2RBKA

X-ray crystallographic structures show conservation of a trigonal-bipyramidal intermediate in a phosphoryl-transfer superfamily.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
261
structure length
261
Chain Sequence
b'MTKALFFDIDGTLVSFETHRIPSSTIEALEAAHAKGLKIFIATGRPKAIINNLSELQDRNLIDGYITMNGAYCFVGEEVIYKSAIPQEEVKAMAAFCEKKGVPCIFVEEHNISVCQPNEMVKKIFYDFLHVNVIPTVSFEEASNKEVIQMTPFITEEEEKEVLPSIPTCEIGRWYPAFADVTAKGDTKQKGIDEIIRHFGIKLEETMSFGDGGNDISMLRHAAIGVAMGQAKEDVKAAADYVTAPIDEDGISKAMKHFGII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title The catalytic scaffold of the haloalkanoic acid dehalogenase enzyme superfamily acts as a mold for the trigonal bipyramidal transition state.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Unknown function
total genus 91
structure length 261
sequence length 261
ec nomenclature
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 2rbkA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2rbkA01
2EARA 2RB5A 5AK5A 3ZW7A 3U13A 5AVXA 3W5AA 4XPZA 1QQ5A 5ALQA 4NV0A 3B9RA 4BX2A 2FI1A 2P27A 4CF3A 1L6RA 3A3YA 2B0CA 4UMDA 3AR6A 1L7MA 2YMQA 5AM4A 2JGAA 3ZX4A 2RARA 4HYTA 1RMTA 2C8KA 3FPBA 3U19A 4OFZA 5AKGA 4NFLA 2Q5EA 3AR2A 3OCVA 3NIWA 5AK4A 4Y2SA 3QGMA 4E88A 1RQNA 1RKVA 1YV9A 2NO5A 5AM2A 2HF2A 3NUQA 2G09A 2B8EA 2HHLA 3WK8A 4XQ0A 2B1RA 2WF6A 4NWIA 3KDPA 5AVQA 3IB6A 5AVRA 1RRCA 2FUCA 3N28A 1X42A 2D2VA 4AS2A 2I54A 1VFPA 3WK9A 1AQ6A 1YDFA 3OCZA 2NO4A 3M9LA 4NAVA 3BA6A 1RLMA 4J2TA 2BDUA 1CR6A 1Z4NA 1YMQA 2OBBA 2GO7A 5AM1A 2G07A 5AK6A 3NASA 2I6XA 4KN8A 3ZTYA 5AI6A 2P11A 1TJ4A 3FGOA 3UMBA 5IS2A 3ZUPA 2FPUA 1ZD4A 2WF8A 1PW5A 4KX3A 3MMZA 5A3RA 1L7NA 3MC1A 1RPZA 2OM6A 3I1YA 4FYPA 5AHXA 3W5CA 3SF0A 1N9KA 1RC8A 2CFSA 2YJ4A 3L8HA 5ALJA 4UMVA 2G1AA 4FFDA 1U2TA 4Y2JA 1RQLA 1U02A 2GMWA 4DFDA 4Y2TA 2AH5A 3D6JA 2IYEA 4UW9A 4HGRA 1WR8A 1S8OA 1YJ5A 5ALWA 2YFYA 4UMEA 5ALDA 2W4MA 3WKAA 5AIBA 2C4NA 5ALXA 1QQ6A 4BX0A 3EPRA 5AW3A 2QLTA 4UU1A 1RKQA 4Y2UA 4EX6A 4HGOA 1MH9A 3OCUA 1Q91A 1TJ5A 1XP5A 4G63A 3ZVMA 1ZS9A 3N5KA 2BY4A 5AVVA 2G08A 4MUMA 5E0OA 2OYCA 3N8GA 5AI9A 4CF5A 3ZWKA 1LTQA 4UARA 2B30A 1RMYA 2I55A 2NYVA 2JAUA 1Z4KA 4CNQA 1SWWA 2ODAA 1CQZA 3L0YA 3ESQA 4C4RA 3L1VA 1QH9A 2C8LA 2FEAA 2B1QA 4YGYA 1NF2A 3FM9A 5AM5A 3S6JA 5AM0A 1Z4IA 2AMYA 5A3QA 3MN1A 3WK7A 2JAOA 5AKZA 4GXTA 4BEVA 4UAVA 1ZD5A 3KOOA 4JDPA 3ED5A 1ZD3A 3CNHA 4YCNA 3R4CA 3AR4A 5ALTA 4HGQA 4KYTA 3SKYA 2I7DA 3CZ4A 5AIAA 5AM3A 3QU5A 3RF6A 5AKEA 3AR8A 3OCXA 3WKDA 4L57A 4EX7A 4BEWA 3P96A 3WKEA 3DV9A 1U7PA 2ZBGA 1Z88A 2W43A 3ONNA 1RLOA 5ALIA 4KNVA 3ESRA 2HDOA 4Y3UA 2Q4RA 3NALA 1ZRMA 4KNWA 2DQSA 5AI5A 3F9RA 1XVIA 4Y2RA 2G80A 1K1EA 2EAUA 2O9JA 4XOUA 2WM8A 2HF7A 2I34A 1T9ZA 2YMLA 1RDFA 3W5DA 3DAOA 5AKHA 5AW8A 1LVHA 3EF0A 4Y2QA 3WKCA 3QNMA 5ALPA 1ZOLA 5ALSA 5ALGA 3WK4A 3PGLA 5AESA 3HLTA 1XPJA 2FPRA 5AW1A 4I9GA 1O08A 1T5TA 3L8EA 3ET4A 2IOHA 2YJ6A 2ZOSA 3KD3A 2HEGA 2P69A 4G9BA 4Y2PA 3U7HB 1ZD2P 3A1EA 2AUTA 2YN4A 2VKQA 3WKBA 2JAWA 4H1WA 3R9KA 4BYGA 2G0AA 3SMVA 4B6JA 3A1DA 3QU7A 4DW8A 3OPXA 1U7OA 4YIKA 4UM5A 1WPGA 1VJ5A 3KZXA 4YIHA 4EZEA 1SU4A 5AKLA 4PNHA 1Z4QA 2OA0A 3KBBA 5AW7A 5AW0A 4EELA 2HCFA 2JARA 2CFRA 2ZBDA 3FVVA 3QU9A 4L6CA 3VAYA 4BX3A 3HYCA 5AW4A 2HOQA 2WF7A 3L1UA 3L5KA 1J8DA 4Y2XA 4RETA 4ZEVA 4DWOA 3I6BA 1Q92A 1L7OA 2GHQA 2PQ0A 1Z4PX 4UATA 4QJBA 3NAMA 1F5SA 1Z4JA 1NRWA 5AICA 5T41A 5ALRA 1KYTA 2C9MA 2BDEA 3ZVLA 4AP9A 3J7TA 3AR7A 1RLTA 4BNDA 2I33A 1JUDA 3E81A 2R8YA 4UM7A 3QUQA 1RKUA 3OTQA 1J97A 4XE5A 3ZX5A 3I28A 3B8EA 3N07A 5AKJA 3WK6A 5AVWA 5JJBA 4HGNA 1WVIA 2ZBFA 3EF1A 3QXGA 5AVSA 4F71A 4BKMA 4UAUA 3NRJA 2RBKA 4J03A 1QQ7A 2Q4TA 4C4TA 3IRUA 4ZEXA 4AS3A 2HI0A 1YS9A 1EK2A 2FPSA 2EATA 1TA0A 3PDWA 2ZBEA 3L7YA 3SD7A 4F72A 1IWOA 2YBDA 2ZG6A 2PKEA 3NANA 2HX1A 3U7GA 2IOFK 2R8XA 2O2XA 3KC2A 4EEKA 2GFHA 4HGPA 5AKIA 5ALUA 1YNSA 3U26A 3L0BA 3QYPA 5ALYA 3SKXA 5AVYA 3RFUA 2R8EA 1N8NA 3QUTA 3L0CA 5AVTA 2MSNA 4YH1A 1QYIA 4YCLA 4KX5A 5AW2A 4L6AA 2WFAA 2CFTA 4OD0A 4OCZA 4CF4A 3QUBA 1O03A 5ALLA 2YJ5A 3IJ5A 1ZJJA 5IT4A 3QLEA 5FP0A 2B8JA 5ALKA 4UMFA 3ZTWA 2X4DA 4NABA 4Y2VA 2YMMA 2WF9A 1NNLA 3K1ZA 4IFTA 2YJ3A 3ZVNA 3L8FA 3R09A 5AKYA 4JB3A 4UU0A 2FUEA 4EENA 2AGVA 5AI4A 2HO4A 1ZRNA 1U2SA 5ALOA 2HSZA 4QQFA 3WGUA 5ALHA 4O8CA 3ZU6A 1SWVA 3U7FB 5AI8A 4Y2YA 4I9FA 3GYGA 3L8GA 2C88A 2GHTA 3WK5A 4YCMA 3EWIA 1S2OA 5IT0A 3N1UA 3E84A 2P9JA 1Z4MA 2PR7A 1Z4OA 3SLRA 3WGVA 4CE6A 1Y8AA 3ZWDA 5AVZA 5ALNA 5A3SA 4UASA 2B82A 2WHEA 3UM9A 5AI0A 4IG4A 1T5SA 3BWVA 4HAIA 1Z5UA 4DCCA 1RMQA 2G06A 4ZEWA 3AR3A 5ALEA 5ALZA 3TLMA 3UMGA 3B9BA 2R8ZA 3FZQA 3ET5A 3QU4A 4MWOA 4RESA 3OCYA 4BBJA 2FPXA 3PCTA 5AW9A 2FPWA 4FE3A 3OCWA 2QYHA 1Z5GA 5AKXA 1EK1A 5AW6A 2MU1A 3E8MA 5ALMA 3AR9A 2ZXEA 3QUCA 2CN1A 2FDRA 4BNDB 1TJ3A 4GIBA 1L8OA 5AW5A 5ALFA 5ALVA 5AVUA 1FEZA 3PGVA 1TE2A 3SHQA 4C4SA 2W11A 3FPSA 3AR5A 2WF5A 3U7EB 2IOFA 2RAVA 3MPOA 1WZCA 3QU2A 3I76A 3UMCA 3A1CA 3W5BA 1L7PA 3DDHA 3E58A 3QX7A 3M1YA 4OHFA 2IA5A 2YMPA 1Z4LA 5AK3A 5AKKA 2YY6A 1L8LA 3ZI4A 1VJRA 3DNPA
chains in the Genus database with same CATH superfamily
