1WR8A

Crystal structure of hypothetical protein ph1421 from pyrococcus horikoshii.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
230
structure length
230
Chain Sequence
KIKAISIDIDGTITYPNRMIHEKALEAIRRAESLGIPIMLVTGNTVQFAEAASILIGTSGPVVAEDGGAISYKKKRIFLASMDEEWILWNEIRKRFPNARTSYTMPDRRAGLVIMRETINVETVREIINELNLNLVAVDSGFAIHVKKPWINKGSGIEKASEFLGIKPKEVAHVGDGENDLDAFKVVGYKVAVAQAPKILKENADYVTKKEYGEGGAEAIYHILEKFGYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a haloacid dehalogenase superfamily phosphatase PH1421 from Pyrococcus horikoshii OT3: oligomeric state and thermoadaptation mechanism.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
molecule keywords Phosphoglycolate phosphatase
total genus 85
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 3.1.3.18: Phosphoglycolate phosphatase.
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1wr8A01
3.90.1070.10 Alpha Beta Alpha-Beta Complex Hypothetical Protein Ta0175; Chain: A, domain 2 Hypothetical Protein Ta0175; Chain: A, domain 2 1wr8A02
2DQSA 2YMLA 3OPXA 4UMVA 4CF4A 4UAVA 3W5AA 1QQ6A 2G07A 1U7PA 4DW8A 2EATA 4YIHA 2RBKA 3ONNA 2JAWA 5ALGA 1T9ZA 3WGUA 2MSNA 1VJRA 2JAOA 3AR2A 5AM0A 1QYIA 3S6JA 1NRWA 5AVVA 5AVYA 2P11A 3W5CA 3WK9A 1TJ3A 2GHTA 4DFDA 2YN4A 3NRJA 3QUCA 3WK8A 3ZVMA 3KBBA 3U7GA 4I9FA 3KC2A 2NO4A 3CZ4A 4GIBA 3PCTA 1RPZA 5AVXA 2MU1A 5AVUA 2PR7A 5ALDA 2EAUA 3WKAA 5IT4A 4XE5A 1SU4A 3FPSA 1U2SA 3IRUA 1RDFA 3QLEA 3N07A 1T5TA 2BDUA 4XQ0A 3I6BA 3AR5A 3OTQA 5AW3A 2NYVA 1RLOA 2HO4A 2I55A 3MN1A 1QH9A 1QQ7A 4YIKA 5T41A 4BX0A 2GMWA 5AM1A 2R8ZA 3UMBA 1NNLA 3E58A 2I34A 3PDWA 5ALNA 1VFPA 3W5DA 1TJ4A 3ZX4A 4Y2YA 1Z4OA 4L6AA 2ZBFA 5ALLA 1J97A 3ET4A 4L6CA 3B8EA 5JJBA 1L7PA 3AR8A 2YJ6A 5A3SA 1Z4MA 2FEAA 1YJ5A 1Z4JA 2FPSA 3SHQA 5AESA 4PNHA 5AKEA 2FUEA 4G63A 5AKJA 5AI6A 5AW4A 2D2VA 4NWIA 1L6RA 1WPGA 3ZWKA 2ZBGA 3UMGA 1WZCA 1RMTA 1U02A 4KN8A 3KD3A 5AKKA 3QXGA 1Z4LA 2HDOA 4YGYA 4UARA 4Y2UA 5ALEA 4AS3A 1RKUA 3MMZA 1Z4PX 4RETA 1F5SA 5AK5A 5AVQA 3FVVA 3R09A 4MUMA 4C4RA 2HX1A 5ALUA 3BA6A 2ZBDA 2YY6A 2HSZA 4UU1A 3ESQA 3ET5A 3MPOA 2P9JA 4DCCA 1U7OA 4AS2A 3P96A 5AKZA 3U7FB 2I6XA 2G1AA 3OCUA 3SLRA 5AKGA 5AVZA 4EENA 4MWOA 4BBJA 4HGPA 5AM3A 3SF0A 2Q5EA 4KX3A 5ALQA 5AVWA 1RLMA 4HGOA 4OFZA 2YFYA 4RESA 2I7DA 4IFTA 4Y2QA 4EX6A 2C88A 2JGAA 5AW9A 3HYCA 1RKVA 2CN1A 1N8NA 1L8LA 4EEKA 2C8LA 1PW5A 3K1ZA 4HGQA 5AK6A 1NF2A 1XPJA 3KOOA 1YDFA 4FFDA 2WFAA 1QQ5A 3ZU6A 4O8CA 1AQ6A 3U7HB 1WR8A 4G9BA 3L1UA 3L8FA 3AR6A 5AW5A 2B1RA 3ZW7A 2Q4RA 4Y2JA 1Z4NA 2AUTA 5AKXA 3ZWDA 2G09A 2OM6A 3U7EB 2CFTA 3M1YA 4QJBA 3NUQA 1L8OA 5FP0A 5AKLA 3L0CA 3N1UA 1RQNA 4CF5A 2RAVA 3A1EA 4KNVA 4YCLA 2HOQA 5AM4A 4NV0A 5ALRA 1Z4IA 2OBBA 2WF7A 1Q92A 3PGVA 3L7YA 2B82A 2AH5A 5AICA 4FYPA 3I28A 3OCZA 1RQLA 2B0CA 2W4MA 4HAIA 3EF0A 3SMVA 3IJ5A 2RARA 4XOUA 5AKHA 2IOFK 3WK6A 1RRCA 3N28A 3AR7A 1N9KA 3L0YA 2CFRA 1EK2A 3L0BA 3QUBA 5E0OA 4ZEWA 3QU7A 4UMEA 2JAUA 5ALWA 4AP9A 5AW0A 5ALJA 4EZEA 1LVHA 3OCVA 1ZS9A 3B9BA 3WKBA 3QU2A 1IWOA 3ZI4A 4BEVA 4BNDB 3UM9A 5AI0A 1Q91A 5AW6A 2ODAA 1RMYA 4H1WA 1CQZA 4ZEVA 4UATA 2FI1A 5ALOA 2X4DA 2I33A 5ALIA 5AI9A 2WF9A 2ZBEA 1ZD2P 3U13A 1WVIA 3NAMA 4C4TA 3QUTA 2FPXA 4CNQA 2O2XA 2ZOSA 3QNMA 1TE2A 2FPRA 2C4NA 1L7MA 2G0AA 5AIAA 5IT0A 1JUDA 1YV9A 2YMQA 4BX3A 3EPRA 5ALMA 1X42A 5AW7A 5ALVA 3HLTA 1K1EA 3AR9A 1XVIA 1XP5A 2WF8A 5A3QA 3OCWA 1U2TA 4BYGA 3OCXA 2QYHA 4HYTA 1YNSA 1L7NA 3DAOA 4OD0A 3ZUPA 1CR6A 3WKDA 5AKYA 4UAUA 3E84A 1ZD3A 5AK3A 2R8EA 3MC1A 3ESRA 3ZVLA 1L7OA 1SWVA 1Z4QA 3IB6A 4HGRA 3M9LA 3N8GA 2FPUA 3OCYA 2IOFA 5ALPA 2PKEA 3AR4A 3DDHA 2WHEA 4ZEXA 1RKQA 4XPZA 3EF1A 2RB5A 3BWVA 4YCNA 1RMQA 2HHLA 4EELA 4JDPA 4OHFA 3RFUA 2B8JA 1J8DA 3WGVA 1Z88A 2WF5A 5AW8A 2G80A 2B30A 2Q4TA 2B1QA 3QU4A 2WF6A 3TLMA 5AVRA 3E81A 4YCMA 3L5KA 3SD7A 5AI8A 2GHQA 5AIBA 3B9RA 3NIWA 3AR3A 5AI4A 4E88A 3SKYA 2HCFA 4F71A 3E8MA 2HF2A 3WK4A 1FEZA 5AM5A 3QU5A 1Z5GA 2VKQA 5IS2A 2PQ0A 5AVSA 3GYGA 2QLTA 2GFHA 2HF7A 1ZRMA 2YMPA 4UMDA 5AW1A 1TJ5A 2ZXEA 2BY4A 2HI0A 5AVTA 3I1YA 2YMMA 4Y2TA 3W5BA 5ALTA 3QYPA 5A3RA 4UM5A 1ZOLA 4QQFA 2GO7A 4OCZA 3FPBA 5ALHA 3QU9A 1ZD5A 3U26A 3QGMA 2G06A 3R4CA 2C8KA 2YJ5A 4JB3A 1SWWA 4YH1A 4L57A 1ZJJA 3FM9A 2IA5A 1Z4KA 2JARA 4NFLA 1LTQA 4Y2RA 4KX5A 1KYTA 1T5SA 3RF6A 4EX7A 5AKIA 4BKMA 3QX7A 2B8EA 4CE6A 3NALA 2I54A 2W11A 2P27A 3KDPA 5AM2A 3EWIA 4I9GA 4Y3UA 4HGNA 5ALSA 3WKCA 4UM7A 2IYEA 1O03A 2IOHA 3A1DA 4UU0A 3DNPA 1S8OA 5AK4A 3R9KA 4DWOA 4UMFA 2P69A 1Z5UA 1Y8AA 2HEGA 3KZXA 3FZQA 3ZTWA 2FUCA 1ZD4A 1YMQA 4Y2SA 5ALXA 4UASA 4BX2A 3NASA 1EK1A 2NO5A 3F9RA 3D6JA 3A1CA 3CNHA 4KYTA 2ZG6A 2WM8A 1MH9A 2R8XA 5ALKA 3L8EA 3VAYA 3SKXA 1VJ5A 3NANA 3N5KA 2YJ4A 4NAVA 4BEWA 3WK5A 5AI5A 2AGVA 4BNDA 1ZRNA 3QUQA 4FE3A 1RLTA 5AHXA 2G08A 3ED5A 3WK7A 3WKEA 3DV9A 2OA0A 4Y2PA 4NABA 3I76A 4F72A 3ZX5A 2YBDA 3ZTYA 3ZVNA 4Y2VA 3L8GA 4KNWA 4C4SA 2R8YA 3J7TA 3FGOA 2AMYA 2O9JA 2BDEA 2FDRA 2W43A 2CFSA 1O08A 3L8HA 4UW9A 4CF3A 1TA0A 2FPWA 4J2TA 1RC8A 4IG4A 5ALZA 1YS9A 2OYCA 4J03A 5ALFA 1S2OA 3A3YA 5AW2A 5ALYA 2YJ3A 2C9MA 4B6JA 3L1VA 4GXTA 2EARA 3PGLA 3UMCA 4Y2XA 3U19A
chains in the Genus database with same CATH superfamily
