1WR8A

Crystal structure of hypothetical protein ph1421 from pyrococcus horikoshii.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
230
structure length
230
Chain Sequence
KIKAISIDIDGTITYPNRMIHEKALEAIRRAESLGIPIMLVTGNTVQFAEAASILIGTSGPVVAEDGGAISYKKKRIFLASMDEEWILWNEIRKRFPNARTSYTMPDRRAGLVIMRETINVETVREIINELNLNLVAVDSGFAIHVKKPWINKGSGIEKASEFLGIKPKEVAHVGDGENDLDAFKVVGYKVAVAQAPKILKENADYVTKKEYGEGGAEAIYHILEKFGYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Phosphoglycolate phosphatase
publication title Structure of a haloacid dehalogenase superfamily phosphatase PH1421 from Pyrococcus horikoshii OT3: oligomeric state and thermoadaptation mechanism.
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 85
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 3.1.3.18: Phosphoglycolate phosphatase.
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1wr8A01
3.90.1070.10 Alpha Beta Alpha-Beta Complex Hypothetical Protein Ta0175; Chain: A, domain 2 Hypothetical Protein Ta0175; Chain: A, domain 2 1wr8A02
5ALYA 3SHQA 1T5SA 4MWOA 3PGVA 1N9KA 3QU9A 1EK2A 4I9FA 2G06A 3I76A 3N28A 5AKHA 5IS2A 3OCZA 5T41A 3EPRA 4CE6A 2IYEA 1K1EA 2FDRA 3W5AA 4HGNA 3R9KA 1RKQA 2JAUA 2R8YA 4UMVA 2HDOA 4HAIA 4XPZA 3EWIA 4Y2SA 2P27A 3RFUA 5AK4A 4FFDA 3WK9A 4CF3A 2Q4RA 4EEKA 5AIAA 1NF2A 1X42A 3N8GA 5AIBA 3HYCA 4EX6A 3B8EA 3ZTYA 4UU1A 1ZD2P 2FEAA 1TE2A 2P69A 4Y2TA 3QX7A 3UM9A 3ET5A 4UARA 2QYHA 1CQZA 5ALFA 5AM2A 2PR7A 1VJ5A 3A3YA 1CR6A 3E84A 2ZBEA 2ZOSA 4IFTA 5AVXA 3L5KA 3L7YA 4Y2RA 3W5CA 4QQFA 3RF6A 5AKYA 1J97A 2ZBDA 3WKDA 3W5BA 3QU2A 2GHTA 3OTQA 3BWVA 3TLMA 2I6XA 3IJ5A 2MU1A 3MMZA 2B1RA 3ED5A 3S6JA 4UAUA 1LVHA 5ALQA 4RESA 4B6JA 5ALOA 3U19A 1Z4MA 1KYTA 2B1QA 4E88A 3L0BA 1AQ6A 4IG4A 5JJBA 1EK1A 2WF7A 3SKXA 5AW4A 3L1VA 4BEWA 3KC2A 3QU5A 3KD3A 3E58A 3AR8A 3ONNA 2HX1A 1Z5UA 5AKLA 1RQLA 3WKAA 4EELA 5A3SA 1S8OA 4MUMA 5ALTA 4BYGA 1TJ3A 2ODAA 3FPSA 5ALLA 5ALJA 2B0CA 5AVZA 2G0AA 3KZXA 4XE5A 4Y2UA 2DQSA 2JAOA 2X4DA 1RLOA 1XVIA 3SF0A 4EENA 3AR4A 5ALEA 2G09A 1ZRNA 2O2XA 5AKIA 1YJ5A 1Z4IA 5FP0A 4AS3A 2RARA 2P11A 1FEZA 4BX3A 2NO5A 4NAVA 4UM7A 4Y2PA 4YIKA 5AW1A 5AVUA 1YS9A 4DW8A 1SWWA 4AP9A 2YY6A 1QYIA 2I55A 4UMFA 3QU4A 4KNWA 3SKYA 5A3QA 3ESRA 3DAOA 1WPGA 4NFLA 2RBKA 2OYCA 4HGQA 1RC8A 2CFTA 3D6JA 2I7DA 3WK8A 1VFPA 4F71A 2CFSA 3ZUPA 2YJ3A 3N5KA 3SLRA 5ALVA 2IA5A 4CF5A 5AW7A 3OCVA 2YMLA 5AM0A 2BY4A 3EF0A 4DWOA 1J8DA 3W5DA 3IB6A 3AR6A 3UMBA 2WHEA 4Y2VA 3QLEA 2C88A 2IOHA 3J7TA 4FYPA 2FPXA 2I54A 1QQ6A 4L57A 5AW8A 5ALZA 1SWVA 1U7OA 3U7GA 1RQNA 3KOOA 5AVRA 5AW0A 5AKZA 1Z4QA 1RMTA 3E81A 3WK5A 1L6RA 4G9BA 4NV0A 1L8LA 1YV9A 3DDHA 1T5TA 3ET4A 3AR5A 2AH5A 1WZCA 4UMDA 4GXTA 2YBDA 2YN4A 4BEVA 5AM4A 2EATA 3ZI4A 1RLMA 2G80A 4RETA 5AKJA 3B9RA 3OPXA 3NALA 3QUCA 3MN1A 5AVYA 1L7PA 3QGMA 3SD7A 2P9JA 4UW9A 3R4CA 3AR2A 5AW6A 4I9GA 2YJ5A 3FPBA 1ZRMA 2YFYA 2EARA 5AW9A 2HI0A 4GIBA 4CNQA 3IRUA 3F9RA 5IT0A 2HHLA 4C4RA 5E0OA 4HGOA 2ZG6A 3QYPA 4BX2A 2WF8A 4L6AA 1U2SA 3NAMA 4UAVA 3ESQA 1ZD4A 1T9ZA 1RLTA 4G63A 5AI4A 1Z4JA 1Z4KA 1U2TA 2RB5A 1YMQA 2IOFK 4YH1A 2HSZA 3OCUA 2GFHA 4KNVA 1Z5GA 5AM3A 3ZVLA 3N07A 2VKQA 3M1YA 2ZBFA 4YCMA 3FZQA 5AI9A 3L1UA 5AK3A 4Y3UA 1JUDA 4UASA 2FPSA 5AW5A 3QUQA 4BBJA 1QH9A 4DFDA 1RDFA 1ZS9A 2WF5A 1LTQA 5AI5A 5AKXA 2BDEA 3NUQA 3I28A 1N8NA 2C8LA 2NO4A 5ALKA 3P96A 4NWIA 3ZX5A 2C9MA 3I1YA 3MC1A 5AVTA 3L8GA 2R8EA 3WKCA 5AI8A 4Y2XA 3ZTWA 3B9BA 2RAVA 3A1CA 1WVIA 1Z88A 5ALNA 1RMYA 4JB3A 4KN8A 2CFRA 3HLTA 3L8EA 1F5SA 3AR7A 1MH9A 5AKKA 4F72A 4OFZA 4C4SA 3ZU6A 1L7OA 3KDPA 2FPWA 2G1AA 2B30A 2HCFA 3M9LA 3L8FA 5ALIA 4EX7A 1L7MA 2B8JA 1RMQA 1YDFA 2PQ0A 4KX5A 2GHQA 2I34A 3L8HA 1Q92A 2OBBA 2MSNA 3WK4A 3DV9A 3U26A 4H1WA 3NASA 5AVWA 5AVVA 2OA0A 3WKBA 4J03A 4HGRA 2HEGA 1NNLA 1TJ5A 4HGPA 4UU0A 5AKGA 3A1EA 2AMYA 3U7FB 2JARA 4Y2JA 5IT4A 2IOFA 3U13A 5ALSA 5ALHA 5AVQA 5AHXA 4UMEA 2YMQA 2FPRA 2WM8A 4YGYA 1TJ4A 1Z4LA 2O9JA 2Q5EA 1QQ7A 2W4MA 4XQ0A 4BNDA 2NYVA 4YCNA 2C8KA 4AS2A 4ZEVA 3WK6A 2D2VA 3ZW7A 4KX3A 4XOUA 3OCYA 3ZVNA 3UMCA 2FI1A 1Z4NA 2R8ZA 3QNMA 2YJ6A 4C4TA 4J2TA 3MPOA 1L8OA 3EF1A 2HF2A 4ZEXA 3GYGA 2ZXEA 3ZX4A 2G08A 1XPJA 5ALWA 2CN1A 3PGLA 4O8CA 3PDWA 2R8XA 3WKEA 4QJBA 3FM9A 3AR3A 5AM5A 5AW2A 2AGVA 1SU4A 1YNSA 1ZD3A 4OCZA 3QUTA 2EAUA 1U7PA 1L7NA 2B82A 3PCTA 4Y2YA 3K1ZA 4EZEA 1VJRA 2I33A 3ZWKA 4FE3A 4JDPA 4BX0A 2W11A 3U7HB 5AICA 3N1UA 4PNHA 2YMPA 4UATA 5ALMA 4UM5A 1U02A 1RKVA 3FVVA 3NANA 5ALRA 3AR9A 3R09A 4YIHA 5AESA 2AUTA 1NRWA 3E8MA 3WGUA 1PW5A 3DNPA 2FUEA 3FGOA 3NIWA 1ZOLA 3QUBA 4HYTA 3WK7A 3CZ4A 2HOQA 1ZJJA 2GO7A 5AI0A 2FUCA 5A3RA 2GMWA 2WF6A 2BDUA 3VAYA 5AI6A 3ZVMA 3OCXA 1RRCA 1Z4OA 1S2OA 2Q4TA 4OD0A 5AK6A 2YMMA 1IWOA 2YJ4A 3WGVA 5AW3A 3I6BA 2QLTA 4ZEWA 5AK5A 5AVSA 2FPUA 1RKUA 3UMGA 4KYTA 2ZBGA 4DCCA 1O08A 4CF4A 4OHFA 3BA6A 5ALPA 2JAWA 3QXGA 5AM1A 2PKEA 3KBBA 3A1DA 5ALUA 2G07A 3OCWA 3U7EB 1TA0A 4BNDB 2C4NA 5ALXA 1Y8AA 2HO4A 5AKEA 5ALGA 1ZD5A 1O03A 1WR8A 2WFAA 3L0CA 1XP5A 1RPZA 2W43A 2OM6A 3SMVA 4YCLA 2HF7A 2B8EA 2JGAA 4Y2QA 3QU7A 4BKMA 3NRJA 3ZWDA 3L0YA 4NABA 3CNHA 1Q91A 1Z4PX 2WF9A 4L6CA 1QQ5A 5ALDA
chains in the Genus database with same CATH superfamily
