1WR8A

Crystal structure of hypothetical protein ph1421 from pyrococcus horikoshii.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
230
structure length
230
Chain Sequence
KIKAISIDIDGTITYPNRMIHEKALEAIRRAESLGIPIMLVTGNTVQFAEAASILIGTSGPVVAEDGGAISYKKKRIFLASMDEEWILWNEIRKRFPNARTSYTMPDRRAGLVIMRETINVETVREIINELNLNLVAVDSGFAIHVKKPWINKGSGIEKASEFLGIKPKEVAHVGDGENDLDAFKVVGYKVAVAQAPKILKENADYVTKKEYGEGGAEAIYHILEKFGYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoglycolate phosphatase
publication title Structure of a haloacid dehalogenase superfamily phosphatase PH1421 from Pyrococcus horikoshii OT3: oligomeric state and thermoadaptation mechanism.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 85
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 3.1.3.18: Phosphoglycolate phosphatase.
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1wr8A01
3.90.1070.10 Alpha Beta Alpha-Beta Complex Hypothetical Protein Ta0175; Chain: A, domain 2 Hypothetical Protein Ta0175; Chain: A, domain 2 1wr8A02
3DDHA 1Z4JA 3QU7A 3ZI4A 3I28A 3L8EA 3QU2A 1RQLA 5AVSA 3ZTYA 4EX6A 1Z5GA 1T5SA 1ZD5A 4AP9A 2IYEA 5AESA 5AVUA 1RC8A 4AS3A 3OTQA 2B1QA 1L7NA 2G07A 1T9ZA 2HSZA 5IT4A 3VAYA 2JARA 3AR7A 1YS9A 2WM8A 3QLEA 3W5AA 1NF2A 2MSNA 2PR7A 5AI4A 1ZOLA 2C88A 4XE5A 2FPWA 2YMMA 3OCXA 4NV0A 3RF6A 3HLTA 2B82A 3I6BA 1WR8A 5ALNA 3L0YA 4EELA 2Q5EA 1RPZA 5AI0A 3QGMA 2YN4A 5AKYA 5AK3A 3OCVA 2W4MA 4Y2RA 1CQZA 3B9RA 4I9FA 1U7PA 5ALRA 1EK1A 2WHEA 4KX5A 3SMVA 5AW0A 2CFRA 1WZCA 5AM0A 2YBDA 3MMZA 3NASA 3FPSA 4MUMA 4EEKA 4PNHA 5AICA 3WGUA 3ZW7A 3W5DA 5ALPA 3ONNA 2NO4A 3PCTA 3ZTWA 5AK6A 1ZRMA 1RLOA 3QXGA 4Y2PA 4FYPA 4CF3A 3N1UA 2GO7A 3D6JA 1L8LA 4UW9A 2ODAA 3U7HB 4G9BA 4UMEA 3AR9A 2X4DA 4YCMA 2WF7A 5AM4A 1QYIA 3UMCA 2I33A 3OCUA 4UARA 1IWOA 3FGOA 4I9GA 5A3QA 3OPXA 5AI9A 4KNVA 2CFSA 5ALHA 4ZEVA 3WK8A 3S6JA 3WKCA 1Z4PX 2FUEA 4YCLA 4E88A 5AW1A 1LVHA 2FDRA 3MN1A 1Q91A 3A1DA 4FFDA 3EF0A 2ZXEA 4GIBA 4KNWA 5AVZA 1L8OA 5ALDA 1RMQA 3PGLA 2YJ3A 2P69A 1QQ7A 3E84A 1Z4KA 3IRUA 2FEAA 4OHFA 1TJ4A 1QQ6A 3CNHA 1EK2A 3MC1A 2ZBGA 4UASA 1TA0A 1L6RA 5ALXA 3EWIA 3L0CA 4UMDA 4CF5A 2G09A 1N8NA 3FZQA 3ESQA 2HHLA 1RMYA 2R8XA 5ALFA 4QJBA 1ZD3A 3TLMA 1O08A 2GHQA 3W5CA 1Q92A 2GMWA 3SKXA 3AR6A 2IOFA 3WKDA 2W43A 2P11A 3AR4A 4RESA 3E81A 4BX0A 1RKVA 1L7PA 3ZVLA 4BBJA 1Z88A 3N5KA 4O8CA 2OYCA 4OCZA 5AKHA 1YV9A 1RDFA 2QLTA 2YY6A 4BYGA 3OCWA 2B8EA 2YMLA 1RLMA 4L6AA 3F9RA 2FPRA 4DCCA 4UM7A 5AVVA 4C4TA 2ZBFA 2NYVA 1YJ5A 2C9MA 4Y2JA 1KYTA 1SU4A 5T41A 3KZXA 3QYPA 3M9LA 4XPZA 3ESRA 3NRJA 1F5SA 2G80A 2RBKA 3QX7A 3GYGA 2WFAA 3FM9A 2QYHA 4L6CA 2EAUA 2JAWA 2GHTA 2Q4TA 1RKUA 2B8JA 2C4NA 2FPUA 2G06A 3PDWA 4RETA 3HYCA 1Z4NA 5AI5A 4BKMA 2IA5A 1T5TA 5ALOA 1ZD4A 4XOUA 3R9KA 3KOOA 3UMGA 4C4SA 1ZS9A 2YJ5A 5AI6A 2DQSA 5AI8A 3RFUA 4JDPA 3SHQA 3N28A 2AH5A 1WPGA 5ALTA 4BX2A 4NFLA 3A1CA 5ALJA 2VKQA 3EPRA 1VJ5A 2HF2A 4C4RA 1NNLA 4Y3UA 2CN1A 3WKEA 5ALQA 4HGRA 3NUQA 3L1UA 4OFZA 5AHXA 5AIAA 