1WR8A

Crystal structure of hypothetical protein ph1421 from pyrococcus horikoshii.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
230
structure length
230
Chain Sequence
b'KIKAISIDIDGTITYPNRMIHEKALEAIRRAESLGIPIMLVTGNTVQFAEAASILIGTSGPVVAEDGGAISYKKKRIFLASMDEEWILWNEIRKRFPNARTSYTMPDRRAGLVIMRETINVETVREIINELNLNLVAVDSGFAIHVKKPWINKGSGIEKASEFLGIKPKEVAHVGDGENDLDAFKVVGYKVAVAQAPKILKENADYVTKKEYGEGGAEAIYHILEKFGYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoglycolate phosphatase
publication title Structure of a haloacid dehalogenase superfamily phosphatase PH1421 from Pyrococcus horikoshii OT3: oligomeric state and thermoadaptation mechanism.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 85
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 3.1.3.18: Phosphoglycolate phosphatase.
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1wr8A01
3.90.1070.10 Alpha Beta Alpha-Beta Complex Hypothetical Protein Ta0175; Chain: A, domain 2 Hypothetical Protein Ta0175; Chain: A, domain 2 1wr8A02
4UMEA 3W5CA 2BY4A 2G1AA 5AI4A 4RETA 2X4DA 4UU1A 4F72A 3QUQA 1QQ6A 3L1UA 3E8MA 2AUTA 2ZBGA 3N5KA 2P9JA 3NRJA 3J7TA 4BEVA 1U2TA 3RFUA 1WR8A 2AH5A 3OCZA 2FUCA 2PR7A 3NALA 5T41A 5AVRA 3R4CA 5ALJA 5ALNA 1VJRA 2Q5EA 4C4SA 3U19A 2HSZA 3QGMA 5AKHA 1Z4OA 1WZCA 1L6RA 2CFSA 2HO4A 3AR6A 2O2XA 2I7DA 1RKVA 3EF1A 4Y2QA 2WF7A 3E84A 5ALYA 2QYHA 2YMPA 1N8NA 4YIKA 3BWVA 3DAOA 3OCUA 4O8CA 5ALLA 4BBJA 1XP5A 4Y2UA 5AVWA 3ZX5A 3L0BA 4XQ0A 4Y2TA 2YY6A 5AKLA 3EPRA 3NANA 2G80A 2WFAA 5AKIA 1Z4MA 2EARA 2JAOA 1RLTA 3WKCA 5AW0A 1TJ4A 1RPZA 1Z88A 3F9RA 1Q92A 4EELA 3AR3A 1L7NA 3NIWA 1RKQA 1YMQA 2P27A 1AQ6A 2HEGA 2IOFK 2CFRA 3QX7A 2ZBDA 1VFPA 2FPWA 4Y2VA 2YN4A 2W11A 5ALMA 3ET4A 2FEAA 3SF0A 1YV9A 3I76A 4JB3A 1LVHA 1J8DA 3SKYA 3CZ4A 3R9KA 3UMGA 2G0AA 5AKKA 3PGVA 3QU9A 4KX5A 3L8FA 5ALRA 5AI8A 1YDFA 2B1QA 2AGVA 4EENA 3A1DA 5AK6A 1U7PA 5AIAA 3WK4A 3DNPA 3QU2A 5AIBA 4BX2A 5AW3A 2IOHA 4KNWA 4UMDA 1L8LA 3I1YA 4AS3A 2VKQA 2FI1A 3M9LA 1Z4IA 3U26A 2ZXEA 2CFTA 5ALIA 2MU1A 5AM5A 3KC2A 3R09A 3FVVA 1O08A 2OBBA 3SD7A 4NV0A 1ZS9A 2D2VA 2YJ4A 4EX6A 2JGAA 2YJ5A 4BEWA 1LTQA 2AMYA 4EEKA 1YS9A 3ZWKA 2IA5A 2HF7A 2JAWA 2Q4RA 1N9KA 2YFYA 4HGNA 2C9MA 2G09A 5AKJA 4CF5A 3A1EA 4GIBA 1RDFA 1F5SA 4OCZA 4C4TA 3D6JA 3WKEA 1TJ3A 3QU5A 5AW9A 1T5TA 1J97A 2ZG6A 3AR9A 3E58A 5AW2A 2PQ0A 3I28A 5AI0A 3AR7A 4OFZA 1YJ5A 1L7MA 2W43A 4UAUA 5ALKA 3N1UA 4H1WA 1Z4QA 2C8LA 2WHEA 4UASA 2R8YA 3ED5A 4Y2YA 4DFDA 3IJ5A 4IFTA 4NABA 3UMBA 2HHLA 4UW9A 5ALHA 4YCLA 3N28A 4J2TA 3P96A 4NFLA 2MSNA 2ZBFA 5AI6A 2I54A 3EWIA 1Z4NA 1NNLA 2JAUA 3A1CA 2IOFA 2FPUA 2FPRA 2ODAA 4AP9A 3OCXA 4L6CA 2YMQA 3IB6A 2WM8A 1ZD3A 3U7GA 3AR2A 5ALZA 5AW8A 4HGPA 2B30A 3QYPA 3U13A 4NAVA 2R8XA 1QH9A 5AK5A 3KDPA 5ALTA 4EZEA 2CN1A 5IS2A 2FUEA 5A3QA 2DQSA 3QUBA 4UM5A 1JUDA 3DDHA 3OCWA 4QJBA 3U7FB 4KN8A 1FEZA 2B82A 2RARA 3L5KA 1CQZA 2YMMA 2O9JA 2HF2A 3L8HA 3FGOA 3FZQA 5JJBA 1RKUA 4Y2PA 5ALXA 3RF6A 3WK8A 4KX3A 4UM7A 2OA0A 4CF4A 4B6JA 2HOQA 3E81A 4Y3UA 3L1VA 3WK5A 2GHQA 2EATA 1QQ7A 4KYTA 3ZVMA 3I6BA 4CE6A 1VJ5A 1K1EA 1XVIA 2RB5A 4HGOA 3WGVA 2GFHA 4FE3A 1XPJA 1Z5GA 2B8EA 1L7OA 5AVYA 2HDOA 5ALDA 4BX0A 4UU0A 2BDUA 3CNHA 4CNQA 2YBDA 5AVZA 1WPGA 5AW6A 3S6JA 1Z5UA 5A3SA 3PCTA 2Q4TA 3UMCA 2FPXA 4XPZA 3WK7A 4YGYA 3GYGA 4FFDA 1TJ5A 3WKDA 5AM2A 2I6XA 2B0CA 3AR4A 4Y2XA 3VAYA 4AS2A 4JDPA 2RBKA 1SWVA 4MUMA 3ZVNA 4BNDB 4BYGA 1RQLA 4KNVA 3L8EA 4MWOA 1S2OA 4G63A 5A3RA 1IWOA 4I9FA 5ALWA 4QQFA 3ZX4A 5AVVA 1NF2A 1RLMA 4ZEWA 4FYPA 1EK1A 5AHXA 5ALPA 1EK2A 5ALEA 3HLTA 3WGUA 3WKBA 1T5SA 3L0YA 1ZD5A 3PDWA 1RMTA 2P69A 2ZBEA 3MC1A 3WK9A 3WKAA 5AVQA 4L6AA 1QQ5A 3A3YA 3TLMA 3W5AA 4ZEVA 2HX1A 3QLEA 2GMWA 4PNHA 5ALQA 4BKMA 3QU7A 3ESRA 3FPSA 3FPBA 5AI9A 4CF3A 2OYCA 4BX3A 5AW1A 4UMVA 3SMVA 4HGQA 2WF9A 1SWWA 3KBBA 5AI5A 3BA6A 3SHQA 1SU4A 2R8ZA 5ALSA 5AKZA 3MN1A 2EAUA 5ALUA 4YCNA 3EF0A 4UARA 2WF8A 4F71A 3NUQA 2RAVA 5AM1A 4UAVA 3FM9A 3KOOA 3ONNA 3ZW7A 3N07A 3QNMA 1PW5A 2R8EA 3DV9A 4E88A 4HGRA 5AM4A 3QU4A 2C88A 4OD0A 5AK4A 5AM0A 4BNDA 3NAMA 1CR6A 5IT4A 2FDRA 1Y8AA 4UATA 2I55A 4HYTA 4YCMA 2I33A 1YNSA 3ZUPA 3AR8A 2B8JA 4YH1A 2GO7A 3W5DA 3AR5A 1L8OA 2NO5A 1T9ZA 3OCVA 5AVUA 2FPSA 4J03A 2G08A 4UMFA 2BDEA 5AVSA 5AW4A 5AICA 5AW5A 3WK6A 3U7HB 3MMZA 3QUCA 3OCYA 1RMYA 1Q91A 5ALGA 1Z4KA 1L7PA 5ALFA 5AVXA 2NO4A 3QXGA 2JARA 3IRUA 2OM6A 2B1RA 3K1ZA 4L57A 3MPOA 3ZI4A 1ZRMA 5AKYA 3ESQA 1Z4PX 3W5BA 2QLTA 3M1YA 4IG4A 1U2SA 2YJ3A 4EX7A 3B9RA 3B8EA 1WVIA 2I34A 4Y2JA 4OHFA 4HAIA 5ALOA 1RQNA 5AK3A 3ZVLA 1MH9A 3SKXA 2HI0A 4XE5A 2YJ6A 1ZD2P 1NRWA 3KD3A 1QYIA 5AVTA 1U02A 2ZOSA 3L7YA 2G06A 2G07A 3ZTYA 4XOUA 5AKGA 3ZU6A 3ET5A 4DWOA 4ZEXA 3PGLA 3ZWDA 5ALVA 5AW7A 2NYVA 1ZJJA 4DW8A 1U7OA 3L8GA 4I9GA 1RRCA 3HYCA 4GXTA 4DCCA 2P11A 5IT0A 3KZXA 2HCFA 1TA0A 2C8KA 1RMQA 5AKXA 1ZOLA 2GHTA 1ZD4A 3SLRA 1ZRNA 2PKEA 5E0OA 4YIHA 4RESA 3OPXA 5AESA 3N8GA 1Z4JA 4G9BA 1X42A 1S8OA 3NASA 5AM3A 1TE2A 3B9BA 2YMLA 3U7EB 4C4RA 1RC8A 2W4MA 3QUTA 3ZTWA 3OTQA 4NWIA 1O03A 3UM9A 1KYTA 2WF6A 5AKEA 1Z4LA 4Y2RA 5FP0A 4Y2SA 2C4NA 2WF5A 3L0CA 1RLOA 2IYEA
chains in the Genus database with same CATH superfamily