3I9LA 2BKUA 4ZV4A 5TPZA 2WYVA 1UP7A 3AINA 3BF7A 3QZUA 5K4HA 4MPPA 2W7TA 1PKXA 2MHCA 3RC3A 1CXZA 4BU0A 5BWNA 4CFSA 1OOEA 3HM9A 3IDZA 5CB4A 3P4UA 1XD2A 2FMKA 1IXRC 1E4YA 1HE8B 1T36B 3CUWA 3E4DA 4BEJA 3PQ6A 2AFIE 3FOAA 4JLNA 2OFOA 1HE2A 1I3OA 2Q6OA 2O3QA 4BDSA 1IG3A 1NYQA 4R68A 2FA9A 5GZ1A 4GLLA 1D07A 1P8AA 1G1MA 5C5CA 5BWLA 3EX7C 1J07A 2KYRA 1TO2E 1ZNQO 1T0JB 4JA2A 3EE6A 4QEZA 5F12A 3Q3JB 2HXSA 1L5NA 1V8DA 3IBSA 1Z3IX 3OPVA 3H9GA 1SBQA 3CVYA 3RFUA 3A9CA 2P27A 2VPZA 4JN6B 3FYSA 3I9V1 3T35A 3WRYA 4DWWA 2VEOA 4G0OA 1AN0A 2VBGA 3AW9A 3LBAA 4KFRA 2QM0A 1YIDA 1ATIA 5AIBA 4RU1A 4OP3A 2WVHA 4YP6A 3TLGB 2YIMA 3OPNA 2X5JO 4M0MA 4QJIA 1ZD2P 4JOQA 1FBTA 3LUBA 3RHSA 4FFBB 3UK2A 3CJRA 5IJ9A 4LF4B 5J5AA 2J45A 1M2OB 4OQPA 2PS1A 4Q1DA 3LZCA 5GVSA 4X00A 1JSLA 3E22B 4PHCA 2J7PD 1ZJ4A 4YDHB 2XNCA 2WKWA 3A3YA 2MWMA 1LWNA 1NKSA 3GGOA 5ES3A 4PX3A 5JADA 4NBRA 1KAHA 2W2XA 5TNXA 2P9FA 1FPMA 2PLFA 4JWTA 3O82A 2PJZA 3P32A 4N3BA 3E0QA 4H7JA 1RXUA 1JA9A 1BYUA 3GTKB 1TQ4A 4U7JA 3ZY4A 2C3PA 5A7GA 4IDHA 2ST1A 3RW9A 5KDDA 2GHTA 2XB8A 2RHBA 1PX2A 1NUHA 2IVFA 1PV1A 4BFZA 1NUSA 1E9DA 2Z9DA 4G86A 3TCKA 3S6JA 1I3CA 2EFHB 1RJFA 3AI3A 2C2HA 1ZBDA 2XF8A 3TN7A 4UBNA 3A9WA 3QV1A 4PM4A 1OHHA 2W58A 4EA7A 1Z4MA 3AEKA 3FA2A 5AHWA 2B1QA 3HR7A 2P5TB 3A9VA 3EZGA 4PC3A 5CVUA 5K99A 3DYIA 4JB0A 4AG3A 3FTQA 2WF7A 4PZPA 3VPHA 2IELA 3P26A 1SN7A 3KYDB 1DDGA 5B6PA 2GYYA 1L5ZA 1J99A 3V4VB 1GXSA 2PR2A 5LMNB 1VL8A 4I1PA 4A3FB 3AF6A 2QTAA 4J49A 3P0EA 2PXAA 5KTYA 3O03A 4AW9A 5KS2A 5ESWA 2IX3A 1N57A 2BTQB 3GO4A 5HS6A 4UNSA 4U3JB 1TKCA 2PYDA 1S4MA 2B69A 2E5WA 2I22A 1TW2A 1FL9A 4JGGA 5D84A 2JGFA 4EGSA 3DZKA 4R84A 5IYZF 1VHTA 5ALLA 4E13A 5FPTA 4DSNA 3M34A 3WOHA 4XE5A 1OXTA 4OUDB 3SX0A 2VTBA 4NE2A 2JLZA 4B73A 2CLOB 3CRMA 4CIAA 4I6JA 4J7CA 3STUA 5B7GA 4UE6A 5KMGA 4Y9UA 1FW6A 1L5KA 1Z0AA 1T9HA 2EU8A 3IMKA 1SCIA 3EXHC 3KWMA 4CMHA 3HJBA 4CQLA 3P9IA 2PGAA 3S8YA 1EVJA 2RGWA 1YBHA 1Z6ZA 2CGEA 2G09A 3EMDA 3NGMA 1KK1A 1XLUA 3IAFA 3RGGA 1OASA 1F0NA 1N9GA 2ZI7A 4UM7A 2ZCJA 4TS3A 1Y63A 1JLLB 4TL9A 4V0NA 2H54A 1D7AA 4M1TA 2WYIA 3GLGA 3I01A 3DE7X 2Q0HA 3IEXA 1Q0HA 2W93A 4CT4B 2I2XB 3O8LA 3ZCQA 2JIPA 4JNKA 2HH9A 2ZJYA 4JLJA 1EDBA 3I39X 4YTEA 1MOZA 3ABSB 1JTFA 4KPUA 4MUGA 3SKYA 3BE6A 3G79A 2WJGA 1PK7A 2CHFA 4FFLA 4ZU3A 1MFZA 5HFJA 5LFAA 2BL4A 3MNFA 2CL5A 4A8JB 1RJGA 4TMYA 3F73A 4JBNA 3ZQ4A 4KIFA 2B6HA 4RDXA 5T7BA 1HDOA 1ZVVA 4YACA 1A4RA 1G2QA 2OB1A 5H0IA 2PD4A 3H5NA 4DJEC 2C2OA 1SCUA 2F1JA 3EPJA 5H7XA 1JHOA 1KEEB 2N0SA 1YZGA 3LZ6A 2Q50A 3PJDA 4LW8A 4RVUA 4TRMA 4FS8A 2IA5A 2ZB2A 3KZ1E 2JH3A 3W7AA 4GLFA 3ZQUA 3FOWA 4N39A 1K88A 1DC4A 3AFGA 1PDWA 4S1VA 4TGLA 3CLUD 2BZ1A 2PUCA 3WLOA 1ULUA 1RE0A 1B0AA 1KI3A 2PH3A 3EBPA 2GN2A 3ZHQA 2XSZA 2D0PB 3KTAA 4LZOA 1AGPA 1RKXA 2VT2A 1B1AA 1X39A 5COAA 4LJRA 2FPXA 4DN6A 2I54A 1XX6A 3H4MA 4BE4A 5BY2A 3ZDDA 1ONSA 2AC4A 1EE2A 3R7SA 1NW7A 1NVTA 2H92A 4NCKA 2IIBA 3U9TA 3LT1A 3LKVA 2ZTUA 1FRNA 3NDRA 4JB2A 4YDQA 4UE2A 1E3TA 4KODA 2BGUA 4GRAA 1UWCA 2SHKA 5D01A 4NTZA 5FA5A 3GD5A 2P68A 4A27A 3DAYA 4PTYA 2WEKA 4H7IA 4TL6A 1UPFA 3GRPA 2V7UA 1DCKA 3M3DA 3V2GA 2QV7A 4KFCA 2Z09A 3MLBA 3OZEA 3MJCA 4IXTA 2XQGA 3HZOA 1CQPA 1H4TA 2F8LA 5CDYA 3A26A 4C7MA 1E6UA 1MO2A 1LCIA 3QG5A 3AIIA 3SYNA 1MT0A 4MR8A 3IHKA 2FY8A 3RRJA 4BLOA 4E5VA 4RD4A 3GTGB 2NUPB 1OMOA 2P3OA 3G9QA 1AG9A 1U31A 2RB4A 3NBZC 3LUAA 5H9VA 2FUNB 2JJ1D 2WHPA 5ECYA 4MITA 4BMZA 5MGBA 3B3JA 3UVEA 1RC1A 1KL7A 1WU7A 2Q5HA 4IH4A 4XSHA 2EZUA 3EHDA 2BN4A 1I0LA 3G8DA 3H87A 2VYQA 3IPAA 3TLBA 1A96A 1TT5B 5JS2A 1QIDA 1YB7A 3P9QA 2HBRA 4RTJA 4KNYA 2XNKA 4PG7A 1MTOA 1QVVA 3EEQA 3GRZA 1FMFA 2ZTMA 5HIKA 3X3HA 1U2SA 2SNIE 1PNVA 1GPJA 4TSFD 4I50F 3CJQA 3ZTYA 3AILA 2PKRA 3RUFA 2WWVD 1AS0A 1U2TA 1SBYA 3WG9A 2J0EA 3DHNA 4DLBA 16PKA 4EY8A 3V4LA 3BMCA 2Y67A 1R0CA 5HM8A 3RIHA 2XB2A 3DLBA 1UF9A 1B42A 1S2LA 4PPYA 3VR5A 2GFHA 2J07A 2O7SA 1OB5A 4RJIA 1PNOA 3F78A 1N6LA 4I9HA 1CUIA 4OI2A 4DR2B 1VBNA 1OZ0A 2DG2A 5JAUA 1IEQA 1CEYA 3E2PA 1FXSA 3C0KA 3A4MA 4FX5A 4K1XA 3VVCA 1D4OA 4XQEA 5IG2A 2Y99A 3L6RA 2GZSA 4QWMA 3UMMA 2UUBB 2C42A 3PX3A 4LXIA 2C8JA 3OEYA 4V38A 3FNHA 4AUEA 4LF6B 4EFKA 1U2RA 3MPUA 2B5VA 4X65B 4K03A 1YI1A 3STHA 4AZ3B 1BEEA 2IZOA 3IJEB 4C7XA 3THXA 1IY2A 1HOTA 5C51B 3NC1C 1C4KA 2G25A 4HLUA 4MLZA 1TIBA 5DEOA 5ALKA 2DWPA 2QNRA 1J09A 1HOXA 3PUIA 4X1YB 1DAEA 2WAMA 2C0CA 3CF4G 3TVDA 3OC0A 5BUCA 2PMZB 4JBIA 1WXQA 2B4YA 3KLBA 2HV8A 3V2UA 3ZYZA 3PD1A 3KJZA 3ONEA 3BMXA 4OBBA 2GS9A 4RPHA 3TIIA 2N1BA 3LRTA 4FDMA 3QI2A 3ONVA 3NW9A 3KB8A 4GM1A 4JJEA 4KZPA 4O2BB 3EZ6A 4TLCA 1AV7A 2ZPUA 2ZCVA 5IWCA 2OCKA 1WOMA 2O8EA 4A92A 5TT1A 1BEUB 1NMYA 4B4VA 2I2CA 4MW7A 4ZOCA 4AJJA 1JDBC 2ATVA 2MSWA 4ZCPA 1EVYA 4AMVA 4DG8A 4Z49A 1CZHA 3MJSA 5ADWA 4WEOA 2EQAA 2H1SA 4KR7A 1KJNA 1PLKA 2ACVA 2B7CA 2OO7A 3DV2A 3N6XA 4PO3X 5H3LA 4C6SA 3SFZA 4M83A 2M32A 1V26A 3TRDA 1OX4B 5IZ4A 2EGGA 5LJLA 1FP4A 1WSWA 4BBSB 2PO7A 4PPNA 1G9XA 4WBXC 5EUMA 2I34A 3HXPA 5CX1B 2GT1A 1VKZA 2XF2A 4GKVA 3ZI7A 1ZCFA 1G8FA 3NONA 1ORRA 1U5CA 3U26A 1UBFA 3NETA 4CKZA 3UPTA 2IX9A 1DFGA 3IE2A 3Q9NA 1OFTA 3G0GA 3ZDAA 2O06A 1BE1A 1I33A 2VJMA 3E7DA 2YL2A 1HWYA 2ONYA 5KSYA 3WJ7A 2C5AA 