3W5BA 3WK7A 3WK6A 1Z4MA 5E0OA 5AW7A 4HGNA 4HGPA 5AKLA 2BY4A 1K1EA 5AM3A 1Z4LA 1U2SA 2WF5A 4UATA 3U19A 4YIHA 1XP5A 3WK4A 3ZVMA 2R8ZA 4NWIA 1RLTA 4OD0A 5AW8A 2I7DA 2HOQA 5AW9A 3OCZA 3QUBA 3I76A 3KD3A 1RQNA 1Z4IA 1XPJA 2PKEA 5AKIA 4YH1A 3UM9A 2NO5A 1Z4QA 3WK5A 5FP0A 1TE2A 1VJRA 4NAVA 4Y2YA 3L8FA 3E58A 2C8KA 4FE3A 3L0BA 2ZBDA 4MWOA 4CE6A 5ALWA 5A3SA 3OCYA 3UMBA 2WF8A 2YJ4A 3L8HA 3L1VA 4YCNA 2YJ6A 4Y2UA 4Y2XA 4UAVA 1CR6A 1JUDA 2IOFK 1Z4OA 2AUTA 4YIKA 3FVVA 5AKJA 5IT0A 5AW6A 3ZUPA 2HF7A 3SKYA 2FUCA 2IOHA 4HGQA 3DAOA 1QQ5A 2WF9A 3B8EA 3QU9A 4KN8A 4BNDA 4CF4A 5ALKA 4BEWA 2BDEA 3L8GA 2HDOA 3A3YA 3KBBA 3WKBA 3IB6A 3IJ5A 5AM5A 4UMFA 1LTQA 4UMVA 3B9BA 2R8EA 4EZEA 4EENA 4AS2A 1U7OA 4L57A 4Y2SA 3MPOA 3I1YA 5IS2A 4HYTA 2HI0A 3ZU6A 1FEZA 3U7FB 1N9KA 1RKQA 2JAUA 3WGVA 3J7TA 4ZEWA 2HEGA 1U2TA 3BA6A 5AVYA 1YDFA 3U7GA 4H1WA 5AIBA 1SWVA 5A3RA 2W11A 1MH9A 2Q4RA 4HGOA 3AR5A 2YMPA 5AKKA 4Y2VA 3AR2A 3M1YA 3NAMA 4UAUA 5ALYA 1ZRNA 5AVWA 3P96A 3ZX5A 4JB3A 3SF0A 3WKAA 3BWVA 2HX1A 2ZOSA 2P27A 4F71A 2OM6A 5AKXA 4DW8A 5AVTA 3NIWA 3L7YA 3EF1A 3ET4A 1PW5A 2FPXA 3QUTA 3CZ4A 2RB5A 2BDUA 5AM2A 3QU4A 2EARA 1WVIA 1ZJJA 2WF6A 4EX7A 2FPSA 1RMTA 1Y8AA 2I34A 3U7EB 2RARA 4KX3A 2G08A 2JAOA 4ZEXA 1L7MA 4DFDA 3QNMA 1AQ6A 2O2XA 5AK4A 1YNSA 3KC2A 2FI1A 1NRWA 4IG4A 2G1AA 3U13A 4YGYA 2B0CA 2GFHA 2HO4A 4Y2TA 4G63A 2PQ0A 5ALSA 2O9JA 5AVXA 2OA0A 4BX3A 4B6JA 3DNPA 4HAIA 4BNDB 4J2TA 5AW3A 5JJBA 1VFPA 2B1RA 1RRCA 2ZBEA 1S2OA 4DWOA 2I6XA 5ALGA 4F72A 3QU5A 2CFTA 5AW4A 5ALMA 2YFYA 2YMQA 5AM1A 2AGVA 2RAVA 1QH9A 3NALA 4KYTA 3FPBA 1J8DA 5ALUA 2P9JA 5AVRA 5AW2A 3PGVA 5AKGA 4J03A 1ZD2P 1L7OA 1J97A 5ALVA 4QQFA 1TJ5A 2R8YA 3NANA 1Z5UA 4NABA 3ZX4A 2OBBA 3WK9A 2B30A 4XQ0A 3U26A 1U02A 4CNQA 3ZWDA 3DV9A 3AR3A 3AR8A 2D2VA 3R09A 2JGAA 1TJ3A 4UU0A 3ZWKA 3ZVNA 2AMYA 2G0AA 5AKZA 3ET5A 2C8LA 1YMQA 1X42A 4GXTA 2MU1A 3E8MA 3KDPA 4UM5A 4UU1A 5ALZA 4IFTA 5ALLA 2EATA 1S8OA 2HCFA 3A1EA 3N8GA 1SWWA 5AK5A 3L5KA 2I54A 5AKEA 5AVQA 1XVIA 5AW5A 3N07A 2ZG6A 5ALIA 2I55A 3QUQA 3R4CA 4Y2QA 5ALEA 3ED5A 4BEVA 3SD7A 3K1ZA 3SLRA 3QUCA 1O03A
chains in the Genus database with same CATH superfamily
1N2EA 1SOUA 4E4TA 3W1WA 4D80A 2PX2A 4N82A 3T1VA 4BVLA 5DM2A 3RAPR 2XOXA 4GZ5A 1G41A 5BRJA 3OZIA 1XZFA 4HRYA 2XUFA 5ECWA 1JJVA 4D97A 5EKDA 2HIHA 1SXQA 3D43A 1S96A 4MTLA 2PN1A 3NM5A 3VPXA 4D1YA 1C1XA 3HSSA 4KN6A 2I78A 5ARBA 1RC8A 2UUPA 2W6PA 4MUEA 4V24A 1A5TA 4DSAA 4F7DA 1RAEA 4RJIA 3C3BA 3UN1A 1DCMA 3I1JA 5D5PA 4EK9A 1DBWA 4IEFB 5IW8A 1A9YA 4DSNA 3CUSA 1JPNA 2PL1A 1MNQA 2L2QA 2PO5A 2HEIA 3QE4A 3R8FA 2FVXA 4I55B 4BO6A 5P21A 3NBUA 3RBVA 2JCGA 4FGUA 3UOGA 4I1VA 1BOOA 1X19A 3GWZA 4KW7A 5FJIA 4BS9A 2HADA 1S5PA 1REQB 1VMIA 3GD7A 3TOVA 4FHEA 1B16A 5H9WA 3RSCA 3TM4A 3U5TA 2ZQYA 2ADOA 3ESYA 3LC2O 3LUJA 4IDDA 2HC9A 2QAIA 3QGMA 3VV2A 4DMFA 3AG6A 1R6BX 1ZVMA 4CWAA 2YHIA 4C3IB 2NVUB 4Q1VA 4AAYA 4RZXA 2XCSB 3L7JA 1E69A 2YS6A 3U7IA 1XCMA 3SMVA 1W76A 3L06A 4LF5B 4EHLA 1CTQA 4P53A 3HUEA 5AM0A 3HRHA 1SPBS 