3IQFA 1DKOA 4Y2HA 5JE8A 1G3UA 3JWJA 1A5BB 1D4ZA 2CKMA 4KIWA 1M1UA 1I01A 4Q9JA 1JX6A 3W5AA 3C8UA 4M9CA 3UK2A 3GMSA 4JLSA 4DBLC 5ADUS 5DGIA 4A9AA 4X1KB 5IZCC 3ZHTA 5IAGA 5F7JA 1S2IA 2BM8A 3W5IA 1O7JA 3I0NA 1Z37A 2VF4X 3X2FA 1KIAA 1JLKA 2YMQA 3H3XA 3SX2A 3VOTA 3G3EA 5JHHB 2DPYA 1CQJA 3OUTA 2HLNA 1IL0A 2IDKA 2CE7A 1G3QA 3LVBA 3PNBA 3PVZA 4TS4A 5ITWA 3KYIB 2CYAA 1A2OA 2MWMA 4OFZA 4PHGA 3RK0A 2R6ZA 4CUJA 3A8TA 2E4UA 2OXTA 4EVSA 3KHUA 3O03A 3BWXA 5FI0B 3OE7D 3HJTA 4D42A 3QVWA 4D9BA 2F3QA 1W0KD 1RC1A 2QNIA 3OAAA 1SQ0A 1TM1E 1L5HA 4MKZA 1W47A 5AM2A 2ATXA 2PWBA 1RRKA 4MQUA 2AMLA 2JI4A 5FBZA 2EIHA 4IJUA 3U44B 2C00A 1LX7A 3KV1A 2JFZA 3QOWA 4G26A 4E5VA 1GCIA 5GP1A 1NJ6A 1LC0A 2DWOA 3KQWA 2FPPB 1XZCA 2EX0A 4MJLA 2OCKA 1E1RA 1USKA 4B0OA 1E5DA 1XL1A 2OV8A 4LK3A 3ROPA 5I4IA 3OPVA 1CVIA 3HNPA 2FWIA 1EYZA 2B61A 2DTEA 4HN9A 3G89A 1V2HE 1BDJA 4JY7A 5ETJA 4BNMA 4YMTA 2IK8A 1KS9A 1CRWG 2NWQA 4IDBA 4LY3A 4NAVA 3PNQA 4C7OB 3W77A 1A50B 3FR8A 3M6WA 4Q9IA 3M3DA 4ZCMA 1ZRSA 1R9NA 1D8AA 1KI4A 5JBQA 2IYTA 1IB0A 1B0AA 1S3IA 1YMQA 1TF5A 2K6GA 2RGNA 2WUFA 3U31A 1UPXA 5JDCC 5D1HA 3FRIA 4EGCB 1QV7A 1THMA 4Q24A 5AM1A 2PXAA 1M7GA 1XQ9A 2I9KA 1ATIA 2YHBA 5KX5B 3HKCA 5CNIA 1AGPA 2BE7A 4FFMA 1YASA 4FFSA 3B6JA 4GVPA 4QGBA 1RRMA 8GPBA 1OXKB 1BHSA 1VXOA 1A1SA 5H02A 3N58A 3U7QB 3O8CA 4U5XA 1YAJA 1YULA 3T9BA 2ZUCA 1U0BB 1EX9A 2H1CA 3DMNA 2WVGA 4ZOQI 4FMDB 1O97D 1W4AA 5KYNA 1B8OA 3HYTA 4IMIB 2G6TA 4ZC8A 5JY1A 4F1KA 2I29A 3MWDA 1RFLA 4NYIR 4PZEA 3M4JA 4EKEA 2WWXA 5BXYA 4MARA 1JDVA 1XCLA 2ZSEA 1AMUA 3IQDB 1GYQA 2EJUA 3S40A 3DEJA 1YZLA 3K2IA 4MVJA 4CXMA 4CMKA 1C9MA 3SF0A 3GB9A 1FRNA 2JCBA 3ETLA 2VJCA 2N46A 3NBUA 2FV8A 2IHNA 4YUWA 1XTVA 3ZU4A 3WYAA 4HR7A 4BE7B 5T6MA 1KHHA 1FYXA 1QGOA 5FBHA 1HEIA 1C7ZA 4KFSA 1ZC4A 3B60A 1ZK1A 3LY8A 4Y2JA 3WWYA 1NR5A 3A32A 3NP9A 5FX2A 4KUEA 4TZTA 5G41A 3OP1A 1MPTA 2VQEB 1I5RA 5BO5A 1IJEA 3E1GA 4QYIB 1M10A 1VYTA 2JATA 1QZZA 3JALB 3LRXA 4G8DA 1KEPA 4MQ4A 2VHWA 5A3JA 3HJFA 4M98A 3U09A 4NAHA 1YOVA 4ZT5A 13PKA 4TKZA 5LU9A 3E7XA 4QLBA 3KBOA 3O7MA 4JC8A 3N05A 2H52A 5E1OA 3OP4A 1HRDA 1OC2A 4IIXA 4RVFA 2FF7A 4DCTA 4ZAXA 3Q6IA 2VS1A 4QKQA 2I3AA 4FR0A 4MV6A 3AL3A 4E5NA 1EFLA 2E7ZA 1DIGA 5IBPA 1T8RA 2RAUA 3A37A 3FMOB 3VO9A 5KQLA 4JGBA 4MYRA 1ZGGA 1ZX1A 1HE5A 1C50A 3RS9A 4AMBA 1LPMA 4QDJA 2W4IA 3Q11A 4FTWA 4UD6A 3PKIA 3SYMA 4D2IA 4QYTA 5JCXA 3HTXA 1LI7A 1PZFA 4MUMA 1DG1G 5J1SB 5J63A 4BFZA 2O8VA 3FXAA 1PK8A 1E1QA 2HMWA 1WBJB 3E0XA 2EP7A 1Z5PA 1TTTA 4N48A 2NADA 3WWOA 1A8UA 3I30X 3LQRA 4O2AB 1HH4A 4PQFA 4I4LA 3C5EA 3C3PA 4JBXA 1JB1A 4F9FA 2Q41A 1H2HA 3X2EA 1Q21A 1XCGB 3F90A 1DC6A 1SAYA 1ULSA 2YRWA 1FZQA 4MMZB 1LPOA 1XTZA 3MCZA 3U7RA 3GL9A 1V7QA 3WJAA 3T94A 3VZCA 3KQKA 3AZQA 4LHVA 4X62B 5DO9A 3HY3A 2BM0A 5KTRA 1A9TA 1SVIA 5ER6A 3MN1A 1N6IA 4FSDA 4M9ZA 5C51B 5DW3A 4YAIA 2ZUDA 3AJDA 1XVAA 3TB4A 3VH2A 4CMCA 1BKSB 1RHQA 3HLYA 1UANA 2ONYA 2VJMB 3FPGA 1N78A 1WQ3A 1E1KA 1U1CA 3D3EA 3EVDA 1ZD3A 2WE8A 3RSSA 2A78A 3T5AA 1BOOA 3V1KA 1UPFA 3G7UA 1M1NA 2ATVA 3KLPX 4RJJA 4YJGA 5ALTA 4EI9A 1P2VA 2YS7A 2F59A 3E9DA 4OMDA 4XYGA 3MUEA 3VDMA 5DM60 4ENRA 1QR6A 4L8FA 3DL0A 2R6FA 3K0FA 4MPRA 5AKEA 5CYPA 2D54A 1SRQA 5TMEA 4EQ6B 1P6UA 1NVBA 4C07A 1Q0TA 3BD7A 3J7AC 1Z88A 1C80A 5IASA 4G8CA 3CRNA 3TE7A 2PE5A 1XZLA 5ALIA 4ZVSA 3TOZA 2GPAA 4RIFA 2P6RA 4FJ0A 4KR7A 1GGVA 1P2BA 1L5FA 3TO5A 4XYLA 1HMPA 1VYHA 3ZHBA 1Y9DA 3DMYA 4XKJA 5T6BA 4B8YA 1W73A 4EH1A 2C98A 4EMSA 1N2CE 1TAQA 2FZGA 2J9XB 2XVXA 1LZLA 3Q3EA 4KG7A 4P4TA 5I5GA 5LOVB 4NZOA 4LF7B 1QCYA 2HIHA 4Z9BA 2DBVO 2OG2A 3OJCA 7MHTA 3PWSA 2A7QA 3DE0X 1FLNA 1SBHA 2YMLA 2PM8A 1XZKA 1V3UA 3TIIA 3DM9B 1VA4A 1Z8FA 4RADA 3AFIA 4QNRA 4IJVA 3GJTA 1ML3A 3NPMA 5ALGA 3Q7SA 5ALPA 3WGOA 3ZIUA 2A9QA 1MDFA 1MHPA 1ADFA 2PFGA 3UOGA 4GSLA 2Q2VA 3O8DA 2I7XA 4J1NA 2CHFA 3WIVA 3VPDA 2L2QA 3IP7A 1Q17A 3AJ8A 4QDTA 5LMNB 2WWRA 3UGKA 1OWLA 3AGQA 3EN0A 2P69A 1KJQA 2F7SA 5EHIA 2UZIR 2PS9A 2C99A 1E6CA 1VDMA 2X9LA 1PFGA 2VKQA 4JQOA 2JAWA 1RI1A 4HVCA 4NCAA 4CEIB 2G0AA 1SHJA 2ON6A 4CM4B 2JLZA 1D0IA 5HKKD 4B6QA 2ZPAA 4G0WA 3JASB 5DYYA 1P9WA 3HDYA 1DO8A 3K6RA 2XNSA 1RBQA 4ZO4A 1XNGA 2CCKA 3M1AA 2XE7A 5B3JA 5IBQA 2CXXA 1ZI6A 4M22A 5AP9A 5K8JB 8OHMA 1Z4QA 4GOMD 1UBTS 3OMWA 4Q3NA 3M4YA 4DF3A 3FVVA 2DZDA 1BHJA 3EQ8A 3BE8A 3QMPA 1LDBA 1WXXA 3KCQA 4R83A 1S7GA 4IVNA 3JWIA 3FR7A 1X8KA 2AC2A 4JOSA 1U2RA 2Q27A 3F7OA 2IOQA 4D02A 1L4MA 3EDYA 3R9XA 5EJ8A 3R6GA 3E7PA 3RNLA 2D59A 4BFYA 2RH9B 1JPVA 1C0LA 1U0OC 5GGXA 1IUKA 4O3FA 2A5JA 1XK6A 4PO8A 3RFTA 2G77B 1Y9JA 3B20A 1W52X 2GHQA 1GR1A 2Y4OA 4G5SA 3GLTA 2ONCA 1R8SA 3GAMA 3CZAA 3A2NA 3K32A 1XRRA 3MGBA 1S8NA 5TC4A 3X1WA 1NQOA 2QAGA 1S4MA 3AP3A 5EHNA 4OMFG 4RUKA 5BYKA 3RSQA 4TX1A 1ZGAA 2J3MA 3DFZA 1O96A 4KE6A 2FFBA 3M3HA 4MVJF 3UWKA 4M8KA 1ABBA 4ZFNA 2OESA 2JFPA 5EJFA 4KKVA 4PPFA 3BMOB 3ZE1B 3HJAA 4G1MB 3QX3A 1UK6A 2EZ9A 4FXPA 4E12A 4Q7LA 3RNOA 2K2WA 3NEPX 4COOA 1QQTA 2FW9A 3CLRD 4Y1FA 5HBRA 1WZUA 3PDHA 3RYHA 3KELA 4MV1A 3T7TA 4UZSA 4JXZA 1FYEA 3I05A 1W5TA 3DB2A 3GFPA 1WU8A 3EZ9A 1AQLA 4FFRA 1AGYA 3OEHD 1Z2PX 1FLVA 4DA0A 4F71A 1QFXA 2WJ4A 3A6HA 3FY4A 3H5TA 5CDGA 1MABA 1UFRA 4QL3A 4YP1A 5FRDA 1YIAA 1ML4A 4B1FA 1B1AA 3GLKA 5CPFA 4ZJPA 1IVSA 1TCVA 