3WA7A 1DGQA 1EUCB 4RGQA 3VUFA 4LV8B 3TI7A 5HE9A 1K0UA 1VE5A 2DFLA 3UUFA 2PRKA 2HSWA 1NRJB 3ISTA 3R3JA 4IAOA 2AMYA 3D3EA 5BUZA 1ZLXA 4JUBA 4BNTA 1XZNA 2XUJA 1NJ5A 3RVLA 1BXRB 2FPRA 3VM6A 2Y1FA 2VQFB 1FDVA 3JQAB 2X8JA 2Z9BA 1BCSA 1NL3A 2WD7A 4TSRA 4RK0A 1M2HA 2WJ4A 1QU2A 4JJAA 4WK6A 2Y68A 2ZYSA 3QFFA 2QRQA 2HMAA 3VGPA 4KPFC 1HMYA 4U2FA 1KETA 4K26A 1S01A 1Y6JA 2GSWA 3S5JA 3SQNA 5CT8A 1QIGA 4C0SA 5C18A 1TZCA 1O6CA 3L4SO 4A3JB 3TR6A 4TQUS 1W4RA 3ER6A 3JZAA 3AY7A 3EC2A 4MLPA 1DZIA 3C5WP 4XFDA 3CRQA 4ZICA 1BN7A 3KVNA 1F4VA 2YJ6A 4QDTA 2NZ8A 5I3CA 2P9ZA 1XNHA 2PKQP 3Q10A 4Q02A 3UXHA 2FSHA 5EERA 3OQJA 4PLWA 4BLQA 5J63A 1JEYA 3O8DA 4MO2A 1NFFA 2ZXEA 3DOHA 3DMTC 1UOQA 2WYWA 3KJQA 5GZ3A 3KQPA 4WJZA 4WLVA 2XDQB 4A3EB 1KQPA 1XPJA 1OW3B 2ROQA 4F2DA 4EG1A 4HOYA 1D04A 1VFNA 3T41A 4ZO4A 4D41A 5M7EA 1GLVA 1TFUA 4MYRA 4F6RA 4GDFA 1FFEA 1XT6A 2XWQA 5G0SA 4E12A 1U9CA 4HSGA 2IY9A 2AHRA 2EAUA 1BWRA 2IC5A 2ZLBA 3OQIA 1VL1A 4EUNA 4UXJA 1KE1A 1RWVA 3LP8A 4PFSA 1E62A 1NZJA 3OX1A 3HXOA 4QUEA 3F6CA 1JDUA 2PMCA 4G01B 3HB7A 2IZ7A 1P31A 1S1MA 3MRVA 2VYND 1A2OA 1R4AA 2WINI 4L22A 1OWOA 3BWXA 3D0KA 3I2YX 2G5TA 3S40A 1XTVA 1JJVA 3OWHA 2GVDC 4PNHA 1UIMA 4NOKA 5BRNA 3TTYA 3OQPA 2Q2OA 4IJ5A 3GR6A 4CMCA 5I7WA 4ZT4A 1FDTA 3Q2OA 4P4SB 3RC7A 4QUAA 1TADA 6ADHA 3T5GA 3JWHA 2TMKA 3M2PA 3KDAA 1C4WA 4L85A 3WAKA 3V4OA 3CTPA 3C14C 4YXWA 3K15A 4L72A 2BFFA 2NNWB 2Q4BA 3F90A 1LJUA 3C5VA 4PRKA 5CH5A 1I2BA 1SIOA 1ZD1A 2Z2XA 2H2DA 4NFHA 3SBDA 4D9GA 4DJJA 4B7CA 1BMFA 2OOSA 3HOUB 3FGOA 2BLLA 2YVAA 2C5SA 3WK7A 4YFYA 3CS3A 3HL4A 3QE2A 1WZ2A 1E2BA 3D31A 1M2KA 2IXTA 4F60A 2XCRB 4WCFB 4TV9B 1U3CA 2RIRA 4XYBA 1ABFA 2A14A 1Z83A 1H3FA 3ETHA 4NAHA 1UDBA 4I46A 3QA9A 3GP8A 3NHSA 4YC7A 2XWJI 1PJCA 1GNSA 1EAYA 2E7ZA 1MXHA 4QBIA 1U4OA 1PKEA 2VN8A 3OZ7A 1DEAA 5BO5A 4F45A 4YAIA 5LWHA 2D6FA 3NGLA 4OI0A 1E3WA 1WDMA 2L18A 1U3WA 1NXVA 1L1RA 3ZLBA 3O91A 1YNOA 2OO3A 2YWHA 4YJHA 3QX3A 2Z5VA 5AK5A 5PGMA 4J29A 2WU1A 3HA7A 4CCYA 1VB5A 3HY4A 4BMSA 3H0GB 2FEPA 1IVYA 4MW2A 1Z75A 5HWSA 1NULA 4YO7A 3W8RA 1QPGA 1US8A 4ZXFA 3NKVA 4BDTA 4UPEA 3JVUA 3OC6A 4NQRA 1E0SA 1FYVA 2JAWA 2NACA 3E9CA 3QXGA 2B94A 4GSLA 4IGEA 2RHDA 1PUXA 4HRXA 1J2YA 5ALUA 2QP4A 3SZ3A 1M83A 5C1OA 3EZ7A 4PONA 4M37A 1RRMA 5DPMA 5THXA 1IK4A 1Y8AA 3DLHA 5FFNA 3M2TA 4JBLA 4NX2A 1JHDA 2DF8A 4BECA 3O3MB 3ENWA 1DXYA 3UV6A 1ADBA 1HNNA 3STYA 2PBFA 4OX9Y 4ID3A 5A7HA 4HAWA 4A2WA 3E1SA 4GXQA 3K7EA 2PUGA 4R6XA 3B1FA 3SDBA 3IULA 4HB0A 4JGIA 1KKUA 2FRDC 2QN1A 2YWFA 1PBNA 2P4QA 4KGXA 3FUWA 1NJ1A 2V54A 5ERGB 4AJHA 1YKFA 3IE1A 1QQ5A 1TAQA 1FYXA 2XMGA 3SCZA 2JFWA 2WJYA 3Q5GA 4M49A 2JJ8A 3EHEA 2C5LA 2DSTA 4GKBA 1QHEA 2PGJA 2QEQA 4XD7A 4HB2A 4OQXA 2IEBA 1FJXA 1R5BA 1CBUA 3OBBA 1U8EA 1R0RE 3NR2A 2O2IA 3CUSA 3D4NA 1OX5A 1IN7A 1Z0KA 2G06A 4HN4B 3A05A 3RFCA 3OCZA 1AKVA 1C8LA 3T15A 2ZI3A 3L7IA 2NM0A 4WZAA 3K70B 5JJLA 3DQZA 3OJXA 4PRYA 3P97A 5ICFA 3FB4A 3AJ9A 1HRDA 5HX7A 3CR7A 1BDMA 4KW7A 1I2MA 5IK2A 4CL8A 1HO3A 3PHCA 3WLJA 1NVWQ 5C3EB 3PQ3A 5C8XA 3N0TA 3ANMA 4QSHA 5P21A 2WYHA 1DAMA 2DWQA 2BCGY 4MVJA 4INOA 4P2GA 3UW3A 4QIHA 2R6GA 4ZVMA 1DUSA 5H80A 4BMPB 4ZZIA 1K7CA 3PNMA 4XIIA 2CVQA 1G18A 4PG5A 5AK4A 1L9KA 1W9HA 3UJ3X 2C29D 1MKYA 2G83A 1FFGA 4PSDA 1MUUA 3W79A 1FJHA 4ZHQB 2BMAA 2C57A 4HQRA 4HUQA 7ABPA 1KARA 2AL7A 3UB2A 3WA6A 4JDUA 4EECA 2FEAA 3QX7A 3UM9A 1GKIA 3OJOA 4UARA 4G5OA 7AT1A 4C4ZA 3WE7A 1CQZA 1L7QA 1Y8QA 3C6XA 4C87A 1C0EA 3B5IA 1O54A 2VDOB 1IK6A 3RFFA 4IFTA 2ZM5A 4AJLA 4ZMRA 3BCRA 4EEXA 3F47A 2AVNA 4Y9RA 3C1TA 2QW1A 4ND3A 3VHLB 5LZ4A 3BH7A 2UUCB 1J97A 4LNUB 1O97D 1WQ4A 4RFSB 3WC4A 3CUTA 3VISA 5KQGA 5BW6B 1U6JA 1V8ZA 1X14A 3DLIA 3T4PA 1X86B 4GPZA 2YW9A 5KTPA 4B40A 4XSVA 5I8PA 5MN4A 4LE0A 4ZI7A 2O8BB 3F3MA 3LHSA 1E3IA 2BELA 5AJXA 4BBZA 3G2JA 3GGDA 4S04A 3CRZA 1XZFA 1V3UA 3FCXA 1NXQA 1H2AS 3KB2A 3QFTA 4TKVB 5I9SA 4YCBA 5JJBA 4UXIA 1EFRD 1N92A 4AKSA 1KJ9A 4G1MB 2P75A 3HSYA 3KTDA 3UZUA 5M04A 4N7BA 1D2GA 1UBUS 2X8LA 4RDCA 4RK6A 4C0WA 3FNBA 4EGCB 2E4XA 5HOEA 4RJKA 1KGSA 4BBPA 3GLSA 2FZLA 2I3ZA 2BVNA 4F91B 9LDBA 1CETA 1SCAA 1XU9A 4ZHSA 1T4MA 3AFOA 4A8TA 3LQKA 1Q7EA 1RS0A 2CXUA 3NC4A 3UJ7A 3QWFA 4DC0A 4KWIA 3PO2B 4PYLA 3VO9A 3IELA 3TAUA 4XVCA 1X2EA 2XZTA 1HE5A 1QYCA 2QAIA 4DBLC 1A3CA 1TLFA 5AVZA 2F8SA 1P5RA 3FIJA 4GEGA 4TMXA 1A4XA 4ZVOA 4B34A 5LN1A 3WFZA 4AK9A 1E2LA 1XEWX 4OJTA 3MERA 3MWJA 2JAOA 1LC3A 4HNQA 3GZTB 1RAEA 1X3SA 5TS3A 5C3MA 4WGGA 4YJ2F 5IWAB 3OU7A 3TM5A 2OD9A 3MA0A 4Q21A 4QOJA 5KTSA 5CHYA 4IIVA 5AR1A 3JAKB 2GRJA 4BV9A 1FFBA 4MS4B 3ROQA 1OLSA 1SC1A 4CVNA 4F9FA 4B33A 2P2YA 4HEA6 1UIRA 3A1SA 4NAVA 1JSCA 1NW3A 1Z2NX 3H3JA 5K8LA 4RLFA 1JFLA 2QR3A 4FGUA 4H6VA 1HSZA 3BFVA 5EE1A 2CVZA 4Q3OA 4M1WA 2QVBA 3PA6A 3ZGVA 5HTOA 4HVAA 2WWTA 1GZ7A 3K6SA 1Y4AE 1KEPA 4QECA 2R1VB 5K3FA 4UMFA 4LXGA 4HD8A 2VP3A 2A9JA 4R0MA 3GGPA 3GAAA 5IABA 5KTNA 1T6YA 1ARZA 2BP7A 5EHGA 5JCPA 4DSTA 1ECFA 2I91A 2CNBA 2G40A 3RS3A 1NG9A 5LIPA 1KMQA 1BFUA 5FL7D 1RJ9B 5JLAA 3WK8A 3UHJA 1TAUA 1P8JA 1CJCA 2BHLA 2HNKA 1HDGO 3DKVA 3DLAA 3MD0A 3L4KA 3QXXA 3SLRA 2Z30A 3IOYA 4UTNA 5E3JA 2PCLA 4LMPA 1TK3A 5CFNA 3CLTD 3DOCA 3A70A 5DVZA 4EYEA 2ZJZA 3OUUA 2Q0SA 4LWOA 2EW2A 