3I4CA 4OPMA 2XYHA 2EJUA 4C7KA 3RJZA 1UJ2A 1OVMA 4H1HA 3I2HA 4NAHA 4KP7A 1CE8B 4V0QA 1PEAA 2PNJA 3O82A 4UAVA 2VDMB 3GXBA 4PYNA 1PRYA 3K31A 4TTJA 3UK2A 5IRCD 3F6EX 2V45A 3K0HA 5LR6A 5JS8A 1RBYA 1EE9A 1U0EA 4C88A 5I9IA 2HMAA 3ONNA 2PUCA 4BAZA 4IG9A 4BTLA 1Q0RA 4P4TA 2PD3A 3BHMA 2DOKA 4CFSA 1U9IA 5ICCA 2RGNC 5D3MA 5L4LA 5CAEA 2X3UA 4N76A 4UE6A 3LK6A 1N77A 1P45A 1EK5A 4CIWA 4UHJA 5JEDA 4TN5A 3AK4A 3SBOA 3E2PA 4QT4A 4GMXA 5MGNA 2ODBA 2ZSUA 2P5TB 1A2BA 3PRYA 3NRJA 1SIWA 4YDRA 3E03A 5DYYA 3D1LA 4TTVA 3DDZX 2MSCB 1S3IA 3UXHA 1T8TA 4NMMA 4XIJA 2MHCA 3RYCA 1EVQA 1G21A 3LDAA 4P0TA 2IZ0A 2ZVJA 4I9FA 1FX0A 2JCBA 2RGRA 4FDMA 3EVGA 1T10A 1P74A 5DHQA 5JD5A 5MGBA 5HFAA 2JA8B 3RVDA 5GIPE 2PVCA 2FTKE 2HGZA 3V7FA 2FWBA 4MW6A 5FPTA 3AXTA 1NUHA 2IITA 5BV1A 2G63A 2P9GA 1HR0B 4FCVA 2W2QA 4OHBA 3VPDA 3WDKA 4U3JB 4BL5A 4MP8A 2CXRA 4GPTA 1Z13A 1C7EA 3SEZA 1MO2A 4UQLA 4U63A 5DM2A 4GOMD 5IM4F 2ZT8A 4Q01A 2A6PA 1U0HC 1M2VA 4TYMA 5DGXA 1NE2A 4BZWA 4EHKA 2QE6A 5JH7B 3B2NA 5B55A 3PXUA 1UPCA 4UPEA 1XTPA 4RPJA 1AS0A 2X0DA 2C7GA 1T4BA 1Y4AE 1U0JA 2AXEA 3BCUA 3OX4A 4Q4AA 4WK4B 5T8KA 3AP3A 3EHEA 1E0AA 4ZQHA 2PZLA 4N5LA 1R0BA 5GV7A 3VH2A 3BKWA 2YWFA 3WHIA 4ESHA 4J3FA 4TT3D 1PSZA 2OCXA 3DHWC 2K7ZA 1M3SA 1Y9ZA 2G0NA 1UM8A 4XW2A 4GD3Q 1N1EA 2C9YA 3GHHA 1QFMA 3BORA 3H5NA 4GOJA 3ANTA 2D2XA 2XMQA 4N49A 4QYXA 3SYLA 4EVIA 3O92A 4MVJA 4L6CA 1VLQA 2D0IA 5K6AA 4UNIA 3MOSA 3H19A 1C4WA 5I9BA 3V97A 3IE1A 1BA3A 4D7AA 1WQ1R 3P27A 3V4LA 1G8GA 1ZUHA 2YU9B 5EE0A 3W06A 1GPWB 3PHGA 3INRA 2Z1DA 1WW8A 2R1VA 5TLSA 3ZWNA 1QVVA 3KUUA 4C76A 1VLJA 2OZLB 4UQPA 2AQ8A 1B8VA 4EF5A 2VYND 4YCCA 1EFRD 1AGNA 3OZRA 4ARSA 4OQ4A 3VPBA 1SKYE 3F78A 1QAQA 2DPXA 2VCYA 2KBFA 1OXUA 4Y9TA 2Q7OE 2PTHA 5EPEA 3OAAA 1K2VN 4PZAA 3O26A 1UK9A 1FNMA 2R5WA 3NXKA 3S27A 3HUUA 4MUYA 2AD5A 2J3HA 3R0VA 4LDZA 5IEBA 3U49A 3S1AA 4UPDA 2CLFB 1WY5A 1HV8A 1MF7A 3IA7A 3MCWA 1KZ9A 1QRUA 1P8JA 1I1HA 3D2LA 3ETDA 1JU3A 1UADA 4CIBA 3GVHA 2BGNA 1DXYA 4HUQA 1M67A 1S3GA 1P1IA 3D6FA 3FTPA 2PKRA 1C14A 3Q4GA 3QX9A 4KIUA 1U3WA 4ZREA 4C22A 4CTOA 2P6RA 2DY0A 2J45A 3N2KB 4YJFA 2QX6A 3PNYA 3WP1B 3FZNA 4U02A 4Y7DA 2C4TA 3SFZA 3AQ4A 1G8YA 3U3KA 4ETWA 3OCUA 2OYSA 3FNIA 4E5VA 1A72A 1WOMA 2HM7A 1SKUA 5GZ6A 4I5IA 3OJWA 4RAQA 4MKZA 1BD4A 4X93A 3OOYA 3CCBA 1T3LA 5FWXA 1P6UA 3FYUB 2RH9B 4MR9A 4XLLA 2GPYA 2A84A 3G23A 5HW0A 2XLBA 4PXYA 3HB7A 5K3SA 2C5AA 4RH1A 3WQSB 1LWOA 1U5AA 2ZRQA 3GFPA 1RQ2A 1C3EA 5HJEA 1JEOA 3AIIA 3DM9B 2HMYB 5K09A 2GBCA 1RKVA 3WWYA 3TKAA 1IUKA 1HBJA 1TVKA 3M5WA 1S1CA 4RD6A 3H2ZA 1GCUA 3SAJA 4BFZA 1BXZA 5A3JA 1T6NA 2O2EA 2GF2A 5F76A 4R3NA 4YMSA 5CVJA 3TFQA 3MTIA 2PZEA 3CW8X 5CFMA 2RJ3A 3JD4A 1YDFA 1ZGBA 4L4XA 2IHTA 1SUIA 5JUWA 5LZ4A 1ULBA 5LMZA 1IVSA 1N78A 1J33A 2VHYA 2X22A 4ZWNA 3ANNA 5M5WB 4HSGA 5C3UA 1F8GA 2XAAA 2I6GA 4A4DA 3OE1A 4CDMA 4BNGA 7ABPA 2L19A 4BECA 2HQRA 4WRRA 3W5VA 5H83A 2C31A 1XPOA 2HRBA 4FGSA 4EVQA 1MUUA 5JXHA 4C0HA 2D1QA 1KS2A 1EVLA 2E1RA 1SD2A 3NHWA 3K9FC 4BYMA 1TT7A 4YCLA 3PT5A 3ZE9A 4EFLA 2GKOA 3C85A 4PGAA 2EEPA 2FGKA 2I65A 5HKOA 3FN4A 1BCSB 2WIGA 3IQFA 3K1YA 3UHPA 4YMWA 1E66A 4FZ3A 3I5UA 1QZXA 5DLQC 4A0FA 4CIXA 1HNWB 5F9FA 4FYXA 2WIBA 2AH5A 1UMKA 3OUZA 3CF0A 4UVEA 3OCZA 6Q21A 4BASA 2W4MA 2DPHA 2R2GA 4CLXA 4JDUA 4WHMA 1ZJYA 1TA9A 1CUBA 2GLUA 3BK2A 1NTOA 3F2VA 1JFVA 2JDID 2YXEA 1RCTE 3GJTA 3VAAA 4F38A 5C8YA 1YZUA 3W3AD 1OIWA 4MHTA 4YASA 1W94A 1VSVA 3LHFA 1SXGA 4KGXA 1TQHA 4J43A 1E3IA 1Z2CA 5M29A 3B1VA 3CX4A 4E32A 3TXXA 4F7WA 4HDKA 4YPOA 2IZ5A 2F55A 3PLAE 2OLEA 1MX1A 3PO2B 2QG6A 1KE1A 3HP7A 3ZWMA 4F21A 2BFEA 1RP7A 1Z07A 2CW5A 3DKVA 1BVHA 1M73E 2XI4A 1RPAA 4MTCA 1R10A 3FROA 3LL7A 1IMOA 5H68A 1PWZA 1SD1A 2H5LA 3TW4A 4CIDA 3AEQB 4BNDB 3KZVA 4LYJA 3LFUA 4XSHA 3AFGA 3OECA 1P33A 1NY5A 1U8CB 2IXFA 3JCZA 3HVUA 3SZMA 3VNRA 4X71A 3IMGA 1VB5A 3HB4X 4LY0A 3EGXB 2WU3A 4B8YA 1YQ9A 2PZAA 3AF5A 2OV3A 4MVYA 4ALJA 3BJIC 4MR7B 2XRZA 3FTDA 2FI1A 3CC8A 3G2QA 5TVKA 4B87A 4B3FX 5C8VA 4C29A 5DULA 1WW2A 3VZDA 3A6EA 2W7TA 4S04A 4LMRA 1FK8A 3WHKA 4X1KA 4BO3A 3PTAA 3MB8A 1MJFA 2AXNA 2R68A 2L2QA 4XRRA 1H3EA 3HDJA 4LJ7A 3H65A 4GOXA 4RENA 3ZDXB 1T4CA 5JAMA 2GH1A 4TQ9A 1ML4A 4KDFA 3CJQA 3KZMA 1NQUA 2QK4A 2QX8A 1NJ2A 4IGIA 1XTUA 1BMTA 4KXMA 5TPWB 1N0VC 3D0RA 4GEKA 4BV9A 2PBFA 4RGVA 2NXJA 3C24A 3N39C 3MS7A 3QVXA 5TMBA 4YK7A 2ISCA 4OXXA 5DKFA 3SNHA 4A7PA 4F11A 1L7VC 1HKHA 1L1EA 2QR5A 4HZIA 1X42A 1XVIA 4DN6A 4GICA 1KS9A 2DB3A 3BJRA 2BFNA 4Q3LA 4BYGA 1W36B 4WGGA 2PGNA 2M32A 4B3JA 3H6GA 3P9YA 4ITUA 4Q6WA 4DMHA 4D45A 1TQ2A 3FGNA 2Z2XA 1Z68A 1GADO 3NOOA 3WLLA 5D7NA 4EYOA 2A30A 2ONJA 3ZV7A 2AFIB 2XH8A 2XUZA 4HDOB 5IEJA 4J0CA 2NXWA 2AOUA 5DBHX 3HYLA 1YR6A 5JD4A 2ZBPA 2DZDA 3OQOA 1CW2B 1HNNA 1R4MA 2Z5FA 1M75A 3C4QA 3HCAA 1NV8A 2CNWA 3KVVA 1BX0A 4CGZA 1JIQA 1ZN2A 2ZIFA 2P5UA 1CEYA 1QKJA 3GMSA 2JB9A 1CU1A 5B1HA 2EJWA 4LWQA 2RB5A 2PS0A 4C7OA 1XZGA 1MTZA 4G1BA 4LJ5A 4R98A 2QG9A 2AFHB 4EL5A 4DR3B 2HHLA 1TJPB 3KS9A 2XNSA 4LRQA 4OHFA 2O2DA 1KXJA 3W0LB 1PNVA 2B8JA 2ZDQA 5ESDA 3PGA1 3OJ0A 3PNLA 3REQA 4BGEA 4BX3A 2Q4TA 3DOOA 1LTHR 3EAFA 1AQYA 1E9FA 4NENA 4V3CA 3WL8A 5L53A 3NJRA 1SC9A 2ORVA 2WT4A 2Q1TA 4QUIA 1JA0A 3P4UA 4MRAA 