4DPLA 2FPGB 2WKSA 1KHTA 2YN2A 2GFQA 3R7WA 2BFAA 1HBJA 1L7AA 5KVVA 2DR2A 1Y42X 4W9RA 2HBZA 4PAWA 3OJEA 5EMJA 1WIWA 3REQB 4D4IA 5ICGA 2RGWA 4K9MA 1IU9A 5HUQA 3ME5A 3GZJA 1BH6A 3K72B 2BC9A 3FKSD 1E1LA 4C4PA 4DCNA 4ZVPA 5LZ2A 1OTHA 4GECA 4KL8S 3PIIA 3IUQA 4QUIA 3GUVA 4JR1A 4H1TA 5BMVB 3R3VA 4OXKA 1NBHA 3HY6A 2OLJA 4W1RA 1NY6A 1OBVA 4KQ9A 1E5QA 1GA1A 3RM3A 4QTUB 1LBHA 1OH7A 1JFRA 3REOA 1BS9A 4GR4A 2EDAA 3KKLA 2ZR9A 3DE2X 3MIZA 4N3CA 4OM8A 1JEOA 3U26A 4XIGS 4YQZA 3SIWA 4GYYA 4UXHA 3EA4A 1TMYA 1Z6PA 5J5AA 1LK7A 1I32A 2V0CA 5F77A 4YRTA 1R18A 2ZSBA 3F3SA 4Z4GA 1IJBA 3IPXA 1YZNA 4ERNA 4R2KA 1GNQA 2A33A 2EEZA 1PQYA 2VDQB 2ZIZA 4IIVA 2V6FA 2Y1FA 4QTXA 3W6UA 4O63O 5AVTA 4Z2AA 1ATZA 3UUGA 4XUCA 5EPOA 5F35A 4B4WA 3QVXA 4GEKA 4L6AA 5HIIA 1G16A 4IXWA 4IUCS 4BNGA 3FOCA 4WOBA 3R9WA 2IEGA 2BFFA 2Z8YM 4WGGA 4E5SA 1L7RA 1KZ7B 2OHOA 3LDHA 4DDUA 1RRGA 4LAFA 2IUTA 1IWPB 2MMGA 3VR6A 2FHPA 2DT5A 4D74A 5JVDF 1CUXA 4E4RA 5EVCA 5AJXA 2PGXA 1N7GA 1VE7A 3NJ4A 1A76A 2EV9A 3K8ZA 1L4NA 1R8YA 3VSDA 2C0PA 4NBNA 5MN5A 1Z2EA 2JCYA 3PYMA 4FI3C 2PUHA 1IBCA 1LQUA 1R4NB 4FNGA 3BWMA 2I6GA 3LQYA 2GR9A 3UB2A 3OWXA 1FSPA 2EKDA 3IH5A 3EZXA 3E2PA 4UU0A 2PRSA 4L7QA 2AGVA 1RWWA 4O2BA 4EVIA 1U8EA 3WYEA 1FTSA 2DH6A 2OCPA 3MJRA 2QTLA 2FEMA 1ZRNA 1QX4A 3E8SA 4DJFC 5C8VA 2MDTA 2PYIA 3MFYA 1H8HA 1SHUX 2OV4A 4QQFA 3O8QB 1YAHA 1DT3A 1DC3A 1OGYA 2WM2A 1MRZA 3BFPA 1JIQA 1SWVA 4YRBA 2BFNA 1MEJA 1ZA1A 3N0XA 1K8RA 4MKFA 3S27A 1G19A 2PS1A 4QSMA 5GAJA 3PGKA 1ZM2A 2WG0A 1RJ9B 1YL5A 3ULKA 1RQRA 1S2OA 1NBOA 1BU8A 1X9HA 2C2MA 2Z2JA 4W1SA 3D0KA 5EP2A 4OHYA 3RE1A 1YFJA 1GUYA 2H1HA 2M6SA 3HB9A 2XLCA 1HDZA 4RHEA 3I6ZA 2ERYA 3GN2A 3M4ZA 4QGGA 1GL9B 1T5SA 1AQNA 2B5OA 3F4BA 4JYZA 3HS3A 4MRRA 3MRSA 1VI2A 2ZJ0A 2ZCJA 1Q6ZA 1XEWX 4H7KA 3IUSA 2W2OA 5E2IA 2OZEA 2XHEA 3AR3A 5E1DA 3TEJA 3D6AA 3EGEA 3LPDA 4DMCA 2H5JA 1OI4A 3ZY2A 3IELA 3O4GA 1U0GA 1X80B 2CEAA 4XB1A 3TXXA 5CCXA 2IYAA 4RY8A 1AGNA 5F7ZA 5CPBA 4IWNA 2ZVPX 5BN4A 2DWQA 2CV2A 2ZPTX 2QSZA 4LJ4A 3QLUA 2ZBRA 5I7FA 3QXSA 4FM9A 3F5FA 1VBNA 1PNTA 1O95D 4ZT3A 5FIUA 1M6EX 1XEFA 2FP3A 4QECA 4Y2GA 2JI6A 1P1KA 4KHZA 4BVEA 5BT8A 2UZ3A 4CU2A 1QBGA 1J25A 4QU0A 5AVUA 2WMDA 2ZRQA 4IWXA 1KRXA 5K0GA 3HBNA 3LC0A 3HBFA 2CMFA 3PX7A 1EDZA 5ENDA 3RVLA 4Y6GB 3BRWD 3EOBI 5D2CA 3GPLA 4G36A 5BOSB 1DJPA 4MCAA 4K5QA 2FPMA 5DCUA 4CIVA 4DR6B 3QX7A 3WB2A 1XL0A 4GOJA 1T8SA 4KXUA 4BDSA 4J0QA 4AP5A 2QYSA 2WV7A 4X44A 3RRNA 2WUVA 2XUIA 4Z1MD 3K8OE 3CVYA 4DHEA 4LVOA 4MW2A 2BKUA 5AKKA 4E09A 5CFPA 3W90A 1P3JA 4DNFA 1RQ2A 3CC8A 3M7IA 1SVSA 3W1EA 3P4YA 1BDMA 2RB5A 2PXCA 2F62A 2P75A 5DHQA 1D4OA 4Q48A 5ALQA 4CQMD 1L1RA 5CVVA 5KKCA 4YO8A 2A9PA 2ECQA 4M49A 3TMYA 1AA9A 1KEKA 5FV4A 1FTWA 1WXGA 2EQBA 3T3PB 1SOAA 3KP1A 4HAUA 1QGZA 1YWGO 3LO8A 5L45A 3RU7A 4G67A 1QP4A 4DYVA 5AM4A 5SZKB 3PJDA 1YDMA 4X7BA 1C4KA 4FHGA 2NPFA 1VG8A 3V5NA 2ETXA 1Z82A 1LK5A 1ADBA 1T1RA 1H1TA 2IF0A 1V43A 4ND5A 4Y9SA 2VSNA 2Z5LA 3NIFB 4DR2B 1P7WA 3OCVA 3NIWA 1L4YA 3NV9A 2JD1A 2PEZA 3HA2A 3L07A 2RKWA 1XDZA 3NHFA 4AVYA 3N8KA 1Y4DE 3CSUA 4I2VA 2GCIA 1XV5A 3BFJA 3I01A 2GCGA 2XNKA 3FNGA 4OL0A 1U5BB 3NUQA 4YXWD 1DBRA 4UUQA 1ZM7A 5GONA 3CMCO 3UFBA 3AIKA 2OCLA 3FOWA 4IQFA 4D0NA 4FFWA 4YCCA 2IXTA 3VNVA 4GGOA 3PQ3A 4X66B 5FWYA 4KB5A 4IHAA 4QHTA 4EI7A 5JNTA 3KDPA 4D25A 2Q3BA 1FNNA 1E2IA 4OHMA 4P7JA 1E8MA 4OBXA 1RYNA 1ZOIA 5JZ9A 2ZYWX 4S05A 1ZAYA 2OE2A 3MJSA 3I9NA 4WJKB 4OK5A 1DB3A 3U3ZA 1GZ6A 3AHGA 1KJYA 2G9VA 2UZ1B 5JZVA 2PCLA 1E60A 1W2GA 2WSMA 4NK5A 3SR0A 3JQQA 3ZYCA 1C3OB 2E49A 2XD4A 3ORSA 4QELA 5DPMA 4ZGBA 3G2HA 2Q99A 3PQDA 3CLTD 3D02A 3NX4A 1UQRA 3HYNA 4TRRA 5E3HA 5KVCA 4I5GA 3NDIA 2PX2A 3EPLA 2CLSA 5D5HA 3NEJA 4HVAA 2CNWA 3VR4A 3IOEA 3FUUA 3L8CA 3OBBA 1M5TA 4CM6A 5JZOA 2BIFA 1Q1GA 2R2GA 3L49A 3U48A 1ECPA 4WJLA 4UBIA 3HKEB 5JROA 5H59A 2GZDA 3UMFA 3MAAC 1EFVB 2NZWA 4B6PA 1PW5A 2YDYA 3COSA 1Q0QA 2CLHB 3H2KA 4KN6A 5CX1A 4KX3A 1SG9A 2Q5HA 1QAMA 4M9RA 4WINA 4PZDA 1NKSA 3BTVA 4QUAA 3ENQA 1L5VA 4XD7A 2WD7A 1YI8A 2HGZA 1CHDA 4GMKA 3DJFA 5AHXA 1LW6E 4UUMA 5E6RB 2XKKA 2HBQA 5JWRA 3K4HA 5CA0A 1AA6A 1M2FA 1BDIA 3S2SA 4TKLA 3J80A 1MP0A 5LQJA 1W88B 3WA6A 4O2BF 1KYZA 4PSCA 4R51A 3WAKA 2FN8A 1U2TA 4FC6A 4BVBA 1FP7A 1W1WA 5KNDD 1K6IA 1LJLA 4YMGA 4DWJA 3FH0A 1VSQA 4F8JA 2O3UA 4PYLA 4DSNA 4BDTA 4ZMSA 3I2JA 3HR8A 3B6KA 3CEJA 1T2VA 3DDSA 1PBTA 1DEHA 1FFGA 1MUUA 2PQ2A 2WD9A 3STUA 1CR2A 1I0ZA 5K6TA 2CLIB 3QE0A 3D4PA 1SY7A 3SHWA 2IZZA 1GN9A 4JBLA 2X1HA 3BOSA 5GVRA 2VWQA 5K51A 5JTTA 4NJOA 2QQ5A 2ZQ5A 1DIOB 3SS9X 5AMXA 1EUCA 5D6NA 1DIAA 1UOPA 3CJTA 2Q9AA 4PXYA 5DBFA 1XP5A 2V96A 1JDZA 2ERXA 3WGQA 4F8EA 1XWWA 3BB4A 5G0UA 2C5EA 2XGJA 4H0NA 3VBCA 1E2BA 3ONFA 1WW8A 2BF7A 4X6XA 1JS1X 1BA3A 2G08A 1TXGA 2JL1A 3GLHE 4QBTA 4A23A 1RACA 4CF5A 5EJ9A 4NFSA 4PR3A 5C31A 3UC9A 1OB5A 3N86A 1E64A 4UHEA 4AXXA 3M6XA 2BFBB 2MOKA 4TMYA 3NRCA 3HCAA 2B30A 2O52A 2CY0A 4LTNA 1E9SA 3QVJA 4JP1A 1F2DA 1W93A 3T5CA 5BN3A 1BJTA 4BMVA 3RYTC 2JJQA 4EARA 1S9DA 2AZMA 1IBRA 1FU7A 2CNOA 3HRIA 4Z54A 4ZRNA 4IILA 5DRYA 7ADHA 4IHKA 4UTRA 3FOFC 1R3DA 3B38A 4YJ3A 4D9GA 1RXCA 4O1HA 3T41A 4AJ1A 1FYFA 1PHPA 3AGPA 3NATA 1KMNA 4HGYA 1GWNA 2ORIA 5CYGA 4ZC1A 