2OFPA 2R6ZA 2B4YA 3CH6A 4CCWA 4EHHA 5I47A 4JOCA 5CFLA 4R0MA 1MVOA 1XLTA 1NLFA 3MTIA 5D86A 5P8WA 1NUHA 4KLAA 1WA5A 1K8ZB 2VYFA 1GJRA 3PCTA 3PPVA 3T4UA 4OHWA 4TMYA 4RTNA 2COKA 4LXTA 4D8YA 2BN4A 2IITA 4YRMA 1ODFA 1JEYB 2Y0PA 2H54A 3R0ZA 4TTIA 3K73O 4NYJR 1YSCA 1N4DA 5AJTA 5BV2P 2L42A 2X0EA 1FU7A 5CFQA 3ZHRA 3CEMA 4LWZA 2VZEA 1Y7PA 3G49A 4U7FA 3TBHA 4B48A 5TPWA 5KJEA 2XMDA 4FBMA 4IUCS 3DLHA 1P7WA 3KKMA 3VJRA 3PHBE 1UKCA 4E03A 1FBNA 2PBFA 3K16A 1JQJC 2QOEA 2H4JA 1HDEA 3SP1A 4ZYVA 3HABA 4ENRA 1D1PA 1SOVA 1J00A 4H1UA 3JTMA 2VSYA 4JHLA 1OE0A 2BBTA 2RI6A 2PGOA 4GBMA 4KI0A 2QMQA 1L3CA 1I2BA 1KY3A 2XXJA 3OE5A 4OV6B 2GAFA 1GZ4A 4BNZA 1C4OA 1DT3A 1YAJA 2AW3A 3E9YA 2EWMA 3F5DA 3MIIA 4B8YA 5ADHA 4RK6A 3G5MA 3HVHA 3L1HA 3RFFA 2YWRA 1LVHA 4G37A 2BBOA 5F2EA 1KWKA 1J23A 4RTMA 5F12A 4B4KA 1B0AA 1RKXA 3LIPA 2LE0A 3KD2A 1Q1AA 2NZUG 3EZFA 1MAUA 2QVLA 4IGEA 3DEZA 2Z8XA 4ABTA 4KAXA 2CXUA 1R6UA 1GGFA 4QHYA 5EXPA 4M7RA 2YJ3A 3GPCA 4C1NA 1B1CA 1PL0A 3FW1A 3BD8A 2I5PO 5D1NA 2AXQA 2J4FA 4REQA 4WMLA 4IJUA 5TMEA 4GLOA 2ZCJA 4L76A 1M1NB 1TUGA 4PF1A 1EGQA 3A14A 5DK6A 1TJ4A 2DP4E 2H1VA 1ZAKA 2LZ0A 3IP9A 3ER8A 4Z3KA 4FFVA 4COKA 5DCUA 1V2GA 3WMXA 2D1TA 1GGEA 1MGPA 3AFNA 5IUJC 2XYHA 2GZ3A 3ZWYA 3B5IA 4XDYA 5D51S 3C3WA 3BTSA 3LLUA 3OBBA 5CXSA 3SC4A 3UMSA 2QPAA 3BDVA 3WV5A 4YMHA 2BE9A 1U7UA 3B1YA 1F2UB 3QJGA 2DB3A 2HHLA 4DV0B 2IZ1A 1KAGA 5FPQA 1N0VC 1UMCA 1BJRE 2WR8A 4HXFB 3NHSA 4EO4A 4NHEA 3UUEA 4EY8A 4UQPA 4CTNA 3JQGA 2LR0A 2AHRA 3LCMA 5IJ9B 3FHOA 3DZKA 3PBKA 4YHBA 5AJXA 5YASA 1WKBA 3HXQA 1N2CA 3OE7A 1RW4A 2X8BA 3MRXA 4JITA 2TMYA 3G13A 3IGFA 4TL6A 4YBZA 2HWUA 3IKLA 4DQ0A 4XB6B 3OZFA 1DAGA 1Y1SA 1F8YA 3IUEA 1Z88A 4ZOLF 4YROA 3FHLA 4Y9SA 1Q16A 2L18A 3P0JA 4HZUB 1TPYA 3ETDA 3N2YA 1VMDA 3VNUA 4E2XA 1NUUA 3RM3A 2IOYA 4BO2A 2C31A 1XTSA 2QZ9A 2VWPA 2XD9A 5BMVB 4A3EB 2PYZA 2GAAA 2HV8A 4XX1A 4E15A 2ZBFA 1K8YB 1H0HA 2YCLA 1PL7A 3HN2A 1N34B 3TR5A 1U9ZA 5LQUA 2VP2A 3PUYA 1TJPB 3KZXA 1K4MA 4LJRA 3GT3A 4DHEA 1OXXK 5JXWA 1TCUA 2VR1A 2PMDA 2J31A 3GRVA 4DCTA 1TYDE 1ELOA 2BFDA 3RO7A 4ZMBA 2QZZA 3NRJA 4WSOA 1A98A 1GTMA 3GYGA 4FLMA 4KK3A 3W06A 1QG4A 3TZKA 3NGMA 5LWQA 1D7OA 4HUQB 2JFZA 3C6BA 1C9DB 1T36A 2XIJA 4YMWA 5DVZA 1TQ6A 1HG1A 3ROXA 3QX8A 3DLAA 4QREA 3O93A 2VYNA 3JQAD 4QYTA 2Q3CA 4DL9A 1O5TA 3TE7A 4KR6A 3AIKA 4G8CA 1H1LA 3KOOA 3GBSA 4HDKA 5H0IA 1BRMA 4BLRA 4NRDA 5AOAA 4AZTA 1UPXA 2HCRA 1L4EA 2LW7A 1R0BA 2C0QA 1GSOA 3GFPA 2DQSA 5AI6A 3RIEA 3NU1A 3K9BA 3OQIA 3RBZA 1ESZA 2NPIA 5LZ4A 3IDAA 3D8HA 1FUYB 4WESB 1QG2A 5CAEA 7REQB 4PPQA 1ZUIA 3X2FA 3NEYA 1XFDA 2G5TA 3MS7A 4Q18A 5FORA 5FR1A 3SC2A 4C4RA 3SE7A 4KO8A 1RT9A 3WKEA 3IVCA 1S4MA 1ZW6A 4EJ2A 2AOTA 4Z9AA 1YZYA 3MTDA 2C7VA 3EZYA 1M2OA 3QV1A 2ZUVA 1NURA 4CRWB 4CT0A 3ETCA 3U7RA 4BV9A 4PSDA 1E5DA 2JFPA 3HCPA 1JR4A 1MG5A 2F64A 3EIFA 3H8SA 3HDQA 3ABZA 1HQDA 4BQRA 1XJQA 4Q0MA 1Z8HA 1PV1A 2PXCA 1ZWLA 3TKAA 2LXNA 3WX0A 4OQXA 1PK9A 2BM0A 4LRTB 4JB8A 4IJ5A 2WD7A 1Z45A 3O90A 4N03A 4QGGA 1I7DA 3I2GA 1Q0LA 