1RJWA 4JT4A 1IMJA 1NQVA 1YQEA 3GIDA 5T3YA 1QV6A 2DBVO 4N3GA 5F7JA 2XEDA 4Q66C 5ITWA 3QPUA 1V9CA 1WDWB 3ESAA 5HKKD 3PNPA 3RBXA 1CZHA 5SYNA 2CE2X 4JJEA 1Q7CA 3BD9A 3AZQA 2B4RO 3B85A 3FBWA 3L6OO 4X6LA 4Q7QA 1XZQA 4NYIR 4AN1A 3QI2A 2JVKA 2E55A 4FINA 5AVSA 1FDTA 1O5OA 1Y8QB 2UVPA 1ZRMA 5GZ1A 3I73A 4S05A 3CUVA 4KQKA 2JLYA 3LQ2A 4TTRA 1WCIA 2G5TA 2HI0A 5EWJB 4UUQA 3TFWA 5A9RA 5JBNA 2KQUA 4GRAA 5JOQA 4ATNA 3UMMA 3PVZA 1USWA 4WWHA 1FP4A 3I37X 3C41J 3TDKA 3LUGA 4MB0A 1I51A 4JT9A 3PXBA 4QELA 3VR0A 3R3ZA 2HU2A 3B3AA 1GWNA 1J49A 3O4IA 1YBAA 2P90A 3ZDBA 3G2KA 4TL8A 1QDEA 1LI4A 1ZC4A 2FSVA 2IRWA 3L41A 1QIMA 4J16A 1OXVA 4XLZA 1SVSA 3LPNA 3PUZA 2QD4A 4IEIA 4MQFA 1ZD5A 1GL9B 5HCNA 2V6IA 3HU2A 3KT8A 4Y6GB 1FFEA 3VKGA 5HBGA 4D1YA 5G0SA 2Z1NA 1JG2A 1UJBA 2AYXA 2YV4A 2EQBA 3KKMA 1MABB 1T8PA 5HWSA 2PS3A 4AURA 5MN4A 2R6JA 2HLDD 1VB3A 5DYTA 4XJVA 3A1UA 1KK3A 1R27A 4F9TA 2A0KA 4BKMA 3ADOA 3QZUA 4GQIA 2GFQA 4FLEA 4HDNB 4OA8A 3ZE7A 3MRSA 3QW2A 4OJNA 3LK7A 3B1WA 2H2AA 4GXNA 4NBLA 3W4IA 3KDPA 4UUNA 5EJ2A 5I3ZA 3RVMA 2FFRA 2HMSA 4DWJA 2FQXA 3FKIB 4I9GA 5CBPA 1QE0A 1PBTA 3OOHA 3CHYA 1R8SA 2A3NA 3FAZA 2IYEA 5AUQA 1OVGA 1PJ2A 1DRVA 1NC1A 2K5UA 3C3DA 5DSXA 5ECGC 4ENSA 3U56A 3RBAA 4BNZA 1XD2B 4HY3A 4WJLA 1H5QA 1A7UA 4QWMA 5T6BA 4D3DA 1Y8AA 5DTIA 3CLHA 1SOAA 1RLIA 3AONB 1FP1D 1HTTA 3DXXA 4RJJA 1YMQA 1U28C 3PFWO 1GPKA 3LPAA 2NO5A 1HSZA 2QMEA 1IHPA 5EYPA 3U4QA 3CNLA 2QUIA 5FR1A 3SJUA 4I1RA 4UHEA 2ID9A 4ZOBA 2X6TA 5TF4A 3TTWA 4J16C 3BILA 1GCGA 2CNWD 2FOLA 2FMIA 2JEZA 2PL3A 5B53A 1WB9A 4GI2A 4EKYA 5IZCC 3TQRA 4BV3A 4G0YA 2FPOA 1QG4A 3ECSA 5ADWA 3B1KA 3W9BA 1T6BY 1TQ8A 4Q3BA 5CX1A 4KVFA 4LNUA 2YZNA 1E1QD 4BEWA 1AHIA 5L3ZA 4CBVA 2RCNA 4W7HA 1ZRNA 2CHEA 2MMGA 2WJVA 4UEKA 4ZO9A 5F3DA 3QE0A 5AMXA 3I6YA 5F9HA 3SBEA 4KITB 4V03A 4RQAA 3W78A 2VDOB 2YBDA 1SFOB 3QVWA 3EMKA 4N0DA 4ZAXA 2Q0HA 1SB9A 3T6KA 3NNSA 4RK6A 5KYUA 2PQMA 3RU7A 2W4IA 3TPZA 1IDN1 4PYQA 2GKGA 4YHBA 4QUEA 1RPZA 4MDEA 3PA6A 4YXFA 1SU6A 3F8TA 1XK6A 4XVQA 3ZLTA 1LH0A 1S9DA 1TWHB 3B2EA 3GFVA 3KR1A 1R6TA 4Q7LA 1UOPA 3IVXA 1UZAA 4V0OA 1D2NA 3UJBA 3NVKI 3S70A 1DBQA 1FDUA 2JAHA 4EY4A 5AW2A 3IPCA 4IGKA 1PJTA 5F98A 2PKYX 3KQQA 2NTJA 3ZQ4A 3MB5A 1OXTA 1F0NA 5FTKA 3IT2A 4B7XA 1APBA 3QNWA 4PFKA 1H6DA 4ASUD 4Y2XA 3UK7A 2QIPA 1C4XA 1OMOA 1C0IA 4YFVA 1IJBA 5KYKA 2REQB 3H0GB 4Q3EA 4DQDA 1CDDA 3EXAA 3NUGA 4RZ3A 3CUEF 5LL6P 4BO2A 1I4EB 5D2CA 2GZ3A 2C7RA 4IQGA 3B5IA 1KEUA 3EFOB 1UH5A 4FGZA 3WLNA 1GZUA 4TMYA 1UFVA 3EIWA 4ZVMA 2C5BA 2OB2A 3IV7A 5JZSA 4G1CA 3DGEC 4WD3A 1UPTA 4DG9A 3GLRA 1UMCA 3AR2A 1E2EA 5GGYA 1M34A 1KRWA 4R1OA 1GFSA 4N8SA 2W6IA 1V37A 3NO4A 4FJ2A 4GR4A 3AGQA 4R2WA 3DVAB 4G36A 3I9NA 3VDNB 1KU0A 2P6OA 3URMA 3X1MA 5CFQA 3HCPA 3NHFA 1KSJA 3NBQA 1P7YA 2VJBA 4O5OA 3PZRA 4RMGA 1DOZA 3PX7A 3D64A 4JN6B 5C4JB 4AJNA 5FBRB 2JLAA 3ZVMA 1VLHA 3FNQA 4B0PA 5KYTA 3GLFA 3VI3B 1OAOA 5K6RA 3TSYA 1T5OA 5JDIC 1IL0A 3CXUA 3ZHSA 2ZYDA 4RA9A 3PR3A 4GXQA 1ECLA 5PGMA 1W6UA 1DWQA 2LTAA 2QLBA 4J6EA 5B4VA 3A3KA 2JFGA 1PR6A 1OZHA 2UUOA 3K9HA 3H86A 5M3MB 4I66A 1EXVA 3WKAA 5CTAA 4F97A 3CPEA 2F48A 3I2FA 3PXCX 3R7LA 3U3JA 1IZ8A 1TI7A 1T25A 1XKLA 1VIYA 4DEYA 2R7AA 4XJXA 3RIGA 3JYPA 4TXHA 2UZ1A 1MLDA 1M2GA 4AJEA 3R5SA 4LY9A 4NK4A 4B35A 3X3HA 2UZ3A 1A2KC 4BMDA 5CDHA 2EYUA 3TN7A 4WASA 5LQMA 3TIIA 1WULS 4K81B 5DNDA 1VHDA 2IYTA 1EX7A 2J6HA 1V8BA 3P9XA 2YYYA 1W5FA 1PEDA 1B2RA 2WJIA 3DL0A 2R7ZB 1BS1A 1O7JA 2J5QA 5ES3A 1Q0SA 1ABBA 2Y1DA 4RWEA 1XLWA 4U39A 3TCNA 3TX6A 4DCGA 4CUKA 5HUJA 3PE6A 5K3FA 1WHSB 4UBOA 3D3WA 3O3MB 5L3SA 1Y0BA 1U11A 1TF5A 5KDDA 3EZXA 3FSRA 3HEMA 3M6FA 4MPJA 5JQWA 1G21E 3GRAA 4WINA 4BTEA 2GERA 4DCJA 1HFKA 1I6HB 1UBEA 4KREA 2I76A 3GRRA 5H80A 1X9GA 5BXYA 4MR9B 1SKYB 1OJ7A 4NNPA 5A3SA 2OGUA 2XT6A 4FGKA 2CE7A 4J0HA 1UMDB 1LCIA 3R7BA 1ZPDA 2X6QA 4ZANA 2ZIAA 3TL3A 5U4QA 5EKSA 1JMVA 3H9JA 2FUEA 2P75A 1DQPA 4M9CA 2VI5A 5AI6A 5FPHA 1EGQA 2QTAA 4EA6A 1A8HA 3D31A 1CUSA 2JFOA 3ZWKA 5CMLA 1JALA 3UCFA 3TTUA 2WTMA 3RUEA 3AWDA 1XB2A 5LXTA 5C44B 3RQIA 5J4VA 2WAYA 3RYIB 1PR1A 1KOJA 5C31A 1Q84A 3JD2A 2ZIUB 5ITZB 2HK9A 4WZBA 3W2TA 3LXUX 3LPMA 3RU9A 4AS3A 2FKAA 3VR4A 4MJ7A 1Z6QA 5FBZA 4DLXA 3A4YA 5BN5B 1OASA 4NE7A 2RHMA 4HJRA 2VQEB 2DFKB 3TI9A 2AJTA 1H69A 1TMGE 4GOLD 4W5OA 4TLDA 2G5CA 5UKDA 1OFGA 1XZBA 4AJHA 1I94B 1BXGA 5H9WA 4OFXA 3KJXA 1YR7A 4RH0A 2EF1A 4HB2A 1N34B 3WGJA 3E9EA 2H1RA 2CL0X 5AKZA 4X8LA 2OOSA 4RD0A 3C7KA 3RD5A 2ZYGA 1CJUC 3GEIA 3O75A 3GV0A 5IWCA 5K3BA 4WCFA 1OWMA 1S02A 2EW1A 3EULA 3IP8A 4M98A 3UGTA 4BKQA 2YWBA 1R0KA 1X87A 1RLMA 1ZH8A 4A6PA 1CVIA 1DHTA 3KTDA 4BGIA 3G8CA 3K96A 3DMGA 3GZTB 1J1ZA 4CG3A 3KB2A 5IUNC 1ESZA 3LWDA 1MJGA 3L8ZA 3SVTA 1CY1A 1KJWA 5K03A 3GUCA 4QVKA 1XZJA 4D57A 2W70A 3V9PA 2JNWA 3DSRA 3K6KA 4Q37A 4AZ3A 2QMZA 4RCVA 1SN7A 1YZGA 2W8BA 2FN9A 2YV3A 1MIHA 1JXQA 2F43B 4GKJB 2I62A 2MIIA 5CD1A 3KOOA 3PKZA 4FMCF 3QEMA 4JQOA 3PFGA 1JFFA 2P7IA 2WZDA 4QGFA 1ISRA 3IOBA 2CJWB 5IARA 3SR0A 4R68A 1PZNA 3C39A 3QTTA 1NU8A 1I3QB 2CL7X 3MPUA 4AZ0B 2W4QA 3OCJA 2GVZC 3MA0A 4QL3A 4D0GA 2PAFA 3H4VA 4QECA 3ID6C 2PR2A 5IDVA 2JJYA 3L46A 2BFEB 1L8QA 3QKUA 1YS2X 4FHZA 1RM5A 4OX9B 5AKXA 1AKEA 2IXAA 2Q1SA 2CFTA 