3UQYS 5B57C 3QENA 2WHYA 3Q3HA 1JR3A 2J31A 3GK3A 3IPLA 3KOOA 4UAVA 5EGSA 3TF5A 2XKAA 3AKEA 2GEKA 3ILVA 1I13A 4AC9A 3DAHA 2ZUSA 4PCUA 1W85A 2X2OA 3I0MA 3FETA 4XX1A 5CXQA 1K06A 3QOFA 4RA6A 1A5SB 1B42A 1ZLYA 3L01A 1VTKA 4FVTA 4ZVVA 3CZ4A 3RODA 2CBXA 4FBLA 4EJMA 3ZD6A 4WT7A 3EAQA 2IXAA 4CLEA 3HP7A 4Z0TA 3AR8A 1IG0A 2C04A 4WCDA 3ELBA 4FYHA 5KYYB 2WTNA 3LPAA 2G04A 3GVPA 3JRXA 4OMUA 2X0DA 1NU6A 4WUTA 1ONBA 4R8LA 1PJSA 2AQIA 1MPXA 3LQ2A 2DQSA 1JLSA 1VSBA 2A5FA 4ZZIA 3UXYA 1OROA 1REQB 1XZQA 2P3LA 3NHLA 4P4UA 2EAUA 5J2TF 2HPZA 2O9JA 3P0IA 1F5NA 1E3DA 3KDAA 4R1NA 4V0SA 3WHIA 2GN2A 1QHYA 1H66A 2GXQA 3L2OB 3QH4A 3TI9A 1CDEA 1NXQA 1GY8A 5IKMA 4WACA 1J8YF 3B8HA 1EFHA 2O07A 3GEEA 4I36A 1HG1A 3EFOB 5DYIA 2JIMA 3RSZA 2FFQA 4Y2QA 1QOQB 2APJA 1KJNA 1O77A 5L7TA 4BASA 3FHLA 5DEOA 3UJPA 4V2UA 1QRTA 1EZ1A 3EZ6A 1PJ4A 1IUPA 2VN8A 3IEMA 5EG5A 5IK2D 3CO0S 4IQ8A 5JATA 4FFNA 3E7FA 1PJRA 1KVUA 4YJFA 2JCXA 4CKEB 1P0QA 1O08A 1V2GA 5LNK1 3SDSA 1T5TA 3I45A 3L8EA 1RAIA 2WWTA 3EFBA 2CDNA 3LJKA 2IV7A 2BFEB 3TLCA 4DMFA 3J81k 2WQ7A 1E7QA 5DF1A 2VPPA 4R8SA 5H1YA 1L8XA 2GM9A 1SA0A 3RTGA 1DU4A 1PN3A 2OXFA 3H7AA 3L1IA 3NFRA 3P0JA 2HA4A 3NTVA 3FTFA 2PMEA 2Z9CA 1GPLA 5F2KA 3AUXA 5DNEA 1JG1A 4LGCA 1ZSYA 1XMPA 4CTNA 5FNVA 2J4DA 4L85A 4UM5A 1D09A 4MWGA 1J8VA 3EZLA 3GRFA 3P97A 3VZPA 4N6OA 1PHRA 2CKDA 2GS9A 5CNJA 3T3EA 4DSOA 2VHXA 5C8YB 3T95A 5E38A 1WLSA 4TLBA 1A8SA 2FFRA 2AG5A 4HDRB 4IIJB 1V8PA 2IY9A 2F55A 4OA5A 1IHUA 4BX3A 5DTEA 2GZSA 3CTMA 2WMNB 4RVNA 2GZMA 4AJ9A 5JBNA 1WXQA 4HNUA 4DV5B 1MLDA 1YS1X 4OK3A 4Y1RA 4DQUA 5JJLA 1HX7A 3JYPA 1AS3A 1QZ3A 3RAJA 1UFQA 1J70A 1Q1NA 1Z0IA 1R9MA 2IPOA 1M6VA 3H9JA 3KTAA 1V95A 2GBGA 3F3YA 4HWKA 4TL7A 4V02A 5EJMA 4C7MA 4DCOA 1JWAB 2C2XA 2PGDA 3OD1A 4EI2A 1U4OA 1UM9B 1XB2A 3NAMA 3GEMA 1GAJA 4R54A 5DIZA 1QM5A 3HDTA 3S68A 1NI5A 3RFXA 3JQEA 1SBQA 1TVKA 1QMGA 4GFDA 2W00A 1FP6A 4RCYA 4YRFA 5CA0F 2GBIA 1NBAA 4LZZA 4ZQEA 4JC5A 2NW6A 5SZIA 4Z51A 1V4NA 3V4LA 4IEIA 3ZQJA 1PFYA 2XZTA 3IGFA 4KXLA 3CX8A 1KOGA 1QC5A 4TRMA 3TYXA 2QRVB 3THWA 4I3HA 1FC0A 1W36D 1RKUA 1IBSA 1KK3A 2O8DB 3ZU3A 3PPXA 5EYPA 3UKDA 2WAXA 4ZEMA 4YMLA 2J09A 2QTMA 3QKSA 3GWGA 2D1SA 1KZ4A 5BQPA 4A0FA 1ZXXA 1VKNA 3EHDA 2P65A 3DA8A 2W6JD 3ABRB 2IX9A 3INRA 1SVWA 3PHIA 1N8SA 4QQ8A 3USCS 2Q4TA 4MQEB 2W2KB 4MH0R 3REFA 3GGOA 2PVPA 5CJ2A 3T38A 4A5OA 3LCVB 1UOQA 1RP7A 3T4UA 1GRQA 3H42B 3PLAE 3LVQE 4E13A 4AW9A 5E2BA 2R6JA 3L7YA 3GCWA 3WJ7A 1MQAA 3ZIAD 4DC0A 4U3JA 2B69A 4KXWA 1U9IA 2Y27A 4WECA 2Y1EA 3BD9A 2MYUA 4WBXC 3NEYA 3FDZB 4R7GA 5C5IA 3H9QA 4P4GA 4A1FA 3OO1A 3MHPA 4B6RA 4GOND 1LK0A 1RRFA 2BGKA 2FSVA 4KQ2A 3L7IA 3FX2A 1M73E 1T13A 3ZY6A 4YECA 3F6CA 1NXXA 2EBWA 1IHPA 2YYZA 5ALUA 4TTTS 5GPBA 5ADHA 1G0OA 2H4FA 5IUNC 3FTEA 1KEZA 1N5OX 1Z17A 3GFRA 2XDQA 2BV3A 1IY9A 3VKWA 5J2UB 5AVYA 3GPDG 1Z39A 1H0KA 2NTVA 4J6EA 4NJMB 3ONVA 2XUZA 2ZKIA 4RPCA 4ITUA 2LCQA 1PCXA 2YBEA 3JARA 1L1EA 3KSBC 4YJ3F 1IPFA 5EEGA 1K68A 2V54A 1YL6A 2PGIA 2Z8YA 3D8SA 2CUKA 4B6OA 3NQ41 1KGSA 4JCCA 4URFA 2PD4A 5LPNA 3ITDA 1GZ7A 4BVJA 3MRVA 2ZYSA 1GVNB 1WA5A 3DBVO 2PMKA 3QLEA 4Y6SA 1RWKA 5ALKA 3SS7X 1M66A 4DEVA 4E1BA 3Q2IA 4O4JB 4CM7A 2SCUA 4OFBA 3JAMA 3JAKA 2PUVA 3HNRA 3I4LA 1N5MA 2HRDA 4IVQA 3ZY5A 4BO9A 5K5EA 2BBWA 4HRVA 3FW1A 2C5HA 4KBGA 4LVNA 2VTKA 3IIKA 3L8FA 3PJGA 3OZ7A 3R09A 1QUFA 4JVMA 1PVOA 5JYCA 2GILA 2ACEA 1E79D 3H13A 1EG7A 4PLWA 2QTRA 4I1YA 4KXQA 2ZRPA 5EJIA 1NAIA 1YC2A 3U2QA 1V5FA 4AWAA 1CUEA 4M7PA 1GUZA 3U4DA 5FPYA 4KPEC 4EUSA 3DBOB 3DMPA 1MVNA 4FCTA 4OHPA 4RQAA 3QVUA 1HM5A 1WSDA 3N0VA 3QVLA 1E4YA 4GVXA 4KMSA 4WESA 5LMUB 2XODA 1F1JA 2C2GA 4OGKA 5AO9A 5I7HA 1ZSVA 3K0BA 4P34A 1YMVA 5FADA 3DDUA 3MELA 2JKVA 1HL7A 1Z0ZA 2A9OA 3C1TA 1Z4MA 3D6FA 3ELYA 4O08A 3BJMA 5FUWA 3SLRA 3W8NA 4CPDA 2VA8A 3A9SA 1TKRA 4AIRA 2HK8A 3HUUA 4L08A 1G21E 2LDXA 4GMFA 4DC1A 2XHZA 3LYUA 3ZD8A 4PFKA 2AYZA 1M1YA 2PUJA 2EJVA 2EVWX 5FBLB 4YBZA 1M8JA 1D1TA 1Y81A 1UT5A 1NP6A 3N59A 1RMQA 2HXYA 4FZJA 4I9NA 1MTZA 4D1YA 1MJHA 4FCCA 4YWHA 1S2DA 1N32B 5ALZA 2RGNC 3VR0A 3FZQA 1JFVA 4Z7JA 1FOEB 2ESRA 2G1KA 2J3IA 4M0KA 4MS1A 4RESA 1K4YA 5T3YA 3FCEA 4PGAA 2O59A 2QPAA 4N0EA 1CCWA 5AW6A 4NU8X 4YVFA 1FX0B 1OLOA 3MT7A 4E2YA 3GY0A 4DBVO 4F86A 1AXRA 4LSGA 3VJMA 4QFDA 2ZXEA 1LSUA 3OQVA 5DZSA 3G8AA 3EXAA 4HATA 2PXXA 3RJTA 4HPJB 3GLFB 5FNVF 3SKVA 2Y1XA 5E6UB 1YZQA 2FUKA 3CEPB 1W581 3OOYA 2R2AA 4S0ZA 1IY1A 3WI7A 3ICCA 1YUBA 4TV8F 2HHJA 1T5LA 2ZDGA 2GZHA 3A25A 2BR3A 1XKXA 4GG1A 1DIRA 3K0CA 2I6TA 3W7AA 1J06A 4IIGA 4YUYA 4HEHA 3ADKA 3E3AA 4HLCA 5FAXA 4JKOA 2NU9B 3RUIA 4A6PA 1EBFA 1P4SA 2D00A 1DBPA 1XMIA 2YHIB 5DWDA 1SIOA 1Z38A 1C3EA 2HCRA 2UAGA 2C9DA 4JT4A 2ZB7A 2O50A 3R7AA 4RMIA 2JLVA 2H00A 4YJHA 1DEOA 3BGDA 1YCDA 1O9BA 3LYAA 3M89A 1ACLA 1ONPA 5EMNA 3SNHA 4BVGA 4EELA 3LY7A 3ZV3A 3HEBA 5DTIA 4B09A 1EE2A 2BEUB 1JDTA 3LKZA 3R7DA 1ZIYA 3D8NA 4GR9A 3L92A 4FHZA 5BSKA 4BLOA 2KLBA 1KZGB 2RGAA 3QX9A 4AN4A 4HDSA 2YWCA 2XYHA 1PJCA 1L6RA 4I8IA 3OPYB 4OX9Y 3EJWA 4V1CA 3OQ1A 1EEHA 4YO7A 3JQRA 3AZPA 1E2KA 2GAOA 1IPEA 3TLBA 1UWLA 1V7CA 2B8NA 4WZZA 4YRJA 3K1JA 4HH4A 5CR9A 2P79A 5AYVA 3UFXA 1VXRA 1WXHA 2CVQA 2R44A 4GNKA 3EZYA 4HSEA 3NGMA 4H3HB 5C2JB 