA 3PDWA 4DFDA 5AKLA 2RARA 2CFSA 2G08A 5AW6A 2I6XA 3AR2A 1ZD2P 1XVIA 2G09A 1T5TA 5ALKA 3A1DA 3L8EA 2CFTA 2G80A 1LTQA 4L57A 2WHEA 5ALDA 1Z4KA 1Z5UA 4UMFA 5AM3A 4CF5A 1RLMA 3K1ZA 3MPOA 4UAVA 2ZBGA 3ESQA 4EEKA 5AVTA 2HF7A 2OBBA 3PGVA 1O03A 2GFHA 2HEGA 4I9GA 5ALRA 2P69A 5IT0A 5AM0A 2I7DA 1T5SA 1QH9A 2P9JA 1YMQA 5AW0A 1QQ7A 5AW8A 4YGYA 4OFZA 4UATA 1SU4A 1Z4MA 3I6BA 5AVZA 2WF7A 4UU0A 3QU7A 3QUCA 3CNHA 2GHTA 4EX6A 1Q92A 4HAIA 3SKXA 3AR4A 5ALJA 2MSNA 2ZBFA 1RKVA 3SHQA 5IT4A 3NASA 5AI5A 5AM1A 3U7HB 1L7PA 2WF5A 1KYTA 3U26A 4BX3A 1X42A 2WF8A 4KNWA 4G63A 1RDFA 3RFUA 2B8JA 4BBJA 4KX5A 2FPUA 2FPXA 2AUTA 2ZBDA 5AI4A 1ZD5A 4UW9A 2FPWA 5ALYA 4L6AA 1YNSA 1Z4PX 2ZXEA 5AW7A 1CR6A 1L8OA 3WK7A 1ZOLA 2PQ0A 4AP9A 1RPZA 2JARA 5ALWA 1RC8A 2B82A 3KDPA 5AVXA 5ALFA 4AS2A 5AKXA 3QUQA 2R8XA 3RF6A 3W5AA 3GYGA 2D2VA 4FE3A 2IOHA 3AR7A 5ALIA 4HGNA 4NV0A 3FZQA 4C4RA 5AI6A 3IRUA 3ONNA 4XQ0A 2P27A 4QJBA 1L6RA 1RMTA 3ZW7A 4ZEWA 1NRWA 3ET5A 4IG4A 2VKQA 2DQSA 3QUTA 3E81A 4KN8A 2GO7A 5ALHA 3R09A 3ZX5A 5JJBA 1RMQA 4Y2XA 3EPRA 3MMZA 1Z4QA 2YMQA 4UARA 5AM5A 4Y2YA 3E8MA 4BYGA 2HCFA 3L0CA 2HF2A 1U2TA 3BWVA 2MU1A 2QYHA 2WFAA 2IYEA 3MN1A 4KX3A 3UMGA 1QQ6A 1ZS9A 3QU4A 1RLOA 1RRCA 4Y2QA 5AK6A 3NALA 4E88A 5AW9A 2OYCA 2OA0A 4BX0A 3SKYA 3UMCA 4EX7A 1ZD4A 1Z4LA 2WM8A 5AI0A 1CQZA 2JAOA 4YH1A 3QGMA 3U13A 3PGLA 1Y8AA 3QNMA 1U2SA 2HSZA 3S6JA 3L0BA 2RBKA 1O08A 2I55A 3B9BA 4Y3UA 1QYIA 4AS3A 4OHFA 1Z4IA 2W43A 5A3QA 4Y2JA 3BA6A 2FDRA 2EARA 2ZBEA 2BDEA 3I28A 5AVYA 1TJ3A 2RB5A 2JAUA 3U19A 5AKYA 3NIWA 3ET4A 2GMWA 4G9BA 4UU1A 3WK8A 3ZTYA 3NUQA 3AR5A 3KC2A 3WK6A 3KD3A 2W4MA 3TLMA 1YJ5A 5ALXA 4OCZA 3R4CA 3E58A 4Y2VA 2YJ5A 2RAVA 3ZI4A 4ZEXA 4NAVA 1RQLA 3IB6A 3WGUA 2HOQA 1WPGA 2ZG6A 2AH5A 1TE2A 1RLTA 2B30A 3ZU6A 4IFTA 3NANA 3QYPA 3OCZA 2B1RA 3M9LA 5ALUA 3U7EB 2FPSA 3IJ5A 3WKDA 4XOUA 1VJ5A 1ZJJA 1Z4JA 4I9FA 3WKAA 4XPZA 5AW2A 5AI9A 4YIKA 1TJ5A 4J03A 4J2TA 2YMMA 2C88A 5AKGA 4MWOA 1U7OA 2O2XA 3EWIA 2R8ZA 2NYVA 3A1CA 3I76A 4Y2TA 3N28A 1U02A 3HLTA 3OCXA 4BX2A 1L7NA 2FEAA 1RMYA 2R8EA 4BNDA 1JUDA 2B8EA 3KOOA 5AI8A 1T9ZA 5AKZA 1L8LA 5AVWA 1SWWA 4L6CA 2AMYA 5A3SA 2JAWA 5AESA 3DDHA 2C8KA 4FFDA 1J8DA 3OTQA 5FP0A 2G1AA 2YJ6A 2FUCA 1PW5A 5AIBA 5AVRA 3QU2A 1VFPA 5AW1A 5ALSA 1K1EA 3UMBA 1EK1A 3L1VA 1N8NA 2NO4A 3CZ4A 4QQFA 3WKEA 4UAUA 5AIAA 2YMLA 3E84A 4MUMA 4O8CA 2CN1A 3FGOA 3P96A 1Z4NA 1VJRA 1RQNA 4YIHA 4Y2SA 1Z4OA 1WVIA 2ZOSA 2EATA 2X4DA 1MH9A 4HYTA 3WK5A 4DCCA 2HO4A 1TA0A 3WK9A 5AKIA 5AKKA 5AW5A 3ZVMA 3A1EA 5ALEA 3L8FA 3OCYA 5T41A 2YBDA 5AW4A 3L8GA 2YN4A 3N07A 1NNLA 3W5DA 3W5CA 2YMPA 5AK5A 3FM9A 3HYCA 3QX7A 4YCMA 1S2OA 1ZRMA 3UM9A 1QQ5A 2HX1A 4HGPA 2JGAA 2YJ4A 3R9KA 3ZVLA 2BDUA 5E0OA 4UASA 3ZWDA 3L7YA 4UMDA 3B9RA 4ZEVA 1SWVA 3D6JA 1IWOA 3OCUA 3L1UA 3L0YA 3ZWKA 5ALPA 3VAYA 4NFLA 3ZX4A 3W5BA 5ALOA 5AVQA 3MC1A 5AKEA 2G0AA 3B8EA 5AW3A 5AK4A 2HI0A 2YFYA 3EF0A 2O9JA 4CF4A 3N1UA 3FPSA 3NAMA 1RKUA 3L5KA 3PCTA 2Q5EA 3SD7A 2FI1A 4XE5A 4YCLA 5AVVA 3M1YA 4H1WA 4BEWA 2BY4A 2QLTA 4JDPA 3OCVA 2I34A 4EENA 2PR7A 3QUBA 2ODAA 3WKBA 1YS9A 2WF6A 2R8YA 3AR3A 5AICA 3NRJA 2P11A 1XPJA 2GHQA 4GIBA 1RKQA 2C8LA 4FYPA 2HHLA 4BNDB 2NO5A 2C4NA 1YV9A 4CF3A 2WF9A 2CFRA 4NWIA 4BKMA 4OD0A 2HDOA 3DV9A 3FVVA 3QU5A 1AQ6A 4HGOA 1WR8A 1N9KA 4KNVA 3AR8A 3AR9A 4Y2UA 2Q4TA 2EAUA 4RESA 4EELA 1U7PA 3J7TA 4Y2RA 5A3RA 5AVSA 4C4SA 2C9MA 5ALTA 2Q4RA 2IOFA 2I54A 5AK3A 3DNPA 3L8HA 4JB3A 4UM5A 2PKEA 3U7FB
chains in the Genus database with same CATH superfamily
5K3FB 1LV8A 2Q1YA 3UYKA 1YVDA 4CLHA 1WLYA 4NE2A 3F9IA 3QJGA 1F0KA 3AF4A 4CLEA 5KHLB 4QREA 3CZRA 3LXRA 5T6MA 3VOBA 5F7XA 4NJEB 4MMZB 2CUZA 1AVTA 2BGMA 3QWHA 1K0FA 3VI3B 4OI4A 4QLOA 2Z5LA 2ZDHA 2CLDX 3PUJA 4PF1A 4XLLA 5KQMA 2O5CA 3VVMA 2PL9A 1HYGA 1YSCA 2FSIA 3NCHA 3QLUA 1ZQ9A 2XMZA 1L4FA 2V8OA 3ILXA 3M5CA 4MVJP 3QKRA 3WB0A 2R44A 4WVFA 1WO8A 1Y3CE 3TEJA 4WPGA 2R97A 1OI2A 4C01A 3ZIUA 4G36A 4HB2A 1U0GA 2NSJA 5F1KA 1DIGA 4R2XA 3CG0A 1XMVA 4X1IA 4FSXA 1D2MA 2JZOA 3R3ZA 4L75A 4YV7A 1X1QA 3MJFA 4MV6A 3IVCA 1P7WA 4DIBA 2QL6A 2PWZA 4Q3CA 4YJ3A 5FOWA 2Y9MB 5JHGB 4G24A 7ABPA 3IOCA 1DLJA 4ECAA 3B3GA 1IHXA 2ZFUA 3D6MA 1A82A 2DH6A 3L02A 4EPYA 4F21A 2ODWA 4JFRA 5H3HA 4MLDA 4EFKA 1U7DA 4RD3A 2YDXA 3BDVA 3BQNB 2V59A 2Q6OA 1LV7A 3G6KA 3PXDA 4AYTA 3WAJA 3SNHA 2ZRQA 3GFFA 4EDHA 3C3MA 3LDAA 1CV2A 2YWDA 5ANRB 3SMVA 4XUEA 2I3AA 5F2KA 4AIRA 3USZA 5HIAA 5CR9A 3QMMA 3L0ZA 4JKOA 1QJ4A 5FA5A 5JS1A 2JS7A 3H4IA 3J7AC 1EKXA 5HTOA 3FRIA 4UJ5A 1AUOA 1DZIA 1O8BA 1H2XA 4J90A 3F7NA 5IC4A 3SSOA 1FTNA 2Z09A 1L4GA 4X20B 4H2DA 5JH7A 5K5EA 3PEEA 4HOYA 4EA8A 4HPXB 2GARA 5ALZA 2JCXA 4LGVA 1CS0B 2B35A 3ZQJA 4L5BA 5DTRA 3OCWA 1KBQA 4E5DA 1YVPA 3BN3A 4B3RB 1PAUA 3A37A 1D8AA 3ELBA 3D5EA 3G8BA 3KLMX 1GHTA 3RAJA 4D9HA 3DQQA 3LUDA 5K45A 1Y7LA 4Q9HA 2B6NA 1D0IA 4C1NA 5CAEA 1J23A 3A1FA 2EF0A 3TJRA 1FUKA 4B9AA 2WKRA 3FB1A 4XASA 1I01A 3JV7A 2AFHB 1Y33E 2ZB4A 1ULZA 1S2DA 2N75A 4JKYA 1KK3A 1NXPA 4KSYA 3GJ5A 3SLKA 3UY4A 3IMEA 