4GQBA 2BY4A 3GRVA 3H75A 2QUKA 3SX2A 3BKXA 4ZHSA 4TS1A 4B32A 1LUAA 2JJYA 4F72A 5TJHA 3C45A 2HU2A 2YRWA 4CIYA 5KNCH 1IBRA 2A3RA 2WSIA 3F8SA 4Q4AA 1EFPB 3A6HA 3N5CA 1EZ4A 3KJXA 3TBHA 2YOGA 1IBCA 2B4RO 4MGIR 1KFBB 3NYQA 3CSDA 2C3YA 3T9BA 3LC1O 5FA5A 3DMFA 1XEAA 3Q3GE 5F7XA 3X1KA 4AWXA 4KPEC 3DJYA 2HLDA 5E0KB 2BJHA 3K9GA 4RTMA 3CVOA 2FLKA 3O9MA 5KAMA 4CN9A 2CLDX 1JDPA 2W90A 4TZ0A 2QD3A 3LQRA 3KQTA 3M8KA 3R4CA 5ALNA 3T3GA 7MDHA 2VATA 4J6EA 1CVRA 2VJPA 3F67A 3VPSA 1RQRA 2NP6A 3B36A 1W4ZA 1BU5A 1S3IA 5C37A 2C54A 5JNWA 2CFSA 3AR6A 3V1KA 4BVGA 1JEQB 2I7DA 2CLMB 2ZS7A 5KPDA 1IVSA 5ANRB 3E84A 3I45A 1FSFA 3EK2A 5ADWA 1N9GA 2QYHA 2JG3A 1N8NA 2ZYGA 3A6ZA 2VJBA 4KHZA 1HDEA 3O3NB 1DEHA 4E5UA 1O95D 1L7AA 5KEIA 5JWRA 4CMHA 3A3PA 2OV4A 3CUYA 4Y2TA 5DM4A 3ZJUA 1QHEA 3UHFA 2WSYB 2ZJ1A 4NSNA 3G2MA 3NHLA 4KV7A 3WIBA 4QVIA 5JNLA 4ZKDA 3RD5A 1IBKB 3TO5A 1BWRA 1Z4MA 5K51A 4GX5A 3W79A 1PS9A 2HJHA 3H7AA 1XKTA 1UK6A 4PCVA 4FGUA 4Y1GA 3ZDZB 4YP5A 3VZCA 1K7CA 4MPDA 1SA0A 1CR0A 4X7MA 4JUCA 3W9UA 3RSZA 4Y2GA 3L7LA 4XWAA 1U28C 4ZGBA 2PKYX 1QOZA 4G1UC 4R1QA 4PLVA 2HMUA 1ZA2A 2X76A 2XNCA 3P0IA 3CR3C 1S01A 2JFQA 4N03A 4MI3A 1NY5A 3HBLA 4K9RA 3AM5A 4RK5A 3VKGA 3QX3A 2XQGA 2ORYA 5TARA 3C6MA 3GO4A 1FLVA 4OP1A 5J58A 1G63A 2GUGA 3LBIA 1ULSA 3C3AA 4RM2A 3FDXA 3GLFA 1VIMA 1L4EA 3GV0A 1BA2A 4D92A 1YNOA 2FEPA 5KOJB 3I76A 1GO2A 3OZUA 4IF6A 2RI1A 4NJOA 3SY8A 1IJBA 2EIHA 1TF2A 2AXQA 1T3TA 3FVQA 1KR2A 5JYBA 3TLGA 4A92A 1WMEA 1P3JA 2XOKA 3PGVA 3TNFA 1U0TA 2FHPA 4K6HA 3WL6A 1ABEA 1PDOA 2VLBA 1ZOSA 1F17A 4DUYB 3NRBA 1VMDA 4CFSA 1T13A 1AGNA 1U7PA 3HGMA 5AIAA 1GNTA 2IZZA 1MC4A 2OGZA 2ZB7A 4KNWA 4RPLA 1CUWA 3C43A 2VDJA 2OWDA 4DCUA 1UKEA 3DLHA 4MVJI 1IPHA 4EUHA 1DUVG 1GYQA 2FVYA 3IT2A 3P4XA 2O8DB 1MC5A 1NR7A 1U2DA 3NMUF 1T35A 3KT3A 4KO3S 1EBUA 1NAIA 1A82A 3VPAA 4O4JB 1FFBA 7AT1A 2YYAA 1KARA 4O02B 2BEWB 4PZ9A 4QA9A 3TFWA 3H13A 3M6WA 2QD2A 3W2TA 4EFNA 4GMDA 3A6LA 4H1VA 4UTZA 5KNDH 4C1BA 4KC0A 2ONJA 4CQJA 5EKTA 2AQKA 4UEJA 4DDVA 4UAJA 2FMUA 3SD7A 1VMIA 2LKDA 1C3XA 1R12A 3PFHA 5U4QA 3KXIA 4FP9A 3L3BA 4MDHA 4ZMBA 2BEKA 2JAPA 4UOEA 3BGSA 4HN2A 1NTRA 2FMXA 3NBAA 4YECA 5ENZA 2C3MA 5IMBA 1R50A 1BDBA 1Y98A 3RAPR 3OZ7A 4KQ9A 2BCGY 4BPBA 3GMDA 1GG9A 3BN3A 4N7JA 1QV7A 4G0QA 1YS9A 3FZGA 4H60A 3L41A 2QX8A 4FNOA 4DDWA 4KACA 3NJ8A 1R0BA 1E79A 1PWYE 1VG9B 1JSXA 2FQQA 1EZ1A 2GPBA 3GFBA 4HQKA 4NE9A 1DBPA 5AHWA 3I4NB 4EHJA 1BG6A 3D4BA 3Q9LA 2PL9A 5FOWA 1F5SA 3ACCA 3S7ZA 1YVEI 2MR6A 2DR0A 2Y0CA 3FCCA 1P5RA 3QOXA 3THSA 5SICE 4LRXA 1OBFO 4PGGA 3WFJA 4CG1A 1EVZA 4BRUA 4F45A 2QBYB 4KDRA 4BO5A 4CV3A 2HMWA 5P8WA 4A6DA 2BJVA 1SG9A 3TIGA 4OJNA 1KP9A 5T5QA 3ANSA 2ZDHA 3BRWD 3JD0A 3KOWA 2CK3D 4RPHA 1F06A 3VPFA 1A8IA 1BHSA 2Q9UA 2YN2A 4JJ8A 4QULA 5DULA 3TIIA 1ZEJA 4B7UA 1YJ5A 3G6KA 2HGSA 3CKYA 1G3UA 3FPFA 1RR6A 4MWTA 4RJ2A 1CYDA 4ZIRA 3L1IA 3CR7A 3NKFA 2ZJ7A 3NCTA 2QS9A 4J07A 2XBMA 3IJ5A 4IFTA 4KGXA 4MPJA 3THYB 4D8YA 1GTL1 3H1EA 2IZ0A 4BU0A 3B89A 4NOKA 3DMRA 1XTJA 2BF4A 5IC6A 3C7AA 1IFXA 1NMYA 2HTEA 3TQFA 3P96A 4FK8A 4ZYWA 5TQJA 4BBSB 4OL0A 1FDRA 4DXHA 4V0ME 5T8KA 2WWFA 4EB8A 1CUYA 5LPNA 5EJ4A 5ELXA 5E95A 1BQ3A 1SBHA 1A8SA 1UKAA 1A1SA 3IR6A 2P4UA 5J2UB 1JZTA 2J48A 2DF8A 2YMQA 3QLTA 3V6LA 3BJIC 1W93A 3Q85A 3R2JA 2AI1A 3HCDA 3IDAA 2Z6QA 1U7UA 3PGKA 3PFBA 3RVRA 3X2EA 1E9SA 3H11A 4YCDA 5ALTA 5JS2A 5IDYA 2C2BA 3JVIA 2YDYA 4IW3B 3NP9A 5C4GB 4DYVA 5LQDA 1ZR2A 1E99A 2BTOA 4OLAA 1BVHA 4RVHA 5KTNA 1JAZA 4CMIA 4LJ5A 2OG1A 3TL6A 5DGIA 1NMXA 1UDBA 3DE5X 3LJKA 2YMMA 1FUEA 1HH4A 2GAIA 2QPTA 3VTZA 1XZQA 3ASZA 3PQDA 4KPUA 3RC1A 4HY3A 4GKJB 3TOXA 3P8ZA 3KUXA 2ID8A 4JC0A 1CJMA 5EVJA 3C4VA 1RJWA 3UW1A 5HKAA 4M9SA 3E1SA 4IH4A 1G0NA 2KMLA 4QYWA 3WK5A 4EYEA 2XWPA 3GLRA 5HCUA 2DE0X 3CSUA 2XODA 5E6UA 2YYZA 3KUUA 3BBPA 3UYLA 4DR1B 3I4MB 4IUYA 3BAFA 3LGXA 5KYXB 4MS1B 3EOZA 5FLXA 3O7MA 1FNCA 2PFGA 2C7VA 3GMSA 4KVZA 4TKLA 3MF4A 1VYTA 3I1FA 1DOHA 1F51E 1CDDA 2GJ8A 3LX4A 3O1LA 4H31A 4ZTBA 5GAJA 3DT9A 4BX0A 3R40A 4HAOA 4E3WA 1QIIA 4DV3B 1J0EA 1XN4A 1Y63A 1SG0A 3IQEA 3IL2A 5CH5A 2H1OA 1WEHA 4XA8A 5BN4A 2TMKA 4BBAA 2H52A 1HYQA 5CDFE 2W2TA 3O4IA 4WK4B 3FVRA 1GWNA 4P98A 1HEIA 4ECAA 1XXHB 5EP3A 5LP1A 5F3WB 1U9ZA 4FE7A 1J8FA 2W6JD 3FYUA 3L82B 2EWVA 1DTSA 5TGDA 2OXIA 1SCQA 4LYEA 3EJWA 4O3FA 3ZH2A 4J7CA 3GH1A 3ISTA 4R3WA 2YN0A 3T3DA 1UAYA 2WWXA 1N5LA 5AM2A 1D4OA 3TPCA 3VAYA 3WHIA 1RTTA 3UXMA 1EFRD 2C58A 3TKAA 1P2VA 2ECOA 1I80A 2WY2D 2HUNA 1PJRA 3FOAA 1Y37A 1R74A 1TJPB 1Y7IA 4HVCA 4D79A 1S2OA 5SYNA 2GN1A 2X2OA 4Z2YA 3FIJA 3PTZA 3S99A 1YOBA 3D8NA 1H8EA 2WG1A 5DH9A 5TVKA 5LZ4A 5CHYA 1PT5A 4FYKA 2ZRGA 3OTHA 3I30X 1TCVA 2G0TA 1NQOA 3PEUA 3UJ3X 5IBCA 3INNA 3KJHA 3LZDA 4AL4A 4RZ3A 4V0RA 1VPVA 4E11A 3EZ7A 1THGA 1EWKA 1GZUA 2ZBQA 5KHLB 2P1RA 4D4IA 2D1FA 1BFDA 4P93A 5F35A 3Q8MA 1A5SB 3DZKA 4G4IA 4RSHA 4RNCA 5LLDA 3QBDA 1RMTA 1HSOA 4A8PA 4AYBB 4HDQB 2FN7A 5LP6B 3C3DA 4C2AA 2EWWA 4NKRA 3UXHA 3PDUA 4V0OA 4UCFA 1ILWA 2R5NA 1WQ1R 1KS9A 3L8YA 1U8EA 3KKLA 4Q3OA 2HRDA 1R6TA 3LY8A 5FBRB 5HS6A 2B6NA 5LZ8A 1IHUA 1E3TA 3OX1A 3KV1A 4D9HA 2YUIA 3DVSX 2QTGA 2GARA 4LXGA 4QU9A 2HKIA 4YHBA 5AW1A 2JGLA 4BGDA 1JR4A 2Y4NA 4A1FA 1P60A 4ZCTA 