1DIRA 4CPDA 5GZ6A 4R6WA 3UJHA 2JS7A 2OLKA 3CB2A 2XKAA 2E48A 3L6UA 3MMSA 3V1UA 4BX8A 4R7TA 3EF0A 2QSUA 1KVSA 2PT6A 3U44A 3G2KA 1A2KC 4F21A 4MWCA 1KFJB 3N2KB 3KL2A 3QLEA 3MOSA 2EF1A 3Q2IA 3VBCA 1BJKA 1JFFA 3CEJA 4Q3DA 1JG3A 2ECOA 3W3AA 4OAOA 2NP7A 3PXBA 2EIXA 3NJRA 4KUHA 4M46A 1HT0A 4F4HA 1AUVA 2BFCA 2WPNA 1L5RA 5CBPB 2VHUA 4JZYA 5AKZA 3R3SA 5G02A 1PJ4A 1T9CA 1X1DA 4RS4A 5FOTA 3TZQA 4Z4IA 2BH2A 3AM3A 4AZTA 1NSTA 5IHXA 3DEIA 3GG9A 1WZIA 3UGJA 3IVAA 1JS1X 4N7MA 3LSYA 3COZA 4KH0A 2EBUA 1Z9BA 5I48A 2YN4A 2YQZA 4X24A 2RGGA 5EXXA 3A4YA 3N2ZB 5BRJA 3JAMA 2PUEA 2YXNA 3RAJA 2HQBA 3LOPA 4UHFA 4QBTA 1GPMA 2G80A 2IKQA 4LDRA 4L5BA 2CB9A 4NU0A 2PJUA 4JVSB 4Z1MA 3ZH2A 3BCHA 4G36A 1BGXT 3ANSA 1EP9A 1JA0A 3QUCA 2X0JA 2XT0A 3VO1A 4CKWB 5AVYA 1UDAA 3K5PA 1VLMA 2HGSA 1H5NA 1TZKA 2K87A 4OGWA 2ZIGA 4MTLA 5AW6A 3PCRB 3NP7A 1H0HA 3DBVO 1SC6A 1IAQA 3LOUA 4GXNA 1QJ4A 4H17A 4LVNA 5EZYA 3UXYA 4A3SA 4DRXB 4HFMA 1WPRA 2UYOA 4HH3C 3VU8A 2QTNA 4FBLA 3H2JA 4E2XA 3F9RA 3R41A 2J9GA 5HOQA 3GEPA 1RAGA 1P1FA 1W2HA 3O1HB 2C83A 4YP9A 1JAIA 2WVGA 1UM9A 1Y81A 5J2UB 1RKBA 2R65A 3TD9A 5I9NA 4W6QA 1UKVY 1ZOOA 2JA2A 3M6LA 3P9CA 1SM4A 1T9ZA 4P84A 1GG2A 5L4SA 2CLDX 1G8JA 1A98A 3JQDA 1P3DA 1JECA 2EP8A 3M6WA 4G63A 3RS0A 2HM7A 2X5OA 2AXPA 2V6GA 4DYDA 1G98A 4FYMA 3NAZA 3R6GA 2I4OA 2MSDB 2OECA 2VQ3A 3T12A 2AOTB 5CDHA 1ISGA 1EESA 2OKGA 3RABA 3JWJA 4G5FA 1I8TA 2CJPA 3EZXA 4CHTA 4KREA 1WUIS 2PEZA 1IZYA 2NUBA 1GWNA 5CURA 2ZBFA 1G5TA 1QOZA 2Y1XA 1UXGA 4V0QA 1DQPA 4II2A 3RR2A 2PU7A 1WBBA 4TTIA 5AK3A 1TU4A 1NN0A 3QH4A 7ADHA 5K20A 2PKXA 4ZQHA 3IHTA 4GYJA 4PZZA 1H69A 1IQRA 1U7WA 4RPIA 3EYAA 3QUQA 4RPCA 4BLPA 1YE8A 3FUVA 2NU8A 2BFDB 1RQ7A 1JR3A 4XLLA 1HQDA 4NJMB 4YMVA 5CB4F 1AQNA 2RAPA 4IFBA 2IZ5A 1LTQA 4XYGA 4LVUA 3CISA 4HX2A 3WNZA 2YWJA 3SQDA 1EUZA 2C59A 1N8NA 1T1EA 2O4UX 5HMLA 1XRRA 2FG5A 4EARA 2XWPA 1AKEA 1E58A 2ZRQA 2YHBA 1VM6A 5FNVA 5IC4A 2ZUBA 1PRYA 1P7WA 5BT9A 3FKSD 5FAKA 3FOEC 5DBHX 1GZHB 2R7KA 4GUAA 5K3SA 1N5KA 1MH1A 1H4VB 2PZAA 3FRJA 1KYQA 2YYAA 3RJTA 4HAUA 1KMHB 4UNQA 3Q7TA 4EJ6A 1IZ9A 4MH0R 3VSBA 1P0PA 4YUXA 3PD0A 1TPZA 4YMSA 2L69A 4RDHA 2W42A 1NBEA 4QUGA 3PLAE 4EHHA 1H9BA 4BV3A 3E9DA 2R5FA 4MQFB 1WDTA 3CE6A 3L92A 3MQ2A 2ZM6B 2APJA 4TLEA 2GM9A 4IUYA 3WK9A 3ZE6A 4EIWA 3SYLA 2V7TA 3RASA 3HOYB 4GVLA 3O8QA 4LYYA 4B4OA 1MA3A 1U8FO 3EH2A 1GNQA 1JU4A 1MAAA 3WWCA 2BKLA 1GUFA 3DD5A 1Z2AA 2VPWA 4DIMA 4OH1A 3NJ8A 1SFRA 3WGTA 1I94B 1EFKA 1DWOA 1XMXA 2RHTA 3MELA 3MS2A 3PZBA 3FOFC 4OMDA 3OQBA 1JB9A 1K83B 2QRLA 2WG2A 3CG0A 1E94E 1OVMA 3FZGA 4MKZA 2CD7A 4YPFA 3T7CA 1UADA 5IVHA 3WO1A 2OHFA 4RKFA 4US2R 4B4UA 1M73E 4JBGA 1FP2A 2GN0A 3K3PA 3PEEA 4Q7EA 1GDDA 3U7IA 3IHLA 1W0KD 1NT4A 1WRBA 4EKNB 1HT2E 4JJGA 4U7PB 5I9IA 1UANA 3W2TA 2OAGA 2I80A 4EATA 4GKJB 2PTHA 3UWPA 4E5YA 5BOSB 3Q3VA 2QUAA 1NBMD 1ZUNA 2FWMX 3B2QA 4KXXA 4W9NA 2ZPAA 4FMBB 1ZYUA 3E18A 1UK8A 3KVYA 1GFSA 3TZKA 1W2WB 3T95A 2W6JD 1DZ3A 3ETCA 4LGCA 5B6IA 5K6AC 3L41A 1ZG3A 1GCUA 4XOUA 1LZKA 1N5IA 3KDSE 3FOBA 3BD8A 2BBSA 2QR5A 4MRMB 4UBKA 5DTEA 4TXJA 2ADOA 3FF4A 4A4DA 3MUEA 3PLRA 2UZIR 3W9BA 2OHXA 1OT3A 1U3VA 3FSGA 3GJSA 4ZTBA 4KPEC 1XVAA 1IRIA 2WUWE 1PGPA 4XR9A 3G17A 3OPMA 3SC3A 4IZHA 3LY7A 5DBIA 2WLSA 3CZPA 3TRHA 4W8GA 1CVLA 3V2IA 1FXWF 4DREA 1D2CA 1ESMA 1PSZA 1R37A 2CN1A 4O8CA 1T15A 2ZWVA 2OSBA 3PDWA 4XUCA 4A73A 1I13A 3DO5A 5EA2A 1GPKA 3AR3A 4XVRA 3RYHB 4JBYA 3KRTA 1ZD3A 4MB6A 2PZKA 3WB9A 2GF2A 1XTZA 1BCRA 2OC4A 2B82A 3GCWA 3QKUA 4QLAA 4TZTA 3ROMA 3H7AA 4MWBA 3F9IA 5EIHA 2E9SA 2JW5A 4J16C 4RMGA 3HKDA 3K0AA 1YB5A 1UEXC 5KOHB 4LYJA 3NHUA 2G8NA 3RVBA 4B83A 4YXFA 3HSSA 3F5SA 3OEWA 4H7HA 1XL0A 3KOUA 1AQLA 4MV8A 4EJSA 2CXPA 4FYYA 2C9BA 1ZC3A 4Y1EA 1WCWA 3JRNA 3NM5A 2RBGA 4E0BA 3THWA 5CNMA 4DJFC 1I4WA 1XMVA 2H0RA 4YRTA 3AI7A 1CJMA 4G2NA 2JFXA 2AA3A 4QUDA 1SHTX 1HRKA 1YVDA 2FV8A 4F5WA 3VYRB 3GEIA 3P19A 5AESA 1KH2A 3HWX1 2RKBA 4GYKA 4CEHA 1Q1NA 1IUPA 3L46A 1JHYA 5D7NA 4M8KA 3HDYA 2JIMA 3S70A 4J0JA 1V43A 4ZXPA 3FN4A 1F8FA 3GP5A 3MCAA 4GAEA 3R76A 5A2GA 2H2GA 2H57A 4EW3A 5KOIA 2R1ZA 3M6AA 1YVRA 2TECE 4TLMB 1D8TA 5CNIA 2J7KA 2WFLB 2WKSA 1VPVA 4LOIA 3VV2A 3U37A 3BX1A 4XJSA 3CX8A 1WBJB 7REQB 3VAYA 3ZVMA 2PTGA 3E1KA 1RZ3A 3CVXA 1G7SA 1DEKA 1Z4OA 2AJBA 1TZJA 2B1GA 2XI4A 1XNQB 1N2HA 3R3WA 2FX5A 1HI9A 3TZLA 2C2ZA 3SU8A 1SZDA 3B52X 2WD8A 4AUKA 2I3DA 2W00A 1EYZA 1NHGA 2CXSA 3I6BA 4RORA 3VKFA 2HSEA 4M8SA 5B2EA 4FD2A 4JHXA 4PQGA 5IVPA 4AKIA 4BB9A 1SQFA 4TYQA 3I9MA 3AI1A 3ED1A 1ZJ6A 4G1CA 1NJ2A 4KDRA 4HUTA 2JCSA 2IPAB 1TAHA 5IMBA 4KHPB 4G0ZA 3FG9A 3PPVA 2LR0A 4AM8A 1Z5PA 4AZ0B 3JATA 3O47A 4FT4A 4W5QA 2ANCA 1MC4A 2WUVA 3TIVA 1U90A 1USKA 1ZCAA 2VSOA 3KPYA 3L79A 1MMFB 3NWBA 4I8DA 5AM1A 4DLVA 3WLKX 3ILYA 3NEAA 3THYA 1JLSA 4JWKA 3DZFA 2AN5A 3IPXA 3PQ4A 4DG9A 1XTIA 2C4NA 2I7XA 1V1JA 2TMGA 2V45A 1RRVA 5SYNA 4BMNA 5E3HA 3BH0A 4D25A 1R6AA 1LK5A 3LYHA 3C6MA 2CNWD 1TYCA 1Y7LA 2WFAA 3G5TA 5EL0A 4AXBA 3K96A 1XP5A 3HBAA 3VJLA 4UAJA 1TRHA 4YV2A 5KOJB 3FZNA 4BFUA 2A92A 1HT1E 3Q3GE 4YJ2B 2IP2A 4XVUA 3OHPA 1QRAA 1T8PA 1V9SA 4M0PA 1FCJA 2A8YA 3GT3A 2OEPA 3O2SB 4WA7A 4ZAYA 1XQ1A 2I6SA 3PJEA 5EGNA 2OGZA 2E2IB 2B5OA 2J3QA 4DR3B 4FQ5A 4L6CA 