4P82A 4MGIR 3O8LA 1EGHA 2GOYA 2JFOA 2RGEA 4RA9A 4DLWA 3O8DA 4JBNA 4G5QA 4NWIA 4QWMA 3TPZA 4EB6B 5AW8A 2C9YA 1GCIA 3MINB 1T0PA 1N3BA 1DSSG 2G9ZA 2JGDA 2AG5A 4BJHB 3KD3A 2Y3IA 1Z34A 3SJCA 4FFWA 4BB0A 2NQ2C 1NF9A 1U7DA 1UP4A 1VJRA 1K2WA 1EWRA 4FEEA 1JYSA 4G8DA 3BJEA 3RS5A 4DLLA 4D9GA 5FI0B 3IDQA 1MOSA 2E89A 2AQHA 3B2EA 3L6CA 1BMQA 1UBMS 4Q3OA 4QELA 4C4AA 1PJAA 4ZT5A 3ZDQA 4CI9A 1ISRA 3UV6A 1L5WA 4M0UA 4X1KB 1P1RA 3CUWA 2PGAA 2DR3A 6REQA 1X9IA 2BKXA 1H8ED 4EZIA 1SC1A 2E21A 3DH0A 1T2CA 4HQ6A 5T4HA 5KOJB 4KSBA 4Y2UA 1JBEA 3HWSA 1M7BA 1NBEA 2AN9A 4OQMA 4IINA 2ZRQA 3NTRA 4IDPA 1KGDA 3L8DA 4A1OA 1WEKA 2LV8A 3ZUPA 4EPYA 5KU7A 3TSAA 1JTEA 2QX8A 4OQLA 2O2IA 2PFSA 2CF6A 3LOQA 1G8HA 3B3JA 4KN8A 4NBWA 1VYVA 3DE0X 4U2KA 5ALKA 2P6MA 2QWXA 4AJOA 4N65A 4EVSA 4F1JA 1O9GA 1MF7A 1ZEMA 2QUKA 3L07A 4NCXA 3A3KA 3GZTB 2HZ7A 2HPAA 3H7AA 4XPIA 3K0EA 1PRYA 1A4RA 1WB6A 4UMFA 2EQAA 4AJ2A 2QRVB 2K7ZA 3K2EA 1DADA 3EQ8A 5G0TA 5J5AA 3S15B 3GTPB 3GLIA 3MT9A 1MJNA 1L7RA 2P5SA 4BKQA 3UPTA 1RLIA 3GPDG 1JG1A 3L7IA 4Q3CA 2CDAA 3A36A 3AONB 4AFNA 5K0SA 2IS6A 2DKOA 4D42A 3PR1A 5JSZA 2A0WA 1ZI6A 1O58A 2ZWVA 1OTXA 1D6JA 1Z18A 2AZDA 2Q2OA 3CW2A 3I5AA 1D2AA 3UUGA 2P35A 3GLHE 3W2GA 3DBHB 1C29B 5F4ZA 3NG1A 4H1WA 3Q41A 5IF9A 1SN7A 1QCCA 3MW8A 5JU6A 4LOIA 4HN4B 4L7VA 1NVUQ 4I6GA 2Q4RA 4D9KA 1LEHA 2JC3A 2Z8ZA 1CIJA 4IJMA 2IWRA 1IMJA 4E33A 3E70C 4K28A 3VTZA 1ZMRA 4DVGA 5I8PA 3E7FA 3T3PB 3A6JA 3W3AH 3P5BA 2HJWA 4LNHA 4F2HA 3LHFA 1TKBA 5AVWA 1KI6B 2YXNA 3GDFA 3HFJA 4LMRA 5KX5F 2JGJA 3DFZA 1TU3A 1D2EA 2II6A 3HP4A 1XMQB 1XWWA 2H5EA 1FLNA 1CKEA 3IOBA 4P0TA 5DOZA 3WRXA 2HX1A 1RPAA 3U31A 2C7OA 3S2DB 1U5CA 2PVPA 3L04A 3U1BA 4Q1BA 2QUAA 4B09A 2MYUA 2QIPA 3B38A 3DA8A 2WLSA 3NNDA 4PX2A 4OQQA 4NF2A 1E6MA 3L7YA 3WOVA 5LOVA 2CJPA 1DX4A 1PW5A 1EFCA 3GUZA 3QUTA 2BDUA 4JMPA 3O94A 4W1RA 5DNAA 3X1ZA 2GK7A 2PGDA 4KR2A 4WZBB 2ZM6B 4ECEA 3S7ZA 3K70C 3OWHA 4RK4A 3OZTA 4XUCA 4ZVUA 5J4YA 1YQUA 1K7SN 2LNDA 3ITEA 5HA5A 1JHMA 1BVRA 2YJTD 4RGVA 1SK8A 2A35A 2OGTA 5DISB 2F90A 1NMXA 3QEJA 2V7TA 4K2HA 1T6BY 1TZCA 1ZHFA 4D4GA 4IV0A 5H8WA 1UKZA 3FCSB 3KC2A 3AM1A 1BD3A 1TFUA 4BO7A 1QO0A 3TI9A 3NC4A 4IOJA 4MKGA 2CCJA 3QG1A 5JAQA 1LZLA 3LTNC 1SR8A 2J7PA 1LVUA 4BBZA 2C2KA 2GSDA 4L9AA 3TW4A 1G8PA 1K7YA 2W8BA 2ZWOA 3PQ2A 4M0MA 3H1EA 1J8FA 1OIVA 4WIAA 5A3VA 3SEQA 2WT4A 1QGUB 1JX6A 1RHQA 1PT6A 3LBYA 3TN7A 2B1IA 4JC0A 2VUTA 3RIXA 2I6XA 1OD6A 4YRIA 3HXMA 4AM8A 4F72A 2PX6A 1FU8A 3WWZA 5CX1B 2CFTA 3FNIA 2B20A 3OOEA 1C8LA 1KQGA 2YFYA 3WQSB 1K9SA 3EIQA 2HNKA 1R9GA 1VL1A 4ZODA 4YBRA 3TR6A 2OENG 3EGDB 3Q9NA 5THQA 5JBNA 3OSUA 4QARA 1Y4AE 3G2JA 1YR7A 4E70A 2O2GA 4JMLA 2X0RA 4EPRA 2H9AA 2VDWA 3H11B 4KI7A 5EWMB 1PWXA 3F4KA 2KPOA 1GPDG 1XZIA 3AGQA 1AXEA 2C3UA 3PDIB 4DCSA 3VO9A 1RFGE 1UODA 2C2ZA 1XROA 2OV6A 2WMNB 3AHIA 3NW9A 3U26A 3NBQA 3R20A 1U02A 3T5PA 1ZQ1A 2P2SA 3C3EA 2H1SA 2YZ7A 4FDVA 4HFNA 4IQ8A 3DEHA 1SFRA 3ONWA 4JCCA 3K1TA 5FPPA 2LDXA 3F5SA 1ML3A 3EVCA 3PJGA 2FFQA 2VPTA 4KKVA 4PX3A 