4JX9A 1R4MA 4X95A 4HFRA 2A67A 2BZ0A 1MRZA 3DKIA 2VHUA 1NQAO 2YZ7A 1XCGB 1NVFA 3A6GA 3HFJA 1GKIA 4PGMA 1D07A 5M3MB 3PC4A 4D4JA 2B8NA 5H9VA 1Z2CA 2EAUA 3F6RA 3OLVA 1L5YA 1ZCFA 1I0ZA 3S68A 1TEZA 1WZ2A 3R76A 1F8UA 1C81A 1D2EA 1SCNE 3ANYB 4MLZA 2FAXA 2AD1A 2A92A 3JAKB 3OPYB 2Q6TA 1LDGA 3N07A 1U3TA 2FW9A 4R2HA 1PKEA 4YI3A 3CVWA 4HWTA 2ZWAA 1KFEB 3JD1A 4ZQGA 3VFDA 3ZWOA 4ZGWA 4BNTA 2I99A 1VBNA 3I5MA 3USCS 1K8RA 4II7A 3VBCA 1XRNA 1USVA 4ISBA 2JCSA 2RGEA 4H08A 3NG1A 1WP9A 5A1TA 1O96A 1CRZA 1NKTA 1T43A 4G36A 3TX2A 4Z4IA 2QEQA 5AHRA 1A4XA 2QOEA 2PWZA 3HPQA 4B84A 1FE8A 1UADA 3ID6C 4P34A 1D2GA 4EQ6A 2ZT8A 2QN1A 4Q1FA 3EPKA 1VJ1A 3G2PA 3IIMA 4D5EA 1PTJC 3B1ZA 3HVHA 2PUBA 2P2ZA 1F6WA 3AR5A 1PWXA 1FYVA 1V8BA 3LBNA 2CNBA 1RXSA 1UXOA 2KBEA 5CT4A 3VGJA 2QU7A 4REQB 4BB9A 5FOTA 4ZI3A 1VM6A 5HRUA 5AOCA 1EXVA 2PJRA 2AMVA 3WYEA 2IVZA 2C77A 4C4ZA 5K0NA 1WCIB 2AQ8A 3FF4A 3OFVA 3GTKB 1X7YB 2P1DA 3B5IA 5EWLA 1Q1GA 4MUEA 5CTJA 1IUKA 2Q4DA 2YDXA 5CJPA 1RZRA 3RSQA 5LA6F 3MJ4A 4HN4B 1ZH0A 2PBLA 1GARA 2ZJAA 3P4YA 1H4VB 2QLTA 3DB2A 4IDQA 4GUAA 5E6SA 2OCYC 1TCCA 3RH0A 4F85A 4I4CA 4Q1AA 5JS6A 1U2SA 4MARA 2YJ3A 1TU4A 2FG5A 2AWNA 2X40A 3FSJX 4M0UA 4BMNA 2Y68A 3LQKA 4QRDA 3ZHZA 4BNXA 1Q57A 4FNAA 4LGCA 3PA6A 4OUDB 3E9MA 5KVVA 3CH6A 1IHDA 5KC8A 4TLDA 3WLOA 3ZCXA 2OCGA 1DKRA 1FC0A 1ULUA 1XJ5A 3BQ9A 3EZFA 4JSRA 5BWOA 3AY3A 3QMWA 2H1FA 2DGDA 4IGEA 1W47A 4U5XA 4DCVA 1E9FA 4J75A 4C0LA 4E6PA 3QNUA 1C0LA 1ZYUA 4AJKA 2J45A 4TSFD 1FNSA 4AICA 2JFOA 3OJLA 3LDHA 2D5CA 1U7TA 1NRWA 1ZGCA 1EDOA 1P9OA 1VYVA 3N7AA 1DOZA 5PNTA 3ICQB 3VR3A 3ZY2A 1V37A 1JU9A 2XT6A 4KVFA 2CNDA 1T6NA 3ELBA 4KQ6A 4R83A 2H5IA 1C1XA 4KPYA 2Y05A 2WB2A 3OM1A 1KR5A 1B2LA 2R1TB 3ZWDA 3TZEA 4DJDC 2CBXA 4ZAGA 2ZVQX 3CLUC 3AVOA 4I9GA 2QTZA 4Z0PA 4C9BA 1PE0A 2YTZA 3TSYA 2XCSB 4A3MB 2N75A 2XUIA 1CQWA 3BWCA 3UAZA 1H6DA 1N6LA 1OKKD 3LG2A 3I9V6 1QFSA 1TAHA 3ADDA 1XKLA 3WDSA 4DLNA 2IS4A 3QFCA 3DXZA 3IPXA 4KO4S 2DFVA 2JGFA 4RFSB 3N8NA 1ZCBA 3KR9A 5HUJA 4IXDA 3JWPA 2Q9AA 5FB3A 1RAGA 1DI0A 4BFWA 1M6EX 1T0HB 2AYXA 1YR3A 4GWKA 5DSZA 5HVNA 2JLRA 5CB4B 5K2OA 5BVGB 1ZZEA 1JEDA 3PC7A 3NH6A 3NASA 3ZV3A 3B9BA 4G5OA 4E6EA 2BONA 1FX0B 2XOEA 3DBIA 3I34X 1Y3AA 3CZ9A 4QOFA 3N59A 5G0WA 4F8YA 1RC8A 5ECWA 5F23A 1TLFA 2C4HA 4NJMA 3PFFA 1KEWA 4CIDA 3R9WA 1DTWB 3MGBA 5TB5A 1GPKA 2O5VA 1SBQA 1K7FB 2G4VA 1V41E 2YW9A 2B94A 2OVFA 1YDWA 3O91A 2WF5A 3HZOA 1ZBDA 2IYEA 4YLEA 3HM2A 3SE0A 4Q0MA 3DTVB 2O6LA 3OOSA 4KAXA 4S1TA 2UVQA 3KVRA 3LUDA 1VL8A 5ED4A 2VJMA 4G5FA 3WJ1A 2XTJA 2YIDA 4AIIA 1AF4A 1WS6A 1H93A 4L95C 5FPSA 3ZJVA 2BH2A 4UNQA 5DFAA 4IGKA 3UK6A 3T7IA 5T4FA 2ZBGA 5BSVA 3BF7A 4ZAVA 5FPQA 3GLGE 3E0QA 3EQ7A 3DD1A 5HZHA 1F0PA 1W9MA 1ESCA 3A2NA 3CEAA 4H16A 4IFEA 5JU6A 1D7OA 2O48X 1PW7A 3WNQA 4ID9A 4N9WA 3L4JA 3OCZA 1NPDA 1JMKC 4UBJA 3G9UA 5EFOA 3SICE 3ESBA 1OA0A 3A1TA 1TYAE 2ZE6A 4AN4A 3NOVA 1L8XA 3ROXA 4B4VA 1PHPA 3LKBA 1TZBA 2VAVA 3B5JA 4HDRB 2ATXA 1AMOA 3PR1A 3I2HA 3B52X 1QKIA 3HL0A 5BR7A 4XH9B 4PR0A 5LN1A 4WBNF 4WN9B 1KI6B 1PZFA 1Y1WB 2Y9PB 1CW2B 3BXEA 4F5EA 4FHFA 3LXUX 2QHXA 3GHHA 5K0EA 1QX3A 1I4EB 1I7SB 2C0PA 2XV1A 4OHWA 2DPMA 4UD2A 2TECE 1Y1SA 5HNKA 5H16A 4QFCA 5SY6A 1Y9DA 5ALLA 1C4KA 2DPYA 2FK8A 4JT4A 4TVOA 3BD7A 3KR0A 3CVXA 5LA6A 2ID7A 3M70A 4RSGA 1QAOA 3MD0A 5AXCA 4BKUA 1R18A 3E53A 1D6JA 1U4SA 4XD2A 4U3JB 5AD1A 2JLUA 1UBJS 2JLQA 3OIDA 3CEMA 4JLMA 4LJ6A 4CTJA 2ECPA 3A9CA 2C07A 4HUJA 3EPHA 4B31A 2IZOA 1XRJA 1DBVO 2VOEA 1JPVA 5C51B 1TZKA 3PGA1 5AW0A 3JWGA 4JNCA 3G9XA 1BOOA 4J4BA 4BNGA 5JZVA 1XD9A 1TB4A 3G68A 3Q3VA 2QUBA 3SS8A 5I7SA 4U9UA 2YC4C 4ZZ2A 2LV8A 3P9KA 1MU0A 1N78A 4PQYA 3JALA 3ZI7A 1IZYA 2ASVA 4DIEA 1SBZA 3QVMA 5DN6D 1Z63A 4DMUB 1JIVA 1U98A 2OV6A 3JSXA 4G0ZA 3RQSA 4BKQA 1V7CA 1C1YA 3BG5A 4FQ8A 4KG7A 1CEYA 2EF0A 4AWAA 2NO9A 1NC1A 5DWDA 1CUDA 5EGNA 4DWJA 5CFRA 2C1EA 2DWCA 3OJFA 2V7QA 2QE6A 3M33A 1CYEA 3P9QA 3UJ6A 3A14A 3FMGA 1JLKA 1Z6TA 2GF0A 2YJTD 3WRWA 2NV6A 1SB9A 3H6HA 4YRGA 5KKCA 3OTOB 1VMEA 3HJBA 2PZMA 1BA3A 3JX9A 3BGOS 3RCBA 1KIAA 4IJ5A 3CG0A 3CNOA 4MR7B 4MRRA 1M1YB 4IMRA 4JUAA 1N4DA 2BBSA 2TRSB 3BC1A 4OQQA 1ZHFA 3U37A 1B7GO 4GGOA 1R5OA 2WAQB 4YRBA 3W5SA 1RWOA 4MVJG 5DHRA 2Y99A 5G4LA 2IF2A 2FR8C 3LY5A 5EEHA 3ISVA 3MJTA 4WOBA 4ZI7F 5KQGA 2JIQA 3ZHYA 3S15B 1KVQA 4ZYUA 1KK0A 3C6KA 2LCIA 4TWAA 5LXTF 2YHAA 3I1YA 2ZSHA 1K7YA 3BEDA 4NNOA 5G3YA 5I5EA 3P19A 1MJ5A 1JVNA 3AT1A 4RY8A 4F12A 2BKAA 2HPHA 4MP8A 4YY3B 3HFRA 3WLJA 5HA5A 3GJ4A 3NKLA 3CLUD 4JOBA 3IUYA 4KXXA 4B47A 3JATB 3FNIA 3EMVA 3SJAA 1T0IA 2YWEA 2OSBA 1GCAA 4ME6A 4L3WA 1M0SA 1LBHA 2MSWA 1C30B 1NVUQ 1ZKMA 3W0LB 1JDJA 3WYFA 3GJZA 3TMKA 4Y1RB 1PI3A 2DCUA 1PR3A 3KT8A 5ELLA 3OSZA 1NBIA 2IELA 3BPSA 2ZJBA 3IUQA 1E1RD 2DM6A 3EH1A 1VLMA 4JI8B 1EWQA 1KY5A 1J0DA 4DMCA 1N32B 2JK0A 2V1XA 5CBPA 2ONKA 3Q6MA 4JI7B 2IXEA 1DAIA 2AL7A 4MAAA 4EKNB 2HIMA 4Z7NB 3DEZA 2XD9A 2ZUBA 2R65A 5ER6A 3GFSA 3ND9A 3BCSA 1YKSA 2IX3A 4LRQA 4E1AA 2GK7A 4WT7A 4PG8A 1XMQB 2DWUA 1V3TA 1LVUA 4DDMA 2D7DA 1QG0A 3A1EA 4IJWA 4JJFA 4CEIA 4P0PB 1I3NA 1H6BA 1V9SA 4LE1A 1N1DA 2Z09A 1NAHA 2PH5A 4D02A 2JFXA 2RHJA 3EF3A 1IH8A 1GGEA 1HOTA 2GBIA 3KJFA 2PJUA 4I14A 4Y6PA 1PK8A 4R9VA 4Y1EA 