2NV2B 1NVEA 2Y8EA 4K6MA 5ALDA 4YJGB 4P7BA 5AP9A 4XM1A 4M9QA 4QEDA 1COZA 3NBYC 3SFTA 1JLLA 1ZNWA 3PKIA 5IU6A 4QGSA 1Y9EA 5EP3A 1YFKA 4UAVA 4WBXC 3QF7A 3T52A 4ZICA 5KQGA 1ZXLA 3AHJA 2FG5A 4RHEA 3VR5D 2HF7A 1ONOA 3B20A 1CEXA 2GN4A 3FMGA 2H3HA 3HCAA 1KVTA 1N2OA 2O07A 1R0KA 3WE7A 2O52A 3MERA 3W6NA 3GJ6A 3R20A 2KLHA 3C6ZA 2C54A 3CT6A 4ME6A 4N7MA 1JFTA 2OHGA 4N3NA 1KGDA 1XK6A 1MX1A 1IM5A 2KBFA 2YHAA 3E61A 2AHOA 4PQEA 3TQTA 2QN1A 1YE3A 4PQFA 5A3JA 3FVRA 5KNBD 1ZEJA 4NCNA 1UJ6A 3E8SA 3EIUA 3X0DA 3VYVA 2ZE6A 2ORWA 2OLEA 4YCCA 4MKIA 3MMSA 3A4LA 4OFXA 2V96A 3E9NA 3TH5A 1JKJB 1V16A 3DMRA 4JKIA 3UKJA 2UUCB 4N5LA 4BV2A 5DHAA 3RANA 5FPHA 5CFPA 1JEYB 2WJWA 3F98A 3H42B 3P9IA 5F4ZA 3RLFA 4LWPA 3PJDA 4FU0A 5JD4A 5KC9A 1KI2A 3UPTA 2PL1A 3RYHA 4XJSA 4CYMA 2WF5A 1TM2A 5CITA 2VXBA 2DFDA 1RYDA 4R54A 5CXSA 1T3TA 1KYXA 3VR5H 3CUSA 2N3ZA 4YO8A 1KEPA 1YJAA 1I3LA 2DUNA 3GT0A 2HPVA 1G8MA 4OQFA 1KC1A 5D1NA 2GLXA 2VSXA 4OMDA 1TT5A 3EGVA 1SOAA 1ZD8A 3DJYA 4L0CA 1YNSA 1CX9B 4L6AA 3RU2A 2CL7X 4NCAA 5I45A 1HETA 3F46A 4BP9A 1ZCFA 3E9RA 4P32A 3RO7A 1LI7A 4GPEA 3TFWA 4DG9A 5KNBH 3O8OB 3DO8A 4UEKA 1HFKA 3FF4A 5DN6A 2NPFA 4AMZA 3KXKA 2MR6A 5ILGA 1ODIA 3MCUA 1MB2A 3S2EA 1O7JA 1P2DA 4JAVC 1CEEA 3QUQA 3TOZA 4CIXA 2ZRJA 2FZKA 1GAXA 3GQBA 5HQ3A 3L8ZA 5DNWA 2IHBA 1FDRA 4ISBA 5BYKA 1G8PA 2GVZC 3FHLA 1PT8A 3ONNA 3WQHA 5IHXA 1S8AA 2EQBA 5EP1A 1SXGA 2RHHA 3C5WP 4XVHA 4KZPA 1NJ5A 5IEBA 2MYTA 3ZZ1A 3GGPA 4MUEA 1MT3A 3AB3A 3EEYA 3FKJA 1X80B 1CJUC 1P1HA 4Y98A 3MWFA 2BGKA 3EMKA 2QL5A 4GLOA 1EVJA 5THKA 1FLDA 1DKLA 1UC4B 3ET5A 4IG4A 5ARDA 3UUGA 5KOIA 3NBKA 3UOAB 2QV0A 2PMCA 1MO2A 2F6RA 5JASA 5LZ8A 1K6MA 1AKVA 2AFVA 2DWCA 2ZJ8A 2WVJA 2O5EA 3A6GA 5ALHA 3IOEA 2JGMA 1PSWA 1DAOA 1VL1A 1ZMOA 5C4MA 5C5EA 5ELXA 2C2GA 5JWRA 5DMXA 3QHPA 4YVFA 4M88A 1GEEA 2C07A 3N3AC 1WP4A 4HJXA 4C2UA 2J9FB 3NI2A 4UBKA 4YCSA 3Q10A 4F3CA 3N5CA 1WSAA 4MIYA 1B42A 2H7YA 2Z9BA 3KLBA 4KBFA 4Q9AA 5B2ZA 3A0UA 3BD8A 4Q7JB 4Z49A 2XCOA 3BE6A 4R6XA 4ERNA 1AOXA 4EATA 2EFYA 3QU4A 1KJQA 2PPLA 4CM7A 5IANA 3NALA 5T4BA 3F8SA 3ILVA 2PUGA 3L0IB 1AKNA 3MILA 4NBWA 4LDRA 3SKYA 2GHIA 2X8JB 4B6RA 1FDUA 2WM8A 3IJPA 2UYHA 4MGZR 1Q83A 2GCEA 3L06A 3TW0A 1U1IA 1W36D 3KR2A 3P9CA 1ZCJA 1H0KA 4A23A 3CLHA 5KQRA 2Z04A 2SECE 2HMAA 4M9RA 3QV1A 1R8XA 1IC6A 4FVTA 4ICIA 4Y2JA 4AULA 4ETWA 5AD1A 2ZBEA 2IYRA 4IIJF 2Q4OA 2YV3A 2MSEB 4UNNA 1UEXC 1KYWA 2VTDA 3U19A 3WXMA 2VHXA 3T1TA 4IOKA 3I37X 4G0MA 5DNAA 1OXVA 2P0YA 1YJ8A 3HA7A 1QFZA 1CBUA 1DQRA 1NUAA 3ES9A 5T4HA 3S2UA 2D0DA 1QV9A 4FE7A 5CDUA 3QVXA 4JV5B 2P77A 2I4RA 2Q3JA 4TL9A 4U3JA 1GNLA 2R8PA 4CT5A 4QHSA 3LOPA 1Z0JA 4G0QA 4Y6SA 3DAPA 2WINI 4B7UA 1XZFA 4FOOA 4F06A 1B6GA 4LI0A 4B8YA 2HO5A 2V9ZA 4A1FA 5CDSA 3FCCA 1NUTA 4YUYA 4P80A 1KJ8A 3U40A 4XQ9A 2HJVA 2ZB3A 4GOXA 4IYRA 3OG9A 5K3EA 1XRMA 1HH4A 3PUKA 4WXEA 3D0KA 5E6RA 5BPHA 5HZHA 2RGRA 1ULHA 4EG1A 2X42A 5BWLA 2Y6VA 4N0QA 4XOUA 1A8HA 4KQGA 3WKAA 3T7TA 1E3QA 4U1RA 1IN4A 4P1ZA 4CU2A 4LZZA 4M36A 4LJ8A 1RS0A 5ICFA 5LFAA 4FLFA 1YI0A 4FT4A 4E5YA 1UM8A 1NYLA 3FCAA 2J31A 1T2FA 4G01B 3HL4A 1JXMA 3EWIA 1RWQA 4DLBA 3T3EA 1I94B 4EF5A 2NYVA 3DC7A 1B1AA 3M34A 3VPBA 1N0UA 5B64A 2VI5A 1XQ9A 4CIAA 3HLTA 5C4IA 3L93A 2PZMA 1RE1A 1W9MA 3P5SA 5TQ0A 1DKMA 4LZNA 2V55B 1EJBA 3FVWA 2G9NA 1HE2A 2JBWA 4KN5A 4AMUA 1QPBA 4NDNE 3U7JA 1P3JA 2J7PD 4EUKA 1S3GA 2BFFA 1KSGA 4CCWA 3KKOA 4N12A 3T7CA 2ZYGA 3KQYA 3HYTA 3LF2A 5JALA 3PEWA 5JSUA 4LV6A 4RZQA 4DVGA 6PFKA 2CYAA 4RVFA 3JQ7B 2O0LA 2DF8A 2F48A 1TK2A 1IXYA 4RYDA 5IVKA 4S1OA 5I5GA 2HLDA 3PXEA 1DFIA 3M2TA 4PQYA 3W2EA 2JAWA 2C94A 4P36A 3TDKA 5CEFA 2YX1A 4HF7A 5K01A 3FAKA 1QQTA 4R9NA 2JHGA 2RGAA 1FU4A 2HA7A 3HJAA 3K5WA 1NW5A 3OM0A 3OTQA 4US1R 1KEUA 1K4YA 2QMEA 2WE8A 1C7ZA 3EFOB 3GHYA 1FYDA 2XB8A 3QE3A 2ZQ5A 5EY5B 3JQBA 1SZDA 3GJTA 4BQEA 2JIBA 2A9OA 3GBPA 3S8MA 5FBZA 1IPFA 1EK1A 1G7SA 2GI4A 4X60A 3GGSA 4LWOA 2J87A 1GZSA 1XZHA 1NNEA 3WSVA 1QP7A 1FS5A 1L3CA 3M6UA 3VSAA 3QVVA 3V4LA 2JI7A 3FCOA 3NBMA 3KB6A 3W5HA 3QX3A 1SCJA 1VJRA 2CCJA 2GPTA 2NTEA 3LCVB 2MDTA 2CYCA 4Y7CA 2XCQA 4KIWA 4DEVA 1MH9A 2D3TA 2JLQA 2PMDA 2W4IA 1OBCA 1OH6A 1XA4A 3HDYA 3DKIA 5A4IS 1IZZA 4P8RA 5PNTA 2GCOA 4K9OA 3BE5A 3TG8A 3ZDFA 5CTAA 1T9BA 5FNVF 2GWRA 5TB5A 5ECDA 3ZBPA 2AXNA 1IUKA 2ICAA 2QMUA 3E05A 4KEAA 1QRSA 1IY8A 4OEHA 4Q3NA 2OHXA 1OC2A 3RAEC 4DLNA 5EIBD 5IF9A 1XDZA 3QEMA 4TMTA 5HEKA 4D4LA 2FZCA 1YAHA 3N6RA 3CE6A 4Q0MA 1K8XB 1UBEA 2YIDA 5SYNA 4E2FA 2OV1A 4A92A 1BMDA 1Y5RA 2C5GA 5LOVB 3QX7A 1CUBA 1K7YA 2NU6B 2PFKA 3EEBA 3QTLA 4LC1A 5H7XA 2ZJ6A 1W4LA 4KI7A 1CUIA 3U3OA 1J49A 1ZM7A 2JVIA 1TI7A 1VG9B 3ZVLA 4EVIA 1I7SB 4PBRA 2DFKB 3QEBZ 1Z0SA 3BPSA 4UMDA 3JAKB 2AX3A 1ADJA 3CLKA 1EUDB 1SU8A 3M6VA 4H1UA 1PWHA 4HAUA 3LBAA 4MW5A 3DBLA 4BNGA 5JCZA 3KM0A 3THXB 1V8ZA 1YB6A 4NFLA 5I6DA 3VR6A 4D3DA 5H59A 3OICA 2AXEA 5KYUB 1U0OC 2ACKA 3L7KA 4L22A 3B5EA 1HNZB 1CY8A 2QW8A 3IALA 1IHPA 4MR8B 5L3RA 4WBNA 2GM5A 3JR7A 2HJSA 3LPMA 3LJKA 4FNGA 3NAMA 1PFVA 