3T0FA 4GBGA 4YLEA 3QVJA 1XEXB 3M9XA 3SHQA 5KYWB 5JARA 3BYZA 2JAXA 5KQRA 2WKQA 2YRXA 2C1XA 2Y0PA 1I01A 3BK2A 3EEFA 3H11B 1JNXX 4FE4A 4LRTB 3JPYA 2H31A 1E8DA 1N0IA 2QM3A 4DBLE 1N78A 5DT2A 2RGNC 3IV9A 3DGFC 3FETA 1K97A 1MX3A 3GEGA 4IVPA 1KC1A 3RBVA 3FDIA 2PV7A 2XIJA 3SI7A 1T3SA 3CQ9A 3FYUB 3TB6A 3MAJA 4B71A 4CE6A 5LM3A 4HF7A 5L3SA 2QD1A 4BLVA 2BTOA 1PFVA 3MBOA 4DCVA 2P2GA 2DCUA 1IXZA 4RJ2A 5LQMA 1ZKMA 3QKIA 3ZIAA 1GV0A 4EZBA 3P9NA 1NLZA 3IXQA 4C20A 4OHWA 4QHYA 4R8MA 4RUKA 3TQSA 3H84A 1JKIA 1RI3A 1N2CB 4FFDA 4ZFNA 1XTSA 2D3WA 3D2CA 1ZVQA 1CQIA 1ODSA 4H7EA 5COQA 5KYNA 3CN7A 4MKXA 4E70A 1BE6A 1XAHA 3AKEA 4QJ4A 2PQ2A 1OIVA 4NMMA 2HF8A 3EW9A 4MA5A 5GONA 4JK3A 3VR0A 1TE2A 1V1MB 2QUKA 1APBA 1V11A 2VPPA 2QVLA 1FSZA 1G20E 2RONA 1U28C 2WWGA 2ZR9A 3AF4A 3GUUA 3PWTA 2NUTB 1LJ8A 4E4YA 1P6XA 3FTCA 5BMVF 4CETA 3UXEA 4P82A 2B0JA 4DSAA 1XNJA 4B0PA 5HKAA 1T6NA 5G53C 1TZBA 1H2YA 1I0IA 3RFTA 5H68A 2DH6A 1I6KA 2AZ4A 3TI9A 3M70A 1QGUB 3OOHA 5IXYA 3LDHA 4GGMX 3E82A 2HBQA 4PCLA 1ZIDA 1W76A 1WKVA 4QZVA 1QZUA 3KP1A 1AB6A 4P8RA 4ARBA 5G4KA 4A2CA 1LSUA 2Y3IA 4TRRA 3IDOA 1E1KA 3F5QA 3L0DA 5A2QA 3IJ5A 1YD7A 2PUHA 2YXDA 2AX3A 3HRHA 5E6SB 5JAQA 3I0NA 1QBGA 4IINA 3ZBTA 1P74A 4UAUA 5B2FA 5MDHA 2BKEA 3B1KA 4Z4HA 5HUQA 3IEIA 4D0LB 3S2YA 1JR6A 2VT7A 2WTEA 2DR3A 3LY8A 1BRTA 1G6HA 2CE7A 3C5CA 1HUQA 3FVTA 3KKPA 4JQOA 1AY0A 4R2KA 4H3SA 4Q7LA 5I51A 1PD0A 1CJKC 1R4ZA 4BNFA 1Z33A 3BDIA 2H65A 5TQ2A 3K32A 1WY5A 3FUTA 3SZOA 1YGYA 4G67A 2HJHA 1J33A 4KU4A 2F43A 2UV8A 1MB2A 2HLHA 3L3BA 2Q0QA 4QTXA 4R4JA 1XU7A 5AJTA 4DA8A 5KWVA 4EKEA 6REQA 1TMKA 1PGJA 1V35A 2CCJA 1FQOA 3IIMA 2GK4A 3AR8A 1I3LA 3LL7A 2HX1A 1Z5UA 4PPFA 1JIQA 4X20B 1Z7YA 1GPAA 1PL7A 1FFAA 1RQLA 1NJFA 1CS0B 2XADA 2ZR7A 3GCGA 2O14A 4DDWA 1XRPA 1AGNA 1WZNA 2GHIA 1BKSB 4QXPA 1ANKA 3GRAA 1B3RA 3JQ7B 1Y6RA 4IHJB 2O8DA 4YCCA 1CUBA 2P40A 1JAZA 3CBQA 1ESDA 1SMKA 4HXFB 1MB0A 4TXMA 3HCFA 4Y0AA 2G0AA 2XB6A 1DJLA 3KZXA 1U5BA 4GWKA 1FRFS 1HYBA 5FEMA 4IKOA 4PVCA 4K6OA 5BSEA 3AUSA 4KRYA 2X1VA 3H99A 2ESRA 1YVPA 1PJAA 4HDRA 1MQAA 2CZQA 1PJRA 3RRBA 4D5EA 1ODCA 2C4TA 2W2LD 4PLPA 3U62A 4I5FA 5H02A 1N36B 1DIOB 1K6EA 1X13A 2XODA 1BN6A 4LJKA 5JWHA 4DVJA 2OBNA 2XYGA 3CVUA 1GAXA 1Z4IA 3AG5A 4JBXA 1JMVA 1YIAA 2P11A 3VVMA 3VTZA 4MB2A 3EYWA 4C03A 5C4MA 1U98A 1A9OA 1QYDA 2XCUA 3IP9A 4I4TA 2LCQA 2OV2A 3LECA 4PLTA 2AE2A 5LYJF 3UT6A 1XD2B 2IYTA 3HO6A 1SVLA 1IH8A 1WCXA 3BERA 4FOLA 3A6JA 1YQXA 4P58A 4Q1CA 4TX1A 2WAXA 1W36C 2OORC 3WWPA 5KJ6A 3ICQB 1GKYA 2SKEA 3AI2A 1B15A 4HQOA 3I2GA 1AZLA 2VP9A 4GQBA 4JJ8A 1VB3A 4HXEB 2OYCA 3SLGA 3TFWA 5FX2A 3E15A 1Z3CA 2QDXA 2I7TA 1PR4A 5LUBA 2CFTA 4Q15A 3SQWA 3AVVA 1RVV1 3KQOA 1MORA 1Z56C 2FQXA 4HWPA 1KS9A 3HYSA 2RI6A 2WMDA 3WNBA 3L84A 4WOJA 3OBIA 4F71A 3ZUPA 3A10A 4O4LB 1N0WA 1QWOA 2HF9A 4JH0A 1NVAA 1H1LA 4IF6A 1Z0ZA 4KQ9A 5HR5A 5IJ9B 1IUKA 3UGKA 1RJDA 2QX8A 4QRDA 4Q4HB 4WEQA 4XI9A 1DXOA 4CHGA 1BZYA 1CY8A 1LPPA 5CGZA 1R5NA 3N2GA 3VR4A 1F6DA 2GILA 2IZZA 2P91A 4FMDB 4WNAA 5CM2Z 4ZRDA 3SDSA 3OP1A 1Y6GA 2DVMA 4OK6A 3H6GA 3HBLA 1EGAA 4EFDA 3WMGA 3VR1A 1YL6A 3HKEA 3X43A 1N9ZA 1XIVA 3LRXA 2PVCA 4M9CA 2AKYA 3MTGA 4E32A 3NOOA 3HGQA 4L57A 4N5DA 3R7DA 3WLMA 1JALA 2JLUA 2QRVA 1F60A 3CNLA 3MVEA 4DIDA 2J3DA 4RJLA 4NARA 3MWYW 2HKIA 3WMWA 2IYXA 1GITA 1M2FA 1Z4QA 2UYYA 1C9KA 1WQ3A 1Z0JA 2V4ZA 2JAQA 3D59A 2O1WA 3F1KA 4NG4A 4RYDA 4PSCA 3OU6A 5AMXA 5B58T 3GTPB 1RADA 4NCNA 1TKBA 2WKPA 3UV3A 5BWBA 2P6UA 3VA7A 3KO8A 1SAYA 1KOLA 4ZZ0A 4GPBA 2IITA 5FL3A 1ZH2A 2VXCA 5C80A 3HCCA 4RZ3A 2NU9A 4R2LA 3TXXA 4GH5A 1RM5A 2J9RA 3NBQA 4NH0A 4Q9HA 4CMGA 1JPUA 3VTAA 1NW4A 1E5QA 2EP5A 2AYZA 2XDAA 4JR0A 2MCFA 3TZBA 3QGMA 3OFJA 3SD7A 4REOA 4DC1A 2I6TA 3BIXA 2NU6B 1WMSA 1W4BA 3JQFA 4OQZA 1H3NA 1V6CA 3KQVA 2O7NA 3NGXA 5GOZA 1T6XA 1E60A 3M9WA 1N1EA 4LCBA 4PXYA 1BH2A 3IRUA 5FQNA 2VRCD 4W9MC 1JBEA 4DSOA 4U2BA 2Q1WA 4NESA 4K6HA 1KERA 2EWMA 4S2EA 4WN9A 5AHRA 3ROEA 4YHHB 3SZRA 2OBFA 3QVWA 1P5FA 4PHHA 4AN0A 4BCDA 4LZNA 4M4SA 1IIRA 1XDDA 2Y2UA 3K73O 4HO1X 5KYTA 1SA0A 3R74A 1L4KA 4XB2A 3RC8A 4HGZA 4M9QA 4PNPA 2PMWB 2P41A 4CQLB 3NV9A 1T2NA 3AOGA 3JD3A 4UEJA 1NBAA 3LNTA 4DV5B 2BBWA 1NFQA 3B6ZA 1JZSA 5CLFA 1N9GB 4U8HA 4XEHA 5F73A 4J3NA 2FSPA 3U7RA 2AVDA 1FLVA 4DJ5X 2EQBA 1OXBB 4MW0A 5B36A 2ODBA 1UINA 3PR3A 4AKEA 1Q0UA 4RIIA 3WMXA 4E30A 2VQSA 3S2SA 4EUEA 4PINA 1KKMA 2G63A 5KU7A 2BFPA 1WS6A 4KPUB 4B8ZA 5JY6A 3T3NA 1ZA2A 1ZXBA 3AJAA 3HB5X 3SC4A 1G60A 4K9KA 2A78A 2ZSKA 2PX3A 2Q5FA 4F9TA 1CR2A 4LHXA 2PZEA 4ZAWA 2FR0A 4DPMA 1XTQA 2FZWA 4G0MA 4ITRC 4HDOB 4WDRA 5EPEA 2MYNA 2PPLA 2YASA 1QTNA 2INGX 3K2IA 3QENA 1Q3KA 4RCVA 4EBFA 1CZUA 4N76A 3WLFA 1B6TA 1P1CA 1UZAA 2ZSJA 2IRWA 3W04A 3RK1A 4BEBA 3GPIA 1R10A 5IJ0A 2DUJA 3H2SA 3JRWA 3PLNA 4LYAA 3PHGA 3ZTWA 1ZIXA 2JIZD 3NTOA 4NYMR 3RUAA 2R66A 4B47A 3A6GA 1Z5OA 2IZ0A 3U17A 3ILXA 1FNCA 3L8EA 3R6DA 1MW8X 5DM70 5T4FA 3O9ZA 3T3GA 3LXUX 4G84A 1R8JA 4IEIA 3T3MB 3KTAB 1JF8A 2ZJ8A 3PXAA 4MJLA 4Q16A 3QVVA 2FPWA 2JRLA 3LNCA 5DNCA 4XAQA 4BC1A 4MQBA 4NR0A 5ELLA 5CX4A 2JK0A 3AP3A 2ZAGA 3GYBA 1WW8A 4DMMA 2OQ2A 3CKMA 2X15A 1KFKB 3LG2A 3WICA 5A6SA 4QFCA 2HW8A 3NS7A 5B7NA 2ZB4A 1Q77A 2JZCA 1LY1A 2V6BA 2RGAA 