3ZWCA 3AFMA 3QU5A 2FFBA 4ZCPA 5JISA 4E12A 4A36A 1UPBA 2R00A 1PLJA 1CY7A 1T5TA 3Q7RA 1J97A 4L50A 2BSXA 1RI5A 1DIGA 4R01A 5KJFA 2SKEA 2QD5A 2P7IA 2JGIA 1S9DA 3H6KA 1F2TA 1UUFA 4RDCA 2LIPA 4YQEA 8AT1A 1Y89A 2BKXA 3DD5A 3MUEA 4XFDA 4F9TA 1XZDA 3FPJA 4JASB 2VJYA 3TLBA 4FDVA 4LBZA 4TMXA 2FR0A 4JELA 1P18A 3ZCQA 1M1YE 1FIUA 4NCBA 3K70B 4LN1A 2I4RA 1JDSA 4WVFA 1P4JA 3V4PB 4BNLA 1YB7A 3SVZA 3M83A 5FL7A 1K8ZB 3LF2A 1S1MA 4LHEA 3OVMA 3MS2A 3OKAA 5A3VA 5B55A 1L3BA 4RZ2A 1WM1A 2I54A 3H97A 3WAJA 1HETA 3VC1A 1VOTA 2JLXA 3L4EA 2GB4A 3U7GA 3AFHA 1SH7A 4UUMA 2JASA 3FNEA 3HZZA 1Z2NX 1Y9ZA 1GV0A 4FYYA 2QXTA 1OZHA 4IIXA 4PC6A 3H8JA 4KIJA 3D2CA 3RRBA 3BJZA 1WSDA 3EGOA 1QAQA 3HH8A 3ZWNA 5A3QA 2X6TA 4IPTA 4TKMA 4IKEA 4QXPA 1X39A 2WPNA 4JU8A 1CQIB 3BMQB 4DGSA 1QYXA 3HKDB 2WNSA 5DLDA 1SVNA 4BO6A 4BN0A 4IGFA 3KUKA 3H18A 5TQ0B 1CERA 4ES6A 4Y2PA 1JSLA 4P7FA 5CM2Z 1NN3A 1HURA 4AG5A 1ZCJA 3IDOA 2XTZA 5J43A 1JU4A 2ZTUA 1JHRA 4XRRA 1SHZA 2NSHA 4X3PA 3UPDA 1M2FA 3ZVMA 4L4UA 2UVDA 1E6LA 1U0NA 4CE6A 1YE5A 2QP9X 4QG3A 4LHXA 2APJA 3MILA 4NYIQ 4UNPA 5DRYA 4A0SA 1B8VA 3ESXA 5HIIA 4ZI7A 4Q4LA 1AS3A 1FDTA 2AUNA 2WWRA 4WNYA 4DLWA 3H8WA 3K09C 3LCVB 2CF6A 4QL3A 4R5MA 3VKUA 5LXTA 1VBKA 4N8EA 2IH4A 1SUCA 3CNHA 3OFNA 4ZCRA 3TECE 4N8SA 1KJNA 3I2IA 1W0JD 1QDUA 4L8FA 2DQKA 1GNRA 4IFIA 2ZYVX 4WN3A 3UQYS 3HDVA 2HA5A 1QQTA 3RO7A 1LFDB 5IAOA 3HA5A 1M34B 3FLEA 4OREX 1I2AA 1UPTA 5B37A 2QY6A 1X8LA 2XUDA 1U5BB 4HDKB 4N6OA 1OTXA 3RUIA 1IZ7A 1NUQA 1QF9A 2JCYA 3AY6A 4FFDA 4W9NA 3R7LA 4CTMA 1MH1A 3CJTA 2G7MC 1E5QA 5BY2A 2D8MA 2UAGA 1E1CA 1UBNA 3WRVA 4HRVA 3EEOA 4ZT2A 3PPXA 4QNMA 4HQFA 4AZ3A 4I4LA 4AF7A 3FHJA 3MCAA 1RYZA 1ORTA 1UIMA 2OECA 4NZNA 3EOAI 4Z8XA 5IJZA 2I1LA 5LWQA 1WCXA 4BWYA 1G21E 2W2KA 3T7TA 2AYYA 4FWBA 1NLFA 2B35A 3I9KA 4PV7A 1NU6A 3L9XA 4KBYA 3SKVA 5K3EA 1XZGA 2Q0SA 3AB8A 1JFLA 2HHCA 2O0MA 3B2QA 3HWWA 2GN2A 1C3OB 1EGVB 3H1GA 1KHTA 4EJFA 4IZHA 5KIAA 2F48A 4WXYB 4DTCA 2NVQB 1SUIA 1TPZA 1U8YA 4HNSA 2WWHA 2NADA 2V8OA 1E77A 4OG2A 4E08A 5IABA 3TTSA 3SZUA 2HA6A 4EZIA 4Z3OA 5A1JA 5ECGC 1DB3A 1O9GA 3PEEA 3WK9A 1LI5A 3IAEA 5CNMA 1VYUA 1QQ5A 2WJJA 1XQ1A 2QVCA 2QX6A 3BH7A 5DK6A 3WB9A 1PLKA 1AKQA 2W9XA 3CW2A 2BKEA 2I87A 3I9NA 4IJKA 3QLEA 4YJKA 2R92B 2AC2A 4R2JA 4TZTA 5ALQA 4Z4GA 3D2BA 3V3KA 5D3MA 4LC1A 1XRLA 3DA8A 3LPCA 4OQDA 1B8OA 2R7AA 1K9SA 3HB4X 2JB9A 3GLIB 2I76A 3BHNA 4ZC8A 1T3ZA 2WF9A 4BLPA 3QKSA 4Z1MA 4FZJA 3CF4A 1A3CA 4GSLA 2QUHA 2W2OA 4OSEA 4IDDA 1FX1A 1J07A 2W4IA 3JQ8A 3OJOA 4P35A 5FTMA 2OXTA 4AP5A 1IHPA 3J80A 4QUHA 4L0MA 5JSQA 3J81A 1G20E 2Z9BA 5ALUA 3SQLA 4RA9B 3DFFA 1CJTC 4ARVA 2WF8A 4F71A 4WHMA 2NZJA 1F38A 3BERA 3KOOA 3PC8C 4QRHA 3RTCA 3OE7D 5I48A 1DNPA 1AHNA 5A05A 3L0IB 4CNBA 1ORDA 4P32A 4I1SA 4CFYA 1EX1A 3G85A 3E5NA 3AETB 3KYCA 2QW8A 3DQQA 2EV9A 2RKBA 3A10A 3H2SA 4I5FA 4ODIA 5DHQA 2A9JA 1KJ9A 2FDRA 3A37A 4I5GA 4V2IA 1RQ7A 3X1DA 4B3HA 3VZSA 3K2QA 4M8NE 4CHGA 2CL7X 4Y2HA 3ORQA 4D7AA 2IHZA 2RJ3A 1IOWA 3FNHA 4K9OA 4INPA 4DQ0A 2PUCA 5LQKA 3ITEA 2I3ZA 5ETJA 3BTSA 1CUBA 2UUCB 5K03A 1YASA 2AHOA 1Y3DE 3BWXA 3GJ6A 3WTBA 3W77A 1D1PA 2Y1DA 5CEEA 1N9ZA 4GZ3A 4NARA 4Q1VA 5AVSA 5AW4A 2FF5A 1U1FA 2WV9A 3UXEA 4X0EA 2BL4A 3MMZA 1G3IA 3CINA 3ROFA 4MQFB 3B3QA 1JW9B 821PA 5ITZA 3Q11A 1TCBA 3EZ6A 1QVRA 1ZNWA 2X5JO 3EXFB 1XA0A 2ETVA 3UT5A 3NJ4A 5F7OA 2RK6A 1BW9A 1P5JA 2WJ3A 3NWPA 2PMEA 4ARUA 2XKJE 3PL1A 5EJ9A 3EPJA 3EMBA 3FY4A 1WQ3A 2DFLA 3ESQA 2AG5A 4IDBA 4KO1S 1RWQA 5J4VA 4B82A 5LD2C 2W98A 5EE9A 3I04M 4G8JA 2OLJA 1OYYA 1U7HA 3BS4A 1G9XA 2TMDA 1JSCA 4AF6A 4HTAA 3RJZA 3V1UA 2CVQA 2X8JB 2PSDA 3G5LA 2NPFA 1H5QA 2D54A 3DKKA 4NH4A 4C2MB 4S05A 1K8XB 1M2WA 1RQNA 1MENA 3JXEA 4W6QA 4F1KA 2OSVA 3GLIE 5CA0F 3INRA 4X1OA 4EMBA 5M5YB 1H2FA 1UM9A 2UXBB 3CLSD 1JV2B 2OC9A 2PRKA 2BMAA 1XOIA 1WU8A 2EFJA 2WYUA 4A10A 2WYVA 2QTHA 3HKEA 4FCCA 4YJHA 3RSSA 1RXCA 5DTRA 5JASA 3A04A 3TLJA 3OQ1A 4QSMA 3T5BA 4Z7JA 4GEGA 1SB8A 2I1VB 3PQFA 2EQBA 2HIAA 2W83A 1XVVA 2FR1A 4IAOA 4BNIA 1EWTA 4E07A 2AQIA 2IBMA 1ZD9A 3CJRA 1Z75A 3OIWA 3IR5A 4N5IX 4AULA 5DBIA 2Z2KA 3IEVA 4FGZA 3RARA 1I2ZA 3H1AA 5C2JB 1OXBB 2N3ZA 3OIFA 1EFVB 4J1QA 4U0JA 5TPZA 1WE2A 4Z9BA 1HE3A 2P6NA 2WM2A 3F6EX 4FU0A 4MROA 1KZYC 4D0RA 1JJAA 3GEGA 2AKEA 4Y6LA 2UUBB 4BNYA 3ZHBA 4XLZA 3Q7SA 4CUKA 5CAEB 3L04A 1W52X 4M4SA 3N0XA 4IV5A 1POWA 1ZLXA 5CVCA 5AKXA 2QP4A 2FQYA 3V6MA 2RGRA 2GK6A 3ONVA 5C8YF 3K0FB 4RO0A 1RXVA 4WCFC 5BSMA 7GPBA 2NU6A 3QWFA 3FI0A 4CLRA 4FNMA 3D7NA 2FPGB 3AY7A 3EIXA 4HNQA 5KYTA 2XTAA 2C95A 5EJGA 4M49A 5F98A 1MAAA 2PGJA 1X1BA 3Q9NA 3NAQA 3M82A 3ZYCA 4DUZB 1BH6A 3CTPA 4WKGA 3UZUA 3RS5A 3ZE1B 1RI2A 2Q5IA 2AOTA 1JNYA 3HJGA 1IB6A 2OILA 2WAXA 2YRXA 3QUTA 4GOJA 5EWMA 2EOAA 3FFAA 1ZM3A 2ID4A 2AEMA 2LDBA 1U3FA 3RTAA 4Q24A 4R1LA 3RROA 2WU1A 3RG2A 1OLXB 3O84A 2QV7A 2V7TA 1QTIA 2XAAA 1PUJA 3B51X 1A2OA 2G1AA 3IQXA 2GLUA 2R4UA 2D00A 4YRKA 5T67A 1YHZA 3QUQA 4D9IA 4RHUA 1E6CA 1MAWA 4D57A 3PYXA 2CDAA 4GQAA 3GRUA 3KWLA 3VU0A 4JEHA 3QOWA 2BR3A 4LHZA 3O8OB 4K9SA 1R2QA 3MTJA 3URMA 5CA1F 1E0KA 1RI4A 1H0RA 4TYWA 2WLSA 2TMGA 1ZM2A 4ADSG 1NBAA 4A0RA 5KVQA 1YQUA 4QUEA 2PSEA 2E49A 4UTRA 1ZIPA 2FZLA 4JBHA 1BSVA 5AKHA 1PL6A 3SR4A 5BMVF 