4BWFB 2A4KA 4U7WA 3JVEA 1TIPA 3PCTA 3OTHA 2CZCA 1L7DA 4LDNA 2WG2A 2TMKA 3TQRA 4RY2A 3ZG6A 2E4WA 1R27A 4K8OA 3ZLJA 4OXIA 1BRMA 1E9CA 2ORED 3NU1A 3IKTA 1XL0A 4BS9A 2J5QA 1T8SA 4JOQA 2CNLA 4HN9A 6ADHA 3WIOA 2WOOA 1YS9A 2XRYA 3K9HA 4CL0A 4Y7DA 1E1RD 1BMFD 2FAXA 2EKDA 2O6HA 1E2QA 3UMSA 3W8EA 5IM4A 1CRPA 3SF8A 2XTZA 4F9GA 3R44A 4ZK6A 2FFBA 2AW3A 2HHLA 2NO5A 2C4NA 2CDBA 5K3DA 3GVPA 4CPDA 4F86A 5E9JA 2ZUBA 4MGEA 5JNRA 1UC5B 2M6SA 2XDQA 3RADC 3WJ7A 1Y63A 1ID1A 2QG9A 2DPYA 1XCJA 1P4HA 4EJSB 1SO8A 3PYMA 2GRAA 2P4SA 3AM4A 5D1HA 5BXYA 2L17A 4ZOLA 1M2NA 3E15A 1J9ZA 5JO0A 3QVOA 2ZDQA 3DF7A 1N8SA 1C4WA 1NI5A 1SJ9A 2QN2A 1VSUA 2WA2A 3WJ1A 2EKLA 4KFSA 4R5MA 1MA3A 1Q20A 3I39X 3IUMA 3SJZA 2IS1A 3P9SA 1LBIA 4CTNA 1ZN2A 3KK0A 3FKSD 1YB2A 4HEQA 2PKEA 1AH2A 4O4LF 2RH4A 4A82A 4PC2A 5ALVA 5BYAA 4RF5A 1JR3E 1NTRA 5JBNA 4CE6A 4O8ZA 1SVWA 3D6TB 2GKGA 3O26A 1ECJA 1ZXBA 2GEKA 3OEEA 4AF7A 4X1IB 1FEZA 1FTQA 4OHOA 4CM1A 1U63A 2GBFA 4GPBA 4F3TA 3HG7A 1QG0A 2WFLB 3KT8A 2JLXA 1XIVA 1N7HA 4GDFA 3LPDA 4GO1A 4ARZB 3KYDA 1JBQA 2FETA 1H0RA 2FDXA 1GQRA 1LVHA 2F8MA 2AKAB 1CERA 2IA5A 2REOA 1FNBA 5DMHA 3TR6A 4EBFA 2ZJ4A 2IXGA 1ORWA 2CHQA 3CLSC 1JA1A 3S27A 4DUGD 2J46A 1FBNA 4R2LA 3PGMA 3QVWA 4X97A 5JC8A 2PMBA 2CVPA 3SAJA 4CMAA 1DOAA 5BPFA 3HU2A 2GXUA 3M1LA 4BFWA 4BFUA 3H4TA 3L49A 1O94A 3DVAB 4NESA 3DXXA 2Q9UA 3UKOA 1HSZA 3EJ6A 4XDHA 1DL5A 2Z5VA 4DB4A 4BX8A 3DVQX 2B92A 4H6WA 2W11A 1LRLA 2B5OA 4JYPA 3SHWA 3LP6A 3OPXA 4FGLA 4C22A 3ETCA 3A10A 1R6BX 2WEKA 1JG3A 2BPOA 3LDUA 3TOCA 2VDJA 5H9WA 1AKYA 1CDDA 1RPJA 1M9NA 3MPUA 3PHHA 4R3UC 2JF0A 2B7BA 1X7HA 5H68A 1ZCZA 1ADCA 2JANA 5IW8A 1N75A 1TJ4A 4HY3A 4CTKA 5JH7B 1YDMA 1SVUA 4RA9B 5D84A 5MN5A 1PJ3A 2OLJA 4KV9A 1PTJC 2NUAB 4BMVA 3K0SA 4MDFA 1QH8B 3L1JA 3GDWA 3T95A 1G3RA 4RETA 1GPBA 3WFZA 4GYWA 2NMVA 5IZCC 1V7CA 4P4NA 1WUKS 2RI0A 1QHFA 4TRNA 5HZMA 3DLIA 1K27A 3OIGA 4GI2A 2AE2A 2ZSAA 3TEMA 5DOZA 1HTWA 2ZUUA 1PF7E 4IMPA 5CAEB 1Z29A 4MI1A 3OZRA 5DGIA 2W93A 3LU1A 3R2JA 3ZUGA 4EAQA 4Z9YA 3ZWPA 3EE6A 5DM70 3SZLA 3U09A 4F96A 5MF6A 3NBFA 2HU8A 5B1IA 3DPUA 4PXYA 2R66A 3GFGA 4OB6A 1E6CA 5FAXA 3TRDA 4BMOB 5JXIA 2HT6A 3NDBB 2GCNA 2WT8A 4ITRC 1ZM9A 2WQ7A 1EWQA 3VU0A 1XVUA 4KPYA 2HK8A 4D0LB 3RFFA 5C5IA 2AS0A 1XEFA 2Y4OA 2XTAA 3ZE9A 1BD3A 5JEEA 3O2QB 3WOHA 2BMFA 2X9LA 3R5TA 1WPRA 2W2XA 1R6XA 1T4GA 3BFJA 3K4PA 5DI3A 4O02B 4V1CA 5KNDA 2DERA 1U90A 1Q21A 1CE8A 2VEOA 4MUYA 1HEIA 3SZUA 4BUCA 3UMRA 2ABWA 4LOKA 3OZ7A 1C7QA 1RAFA 2ZAMA 3TE6A 2QNBA 2GK6A 4DLTA 2WIJA 3NHLA 4Q7KA 1RLMA 4IDBA 1OREA 1MORA 4N0PA 3TR0A 3TZKA 1QANA 2GHRA 1TO6A 1Z7EA 5BY2A 2RGNA 2QVGA 3M6WA 1YR3A 4OP3A 3PC8C 2AKEA 2CF6A 3FTFA 2BCJQ 2OBBA 1G42A 2BHLA 2ONCA 3D3QA 4D0RA 3WWYA 2EL7A 3RBAA 5IKEA 3EOBI 3BKXA 1GV0A 1FXSA 5CU7A 5IT0A 5KB3A 4B0PA 4COKA 4UAJA 4EG6A 4ILKA 1BVYF 4YBRA 4G67A 3OLXA 3MRSA 2PR2A 3HS3A 4LAFA 5JTUA 3L79A 3WWZA 4C3OB 4EARA 5HX7A 5IFLA 2G5CA 1L9KA 1KR2A 1UWCA 1CZNA 3SI7A 3T7KA 4JLOA 3GLQA 4E1VA 4HSGA 4JOCA 1U31A 3V1NA 4LFBB 2H2HA 3WZLA 1SUCA 1DXOA 4QXRA 1V4NA 1Q92A 4TS9A 4HAIA 1TT5B 3IVRA 2R00A 4NDZA 5ALJA 4R8RA 1DG9A 3VH2A 1QGOA 2ZSFA 4U7PB 3KX2A 1AS3A 1SBYA 1VIAA 3R40A 3AFHA 3LSTA 5D87A 3ZLVA 1QO0D 3W8FA 1PK8A 3W9UA 2OFXA 3OZGA 4J6EA 1AA6A 4FBLA 4H27A 4DWJA 1I51A 3H1PA 3BJRA 3KPYA 1N25A 4BC1A 3J80A 4OUDA 1TKBA 4BU0A 4CWAA 4HVCA 3JVDA 1YNOA 3GQBB 4E2YA 4AO8A 1HV8A 3CLTD 3PPXA 1XQVA 5IC6A 1JZQA 4F4FA 5GTDA 5LMNB 2ZXEA 2PV7A 5FULA 3KDAA 2IYVA 5LKRA 1L8OA 2VYCA 1M6VA 3HKCA 1NOJA 1AHNA 1C81A 2NYUA 3N0WA 4LHVA 3GJ0A 3L07A 1QU2A 3EOZA 1QP8A 1WQ4A 5JRDS 2W6JD 4AD8A 1XV5A 2CSUA 1X15A 3CN7A 3WGNA 1E92A 1X8JA 1ZESA 2C2ZA 3ZWMA 2YIMA 1P1KA 5T64A 4CDNA 1OYVA 4QUIA 4F9TA 2IOHA 3GROA 1F7UA 4E31A 4RJLA 1E6EA 4TYWA 2ZJ5A 2VHWA 3GUVA 4ESVA 2WAMA 1NG1A 3PFGA 4MW9A 4NCIA 3VTFA 4D6XA 4BV8A 1M7HA 3JW8A 1L6RA 4TSKA 4EYSA 4YAWA 1FUUA 1UAAA 2BFBA 4IGIA 5I4CA 1IUPA 3NHUA 3PI7A 3VSDA 1NMZA 3SR0A 1XL1A 1NVVQ 4OQXA 7MHTA 3ZVRA 2K7ZA 4YWJA 2K7FA 3K70D 1U0JA 3D3KA 4HDSA 3I34X 1M5RA 3BRWD 1R9JA 3FOCA 4MIKA 1B14A 1KXZA 2JVJA 4GU5A 4FFPA 4WAUA 2VWPA 1VLVA 1ZZEA 1TKCA 3OFJA 3PWKA 1G8FA 2GEVA 1HRKA 3V8RA 4B4VA 4KXQA 1SB9A 1ZOSA 4KWTA 3SCZA 5JJBA 2ANBA 1JKXA 1P91A 4OBBA 1CY6A 3QG1A 1IN7A 2JAHA 2RHGB 1OFUA 2GBIA 3EWSA 1KQ3A 3FHOA 5HKLA 5AM5A 1DGQA 3OWXA 4TOIA 3NWBA 1GILA 2G72A 1AUQA 5JSYA 1Y6GA 3SPXA 2QE7D 1Z36A 4NLLA 2RKOA 4ENQA 1N6NA 1NI4A 4BNFA 1Y34E 1TW2A 2ZBVA 1MT0A 4KQWA 3SS8A 2C8JA 1B8NA 3ZHRA 3BQ9A 3LSYA 2Q6TA 1UOOA 2R11A 4MV0A 2HSJA 5EGNA 4CU5A 1VPLA 2I2CA 3JQ9A 4OLHA 1BTOA 1CRZA 1E1QD 5AW9A 4E88A 1CF9A 3CZ5A 4EX7A 2UVPB 1ZD4A 3N2YA 4NYMR 2ACWA 1O1YA 1YONA 2C4TA 3FN4A 3RFCA 3ZBQA 5GZ3A 1HXHA 5E4YA 3ONDA 5J59A 4NBTA 4TT8A 4KG7A 5JIBA 4PFQA 2CL5A 4P0PB 2WPDD 2NAFA 3L7BA 2E6KA 1YDEA 1E2EA 4BX9A 1QHYA 1Z6XA 1U9IC 3F4KA 4A73A 2IV2X 2P1RA 4Y6QA 4AS3A 3TQIA 5FOXA 3FIJA 1AGNA 2CVOA 3ROGA 2FE1A 3ACBA 4G5YA 1JT9A 2XBMA 1RWWA 1UK6A 2E5WA 1ZBQA 4G25A 2JFNA 3ZK8A 1RTKA 4D3XA 