3HMKA 2FUNB 1UWVA 1UP7A 4MI3A 4HB4A 2EW8A 2ZS7A 4GLOA 1WHTB 1X38A 1WAMA 3OOWA 2P2LA 4HNAA 1E2FA 4GRAA 4LRXA 1JLHA 4N9WA 4O5AA 5BWBA 4R2XA 1AURA 1NP7A 2GT1A 3UICA 4HRAA 4DIOA 2HUPA 3EUAA 3KO8A 5BN5A 5CLQA 2R1ZA 2HQOA 2EWVA 1EXVA 2QL9A 1EBBA 1VB3A 1L5GB 3RTCA 4Y0VA 4JJGA 3I5AA 4IXDA 1KAHA 4O4IF 1EVIA 4TLLB 5B1YA 4IEFB 3LHSA 1M0EA 3U0BA 2PSEA 2FUCA 5K3SA 1J07A 3B85A 4RBNA 1IY0A 4ENPA 4Y9RA 2XIJA 3OCZA 1EFKA 2IEIA 4HK4A 3HZRA 1FMFA 2JGMA 3GP3A 3RRJA 2BDUA 3HXQA 1L4EA 3OETA 4E3WA 3PUVA 2Y77A 3LUDA 4YNBA 2F4VB 2QUZA 1E69A 1JTVA 1L0BA 3GRYA 4K9RA 1K5HA 4V03A 1HEUA 2ZBPA 3R3WA 1ORVA 1YRWA 2AWNA 1VPDA 1FYDA 1VE9A 3NTUA 3WWCA 1A97A 1OSNA 4HMPA 3NHAA 2G28A 5K8VA 1CULC 4TUYB 4BRUA 4ZAFA 1W0JA 3BIXA 2CXPA 2IJGX 4ILEA 5F5XA 1XN1A 4AICA 1N4AA 3H19A 4X20A 1KF0A 2VP2A 1ZJ6A 2A9JA 2MSEB 2V97A 5IF3A 1RXYA 3DLHA 2JK0A 2C77A 5BV2P 1HQKA 1KOFA 1U6KA 3GFSA 4HQRA 4KE7A 3DZ8A 4MRVA 4N3GA 3W5CA 1OXUA 4QPDA 4YMSA 3NWEA 1JKJB 2I2BA 3GROA 2X4GA 3H9BA 3RCBA 1ZCJA 4NCJA 4QE3A 5DULA 4C89A 5L3QB 4MJ3A 1GZDA 3QSYA 3N6RA 1LA2A 4MDYA 3IVXA 2Y67A 1V6SA 3FFAA 5HF5A 3A2KA 3DV0B 3LRTA 2V58A 1YR7A 3H3FA 3BQMB 4N18A 1Y48E 1M2NA 2H1LA 4B3HA 4OI1A 1YBMA 3H1TA 5C0OE 2RHJA 4MVYA 5EIXA 2ZAOA 5ABPA 2A3RA 2YVAA 4QEDA 5BRAA 3UVEA 3VR3A 1M72A 2GJ9A 4EI8A 3N8IA 2W2MA 1UDXA 4IIDA 4QVKA 2X2PA 2PZLA 3KKKA 5LCXA 1IRIA 2QF7A 3TZKA 3G9ZA 4K3UA 4ED9A 2YV3A 1Y4SA 2EFEB 2XUFA 4H4DA 1GPJA 4BWVA 1H5QA 1LF5A 1WXFA 3O82A 4IDEA 1PT5A 2OSVA 5MHTA 4PRYA 1QQ6A 1HXHA 2PAAA 1EQUA 3RWOA 1RKQA 1U1EA 4TLEA 4Q03A 2Y1GA 4BO3A 4ND8B 2ZRIA 3TLEA 1Y6QA 2I7VA 3K9LA 3CW9A 1TZ2A 3EOZA 3NHPA 4AG3A 2WUGA 5ICCA 5JD6A 5JQGA 1KAQA 2NO1A 4LPKA 1AK9A 4A5SA 4CKBB 3OFJA 3PEWA 2VOJA 2QRUA 4UBMA 4DCPA 1G2QA 4LOHA 5B3JC 2V1UA 2QI9F 1NLFA 2DCUA 4WOPA 3HVIA 1E9DA 3H0KA 3ORQA 5EJGA 2JIBA 2BEKA 2HGSA 3B12A 4UHFA 5DHPA 2NYVA 3H9EO 621PA 1SUWA 1FDSA 1RXEA 2V74B 1RNLA 5HWSA 5JO9A 1VI5A 4MWBA 1BN7A 2E6UX 2VJOA 4EJ2A 1RS0A 2XNJA 3B2QA 2C8LA 3JYLA 3LCMA 2FEAA 3G0GA 1CQJB 5DHAA 2H4HA 4F2PA 2NX2A 1WL8A 2ZYHA 4LFCB 3A26A 3KOZA 4S04A 3ZKAA 4XVRA 4EO7A 3ZHRA 3W9BA 1SZCA 1CLUA 1DKUA 1E2DA 1P6XA 3KJIA 4BMCA 2SKEA 1SXJD 3GIDA 2XQVA 2OV1A 1V5GA 3LUGA 3Q2OA 5BPFA 5JFGA 5I7SA 4QODA 2H63A 3EVNA 2GOYA 4BN0A 1L5HB 3AV0B 1Y3CE 3MUFA 1XZIA 3SYTA 3WFZA 3MJHA 2HK9A 1ABFA 2CLMB 1DTSA 2OBFA 2VSXA 2ZE7A 4M0MA 2Q6LA 5AQEA 3R7NA 3AW9A 5FCDA 1JE0A 1P17A 5K05A 4K9DA 4NZPA 2XMDA 1ZK0A 5KC8A 4YMIA 4QYXA 3V4RA 3NJ8A 1H0RA 2H0QA 1HYHA 3A4IA 1LWNA 2F3SA 3WDSA 3BBPA 4CETA 3BMNA 4Z53A 1MJNA 1ODFA 2EP5A 2ZJZA 3QVOA 4N8DA 1U7PA 4RPGA 2NYUA 2PDAA 2WLTA 4YP9A 3FZYA 1UQTA 1DAPA 5LP6A 1IBLB 3JXEA 1QG4A 1OPXA 1YRBA 2OQRA 2RI1A 4QREA 4TSRA 3WMXA 4JI2B 3AVOA 1Y3BE 3L0SA 1T0UA 5E8JA 4DQKA 2XRYA 2RBEA 2C4KA 1QO0D 2P9CA 1KGDA 5JEEA 1E94E 1O6CA 4MA0A 2F8TA 2C2BA 2PKQP 4KYIB 5BQOA 5HK9A 5JRZA 2LP4Y 1PGQA 2WT9A 3NKFA 5ARDA 3O0DA 1WOYA 3QUAA 4J1QA 3RSGA 4YFYA 4NL4H 3NDPA 1MH1A 2VHEA 4NU0A 3W7VA 3HKCB 2HUNA 1VM6A 4F9EA 4UJ5A 2FTKE 4HN2A 2KBFA 2DMRA 3V1LA 1O57A 2XY4A 2Y66A 2ZJ3A 3CE6A 4HAXA 5ALSA 5TQ2A 4YDQA 2EKPA 3VYSB 1KXZA 3CUUA 5ELMA 4WMLA 3TXYA 1DEXA 2GRUA 3ADPA 3AY7A 1DBQA 4KZKA 4XGQA 5LZ5A 3PU6A 3KS9A 5AESA 2IHTA 2BONA 4BGVA 5IVPA 2YXLA 5EZYB 4MMXB 1SIUA 2IHYA 4KACA 4QD3A 4GKAA 4BBAA 3H17A 2QV7A 1FDIA 3PA6A 3PHHA 4YJ2B 3P7MA 3KD3A 1T9GS 3P2KA 4F97A 3RREA 1MQSA 2J4CA 3HB5X 3JZMA 4PFQA 2ZW9A 3U49A 3WL6A 4ALKA 4NNPA 1PJ3A 3I62A 1M83A 4RJTA 2PUDA 1T1GA 4JJKA 4MWSA 3K73O 4NLLA 4FZ3A 4QGHA 3RKRA 1UBFA 3JWHA 3AJAA 2ZE6A 1TYDE 3CEHA 4DW8A 4M1MA 5LQRA 2FDXA 1XZMA 2FOLA 2I7TA 3EW9A 1U0NA 1V3VA 1T25A 2Q3MA 3GZ4A 4OHUA 1KORA 2WIDA 4ZZ1A 1AG9A 4FWBA 1I3NA 4KO8A 1SC6A 2VT7A 1NPDA 2VDNB 2QXTA 2XE8A 2ZWOA 1HOTA 1I1OA 1KXJA 3AC0A 4EF4A 3BDAA 4EABA 1MT3A 1PTKA 5K1ZA 4K9OA 2YJGA 1JXQA 1WW2A 3HYCA 3B9PA 1L2TA 4EFDA 1YOVB 3AI2A 3HU2A 4YWJA 3UT6A 1OVGA 1O4WA 2W2LD 5KNBD 3TZEA 2IV2X 1J8DA 2V59A 4MUNA 1LPPA 1C8KA 2YWXA 4L8WB 1K8YB 5DM0A 3REGA 1SCDA 2AZTA 5J23A 4LJSA 4KPUA 5ITVA 2IY7A 1ILEA 2P4EA 2VF7A 4KODA 2PQ0A 2X0IA 3DE1X 3DVLA 1HSOA 2E3JA 2MSLA 5G0TA 4JELA 4RHUA 2VHJA 4CUKA 3KALA 2DHRA 5T41A 3TAHA 2Z5FA 2R7MA 1K9SA 3D6MA 3N2IA 1OB2A 1JLLA 3GLHB 1HTWA 2LCIA 3MERA 3AFNA 4UAJA 3TOCA 3NH9A 2O0LA 3R0XA 2WPNA 3CW8X 2QRPA 1RLTA 2UVPB 4RK0A 9GPBA 1ODLA 4L2IA 1ILWA 1CLEA 3FRHA 4TXJA 1H3EA 2R8YA 4G4IA 4TTJA 1HF3A 3WLJA 1PYOA 3VR5A 3E3MA 2V4ZA 1JHPA 3ER6A 5J40A 5LQDA 2H48A 2JFHA 4AQDA 3AIOA 1ZCZA 1TQDA 4E6PA 3MS7A 4JOQA 2W2QA 4MLDA 4Q3OA 1J0BA 3TTYA 3GEHA 2QUAA 3E9EA 1CNFA 4UAUA 4DA4A 2JASA 2AJCA 3M6FA 3H1EA 5LB2A 5HSGA 3FCSB 3P26A 5HZHA 5I51A 4GM1A 4G4GA 2VRWA 2PVCA 3OJLA 4I5IA 3DLTA 4H6WA 3CF0A 1PR3A 3H5OA 1A9OA 1KP9A 1U7WA 1TMOA 2B4RO 2BP7B 2JVJA 2O2ZA 2WJJA 3BCSA 3EIWA 3IA7A 1UH5A 4GS5A 1NW3A 3EY4A 4PLZA 1T1IA 1ORHA 3WXBA 3CF2A 3QLUC 3QVSA 4MIKA 1CPYA 3AP1A 1UPCA 2GN8A 3M4NA 3OX3A 1KDVA 4BV3A 3GCXA 5CD9A 1B6RA 3M5PA 1I2BA 1RC0A 3IOYA 1GU0A 5JQGF 3ADBA 1CD5A 2OV3A 2QX7A 5KUTA 1Y6JA 2P3OA 4YJGB 4N5MA 3NDBB 1V7ZA 1U1IA 1A4UA 4M1OA 2AG0A 4ND1A 1I7NA 2Q0SA 3WDMA 4BMXA 2W2VA 3ND9A 4Q7MB 3KC2A 5JNUA 2ZRFA 3CJRA 1UOOA 3T9DA 2ZXUA 5SY6A 1GNVA 2YC2C 3HZHA 