1E6EA 2CC2A 2HDHA 2JKYA 2Z56A 4KI0A 3O95A 4MR9B 4LRWA 5EERA 2PS3A 4HMPA 3UG7A 1NV9A 1SD2A 2PSJA 3TYXA 4DABA 5JAUA 3S1LA 3D3WB 2JGDA 3C6BA 4Q3LA 4P7BA 1IZ9A 3BSYA 3O9ZA 1A77A 1JNXX 4C7XA 5GTDA 5HEKA 7REQA 3E15A 3KZVA 2QDKA 5D01A 1JEYA 1F20A 2IRWA 5BW5A 2R96A 2XWBF 3S2GA 3VU3A 2O8FB 4CQLA 2EG5A 5BUCA 1ZO8A 1OVMA 2F43A 3TW8A 3WG9A 1CP3A 4UNRA 1AQIA 2J5XA 1CUSA 3LPLA 2UZAA 2OFOA 1YL6A 4MPPA 5EZ6B 1WF6A 2Z3VA 3I01M 4Z9AA 2I4NA 2JFFA 4UDXX 5J2TF 1M2EA 2AG6A 5FYQA 5L3QA 1WZEA 1QDLB 3DM9B 1D6NA 1DJNA 4DM4A 1MX3A 1YC5A 4RZUA 4ZPJA 4N5HX 4IYJA 4O0MA 2R6ZA 4RCVA 3P9ZA 5DEIA 1IQRA 5IJ0B 4EUSA 2O7SA 3FPAA 5CA0A 3W06A 3BE8A 5CB0A 1SC9A 1WBBA 3LVFO 1HC7A 1VL6A 1Y3BE 1WPRA 2CL0X 5IFKA 2GCPA 3KFLA 4YWJA 4WXPA 4ZMSA 1QH1B 3REQA 4TXMA 1M66A 2J33A 1YD7A 2W11A 2XDYA 4FJ0A 1X8XA 1T3SA 2Q5HA 1UFOA 5KNBH 2JK1A 1A9QA 2P5YA 3CF4G 4M0CA 2F4NA 4X9XA 4TL6A 1XNGA 5FUQA 4F9FA 2G76A 1IUPA 3T6KA 2ZUSA 4I1VA 3T35A 3R9KA 3LWBA 3OO1A 1GG5A 1WJGA 4DLUA 2G40A 1C1HA 2YZGA 3CRVA 3L8FA 3C48A 1PR0A 2DUUA 1V5IA 3UGQA 5BVHA 4ARCA 4UM9D 3AI7A 4KE9A 1O8CA 3ERCA 2AGVA 5AK6A 1T9GS 3OP4A 1HT3A 1MAHA 3WYDA 1FK8A 1WRBA 1Y3IA 4Q3EA 3ZEIA 2FG6C 2GN8A 2J4FA 2Q3CA 5BN3A 5C18A 4M1OA 4K9QA 4WXHA 2WJ6A 3KKQA 5IVIA 4BO8A 4Z8YA 4F91B 2AZXA 2Y27A 1TW3A 4WLUA 1E2EA 2ZROA 1A98A 1I2MA 1MOPA 3MHTA 1SCDA 5CXSA 1NG1A 4CV1A 1KP3A 5LMCA 3TF5A 3PNOA 5INTA 3KJNA 2CHQA 3WGKA 4RTLA 2EBUA 1V11A 2OOSA 2WZDA 1XZMA 3F74A 1XVLA 1Y5MA 2E6UX 1L4MA 3Q7QA 4PR3A 4RJLA 1XU7A 1IUNA 5A5GA 4DM7A 3B60A 1SCJA 4J0CA 3BXXA 1ZXLA 1C7IA 3B1JA 2VTEA 4NNJA 2YJ4A 3M5CA 4ZOLA 1KKUA 3K53A 2C59A 2XYQA 3V80A 4RF5A 5KYNA 4B3TB 2QR5A 5SZIA 3NUGA 3RS9A 4BMPB 2DR3A 2IPOA 3Q87B 2ZYWX 3TLZA 5TQ2A 5MN5A 5IYZF 3TS1A 4PLGA 3JQ6A 3OLYA 4OAPA 1G19A 2PT6A 4PCUA 4YAEA 2J09A 2J46A 2OV3A 5DPMA 5CFNA 3IO5A 1DO2A 1SVWA 2WDPA 2IYLD 4MWSA 4GG1A 4Q21A 3AKDA 2PT7A 1PT6A 3HP4A 2H4JA 3EVZA 3JQGB 5K8CA 4GIBA 1HDIA 1N2JA 5B1EA 3D3NA 4XGNA 1WKCA 4BJ1A 4LF5B 4Y0AA 4C4TA 2H9AA 3AY0A 3DKVA 3E27A 3D4OA 2COEA 3F7NA 1XD2B 3PXEA 4WL0A 3ABSB 5CA1A 3A4IA 1AV6A 1WVGA 1OWNA 1QM5A 1WXGA 2YNMA 3DCJA 2X9NA 5AW9A 4NU0A 3F7MA 1UDCA 4WGGA 3F4LA 4OMFG 4JLOA 1CTQA 1N36B 1I6HB 4OXYA 3DT6A 3P0FA 1T34A 3KLOA 5BMVA 4CR6A 4WJLA 5ALKA 1ZW1A 2G17A 4MCAA 2COKA 2D8AA 3K8YA 1NWCA 1M2OB 1OBVA 1US8A 4JD5A 3U48A 3BVPA 3V3TA 3ODGA 4PS1A 2QT0A 4TRJA 3VI3B 4Y6SA 2WYWA 3OQIA 2I2XB 1AV7A 2V5VA 1YB2A 4U7WA 2FEOA 1COWA 5ALHA 1CJVC 3O3OB 2QI9F 4UHBA 1Z0JA 5DM2A 1JKJA 2JHGA 5DTIA 2R1UA 3Q6IA 3KS9A 4HEJA 4PYLA 3IMKA 4BL5A 3EXIA 4U4AA 3AF0A 5DCWA 2OZEA 3UJNA 3U60B 4LCEA 1M2NA 1UEXC 4RIEA 4B2YA 4BWFB 4GPZA 3A1CA 3KJQA 1DZ3A 3OJWA 1L5RA 2FPRA 2XYHA 3WRXC 3OCXA 2E2IB 2EBFX 3IB6A 2WM8A 3CUEF 3KXKA 4URHA 4XB6B 5J2TA 1F9EA 3OLXA 1N7JA 1PR4A 3KJGA 2CHUA 3E0XA 3E82A 3SEFA 2E89A 3H9EO 4HDOB 2IZ5A 4JUBA 4PWZA 4OSPA 4HDSA 4XFJA 4DMGA 4CT0A 1GLNA 1VSBA 2NPIA 4OJTA 4LOHA 4ALLA 5IS2A 2AIRA 4O25A 3IILA 2A0UA 3ZH9B 1SXJB 5HZGA 1J1UA 1Z6GA 1TMOA 4QBKA 2YXNA 1AIPA 1VCIA 2A0XA 2AVDA 3DDHA 4B3XA 2N9UA 2RARA 2W2VA 2WJYA 3TVYA 5K3CA 1GU7A 1GAQA 1P31A 1Q7CA 3L8HA 3LZ6A 4ZD6A 1KSGA 1CHDA 1V6SA 4AVYA 4WESB 1FFEA 1FQWA 5DGCA 4CF4A 5IEJA 5CJJA 2WYIA 3C6QA 4QEZA 3PRJA 4TS9A 4W1PA 1SVMA 3ICPA 5DW0A 5JYEA 3PEVA 1QQ7A 2O0JA 4XX0A 3JQAD 1QB8A 5AICA 2RGNA 1DIHA 1FNMA 5JZSA 1Z8FA 5K6AC 4ND8B 2QQ0A 3A9SA 4M8IA 1QH8B 3AOGA 4G01B 3TM5A 3LU1A 1L1EA 2GFHA 3GNQA 1Z5GA 1P6XA 4IIYA 5TSDA 4NMXB 3AV0B 4DLLA 5ALDA 3NC4A 3IP1A 2GZ1A 4GW3A 3I0NA 3ZE8A 4UU0A 2FXVA 4YXWA 1PJAA 4P58A 5B57C 4HFJA 3D8UA 3RHSA 3LCJA 2GN9A 4F2HA 5AW6A 4G07A 3WBFA 1WXDA 4D3XA 1Z47A 1PT8A 1E9EA 3HUTA 3RUHA 1DKNA 5KKNB 2QNBA 3I5YA 5C44B 4ER7A 5F3DA 4KAAA 1W5TA 1R10A 4OA5A 1XLTC 2Q28A 2QRGA 5JQGB 1BE0A 1CZOA 2O8BA 1TUIA 4XUEA 1JHUA 2XB8A 4R1PA 5JCJA 1JAXA 1DELA 4D0GA 5F2KA 3AIOA 4F3CA 1R6DA 5KSYA 1PDVA 3VVBA 3W2EA 1B76A 2AXPA 2PSSA 3HEAA 5JJIA 2Z04A 4JP3A 4P5EA 8MHTA 2YASA 5G3ZA 3OZDA 3CPHA 4Q4DA 1OX4B 4OBWA 2EDAA 2FFAA 3B70A 3CUWA 3DWEX 5IYZA 3HYRA 2V4MA 1S1CA 3K1JA 1BJRE 1CUVA 4C7OB 3CZAA 1LBTA 3GRRA 4B6FA 1QO9A 2WHRA 4DR6B 2YFHA 1U2DC 2PUGA 5TY0A 3FDFA 4R84A 4C22A 1N33B 1BMFD 5B53A 5CVEA 3JD3A 2I6QA 2O3TA 4FLMA 4JOSA 4Y9RA 2CHEA 1K4KA 3IOCA 3ITDA 3ZV6A 3HJUA 4U6SA 3WDLA 1QGDA 1WCV1 3PC2A 2AG0A 4PN3A 1OSNA 4AAYA 3P0JA 2BFBA 4FGKA 1Z2PX 1IWPB 4BV8A 4BEJA 1OU0A 4DV0B 1SXJE 4WUTA 3I73A 3TAHA 1LNSA 1Z7EA 1TQ8A 4P3XA 5KYVA 5BURA 2RSLA 1T6ZA 2VVTA 4L27A 4M22A 3QSYA 3OFSA 1LX6A 1CUXA 3RAFC 2OAEA 2PMWB 1K75A 5C1BA 1M8KA 2FDCA 3H5OA 3LHDA 3JYLA 1WNTA 4HNGA 1QHXA 1A5TA 4OHPA 4RZQA 4ONEA 2J32A 3HZRA 4FINA 4YR7A 4H6XA 4ZOEA 5A0FA 3THRA 4P4SB 5JSZA 1RBYA 2IIVA 5JO0A 1LK7A 3L4SO 4RFLA 3UENA 1E0SA 1QIDA 5BSUA 2C7QA 2C92A 2A2ZA 5CW1A 1WPQA 2RHTA 4B35A 2FZKA 1A97A 5GV8A 1BD3A 1YOVB 4KDCA 3WNVA 3EMKA 3NUQA 1SIWA 2ZRIA 5JH7F 4W1QA 3WLKX 5EWJB 3HRKA 5I7FA 3TZHA 1ELOA 3ZBQA 1GDTA 4GYJA 4MJXA 3DTYA 1BHQ1 3OIGA 1JLLA 4TN5A 1HG1A 3WS7A 3MWLA 3ICEA 1M2VB 3TNLA 2B21A 5EJ8A 2GKSA 1BCRB 4R6WA 3PL5A 2DHQA 1QPBA 3AG6A 3MSCA 4X62B 3PXGA 1Q3KA 4PHHA 1SURA 5G53C 4WTOA 4BNDA 2HLDD 3F97A 2QMUA 4JQOA 4JR0A 1BHO1 1E2JA 2IL1A 4YJGB 1K92A 3TJRA 4TYQA 2I7VA 