3WMWA 2C4TA 5JHGB 1XCBA 3QW4B 3QPUA 1K8QA 1FNNA 4RE5A 3P9PA 4BMOB 3U60B 1WXXA 4QU8A 3RTAA 1S89A 2G5GX 3CR8A 1WJGA 1QCDA 2JFFA 2ANBA 2OP1A 5BNTA 2EJCA 5HTKA 1X42A 2IXDA 3SIXA 4RZQA 5CW1A 4XFJA 4PIPA 1MT3A 3HOVB 9GPBA 3H65A 5AOBA 5U4QA 4LRSB 3LW7A 4C5BA 1RZ3A 1ECGA 3Q87B 3DKPA 3WLFA 1D5WA 2H5IA 2W7TA 1SHJA 2QR5A 2I4RA 3CY6A 4ZVKA 4LX0A 1IMOA 3DHVA 4YK7A 4XB2A 5T64A 4LFBB 1NFFA 4LZAA 3U4CA 2GS9A 3IQFA 5JW6A 3DVSX 4YLEA 4JJ8A 1UT6A 4B0OA 4OYRA 2C7PA 4G41A 5IABA 2K6GA 1FTWA 2JGFA 4KEAA 2BRUA 2BZGA 1USGA 3GJRA 3KKOA 4G0PA 4P54A 3LA6A 3K1ZA 3SD7A 4ZO9A 3UHPA 5A06A 3AVTA 1KORA 5IDXA 1IL0A 3MELA 3QWAA 4TTVA 1YZFA 4R1MA 2FFBA 3OX2A 1G20B 2ZS8A 4PZLA 4E46A 2DBZA 3G79A 5AUNB 3CNQS 4MJXA 2C7BA 2DWQA 1SIOA 3BXGA 3HO8A 4IF4A 4X6XA 1U31A 2DZDA 4KO3S 3RFTA 3U4DA 1B00A 2A6PA 1Z5GA 3INNA 1RXEA 1G21E 4NTZA 1JR3E 4HXEB 2AT1A 2LIVA 2Z9DA 3PZRA 1WHSB 3MJFA 4MMYB 5FIUA 3I4CA 5FUWA 4ZVTA 5H5JA 4FB5A 4XI9A 3I4FA 5CUQA 2DHDA 1TKCA 5AVUA 2IW3A 1RM0A 4YYEA 2J3QA 4Y6RA 3VSDA 4ID3A 4FT2A 3X44A 2V1XA 3UC9A 4LV6A 4L22A 5D2CA 1OT5A 3AX6A 1FVOA 4AN0A 4K9DA 5KYUB 3LTEA 3Q10A 4V0RA 2JCXA 3HKZB 4AYXA 1K86A 4MW7A 4PZCA 1XEXB 2OGSA 2OV3A 2JI4A 3HKDA 4OHPA 1FX0A 1QFJA 3LQKA 1O94D 4P4SA 4Q00A 4TWZA 3ZU2A 2BIFA 2RGYA 1GSAA 3K1JA 3ZY5A 2HSDA 3PS9A 4P4TA 1W73A 1UDAA 4RJTA 3NM4A 2JVIA 2AFHA 2XT6A 3H16A 4BE4A 2PUJA 1LI5A 1X7ZB 1JKXA 4X65B 2CT8A 1OFIA 4OAOA 2FMKA 1TTHA 4U0JA 3O9VA 1CWUA 1URPA 1E7SA 3T7CA 4C2UA 4E2YA 2QJWA 4QUIA 1DBIA 1LPPA 3PGJA 1DKNA 5AI0A 4ZQFA 2BE7A 3G7UA 1V5GA 2BMDA 3MCTA 3N87A 3IP3A 3GBPA 4RH1A 4JBWA 2FLKA 1VL6A 2ZIEA 5BN3A 3EDOA 3HM2A 3CZQA 1K6IA 2NP7A 3B9RA 2PGIA 4I9FA 4DZRA 1ZYUA 2V98A 3LBIA 2R8RA 2FB9A 5L3SB 1CUXA 4POOA 2Z4TA 4LYDA 4TQGA 1ZH8A 2GBPA 2P7HA 4O5OA 1JHXA 2R6DA 3UJ9A 1VDZA 1RTKA 4Q4JA 3K71B 2Q9CA 2GGSA 2ROQA 2ODEA 4LKOA 5SY4A 4RYDA 1G1MA 3REQB 5CHYA 1W85B 2A9KA 2XQGA 1P5HA 3U48A 3S17B 1CQWA 1PD1A 2Y0DA 5KX5B 3LHSA 2IEIA 4IRMA 4BIIA 1JBKA 1KFKB 3G0IA 1IJKA 5HK9A 3P4XA 5C31A 5DYNA 1VBNA 4GFDA 5HUQA 2JK0A 5CXUA 4HAOA 4MDEA 2NUTB 1GPUA 1PZFA 1UPTA 1HV8A 1Z8FA 3I5MA 4BLPA 5HZGA 1ZBQA 4KMRA 2G5CA 5GJBA 3DG9A 3KJIA 1CERA 4UQOA 4UHEA 1V6AA 3GFVA 2SKEA 5TE9A 3FHTA 5IU6A 1QYIA 4W1SA 3IIJA 3NJ8A 5BOSB 2JCBA 3BWEA 2WC1A 1N77A 5BQXA 2PU5A 2WJWA 2BEKA 1RWXA 2GK6A 2PMFA 3KJGA 4R1UA 1ST3A 4Z86A 4MXDA 2K2WA 3TL6A 2GX6A 1JA1A 2NLOA 4GVPA 4PXSA 5CIQA 3VYTB 4TV9F 5CLLA 1VZ2A 2CSXA 1WDMA 1GKIA 3KLNA 5BPFA 1TL7C 2XI4A 3LXRA 3A1DA 4M1WA 3P2JA 3I6QA 1T24A 3KE9A 4UC0A 2DPYA 2DBQA 3V7UA 4INOA 4D9JA 1W2GA 5I4KA 3C3YA 3ND5A 3PGLA 4M22A 2XXBA 1UM9B 1FW8A 2A67A 2ZJ1A 3BEOA 3QXHA 4AYBB 2PS0A 1W4RA 2H1OA 3KSRA 4LHEA 1V45E 3D8UA 1IG0A 2WKWA 3DMTA 3EGOA 1HYQA 2HA0A 4AMVA 2IU0A 1RJEA 2FN8A 1V8PA 3OP1A 3FTQA 4D82A 1WZNA 3QLUC 2O8CB 1P9LA 3SOZA 1DBSA 3PPYA 2QGFA 4U6SA 5IRCD 1S7CA 3T54A 2XQJA 1HM5A 2WYVA 2R11A 4HNQA 1JNYA 1OZGA 3BMCA 1WSDA 4FKMA 4J16A 4PR0A 4TOIA 2VRNA 3WJAA 4ZD6A 3EF3A 2HU5A 3A3PA 3QLVC 4P3PA 5JE8A 1LV7A 4QDXA 