1ZAYA 1EGVB 1ORTA 1OBHA 1TD1A 2OHIA 3NASA 4CG3A 1L5OA 4ESVA 5SY6A 1JQKA 1ZNXA 4Y9DA 4YCDA 3I61A 3GG2A 3HLKA 4FJ2A 4L1KA 5ITWA 2QVZX 3GAMA 4YRBA 5C46F 7MDHA 2RSLA 3RVDA 5DYGA 5MF6A 1E3MA 2Q3EA 3PFGA 2BGRA 2OVFA 1NQXA 1R0YA 2R4UA 3MEQA 5DHRA 3I4LA 4MR8B 1VCIA 4FZRA 4KK3A 3WRXA 3QVGA 3ZE9A 5CITA 5L4LA 4M86A 4GYWA 5ALSA 3GFFA 2ZRNA 2WK1A 3V8BA 3F6PA 2AEJA 3UAGA 1YK1A 2O3SA 2OCGA 2OZPA 3A25A 3L82B 3LUJA 1FFWA 3FMGA 3SZMA 3ZDQA 4TL7A 5DT9A 1E4EA 3PYXA 2IFTA 1QQ7A 4BNDA 2C7QA 1NRXA 2OV8A 4ND7A 4P53A 2O5EA 5H9WA 1N2CE 3ZE8A 1JKMA 1G6Q1 1CEEA 3RUPA 1CLEA 1GCGA 2XBLA 1GZ4A 5H4HA 3ZW7A 4AXXA 2QZPA 1JG6A 3R2JA 4BQOA 2XE4A 3QPUA 4Q9KA 1UAAA 1JIIA 2LBPA 3W06A 4C3ZA 1FUYB 1P2GA 1X7WA 1PGQA 2H0AA 4IYRA 3L0IB 4K7JA 1D1SA 3OQHA 4RVGA 3UMCA 3W1VA 2F8TA 4IIJA 3NBYC 1CULC 1NYRA 1UJ5A 1B4DA 1G4HA 1VYVA 2CJWA 2IXGA 2UVQA 4UZEA 1O6FA 4GDMA 4GBED 1QLWA 3I42A 3ZBPA 3QW2A 4UUAA 4YCJA 4YA6A 2FLVA 2G08A 2VJKA 5TE9A 4ESHA 4L28A 4YJ3F 3T4XA 4Q7MB 2QXYA 2JGJA 1ICIA 3JD1A 3WKEA 4WINA 1X77A 3RFXA 4F8EA 1O0CA 5GTDA 1QK4A 2NVXB 3OFSA 4G56A 1ITZA 1SU4A 3O3NB 4OCZA 2DY1A 3QUTA 4IVQA 3R77A 2AEEA 3KL4A 1N7JA 4MQEA 1L4FA 2EJVA 4FYJA 1Q21A 3K1ZA 4N48A 3IEVA 3HKZB 5E9JA 3ZWKA 3M3PA 1UBNA 5FPSA 4FE3A 1Z26A 2WWXA 2VAXA 1M6EX 3C48A 5EY5B 4AMUA 3G0OA 3V9PA 4CTKA 3AETA 2FQ1A 2KMLA 3PV0A 1UR5A 3GBSA 3THXB 4F96A 1KF0A 3IDAA 4WLUA 1S8NA 3KJEA 5FPKA 1GYRA 2IUYA 1HDYA 4GOND 4B3BA 2GEVA 2HHAA 2PL5A 4PYKA 4RYLA 1XZDA 2P2CA 1FP6A 1YH3A 5CG1A 4MRVA 1XKXA 2YS6A 4JP8A 3UJDA 1A9RA 3WV5A 3ILVA 1FFSA 1I1NA 5FKJA 2W6QA 4PAQA 5THQA 2OUIA 1UBRS 1VG0B 5D5QA 4OQYA 5DCUA 1D2MA 4A8HA 1SUBA 3NIWA 3W1WA 1WP9A 4LJAA 4DCOA 5ENVA 4R8RA 1K7FB 3NIBA 1JJFA 3PRHA 5DK4A 2XD4A 3NDPA 2I7CA 1KEEA 4RANA 3NT5A 3TMKA 2R6DA 2QL9A 2ZXUA 4KVGA 1JKFA 3B3GA 2HPAA 2O7RA 4OB6A 1QHIA 2GR9A 4DT1A 2V5AA 5MN5A 3OMWA 1I4EB 3KZVA 4ZCSA 3W8DA 5JYDA 2H8GA 2O1EA 5IT9A 3BIJA 5EJ6A 1MX1A 3IDFA 3CNNA 4FFWA 4OXKA 4EK9A 4TTVA 2A5DA 4ILKA 1GFIA 2AMVA 1E0DA 2QLTA 4RKEA 5HCIA 2VJMB 3GFRA 3P2OA 4KTVE 4MUEA 3T34A 1XTRA 1LSSA 4RHCA 3EVZA 4IDCA 3SBEA 1L1QA 1S3SA 2PWBA 5DM1A 4AY5A 4FBMA 1WG8A 5JBNA 5EVJA 4ON9A 4QXMA 5FR2A 5D1HA 5DIZA 1CT9A 5TRTA 3S2DB 2GRUA 2LCIA 2QI9F 2GJAA 4UCXA 3SY8A 2XZLA 3BTVA 2PRZA 1XTBA 5HIIA 1E0KA 5CXUA 4L2IA 4G6ZA 1BCSB 3W4IA 3MCTA 4GWLA 3LK7A 4TS9A 1YS2X 2WIJA 2BR5A 3CLUC 2NPOA 1Q1QA 1QF9A 4E2ZA 2WIKA 3IKJA 1X7DA 2CC2A 4H0NA 5EUBA 4D9FA 4RF4A 3ZEIA 1ODIA 3E05A 3HU1A 3N53A 2RHHA 1TLTA 1FNBA 3O7WA 1R4NA 1HYQA 1THGA 2PWZA 4HWKA 3SHWA 1T8RA 5DNEA 3W4JA 4BKMA 1FDUA 2GK3A 1QIKA 2P78A 2FU5C 3I73A 3L6DA 5A03A 3S2HB 2RGEA 4X84A 1U0GA 2QAJA 3I6MA 1FDOA 3PWSA 1RRGA 1F14A 2EEZA 2I71A 4N8DA 1N5JA 3P71T 2C3OA 1NDHA 1SKYE 3KQWA 1I2CA 5HIMA 5JC8A 4KUEA 4IHAA 2Q1SA 3CW8X 2C9YA 4JVNA 3UICA 3HXMA 5DCLA 1CCWA 1RPAA 2NVBA 2PPVA 4O4JA 3OQIB 5GIOE 1YQ9A 3LQFA 3OA2A 4DMRA 1K1EA 1TCAA 2IKSA 4XVHA 1A8PA 1S96A 1SK8A 1SVKA 1YOBA 3CIOA 1UK6A 1CUFA 2GXQA 2IDKA 1QZXA 1PQWA 3PZRA 4D8YA 3F8WA 4Q3EA 1W29A 4YY3B 1P2DA 4WNYA 4GI7A 2ATEA 4ETIA 5I6DA 2HWWA 2B4QA 4M76B 4ZAFA 3V55A 4TYYA 4HYYA 3JQQA 3RVOA 2FF5A 2VWQA 1BXKA 5JJKA 2WIFA 3NBXX 4WBSA 1GSHA 1EK6A 3PXGA 4YMGA 3SBOA 4EI9A 3CX7A 2DCMA 2IVZA 2WA1A 4MMZB 2P69A 4RWEA 4RZXA 5B6JA 3RARA 1NQUA 1ZY2A 1HY3A 2VF4X 1LF0A 3C3BA 5HXAA 1SZJG 4KVFA 4OIMA 3ZDCA 4KR2A 1U0FA 4BIMA 3V3KA 1IATA 4FCVA 1TL7C 4WK4B 1CR6A 3P45A 4ARCA 5GJCA 3J7AC 1JDVA 3LI2A 2RJOA 1Z62A 2FPPA 2AF4C 1Q15A 3FLMA 3FROA 3UWKA 1DIAA 3A0UA 3IVCA 2HCTA 1QYRA 5EQTA 4ER5A 3A1TA 4JVMA 2V7WA 3OAAA 4F4UA 3FYHA 1JH8A 3Q3HA 5EIFA 2GRAA 4R41A 5H4GA 4O4IA 3ZE0B 1I4DD 4QYIA 1CJUC 4E11A 5EWJA 1YRQA 4FINA 1E3WB 3E5HA 2B1RA 3IAHA 2ISSD 4X85A 4AB1A 1F2TA 3DOIA 1H6AA 4XFKA 2X5KO 4JL8A 4F4JA 5IVIA 2R87A 4FHEA 3BTOA 4JV5B 5AUNB 3AH8A 1B74A 1GRNA 1WAMA 2J3JA 4CUJA 4QSMA 3WYAA 4CCYB 3GLGE 3REOA 2VSXA 2IEAA 2WLTA 3OM8A 4CR6A 4OLAA 2FJUA 5ILQA 1JDJA 1LDNA 1IOLA 4RIEA 4NQZA 1KRWA 3SKXA 5AD1A 5EHNA 5C4XB 1P7VA 3WY9A 4H18A 1ONNA 1US8B 4PSAA 4E88A 1EQAA 3OECA 2DPMA 4GZ6A 4J0IA 4V2UA 3T0IA 3TAHA 2EG5A 1P0MA 1PG2A 3BHIA 3SF8A 2CVPA 4UTRA 1KYZA 4CDNA 1RBQA 3JQ8B 1VHDA 3EGOA 3G8CA 2WW8A 4H0CA 4H59A 5H70A 3FMOB 4BJ3A 1DAFA 3FNFA 3TLZA 1RXIA 4D9JA 2IYYA 3KJXA 4CIVA 4E09A 1IHOA 1SCDA 1T8TA 3MHPA 2BONA 1KQFA 1MJGA 2HREA 2B0CA 1VMKA 1G5IA 2CDRA 1HMPA 4XGNA 2QJRA 4Y2UA 4PIMA 4DWVA 1ZQ1A 1W5FA 1VZ3A 2HU2A 3IVGA 4OV6B 1G2OA 1N6NA 3H3XA 1SZCA 1V7ZA 1E7RA 1K06A 4OIFA 5J1TB 3UB3A 4PBTA 2X4DA 1DLJA 1C4OA 4LPSA 3G13A 4YRSA 5IULC 1PZEA 3A4VA 4CG2A 3VJKA 2VXYA 3H8VA 2RGXA 3EB9A 4AS3A 1W85B 2BFEB 2RARA 4UDOA 3UAZA 6CHYA 4KV9A 4YMUA 3KZNA 1Q22A 2WYOA 2HMWA 5KNCH 1B3BA 1V8BA 4M1YA 4KQJA 2F1OA 3WZLA 3PCXA 2QOEA 4HJXA 3UJ9A 1GHTA 4BQIA 1EMDA 4L08A 1OKKA 1H23A 2FW9A 2PWYA 4WZAB 1ZMTA 3M6FA 1NBIA 2H06A 3I2KA 2XNDA 4MKFA 3H19A 4PCUA 1K4KA 2FPKA 2NSYA 3E7PA 2ES4A 2E4VA 3DBLA 3HBNA 3QU4A 2GBIA 4QDOA 5FBHA 1NMSA 2HADA 3UG7A 5J58A 1JDPA 1PIWA 4QICA 4Q4LA 5GMOA 4ZA2A 5KVAA 1NVUQ 4BZWA 3IDSA 3ODPA 4J9UE 3ZC3A 4AZWA 4B7XA 1C3OA 1NI4A 2A88A 3SYTA 5LXTA 3JYLA 4WECA 4ZWNA 3RYTC 3IYLW 4R01A 4FDVA 3JW8A 1DU4A 2FWPA 3DBIA 1WM1A 2QMUA 2WJ6A 3IB3A 4FYHA 1RWPA 