1OFVA 3T5DA 4N6GA 3IP9A 4X24A 3L6CA 4F8EA 1OT3A 3LTNC 1Q84A 4U00A 4B8ZA 4F1JA 2Q7XA 4DSTA 1IVSA 3O74A 1B76A 3N0TA 3ZTYA 4D9IA 1AIPA 2EZ8A 3GLUA 4X5OA 3KSBC 5CFQA 1AKMA 1EUYA 1BXGA 1ZKDA 2VBIA 1OFTA 4HQ0A 1LNZA 2NAPA 1OTXA 1T6NA 3INGA 1SKUA 1TQ6A 1UXOA 2R84A 1GKUB 4RU1A 1RZRA 3N70A 1P0QA 3EZ9A 4K6KA 1W85A 1UMDA 4FWTA 3PVSA 1SBHA 3UAYA 1JR3D 1NX6A 1Z38A 1GCIA 2WKSA 2I76A 3IIJA 1EJ2A 4H15A 3DZ8A 4LJ4A 2LD4A 2BFOA 2R96A 2Y05A 3AK4A 4EFLA 1SKYB 1AQIA 4FEYA 1R6UA 1R8YA 4GBGA 4UDYX 3VHLB 5HBRA 1A7JA 1V3VA 1NVWQ 2BGTA 2YHUA 4NBSA 3NANA 4B4KA 4QOSA 1CUYA 1T8RA 3ETHA 1PO7A 3KXLA 1R7RA 2ZAIA 1KIMA 4LDZA 4NJOA 1Q57A 4ESHA 2NTJA 3N2EA 3WQBA 3L43A 3WKDA 4Y1EA 2XAUA 3GA0A 3VDQA 5K8JB 4AG6A 1WE2A 4TSRA 3AHCA 4I5IA 3JYPA 3OH8A 3ZHOA 2ZYIA 1L7VC 1QVWA 3ON5A 3GRCA 1Z07A 2QT0A 3TZQA 1V45E 2AKYA 2R2GA 2QOEA 3MQFA 2HT1A 1Z18A 4AJOA 2QZSA 2WFMA 1X8LA 5BSWA 4FZVA 1WXFA 2CBGA 3HU5A 3PFIA 2X0RA 1DUSA 4DR3B 3L3BA 1W87A 3KJZA 4BX2A 4BNDA 4KAXA 3OEYA 3N76A 3OLYA 521PA 2F8SA 2YBEA 4KVGA 1QTIA 4EVQA 4QGFA 4LEIA 3UHOA 1EXWA 5HJ2A 4D8UA 4WFKA 5FUWA 3C48A 4LA4A 4Y9UA 4TKLA 2DY1A 3NBUA 4YV0A 2E1PA 1L8LA 3PKZA 4RKYA 2OXCA 2C84A 2VZ0A 2N1MA 2J6BA 5AT1A 1SKYE 4Q7EA 3I8SA 4AJ2A 2W8BB 1WF3A 2DM6A 3IB3A 1P75A 3MVEA 4KACA 1M5UA 5BN3A 2V1UA 1FB5A 4HR7A 1APBA 2HJHA 4R8KA 2J3QA 1J8DA 1P44A 3TMYA 4HVTA 4DR7B 5KDDA 3S4YA 3DAYA 3VR3A 2X9GA 3TJMA 4A6EA 5FUVA 3H3XA 4WECA 4MEBA 3NW9A 1I4OA 2GCGA 3IR6A 5ALSA 3RC3A 5B6IA 2W0SA 1F14A 3AILA 1H2FA 4Q19A 2BRUA 5FI3A 5IN4A 4GR4A 1K8QA 4ND7A 4NZZA 4B2PA 2CN1A 1X1EA 2V7XA 4KMRA 4UZFA 4C89A 2F67A 1ZFNA 3OPVA 2O8CB 3NNSA 3H1FA 3DFUA 4IQFA 4TWIA 5KAPA 2IYPA 3SFVA 3I6MA 3QEMB 4LYYA 4N7JA 2DBVO 2X4DA 4RA6B 1XG5A 1CZRA 1QNLA 1W59A 3RVSA 4KDCA 1F4PA 2WSBA 5I51A 4GKVA 1I5OA 5HK8A 5LP6B 4U2KA 2FWBA 2YIVX 5A5DA 2XGJA 1QHIA 2G3YA 1E9VA 3TF5A 4IRXA 3VU8A 2AHRA 4KXWA 3LLVA 3GMDA 5H82A 3DKVA 3H9QA 5BUSA 2QM8A 1JQBA 2OBXA 1AS2A 2NZXA 3AHGA 3I6ZA 4Q3AA 1Z8FA 4P7GA 5EJ6A 2Y1LA 3C3KA 2EERA 4XWOA 3BG5A 4HNQA 4RPGA 2ZUTA 3RR2A 3V97A 2H2FA 3OD5A 3NH9A 2HA4A 4OXXA 3AG5A 5K4GA 1WCIA 1H65A 2YJ4A 4Q5IA 3OLZA 1XNQB 1DVRA 4PFKA 4BQRA 1TMKA 3OI7A 2P2NA 4WBSA 4BFXA 5LOVF 1G3UA 4A15A 1HT3A 2V4MA 2ZRPA 1ID8A 2JATA 1ONSA 4E09A 2J5BA 4RGBA 4C4XA 4DLKA 3T1NA 3PQ8A 3O4JA 1JEDA 4Q82A 3ZBTA 5AKEA 1QK3A 5FXMA 2XKJE 2RGCA 4JDUA 5NLLA 1MC4A 2Y2VA 1TL7C 1C8BA 3N1UA 5CM2Z 4AZ3A 4EPVA 3K3PA 4ND8A 3SF8B 3CYFA 1CJMA 3CX8A 5ARBA 4CEIB 2P40A 3EVEA 3SE0A 4BGIA 1RI3A 4QM7A 1SUEA 2YYZA 3PQ3A 3AI7A 2W48A 2XDQB 1DO0A 3BMOB 1OC4A 1RM4A 2A9KA 2AK2A 2VAPA 4L7QA 4LVCA 4OIFA 2BWJA 3I9OA 1F7VA 4AY5A 1Y5NA 1K6IA 3WDLA 1TT7A 4QBIA 4C0AC 1U5AA 4FFRA 1B41A 4Q24A 3STYA 2MSKA 3FWZA 5FTJA 1TTPB 3P9ZA 4EY7A 4LJKA 3CZPA 2E2WA 2ZE5A 4CODB 1L5WA 2GS9A 3HEAA 4K9QA 4N5HX 3RGWS 5EJ7A 1HFJA 5KYYA 4UTPA 2QGNA 4INAA 3TGPA 2QN7A 3WGZA 5CG2A 3EQ9A 4DRXA 1GGHA 2EJVA 4QYIA 1F4LA 1UBHS 3U81A 4EPTA 2VVTA 4KPFC 4YP5A 2JHAA 3TQHA 1CPYA 1PJ2A 4MVJA 2C2BA 4AZTA 2C0QA 3MS7A 1LI5A 1HQKA 1Z83A 4F9EA 4L8WB 1UK7A 2H0QA 2V7TA 3GRPA 1UDRA 3NOQA 5EE5B 1DIOB 2MT9A 4Q01A 2IEIA 3B1JA 2CDNA 2FJUA 3AR8A 2EAUA 2PGJA 3AZPA 4HDMA 4RKQA 1VM6A 3LC2O 3ZW8A 4R9UC 5LLDA 1K3FA 4EI2A 1WHTA 3M82A 4K3UA 1RACA 4DSOA 1PX0A 1R5OA 1ISSA 5DN6D 5DTEA 1NN3A 2IYLD 4HQLA 4X1YB 3PUHA 1OXMA 1KDRA 3QWIA 4DLLA 5I3ZA 2HJGA 5CA0A 4BNNA 1VL0A 3HUFA 5FTNA 1QV7A 2Z83A 5A9RA 2AEMA 1O96A 3NTUA 3O1IC 4J0DA 5JEDA 4B45A 1A2QA 4G86A 4I4CA 2IIBA 3BIXA 3KR0A 4R2MA 4UDOA 1GSOA 4BIIA 4CLXA 5A1TA 4E13A 3BOSA 3VOSA 4INZA 1M2KA 3THWA 2TYSB 1N7GA 2QLFA 1I4TD 1N2IA 3FTPA 5FB3A 2Z5GA 4UKDA 2FVYA 1C7IA 1CQWA 1KRHA 3L7MA 4XKJA 4XUCA 3BWYA 2WWYA 3DWFA 3MUNA 3FHCB 1T6ZA 1BYUA 4M0MA 4P86A 1QQAA 3B2NA 3EOAI 2FZ4A 1ZMXA 3GFQA 2ZCVA 2XDYA 4DWVA 1S8NA 2V3WA 5M3BA 3Q8KA 3GLHB 4MKXA 4GNKA 3EB9A 4IH4A 2NPIA 2AYYA 4F2DA 4IDQA 3LTEA 4PSVA 5K8TA 4BKRA 1T2AA 4OAOA 3Q72A 1YMUA 1UR5A 1TM7E 4G1CA 4Q4AA 4RL6A 3JQ8B 1AB6A 2EBHX 4PANA 2VT6A 1M7BA 5ICCA 1BE8A 3FPBA 4MPPA 4RDXA 1U0TA 1JL3A 5EI5A 4PCUA 1GZ3A 1M54A 4O4IA 2ILTA 5K0FA 3EQ2A 2HK9A 4KQKA 4XEHA 5JBQA 3QLJA 5BV0A 3VNVA 2JKYA 1X0VA 4W63A 1M8PA 1MD9A 3KPJA 3MCZA 3C1AA 3GVXA 4HWTA 3ULKA 3RSCA 1TVCA 1ZIOA 4OHMA 1KERA 2DHRA 3TZEA 1L7MA 2G06A 1S3FA 2G0TA 1DBPA 4W9NC 5ERXA 4BNZA 1M66A 4IQGA 1YB7A 5FL7D 1BCRA 1TK3A 5ICMA 4CM9D 4NY1A 3I42A 1E61A 1IBRA 3I9KA 3IELA 2XD4A 5JH7F 5E3JA 5CDGA 2AMFA 3TXXA 4JT9A 1V7PC 4TVSA 5T67A 4MKHA 1Y4DE 1OX4A 3NGMA 3KPWA 4J1TC 4MIEA 4JI1B 3ERCA 3MSXA 4A8TA 5IT9A 1XDUA 1ZRNA 2NXWA 1EK2A 2VT3A 5MDHA 4Q39A 3RH0A 3E4DA 1CE8B 3AR6A 5KTNA 3WLQA 2ZSKA 3KQOA 1YCFA 5DT2A 4NHEA 3T1HB 5KU7A 3KB2A 2H48A 5K3AA 3FRHA 2QX7A 2WIBA 2B1QA 3SF0A 2OHHA 3EXIA 1G3MA 3NB0A 5SV2A 2R4QA 2XZPA 4DIUA 4PGAA 1U2DC 1JQKA 2VHJA 3G2LA 1MQAA 2JGEA 1CK4A 5M29A 5LZ7A 2B4KA 4KMMA 4QJ4A 2G09A 5ALKA 1UPTA 2BGIA 4FFSA 4H4CA 4ZOCA 2B83A 4RLSA 5L3QA 4CEHB 3K9LA 2HCBA 2OCGA 5IBPA 2G80A 1FNNA 5ESWA 5LLTA 2AW5A 3IRVA 3ONEA 