4YCMA 1YQEA 4K0KB 1ZMTA 4P4GA 1VQ1A 1T8SA 2CXQA 5H70A 2HCTA 3PS9A 4DNQA 2G67A 4CKEA 1TK2A 1Y5RA 3VYVA 2JBHA 5L6LB 2DH5A 2GO7A 3OP1A 1CLEA 1XMJA 2E21A 3V2HA 1UZMA 3V9PA 2FOXA 4PZYA 3OPYI 3G9TA 1SD1A 2AXNA 4LISA 2JZCA 4LRSB 4ON9A 5T8KC 3S1AA 2RB4A 5EIWA 3T3PB 2KE5A 4HZUB 3WWOA 2J30A 1X7ZA 1E9BA 1RFLA 2J3DA 2J41A 1IB0A 3BZUA 3CEHA 3G82C 2VAXA 3QVGA 4JMLA 3U7HB 3SF8B 3PNKA 3H1PA 4GI2A 4CXMA 5EKDA 4HLUA 2HK6A 1XEFA 2O0LA 1QWSA 2OOKA 3IAS6 4G26A 3T9FA 2I03A 4D2IA 1CNEA 1KI7A 1RXUA 2XE8A 4JKOA 4NTZA 4Q6BA 4WLVA 3RABA 1ZI8A 4WNAB 1E1LA 3WZLA 4E30A 2Y71A 4M8LA 2BHNA 3PYMA 4BDSA 3WMRA 3ZI4A 1T2CA 1P7PA 5JTTA 2RJNA 2Q6VA 2KQUA 3LS2A 4M99A 4UUNA 5EQDA 3Q8XB 2KLBA 2KBFA 3D5QA 4R2WA 5BUSA 1C9YA 2ZE5A 3VZDA 2A78A 2JVJA 3NHMA 1GTJ1 1ZNZA 1T8TA 2SNIE 1EE2A 3FMPB 4G09A 4G41A 4RXUA 4ZQEA 4AUMA 1YFLA 1UDAA 2AMFA 2MSEB 3L7IA 4GZ5A 1M6WA 1XMIA 3L2OB 1V9CA 3PK0A 4YX9A 5C4MA 3K0AA 4PO9A 2ZUTA 3I2YX 4IOLA 1T1JA 4RD4A 4ZOBA 5F64A 4CZ2A 5H8WA 4XLLA 4DUGD 3P45A 3SDSA 5DYTA 1PQPA 2WTNA 4MR8A 1LPBB 2AW5A 3DAPA 2F9LA 1Z28A 3JARB 4HZIA 2FZVA 4M54A 3ENNA 4P4TA 4YAFA 2ZE8A 2DQ4A 2JBAA 2XGGA 5BT8A 4IH9A 1AH2A 3II6X 4EYKA 2WUFA 2Q6OA 3WNCA 3H3VC 4KK3A 2WTBA 1H8HA 4MV1A 3GX1A 2QE7A 5A6VA 4A2QA 3T1HB 5JY1A 1U02A 3ZNOA 2UUPA 3C7KA 1XK7A 2VDWB 3UJCA 5CLJA 3S81A 2JIZD 5EJ7A 2XOKD 4X7BA 1AGYA 2PQ6A 4IIJB 1JR3E 2WHPB 3JQEA 2IDZA 4KGDA 5AKGA 4ZU1X 4B7CA 3CMCO 2JH8A 1USUA 3L7JA 3PDIA 1M8GA 1ST2A 2BFEB 2PV0A 2V03A 4JB2A 2FW7A 421PA 3TAXA 1UMDB 3FYUC 2W6PA 4WZBB 3RWMB 3ZZTA 1CC1S 1OFGA 1ENYA 1KDPA 1ZIYA 2FN8A 1DDOA 4YAUA 4C3IB 4B09A 4ZQBA 3VR4A 2P11A 3A7EA 3DV2A 3VYUB 1EFDN 1I51A 4ZFNA 1IVYA 5GIPE 3Q8WA 2PLRA 1I1QB 2UVPB 5PGMA 1EUDA 4KWIA 3O8RA 3RR2A 2WI8A 3PC3A 5B6IA 4D4KA 1ZRNA 3DE3X 5HKKA 5KJEA 2VQ6A 5E0OA 1BCSA 4DRZA 3GY0A 5CX1B 1LX7A 1JDBB 2HRRA 4C01A 2MDTA 4RJJA 4QM7A 2FEKA 1BKYA 2VTVA 1NW3A 1N1MA 3D4IA 4FI3C 4PCAA 4GRDA 5E7MA 1KJWA 4NEQA 4YUVA 3TEFA 1E89A 3NBYC 2AFHB 3B7WA 3DAGA 1WABA 3WR5A 1QIHA 5K8LA 4PC7A 3KJIA 2E4UA 4B79A 1A9OA 1O9BA 2MINB 1CZRA 3ENWA 4LSWA 3KZNA 1FU8A 4EW3A 3CGGA 3ZTWA 2G8NA 1BEEA 1BEZA 1Q0QA 1FRZA 1BVYF 1G17A 1QCYA 2ESRA 3PFKA 3PNVA 4QOHA 3V2IA 4B6GA 1EHYA 1YR1A 1X7WB 2DTXA 1GSAA 2PH7A 2WF6A 4JHXA 1I4WA 4X24A 5AT1A 2WWWA 4FFBB 1FVHA 2OTCA 2H29A 2ZJYA 3IJEB 3OZIA 1M6YA 1DFHA 2IDKA 5JH7A 1JXQA 4LV5B 2RH9B 1TYDE 1YAHA 4C5CA 1IOVA 1E79D 2MYTA 5C52B 2BEVB 4UE6A 1SPXA 3A4MA 3ZGOA 3K4PA 4ICIA 2BM0A 3Q5DA 5KX5A 4RY0A 1I14A 2D1SA 2IIBA 3BD8A 3M6IA 4E21A 4ZO8A 1ABBA 1RCTE 3JD2A 2P9JA 2RD2A 1MX5A 1AUPA 2EFGA 4CCWA 1YR7A 2F9MA 5BUZA 1H3EA 3NORA 3JRNA 3W1VA 3C98A 5CT5A 5BSKA 2NUTB 1ZGBA 2BEUB 2QR3A 1QV6A 3HA2A 3UT0A 1ISFA 2CHFA 3OU6A 3Q5GA 3MQ4A 4FCWA 4YMIA 4B83A 1PD0A 3NALA 1P33A 5CGZA 3U7RA 4MHOA 4W5OA 4KWEA 1E7RA 3B7PA 5B3LA 4RMHA 5ALJA 1WXQA 2VRBA 3PR2B 1JA0A 1DAMA 2Q5JA 4EOGA 2Q5EA 5F2EA 4Q7QA 2Q2NA 4XEHA 1EFLA 1QIEA 2TS1A 3B2EA 4RS4A 3E70C 3R6LA 3M3YB 4HT3B 1MFZA 5G41A 4BB5A 1YTUA 3CVUA 4EI8A 2P9EA 4B3JA 1ECFA 3IE0A 4BHTA 5FLYA 4IGIA 2XIQA 1G5HA 2EW1A 4FEAA 1FYEA 3AUXA 3OCCA 4CTNA 1VL5A 4KV9A 3DAOA 2Y2VA 4XTCS 5GZ6A 1LFAA 4TMTA 1A9XB 1XP5A 1J70A 3TGWA 5LKAA 2V3CC 3AU8A 4OY3A 4P1ZA 4PX5A 1T3LA 4WZBE 5KC9A 2G8LA 2O2JA 1T36B 2IYQA 1SELA 4PG6A 4F9EA 2VDQB 2G9UA 4NFSA 2X77A 4C0HA 1J0AA 2YKGA 3HVKA 1EPUA 1CBUA 3KYDB 1DKLA 3DOJA 3HO6A 3HWRA 3H04A 1RLTA 1RW4A 1T1GA 1W88A 2X19A 3O4JA 3WWZA 1U3VA 1Y6RA 4Q66C 4ZVMA 5IXYA 3FWPA 1QF7A 1CIPA 4F6RB 1E58A 3M4ZA 1DG3A 3QOYA 3FMFA 1UFVA 4LC9A 3L93A 4EY5A 3INTA 1M0EA 3CX4A 1QP7A 2AFHE 2Z2XA 4FR0A 5BT9A 1W85A 4S1NA 2IEAA 1SNYA 1ULBA 1QGOA 1AQ6A 2DTDA 2QRVB 4L1KA 1ZH8A 2EJCA 2C8VA 2J5KA 2MYUA 3JASB 4KXNA 3EN0A 3WQSB 1OFUA 5CYFA 3EDMA 4W4TA 2NN3C 1C50A 2EX1A 1CQXA 3F4BA 2OT3B 1IPFA 2GBGA 4JB3A 1IOLA 4ZO4A 3U4GA 4EJ0A 1BDMA 4V3CA 2X3UA 4DEVA 3SNKA 1DAKA 4DG5A 2FOLA 3QIAA 1TWFB 1UINA 1X86B 3QKRB 5TMEA 1PP4A 2QRQA 3ECSA 3ZDXB 5JNTA 4G0UA 4FGWA 4ZHQF 2R6FA 1WB5A 2JI4A 3B6KA 3Q5EA 3LC7O 4NONA 1KZHA 4X84A 4CQMA 3HZHA 2C00A 3DLTA 3NB0A 1Z15A 1U7WA 3S5JA 3BYZA 5IAEA 3LD9A 2IOHA 3PX2A 2AEEA 2QTVA 5EXPA 2AK2A 4JP8A 5TF0A 3KZKA 3AESA 1JDUA 3VR5A 1XEWX 2HXSA 3DONA 1Q16A 3MJRA 3DVLA 5JJCA 1P72A 4F84A 3VU1A 4GVXA 2X86A 1IBSA 3MWEA 1W34A 1G8AA 2WFMA 3N2IA 3NBQA 4IICA 1SU7A 2VYNA 2WT4A 4LY0A 1YU9A 3W6NA 1T1RA 1H66A 1Z4IA 5IVHA 3U26A 4YMGA 3R7WA 4BMOB 1KRWA 3OJEA 4KEAA 3T06B 1EK0A 1ZJYA 1DG9A 1YZ3A 2MU1A 3MINB 4N3BA 3TSZA 3QPWA 3VOBA 1KO5A 1R0KA 2OBYA 2GM4A 1Y6JA 2HMYB 2PR2A 3MCWA 4OU4A 2POQX 2F8LA 1MABA 2Q6LA 2WLTA 3O4VA 4YMHA 1U7ZA 5KMGB 1TFRA 2HLNA 3IUEA 1LLDA 2XY4A 2K5UA 4KAJA 4TOIA 5KJ1A 4WA7A 1GQYA 3P9XA 2VRWA 5EP1A 2J3MA 2XUGA 4F2DA 5LOVB 4BMYA 1H3NA 1VHTA 3FGNA 3TI7A 4KQEA 4D98A 4F9GA 4BXOB 2CXTA 5D7BA 1DMSA 1KQFA 2G6BA 3I53A 4ZU3A 5ECYA 4C4OA 3LW8A 2J3IA 1WXHA 4MUBA 2BGIA 1JFFB 1OLSB 3U3XA 3KSDO 1KO1A 3GQBB 4WAUA 3IQDB 2ZBUA 2I9KA 2C9MA 3RHFA 2XJ4A 1O0BA 1WY5A 2YU9B 1SQFA 5D2CA 1I7LA 3KEOA 4KXFB 4QWWA 4CIVA 1V1MB 1O4WA 4B5KA 3DFKA 2ZYRA 2H07A 2VP9A 3JWHA 3FR7A 3V1LA 4HAZA 4BO0A 5C35A 4LI0A 4U2EA 3RJTA 3K71B 4KE8A 3PBKA 2J6CA 1R0RE 1N5KA 1ZX1A 5HILA 4QIWB 2YXDA 2IYXA 1JDTA 4JBNA 3AR9A 