3VNVA 4XJSA 3UJDA 4AJ4A 2X0KA 1N1EA 1Y4UA 3W8FA 1ANKA 4ALNA 2A0YA 1BYIA 1TM2A 4NS1A 1UPBA 3THWB 3HBFA 4O2AB 1I4TD 3EVDA 2SKCA 5DBOA 4AG5A 3I64A 2WAQB 2FLVA 5BOVA 4B3SB 2PMZB 5EJMA 4CKWB 4F5ZA 3OM8A 5F5XA 5LP6A 4MR8A 1FY2A 4G4JA 2I3ZA 3S1AB 5I7EA 3OPYI 2HWWA 1MH1A 2A5YB 1NRJB 2DVMA 2OXTA 4WPGA 4UHJA 3N2KA 4PFJA 4YP1A 3LP8A 3A1SA 4INJA 4R5HA 2YRWA 3EQ9A 1R0LA 5HF8A 16PKA 1KI1A 3CIOA 2PSFA 3LYAA 2COUA 3RYHA 1W8IA 2JHAA 2R96A 3SU8A 1MAWA 3STUA 1VYUA 1NKVA 2ZKLA 1O6ZA 3SVZA 2G63A 3OOYA 5BSRA 4W9MC 3O4RA 1E3WA 4WGGA 1C9JA 2G83A 4KREA 3HRKA 1PS8A 3RQIA 1A5SB 3TDKA 3AETB 1PFVA 1N33B 4UAGA 2XSZD 4ER0A 3AUSA 3DMRA 1XN4A 2HL6A 3KT8A 3KVYA 1WHTB 1EVIA 1B0PA 3IHKA 3BMQB 4C78A 3W90A 4M1SA 3WA7A 2F9FA 4C0LA 4YWHA 4K1XA 1NXVA 2IYTA 1WOYA 4RD3A 4KQGA 4G5XA 3NPMA 3JQAA 2X7JA 2NO6A 4YFVA 3ER9A 3D6AA 1CXZA 4FNGA 1HQYE 4FDLA 4ENVA 4MAAA 4P36A 2WIFA 2Q1SA 5A1TA 1KP9A 3E9MA 3OTHA 3DDCA 2V9CA 3WLIA 5HRAA 4KKXB 4FIDA 5EQDA 3GNLA 3ZJYA 3V4OA 3GT4A 3DO8A 2BLNA 1MCZA 2CVFA 3I73A 4GHWA 5A02A 5IKPA 2JKVA 4OQPA 2AFIA 2V54A 5DHUA 3T3IA 1Z2EA 2XLBA 4C7VA 1JAYA 2MHCA 3KPYA 3PICA 5CBKA 3WXMA 4FMBB 2VJYA 2XR1A 1HDXA 2WFMA 1RRMA 1YA8A 4HYYA 4L7QA 1QB7A 4UZEA 4FW9A 4RAOA 1TX4B 5CJ2A 5EPEA 3ZE7A 3WLNA 4OFZA 5KOHB 1YAHA 3EUFA 1YL6A 2BPOA 1KSFX 1GG2A 3ELUA 1XEWX 4BFUA 4PM4A 1AQLA 4KPFC 1PYOA 1ZD1A 3C3AA 1PTKA 5A9RA 1RYMA 3DPSA 3SR4A 1ZQ9A 5TT1A 1GV0A 1LDYA 1O96B 3OJEA 4U2FA 4H18A 4R8KA 3LO5A 3QQ5A 3I9FA 3FTPA 2CCKA 2HIGA 4RA6A 2KM1A 2PL5A 3U19A 1T4CA 2XVZA 1JTVA 3EIWA 5KHOC 1WB4A 2AVDA 2JA5B 3ZDAA 4Q9KA 1UM8A 4P3NA 1E2LA 3OIDA 3QE9Y 3PEYA 4KR7A 3QIAA 1U1EA 2XY4A 4RS4A 1UIRA 3D8TA 4DS3A 1TE2A 1XZNA 3TFWA 5T7BA 3KQUA 2VZ8A 2HRZA 3IP1A 4BNNA 1C0KA 3CGGA 1W4CA 2A9OA 2VO1A 4NG5A 5MFPA 3C41J 2E4VA 2Q27A 3GD5A 1CVIA 2ZT5A 5GV8A 1L4MA 3TIXB 4UXHA 2DF8A 3G2HA 2PWPA 4BVBA 2XUQA 1H8EA 2J0UA 3TECE 5JVDA 5ECGC 2Q5JA 2Q3LA 3CG0A 4G0UA 3BJIC 1MB4A 3OOHA 4YAGA 3PFIA 1RFLA 1PZMA 1CR6A 2GN4A 1P5RA 1R8JA 2EP7A 2GN8A 3EMBA 3VVLA 1U8XX 1FSFA 5ARCA 3TSZA 3OQOA 5K6AC 3IKJA 1HE1C 4LBYA 4UREA 4C07A 1YONA 3LY7A 3TGPA 4P0PB 2CJWA 4RZSA 2P90A 2OOKA 1XTTA 1C3LA 1VLVA 2VWGA 1GNVA 3TTTA 2GPYA 3OF2A 2H4WA 2Y1CA 3KVNA 3M9WA 4PYRA 5KB3A 3H2KA 4N3CA 5B5SA 2W2KA 4Z6KA 1YRBA 4HXYA 4MQMA 3GJTA 1EPUA 2AJBA 4NXNB 4CEHB 3X1KA 2AZMA 3DEJA 2B4QA 2DPXA 4EG8A 1N6NA 2I2FA 4J1QA 2ZDQA 4B35A 3DOUA 4OI4A 5CFMA 3S1QB 4XDGA 1AMOA 3F3KA 1LSUA 3H99A 2VOJA 4G5HA 5EJ8A 4C4YA 4GQAA 4MW9A 2ZRHA 3O1LA 2BM1A 2C2GA 1U7OA 4AS2A 2V3CC 2JEYA 1G55A 2H3HA 5IS2A 2WJHA 2IIQA 4R3WA 2IHZA 4JQOA 4K05A 2R6R1 1MW8X 2IHNA 5JASA 1Z0SA 5JZ9A 1RKQA 3FIJA 4MA5A 1NY5A 3C8ZA 3OA2A 2V7GA 3DV0B 3EW7A 4G81A 5EZYA 4DVJA 2WB2A 4I50A 3U7GA 1QAMA 1U4SA 2J87A 3OZVA 2UAGA 5MDHA 2HFJA 1VOTA 1VSVA 4JVSB 2HNAA 1U7HA 5CK4A 1YE8A 1PJ3A 2FP4B 3EXEB 2I9KA 5JBIA 5C5EA 4TRMA 3NTLA 4PG7A 1CF2O 1M2KA 3UAOA 5M04A 2ZJAA 3ZDFA 1J39A 2PRJA 3JRWA 4CMBA 5A4JA 1EA5A 3G2PA 1W87A 4MK4A 1TM4E 2BMJA 3VR1A 4CKBB 1E6EA 4ESHA 4X45A 