1EGAA 2RIPA 4QJBA 4DDUA 1SA0B 3EXG2 2I78A 1N3BA 2J0UA 4KQMA 2WP0A 3KVNA 4YP5A 4MQEA 2CNDA 2RAVA 3FJYA 4DAOA 3CX8A 2V6MA 1K8QA 5L4NA 1XBTA 4FR0A 1T24A 1EGMB 4HGYA 2IBTA 5JANA 5HK9A 1SCUB 2FFQA 4H08A 3G2NA 3OKAA 4RVNA 2D3WA 3HOYB 2OBBA 2QYSA 4H4EA 3U60B 2EU8A 4EZIA 3RAPR 2YCBA 3E7PA 4DILA 4KR3A 2A1TS 1MR3F 5IKEA 5L6LB 3JYLA 4BFUA 5JZMA 4Q82A 1RZRD 3F3MA 1H9AA 1TGVA 2WBLC 4ECEA 1K6XA 3JQEA 5JO0A 4AFNA 3RTCA 3FSGD 2IOFK 4MV1A 2C82A 5DGCA 4RF3A 5CDTA 3L0YA 1ADBA 3KOWA 3MLBA 3IDAA 1NVFA 2AVDA 2E6KA 3W3ZB 1P5ZB 1U7DA 1PK8A 2CXPA 4AQ7A 1E1QA 3HJAA 3PFBA 2WQZA 2JJ1D 4X62B 3CLTD 2R6ZA 2RGGA 4L22A 3IXMA 1VPLA 1RI3A 1LSUA 1U2DC 2HTEA 3E22A 2JA2A 3WFJA 3BCSA 1Q1NA 3OCVA 4KMRA 1EK6A 3BD6A 5JNSA 2DWPA 2BE9A 2ZGVA 2HN9A 3D8HA 4DDKA 5FKJA 4OB7A 3B2QA 1E9RA 1RWVA 3NATA 2C5HA 4PGHA 2R1UA 1VL6A 2DPLA 1VI5A 4MYCA 2BMEA 2XGMA 4BIMA 4OI2A 1IZ9A 1IXSB 4RF5A 3CQZB 3DBRB 2PLFA 4WACA 2JFXA 2VEDA 4P22A 1CQPA 3AQIA 4QTUB 1DKMA 1RXSA 4ED9A 1JPJA 3ABIA 2EF0A 3CB4A 4KQJA 3LKVA 4FW9A 5C7YA 2F3TA 1JR3A 3H87A 1SFRA 1X70A 3G6WA 3H5WA 4AG5A 3ZZ1A 1FNNA 5IJXA 3SYKA 5HIAA 3ND5A 1FP6A 1FSZA 2CBXA 4JQYA 2ZE5A 5EXEA 1ZCZA 3NAMA 2ZAOA 4M1YA 5E1OA 3UWSA 4KQ1A 2Y9MB 4WY5A 2IC5A 4IIHA 4CNQA 4Y98A 1ZIOA 1OW3B 2P5SA 3RUFA 3EEBA 2W6JD 3ORHA 2B4YA 3FPKA 3GQBA 1U2GA 5KO2A 5EJ6A 1N5IA 1HDXA 3RUDA 1ZZGA 2QLFA 4LPSA 1ZEJA 1CUZA 2AR0A 2NACA 4OGGA 1QDUA 3VZBA 3AV0B 4KQGA 3VX3A 2P2GA 3GCZA 4RVFA 2AIRA 3T1OA 2J9XB 4RHTA 4IFBA 4OI0A 1CUEA 3AP2A 1OLSB 5ERYA 1U1EA 2JGJA 3AR9A 3CTPA 3ICQB 1PAUA 1E58A 3DLTA 3QG5A 2QBYA 1U2ZA 4YUVA 4J4TA 3U4HA 2CXQA 2GJSA 4PC3A 2G76A 1W36C 1A04A 4KR7A 4V1CA 1SVKA 2XMGA 4FJ1A 4FUQA 3OLXA 1IBCA 1TPZA 2DSNA 2WD7B 1FQOA 1JG3A 5CLFA 2YVUA 1J5EB 1CTQA 3NHYA 1EA7A 4ZAWA 2AFHE 2OZLA 5A7FA 3VPXA 3LX8A 5TGTA 3OQHA 1OGJA 3EGDB 2EFDB 4CLEA 1Y1WB 2I66A 2Q99A 4XPZA 4HMPA 1XRPA 2F3RA 3UPDA 1TOAA 1O4WA 2AB0A 3G8AA 3UGJA 3LCUA 2CKDA 1KYZA 2R6HA 3F74A 4DDVA 3DVAA 1KR5A 1F12A 2CHVA 1S9HA 2ODQA 3B38A 3QKRA 3LNCA 1PR9A 1BE0A 2AN4A 2K2QB 2XQVA 3ETHA 3QY0A 4HC4A 3E05A 5DFAA 1KPHA 1HLFA 2RGBA 4LGCA 2VBIA 2YHIB 1FMLA 5E9JA 2QPAA 3K0FB 4E2ZA 2CZCA 3C8ZA 3QU4A 1ISFA 2NZVG 1MB3A 3OMXA 4DG5A 5BV2P 3QP9A 3D8UA 5ERGB 4YMVA 2X5XA 5L3VA 1E3LA 4OU5A 1Y8ZA 2IK8A 2IP2A 2P3OA 3KFLA 3OQ1A 1AY0A 4P2BA 1CQIA 1J9GA 4GSKA 3IP7A 2OHVA 1D0SA 3TZCA 5ELXA 2P9BA 1BFUA 3RVQA 1JG7A 1RQ7A 2I2CA 1A1SA 3Q2IA 4KN9S 3TSAA 1XT6A 1WD7A 1HORA 3GX1A 4NBKA 1P18A 2Y3IA 4Q4AB 3EH1A 4NS4A 4P4NA 3SSNA 4D56A 3WNQA 2PCLA 2F8LA 5T4BA 3LHIA 3WQRA 4U2GA 4Y67A 2WABA 4EPYA 5A9SA 4AL4A 3PDIB 4IV5A 2R25B 1I1NA 3P71T 4HYQA 2PT9A 3DP9A 4DPMA 2GXQA 5K01A 1D6NA 1HT2E 3ANSA 1BZYA 1P1JA 1VL0A 2PPLA 4WJZA 3LPLA 5ADVA 1M72A 1NP6A 2VPYA 1EJBA 4RVGA 1Y3HA 4W5WA 3FNFA 3VC2A 4F9FA 5I4KA 2BR5A 2QN7A 2AC2A 1N6IA 4BO8A 1NBWB 1I14A 5KNCD 1P7WA 1J5XA 3VTAA 2HQSA 1YU9A 3AEUB 4QUJA 1U90A 1VSUA 4D97A 3VPAA 5GMOA 1DC3A 1JR2A 3U4QB 1NMZA 4S1TA 4IZIA 3BL5A 3QU9A 5DZSA 4JROA 1OU4A 2YJ5A 1A98A 1V43A 2QRPA 3QJYA 4TKUB 5AK0A 1GAEO 1M0WA 4GM0A 4AXBA 4BLTA 5F33A 2B9VA 7REQA 5JD6A 5K8LA 2O1SA 3EQ9A 4WZAE 1NG9A 2L18A 1QS0B 1WXXA 4BFSA 2FLKA 5EMMA 5JSZA 3HKCB 5L9AA 5K8IA 1A9PA 2ECQA 5IKXA 1L1QA 3EE6A 4KRXA 1K6IA 1ULTA 2DVMA 4KACA 2UXDB 2W6JA 3FWPA 5EIHA 4OHZA 2C7QA 5JLAA 4Z4FA 2X0FA 1YI0A 2I54A 2Q1WA 4S0XA 1KWKA 3HRIA 2Q3EA 4FZVA 4FGWA 2LGJA 2RHHA 5A4IS 3Q87B 1I5RA 1M1UA 4CEIA 1X1BA 3BL6A 4XFKA 5K4AA 3PWTA 3RBZA 1PI3A 1Y3DE 3D7SA 2QA5A 1D2HA 2M9MA 5JMWA 3OZUA 1XQYA 2HEGA 3V4FA 1RQGA 2H0QA 2VYVA 3PXXA 4HNUA 1N2OA 4RTJA 4QBFA 1Z37A 4YB8A 3VC7A 3LOUA 5KNBA 4MV5A 2JLWA 1FUIA 4HLQB 4MKXA 1DO8A 1OXSC 3O47A 4S2EA 3CNHA 1XZAA 1SO8A 4DR2B 4JT8A 3K7EA 4B3TB 3AILA 3CBQA 4KXWA 4EMTA 2PQ6A 3NWJA 4XIIA 4R01A 2J0QA 3TX2A 1RXCA 3PRHA 3CRRA 5JNLA 3I9V6 1YR9A 2VK1A 4W9MC 1D04A 1O95A 1QGAA 2P4HX 2PS9A 3OEED 4UBIA 4C78A 2Z0MA 2Q29A 1DG1G 4RVHA 5DSTA 2BKEA 2PPVA 4PGGA 1OF1A 4TMKA 5EP3A 4BB5A 1SNYA 2Y77A 1RLUA 1H8HA 3D6VA 4NONA 1RKBA 4Q1DA 2JJ1A 4KO4S 1O6GA 4U7DA 4GUAA 2VSFA 3GFOA 1U4NA 1GD1O 3JARB 4B7ZA 3H18A 1Z6YA 5KMGB 2NAPA 4FILA 2NU6A 2OY0A 3KM0A 4I4NA 1FZQA 2BGKA 3BKXA 1EG7A 2CC2A 5EE3A 5SYMA 3SLGA 5EUQB 1BGXT 4Y2VA 1UQRA 2QM3A 4XM1A 5BW6B 4LXGA 1CUUA 4BBAA 2ZI6A 1C7FA 3FFXA 4MGHA 4ZQEA 3SK0A 1ZA2A 3HCWA 3KZOA 4H6VA 4ZXPA 2D3TA 2HJ9A 1X39A 1X7HA 4LEIA 3F5DA 4DRXB 1DMSA 1SHZA 1P1FA 2DWCA 2X1VA 1IBLB 2HHAA 4ER7A 1M1XB 4ZV7A 1TZCA 2P4QA 2VAXA 4CFZA 4JIGA 3B1ZA 3TW8A 3QVTA 1QIGA 4BRZA 4CL8A 4WVLA 5C80A 2QQ0A 2B6HA 2J41A 1RZ3A 2R1ZA 2GNPA 1BHO1 4PTZA 3TINA 3ZN2A 1GYRA 5JJKA 1E3TA 3MTGA 2PVPA 3Q8LA 4JKYA 4J1TC 1U7TA 4QGBA 4C7BA 3D1VA 1QHHA 1VJ1A 3G9TA 4RYLA 5LD2B 3P1JA 4HNSA 3LGSA 3CW9A 3P8ZA 5KI6A 2IEAA 1S3FA 2VFAA 1EAMA 1DLIA 4MICA 5TMDA 3WGQA 5ICMA 1QQ6A 3B60A 4A3FB 1JNXX 3E0QA 3G1TA 2N9UA 1H3FA 4YIHA 2NUTB 2O6HA 3MYRA 4BZPA 3E9CA 5HCUA 2OPBA 1T9ZA 3NQ41 4ZV4A 4L3VA 4W5RA 3K70C 3JQ9A 1AQUA 3Q8MA 1MJGM 2QVBA 2RHWA 1ZU5A 4J4BA 4ME6A 5A3VA 3DVLA 1N4DA 1QYIA 4URVR 3PDUA 3R6TA 1GDTA 1FU4A 5KNDA 1BHQ1 3VOAA 1VIMA 1GTL1 1AKWA 1XJ0A 2J9RA 4R8LA 5C3EB 5ILGA 1N2XA 1DKOA 3B1JA 5DHUA 5DBOA 2GZ1A 3DDCA 4W5TA 1Z6GA 1Z6XA 3QUCA 3AG6A 3CVJA 3SF8B 