1UBGA 1MO4A 3GROA 3K0BA 1KQ3A 3WLFA 5CVTA 5AW2A 3I28A 2QORA 5FTWA 1FYFA 2P2GA 1AN0A 1NVXQ 1UFQA 1L7MA 1U3DA 2HREA 4JUIA 4OFBA 3SX4A 5B30A 4HHEA 1Z6AA 2JCVA 2AV6A 1KY4A 2OMKA 3U4QB 3G79A 4EUKA 4GPIB 1G2IA 3KJZA 5L8VA 3OJXA 2QB5A 3ZV7A 2CXNA 3SZLA 4E2YA 4XVCA 4M89A 1DC3A 1USIA 3UKDA 4B7XA 5FV4A 4L4SA 2QLMA 3N28A 1U0JA 2VK2A 3QEBZ 2J5BA 5H02A 4GM4A 1P4AA 2QG9A 4LBWA 4COOA 2XDQB 1VJCA 4YRRA 2EKBA 5BSEA 2EGHA 5NULA 3RIMA 2N47A 1DCMA 1YCDA 3DO6A 3STHA 2QM8A 1E3SA 2YVUA 5BV2P 4WSOA 4B9EA 1Z5VA 3KTAB 1KEEB 2HJRA 4PN7A 2DOKA 1NBMA 4IIHA 2WRZA 4FMCF 4HNAB 4Q9JA 4ZRMA 4HGPA 3L1HA 2L19A 2R8XA 3HVUA 2GS9A 1BRTA 4CETA 3KDPA 4BCCA 1UEJA 3AQ4A 2WKPA 3CCBA 2CN1A 3M1LA 4L28A 4OKNA 5FJIA 3W6OA 4EZEA 5ADUS 2VUMB 3ELUA 3WRYA 3WBKA 2XZDA 4XLTA 4HEHA 1CZNA 1J7KA 3VRHA 4J0EA 1D03A 4OK6A 4GHWA 2PQ2A 2LRHA 2XA9A 4TMYA 4ZWNA 3HHPA 4JT2A 5DYWA 1HDOA 1PRYA 3O1IC 1PG5A 2OHVA 3AXTA 4MULA 2HF2A 2OBNA 4J9UE 4JJAA 3SJUA 3VPGA 4A8HA 3WA7A 3TE7A 1JSRA 2PUWA 3VC3A 4JEMA 4PXAA 2NVYB 2XX3A 5B1IA 1HYHA 4N5MA 2H4ZA 1XPOA 1YB5A 3B82A 1KVTA 2WD9A 4B6JA 2JLVA 3OUUA 3OFJA 2HOQA 1II9A 5C5EA 2GESA 3SHVA 2MSCB 2GCGA 221PA 3BMOB 3B3AA 3QVTA 1LDNA 1AKRA 3JYOA 4TRMA 3MLAA 5EA2A 5ERYA 5HGJA 4BLQA 3KPVA 4ZHQA 4CKZA 3MGKA 1RZRD 1RADA 3MQ2A 2O3UA 4RY9A 4DUPA 1HE2A 3HKCB 4QPZA 5AJUA 4PX9A 5E8RA 4QU8A 1FP1D 4CKWB 1GGJA 3RRFA 5K3BA 4DWWA 1OWMA 1Q22A 3GAMA 3IPLA 4FM9A 2YV1A 1WZNA 1GQOA 3N74A 5DOZA 2BDUA 5EUCA 3PGMA 3ZR4B 2RGGA 3IH5A 1LEHA 3NWJA 3F6PA 2O8NA 5EHIA 5B58T 2RAFA 3GJ5A 3MJEA 4G84A 4XYBA 5GJVC 3U7IA 4ZDJA 3WZ2A 1YR6A 4C7BA 4PRZA 3L07A 1I1OA 3E3NA 5HHTA 3A9VA 2YWRA 5DCUA 2J0SA 3GTJB 1V8PA 3C7TA 4NCAA 4MRSA 4HNTA 5KVSA 2B8WA 2Z2ZA 3G89A 3PGXA 2EZ9A 2HUPA 3U2QA 4BV9A 2W48A 4DRYA 1NX9A 1ZLYA 1D2AA 4HNVA 1RLIA 2ST1A 4L2IA 1K08A 4G0VA 3VHQA 4H7FA 1M6VB 3RYFA 3VR3D 3TTUA 1C7EA 4BRZA 2WUDA 3B5EA 4ER6A 4C3VA 4GPD1 3NDPA 5M5XB 1YGYA 5LM3A 2XITA 3RSOA 2C3PA 3OPVA 3F98A 4N39A 4P5PA 3WLPA 3WMXA 4I2VA 5AVVA 3EUWA 3LKZA 4DDUA 2L17A 2DFKB 4XPIA 1HMYA 4D74A 1YS6A 2Y9MB 4LV6A 3LRTA 4KQ2A 4UQPA 3WGUA 4AYTA 4V1CA 5MN6A 2C99A 4UVDA 1MF7A 3UICA 1PV4A 3DO8A 1N2CA 3QQPA 4CUZA 3HCRA 4L22A 4DDTA 1GT6A 4KE7A 5F5NA 4DIBA 5IG2A 5AUNB 3EBPA 1JT9A 2XLBA 2RK3A 1FSGA 4BVHA 3WJ7A 1LPSA 2HX1A 4YLYA 1H5UA 4AJOA 2FFRA 3Q0IA 2R1VA 2B1JA 3A0UA 3RQIA 1W29A 4RTPA 4HPJB 4X1YA 2JDIA 4CF3A 3HCCA 1CR2A 3DWGA 2OYCA 4LJRA 4LGMA 3PUKA 1B1CA 2VPIA 1EIWA 1NXXA 4C89A 1QLWA 4I9HA 4UEWA 4CMKA 4YQFA 2D1QA 2W0MA 1NYTA 1P0PA 1LD3A 1SU4A 1RC0A 4H0CA 3G5UA 2JI9A 4IV0A 4MS4A 4NBRA 4PSVA 5ILQA 3ZU3A 3HLKA 4PLZA 4RORA 5JEDA 4BZWA 2WFLA 3SC4A 4UARA 3UMFA 2X42A 2EX0A 5IJWA 3GJRA 4RVGA 4UM8B 1T6XA 3DPSA 4ENTA 3MJSA 1M1NB 3MJVA 2AFIB 3AKYA 4OK5A 1DU4A 3ZIDA 4LFBB 1T9CA 1FDVA 3CRNA 1J33A 2GM9A 4J0FA 1RHUA 5CJ2A 1D2HA 1MB2A 4YJFA 1C9DB 3ZZMA 1V2GA 5J5VA 2VKTA 2ORVA 3P2JA 1Q1BA 3T3IA 3EMDA 2B69A 4KDFA 1IZ8A 2Q5CA 3ND6A 4MRAA 3Q12A 1G98A 2K2QB 2GASA 4AZ0A 8ATCA 3GRZA 1IEQA 4DV5B 2YHIA 3A3NA 2WIDA 2A9KA 1SKMA 4DR4B 1ZUHA 2QL5A 2ZYIA 1TM3E 2CNLA 3AR8A 1OY1A 3IMCA 4CYMA 2A0KA 3A6KA 2BN4A 2XVYA 4YH1A 3DEFA 3LCMA 4MEAA 4QYMA 4KR9A 3BDAA 2OVBA 1U6IA 4MCHA 2IODA 1W35A 4B3RB 4IO0A 1NW4A 2AVNA 4MKFA 1JBEA 1IY8A 1QHHB 1Z6YA 3ZXIA 3UHJA 4EF6A 3EDYA 3TG2A 1MJGA 4UMFA 1EM6A 3I6YA 2CB9A 4YPFA 3QE9Y 1JIXA 3UWMA 2I4OA 1ZESA 2P62A 3QFSA 2BUBA 3THWA 1Q91A 3EFOA 5ALFA 1MEOA 2FWNA 4YCJA 2JIBA 3L6RA 2V5AA 2V0CA 1MIOB 4GU5A 3ODPA 4IKOA 3ONFA 3W2HA 4RD2A 4Q19A 1VPLA 4JBGA 1ORWA 1UXIA 1V16A 3WAKA 1PKXA 4YYEA 4K5QA 1KAOA 4NCJA 4ZOQI 1R16A 2FVXA 1YS4A 4XB1A 2DCMA 3Q7PA 5AKYA 4D4HA 1TQDA 2OAQ1 3B48A 4URUR 4FVTA 4IG4A 4OYRA 4Z2AA 2Y66A 4CF6A 3B9RA 4MIYA 1X87A 3D4NA 3WLAA 2C7RA 1MX9A 1DX4A 4XDZA 1SBYA 3DVAA 2Y1OA 1TWAB 4CM4A 1CUFA 4AJJA 1V6AA 2YS6A 4MTLA 1N5MA 4WI1A 4PLTA 4GOND 3SN6A 1GCOA 2BZ1A 3D6MA 1KE1A 1NM5A 1Z5PA 5AHOA 3MHPA 1OAOA 1J56A 2HK8A 3KOZA 2V7QD 3U7QB 2A14A 3FB4A 1FFXA 3LSYA 2VP6A 1NUSA 2DKOA 3Q3HA 5IJ9A 2Z1DA 4QGGA 5M3BA 4A5SA 1H2RS 2P9TA 3AHGA 1ZK4A 4L73A 5CT8A 4ZARA 2EFDB 3L40A 3QLVA 2LUOA 4RA6B 2O1XA 2JI8A 3RIXA 4PZAA 2HHAA 4YAWA 3ADOA 4TLEA 3SOPA 1FW6A 5CT9A 3R6DA 3VKHA 4FQ7A 1RBQA 4XIGS 3TMYA 2UZ1A 3PGLA 3UAXA 3ZK8A 2AJCA 3IELA 2CXRA 2NYVA 4MVJH 3AVVA 3BIXA 4JVOA 2I65A 2Q46A 3CLKA 4IMPA 5EHNA 5KQRA 2AZTA 1YZVA 4WZAA 2D0IA 2HLPA 4FT2A 3D1VA 3PZBA 3BMNB 4WFQA 4BVKA 4F4UA 2FF7A 4MQ6A 2ES4A 1SFOB 2NACA 3WL4A 4A3IB 4J2HA 4AQDA 1NP3A 4HH3C 5TLSA 1A4RA 3X43A 2WMYA 3OI7A 3H4MA 3AP3A 3TCKA 4OQEA 2CSXA 1UJ5A 1ML4A 2Q62A 4OGFA 1V35A 3N0VA 2NXCA 3EBOA 4KXVA 4TV9F 5B1HA 3RLIA 3TUIC 3C1UA 3EG9B 3OT1A 3UFXB 5LQCA 3PE4A 4ZT4A 1S8OA 3Q8KA 4CL0A 3IAS1 4BLUA 3QXCA 4IGAA 4U02A 3KAQA 3IQWA 3HQ4O 5EIOA 7ABPA 2DKFA 4KZKA 5BWCA 4KUHA 1E6KA 1XQYA 2M6RA 2IYAA 4EO9A 4XGRA 5HSGA 5D6OA 3U19A 1WCWA 2HNKA 3PFGA 2PU7A 4MQUA 3SFVA 2QQGA 2WJHA 3Q4GA 3OIVA 4DR3B 4X63A 3O8DA 4L8LA 1TIKA 3T61A 5BNFA 4US2R 1F14A 2B2CA 2PBZA 2VWPA 3BILA 4RETA 2J0QA 1EUCA 1LQ2A 1QIFA 3JVEA 4NS4A 4X61A 2ZJ0A 4EHBA 2WQ7A 2PVSA 3F96A 4KRGA 3ZD6A 3DMYA 3L1UA 3ROPA 1YR2A 4A23A 1NSFA 2QMZA 2ZRJA 3C3WA 4JJZA 1JHOA 3IV7A 1P17A 2P91A 1JKXA 4X41A 4XQ9A 1U5CA 4Z4FA 4JJ7A 