3TTWA 3QEAZ 4UM9D 4EPRA 3FWYA 4JHLA 1Z0DA 2KSQA 3H84A 2GASA 4FFVA 5AM3A 1FMLA 1W0KD 3R75A 4OK5A 4D26A 1Z74A 3NC1C 3D4PA 3JVVA 3MPOA 5EPEA 2R1ZA 1N6RA 3T3OA 3L6BA 2AOXA 1FLVA 4K88A 3VPCA 3GEIA 2WD9A 3CR8A 1GLGA 3ZWVA 3QUAA 4YJHB 1DTWA 2GEFA 5FTWA 4L6IA 3I45A 1OWMA 1E7RA 1L5HB 5ALRA 2BZ1A 3ABIA 1HL3A 3QLVC 1NXTA 3G6WA 3KAQA 3UK0A 4Q7LA 1ELOA 5AM0A 4ZMRA 1BIFA 1IFXA 4AECA 5KTKA 1SC1A 5HGJA 1EFTA 4N65A 1PFUA 3PFBA 3P7MA 3LQRA 3WYBA 4D0NA 1KAHA 2VNHA 1BX3A 5AW8A 1O0SA 1RRPA 5B3JC 4ARVA 1ETHA 1MX5A 3CRZA 2YWCA 3ZWBA 3WSWA 3I6BA 5GGYA 5FTLA 1XMOB 4JCOA 3KUUA 4BQSA 1V8FA 4JLSA 2VF7A 1I5RA 4TUYA 4REMA 4ZAFA 5LKAA 16PKA 4OUDB 2I4NA 3LXMA 4LJ6A 1G66A 1UKCA 3OEHA 4RPIA 3VU1A 1ZHOA 4RVDA 4W5RA 1Z6PA 3DOUA 1IHOA 4CIDA 4NBRA 4YECA 3DOHA 4DJAA 7MDHA 3F1LA 5T57A 1GQQA 1E89A 1JDBB 3OPNA 5C5DA 3TMKA 3K05A 1M6VB 2ACEA 3LBFA 1H2ZA 1E3DA 3DCYA 4ND3A 4PX3A 2GK4A 2WYUA 2OCYC 1QIKA 3A9VA 4L51A 2Y1OA 3RFUA 4BBJA 2Y1DA 3EVCA 2FPXA 2RI1A 2Z4TA 1E59A 1SD1A 3CZQA 1XZLA 3RE1A 2A9VA 2H1SA 1LTHR 3DWEX 1RI4A 4HWGA 1JDTA 3MGKA 5EKXA 3VGJA 5F98A 2QPAA 2WILA 3FVQA 4QEZA 3C4VA 2YZKA 2O3JA 3MIIA 3WWEA 4BP8A 2YWXA 1MJGM 1XTQA 4ZOBA 3WGIA 2XF8A 4GBJA 1CD5A 3K7EA 4E33A 2G88A 1ONBA 3HXQA 2IS2A 5AVXA 1WZEA 2FKNA 3EZXA 3UB4A 1XTPA 2C4WA 2Q62A 3MWLA 3RF6A 3NT4A 3ZGVA 4CUZA 4BFVA 1U7WA 2XYHA 4U0JA 1NKSA 3GA5A 4YR7A 5DP2A 1K6XA 2BGJA 3KUKA 5K8UA 1HZZA 4ZKDA 3CPSA 3ZOKA 4ZC1A 1UXGA 1MQ9A 3ZDRA 3NVDA 3TGLA 1P9NA 1SCDA 1TGYA 2C8VA 2QGFA 1Z33A 4WWHA 4BPBA 1XT6A 1A8PA 3KEQA 2H4XA 5K7SA 2WAXA 2CZQA 4HFRA 3OLWA 3KTAA 4CN8A 1X2EA 3H18A 3WIBA 3QQPA 3T15A 3LUHA 1L4MA 1M1YA 1RZ3A 4TMKA 2QRVA 2J30A 4CR8A 1Q1ZA 1PWZA 3FYTA 4YFYA 5L6MB 1NI4B 1OBVA 4CTJA 2ZXFA 1MB3A 3EXHA 1QGYA 3AB7A 3UGJA 3RAGA 3ZX5A 2C57A 4JYMA 1W9HA 1KTIA 5T8KA 4B3GA 2J0UA 4DQDA 1C9NA 2OCKA 4RTRA 3LUAA 1QQBA 2CNKA 2XNHA 1TU0A 2PVCA 3EUEA 3K6JA 3RPEA 1LJLA 4BYGA 2HCFA 4DMCA 2HF2A 4ZXFA 1SPBS 2MYUA 1NF3A 3BGIA 3BWVA 4XXHA 2CK3A 5D01A 3FUXA 1E7SA 1E5TA 1PS0A 1M2FA 1GO2A 2EJCA 5BSTA 3VC2A 1TA4A 3TSCA 4K8RB 4JLUA 3HUTA 1ZS9A 3OCCA 1RRCA 5TQVA 1NR7A 1N5RA 1W1WA 3NEYA 1ZVQA 1T43A 1XPUA 1ZONA 1EPUA 1KAEA 2OZEA 4TS3A 2C7QA 3MWGA 2EFEB 1VRVA 1IEVA 1G6Q1 2JGLA 4NARA 4BMXA 5BV7A 5CD9A 1CJSA 4A8JC 3N8NA 2RHCA 3VR6D 4IF6A 1OIXA 1BGVA 2FP4B 1C30A 3ZCRA 4K0KB 2HPZA 3IMKA 1ZJWA 2WWGA 1TTQB 1KFEB 2A9PA 1BEZA 4LX8A 4AS1A 2FKAA 2FR8C 2YL2A 5I7FA 5FPSA 3JSXA 3MLEA 2OC9A 2I66A 2W43A 4MP6A 3BCUA 1NUQA 3SGLA 1TLFA 1BXGB 4YMGA 5B57C 3U3XA 5JXJA 4TPKA 4Z4EA 1DDIA 5CUQA 4W82A 4DCTA 2PEZA 3I28A 5H70A 1K68A 3KWFA 2QAGC 1RHMA 4DMMA 3A9TA 2BFEB 1IM2A 3PUZA 3TCXB 1W85B 1UMDB 4NK5A 2PGLA 3CNBA 5I7WA 3TGWA 4AQYB 2HFJA 3A6DA 3QVGB 3ID6C 1C4XA 3EBPA 1VMKA 2I9KA 3EYAA 4EHIA 5HA5A 3LBNA 4WQMA 4BJHB 3EVAA 3KOMA 2PLRA 1RXSA 4L5CA 5A9SA 2DETA 5ALXA 4B1FA 5HP4A 2NT4A 5D00A 2GSWA 4CGZA 4QOJA 3EFEA 1DJNA 4FN5A 1Y42X 4BMPB 1PVOA 4N8SA 1NQXA 4QJ5A 4R4JA 4AUEA 2YJ5A 3VR6H 3UWOA 1G4UR 2WTAA 2XE4A 3H6HA 1N1MA 3C5HA 1JVNA 1WEHA 3CCCA 3FNEA 3Q12A 4H4DA 3WGUA 5KHAA 2ALJA 4C4ZA 5F7OA 4DV6B 1SEPA 1N34B 1X0XA 3RVOA 3CLUC 2IU0A 3UMVA 1VBNA 2H2GA 2NVBA 2PUWA 4WE3A 1KDZA 3VKGA 3AU9A 1LQTA 1OA1A 4YAJA 4M0DA 3WMFA 1PZGA 4CJXA 5IN5A 3G8DA 3WLAA 4FD2A 2CLIB 1I5EA 3KV3O 3TW8A 1IMOA 2YHIB 5D86A 4ZANA 2V6IA 4XDGA 1Y7TA 3WNCA 1T9KA 1H6CA 1L8QA 1VJ5A 3KJQA 4FMBB 5G0UA 1N57A 1C2TA 1ZRHA 3NTRA 1MJ5A 2AJBA 1KR5A 4TSFD 4XSHA 1ENZA 1TIKA 2HLNA 1W5FA 3IAAA 1MOSA 2L42A 3M3PA 1UXIA 3WP0A 4BRWA 1YZHA 1DPGA 4IINA 4JBYA 1U7OA 4TZKA 3DVSX 3OEED 1O8CA 2NNWB 3N28A 1ODFA 4QGBA 2DQ4A 2KS6A 1SQ6A 1U02A 4HDQB 5COBA 2IU4A 3TLBA 4W5NA 4CV0A 3QHAA 5BN3B 5J58A 3SLRA 4IZOA 3SMQA 3UHJA 3K0CC 3C3AA 2O8EA 2Q7DA 1WDWB 3W78A 1TZBA 1C29B 4LSMA 3UPUA 4P3PA 3NAZA 3UF0A 2B25A 4F1WA 4YV1A 2J41A 2DKFA 3TL3A 1YQTA 1GGFA 3HDQA 2RHTA 3GJZA 4I66A 4YEDA 1DWPA 1YDWA 3ZD8A 2M32A 2HWWA 1X1CA 1WW8A 4ENTA 1GXSB 4P98A 4RPJA 1AQUA 2YOFA 5BQXA 1MEEA 1L5FA 3HB7A 2W2LD 2J0VA 1B15A 4HTAA 4ZT7A 5C1OA 2X19A 4HZIA 4EG8A 4P5DA 4U7GA 4IUYA 3W1VA 3RG8A 3HP4A 5EHXA 1ULTA 3P5BA 3A6EA 3ANYB 2TMGA 4NU6A 1N9ZA 2AQ8A 4RY8A 4U2GA 2UYCA 1NV8A 1RIIA 3FCEA 3PIDA 4DV2B 2NO4A 4BJ1A 3AVPA 1R10A 4WCFC 3TRKA 3SVLA 4PHFA 2C99A 2VWHA 3OTIA 1J9GA 4P7JA 2PSDA 4UHJA 4RTSA 1Z6YA 2QUAA 1KSJA 2GZAA 4OP2A 3M4JA 4V0LA 5J1SB 5I3CA 3M4YA 5IAOA 3IIIA 1ZGGA 1X7XA 2HGSA 3GBVA 3HVKA 4KK4A 2YCBA 3MAJA 3TJZA 4BNMA 6AT1A 1USVA 2R7LA 3ZD9A 4N18A 1DAMA 1EA5A 1QTRA 2EATA 4TROA 1A9ZA 3H8WA 4GT1A 2A5YB 4AKSA 4TT3A 4NP6A 3V8PA 3UJBA 5JYCA 3NV9A 3OFND 4G26A 2R1UA 3H86A 3IAFA 1GYQA 1OB5A 2B3TA 1F3LA 1T2DA 4GLLA 2KBEA 4NRDA 3E2PA 4E4RA 5C1DA 1G21A 3IURA 5HKBA 2FRXA 2OD9A 4Q3KA 2D2EA 1JWAB 2KMLA 5I01A 3RVRA 3ZY6A 3ZCVA 5C8DA 1RWVA 1T0HB 3N07A 4L4XA 1F1JA 5LP6F 3VJRA 1FJHA 2HYIC 4IF4A 4EHKA 3UOWA 4CKEA 2GJ8A 1XLTC 2FMUA 1BKSB 1QQ5A 3FDFA 3AF1A 5SZIA 2V5VA 4BLSA 1H4SA 3OT4A 4MKFA 1L4YA 1PZEA 4JL8A 1PNQA 4RTNA 4J1NA 3WYNA 2VK1A 1TTHA 4ND8B 4ZVSA 1TLTA 