2V9PA 3WDSA 5CPFA 2DWQA 4BNNA 2WTEA 3G7SA 3SC6A 1DTEA 4OB6A 1IEXA 1Q2UA 3IAS6 3QYFA 4PC6A 5LNK6 1ACLA 3S1RB 4WOJA 3QPCA 3W2IA 2JGIA 4TQAA 1IULA 4X85A 3PF8A 4CETA 3CO5A 4ENUA 3BTOA 1A97A 1Q1AA 4K9RA 3UMJA 4DBLE 1UXJA 1TW2A 3HL0A 1ZKMA 3NWOA 4D9JA 3AV3A 5JJ5A 4PG7A 1G2IA 3QLVA 4X66B 1FXWA 4U2EA 2WUEA 4P6VF 3C3EA 3ZV4A 1JE1A 1ZCBA 1XCPA 1AN9A 1ITZA 2VP0A 2WNSA 3GUYA 3OETA 1GL6A 1U8ZA 2VWQA 4K46A 3VKFA 2AOTA 4DQ0A 3B3JA 1T5TA 2VL7A 3R5TA 2JZNA 3R6GA 1E5VA 5IVKA 4GMKA 5CA1B 1BQ3A 1QTRA 4M86A 1Y8QA 2I55A 2UVPB 2FR1A 1C7QA 3O2SB 4MROA 4HNTA 1B6TA 2BZGA 2O1XA 1DE0A 3WNDA 5LDHA 4P7FA 4JWTA 4BB9A 5HNKA 2WA2A 4DNPA 2BSXA 1EQ2A 2IELA 4F6LA 4ZJUA 1A0OA 1WHTB 3OT5A 1EHYA 3QX8A 1WZ2A 2C1ZA 1ORDA 1VDZA 3H75A 2G71A 3ZDEA 3ZNNA 4L3WA 4WNAB 4DLSA 3R0QA 4R1MA 1TIPA 2JLBA 1JQLB 1A50B 2WT8A 2EP8A 4PNPA 1YJAA 1Z4OA 1UXOA 3K3PA 1NVTA 3GJYA 1K3FA 2WB2A 2M6LA 3DB1A 1Z0KA 4H4CA 5CH8A 2IP4A 2P62A 3EG9B 2NP6A 1GUYA 1SU8A 1CKEA 3B1YA 3GN2A 5EESA 5TJ9A 2FEAA 4L72A 3X1JA 2BKAA 1YDGA 3L5OA 3GJ0A 4DJDC 4MPDA 2P35A 4GP9A 2RBGA 3JSXA 2VCEA 3IEKA 4PNHA 5AKEA 5AESA 4DB4A 3ESDA 5EHGA 2YWHA 2BKLA 2Y1OA 2WICA 1OI4A 5IPFA 4FNOA 2YFQA 2W2KB 4GGMX 4RS4A 1A27A 2WMOB 3PO3B 4TRRA 4BQRA 5T7BA 1DLJA 2BM0A 1OX5A 2NTYC 2WVJA 4AJ2A 2RJOA 5AHRA 2XCTB 4CMAA 4BJ3A 4XYBA 4Y9DA 1NI5A 3B7GA 1XZ8A 1BKSB 1NVWQ 4F6RB 2ATIA 1JJVA 4G56A 4C2MB 3DHNA 3RRXA 5CB4A 1JMYA 1VRWA 2BP7B 2GETA 2JHCA 3IR5A 4Z51A 2V97A 3V1NA 4XKJA 3T94A 3JWIA 3K8OE 4PRKA 1K97A 4CI9A 5AVQA 2FMKA 3FVVA 4J0IA 4C07A 1TYZA 2IYAA 3Q10A 1RYFA 4HX9A 3SZRA 3K70B 1XZIA 3KKLA 4CM3A 2KLHA 1L5HA 4F2GA 3ESQA 2IDZA 3WISA 4NOJA 1QH1B 1C3LA 4DAEA 4QM7A 4JBWA 4K9KA 2ZDHA 3UK0A 1PKEA 2BPOA 4R6XA 3COVA 4FLFA 1TX4B 3LA6A 3GN1A 1FNBA 5J5CA 3OX2A 3HV2A 1UQUA 1GZ4A 2PTGA 4EHNA 4QG7A 3CVUA 2GPJA 1EUDA 4YR7A 1SHKA 4AICA 5U9CA 2QD2A 2GBIA 3D3KA 3O95A 4G1MB 1KHHA 2NVUB 3WRXC 4F1WA 4MGZR 2KSQA 1JPUA 1KK1A 1KQPA 1SUPA 2HCTA 2IYLD 3C15C 4TTSA 1M10A 1MPTA 4WT7A 3QSYA 1KU6A 2HAEA 2NW6A 4MLPA 3KOXA 4UDXX 2C88A 4AMGA 1UF9A 2JKYA 4J94A 1RPNA 5DP1A 3UJ9A 4DCVA 1HTWA 1JR4A 3PDIA 1JFSA 5H82A 4G84A 5DN9A 2H00A 1G2QA 2VTBA 3JQ7B 3IHLA 1USGA 2FXVA 5JZOA 3CX3A 3ZDCA 1WRBA 2KYRA 4O3MA 4PXAA 3UG7A 4H0NA 2Q6TA 5A7GA 4H7IA 3PNSA 1RZVA 3D1JA 2YJTD 3JTMA 1LWNA 1W85A 2C4MA 3NLLA 4DA0A 1ID8A 2XOKA 5JRJA 3M6LA 1T26A 3ONVA 3QWFA 5BV8A 4PX9A 4IMRA 3FLBA 3I23A 1GG8A 3LRPA 3HKDB 4BQQA 1O6CA 4Y2JA 3ZS8A 4R5HA 1Z8DA 2V6FA 2O8CB 5FAXA 2OMEA 4LX0A 3BIFA 2BCJQ 4MB6A 4UEQA 2ZJ3A 1SXJC 2H5JA 1UXKA 4KO8A 4K9PA 3ZR4B 3G0BA 3P9QA 1NN1A 2UAGA 1G5PA 2HOQA 2JIDA 3GBPA 2XYGA 4HNGA 5CURA 3V7WA 4F96A 3BH0A 1G8JA 4NV0A 2YRXA 1PVOA 2YVQA 5CEFA 2ZVQX 1D2AA 3EDYA 4IXWA 4IXDA 1Q0QA 2JGLA 3AHEA 3FCYA 4D74A 2AKEA 4FWTA 4W9NA 1ZM4A 3EFOA 3RC7A 2HR1A 2OAQ1 5TQ2A 4UHDA 4YJ3B 3SMVA 3MTQA 4CM9A 2I0FA 3AKYA 1XOIA 5JZBA 1PFKA 5KVVA 3EC2A 1U0OC 5B58T 4C7VA 3LYAA 2BRUC 1CT9A 4G8DA 1JHMA 2I2BA 4XVCA 2Z30A 3ONWA 2W2PA 3D6UA 1F8XA 1GKLA 3N28A 4HDSA 3TTVA 5LP6F 3G79A 3QUBA 2D5AA 5COBA 1P73A 2Q9CA 5E0OA 4AO8A 1N33B 3EGVA 3JASB 3QXCA 4ZOLF 1FS4A 4RA6A 5E38A 3ZDYB 2EERA 2VPZA 4Q47A 5ALJA 1PEKE 4QBHA 1FUEA 1KC3A 3VNBA 2ZSJA 3EAGA 6ADHA 2Z4RA 3QU2A 4R2XA 3KR0A 5KKAA 3STVA 1IWOA 4I46A 4E31A 1H1LA 3AUUA 3JS5A 2K4MA 4WBNB 5HZHA 4A9AA 4DM7A 2LD4A 3TQCA 3CRW1 3G9XA 3MMNA 4UTZA 1U31A 1PSWA 3PD7A 4CL3A 4XWKA 2WAQB 1HFEL 4IYRA 5I8ZA 1XALA 3A27A 4MRVA 2W6CX 1FDRA 3LKDA 3AUFA 1EE2A 4RV4A 1FBNA 1NATA 1AB6A 1R0SA 3I3OA 2VZ9A 2NO0A 4R2LA 5AI9A 3SZ3A 4JBIA 4XPIA 2EL9A 2WAOA 3EZGA 4ZICA 2B4AA 4KCGA 1NW6A 4GO1A 2BGIA 2QTHA 5KAPA 5GIOE 3HBAA 3RABA 3ANYB 1KGSA 5EQFA 2YYSA 1Z25A 1C9DB 3IKLA 1XVUA 1AQNA 1A4RA 2FWPA 2OV6A 4MUBA 2GX6A 3VPCA 4GT1A 5C4MA 1IY2A 4CKXA 1J2RA 1ST2A 3I72A 1U4OA 1L9XA 2QN2A 3MMXA 5AD1A 3QXXA 2GJ8A 3CUKA 3OZXA 5HF6A 3F46A 2NZ8A 4OVKA 4WUTA 2NYUA 1Z22A 2YWGA 3B6JA 1X2EA 4TL9A 4X1IB 4BNYA 1BCRA 1ZM3A 2HIAA 2MSWA 2NO1A 4I4CA 4Q93A 2J5RA 2PMCA 2QUBA 4E4YA 1PL6A 1SPBS 5JWOA 1JHYA 2J5BA 4TYPA 4BLPA 2MT9A 3NKLA 4OIFA 3VR2A 1KJIA 1XZFA 1P2GA 1F1JA 3BMOA 4NJMB 2QYHA 2XXAB 4XM2A 4TSKA 5CM2Z 4QUDA 3ROFA 4GKKB 2DM6A 1MW9X 2QRQA 3HFRA 5F2OA 2JZOA 3WKDA 3E84A 2HQOA 3AHIA 4GX0A 2HWYA 2R8EA 2BN4A 4OQFA 1L7OA 3K0BA 1UWKA 5BR8B 3GARA 1JHOA 4LJAA 3U37A 2YZMA 1G3MA 2EKDA 4FUTA 2FPUA 3QFTA 2A9OA 4O2BA 4N5HX 2PKEA 3GFFA 1MN6A 3Q6MA 2VAPA 1GNTA 3TB6A 3GRUA 5AHWA 1O6ZA 1GIAA 2RH5A 1JTEA 1MZVA 2VF8A 4MS1A 3DBHB 3CCFA 1E63A 1FB5A 4NX2A 2DFLA 1F2VA 2B7CA 3EXG1 4P36A 4II7A 5C5IA 4X97A 2H08A 3A9TA 4WZ6A 1ILWA 3RIEA 1ETUA 1LBTA 1O1YA 2YJGA 5GAJA 4EELA 1V1JA 2DCMA 1R0CA 1XSEA 4KVGA 2VDLB 2FX2A 2HPHA 3D0OA 3L7IA 3PQ5A 4LHYA 4JWKA 4DADA 1CY4A 3GJ5A 4GNKA 1NMYA 2P6PA 2YNMC 1RKXA 2B36A 3MCVA 1RQPA 4IGEA 1SZDA 3S2SA 1VG1A 3CZ5A 1HO3A 3I5MA 3I58A 4M0UA 4KXFB 2DERA 1U0BB 4GG1A 4KSYA 3MAGA 2XYPA 3N2NA 2H1HA 3FCAA 2COUA 2GB4A 1MC5A 1KAQA 3AIKA 3MOIA 4PCVA 4DOMA 3B20A 1P6QA 1XA0A 2ISSD 3OFSA 1AKRA 5G41A 5JSYA 4CDRA 3EZYA 1ADYA 3RS9A 4DWVA 4JSRA 2IT1A 5KKCA 3H2YA 3DGFC 4CMIA 1NXOA 1PG5A 1SOMA 2P3SA 3B3FA 2WYOA 4C08A 4A8JA 5JFGA 1PK7A 3MBKA 4MR8A 3QV2A 1BKDR 2NU7B 4OMFG 3WRXA 1KMQA 2BL4A 4P3NA 1YF3A 3SC4A 