1Y6ZA 2AJDA 3A2LA 3EH1A 4HUQB 5HFAA 4DNQA 3TCNA 5LR6A 4O2AA 2WOJA 1UMKA 3A6FA 3T8YA 5KVQA 2LE0A 3T9CA 5JRDS 2P2ZA 4W7IA 1W1IA 4C3UA 2HLNA 5K0GA 4QOIA 2JFNA 2JI9A 2PUWA 2QN7A 4UDNA 2J1LA 4I55F 4LV5B 3U1BA 1Y8QB 1KP9A 3RRZA 4PAWA 1I1QB 1GGMA 4KRFA 4IOJA 3H9BA 4J6FA 4KYIB 1ZH0A 4GL4A 3BXZA 1T25A 3MG9A 2X8BA 2V5VA 2YH2A 5DBGA 2IHJA 3DXXA 1IBMB 1JQDA 1ZZGA 1TWHB 1RM0A 5EKDA 3EIUA 2QLNA 3IP1A 3O4VA 3I4NB 2JFOA 4RSHA 2VSNA 3EW7A 5CXSA 4ID9A 3COVA 5ER6A 3KKEA 1ZCJA 3DAGA 3HEBA 2ZTHA 3GUVA 3A6KA 3IEPA 3DDHA 4Z53A 3DOJA 3LYAA 721PA 3JXEA 1K7XB 4PR3A 1T5TA 4ZI7B 1REQA 3ET4A 3FVRA 3LUGA 4MDHA 5D6NA 4ONEA 4ER3A 2JLXA 1E4VA 4UMDA 2JCVA 1JWLA 3KVVA 4EFLA 4WMLA 2NXWA 5AM4A 4DXAA 4KOAA 4N12A 4YRIA 2V7XA 1QU3A 1OBOA 1ADCA 2CXNA 4LCJA 1YGPA 4EO9A 1EFCA 2TSYB 1DSSG 2X22A 4R5HA 4G65A 1SBIA 3L0SA 4OJQA 3OWOA 2H00A 4WK0B 4EL5A 4RJJA 5KJ1A 2CUTA 1A5SB 4GO1A 4LYGA 5FA8A 2Q1XA 2X6TA 1OH5A 4YQFA 2ZUDA 5F1PA 1SG6A 3ZZ0A 5K0LA 2FOLA 1Y7HA 1Y9ZA 4R3UC 5KPJA 1VIMA 2XDYA 4PZCA 2BGJA 3C1AA 5SZKB 2H1OA 5JTTA 4QUHA 3VJRA 4LA4A 2XQJA 4OSOA 5CG2A 2CKMA 1AC5A 5EMHA 5KTKA 3LQ4A 2BJVA 5CB6A 1U65A 2O48X 3E3LA 1GZ5A 2F64A 2NTJA 4BLUA 2O7QA 3TR0A 2C7PA 5GP1A 2D59A 4NK4A 4C0BA 4R1QA 1MHPA 1KO4A 2DJ5A 3E7FA 1NR1A 1YMQA 2J5RA 3V9AA 1UDWA 5D3KA 3ZY2A 4CL3A 3S1MB 1YR2A 4RELA 1FYWA 4G25A 4UVIA 1UJBA 5FPHA 2IBSA 1G4UR 2NSLA 2QQFA 4J2OA 2GB4A 3GGCA 1F06A 2VQ6A 4E7OA 1ODTC 1X8LA 3GK3A 4KXMA 5G1NA 2RI0A 4ZK6A 5AXCA 3D6HA 5FRDA 4DQUA 3RIGA 2YYSA 1WSBA 3LFTA 2IEIA 3K6SB 5JDCA 4BBJA 1VJGA 1C9DB 1QKKA 3BMOA 3R7NA 5K3FB 5LBIA 4D5GA 1P4AA 5CAEA 3W77A 5LZ5A 1E99A 2A30A 4N40A 3CN9A 3D7KA 1PR5A 2BP7B 3I1FA 2FEOA 3JARB 4FDAA 4LJ5A 5H3CA 4ED9A 2VWGA 2QMYA 4AMGA 3WSVA 3QVUA 3BAFA 3HVIA 2R8BA 1I7LA 5H5JA 4RV4A 3TJZA 1E1QD 1SUPA 1O0SA 1DHTA 1L3BA 3ZIDA 2CSUA 1C30A 1UC9A 2WAYA 2YIVX 4URWR 2OK7A 4LJ9A 3WNQA 4E07A 3BC1A 4B79A 4ENWA 2V7GA 3L8GA 3QVMA 5CIWA 2YCBA 4YMWA 5DWQA 5GV8A 3WP0A 4RTOA 4Y6OA 1E89A 2X0NA 2IH2A 2ZETA 2AZTA 4TTJA 2YJGA 1JQ3A 1QCCA 3R0ZA 5GONF 2BM0A 1E5LA 3TPFA 4BOYA 3QWAA 4NFSA 1UWLA 2VHQA 1I1OA 2WG0A 5DXJA 3YASA 2G70A 3S1RB 1JFFB 2H4XA 4DB2A 5E6RA 4K46A 3BL8A 2B8JA 5HILA 3KAPA 2BFCB 4UEOA 4C01A 1RMQA 4ES6A 1SXJA 2QQ5A 1NF9A 4L27A 3NCTA 2MSNA 2C0QA 1X7ZB 1EFVA 2AK3A 3GEHA 5BYJA 3WLLA 2CWDA 4ATNA 4KPGA 1RYEA 4IIFA 1QHHA 1COZA 5G40A 1W4CA 3G0CA 1UMDA 1A82A 3TE6A 1YU6A 2DBYA 4TUYA 3ZWVA 1ND5A 4EGJA 1JVNA 1L5SA 1ORWA 1E2UA 2E85A 4Y18A 1P4JA 4ENTA 5EKUA 1GQSA 1UKEA 5HZHA 1XC7A 1TGVA 1OLUA 1TJ5A 4E2YA 5IH3A 5NULA 2GHRA 5AKGA 4DLLA 3N8HA 2YY5A 2PT5A 2VKTA 2P7HA 1T26A 2ZBRA 2IOFA 5ALHA 1XNGA 2VJNA 3GZNA 1RCUA 1AUQA 3NBUA 1PZGA 4RQUA 4N41A 1QG4A 3WGJA 1K6JA 5EZYB 4EP1A 1I0ZA 3IMEA 3R6TA 2NVWA 1CEXA 1NIPA 3GJ0A 4H1VA 4I1VA 3TEFA 4NHEA 4QGHA 4ZQEA 4AF8A 2A0KA 5TQ0B 2Q41A 2RH9B 2H5IA 4DILA 2YW2A 2D2VA 9GPBA 1Z29A 1OWLA 3SVLA 4LMAA 1ADJA 3CWQA 2ZYAA 2XDWA 4LXXA 3EBOA 1S7GA 4BN4A 3NTLA 3QWHA 1Y1RA 3EXAA 2YOHA 3ZVNA 4NCJA 1YRBA 4UFPA 4B3TB 3CCCA 4E51A 3C3KA 4FYKA 1KTIA 1ZN8A 4HKTA 5J2TA 2C2KA 5JNLA 3I05A 3TL2A 3TDKA 4NZZA 1OYWA 4RVHA 1W88A 2JKVA 4CMIA 3G2LA 2ZVPX 1XEAA 1YR7A 4DV2B 3OESA 3F7TA 4M9SA 4D98A 1KH3A 4URZR 1IPHA 2XNJA 3ECSA 4L4UA 4YS6A 3VC7A 4LFCB 3PGLA 3HHEA 2WJ3A 4N5HX 4OREX 2XMPA 2C61A 2CBXA 2IU3A 3G82C 5J40A 3WYBA 3RJ5A 1GM5A 1K5PA 4MV9A 1DKNA 1TM3E 3QWBA 4LDZA 1M66A 3GX1A 4LXTA 2HQSA 2W6PA 2GLUA 4FQ7A 3FFBA 4YMIA 2ALJA 2D1TA 2VNKA 3CONA 2RCNA 3ESXA 1TECE 3O4GA 4IRMA 4N8SA 4Y6QA 2E5LB 2BEWA 4MVWA 1KORA 1XXHA 2EFDB 4EVIA 5IKMA 5GAJA 3WLRA 5TX7A 1KA9H 2Q62A 2JNWA 3NDJA 4MP8A 4P7FA 4F4FA 4ENRA 1DHRA 1K92A 3AF2A 4QYMA 4URYR 1JSRA 1IEVA 3ULKA 4BJ6A 1C29B 3S17B 1O6BA 1PL8A 1YA6A 5FNVB 4Z2AA 5BV0A 4U2KA 4M1EA 5DNWA 5BSGA 1U7HA 1PT5A 4OUKX 3EOBI 1M33A 2WJPA 4UATA 1CDEA 1V0JA 3VR6H 3WYDA 5K6TA 3FVVA 3H5IA 4XWTA 1PZXA 3DOEA 2RAFA 1F1BA 2XEXA 2RH8A 3FB1A 1JRLA 1O95D 4MOWA 1QUEA 3CV3A 1ES9A 3HBFA 4QU8A 3PGXA 1W4AA 3AGPA 2RI1A 3E8MA 3G2QA 3H5LA 3WLIA 5E6UA 1TYEB 3TO5A 4YDRA 5C52B 2J08A 1OJLA 2YINC 3OPYB 1K27A 3QUBA 5BYKA 5KYYA 3BN3A 3UIEA 4ZGBA 3SJAA 1WX1A 1Q5PA 1ZD9A 1DS6A 2GNAA 3FJOA 3PICA 1EXVA 2YX1A 1M76A 2PX8A 2WF6A 3G85A 5DW3A 5JISA 2D7CA 3TGLA 2I66A 1LS1A 1JEAA 3O8QB 5HK9A 3COYA 3D4PA 1Z2PX 1VC2A 2JJYA 2VDJA 5BSRA 3ZPXA 5DM0A 1E3SA 4ND6A 1RJWA 2C31A 2XLBA 4PCVA 4WZ6A 3R9XA 1SXGA 4BWVA 4AJ4A 4ISCA 4LC1A 4YRZA 1Q0SA 4OEHA 4ZEWA 4JX8A 2R1TB 4HAXA 2OYRA 4F9EA 5JFGA 1JFSA 2N46A 1D1QA 4U2DA 3K6KA 4RQTA 4A3KB 4R0NA 3NEPX 1WL8A 1GUYA 2ARKA 3HI4A 5DIFA 4WZAE 4CF4A 4PIVA 4BUJA 2HXYA 3AOEA 1EJ6A 5EJEA 3T3IA 5EZ6B 4CMKA 2LW7A 1O9HA 5ALPA 3OCJA 2F8MA 4RAQA 1LSJA 3V1LA 2FPIB 3CLTC 4QREA 2OE2A 4MI6A 1YZQA 3EA5A 3U7EB 1OLXA 1GFWA 3AV3A 4MVJE 3MJVA 5DGXA 4CWAA 3V34A 5I4IA 4LKOA 3EFBA 1ZUNB 2CD9A 3UUGA 5F1YA 1DJMA 4D9IA 1DPGA 1UZLA 4BB5A 1ZP6A 4TWAA 4DV3B 3SLKA 1UJNA 4RZUA 3BCUA 1N3BA 3PQFA 5P8WA 3T7JA 2OCIA 3MRXA 4BAZA 2GJKA 1P5ZB 1UBOS 3CX6A 4IGKA 3S0JA 2JGAA 4EB3A 4LBZA 3C24A 3SZGA 3M8KA 4MLDA 1FMTA 9MHTA 2WVAA 1B0PA 3TQHA 2IBMA 4EF6A 4J0EA 3KJNA 1N8SA 1UP4A 1XEFA 2DU8A 2QU8A 3NI2A 2XITA 2YUTA 2VVTA 5ALDA 2P65A 4FI3F 3UJBA 1EFUA 4QOFA 3EUAA 2CJYA 2ZYWX 