1V8DA 1ZW1A 3KNZA 2ID7A 4H18A 4KH1A 5ALPA 4EG4A 4ZJUA 2EP7A 3E9ZA 5CLGA 2IZOA 1O6FA 2QV7A 1FX0A 1OGJA 2PRIA 5L40A 2JJ1D 4CDMA 1O2DA 3ZXIA 2QUJA 2GN1A 3GDGA 4MCJA 4NMHA 4QULA 1WIWA 1Z0KA 2I0FA 3GXBA 2WD7B 3OIVA 3TVDA 2BF4A 3QX8A 4UU8A 3OZFA 4Q9JA 4V2IA 3HPRA 5F7JA 3ZV6A 1PSZA 1JEAA 5F1OA 4LOAA 4LDQA 3SVTA 4JQYA 2PM8A 1OWOA 4EGJA 2GSDA 2WZQA 4LXTA 1B3RA 3TN7A 1D4FA 1VJDA 2G71A 3F6CA 3C1UA 4GMGA 1SULA 4DRXB 4Q4LA 2SCUA 4QYIB 2H5LA 4KOAA 3ZJ5A 2GOYA 1FMCA 4D92A 1N5DA 3ZZTA 3VAAA 4L4RA 5EZYA 1NUUA 3G9ZA 4RZUA 1P6QA 3DWGA 5B6PA 2I29A 1E2DA 4ZTZB 4IGFA 3EDQA 1XQ6A 4II3A 5FBVB 3RV3A 5ITSA 2QTTA 4H1VA 3BCSA 2CT8A 2AG5A 2WTEA 3GRAA 1GL6A 4CM8A 1WHTB 4D9GA 1KH2A 3G2OA 2QX6A 4I4TB 4LHXA 3S99A 1O58A 4ZZ2A 2X9VA 1ABFA 2P2YA 2OECA 2OXTA 4YRMA 4HAXA 3H2SA 1ZR4A 3MJSA 4HEA1 4WD3A 2HAEA 1R0YA 3A1NA 3I83A 2JGRA 1DBWA 4PGGA 3R7WB 4WGFA 1J07A 3FLAA 4YC7A 1O96B 4ZDWA 4Z7QB 1J0CA 1LJUA 1XD8A 3QBTA 5HHTA 4C4SA 1X7GA 4R81A 3NETA 3EISA 1JH9A 3I53A 4CVNA 1D7AA 4R7TA 2PD3A 1P9WA 4BO1A 1DJLA 4KQFA 1HEYA 2JASA 2C82A 3IUQA 3MTBA 4YQYA 4MVJE 3TLXA 3DBIA 3GZNB 2PL5A 2VQ6A 1HQYE 4ZEOA 3RC1A 3B60A 3ELYA 5PGMA 3UICA 3AUKA 2DJ5A 4FOTA 2QL9A 4GWGA 4RM2A 3LQ1A 1Z5PA 3LAWA 4DIEA 4GI5A 1ZU4A 4QSMA 4KIFA 1L4LA 2VDUE 4NMXB 3O0DA 1OZGA 3K4QA 1YGPA 3G02A 3VKWA 5EGSA 3WX0A 5E6SB 3ZUPA 3SQOA 2AXQA 2X8BA 2ZIZA 3W5UA 1NWHA 2F9FA 3A2LA 3I72A 5TMEA 1NF2A 3D5QA 1W2GA 2A1TR 5J4HA 1H6DA 3EG9B 2G36A 5C8YB 4ALMA 3W7VA 3DM5A 2PNJA 3DEKA 3K5IA 3BERA 4MUIA 4CNQA 4ZREA 2OGZA 1U0FA 1U99A 5KVCA 2DP4E 3WO1A 3ZU5A 4LRQA 4HGRA 4FYYA 1KVSA 3ODGA 4DREA 3W5SA 5JD5A 1D0VA 1RYYA 1HYEA 1ZVJA 4RD2A 1IZ7A 4K28A 5KNLA 4YMIA 2JI6A 2OV2A 1XVVA 4RDHA 2BT4A 1BCRB 4CQLA 3KSAC 2UZAA 4Q93A 1II9A 2BHTA 3HCFA 5K0NA 2IUFA 3Q8LA 1EWKA 2RHRA 3M1IA 3R3WA 5ERYA 2G8LA 4HH3C 3PKJA 4IY1A 4KO2S 4FHZA 3RVBA 3ZY2A 4FYIA 5BWCA 1U0EA 4U7HA 3HUEA 4CLOA 1VE1A 4I99A 2ZU6A 5MGBA 2UKDA 2HSEA 4ZVMA 1GT6A 4M2LA 1LD3A 2ON6A 1E1MA 4DJEC 4BAUA 4NCJA 1ZA2A 4NC9A 5CHYA 1DUIA 1L1RA 3BCHA 3DPIA 2NV6A 4OQYA 2IP1A 4DBLC 1PTKA 2QP3A 2WJZB 3EEFA 3RJZA 3I2GA 4LJ5A 4BJ3A 2P9QA 1RRVA 2QMYA 4KAFA 5IZ4A 2YWGA 4ZTBA 1GPWB 2FW1A 4AZWA 4IAOA 5GM2A 1H9AA 3LQ4A 4EB6A 5L3QB 1G5HA 4D5EA 1OTHA 4MRVA 1V35A 2QS9A 2YVLA 4CIVA 1K5DA 1BNCA 1G8HA 1UMCA 2FK8A 2CUNA 3E48A 3OIUA 4DEXA 4UAGA 2E5FA 2JNWA 4HATA 2QI9C 4AMBA 2OV3A 1VA5A 2HPHA 1Q5PA 3UT6A 2RARA 1BH6A 1X8XA 4DFDA 1D2RA 5GONA 2GYYA 1Y5IA 2FN9A 4B75A 4S04A 3ANTA 3TB6A 1T5TA 3U31A 3M7IA 3Q3EA 3H2ZA 5ERGB 3B36A 1ZNYA 5AOVA 1DTWB 1QDEA 3NJRA 3RASA 1OH5A 4H77A 4WJZA 4UFNA 1IZ9A 1SZCA 1LTQA 2FLVA 3LA8A 4N3AA 4P53A 3GRUA 1PGOA 5EIXA 1R0SA 2RBEA 4H3VA 4RSHA 3RYIA 1RBZA 4FEAA 1SA0B 2EV9A 2CKDA 3FYUC 4CQMB 4M55A 1WMSA 4MA5A 3TNDA 5EHGA 4BC0A 2EDAA 2O05A 2V58A 1G20A 5TNXA 1BXZA 1ZICA 2GBLA 4E1BA 5CIYA 4TLDA 5AVTA 5KYGA 2R5NA 3GF4A 4MGIR 4Y6RA 3Q4GA 4RD1A 2J0QA 2A9FA 3RK0A 1Y6FA 4JEUA 3P0FA 1KU0A 3R3XA 2I7DA 2ARKA 1JR2A 1CIJA 4BLTA 3OE1A 3I9JA 5LQAA 1JA0A 1NA5A 2WIGA 3HI6A 2FPOA 3NHPA 3DMPA 5ILQA 4C14A 1TUBA 3ZDCA 2VDMB 1OD6A 3ZY5A 3RSLA 2WJ6A 3GH3A 4FX2A 1ESEA 4EVSA 3E9YA 1V11B 3E35A 3BHIA 3RW9A 3ZGZA 3G1TA 1KQFA 3RC7A 2Q3EA 3NNDA 4RE6A 4GKBA 1TYAE 5F77A 5HZGA 1FSFA 3JQFC 2R6FA 2R8BA 3QK7A 3G88A 4AWXA 4R2JA 1AXGA 4MWBA 1LLFA 2ZBFA 3KU4A 4Q18A 3TLCA 3EAQA 3S7TA 4AFNA 4KNWA 3FSRA 4G63A 3VPFA 4B2LA 4JI0B 1YVRA 2AN3A 1BDHA 2OAGA 3VH1A 4EQ6B 2RGWA 4EMSA 3T7DA 2ZBDA 4KODA 1N36B 2XRFA 1BYIA 3IVMA 4KXUA 2H1HA 3EYWA 2QD2A 4LCJA 4EQZA 3OESA 4YMHA 2PDAA 2PJZA 3IBTA 3VUEA 4RX1A 2A78A 4G6ZA 2RHJA 5D6NA 1R4MA 2XLCA 1CR2A 3R5SA 5ESRA 1UWLA 3VR3D 3W6PA 4JGBA 2QTGA 3HJHA 2RAPA 4QWMA 4LQ4A 4WLOA 3PSAA 1VPWA 2WJAA 3F49S 1P80A 2LRHA 2HHAA 2Q5JA 3AFNA 4RV9A 4GKJB 3KTAB 5TJHA 1Q44A 4AI6A 2X5NA 2BMEA 3ASVA 4FE3A 2J4FA 4UHFA 4A3SA 4KE8A 2PKXA 2CLFB 3UAWA 3PE3A 3ZE0B 4TVOA 2PANA 1SUBA 5E8RA 4C6HA 5DGHA 6REQA 2FU5C 3N7TA 4EY4A 10MHA 2O7SA 1Z34A 4GEKA 5AXDA 1QP0A 3L04A 3UAGA 3D0OA 3VOTA 2RC5A 3I3OA 1EBFA 1ONPA 2BE7A 2JDIA 4G8BA 5ISMA 2R3SA 3GFRA 4TVBA 1N6LA 5KTRA 1NM5A 2WHYA 4HWOA 2UDPA 1JG6A 2UVDA 1MV8A 2WTNA 3OPYB 5CVJA 3SEAA 3HQ4O 5CX4A 3RNLA 1P45A 3IQFA 4QRDA 3HKDA 4KN8A 3S2FA 2FN8A 1O95C 4HNVA 4AG5A 4DJ5X 2I2DA 3RTAA 2X6QA 3EPRA 4FXPA 4RXTA 5SY9A 5LJIA 3GLGA 2BD0A 3F0TA 3KPUA 3I4CA 4IMIB 4BE7B 4M1EA 2VTBA 2AZDA 4URHA 3E8MA 3T5BA 4AKGA 2ECKA 1YU9A 1O97C 4NZOA 1L5LA 2D62A 3DONA 4C3ZA 4EFMA 4Z7JA 2VZEA 5BWNA 1KJWA 2BHNA 2EIHA 3E22B 4MQ5A 1C30B 5EXXA 1M1YE 1XJWA 5IUJC 2GN6A 3JWPA 4CT4B 3EBLA 4E2XA 3FMOB 1R8QA 2OSVA 3DLHA 3O1LA 1GJRA 4D0SA 1Y3BE 4Y2HA 3Q0IA 4R3NA 1EESA 4FIZA 2I4OA 3ZQUA 5JBIA 2D7DA 4CKWA 1ZH8A 1K0UA 2V8BA 3C98A 4DCGA 3H05A 4LQCA 4ZQIA 2ZQYA 2ERYA 5EUMA 2OV4A 1ECFA 4A6DA 4YCDA 2WUWE 1VPTA 1K2VN 4NF2A 3PDIB 5FPYA 2X5XA 4RQUA 2Q8QA 3OF2A 4BEJA 3KTFA 4LY0A 1D6MA 2RC6A 2I1QA 3IO3A 1QUFA 2HK7A 4HX9A 3FCXA 3O4HA 1YI8A 5A3QA 3HXMA 1DWQA 4BAZA 1AG9A 1WUIS 3VM6A 2R0QC 2ONJA 3UK6A 4MW6A 1TD1A 