1WLYA 4DLUA 3T06B 4QEDA 2C7PA 2JBWA 4J1TA 4B17A 3GPBA 3QFRA 2K6GA 3BGOS 1VPTA 4BMYA 4H7PA 1V96A 3QWHA 4J1NA 3CURA 3IOEA 3QYPA 4YACA 4F06A 2QENA 3IAS1 5DYNA 2WAXA 2ACWA 4YRMA 2C9DA 3HI6A 2BEUA 2ZSFA 3UAGA 3NGXA 5KU1A 3N6XA 3LIIA 4NBSA 1AXGA 3KKZA 3OIUA 4PTLA 3E9ZA 3THOA 1SR8A 3OTIA 5I3CA 3DONA 1USVA 5LUAA 4WXMA 1RC1A 2FPIB 2G72A 1Q7TA 5CT8A 5FWYB 3RC8A 4L57A 2WNIA 2SHKA 4KR2A 2Y99A 1L8XA 4PYLA 5EZYB 4PCUA 1PQ4A 4IH1A 4NDAA 1T34A 1RI5A 1NW5A 2WDPA 3RF6A 1RXYA 1O0BA 1Z45A 1U2EA 4HATA 1K0UA 3NM5A 4LIPD 5DNWA 3WSTA 1Z5NA 1GSAA 4Q3KA 4FI3F 4JXZA 1YT5A 4YRLA 4MUGA 1OZAA 2W11A 4RY9A 1A9SA 1DXHA 1FFDA 2UZ4A 3CT6A 5EUBA 3OIWA 2O8FB 3KXLA 1W49A 1F20A 4Y3UA 4B74A 5KJCA 1LK5A 1J39A 4ZALA 1P31A 1GPUA 2RI1A 3U81A 4ZK6A 4DJJA 4PHHA 4DWOA 3R9KA 5KOIA 4R2MA 2YZ7A 5E4YA 1U8EA 5AQEA 1SZCA 3R7NA 4DNXA 3RDPA 1YRBA 3QKIA 5BWNA 2OG1A 1PT6A 2YZ2A 2ZS8A 4DDTA 3O3NB 1IN8A 1XZHA 5BSMA 5ALXA 1E79A 2WQ7A 5CM9C 2Z4TA 3JD3A 4DQLA 1EUQA 3D6JA 3TXYA 1M83A 1RJFA 3ETEA 3PL1A 4RH3A 2O4CA 2CY0A 2OHXA 4JX9A 4Q3CA 4G1EB 4WK2B 4EHJA 2ARKA 1JAIA 1LU9A 1Y3BE 2ZG6A 1ZVQA 4M0DA 4RORA 1IQ0A 5E95A 5FA5A 3WMXA 1KEVA 5F1OA 2J9FA 2OOKA 1ZN8A 2PD6A 3KKNA 1DS6A 3MINA 3MWLA 3OZIA 2VEOA 2V0CA 2PUWA 3E2MA 3FKQA 3MIIA 3WXMA 1P0FA 1OSNA 3HP4A 2XZOA 1ZC3A 4J75A 3HYRA 4H1UA 4G86A 4DEXA 3LY5A 3CUSA 2QL6A 3SM9A 3GPDG 2C8VA 4OJQA 5FA6A 4F8JA 1RLTA 3ED5A 3T3DA 4IHKA 4N12A 1BYIA 3H9GA 5BO5A 1PYGA 2ZYIA 4N03A 5D6NA 5K0NA 1UDRA 3OJXA 2YFHA 4HKTA 5PNTA 3PA8A 1X7XA 3SVLA 3E15A 1CPYA 2YIVX 1R8YA 1M34E 2H1CA 3BQMB 2RI0A 4GRDA 4ZVLA 2AMYA 4OH7A 2BMWA 4HVLA 5FBWB 1P4HA 3Q3HA 5FPYA 3VJMA 1N2JA 3UJDA 3LT5A 3ZJYA 4CG1A 3D0QA 1DOAA 3UTCA 4E5KA 1PDOA 2EFEB 2X76A 3UT0A 4ZZ1A 3NEYA 2XDQA 2P77A 1L0BA 2CUKA 3I0MA 4J2TA 2D1TA 3IEUA 5LDGA 4BLSA 2XWBF 4NATA 2M2IA 3K8QA 3SQMA 3CW2A 3SJCA 4ETMA 1T9DA 2ZYHA 4QUAA 3L77A 1OWNA 3VHRA 2GJ9A 2WE7A 5GY7A 5JG7A 5LPNA 3EIQA 5DX1A 4XTRA 2HA6A 2V7BA 2YJ3A 1J1UA 1R4NB 1W52X 4AZVA 2GI4A 4TWIA 1YGYA 6GPBA 4LDAA 2QP4A 1P4GA 2Y1CA 2OUIA 3VDRA 4EGAA 1SCAA 3O90A 1IHYA 1YVPA 1ZJ6A 4ZHQA 1G8MA 1T0HB 2QTLA 5DHRA 3ABSB 1ECPA 1E6MA 1GZ7A 2H3EA 1NVDA 5LWQA 4LJRA 4TVKA 1KZYC 2G07A 1N2CB 1ZM9A 2VDVE 3D54D 3ESCA 2H2GA 3G49A 2OBMA 3H9UA 1Y1RA 4QD3A 5CJPA 3UGKA 4V1CB 3TPCA 3ZQ6A 1J00A 4IH9A 3OZEA 4MVXA 4OREX 4F8EA 1NF8A 1TAQA 3CG0A 2IGTA 3NEJA 4GL4A 4LK3A 4OUKX 3ZBTA 4PVDA 1P2VA 2HLDA 4MJ3A 5ETJA 3RJ9A 4DB2A 2F9LA 1AOXA 5BVGA 1EG2A 1RM4A 1BDJA 4M1TA 2QE7A 3BMNA 2VSQA 4P7KA 3KL2A 4IUCS 1DXOA 2ZRNA 3A8TA 4LJLA 4JXKA 4OP2A 3UJNA 5HVNA 3SQLA 4DL9A 1P77A 5BPFA 3N3BC 4REQB 2ROQA 1QGOA 4YPVA 1KVRA 3LBAA 4C4PA 1AKNA 2A2ZA 5K3EA 2QVLA 2ZJ6A 3CN7A 1ZI6A 1XQ1A 2ZJ4A 3LZCA 4KR0A 4M87A 5K8TA 2E2JB 2Y1LA 2HDNB 3FYSA 3HWWA 1MOZA 1XDWA 3SIWA 4U7TB 4E5PA 5BUQA 1Q50A 2OV8A 4AO7A 2F1JA 3VYTB 3DC7A 1RS0A 2QM0A 2WJWA 4G85A 1RSZA 4PPFA 1VJ0A 2Q50A 1HE2A 3S2UA 1DEKA 4DSNA 4DMGA 5JWRA 4CN8A 1M8FA 3K9CA 2ZWIA 3DT9A 2QWXA 4TVOA 4ESVA 4U2KA 4FGLA 4FFOA 4F71A 3C3WA 4EECA 1PFVA 2FVYA 2GEVA 4R8SA 2DQKA 3IBSA 1CB7A 2SKCA 3IV9A 2H18A 3B6KA 5E7QA 2PMEA 1OT3A 3NXSA 3C98A 3W5IA 1KYWA 3TRIA 4CM8B 3AOEA 4XCQA 2DFDA 4MI6A 4UVDA 2BFDA 2XB8A 2PWAA 1LV7A 2BFCB 2DUWA 2R8ZA 3ZDFA 1VMIA 3SC3A 4BVEA 5IXYA 3C1TA 2WR8A 1IRIA 3HO6A 1AK9A 3HADA 1BOFA 2L17A 4F4CA 3DWFA 1QLHA 1ZOSA 2WJ3A 2UVDA 4KVAA 1HDEA 1E1MA 1L4KA 4QULA 5J4HA 5J2TA 3OWXA 1QO9A 1QC5B 1HMPA 2ZJ5A 4CPDA 1EDDA 3E3OA 4L6AA 1C0EA 4EO4A 5IYZB 4TWBA 4EF4A 3PEWA 1W581 3SHOA 2R85A 2HMVA 1C4OA 3S7TA 3WZ2A 4IUYA 5THXA 2IP1A 3AR8A 3DM5A 4GBED 5CB8A 3GO4A 5G2OA 3TEJA 1Z4JA 3TL6A 1OOEA 1SAYA 2QN3A 2XTMA 1AHPA 1Q7EA 1T0IA 2JJQA 1GCIA 2PH5A 2QTBA 4HVCA 2N1BA 1SCKA 3PXDA 3RUPA 5ILOA 3M1LA 3VX4A 1Y8RA 2ZAGA 5F2EA 3SGLA 4MYUA 4C4OA 3KD3A 1S89A 1MX5A 1BGVA 3N76A 4OHXA 2YHIA 4OHMA 3U7JA 5HF5A 1P1HA 4JT2A 4CM4B 1JEEA 1BAPA 2ASEA 2O2HA 2O2JA 4QNRA 2VHEA 3NHJA 3PZBA 1KQOA 4LDQA 2X9GA 1F5SA 3C8MA 3UCEA 3KE8A 1NLZA 3GA7A 4RXTA 4Q7JB 4IWXA 4HWTA 4YA6A 5D3ZA 3ZHXA 3BA6A 1AG9A 1E3EA 4I81A 1P7VA 1P4AA 2Q28A 3K9NA 5F4BA 4M9ZA 2X9NA 2BGMA 9LDTA 5K6TA 2IH2A 1R9NA 4DLYA 4UREA 4ZAVA 1CP2A 3S2IA 4YV1A 3JR3A 4JP2A 2G6BA 1M33A 3DXYA 1TPYA 3DDNA 4B2PA 2QAGB 3SYRA 3ZUGA 4C0SA 1WKBA 2XGGA 1ECFA 1L5SA 1UP4A 4FHEA 3QPBA 4BN0A 1T5IA 3K0AA 3W1VA 3ELDA 1Q0LA 2OM2A 4JLVA 5F2NA 4LA4A 3D8SA 4URZR 4WLOA 5BOVA 4IDQA 1VFNA 3D2BA 3W6OA 4DKXA 1IN1A 3LHKA 2NO7A 4IVPA 4QXAA 3TBKA 4Y2QA 1JJIA 3EXEB 1EQUA 3O2JA 4B80A 3G7NA 1PSDA 1A77A 1PTKA 2YQZA 5EWLB 1UKEA 3TRDA 5BWLA 3A0UA 4E1AA 3VSCA 1XMOB 3FJ1A 1WAMA 3N2YA 3PHHA 3UMSA 4BWGA 1VE9A 4C3VA 2DFVA 5A04A 1DAMA 5I51A 5TRTA 1E5XA 1YHYA 2NQ2C 4M8NE 3ILHA 4JC4A 4DBLC 3DDOA 2IKQA 4Z4GA 3IA2A 4B7UA 3OY7A 1NF2A 2WHQA 2WIAA 1QCCA 4IIJA 1N2HA 3PHBE 1XXLA 3CZQA 4RKQA 3ZD8A 4D92A 1LKZA 2O2GA 5IG2A 3ZU6A 1M2OB 1ZQ1A 4EB6A 2ENWA 1CC1S 5I7EA 1A8SA 3U7HB 3GFGA 3HVIA 2E1PA 2BR4A 2QPOA 1Z8HA 2VIIA 4ND7A 4OMDA 4RA6B 4UQOA 1J22A 1JSXA 3L1UA 3HPRA 1P1RA 3SX4A 1AMOA 2EDAA 4ENWA 3S0JA 3M6AA 3DLBA 3KSAC 2E4ZA 3WI7A 4E5MA 2D6FA 3KOUA 4PSDA 1Z4NA 1YUBA 5I7UA 1GSIA 1PKXA 1X0XA 3WDLA 4JD5A 2H8KA 4K88A 4CKWA 2CFOA 1J25A 1N9GA 3IX7A 1QFXA 3TJMA 5B2EA 3FPAA 5EZSA 