2ZOSA 3H83A 5I9TA 1BDBA 3DE2X 3A11A 2NZWA 4A0HA 3JS5A 2OZEA 3EMKA 3Q2KA 5KQRA 1ESMA 3GLGA 4M7OA 1I6LA 4DIFA 3CPJB 4DJFC 2R751 3KE8A 4HQFA 1QU3A 2A88A 4D6PA 4AY2A 4AZ0A 1RP1A 4B6GA 4Z2YA 3UFXA 3UENA 1VB5A 3VDNB 5HW0A 1H6AA 1QPGA 2OUKA 3DT6A 3LC7O 3FAZA 4JH0A 3M6MD 5JCPA 3CBQA 1JGTA 1WMBA 4LF7B 2KMLA 1AG9A 1WVIA 2CFCA 4J7CA 1B8VA 1QIIA 1TM3E 3JALA 1DAEA 1YZUA 1ESNA 4BKOA 3CMCO 3FX2A 2O6HA 4RPLA 3EEIA 3FDZB 1POWA 2GBIA 3V00A 3RS7A 3ZC3A 5BYJA 1LH0A 2DFPA 2V03A 1LDMA 3A1UA 3CZPA 1IY2A 3AEUB 3FGZA 3MBIA 3HCEA 3FZEA 4YJ3A 2RHRA 5AWFC 4HLUA 4URXR 3UC5A 1AO0A 4XX0A 1NATA 1R10A 3T1HB 4XTRA 4IG4A 1P2BA 4BJ6A 1SVOA 1I3CA 4R51A 3U5ZB 2B0CA 2P9BA 3F47A 3OCCA 3PTLA 4R01A 2C3MA 4ILEA 1GN8A 1OBVA 1NYRA 4V0NA 3TEMA 2EX0A 1ENYA 2ZRIA 2O9JA 5EXXA 3HGMA 3BYZA 2CXQA 4B1FA 1UOQA 4FYWA 4WFKA 4EI8A 5AD1A 4ZI2A 3HI6A 3MLBA 4KACA 3U9TA 4HDMA 5I9NA 5EZSA 4L9WA 4HZIA 4E5UA 5B6IA 3FPGA 2V3WA 4Q47A 5U9CA 1U8TA 2RHLA 3AKDA 1Z6AA 4PLYA 3AW8A 4BNYA 1OTHA 4I55A 3FCYA 4XJVA 5MF6A 1FP4B 1I2CA 4RNDB 3KSZO 4CI0B 3OH8A 5JTTA 1I7SB 5C4JB 1M2EA 3A05A 1QR6A 1Z6XA 2ZIUB 5ALUA 1REQA 5I4IA 5KREA 1ZN2A 1HZZA 1RQXA 1SJ9A 1JMYA 1N6PA 4XSGA 5HBGA 4DR4B 1E2BA 4XSVA 1KI4A 3G2QA 2PZJA 1QUEA 3WWOA 2BFCB 3WVNA 4EO9A 3SZGA 5IDQA 2MYNA 4NL4H 1F9EA 2NVUA 2WPDD 3Q0IA 2VAWA 4HZGA 4BYMA 3EZ9A 1LNZA 3DV9A 1QTIA 1G8FA 5DYWA 4NEQA 3AR8A 1L5FA 2VHXA 1ZUNB 3DB1A 3EGEA 3ESCA 4MUBA 2P3QA 3WRVA 3VHXB 1KEPA 1SKBA 4DT1B 1TJ3A 1U2ZA 1JR2A 1P3Y1 2HNBA 3G8CA 1SXPA 1DEKA 1SB8A 3W5SA 4QT0A 5CBPB 5A9TA 4JQSA 3VU0A 5TR9A 2I1VB 3D4BA 4KXLA 4TQUS 1JEYA 3GXOA 3O26A 2OKGA 5IAAA 3BE4A 1PR6A 4QQKA 5ALZA 4JGGA 3E8MA 3IAXA 1XRJA 1AC5A 3GLHB 2ZR0A 1U0NA 3Q0TA 1R9TB 1CJMA 3HXPA 3RPEA 5K99A 3KYDB 4LJ5A 3DL4A 4DG9A 1O6BA 3BRSA 3DKRA 5AK5A 5CVJA 4JI4B 2OZPA 4BP9A 1DELA 1N2HA 4KP7A 4MV9A 1EE1A 2ZYHA 4UBKA 1GPJA 5IKXA 1QIMA 1PT7A 4DYHA 4N12A 2VPZA 2AFVA 2XE6A 3G17A 3MJVA 1KEEA 5J43A 2I4MA 2RH4A 5C4MA 1U8CB 2OHFA 3CVOA 3PXCX 2YY7A 1VCIA 1JFFB 3ND9A 3ZYZA 4C89A 1CHNA 3TDMA 1EG7A 1E64A 1GADO 2KBEA 4LWOA 2M32A 2QT0A 1THZA 2GZMA 3ANLA 2POCA 1B14A 3ZW8A 1F2DA 4J0QA 4ZC8A 1N2OA 3AVOA 5HZKA 1CUFA 2OL4A 3DCNA 5E6SB 3FVQA 4BVKA 3QU7A 2OSVA 2E7ZA 5EVCA 3G6WA 3NC1C 3AHEA 2F62A 4DCNA 1NFRA 1HO3A 3E35A 1WEHA 1PGQA 2DKFA 2IYEA 3H4TA 3KJNA 1AQNA 4F2DA 1IHDA 2DOKA 1L5GB 4FC7A 3TF5A 4KN9S 2P40A 4D4LA 3ETEA 4BN0A 4MW2A 2C4WA 4RPGA 5IKMA 5HJ2A 2H17A 3B20A 5LMNB 2H4YA 4OSEA 4J0KA 3O3OB 3R7AA 3Q3GE 4O3FA 2Q2QA 3QVUA 2AC2A 2JZOA 3TQQA 4JLNA 1F2UA 1O94A 1VRVA 5IT4A 1AKWA 1ISIA 2WM8A 1CCWA 3TG8A 3EQZA 2ZYTX 3C87A 3U6BA 5FD8A 1EVZA 5AI4A 2QVGA 4Z7OB 1QIHA 1P5JA 4TXHA 1ZOLA 5FWNA 3LXMA 2BEJA 121PA 1L4BA 2FZ4A 2PKQO 2LKDA 3NHUA 5JAMA 4FSDA 1CJUC 1ZGCA 5DHSA 1NVMB 5IJ9A 4GO1A 1F6DA 3DO5A 3RABA 1R0SA 5ALNA 3RODA 2EP8A 3ZV4A 4B80A 4Y0NA 1RPZA 1PQWA 5AR1A 1Y3DE 3PFBA 3WLPA 1HY3A 4R2WA 1SC9A 4DADA 2BGKA 4OLFA 2BGNA 4DLKA 3GIDA 4EHIA 4HWPA 4AMGA 3PRJA 1Q17A 4JOSA 2ZUSA 4HZUA 3GRKA 2XTJA 1G3RA 3DWEX 2DETA 2CFRA 