1GNRA 1SN7A 2OZLA 4F6RA 4OM8A 2I67A 1V3UA 1YQGA 5G0SA 3TZLA 5TS3A 2IGBA 1OLSA 1XRSB 1AZSC 4GWLA 2HA0A 4YT5A 3X1KA 1JKMA 3CN9A 5E38A 1NLFA 3C3YA 1CSEE 3H87A 2X0EA 3WC4A 1EI9A 3UB3A 5CBKA 4B09A 3UGQA 3DR5A 4ITVA 3WK6A 4YUAA 1UP7A 4RH1A 1JX6A 4CIBA 5EIEA 3K8YA 2NUTB 1OWPA 1QYXA 2ZAGA 3GR6A 4ZPJA 5HNKA 3PUXA 3D2LA 1BEEA 5CPBA 3C41J 4PPQA 1EDOA 3TW8B 3FETA 3VKVA 3URKA 2CXHA 2W2KA 3G2QA 5CBPB 3PFWO 4GLBA 4P2BA 4B3XA 2I1WA 3A27A 4N40A 1PJAA 2JFFA 4ND6A 3BDIA 4W1QA 4WNAA 5TPZA 4CKYA 1WV1A 3DFFA 3DB1A 3E5HA 4IOJA 2F8TA 1HLGA 2W37A 3A36A 4CMIA 3E9MA 4N7RA 2VHVA 2HCRA 5LB2A 3CXUA 1DBQA 1YQQA 3FNRA 4Z0TA 4BNJA 3LVQE 5TX7A 4UOEA 4PY2A 4TV8A 2IHVA 2OFOA 3LBHA 4MAAA 2A1TS 1HQDA 2FF7A 3IKJA 1AO3A 3D4LA 1CQPA 3HH8A 4B17A 4YAUA 2ZULA 4R1OA 3G9QA 3MB8A 5LA6B 3IPLA 5AI9A 2XB2A 1ONNA 1ZC4A 5FLKA 3EGXB 4JH0A 1R50A 3OMXA 1GU1A 5I7AA 1REQA 1L8XA 4KE9A 2B21A 3WYAA 5A02A 4ZDJA 4BU1A 1KFKB 5AKGA 1GQSA 4BFYA 3PNSA 1OT5A 2VF5X 3PRYA 3WNVA 1OYYA 5JS2A 4NYMQ 2XEXA 4ALNA 2WWXA 1O9HA 2PL3A 1PEDA 3RVKA 5B3KA 5LQUA 3FFTA 4KLNA 4MVCA 2VP3A 4NFHA 1XP8A 3JQAA 4X90A 2JLWA 2VT7A 5EVCA 3V1MA 2EYUA 3I09A 2G1JA 1T36B 4FC6A 4GZ6A 4MARA 4OY3A 3LT1A 2PGDA 5B4VA 4QL3A 5KREA 4FQ8A 1U2ZA 3PYXA 1N0VC 5IYZA 3VPXA 4BVFA 2PXAA 3NOVA 4J0IA 2RGBA 3A4NA 4PZCA 5HRAA 5LQDA 3OA2A 4JVOA 2R6ZA 4V0KA 2EEZA 4B76A 2V6BA 2AG0A 4QQ8A 4ERXA 3ZVKA 4RMGA 3UATA 3JRXA 2CLLB 3PGJA 2WU0A 1E0AA 5FHRA 1GFIA 3DFKA 3I2FA 3UUEA 1BA3A 5GVRA 1JJAA 3RHTA 5DWDA 2Q9BA 3AW8A 1GV1A 1UFOA 3AIIA 4INJA 3BRCA 2A4MA 2RD2A 2Z8ZA 4XIFA 1U4NA 1XTUA 2I8AA 1DJPA 1QVAA 3BXFA 1OXTA 3CZ4A 4YR9A 1Z15A 2DBZA 2BEKA 4GXQA 4GEGA 4DNFA 1H3FA 1SXJB 2VYVD 2RGYA 4NATA 1D03A 1E8DA 3IERA 4M22A 3ZD7A 4MUNA 2XUOA 3EW9A 5INTA 1P3Y1 5TDHA 1XLVA 3H3FA 1QF6A 2XV1A 5KOJB 3IP8A 1ZW6A 4JIGA 3BJZA 4MUXA 4BLPA 5E1MA 4L3WA 1WHSA 3WK5A 1QIJA 4M8SA 3GDFA 4CCAA 1Q95A 4AZSA 3OJLA 5JJ5A 5L7WA 3FSJX 1YCDA 1NUPA 4FQ5A 4J0KA 2YJNA 3PTZA 3EZLA 4CKEB 1IBLB 2B99A 3OIDA 4MS1B 4XWKA 3CX7A 5DXAA 3KFLA 1O77A 4ZI5A 2X6RA 1K8YB 4QQRA 1H2BA 1ZY2A 2F8LA 1Z5WA 1X19A 5H81A 2BTOA 1K5GA 4V0OA 4R51A 1N2GA 1EINA 2QDKA 1VTKA 2EJUA 2I6SA 1Y48E 2ODPA 3OZAA 4CMJA 3W5CA 3GLFE 3FNGA 5IJ0A 1JB1A 3NT5A 1A8SA 1CUHA 1IRIA 1NDUA 1S2OA 2GBPA 4S1NA 1UP6A 1FYFA 3LMKA 4R68A 4HUTA 1I6WA 2QKYA 4X7MA 2HX1A 1SOWA 2IUUA 1YE8A 4JP8A 3V4PB 3VKUA 3WB1A 4HLDA 2ZWOA 3WVNA 3VA7A 1RT9A 1BAPA 3KQUA 4I7EA 3JSAA 1LNSA 3VC3A 1G21E 2HH9A 3I2HA 4BP3A 4MQEB 2YWRA 2PRSA 1L5QA 4K6FA 1JQJC 1HOTA 2IXAA 2E0IA 4MDHA 1WCWA 4YYZA 2QSZA 1I7DA 5B7GA 4LMPA 5AXCA 4DSAA 2OQ2A 4GM4A 3FKQA 2H8KA 5LQJA 5K4HA 1L8AA 1J21A 4J16C 2IQ5A 1ZN8A 4XGQA 5H80A 3FTDA 5JOQA 1ZAYA 5EZYB 2HQ1A 1PSDA 3G2KA 3WIEA 3KS9A 2XGMA 1PFQA 3DZDA 4Q9DA 4ZU6X 4LY6A 2HJ9A 5LDDC 4R1NA 4BLWA 1H2WA 2OQIA 1MO6A 5FYQA 1VE7A 3GEGA 1CRQA 4CM8B 2CJWA 1U8AA 3BYZA 3WDMA 2ZKIA 4LXGA 4GM0A 1KVRA 2BH9A 4YHBA 2W70A 3N6VA 1JI3A 1JEQA 2ZE8A 2PVSA 2QRPA 2X8AA 4WACA 2X0IA 3VI4B 5FPQA 1VYHA 1FJXA 1XZJA 5LDHA 4XVUA 2E4ZA 3NRJA 1KP2A 1VYUA 4RH0A 1D07A 1EVIA 3TLKA 4ALLA 8ATCA 1ZP6A 5I8PA 2R6AA 3TUJC 2PYZA 2QRHA 3AY3A 2H7VA 4IOLA 4QXOA 5DB4A 2R1TA 1Z56C 3ANXA 1CJVC 4OL9A 2ZU0C 3FWPA 4MVJF 5C8ZA 1YS6A 3AEKB 4PE5B 3MHPA 4UD2A 1PYGA 1KDPA 4FONA 3DEHA 3QI7A 3MG9A 4IPTA 4L3VA 5B1SA 1DWUA 1UBKS 1WR8A 1USWA 5JCXA 1U3FA 1NFRA 4LYHA 2Y3IA 5BR4A 2Z6UA 1XLUA 4LTDA 4YRSA 2JFQA 4I4TF 4Y2UA 2Z58A 5DCUA 1NNUA 1P5JA 1QLJA 1SK8A 1Q11A 1Q15A 2D1QA 4FCTA 2IP4A 4EELA 1WD5A 4MJLA 1DEXA 1JILA 1GTMA 2QIOA 4CQNA 2AVDA 4J75A 4A16A 1IIRA 4Q1BA 3V6MA 5JAPA 2M6LA 1CUXA 4G23A 4OSOA 1DBRA 4BVKA 4PQRA 3I6QA 4EL5A 2J32A 1Z82A 2VUSA 2ZRFA 2FG6C 2ZJ0A 3NBQA 5L3ZA 2W6IA 1PRYA 5F35A 1F17A 1DV1A 1F9EA 1K2WA 2VPPA 2YHBA 3GGOA 4M98A 4ZQCB 2XT9A 4H7DA 2UXCB 2XBLA 4UNSA 1YOBA 3T9CA 5KVVA 1TADA 3VFDA 2D4HA 2DSNA 4Q6BA 1Y8ZA 5K9ZA 1U11A 2YV5A 4AZ0A 4CNBA 3LHSA 2VQDA 3LL7A 1GGEA 2WJJA 4MAMA 4GP7A 4QBTA 2DG2A 3RYCB 1SHUX 1L4HA 1P6XA 3D4BA 4L0QA 3MLAA 2O50A 2VCYA 5CVUA 1QTNA 4XA8A 1FS4A 2GZSA 4FFLA 4NQZA 4DCSA 5CYGA 2FQQA 3F9CA 1YDHA 2H4YA 5DYIA 4P4TA 1QFSA 1GFZA 1DIBA 3ANMA 4HLCA 1QOPB 3B2QA 3Q3VA 1YL7A 3GLKA 5KX5A 4KREA 1F8FA 3WZ2A 2W22A 2PMWB 4GXTA 5AKJA 4HYQA 3OFKA 5C8YF 5LNK6 4O2BA 1DOHA 1D9XA 1XPOA 1II0A 3MYYA 1GPYA 3EGOA 4DJDC 2HC9A 3AEQA 2HNKA 3O38A 4PZAA 1GU7A 1IHUA 3CJRA 4INOA 4KJZA 1I80A 4FBMA 2SKEA 1U7UA 5CVVA 5BV1A 2ZCJA 1YWGO 1T9CA 4NDAA 2H2DA 4YTEA 1QHGA 3UH1A 1A5SB 1OBHA 1WXQA 2G4CA 5DLPA 2A1UB 1U6JA 3DOJA 2W6OA 1P5HA 3HN6A 3G2MA 2C5BA 3OHMA 4EB6B 5F76A 3TTYA 3RFVA 1BH2A 1QRDA 2FPRA 2O2CA 2P5SA 1KZ4A 4H7KA 4NG5A 4MICA 5FTKA 5LBTA 1X86B 1CNEA 3FZYA 3NP7A 1JJ7A 1GA4A 1L3BA 2RB4A 1T5BA 2QW0X 1Q1BA 1EX9A 1RJDA 1T8TA 3R5KA 2HDHA 4QZVA 2XECA 4OBEA 1XYYA 4M53A 4W5JA 5GONB 4OI0A 1HOXA 1NVUQ 2X1HA 4LC9A 2LDXA 4JUBA 4ROSA 4UMEA 1YVUA 2FTKE 4FI3C 4BNYA 1FPMA 1K9VF 4LN1A 1RTTA 4WNCA 2NN3C 5EMJA 5FI0B 3ZS8A 4CL2A 2IIVA 3D8TA 2XTNA 1E0SA 2V9CA 4HAYA 3E7XA 1W1IA 1OSNA 2QG6A 