1QKIA 1XEXA 2ARKA 2J6CA 3WK8A 1R0BA 2PJZA 3GCDA 4H3SA 3C1AA 3ZDXB 1JQLB 3U4GA 1PNQA 2JS7A 4BPRA 4RD1A 2IWRA 4LYEA 1DMSA 3KXKA 4LHEA 1OBHA 2G5CA 5BSUA 5ER9A 1JPNA 3P9SA 3LL7A 3E9MA 1BG6A 2JLBA 2XMRA 1DAMA 3DXYA 1GN8A 1G17A 1FPMA 1N6LA 3SBOA 5LD2C 2ZVDA 4JSTA 2CFTA 1PU2A 2OK7A 3ONDA 2VQ3A 4XYEA 2HZ7A 1RKXA 2P30A 3GARA 1U3FA 4JNKA 5ENZA 4I4TF 3CPJB 1EVJA 4MQ5A 1N6NA 4Q7JB 1YR6A 4FBMA 2OL4A 3C15C 3DCJA 4JEHA 3A6GA 3KU4A 1OFGA 1Q83A 1MIOA 4EP1A 1C7FA 5JXJA 3R5JA 4U8HA 3LDFA 3S70A 2P67A 2WF9A 3THYA 5DNYB 1O0SA 4J9VA 2JLYA 5CGQB 3DDCA 2EBHX 1QNLA 1X1AA 2IPXA 4K46A 4JA2A 4D4MA 4URHA 3KQUA 4FJ1A 2YUIA 3JR7A 3FVTA 3O3NB 4HB2A 3L3BA 1FFEA 4P58A 1L7BA 1R64A 2M9MA 5K0LA 4YPVA 2X5XA 2ZS8A 4JLWA 3RTAA 5BQFA 5HHTA 4N4AA 1ZMXA 5LP6F 2QQFA 3VC7A 1QTQA 1BWQA 1Q3HA 2OCYC 4TLAA 3U7FB 5KX5F 1QG2A 4ZT2A 5IMSA 2AL7A 2F9LA 4KV9A 4NECA 5KMGA 4KQWA 4ZVRA 1E59A 1PD1A 3TN7A 2JFWA 5KSWB 4B2PA 2EGHA 3F67A 4UULA 2OTCA 1PDVA 3KAJA 2HT1A 2QV0A 1P72A 3ZXSA 1Q2XA 1EFCA 2X0NA 5EWLA 5DNUA 3GW8A 2ZJ4A 4UTPA 4EPTA 4HH0A 2P2SA 1XWIA 1DPFA 4F5DA 5CDFA 4MUFA 3R9XB 4JU8A 1UXHA 3DDZX 4X1IB 2PL9A 3ZU5A 2NPOA 1VYVA 3AHHA 4GH5A 4GLBA 4IG4A 3K9NA 3RH0A 1WSAA 2JIPA 4OAPA 1MX9A 3GELA 3WO1A 3X3HA 1SVKA 3FHCB 4DCCA 1ZVJA 1AJEA 1U3DA 2ZAIA 3ESZA 4RK5A 1BFKA 1XUOA 1IY8A 2K87A 3I1JA 3MAGA 4IG9A 4LSZA 3QU4A 4NULA 1T8TA 4RA9A 5JLAA 4DJJA 4BBJA 4EA8A 1FP4A 4FNAA 1MVLA 4PYOA 1C0PA 2F3RA 3HDJA 1H1LA 2P9YA 3I92A 1ECGA 1YRQA 1EGQA 3NBKA 4EMBA 5B64A 1QG6A 2CLDX 3L8YA 3RIGA 5LMZA 3ZZTA 4U7DA 3E8MA 2ZXFA 4IGIA 2GDZA 1NJSA 2J46A 3DDNA 5CMLA 4EIWA 1F48A 3F8SA 3BTSA 1YHYA 3L04A 1TJ3A 3F1LA 2NACA 1GDDA 2XITA 4R1MA 3WKCA 1DJMA 3O2NA 4DCMA 1KO4A 1YZVA 2I5PO 3BKWA 3B1JA 3N3AC 1GFZA 4Q1EA 5G0SA 3OE7A 2XQIA 1GRRA 2CXSA 3RYHB 4PE5B 2CJPA 1CRQA 3L05A 1TE2A 4MB0A 4YPFA 4D4KA 3IKJA 3L4KA 2O8NA 5CA1A 1QGUA 4MR9A 1Z3CA 2CJXA 3V4SA 4DMRA 2G72A 1ZJ5A 4QNNA 3QU2A 5LKRA 8MHTA 1K6JA 3DAGA 1MABB 1PNRA 2IU3A 2XB8A 4KUHA 4KMRA 4U2DA 5BVGA 3VH1A 1ISGA 4MW0A 2Z30A 3P20A 4L4SA 4L1KA 2ZRDA 4PZCA 4Z4QA 1OBFO 3LXRA 2IXDA 5LDDC 3E9ZA 3FWYA 4L4RA 2DPHA 2ZIUB 1Z6GA 2A5YB 1I1HA 1QO9A 3FOBA 2YMPA 3ISTA 1WEHA 3WC4A 4BNFA 4QVIA 1X0VA 4F0JA 4O6VA 1Z0UA 4R9SA 1JQ5A 2VYCA 1GGEA 2IGTA 2IYUA 3H65A 3EGWA 5I9SA 3WTCA 2QTTA 2WHXA 3HABA 4BLPA 4CBVA 2HYIC 3S7TA 1CS4C 2NUAA 3BJEA 1I3CA 2Q3HA 4DSTA 1V5EA 4EPVA 3B9RA 5UKDA 2L42A 1L5ZA 2I1LA 2X0JA 5TGTA 4OUKX 1GM5A 1IXRC 4R6XA 1R15A 1TCBA 3E6AA 1NVWQ 1SVNA 2PWAA 4U6NA 1J5XA 2WNSA 5ELXA 4X91A 2RARA 1RT9A 2QZPA 3K6JA 2CD7A 4A0RA 2C8KA 4OREX 2QLMA 4XQEA 3EAGA 4HYEA 4NYMR 1NOKA 1TZMA 2QXUA 3ANLA 3ERCA 3OIFA 4FOPA 1WHSB 1ABEA 3TGWA 2R66A 3LP6A 3OZSA 3TSWA 3OOHA 4R01A 5J4LA 5JD4A 3NOOA 4Q15A 1NNI1 4OXRA 1KP2A 4BKQA 5L53A 5D3KA 2XMGA 3DTYA 1ADJA 3HXOA 2DHDA 2DM6A 2BFFB 1Q0ZA 4NCBA 1R16A 1Y4AE 3S8MA 1CUSA 1JI0A 2JAQA 3GLGE 2CHUA 1LLDA 3DTVD 2WUDA 2WF6A 4IWYA 2QVCA 1YRYE 5C8DA 1NXSA 1P18A 2WOOA 1WCXA 2AW3A 2FEWB 4M4SA 2W48A 2EX1A 3JYQA 1NUUA 2D4HA 5EJAA 2O7VA 5DYNA 1X6VA 5FL7D 5DN9A 5JJCA 4LF9B 3G59A 4C4YA 2AJBA 1Z56C 3C16C 3G8CA 4RHXA 4MQFA 1CS0B 1QYVA 4N5DA 4POOA 1KEEA 4UNNA 2QTGA 4Z5XA 4X3PA 2PWYA 2P9TA 5HIMA 3RTDA 3SR3A 4FZVA 4AJIA 4P0QB 4HLDA 1W4ZA 3V4ZA 5DU2A 4J2TA 2GBLA 1N1MA 4MRAA 4RMHA 4M1QA 3E1KA 1CF9A 2C83A 4WQMA 1JWBB 1P3DA 4OYLA 1TK2A 3TUJC 3RT1A 1LI5A 3DL7A 3EHEA 3H3JA 2B2XA 4RNDB 3W78A 3WRYA 4DZZA 1GQSA 5U4XA 2CBGA 4IJKA 2NSHA 1BQEA 5LQKA 2QMEA 4MGKR 1KZYC 2BF4A 1NR1A 4G0PA 4PX3A 3OX4A 3VDRA 3VJKA 4YUVA 4FKMA 4BJ1A 1ISMA 4Y9UA 4IH1A 3LK7A 2ZUTA 3SF8A 3PE6A 1ZD4A 4L02A 4MA4A 1DV1A 5CITA 4LRSB 1BJKA 2GTIA 2WJVA 3MCAA 3W5VA 1DLJA 4W9MC 1JSZA 2PANA 4L50A 1IZ9A 2E85A 3DD5A 3IO5A 4G5QA 2EBUA 2EL9A 3H2GA 4MW9A 4NH0A 4XB6B 3O0TA 1Y1PA 4UNSA 4CR6A 3KZMA 5BV0A 2PLWA 4LCEA 5C7OO 4KDFA 1STOA 4FGUA 3WRWA 1N9KA 1URPA 2BI8A 1AKNA 3HYSA 1QLJA 4MUJA 2A0YA 3G2KA 4IAOA 4TWBA 4WFKA 3ABSB 4FOOA 1I1NA 4PLFA 5DX0A 4D9CA 4EFMA 2HRQA 3ZNNA 2E48A 4BKUA 3E9CA 2YHSA 3EC2A 1XK7A 1NVVR 2J08A 4GZLA 4KQFA 4M0PA 2BMDA 4XGNA 3RS4A 4MWDA 3TR5A 4ENTA 1YFLA 1US8A 2BCEA 3TIFA 4AJKA 1NTRA 2BCGY 2I8LA 2JFXA 4UW9A 1J0DA 2J6BA 3FG9A 3QVMA 1SRRA 2Z56A 2J32A 4MGHA 4B33A 3MILA 5TR9A 3KT8A 3IAS6 3L6BA 3RG8A 1A5TA 5HK8A 3TAUA 1JJVA 2ROQA 1B3RA 1KK2A 1L6IA 1RYYA 3A6JA 4TMXA 4LVUA 4US1R 2PNJA 3T4XA 4B84A 1CFJA 2C4NA 2HU7A 3UHOA 3P71T 4G2TA 2P2YA 2QJFA 2AHOA 4P1ZA 3SQOA 4E5MA 3C7AA 3Q8MA 4FGLA 5L3ZA 1IVYA 4BNWA 5JXGA 2YXEA 3T3OA 1QAOA 1FDVA 2WYWA 3LA6A 5THQA 1TJ5A 3VZDA 2QR5A 4F5ZA 1MO2A 1RXIA 1UBRS 3DZCA 3KVNA 4ER5A 3FIUA 1PIWA 1K89A 1SOWA 3VR2D 1NMYA 5LD2B 5E0OA 1WETA 3CVVA 3DT6A 2XQKA 3D4BA 1L7DA 3VZBA 2DJ5A 1OLSA 1E98A 2H11A 1CY6A 1X7ZB 5AUPB 1XQ1A 1D04A 4YCDA 3H0CA 5A4MS 1MXHA 1PQUA 1ZN2A 2IYSA 4IDFA 3H2HA 3IE1A 1OWPA 3ZJTA 2XKBA 2VF5X 4YUZA 3A7EA 1LSJA 2O0HA 4FCVA 2J4FA 3Q2KA 4YGYA 3G2OA 4RF4A 3DL2A 3V8PA 5T64A 3KYCB 5L8VA 3OFKA 3LP5A 1BEEA 1I7PA 1JSLA 4NYJQ 4QXAA 4N9QA 1TD9A 4HDNA 2QT9A 5HMMA 3U1TA 1NC1A 4MVJH 4ZGWA 3CW2A 4N39A 4CM5A 4PTYA 2QENA 2WB2A 1QCCA 4G1UC 1DDOA 5EJ6A 2YCBA 3K9GA 1C8BA 1XA0A 5GONB 2IBMA 3CNHA 3LG2A 4YRKA 1XXHA 4TLMB 1X7WB 1R8XA 1QOPB 3MWEA 3MTGA 3QI7A 