3VR4H 5F73A 2QX9A 4FZJA 4GKVA 1HZZA 3A1EA 3BRSA 3BXOA 5ERXA 3FG9A 3NV7A 2QHXA 1IOZA 1BIFA 3QVLA 4G0ZA 4E3WA 4CL2A 3ZDQA 1FFXA 1LDGA 3MCTA 1GOTA 3A10A 3PTZA 4HAUA 4PHFA 4UAGA 1MX3A 4TT3A 2E4VA 3QM1A 4H7EA 1DDGA 1P0IA 1YUMA 3ENWA 3JALA 3I28A 4QDZA 5HKBA 1W2GA 2IEDA 1MGOA 4P31A 2FP4A 1XQWA 2LCIA 2YIMA 1Z16A 2Y05A 2H06A 5GOZA 3OURA 1E0SA 3RNOA 5KVSA 4CQJA 4DUZB 3EH2A 2H4HA 2QT9A 1M7GA 5DWVA 2QUHA 1GL3A 1WU7A 2RGEA 2X13A 3G2LA 4CLRB 1M5TA 4HG2A 1Z56C 2F2TA 2NQTA 3OWHA 1VE5A 4DE5A 4Z7QB 3EXFB 3WWPA 4K9MA 5KSZA 2V55B 4LGMA 3OF2A 1US8A 1OIVA 1STOA 2AEMA 2AN5A 3G0GA 4D8UA 5F5NA 3L92A 2YKGA 1IZYA 2W83A 3R20A 5C52B 3TAHA 4BNJA 4IIUA 1Q5PA 1RYHA 3C4VA 4HAOA 2ZK7A 3WMWA 1OFVA 1HE8B 4MYTA 4LMAA 4ENRA 1CNEA 2QJOA 3RFXA 4ZYYA 4MQUA 4CEHB 3BT7A 2IOQA 3AESA 2O2CA 3AEXA 3R24A 1WKCA 2W00A 1U7XA 3X1XA 2CBZA 1ULZA 2IW1A 3GFRA 5ED0A 4YECA 1WUIS 3OZVA 4UATA 4DRXA 2WZBA 3VNUA 3QG1A 5BW4A 3BGWA 5E3JA 4B45A 1GG2A 2IIPA 3INNA 5ALIA 4A3EB 5FI0B 4W9NC 4JY7A 3U44B 2D2FA 2IYSA 1TAUA 3AF1A 2ZANA 3DYVA 5DM1A 3HNRA 2W6MA 3RU2A 3T4EA 3T5GA 1NPYA 1DC6A 2IUSA 1MEOA 2OTCA 2X8JB 4HMQA 3A6KA 4YREA 1K7SN 1VPVA 4CMGA 4G6ZA 5ESRA 4HQKA 3LQKA 1EP1B 4K9SA 1ZAYA 4BY1B 1DCMA 1PT7A 1D1SA 4BVJA 4ZI7A 2GK6A 4GXRA 4JI1B 2OHOA 5DJ5A 4P32A 1KVSA 4KOEC 2AC7A 5JU6A 2X2PA 2PH3A 2O06A 4A10A 4CU2A 2PGOA 2JA7B 3TLYA 5DYIA 3GUUA 1KFCB 5EL0A 4DLAA 5JIBA 4CN9A 5FUYA 4A3BB 3GQVA 3F7NA 5ALMA 5JCJA 4EZBA 3FUVA 3O8OA 1H93A 2NUPB 2F1IA 3O1IC 3PQEA 2WF8A 1Z3CA 2F3UA 2GJAA 3RVRA 3TJZA 3WG9A 1Z0UA 4ZO6A 2HNBA 1MG0A 5T57A 4EY7A 4HYTA 1TKBA 1YNSA 4I50B 5TXGA 1TUBA 2NU8B 5TARA 4N8EA 3ZUPA 2EWVA 3GJQA 3ZIUA 3BQNB 5T4FA 3TNFA 2PWBA 1H9BA 5KNDD 5K3CA 4JIMA 4U9HS 3GTGB 2JCSA 1E2IA 1P1CA 1CJMA 1JIVA 4F84A 2HNAA 1KJNA 1X86B 2R60A 3B1FA 3LT1A 5KQRA 4IX9A 4P3XA 1ENPA 1SG9A 3EZLA 3SF8A 3OCYA 4WDQA 5HPYB 1E2NA 1Y7LA 3TECE 3KEOA 2FF7A 5BSRA 5EJ7A 3EEFA 1UBFA 1JDVA 1B0UA 2LKDA 4DXDA 1H2AS 3P5BA 1EFRA 1DBPA 1BMFD 3QPVA 5BN3B 2MYNA 1LW6E 3IXQA 2FN8A 2V7UA 5LZ7A 1L5HB 5JCOC 2GPNA 2YJNA 2I4NA 2OG2A 4I7EA 2E85A 2FE1A 1ID1A 2W2LA 3P9SA 2PD4A 2ZSEA 5GM1A 1HQYE 3JQGA 4ZI3A 2XMSA 1L7BA 1VHWA 2QUJA 3F7MA 3HBLA 4CCYA 3G0IA 5IKOA 5ADUS 1P4RA 2WWGA 5AI8A 1BE1A 4NOKA 2VOEA 3ICOA 4MHSA 2W98A 4ARIA 3PFFA 4E12A 3AYXB 4J29A 1CZKA 1PJ4A 5IT5A 3SY8A 4D2IA 2AMLA 4WW0A 3K09A 2Q1UA 1E99A 2WU0A 2RIRA 3M5DA 3WB0A 6NULA 1H2ZA 3JATB 1FEZA 3KTOA 1W73A 1KY4A 2X58A 4Q7EA 4WLEA 1K9VF 2BC9A 2ZUTA 5LU8A 4RHCA 1KXZA 3V2GA 1NQTA 3ZE6A 4OGWA 1KPGA 3LC1O 2NVQB 3K0KA 1KQGA 1E9SA 1XXHA 3GUHA 4LX8A 1U2DA 4OL0A 3D0KA 4QE3A 4CF6A 2FZ5A 1V6AA 1TECE 5A4FS 2PX0A 2C78A 3P0RA 2UXCB 3EZNA 4YBZA 3EFEA 4IMPA 4HLUC 1U8FO 2MINA 3MD9A 5E1BA 1RRMA 3A31A 4DMLA 5TQ0B 2SKEA 4HB3A 3O21A 1UDXA 5DDIP 2AA3A 3AHGA 4IDCA 4R0VA 4ER6A 5KHLB 1DJOA 4R40A 4X1OA 4CQMD 4CV0A 1N5DA 2I6UA 2CK3D 2KJQA 3N8DA 3AGPA 3OU2A 5EAIA 4A3IB 3MBOA 4QBKA 2B1IA 1RTKA 3KV3O 2X0JA 4S1OA 1B16A 2QTMA 3QVVA 2JC3A 4LMBA 4NPAA 3TEFA 1B14A 1MVOA 3TNJA 4KFUA 4TSRA 2JI8A 2VPIA 1WCWA 3K6SB 4BX8A 5B1YA 1Z4KA 4XSVA 3S16B 1GP2A 2DSTA 4GRIA 5CUQA 2W93A 5JCOA 1SVNA 2G4LA 2RONA 3CBGA 4BWYA 3RJMA 3G9QA 2JLZA 4Y2RA 3OZDA 4P3KA 1VSTA 2GHIA 2VUIB 1Z5VA 2JFHA 4S35A 5AVOA 1G16A 3QX7A 4L27A 1LC3A 4FR5A 4AY4A 1T2DA 4ZQIA 3EOBI 2QMYA 2IQIA 2H9IA 2P27A 2Q5LA 2QROA 3B7PA 4O8ZA 3ELWA 1ULSA 3I6QA 3KEFA 4JH0A 1TTTA 5I01A 4FZRA 3W05A 4YJGA 4GMDA 2Y8EA 4X91A 1V7CA 1Q22A 3LL4A 3TRJA 1FDVA 1OX4B 2HSWA 2JBAA 3QLVC 1JWAB 4N3NA 3UAYA 5CFNA 4D3ZA 2XUJA 2O8VA 4E21A 4RVDA 1ZBQA 1YHZA 3GA5A 3DFKA 2FUCA 3F8WA 1NBMD 3I2JA 3IUBA 4B8ZA 1I2AA 2V7VA 1WEKA 1FDOA 1HYHA 1R4AA 1U5BB 4LBYA 2QS9A 3L43A 4Q4JB 1LBEA 1K4MA 1FQJA 1WV1A 2JFNA 4YMHA 3AB7A 1TO1E 4KO1S 4MIKA 4LFCB 3D8RA 4TTQA 4DLTA 4S24A 1NDQA 3ZZMA 3A6FA 5AJXA 5JADA 4KLAA 3K6JA 1NBHA 2DH6A 1B6SA 2Y1XA 1Y7TA 1KY5A 4YUAA 3O6VA 2EKZA 1C0LA 1NYLA 2ZRJA 3N5KA 2PSHA 3S28A 3F5QA 3UFXA 3ZBQA 2IS6A 4Z53A 5JJIA 3FVRA 5AI5A 3F98A 1L1RA 4KH1A 5AHXA 2HXYA 4WEQA 4CMKA 2CZGA 2HJRA 1ACJA 2A3RA 4MS4A 3IKVA 2PA0A 4ZVRA 1L5NA 3ZCXA 3WNZA 4URHA 1Y3IA 5EYPB 3LDFA 1CHNA 2X7HA 3I92A 4YUXA 2DTEA 4FEGA 4A3JB 2VPQA 4KNWA 3AUSA 3M3PA 3ZIDA 5FH9A 3NTRA 2F67A 1C3OA 3FGOA 1V3QE 1YS6A 2O9JA 5BMOA 3AKCA 3S3TA 3SIRA 3C16C 4ALIA 4PPGA 3NB0A 4HRAA 1NM5A 3L8HA 4KVZA 1DT5A 4R5MA 1YDWA 3NHKA 4MUHA 4OP3A 3HUTA 1GO2A 1UC8A 4HNRA 3TIVA 1D1QA 4JR2A 2E18A 3I2GA 1UMBB 4R41A 4UFNA 2QVXX 3EDQA 4CZ2A 2O7NA 1P7ZA 4EVSA 4J0JA 1VXOA 3BGVA 3HL4A 1Q7GA 1T2VA 1UANA 1Y81A 2JGDA 2E9SA 2QRNA 2Z8ZA 2ZDGA 3E5NA 5EWMB 3R76A 1X19A 1J99A 3UMCA 3ZIAD 4N5IX 1F7VA 4TUYF 1RIIA 4RHYA 2TMYA 2H16A 2C1XA 4U9IS 3DE5X 4DGQA 1PD1A 3T9EA 1EWYA 1QLJA 4UMVA 5FUQA 3NWPA 3ZHBA 1CR4A 1GU7A 3IQEA 4OJMX 5JI2E 3K70D 5HKAA 4ENVA 3CNNA 2FEMA 1I6LA 2F3QA 3BREA 5BWMA 1I2CA 4RNDB 4ARAA 5KUTA 1QU3A 3DAYA 2G9RA 1U6IA 2V54A 1WL8A 2FSHA 1UP6A 1VLLA 3HA7A 4OI1A 3DMHA 3JQCA 3VPFA 2DHDA 1ZM2A 4ONEA 3FOBA 1KI2A 5IX8A 5FYDA 4Y0VA 1ZSNA 2P11A 3DWGA 1E69A 2X77A 4N0QA 1TJ3A 3WK9A 3G82C 2AX3A 3DBHA 1FFWA 8ADHA 1BEUB 1CIPA 3N8HA 1H0RA 1C2TA 4WLFA 2CB9A 3GPLA 5F12A 1CR0A 1HRDA 4CUJA 2Q5OA 1YL6A 2P8SA 4JGIA 3EQZA 3HVHA 4BE9A 1FYVA 2C9CA 3GVXA 