2A58A 4QXQA 3DCNA 4F60A 2V97A 3IUPA 4V0MA 1ZUNA 1G20B 2BEUB 4ZAWA 3ETEA 4BDTA 2IC5A 3KHKA 3P94A 2VJKA 5BSRA 1TMOA 2OBNA 3BF7A 2G04A 1CY4A 2WYIA 3WGKA 3ZH2A 1RRKA 2BFPA 2ENWA 3N86A 1EFDN 3K0FA 2IHKA 4Q21A 4YJFA 5G41A 1F38A 1S2MA 2ZK7A 4IKEA 1WBBA 3IA7A 4JI4B 2PVPA 3TL2A 4RVCA 1GG8A 4ZVPA 1KI6A 3LV8A 4R8VA 1Z3CA 3IAUA 3N0RA 3O8QA 3PUIA 4IH9A 4ZVUA 3ZQ4A 1JQ3A 4B46A 1F2VA 1E5XA 1UDXA 4CG3A 3C45A 1JTVA 3HUDA 2C2HA 5FWAA 5GZ6A 2Y66A 1SOVA 3A3KA 4AJIA 1MO3A 4LYFA 5DW3A 5HWSA 4JUIA 5EN4A 1R9GA 5JXWA 3KAJA 3S5UA 2X22A 1H0HA 4ND2A 1I9CA 5JSKA 3VX3A 1OIVA 1ZJ4A 4XX0A 3BXOA 5IK2A 5FPTA 2YYSA 3OC0A 1WPXA 3RQIA 2A86A 3WQSB 2PWBA 1PEKE 1G20E 3QUCA 3STUA 5IG2A 3KKKA 2H57A 1I4DD 1G63A 3IDSA 3ZGXA 4DSNA 1DJMA 2PRYA 2NU8A 1ZZGA 1EXVA 1GNPA 1IQUA 3U16A 4RV5A 2QVLA 3MMNA 4PONA 2QUKA 2ZCUA 3AL2A 4N9WA 3FCSB 4TQ9A 1PHPA 4LOIA 4Q4HA 1TCBA 3LFHA 1RKVA 4GKAA 3BGDA 3SEZA 3U7HB 2A3RA 4BX3A 1JJBA 2XCLA 1Z68A 4HEJA 4MITA 1CT9A 4Q4DA 2H63A 1D6SA 3C8ZA 3RT1A 4KX5A 1OU0A 3EA0A 4OKNA 2FPUA 4FCWA 4NMLA 3Q7IA 2Z6QA 2YZ7A 3CUWA 3JQDA 5IDWA 4PLFA 7ADHA 5LQNA 3O8CA 3B2EA 4ZODA 2LWIA 2R60A 1Z4PX 1T25A 1UBJS 1GN9A 4E2ZA 2O2ZA 1WLSA 4JYAB 1VCHA 4DMFA 1NUHA 1CR6A 4WLUA 1QCDA 4TTAA 4LNAA 4IJVA 3UIEA 2C5HA 3KLNA 4COOA 6REQB 4ZCRA 2WJ4A 5HZKA 1VHDA 2B82A 3KDPA 4MWEA 1T91A 1WOYA 1MLDA 1X1AA 2B9EA 2VUTA 1U2RA 2ZGVA 3OURA 1E3WA 3HKEA 3QLTA 5J5VA 4JGGA 2VSFA 5B7PA 1ISHA 4BMZA 2I4TA 4UVHA 2AOWA 3L40A 1I7QB 4G5SA 1HG1A 1T5LA 2WLSA 4Q3OA 1ICIA 1NGSA 3FBTA 3GEBA 3PTAA 4UEOA 1YI1A 1C9EA 2QRNA 5IH7A 3SDZA 3P9RA 4NNJA 2PX2A 4TGLA 4U2DA 5IXSA 2WSYB 3TFOA 1FRFS 1EZ1A 2CHGA 4TV9B 1EVZA 4L5YA 4MSUA 1P0PA 5KVQA 4LFCB 3RRBA 3C3WA 4AF6A 4YRBA 4KR2A 1JHOA 4KW7A 3BSYA 2BKEA 1FL9A 3DAGA 1MHPA 4GWKA 4TT3D 3T8YA 2JGDA 4KHZA 1C0PA 3WYGA 4AC9A 3U4QA 4JXZA 3LIPA 2JFPA 2J1LA 1SKQA 3UMFA 2WV9A 2DQSA 3HRHA 4M1SA 1EQUA 1FSSA 2GRJA 2R85A 3PHLA 3BD6A 2MYPA 4B6EA 3UJAA 1RMQA 3D3EA 3T94A 1JNXX 2IBSA 4F2GA 3KJFA 2R8OA 4PHTA 4PAWA 4CKWB 5TY0A 4LXQA 2OILA 2WSSD 2IV3A 4Y2YA 3H5RA 3KP1A 4KC0A 3T9BA 3EIFA 1FVFA 1R4NB 3VVLA 1IMJA 5ETJA 5AQ1A 1MPXA 1PHRA 1EVKA 1EVEA 3EC2A 4IYJA 5B37A 2X0DA 1DADA 3G2PA 3PBKA 4URXR 5J2TA 3ZE1B 1G8GA 3NVAA 3NIGB 1RLOA 2H2AA 2H9AA 3D8HA 5H1YA 1W46A 5FWYA 1OILA 2ZBRA 2X15A 4OMFG 3WNBA 1T1RA 5BQOA 3DV0A 4S3MA 2FY8A 3E7PA 3AESA 5C1BA 3GLGE 5JPDA 4F6RB 4MW7A 4ZCTA 3MCVA 2JLSA 4I8XA 2Q5LA 2QHXA 1AQYA 1OLSB 5KNCD 1U2SA 2CJPA 1JDNA 4HN4B 4QOFA 5L53A 1IWPB 2BMWA 2CHEA 2ZSIA 5TVGA 1KQNA 3X2SA 2OPHA 1YIAA 3H1AA 1JH8A 2XWBF 5A6SA 2EHDA 1ZN9A 3W4JA 4M46A 3KKNA 3IQDB 1KPIA 3F74A 4NZMA 2YYAA 3ZJTA 4KIGA 5AVYA 3ER9A 3O8DA 5C7IO 4GX2A 1BU8A 1M6WA 1MBZA 2X76A 1XZKA 2LGJA 3L7NA 3O3OB 4KBGA 4G0YA 1SVSA 4WNAB 1K5HA 3LG2A 3KQKA 5LR6A 4ZEMA 5EESA 5FL3A 4R0MA 1AKTA 2JCBA 2WG1A 2ZB7A 3FCYA 1ZINA 1W5SA 3OQPA 4ON9A 1LRJA 1QO7A 3BFVA 4ZRNA 3RQSA 4KXYA 5G4LA 2XWSA 2Y1XA 4GH5A 4V0NA 4LISA 1OMOA 2A0XA 4GM1A 1JQAA 4LDPA 3DOOA 1NBIA 4FZRA 2RAVA 2LP4Y 3ND5A 4C0LA 3AYXB 1CUJA 4ZEXA 1ZA1A 3CB2A 3NKLA 2FW6A 3KHTA 3OP4A 2X5OA 3VGPA 2F3SA 1AUXA 1WPGA 4L9RA 3WWDA 2PTHA 4LHYA 4NTZA 4DXAA 4Z54A 4UHEA 4DPMA 2YY7A 5A2QA 2B30A 3OKCA 3TTSA 4MMXB 2DHQA 2B8NA 2JW5A 4XRRA 3DL4A 4X85A 1BHJA 3C8MA 3QYPA 4R2HA 2HRCA 4JYBA 4YMSA 1GP2A 4CFYA 3IIEA 5BUQA 5LQKA 5CXUA 2Q2QA 2P9TA 3IDQA 3AJDA 2JFHA 1MAVA 1YIOA 3B7GA 4ER6A 2Z4RA 1VLMA 5FOQA 5ES3A 1G0NA 4N3BA 3RKSA 1X9IA 1BDBA 1E5QA 1U94A 2W2NA 3OM9A 1VP3A 4AIIA 3CISA 3UJPA 2GR9A 1XRQA 2XNSA 1HNWB 3A1CA 4Y2TA 2VYNA 4MYRA 2FWIA 5LA6F 2CNDA 4WZAA 3GUUA 1JNYA 1HNXB 2Q2VA 2YHSA 5EZ5A 1IB6A 2ZRNA 3PR1A 4FDTA 1YKSA 2DYKA 2GYUA 4QQKA 2N9UA 3HBFA 5DEIA 4EGSA 4KYVA 3ER8A 4BUZA 4IIXA 4H6VA 5H8WA 2BFDA 2NZJA 1USUA 2ODNA 4PZZA 1UAYA 2QN9A 3E3AA 4PN7A 2IQIA 1Y1KE 1D2AA 5E9WA 1ZIDA 2XUFA 3ENVA 4J6FA 3FUUA 3WI7A 3EA5A 3KEMA 3U62A 1DARA 9LDBA 2ROQA 3G0HA 1BOOA 2C7OA 1EP2B 1ULAA 1QRUA 1E62A 1NLYA 1JFVA 2J6IA 2FUCA 1MW9X 3PQEA 3MINA 5EHNA 4D8TA 1N32B 4OXKA 1J39A 2G0NA 2QENA 4I1IA 3DZFA 1GOTA 2C03A 4M0KA 1VFPA 1CY7A 2BEVA 2Y9PB 3AHFA 3IBYA 1WHSB 3EFHA 4JA0A 4LE2A 4CIYA 4X00A 2GAIA 2OAP1 2OD7A 3PT9A 4QQFA 1DAKA 5I9TA 3WRVA 4UAUA 1XWWA 3LPAA 2CV2A 4BZQA 3RK4A 3S2IA 4RNDB 3O8NA 3PLAE 3N2NA 1ZISA 4E6PA 1GGVA 2WSIA 1P2BA 1VIVA 5HE9A 3H2JA 3P9NA 4YLYA 2XVAA 2CDRA 1U5BA 3D6AA 3L1KA 3AUAA 2VPTA 5H16A 5I9LA 1H85A 3TBKA 1L7EA 3EQZA 5IJ0B 1F51E 1N8TA 5EUCA 3QBVA 1RYFA 1NQOA 3X44A 1PL6A 4DM3A 3GRKA 1XGKA 4YJKA 3L8FA 2W6CX 3GRYA 3FE2A 4OV6B 5D7NA 3J81k 1O0CA 5G4KA 1X87A 2ID4A 3GUCA 3K8QA 2CLEB 3Q7QA 4I6EA 4EUEA 4RJIA 2ZUEA 1IATA 2NWQA 1QHHA 3EXEA 3LD9A 1RXEA 1E0KA 3A6JA 1MEJA 2RH9B 2QT1A 3HFJA 1XZDA 3HZOA 2BBOA 4W5TA 4DBZA 2VJDA 4EUFA 1MZVA 1GZ7A 4RFSA 2I4LA 1L7BA 4N5IX 1EB9A 1A5AB 1ML3A 2FNAA 4MMYB 4OSEA 4HB3A 1E8NA 2F1OA 2J7KA 4K9MA 3FGZA 1BW9B 5KMGA 4F0JA 2JAQA 5K2OA 1OGIA 1YDGA 2REBA 3L7YA 4B6SA 3V7UA 1ECGA 1P39A 1ZCBA 3KRTA 5FLEX 1DRUA 4WK0B 1BDMA 5MN6A 1SG9A 1NULA 3ESXA 4QARA 1E66A