3OEED 1FLDA 3HCEA 4ZMBA 1UT5A 4JT4A 1VPEA 3PGVA 4WXHA 1MR3F 4YJGA 4E03A 3QU9A 4Q9DA 4QTUB 1F20A 3KOZA 4LIPD 4RY8A 4ZPXA 2M6RA 3Q7IA 4IUCS 3VI4B 1G6OA 4RK5A 4GZ3A 4LZZA 1DFHA 1SXIA 2OFPA 5LP6A 2ZUEA 3EPRA 4AG5A 1SVNA 5JMOA 2Z9CA 1J1UA 1BCRB 1E8MA 1HFKA 2NO9A 2QYTA 3I0ZA 2IYEA 3Q87B 3MUNA 3A36A 2IH5A 4AIRA 3HKDB 3K0AB 2IU0A 1V39A 4OGGA 4ZN6A 4A2PA 3GIDA 1A7AA 3HR8A 4CV1A 3DYVA 5TB5A 3CF2A 1V3VA 3UHAA 3HO1A 5K8JB 1XHEA 2DZDA 2C4UA 3UQYS 1TQDA 1RPJA 3CWZA 4EJSB 2O8FB 1CDDA 2NPIA 2BCJQ 4CF3A 1YA8A 2Q4RA 2WI8A 4G4SO 4K87A 5AIAA 1NYLA 3GAZA 4HTFB 2R3SA 4NHOA 4U5QA 1K75A 4UUMA 3HYCA 1EFLA 1HDXA 4XQCA 3RI3A 4ALMA 3BRWA 5BW8A 1V95A 4C2MB 1OILA 1LGYA 4CEHB 1N77A 2XB9A 1XAGA 4QM6A 5JLJA 4H6PA 3FRIA 2YXBA 4MK4A 5DFAA 4BQNA 3CH6A 3ZZMA 3LYLA 4M9ZA 5D7BA 3B7WA 5JI2E 2Z6UA 3NVKI 4DQLA 1V8FA 3LVRE 4JLMA 1SR8A 4XWGA 4ILEA 1AHHA 3W7VA 3UJNA 1VRVA 4IUDS 4BZPA 2YFQA 3IQDB 4MV5A 2REBA 3ZHCA 3ORRA 1Z7EA 1NQVA 1QTQA 5IBRA 3TNYA 1KDYA 2RHRA 3OO1A 1SU6A 1RYDA 2C4HA 1WEHA 2DYKA 3E35A 3I23A 1DC8A 1LK0A 2BGNA 2VHVA 3O2NA 1WJGA 1P9NA 1R18A 3OTQA 4MW4A 4NBSA 4IOKA 2NX2A 3A6DA 4P34A 3HVKA 3ZR4B 3VHQA 5CD9A 3WAJA 1HBJA 4Q1FA 5DI3A 5L3RA 3RSSA 4GMGA 4DIUA 4CBVA 2WU3A 1THTA 2J3LA 3ABOB 4RESA 2I4MA 1P2TA 1J1ZA 3GT4A 4XQ9A 1E1LA 4H60A 2FMUA 2SCUA 2D0DA 3C7TA 2K7FA 1SD1A 3H5WA 2FMIA 3WJ2A 3RUEA 4EI8A 2ZUWA 4F38A 1EK1A 3QE3A 4AURA 3ZN2A 5JS8A 1C0LA 3L1JA 3PFKA 2XJ9A 4QBKA 4WH0A 3JATB 4WD3A 2A5JA 3K0HA 2WZDA 4G4JA 4S1WA 1VKHA 1Z6YA 3I3OA 2W71A 2ZRJA 3PE6A 5JZMA 2X0KA 2FR1A 3KD3A 1A7UA 5AJZA 3ONNA 2PZ8A 3WFIA 4NULA 1QE3A 3KSRA 1EZ1A 1CUCA 1NVDA 2X58A 2X9QA 3IJRA 4L78A 3WKAA 3WQHA 4EELA 4PG6A 5E1DA 4F1JA 5IUNC 1RFLA 5J3JA 3HDHA 1TTPB 2VZLA 2COEA 3MUOA 5HIAA 3E3OA 3QKSB 5F7ZA 3T3HA 3VZDA 3H1BA 4EG7A 3CEMA 5IVDA 3ZZNA 2X1HA 3FPSA 421PA 4RY2A 3L04A 1EQ2A 2HEIA 4GS5A 2J5QA 1D0SA 4RTQA 4MDEA 4WOPA 3KS9A 2YZ2A 2Q3FA 2WIAA 4NKRA 3GROA 4LC0A 4DNXA 4ND5A 2V7QD 2Z04A 5LD2C 4L4XA 4OXQA 1Q2XA 1Z22A 1BFKA 2QWXA 3KEMA 4OYYA 4RZSA 1W0JA 3CNBA 3EZ9A 4OQNA 3PQCA 4R2HA 1L7RA 4YJFB 1K8QA 1GKUB 5DJ5A 1A7KA 3SF0A 1CW2B 1G9TA 4EENA 1CUUA 4EGAA 5KSOA 1ZRNA 4NMXB 1KQ3A 1HTBA 1SHLA 2QVXX 1E1RA 3GJ8A 1P7YA 2O0HA 2XMDA 3F5FA 3ZWAA 2G4LA 1MDFA 4R5MA 5IZCA 3EIFA 2LDXA 1XAIA 2LIPA 3EMVA 5AW1A 1KIMA 2J4FA 1TA4A 3G5LA 4L8YA 2JLWA 1OUMA 3EGCA 5EP1A 4ARSA 5JASA 1P19A 4G89A 3GLIA 1SKQA 1V6AA 3IXLA 4TXNA 2AE1A 1MDBA 3HWWA 4WFQA 3H5AA 4CI0B 1EX9A 5L3SB 1QYIA 4F4IA 2P6MA 1LFAA 3WO0A 1T3ZA 3ASUA 4XFJA 4NFLA 2Q9CA 2WP0A 1KY5A 1P6QA 1Z2CA 3GDGA 3I6YA 3PQEA 2P79A 1RAAA 1IEXA 1EHIA 4KR9A 3ZU4A 1ZI9A 4TTRA 1PJLA 1KIAA 4B3XA 4JLAA 2IYPA 2I7DA 2RGUA 3DCYA 3GMSA 4K6GA 2XUAA 3BB1A 3RS9A 3H2IA 2C2XA 3ZWXA 2K4MA 3DLCA 5LLSA 1LSOA 4MWDA 1EVLA 5TARA 2A9QA 2ODTX 1O3YA 4JUIA 1NDQA 4CEIA 2ODWA 3OX3A 4HS9A 5AXAA 1V11B 3CKKA 3EEBA 2XVMA 2GERA 4O6VA 5EAIA 4UHKA 5L3ZA 2CMGA 5EJGA 1P60A 1NNEA 4KMSA 3QIVA 3I2JA 2HWXA 3HNOA 4RY9A 3RC9A 5KJCA 5EFOA 1BS9A 3IP8A 4A3BB 1C0IA 1R6TA 1U9ZA 3UMBA 4F9GA 3D6UA 5HVNA 4LOKA 1MC1A 2QTVA 3H42B 4G3XA 3VR5H 1U0BB 1N75A 4JEIA 4MRRA 2H1CA 2C4KA 2V6MA 4DCSA 4ZOLA 1PWXA 2FKAA 2P9YA 1JU3A 1X0XA 4NVRA 5KI6A 1N6HA 3VNRA 5JH7F 5G4KB 3CH7A 3LK6A 3AKCA 9LDTA 3TOXA 2H1FA 2VDWA 4ALJA 2B1IA 1OFGA 3I45A 2C5EA 3OM1A 3TK1A 1QLHA 3USCS 2AH5A 3TNFA 1CDZA 3T3OA 3U4HA 2VBIA 3DO8A 3JQPA 3BE5A 2D1SA 3C3XA 3HFJA 1UXOA 3OFNA 4Z9XA 2Z1DA 4POOA 1BX0A 4B75A 1TUBA 1SQ0A 1ZITA 2FOXA 5TQ2B 3W6ZA 4B3RB 3BXOA 1BGVA 2VUIB 1C1HA 5CA1A 2QX4A 1FMJA 3P9XA 4J1TA 4P31A 4ASUD 1JR3E 1BQ4A 4A03A 3F67A 5LC1A 3V7YA 4C04A 4CCSA 1T5LA 2J67A 3E2IA 5A4MS 1X1QA 3CVOA 4I36A 5FWYB 5C81A 3R4CA 3AR2A 1VOTA 3HPQA 4PO8A 4ZT7A 3C1UA 4GVPA 1MQ8B 2IHNA 3M6UA 4TXLA 2GTHA 2HBZA 2O8DB 5D51S 1V3QE 2HI0A 5HBGA 3OTGA 5CFPA 3S2GA 3SIRA 3RB8A 4YAGA 2ONZA 1G21A 3VR2A 1T36A 3OQVA 4HL6A 2CEKA 5A5VA 4JU8A 2BFOA 4YUWA 2PUVA 5F2KA 2AZXA 3DBOB 3LT4A 1JR2A 2Y71A 4YX9A 1LPNA 1ZM7A 4L6AA 1XFDA 4ENPA 3A1FA 3C6BA 2Q3BA 5LYYA 3TVTA 5GJBA 3LT5A 4LHVA 2WMOB 3OF5A 2J31A 4HDRB 3EN0A 5CVDA 5JD3A 3T1VA 3FKQA 1Z13A 4HT3B 3R8FA 1LXCA 1TU0A 1R0KA 2H2HA 2H3EA 1DMSA 2ZQYA 4FGLA 2IBTA 2C7BA 4MKGA 4YAKA 5LQUA 4KNVA 5G1OA 4R69A 4Q7KA 4FKZA 4LXHA 5CU7A 4I4TB 4PWZA 3TLGA 4MWTA 3BCSA 5L8VA 2CZCA 2JA8B 4FFBA 4KLZA 4IBOA 1QQAA 2CNNA 2BZ0A 1M2OA 5DZSA 3URMA 6ABPA 2LUOA 1HDIA 4ZTZB 2HCBA 2GD0A 4RXTA 4OQ4A 2GAIA 2CKDA 4G8BA 1XCGB 1CR0A 2DUNA 3I52A 4CODB 1QO9A 2R6ZA 2B5WA 1XBTA 4JSTA 3MBIA 1QHFA 3FUXA 3OIFA 3EA4A 1CPYA 1L9XA 2DLDA 3P0JA 4MO9A 4TROA 2NV6A 4F6RB 5KNBD 3MQFA 2HK8A 3K30A 2VTKA 3WGMA 4BIIA 1W8IA 1A9ZA 1N8TA 3P96A 5F76A 2D7DA 1LQTA 3IAM6 3C3JA 3VX3A 2GEDA 2ADMA 3AYXB 4RMIA 3PE4A 3QIAA 4IY1A 3L77A 4HFJA 1BFDA 4XUDA 4FI3C 5AI8A 1YBMA 3B3QA 1I3NA 3T9EA 4BWGA 2VIIA 4KAFA 2KS6A 4UAGA 3V33A 4IIGA 5EMLA 3VTFA 3A6PC 1ULAA 5EIWA 2QQGA 3M7IA 4WNAB 3FDFA 4E46A 1Z34A 3AYZB 3IGFA 4YCAA 1LW7A 4D42A 5BW4A 2ZJ5A 2I0FA 3ZUGA 1CK4A 4QEDA 4B8YA 3HKEB 1Z36A 4HEJA 4KAAA 5K8TA 2JKZA 2JFFA 2CBZA 1Y89A 3AUFA 3R5SA 5T3YA 1X7XB 4R98A 4C2UA 5HSGA 4W8OA 2ATXA 2QRVB 2R62A 4IQGA 5C1DA 5DHSA 4U7DA 4ZVTA 2IZ1A 4DV7B 1E2MA 4Y7DA 3KFVA 2O6LA 4O4JB 4Q93A 5FUWA 1T1SA 2BTQA<