3MQ4A 4Q9NA 2J4FA 4JA2A 2NGRA 1EUZA 1GGEA 4H18A 1FSPA 4GMFA 3OZAA 1PX0A 1NXPA 4YP7A 1S2IA 1N7HA 2VJNA 3GCDA 3WL5A 1VSQA 3R74A 4CV1A 1P2UA 3P9ZA 4IJVA 1MW8X 3NS7A 3ROMA 3RANA 2QYTA 2UXBB 2XSZA 3GZ4A 2OVBA 5FL7A 3VV3A 1PL7A 1WXEA 4TYYA 3FPSA 1P0CA 4B2YA 5FULA 3PD0A 4I9NA 1S4MA 5CNIA 1KOLA 1VP3A 2A8YA 2AK2A 5JDIA 1HT3A 1VKHA 2IGBA 3EGXA 4INOA 5E9WA 3RG8A 3AF6A 3D59A 4YAJA 2CDCA 3MWDA 1W47A 1UT5A 3HEBA 3LT4A 1WCV1 4PQFA 5AW3A 1O94D 1DKNA 4QRHA 5CYFA 3ROQA 1D1TA 1VQ1A 5I7SA 1M5RA 1QQBA 1XTRA 2JHFA 4MR8B 4QJ5A 2I6QA 3OOJA 1Z8NA 5KOHB 4DCPA 2IF0A 1T35A 1O95D 2IXBA 3BGIA 4I99A 5AM1A 3CMMA 1NNLA 4PYIA 4EJSB 4X65B 1T9GR 2IDJA 3G9UA 2QJTA 2C61A 3TM4A 4OYHA 1XIVA 2O7QA 3QXHA 5FWXB 4B3MB 4DM3A 3GD5A 5DHFA 1CJKC 1L7QA 3FW1A 2HSEA 3OPNA 4IDPA 3F6SA 4PSUA 3ICEA 4C6TA 4UJ3A 1CJCA 3T3GA 3EGCA 1IAQA 5KNBH 1SUEA 4IIVA 3VDMA 4C6HA 4CVNA 1P5RA 1RHMA 1TAGA 3T0IA 1IZZA 4QXRA 2XZPA 4LDNA 1G9TA 1K8XB 1Q83A 2J9ZB 4E3ZA 1L7PA 4X6UA 4Q4HB 1L4LA 4L5YA 1ZDMA 3IR7A 4KE6A 1CD5A 1C9YA 1RWBA 1ZA1A 2YHSA 4MDHA 1W8DA 4OXRA 1OYOA 5BN4A 2E89A 2VP2A 3TGWA 2W2OA 3X1DA 2NSJA 1HH4A 4BZXA 3L9WA 5AW4A 4FPXA 4DIEA 1L6RA 2ZJZA 2O4UX 2PJRA 1QHEA 3HC7A 4N3AA 1UPUA 5A0VA 3E4DA 1T6XA 3PNVA 5M5YB 1DAFA 2YDXA 4F04A 3TG8A 2MCFA 2XE7A 1JIKA 4D43A 2I3BA 4S2UA 2GM4A 4M0FA 3MAJA 4BVBA 2ZQYA 5BWOA 4R84A 4MPTA 4J0GA 3NFRA 3A0RB 1UEJA 4JXXA 1A9XB 2G4VA 3CGWA 3N2ZB 1ND6A 3MMZA 2IU3A 3OHMA 1GYQA 2HW8A 1QH0A 4QLBA 2OD2A 1IUOA 5U1PA 3TQSA 3V8RA 2PGIA 3EUWA 2X4IA 4MO2A 4LJKA 1LPBB 1E8MA 1MB0A 1V11A 4LECA 1EGVB 4MW0A 1SUFA 4QDJA 4RUKA 1E98A 4DR5B 5BN3A 3RM3A 2ET6A 3ADPA 1GZSA 4H0CA 5JS7A 1OR8A 1E2JA 3N0WA 4IRXA 1OILA 4JP1A 1C29B 4K87A 5DASA 4NRDA 3SLRA 3ZG6A 1RZUA 4ZN6A 3UN1A 2ZT6A 5AVZA 3K09C 3KLBA 4X8MA 3RNLA 5A5VA 1MQSA 4PE5B 4U4AA 3FBTA 4Y9UA 5CVUA 2HA4A 4Z9BA 3ZW9A 1TT5B 2JATA 2WU4A 2X8BA 2A5GA 4DTIA 4PG5A 3RZOB 2YL2A 4DBVO 3DEZA 4QLAA 5DMXA 5B3LA 3PRKE 2QMOA 1I7PA 1YR8A 3R3SA 4US0R 3V55A 1RXVA 5DM60 1OJLA 3M6MD 2PZFA 5M04A 5EJEA 4I4LA 4WADA 1OY1A 4MV3A 2ERXA 1ZLXA 4XD7D 4EHLA 5L51A 4DV3B 3LO8A 1PW5A 2Q45A 4U3JA 1D5CA 2A88A 2FQYA 3DLAA 3HXTA 1UAYA 1P75A 2F1OA 3DZFA 5EWJA 3TRHA 4A3KB 3DZKA 3VKVA 1BDMA 4WCFB 2PNFA 2C4KA 4OFWA 1UM9A 4UCXA 3TZBA 1QQ5A 2Q6VA 3HLYA 4EAAA 1N2CE 4L0MA 4N82A 3ZEIA 2FP3A 1P4JA 4ZZ0A 3JAMA 2FMTA 3KKPA 4N5DA 3THYB 3L4JA 1XRSB 3EFBA 2WJ4A 2OO5C 5B2ZA 3URKA 1XPRA 1FVHA 3CUTA 3W8FA 5A06A 4LE0A 2CUTA 3CVVA 3D4LA 1G6KA 1N0IA 2G09A 2OM6A 5IUKC 4NTZA 4DIFA 3DBLB 1QV7A 3OBIA 4NMHA 2FWAA 2EP7A 1XZCA 3N1UA 1RQNA 2ZVDA 4L7QA 4R05A 4CF5A 1JEYB 2VBGA 3DHEA 1T3HA 3GAZA 2UYYA 1D4FA 1AA6A 2CMFA 1MA0A 3W8NA 3LWZA 4R7GA 1JDNA 2QZ4A 1EGHA 4ML3A 3NMUF 4JYCA 3JQAD 5IXSA 2QVGA 3TLZA 4EATA 4BU1A 1ZR2A 5EZ5A 3LLVA 3HMQA 1M1YA 5F21A 4O63O 3HNPA 2VJPA 2H4WA 1P19A 2GUWA 3KOMA 3R9XA 2Q21A 4QDTA 1C9JA 3D4NA 3T95A 3L06A 1U7HA 5T3UA 1N2GA 4BNTA 1K5PA 2PV0A 2G70A 4XOUA 3ZGYA 2XTJA 3H2HA 3T4XA 1SA0A 3BB3A 1FRZA 821PA 4OHVA 2WY2D 3IT3A 3RLFA 4TMXA 1VYUA 4XWOA 1CX9B 3OEEA 3RK4A 2Q3DA 4ZAZA 2GCOB 1TWAB 4ZEWA 2IHUA 5GONB 3CVWA 2DFNA 1M2EA 4M1MA 2ONKA 1F2TA 1PFUA 4DQUA 2KM1A 1KOFA 4IM7A 3K05A 3QBDA 4MVJH 2ZZKA 2EG9A 1LXCA 3BULA 4INZA 5IJ0B 1W4LA 3PD1A 1AUVA 1RYNA 3IALA 3DP7A 1ODTC 1ZS9A 3JQAB 3KTAB 1QF7A 4LZPA 4R1UA 4CLHA 2E4XA 2F3PA 1V5EA 2JFUA 3H8VA 5GPBA 3NBZC 4BIIA 1SK8A 2M1XA 3C5CA 3AF2A 1O77A 3F4LA 1YS1X 2Q5CA 2YXBA 5GJWC 2IZ7A 2N1MA 4JFAA 3FHLA 3EVAA 1R9JA 4GZ5A 3V4PB 4EHIA 3VOTA 2MYPA 2TMKA 2A7QA 1Q44A 1MD9A 1YR2A 3EC7A 3Q8XB 4AT1A 2FETA 4D3XA 5K0TA 2Z9CA 3IUPA 3LBYA 2J3KA 5LYJA 5P8WA 4P92A 3SIPA 2FZVA 5J2TF 4BLUA 3L7CA 3F6YA 3GRFA 4WFJA 1HTBA 1FC0A 1G8AA 1I6KA 1N0WA 1YK0A 1ZVMA 2QRVB 3TKYA 1DRKA 5JNWA 3T3IA 1PHRA 3FYUC 1N2EA 3GUZA 3HJTA 4BUJA 1AGYA 4BMXA 5JMPA 2OGSA 1EWTA 1M0EA 4IICA 4QOFA 5JH7A 2GEDA 1G59A 1NMEA 4FQ8A 1ZG3A 3RSHA 2A4KA 4QTYA 3QNMA 3FFAA 2YOGA 2OFOA 2W5UA 1PU2A 2J67A 3H2GA 2HNKA 3WJ7A 1L7MA 4LRWA 1OHHA 2G0AA 3K30A 2VUUA 1O2DA 3FDJA 5CBKA 3PC2A 1RRVA 3PNBA 3GLHE 4KMMA 4R2JA 4PQRA 5DVZA 1H4QA 2NZXA 1F4PA 1VI2A 1QIHA 3JQGB 3P9RA 3CX6A 4YJHB 2GT1A 3CTMA 2ZTSA 3I8XA 3PYLA 4A0RA 3DLHA 3DL2A 2IVZA 4LRSB 4IO1A 2YUTA 3DAGA 2JCGA 2R47A 3WGOA 1Q1BA 1O96A 1U0FA 3H6HA 1MAAA 1K1EA 2P6UA 1DDIA 1G7TA 3QIAA 4MITA 4XJSA 3VU1A 1U2TA 2BKUA 3QUSA 3OCXA 4O4LF 4G0OA 2PVSA 4YAUA 1Z35A 4YRPA 3DAOA 1CEEA 4OD0A 4TQGA 16PKA 4IH4A 3PNKA 1RWPA 5HM6A 4YCSA 3KRTA 3BHIA 1UBRS 2R8PA 3MC1A 2JH8A 3KB6A 2HDWA 4D9HA 5F52A 1C3VA 1B0PA 1K98A 2IHZA 1Y8RB 1DPGA 4HGRA 4OTZA 3UCXA 1HNXB 5JISA 1V95A 2ZITA 4IJUA 3SZOA 4LUCA 4TXMA 4MW5A 4WSOA 1JLRA 4ZIRB 4QPZA 4ZJPA 5BSHA 1J7JA 2VYFA 3CKMA 2HHCA 1L4GA 1DAEA 2ZTUA 3KSDO 4EFMA 4QNNA 1B3BA 1NQWA 3AIOA 1T3SA 5LP6A 1Q21A 1M1NA 1QJCA 2FPGB 3EIHA 2CNBA 4OQPA 5TS3A 1HQDA 1WIWA 1RMQA 1XAGA 3RJTA 1OI7A 1OZGA 4KSBA 3ZCQA 3NH6A 3TOZA 2Z08A 3TFOA 1RIFA 4YRBA 4REOA 2IUYA 1LVUA 2WF5A 2E2WA 4ZARA 5B1SA 5BY2A 1LLUA 2Z3VA 3VR5A 5IXJA 4HDNA 4QGAA 5TSDA 3U7QB 2Q5IA 2DQ4A 1PZHA 1QORA 3O74A 5L7TA 2J3QA 4RPCA 2Q6OA 2XIQA 5EIXA 2C3MA 2R44A 1HE1C 3BRQA 2PIDA 4D6YA 3BDAA 1KVUA 4OXYA 5LA6F 3C5VA 1YBHA 4PV7A 4TLMB 4D9KA 3KBOA 3L4SO 4H6WA 1QLWA 3A36A 5AM5A