5K9ZA 4KR6A 4JVMA 4G85A 4B6RA 2GK4A 5FCDA 3LLCA 2ZR7A 2ID9A 4D6PA 4Z49A 1O0CA 5KSWB 1XCLA 3E23A 4OGKA 1O94C 4D43A 2NVXB 3GLHB 5T41A 3ZE2B 1EJ6A 3AP1A 1FNBA 1EVQA 2NXEA 4ENQA 3QXSA 1Q7BA 1WIWA 3NHKA 2EGUA 2VT3A 4W9MC 3TOZA 3NAGA 5JG7A 3WWYA 4X20B 4KITB 4EARA 4EG8A 4JQZA 2PWPA 2HCBA 4ARZB 4BDTA 4ZCSA 3T5DA 4JEIA 3R7AA 5BQPA 1RKVA 4FDUA 4X94A 5ALYA 2A33A 1HK7A 1RM4A 1T9GR 2VH1A 2YYYA 4RH0A 1V7PC 2DECA 1JALA 2PY6A 4P81A 1AURA 5FL7D 4B7ZA 3IQFA 2V3VA 1HR0B 4GVPA 5T3YA 1EQUA 1F2DA 4EBBA 3N3BC 2WUVA 1D6MA 3N9IA 2ROQA 3HK2A 3I23A 1E98A 3Q7IA 1ETHA 4GOLD 4HB3A 3D7MA 1FU4A 1PGOA 2NU7B 3AVQA 1DSSG 1KSJA 5I9SA 3NANA 4NZMA 1FTNA 2WFAA 2XWQA 5EZYA 1UBLS 4OQNA 2JAOA 3SYLA 1T3GA 2PUEA 1BHJA 3L4BA 2XNSA 5BW8A 5ESRA 4AQ7A 1QB7A 2P9YA 4J49A 1ECJA 1G8KA 4M88A 1NN5A 4XJTA 1QZ3A 1OUMA 3GJ7A 4FHDA 1U8UA 3PNQA 3ZKWB 1GG8A 5D51S 2OY0A 2YYSA 3D6FA 4EELA 1HTWA 1DKMA 1JYEA 3MJFA 1FQJA 1DO0A 2P2YA 4P8RA 5D85A 2FSFA 1YMQA 2D1YA 3WLQA 1ZVJA 4UDNA 2C9ZA 6ADHA 2GA9A 2SCUB 4PSDA 4EVQA 4UD6A 4I55F 1T6BY 4Q5IA 2YN4A 1DFIA 2BJWA 1X80A 1XWWA 3PFCA 5BQFA 4LSGA 3FYSA 1X9HA 2C3OA 1U90A 1RAEA 3H3FA 4G1FA 4EW1A 2ZDGA 3ST7A 3EB9A 1P2SA 2AN4A 4D81A 2ISCA 2A5JA 3BM5A 3PE3A 4ER5A 4XE5A 4DBLE 1W1IA 1I1HA 3H5AA 4Q05A 5AKKA 3DBHB 3R9IA 1YQQA 1RC1A 1AKUA 1G6HA 1YDFA 1ICEA 5L51A 3O9VA 3RS4A 3TPFA 2ONYA 3LMKA 4PAWA 4K05A 1FZTA 5I9TA 5FUYA 4L9AA 5DGHA 2ZRCA 2IT1A 3H65A 3S55A 3OFND 3ZY3A 5KQPA 1OI2A 3ZBPA 1ISSA 3KQYA 3FOZA 2GPTA 4LWZA 4XKJA 5K4AA 5LZ2A 1RACA 5K0BA 2XT0A 3H0EA 4WH0A 4B73A 2OZLB 3CS3A 4Q01A 2V0GA 3GLHE 4DCJA 2DT8A 2AKYA 5H81A 1RQGA 3SIRA 1BX3A 4QTZA 2C1ZA 3BD6A 5I7AA 3SBEA 1P7YA 3AUKA 3W5HA 4GE0A 1NJ6A 1QZUA 2PU5A 2PIAA 3S40A 1VHWA 1YZKA 1UBTS 3DFUA 4LNAA 1F4LA 2ZXEA 4TV9A 4DT1A 3SEQA 3RRNA 2PWAA 3GAAA 4KXUA 5BUQA 3WISA 4PNPA 2JEZA 2XUHA 2Y77A 3BL8A 4LIPD 2W6QA 1V7QA 3PG5A 3TCXB 1FFGA 1IC6A 1DLIA 1NUHA 4K6GA 4MGKR 4X6XA 3RYHB 3ZZ0A 1ABFA 1WDKA 1QC5A 2IY7A 1SUPA 5FLKA 3RANA 1OH6A 5JBQA 2WB1B 5E7QA 2CXXA 4N41A 4N76A 5J63A 4EW2A 1GITA 1O7JA 4HQOA 4PZEA 3KKNA 2Z0MA 3CQZB 4LC0A 1VXRA 4XWYA 4R8MA 1DJMA 4NYMR 1F0NA 2XMCA 3HN6A 2UDPA 5D3KA 1Z0ZA 2F59A 4DSUA 3HCNA 4DA8A 5L9AA 4HGNA 1N5DA 4FEYA 3UOWA 1CEQA 3BWMA 3WLTA 4MKIA 2DBVO 3FMOB 2GPYA 3DOFA 3O3CA 3SC3A 3CF0A 4BMXA 1XAHA 5SY9A 1UXGA 2OBFA 3FTDA 4HS9A 1OLUA 5KHOC 1C8KA 5DMXA 1R5BA 4KKVA 5HMLA 1AK9A 2EC5A 1NR1A 2VHVA 1YJAA 2BFDB 3ND5A 3L8CA 1NR5A 1CE8A 3GARA 3LZCA 5DKFA 3KB6A 1BVRA 3WFIA 2ZG6A 2NUBA 3STXA 3WQBA 3WO0A 3HVIA 4IXWA 4QSHA 2WVAA 3HBNA 3JTEA 3I8SA 4OI2A 3EGIA 2J67A 1X1TA 2RGAA 1JLHA 2R751 3AONB 3BXHA 1O94D 3O31A 4JNKA 2CW5A 4LRYA 4TLCA 4UASA 3ZY4A 5AOBA 1W7AA 5IK2D 4EFKA 5DNAA 1OD6A 2CJXA 3PF9A 4YRAA 3WB0A 2QN9A 3IVMA 4UHHA 3S8MA 5CDGA 3DGFC 5KDOA 2ZSEA 3I9LA 3LX5A 1EVYA 2AG8A 2FFHA 1UZNA 2FW1A 3RGGA 5D87A 2Z6VA 2GZDA 4Z9YA 3U7JA 3EGWA 4X1KB 3EXEB 5TMPA 1BU8A 3JQRA 3OE5A 4UVGA 4HNRA 3S8EA 2G9RA 3T3NA 5DTMA 4FC7A 3MJHA 2DQZA 2MSNA 4U7GA 2KB0A 1N2ZA 4R9SA 1IN1A 3P2KA 4KO8A 1C2YA 1NNLA 2JAUA 3V4ZA 5DM60 4ETNA 3QF4B 1XCBA 4TL7A 3EIEA 4YMUA 1WWKA 4TM7A 5HQTA 5KYYB 2PX8A 4LCJA 5BNIA 1B41A 1C14A 1T5OA 3KQLA 2HA3A 4RZXA 2CMHA 1OZ0A 1E92A 1Z56C 3QYPA 4FMBB 5CHEA 5THXA 3VOSA 3REFA 5EINA 3ZNQA 4EG5A 3QBEA 3PDJA 1Q1ZA 1SKUA 1ES9A 5ILGA 5KOIA 3G1WA 3TBFA 1G6KA 3GJ0A 3M81A 1XELA 4PYNA 4G37A 4MKGA 3D81A 1CJCA 3ETNA 5LZ7A 1MQ8B 3VPXA 5UKDA 3OCWA 4I55A 10MHA 4H6PA 3H2ZA 1U28A 3IC5A 3GH3A 2VP0A 3VZBA 5CDSA 4X6UA 3TDMA 2QUIA 1KGDA 5CDYA 4RWEA 2NV2B 3IYLW 3NHBA 2R48A 1E9RA 3E9EA 3GFQA 4GMKA 1V3UA 1NASA 4HWSA 4QXQA 2E7ZA 2IEGA 4Y3UA 5YASA 1A1VA 1HI9A 4PHTA 4KYTA 2ZR8A 2G1UA 5FUWA 4ETWA 1RYBA 5EYPA 2IU6A 2AW3A 3WYCA 2GILA 4QOEA 3T5CA 4BC1A 1WUKS 5FI0B 4NC9A 4YRJA 4EAAA 1T9HA 3GL9A 5EMLA 5G2OA 4BUZA 1RPNA 2QLFA 4AJ2A 3WGVA 4HEA6 3DL0A 1C8BA 1U0EA 2XQKA 5BSGA 4O2BF 5I4KA 1GKKA 1QIKA 2W2XA 4HLCA 1OXKB 2DG2A 2QM7A 3G49A 1SQ0A 1LZKA 2YBDA 1C3LA 4LECA 1CR4A 2PFSA 4PWYA 3R9XA 1B3BA 1EM8A 1AHHA 2C5LA 4LJYA 4F92B 4QKQA 2BEJA 1Z5UA 2OP1A 2V6IA 1P91A 2X5KO 3VSAA 5ADVA 4UUPA 4X64B 4MQMA 3IXQA 1A7KA 2I4MA 1P5FA 2CDCA 3GUYA 4YONB 1FU7A 2VYQA 4LNUB 3QUSA 1QUFA 4IMJB 2MSLA 3A4NA 2IXDA 4HQNA 4B4KA 2ZM6B 2QIPA 5LBTA 1EFRA 3LUBA 4HSGA 1SN7A 2W4QA 3BHJA 4AS2A 4JYPA 4B3CA 3N2GB 4YC7A 3ER9A 2PLAA 2Y1KA 3EVCA 1WU7A 2HTFA 3IURA 1RQLA 4FHZA 4F04A 1ZU4A 3EIUA 5CFQA 2QQFA 2VNAA 4E5PA 1EWRA 1CULC 1MO5A 4DV7B 1NI5A 4G0PA 4EATA 3BIJA 2D1RA 3CXUA 4HMQA 2GBPA 3EH2A 3EY9A 1M0WA 1W5EA 2VG8A 4F3KA 5KYKA 1RLMA 4O4IA 5ESXA 1O5IA 3C5VA 3D4PA 4FYPA 5TPZD 3B6MA 1DQYA 4Y7CA 3RVJA 3EA0A 1IJEA 2GZMA 1BXGB 4LYFA 3X1JA 4ZPXA 1TGVA 2Q3HA 3KEMA 3OHMA 1E5XA 4JT9A 2REQA 3AL0C 3WYGA 1NMSA 1TA9A 3ETDA 3D3JA 4OL9A 2J9FA 4Y9SA 2QA5A 3FYTA 4KGZA 3S2IA 1QP4A 4YRTA 3LGSA 2Q1XA 3I6ZA 3HO8A 3MC1A 3M49A 4F7DA 5AVQA 4UU7A 4HQLA 1XZ8A 1E5LA 1I0IA 4ZEVA 1Q19A 4HF7A 3QG5A 5AXDA 1JPJA 1ZMRA 1L5KA 2J5QA 3VR2A 3ZGLA 1PX2A 1D7AA 2Z9DA 1TM5E 3FUXA 4D9BA 3S14B 4TT3A 4IY1A 4OHRA 1IMOA 3IUNA 4LSMA 4CL8A 4RVSA 1LJLA 4D0LB 3RHTA 2ODBA 2G4CA 5DP2A 5REQA 2H7VA 5I7EA 3GGCA 3SFTA 1XTBA 3IPRA 3ZDBA 1GM5A 2VZLA 5GPBA 2EG9A 5AUPB 3LY7A 5AKZA 3WLEA 4LMBA 2C5HA 4IV8A