1IB6A 2Z1MA 1D1SA 1FDUA 3IRVA 3ROXA 5FWYB 1W4BA 2OCBA 3DHYA 3VZSA 2QUKA 4MCJA 1AS2A 1XZAA 3C5VA 4W99A 3UJ8A 2Q9CA 1PYDA 2YKGA 3ROMA 4EPRA 3LKBA 1SCUA 4BVLA 2BBTA 2GN0A 5HKKA 3X1JA 5EIWA 4WKGA 2AEFA 2W43A 2QZSA 1XD2A 4ALLA 4C0KA 3V2HA 3PD1A 1BKDR 3SJAA 3ICOA 3BXXA 5LZ4A 3JTEA 3QJGA 5E4YA 4L3VA 5HCNA 5T67A 4FDLA 4G4SO 4B3JA 3FOEC 2OBXA 3ORRA 3PRHA 3TZCA 1UCFA 3ZOKA 1V6CA 3L02A 1JEYA 1H2RS 3TPCA 1U9IC 3BB1A 5D51S 3OLYA 4L0CA 3AL0C 4J90A 2RKOA 1DNPA 3UWOA 1SCNE 1FNBA 3HU1A 3V7WA 1DWPA 3W5SA 1JAIA 4E1AA 4YRRA 3HR4A 1J9ZA 1BMQA 4P8RA 4G0XA 1ZOLA 1JFLA 3ZJVA 2FSVC 5LJIA 1S9HA 5KIAA 4KHPB 3KB6A 4JVSB 4YAWA 4BE9A 4PAMA 2GD1O 3RJ9A 1FMCA 4F1JA 2G70A 5CX1B 2QDKA 3FNHA 2Y0EA 3F9IA 4HX9A 2MSKA 1FQOA 1FTQA 4TSKA 4N41A 1JJAA 1P0FA 1TIBA 1HDIA 1OFUA 3DUWA 3SSNA 4EGQA 3D6TB 3G9XA 2WD7B 4KAJA 1QOZA 4JI6B 4FS8A 3P45A 1GZUA 3RUPA 1XZPA 3K09A 1N4DA 2X42A 3PPYA 4C3ZA 1UBLS 4BYGA 4CIAA 4G0NA 2BISA 3OT5A 1ORWA 3NBZC 4EKGA 4WK4B 1E0KA 2B7BA 3AFMA 3Q98A 4ZU1X 2C4TA 1WPGA 3X0DA 3OEHA 4P53A 3CH5A 1WWKA 3OZFA 1TMKA 2XVZA 4HWPA 2VDMB 1MD9A 1V41E 2J67A 4PNHA 3LTNC 1Z34A 4MQ6A 3KBBA 1D2NA 4I1RA 1Q12A 4UKDA 1IN1A 3K8QA 3I4FA 1H69A 1G9TA 3QKRA 3R3ZA 3OT1B 3QU9A 5ARCA 5JD3A 1KARA 1PVVA 2R86A 1KVTA 4A27A 1CQIB 3GUHA 2HOQA 2ZRLA 3QLVA 1HEYA 3EFHA 1YA8A 4IO1A 5ES3A 4KUGA 1ZH2A 3DMDA 3EVFA 4C0HA 1JEQB 3M8KA 4DRXA 3BL8A 4CG0A 7REQA 1YS4A 1PL8A 4C6HA 3FKSA 3PDIA 4FIDA 4FYVA 5CDTA 2FMHA 4Q4DA 4YREA 4WLEA 3PEUA 2IEZA 3M6LA 1QH8A 1YTLA 3N7AA 4XFDA 5IUKC 3EG5A 1YXMA 4QJBA 4IKEA 4PO1A 1HG0A 3TM5A 1F5SA 1MRSA 2QM7A 3V4VB 4EY3A 4CGZA 3VU0A 4W1PA 2BTEA 4S3MA 1OYVA 4NRDA 3L8DA 4ZTBA 3AWIA 3LIPA 3I5MA 1X9IA 4TVOA 5D7BA 4QEZA 5A4IS 1E62A 5C53B 1W9HA 3J7TA 1ELOA 4YJKA 2GO1A 3KQVA 2D5IA 3TH5A 2R79A 4IINA 4Z49A 3A6DA 1GPKA 4R9VA 3WBJA 5HR5A 2I33A 4B5LA 3S2GA 3M0EA 1S89A 2GXUA 2PHZA 3IBCA 2IGBA 3OTQA 4V0ME 3QKTA 5LYJB 1RHKA 2BGIA 3IT0A 4INZA 4F4JA 1NKTA 2KWIA 4PX5A 4ZI7B 3VPXA 3LM8A 3UJ9A 1YK0A 2QMQA 3QXGA 4DTIA 3GQVA 3Q3IA 1PJAA 1UBEA 3ZW8A 3VKFA 1VMAA 1Y4UA 4DRYA 1T26A 1E1YA 1NT4A 2M6RA 3CIFA 2KPOA 5CB6A 3ZWAA 4GL2A 1IC6A 3PNKA 1UJ5A 3X1XA 3GDOA 3AEQB 2UU9B 4QWMA 3R1IA 3TE6A 2IHKA 4R1OA 3ZWNA 2ZWIA 2QS9A 2ZBEA 5SYNA 4GI5A 4WK0B 1H05A 1THGA 4FFPA 4UTVA 5I8WA 2DECA 2ZG6A 1W85B 3PXCX 2PYDA 1WULS 2QMHA 3D0QA 4Q3DA 5E9WA 2RBGA 3WGNA 4ANFA 3EPJA 2PKEA 4DXDA 3L4JA 2CL6X 4J0DA 1P6QA 2SBTA 4UXIA 2ISCA 4OQEA 4BNJA 3O21A 1A69A 4ARVA 3Q12A 4JQSA 1C14A 3LQKA 4R2IA 4XTRA 4N5IX 3UWDA 3P0FA 4CMJA 3FPEA 4D4LA 4IDNA 3K0CC 1ZK2A 2R6GA 2H2AA 3HCOA 3EQZA 4XXHA 3SKXA 3PR3A 4TMFA 1ISFA 1I3LA 2F1JA 4K88A 4NCKA 2JRCA 2B0JA 4PN3A 2R8EA 2TMKA 4KO1S 2Q3FA 2X5NA 1WLYA 1RPTA 4N5LA 2FN9A 4P3PA 4TLCA 3ZJUA 3O2SB 5DDIP 2Y99A 5TRTA 3A4NA 4KC0A 4DIMA 2A94A 2XTJA 2V1XA 4CF4A 4P98A 1FLAA 3CWCA 4LDRA 4Y0AA 1IIRA 5GJBA 2QTZA 4CUZA 1UK9A 4BAUA 1SOUA 2LZ0A 4AY2A 3HY4A 3ZVKA 1CY4A 2Y4NA 2HA7A 5I9IA 4EF6A 1ZGHA 3C3MA 5E9QA 1LBSA 3GMTA 4DIDA 1NNLA 4KK3A 3R74A 1JP7A 3MMPA 3PTLA 1PJTA 1V8DA 1CW2B 3PNPA 1G8MA 4CGYA 3MGGA 5FYQA 3ZDBA 1LI4A 2B9VA 1W96A 3D4NA 3L4EA 1BMFD 1YBFA 2PIAA 3N2ZB 4FONA 3T9AA 3WLRA 5JPCA 3GP5A 4O33A 1JFSA 3GLIA 1O95A 3H99A 3A28A 3G85A 4ZK6A 2GK6A 3B82A 1DSSG 3CUYA 3GJQA 4U7WA 3EVGA 3SZUA 2V0NA 4HWGA 2O6HA 4YUXA 5WRFA 2AJTA 1P60A 4POAA 1VCIA 2E6KA 3HXTA 2QLNA 1PRYA 4GGPA 2DUWA 2JGKA 4I9FA 2QRLA 5FUYA 4AF6A 4UNRA 5KQSA 5BQXA 2XCQA 3EGOA 4LBZA 3ZHCA 4KZPA 3BRWA 5BWCA 4E3ZA 2ZSHA 3U4IA 1WBBA 1OX4A 1G6HA 1JQDA 3CJQA 3LBHA 5C5EA 3OHPA 1TZBA 1HT1E 1QYRA 4PEVA 3F6EX 4K9QA 2PQMA 1FLDA 2FUG1 4ISCA 2B4KA 2GUGA 4M1KA 5KS2A 1GUAA 5I7RA 1KK0A 4Z1MA 3FMFA 4C14A 5KOHA 4DMUB 4CG1A 4O4LF 4KLZA 2C07A 2ZAGA 1TYZA 3VM6A 3T1YB 4Y1RB 1XMOB 3GJ4A 1QJCA 2QW8A 1EDBA 3NV7A 1GCUA 2P68A 4NI5A 4JL6A 3PIDA 3MBOA 4RFVA 5LVAA 3LSTA 4TS3A 3OQNA 3UZUA 3NYQA 5JLJA 4D9EA 1SC3A 5JCZA 3MT0A 5LLDA 2QNRA 4F3KA 3ET5A 3T06B 5FOSA 1QRAA 2FPXA 1KR5A 4YQYA 5BXQC 2VT2A 3HV0A 2AR0A 4MW7A 5LBTA 2JEYA 1IDN1 1EK1A 3LECA 4I08A 5AKXA 3VO1A 4F6RA 4RMNA 3GPCA 5MN6A 2PZEA 4GUAA 2BJVA 1Y82A 2VBGA 1T10A 3A1VA 4L5IA 5D01A 1ACMA 1QC5B 4MW5A 2XZDA 3S0JA 1APBA 3VR6H 5JAPA 2OCIA 4QXOA 5B7PA 3V7FA 4EG5A 3KPYA 3SHQA 3FPSA 4IGEA 4YXWA 1T2EA 1JMKC 4PZYA 3LX8A 4MUXA 1GZ5A 1KDPA 4BKPA 3W3AA 1J2RA 2FWNA 4II2A 4MIEA 3RJZA 2JLXA 4YHBA 1WPXA 1KSJA 1DARA 2VZEA 3G8DA 3PRKE 5AXCA 2P41A 2YWFA 1LNZA 2QP3A 3B6EA 5I7WA 3BSSA 1XAHA 2GVNA 3K6KA 1GTRA 4PIVA 3WWEA 2DFNA 1NXOA 3C3XA 4INAA 3LZ6A 4PINA 3BDIA 4CMEA 2K2QB 1GAWA 3F74A 3B3GA 1SQFA 1FDRA 2OT3B 3L0PA 5F51A 1DLIA 3WO0A 721PA 4Z4CA 4JC0A 4FHFA 3UF0A 5JNRA 1BVRA 4FHEA 2P9ZA 3A9VA 2B7CA 4OATA 5IJWA 3V48A 1I0LA 5SYMA 1KJJA 1GCGA 4ERXA 4PNEA 4R7TA 2WM9B 4GC5A 4WLOA 2C4VA 4QIHA 5KYUA 1ST2A 1DQSA 2FFAA 1E7SA 3AILA 2HIMA 1C4OA 4J43A 4G09A 5KKNB 3G6KA 3I8SA 3QI2A 3X43A 4CFSA 5BV8A 2C7VA 4RDXA 1Y1SA 2EHDA 2XDQB 1Y7LA 2YNMD 3WFJA 1VE5A 5JFTA 4Q9LA 1FSZA 3LQQA 4GVLA 1OXTA 3BB3A 2AI1A 5AK4A 4D9JA 2ZUVA 1TTQB 1M2HA 3EK2A 2O2CA 4EYQA 1UT6A 3CRQA 5G1NA 1QRDA 1ODKA 4RJIA 5JAUA 3T5MA 3C5CA 3TDMA 1HYBA 5M5BA 3CKMA 3EZGA 2HF2A 2Z9BA 3P2YA 4HNQA 3ZWPA 1X92A 3KPVA 4RL6A 4C9BA 2CYBA 3HSYA 1VKHA 3SBDA 2LPMA 2G09A 3QX8A 3OY7A 3S2ZA 3SIXA 3JZIA 1M9NA 3TSAA 4E46A 4W8HA 2GJSA 3TMAA 3D5QA 2SCUB 3VDNB 3JAKB 4WLUA 5K4GA 3UJDA 1FQKA 2OV2A 3PYXA 3R0JA 3U3DA 4D5GA 3MFQA 5A0VA 4ZYVA 3K3PA 4AS2A 4CQJA 2R60A 5CVEA 1EB9A 1EVKA 4EFKA 5LIRA 1OWNA 3N74A 5IXSA 1R1DA 5KNDA 4KJXA 4WKBA 2FZKA 2P90A 1CUFA 2P4HX 3SC3A 2GD0A 4P3OA 1UWCA 4LZJA 2AYYA 2I8CA 5K3OA 3GVXA 4LHWA 4CCAA 2QLLA 1I2AA 4G86A 1SN7A 2XDAA 2ZYDA 3GEGA 2P6NA 2BM9A 3LWNA 1M34A 4P4NA 4WESB 3UAWA 3AKCA 3EEQA 1G4UR 1UBNA 1WB5A 3A10A 4IIBA 2HREA 3OM9A 1B1CA 2J5XA 5B58T 2J0UA 3MCTA 1BN6A 3ZUPA 3GA5A 4UUPA 1A9ZA 1X1EA 2GESA 4M9XA 4N0PA 1W30A 2EFGA 1X86B 4W63A 3UK1A 3ZXXA 4A7PA 4DZRA 4QOFA 2D13A 1Y7HA 1CEQA 5LP6C 3ZEAA 3KQYA 1ODIA 4ZO6A 4AKHA 1R6TA 1L4BA 4OQXA 2HF8A 3HI6A 1KEWA 1J1ZA 1TTHA 5E3IA 2JJ1A 4QLOA 1CV2A 3R3HA 4HUQB 4C22A 3ZDAA 3RABA 4EBBA 3E15A 1H22A 1C9KA 3WICA 3MTIA 4PG6A 4B3XA 1KP3A 4Q82A 5C80A 2L17A 3QJYA 3B7GA 5IYZA 2XUKA 5DASA 2XRMA 3QZUA 2HK7A 5A7FA 3A6LA 1RWVA 1AHPA 4OG2A 2COKA 1AS0A 1QORA 1X1SA 3M6VA 3SM3A 4DFDA 1ES9A 4NAUA 4CEJA 5C5DA 4G1BA 1CP2A 4CN8A 3I2YX 1T9GR 2W2TA 1ECLA 2PZFA 3UB4A 1R0RE 2IEAA 3I9MA 1FJ2A 1EXWA 1U94A 1HOXA 1P2UA 1CF4A 1JEJA 3FLEA 4KSCA 4R40A 3W8DA 1K7FB 2O0JA 4RKFA 4M6WA 2G17A 1NF9A 2GVDC 3DUFB 1I7SB 1EZZA 1JIKA 5EXPA 2BBOA 1JDBB 3GLRA 5EN4A 3LAWA 3EVCA 3FWKA 3G02A 5DKFA 3HV2A 3OEYA 4Q4HA 5LM3A 1NJ2A 4W7HA 3HBLA 3MTQA 1CP3A 3IMKA 4AXBA 1H2ZA 4XLZA 4FNOA 1P39A 2CJYA 3G0IA 4JA0A 5EUBA 3ZG6A 3AOEA 4I1PA 2QZ9A 1QR2A 2R5WA 4KIGA 2FR8A 2VDPB 3LUCA 1VBKA 4WXRA 5EEHA 4H4CA 4YJHB 5LA6B 3KUDA 1SH7A 2W93A 2YWGA 1NW6A 1OMOA 1Y3AA 3L43A 4K6OA 2NN3C 5H80A 3MUNA 1OVMA 5EXTA 2HN9A 3A3OA 3NWOA 5JG7A 3E4DA 1N6PA 3O7WA 4JHXA 3KKZA 3ZHUA 3MQ4A 3H6GA 3VR4H 5GIPE 3U1VA 1Y6FA 3Q3CA 3WL7A 1ZNWA 1C8VB 1M67A 3L7MA 4HDSB 4NZYA 4P33A 5HNKA 2JVIA 1TF2A 1ZWKA 2PQ6A 1C29B 4V1CB 1IWBB 1PJZA 2CL7X 2EGUA 4YALA 1W59A 3RC8A 5TF0A 3PDCA 5AXBA 4D8XA 4ND6A 3UFXB 4TTVA 1TO1E 1VBMA 1VKOA 2ONKA 4ZCLA 4ZI5A 3RHFA 1INLA 3CSDA 3ZD9A 4QAQA 2PTGA 2GAAA 2B36A 3QE2A 2QE7D 4PR0A 5AM5A 2ZWPA 3QYAA 2IS1A 3P32A 5AQ1A 1XRSB 3VHLB 3HNOA 5J47A 3LSYA 1SR8A 2P8JA 2A0XA 2ZIXB 1R0KA 3AY3A 4HNAB 1ODTC 2P9FA 1T1SA 3HVKA 3BWBA 4QXQA 5KOIA 5IK2A 2E4VA 4ZOBA 2NU8B 2JF0A 3R4VA 2FY8A 2W6ZA 2FSUA 4RDIA 4R81A 4CDRA 2Z83A 1JF8A 2BJWA 1AVTA 3LZCA 4M86A 3GG2A 1QKJA 3OLXA 1R3UA 1FE8A 4EUEA 4EZIA 4MUAA 4EUKA 1TKCA 2QSJA 5I3ZA 1TA9A 2KSQA 3V00A 1KO8A 3IUBA 4GNRA 5B6PA 3GP8A 3AEUB 1GTZA 2GA9A 4OSEA 1Q95A 5BY2A 2P1DA 1LLUA 1QVZA 4L57A 2OR3A 3QPCA 1M2WA 4J3FA 5TMBA 1MJGM 2QLFA 3EARA 4JI1B 1C0EA 1H4TA 1YS7A 3E35A 2CB9A 5CB8A 3I34X 3JD4A 4DSAA 3C6MA 1RQXA 5IEBA 5EP3A 5LSAA 3KJEA 2ANBA 3GT3A 1FVXA 1MXFA 1O58A 4HHEA 1S7CA 2Q50A 4OQYA 1JU9A 4R2HA 4YDSA 3WNVA 1UXKA 3W2FA 2QUJA 4UDXX 1KETA 2WM8A 3Q3VA 2PBRA 3U44A 2BLLA 1T9ZA 2Y93A 4ZYTA 2WOJA 2EW2A 5F3RA 1ODCA 3GGCA 1YZKA 2VWHA 1XG5A 4FN4A 4FWIB 4PCLA 5EJ2A 3VC3A 4E15A 3JQ7A 5DTRA 2GF2A 2EKBA 3C0KA 5E95A 2C8JA 2VDRB 2VDKB 3ZH2A 4NZ9A 1BDHA 2X77A 3CVJA 4N47A 1NKVA 2HSGA 2XCSB 4PLCA 1MIHA 3H11B 5LZ7A 2O8EB 4BFWA 1NU8A 4D46A 1E5VA 4O4HA 1XRLA 2AR9A 4MV5A 4NCIA 4NU5A 3EMDA 4BGEA 4Y1GA 2AXNA 1RI2A 1JAXA 3CZ9A 5ECWA 1SUCA 1SXQA 5A6VA 4C7OA 1MB2A 3OD5A 3DB1A 1RXVA 3WYNA 4CIWA 3G0BA 5LDGA 4BNZA 2NUPA 1F6DA 1P4GA 3MB8A 5FPPA 2IEYA 2I4IA 3LDGA 4EHHA 3MLBA 4BQSA 5JSZA 2QPTA 3P9KA 3RYIB 4AIIA 1WY5A 5CEFA 2QQ0A 4LCBA 3RVKA 2FWAA 2OSBA 4B7XA 3CFYA 4HSGA 4BVKA 1JHAA 2JZNA 3A1DA 4Q9KA 1EX1A 3FCCA 3O94A 1YQWA 2E9SA 5C1OA 3AEXA 3KZXA 3R24A 3DPIA 2GPBA 3JQFA 3U7QA 2W6JA 3T3IA 4B4VA 4ZIRA 1MC5A 3D7SA 3TD2A 3BF7A 3AB8A 1ZQ1A 5FJJA 4FPXA 5DOVA 2POQX 1NVDA 4LYJA 3O95A 2Q5CA 3ENVA 2HLPA 3KSZO 1H2XA 3DMHA 4L6CA 4PCVA 4RPKA 2WYHA 4JJIA 4TXNA 4WCFA 4EHJA 4DV4B 4AMGA 2R4UA 2OHIA 2CZGA 2V7QD 2DQZA 5CM8B 5EIBC 3SHVA 3KXIA 4U63A 3I9V6 1JRLA 4FZ5A 2A58A 2ES4A 3K9WA 3UKOA 2FRVA 1S0UA 3VR6D 3PNVA 4U7TB 5FTJA 4DWOA 3ZIAA 2HADA 5HUJA 1KSFX 3UTCA 3ETJA 4WFIA 4HNGA 1Z63A 5C8ZA 2FSGA 1NHWA 4LOAA 4P83A 3WWZA 2Q2QA 1IUNA 3HFJA 1E7MA 2WA2A 1Z4JA 3BULA 3AVYA 2ERCA 1Y98A 1LUAA 2OKGA 1DRVA 4X6UA 5M04A 1DQRA 1I4TD 1KYTA 3OG9A 1KDZA 2GUWA 4QYIA 3AP2A 3QW4B 2C9YA 2J3EA 3JALA 5I9MA 1H8HD 1FXWA 4MGYR 4BNDA 3QQPA 4HYYA 4BGUA 1YZGA 1W46A 3A6ZA 4TWZA 4W5TA 3Q15C 4HNVA 1V7PC 4U0JA 1OI2A 3N07A 1LPSA 3LVFO 2HPAA 4MIYA 3CLHA 3ND5A 4HGNA 2VYND 3V8RA 4B3RB 2VZLA 2ZWAA 3TFWA 3ACDA 2VP3A 4X60A 2WIGA 1RWXA 3FN4A 1PGOA 4GL4A 1W49A 4KIFA 1NXTA 2OB1A 5FO1A 3ZCRA 4AX4A 1SIWA 4ZQHA 1UZMA 4EKDA 3P9XA 3PQEA 4XD2A 4AUNA 4FEGA 4ZP1A 2JNWA 5IDVA 1KO5A 3EX7C 4LFAB 1IY2A 1Y7PA 2NP7A 1JN0A 4LXYA 4KKXB 5DX1A 2O1SA 3COZA 1N9GA 3PICA 4O5OA 1E9CA 5LXTA 3ZGVA 4CR8A 1E8DA 1SKUA 2YASA 3JPWA 1GNSA 4UBNA 4PG7A 1KKMA 3SD7A 2ZI9A 4X8MA 1VGRA 1FVFA 4X1OA 2IYPA 3N2EA 1E79A 2HWUA 1ZG3A 3NM6B 1PSZA 3CISA 3U7GA 4Z3KA 5EQFA 3H05A 1R4MB 1N34B 1XKLA 3C3BA 4HZUA 1DFGA 3BMNB 1R8QA 2VIIA 4ZQIA 4CM9A 1VI6A 4P3NA 2OBMA 2ZBUA 3TBHA 1ZRHA 2V7GA 3QG1A 1C1XB 1MOZA 4Y6QA 1M2OA 1SKAA 2QMZA 4RK6A 4UE6A 2DCMA 3PQ8A 1I3KA 1ZR4A 3NYIA 1U8UA 1DUVG 2JKZA 4YGXB 5JARA 4ZOEA 4DGSA 2XOKD 1E96A 3QF7A 1S01A 1CX9B 4GD3Q 1SVMA 3HCBA 4PHCA 3PWTA 5BNFA