3A27A 3F4LA 4KJXA 2G82A 2YWJA 3GDWA 2Z09A 2DFNA 4MUMA 2RCYA 4ENPA 5BMVA 1RI5A 5UKDA 5L95A 3H8JA 3U81A 2XA1A 4CMEA 2PM8A 4EA8A 5LIPA 4BQNA 5LD2B 1W5TA 5DWVA 1RLOA 3ELYA 1LWOA 1XRPA 2BI8A 5JO9A 1SCUA 1YJAA 5EE9A 5GOTA 5HIMA 3RRMA 1R9MA 2A4KA 1A4UA 4OJTA 4F38A 3E3OA 5CLGA 2IT1A 1IY1A 1RZRD 1XG5A 2WTUA 2RGBA 4AB1A 4FOPA 4KFCA 1YBMA 3GCGA 2I33A 1CUIA 1P72A 3A25A 5T4EA 5JJKA 2IS4A 3CRZA 1CF4A 1IWOA 2Q1YA 4MS3A 1U9CA 2DY0A 4BV2A 2E49A 4RD1A 3SXPA 3IEMA 3HJFA 2QU7A 3R5XA 4QSMA 4UJ5A 3TSOA 5LZ2A 4HVTA 3FNFA 3QKTA 3WK8A 4LYYA 4GC5A 4NYMR 3P45A 3WKCA 3B12A 5EZ5A 3SYRA 2H08A 2ZIWB 2NV0A 3KUCA 1JV2B 4GLBA 2CJFA 2FPPA 3EFEA 1OFTA 1Q12A 3SK0A 2CC2A 3PYMA 1LZKA 5AXBA 1YE5A 2F1HA 3UK0A 1YRWA 3D2AA 5EQJB 4WESA 1N3YA 1NPTO 4C1BA 7REQA 2XYGA 3JWGA 3W9BA 3P71T 3RJMA 3OHPA 1XCPA 4MWCA 1KMIY 1MJ5A 4EA9A 2J3IA 3K0CA 1G3IA 3GLKA 2BFOA 4OHFA 4QAQA 3SIWA 3TB4A 2H7VA 1DAFA 1ODSA 3FMOB 3IIMA 1XLTC 1L8QA 2GJSA 2YVAA 2R2AA 2XKBA 4ITRC 1M67A 5E0KB 3TJRA 3NHYA 3K0SA 2PUEA 2ZVJA 2VZ0A 5GGXA 4ENTA 2PL3A 1WD7A 3OLCX 1KI2A 2GR9A 3VU3A 4I5GA 1JIJA 5FXMA 5CA1B 1E32A 2OOSA 1OH6A 3AEQB 2E4WA 3IAFA 1NMEA 3H8WA 5JOQA 1L7AA 3OC6A 3W8DA 1I7QB 2NXCA 4GOOD 4TZKA 4ARIA 1Y5RA 1DNPA 3HUFA 1CUGA 2YV5A 3LM8A 4EB6A 3CTMA 5DM1A 3GFTA 3ZPXA 2B7LA 1Q2XA 2DC1A 3C70A 5JPIA 4D79A 2OC4A 3QFTA 1RAIA 2VNJA 1ZOIA 1NMZA 3AR4A 4JR0A 4OJYA 2Q4OA 3PPWA 4GNKA 3QTBA 4AU1A 2Y1OA 4GPTA 2XHEA 4C6SA 4IWXA 1U3VA 1P45A 4NJEB 2FUG6 4LRQA 4UJ3A 3AVWA 1UKYA 1KETA 3ASZA 3IOYA 1GRQA 2C3OA 2JG3A 5ER6A 4JR1A 4QYSA 4XYBA 4DIBA 2QYSA 1ZH0A 4YNBA 4V3BA 1KDPA 1K83B 2WKSA 1XE3A 3F4BA 2PRKA 3TCNA 1ATZA 2O0KA 3INRA 2Y93A 2UV8A 5CCXA 3KQHA 1A2BA 4X1KA 1BGXT 1KY4A 1T9BA 4DJAA 4B31A 2KYRA 1N0WA 2A9QA 2Y0BA 3D2BA 1Z47A 2A7QA 2DUJA 2J6HA 1QONA 2VJQA 4W8HA 5EMHA 4HNUA 5CA0F 1LNQA 1KJZA 4IGAA 3LX4A 2ESRA 3E6AA 1NXWA 5KOJA 3BWYA 5FBWB 3AM5A 5LBUA 4JVOA 3LUPA 3BH6A 4GLJA 2J0EA 2OILA 4NFHA 3UNXA 3VNBA 3IEXA 3ZZ1A 4O6VA 3G89A 2RONA 1TLFA 2WHYA 2XSZA 4AZSA 3PQ3A 4BV8A 2VDPB 2QAGA 1CYEA 4II3A 4N8DA 3IRVA 1PJ8A 4J76A 4COOA 4CR6A 4E5YA 3CYFA 1JDPA 2WZBA 4UTRA 4LAFA 3LQRA 3UZUA 4A3SA 5A2GA 5JUWA 1E1LA 3AQIA 2PMWB 4CMCA 4BX8A 1T1IA 4R1OA 4ARZA 3PJDA 4BOYA 1VLQA 1KL7A 1PL6A 5DP1A 3W7BA 2NO0A 3ORSA 3QWFA 3LG2A 4HUJA 4EM6A 4CETA 3IIKA 3R9KA 3TDNA 1SVIA 2O7QA 2QRVA 5D1HA 4QZVA 3K72B 3ITNA 1XTKA 1OA1A 3FWZA 2JJQA 1E60A 4OHXA 3W5JA 4BVHA 1ZA2A 4NYJQ 3FR8A 2VPWA 3A10A 3R3ZA 1TJYA 3OWXA 4AXBA 3V2UA 4PSUA 4X3PA 3T6KA 1M8KA 2HF2A 2ZYIA 1AKEA 5ALQA 4F93B 1A27A 2HV9A 1HQKA 4RY2A 3JQDA 1SOWA 1KH3A 1KI9A 1X6VA 2GH1A 4K8RB 4RK7A 1Z4MA 3KUDA 1TEXA 3K0AB 5J1SB 1CRLA 2RDMA 3M6FA 4HB2A 4LHZA 1FNCA 4IH9A 3FH0A 4PCUA 3UMFA 3WMEA 2HQBA 1MKYA 1AOXA 4FB4A 3BULA 1OX4B 3L7MA 3AXTA 2JLSA 2REBA 2FWBA 1GUZA 4CT4B 5CB0A 4R8LA 2P41A 1UJMA 2F4NA 1T5LA 3CW9A 2G6TA 1DLJA 1VKHA 4TROA 4HR7A 3K2QA 2C5FA 1DTWB 1Q3KA 2JFQA 4MVJH 1XK6A 3FVRA 2OCDA 1T8TA 2QRZA 4AY4A 4GPD1 5JATA 1HDGO 1EB8A 2WMOB 2R66A 3JVUA 3MM4A 3PXXA 4RKQA 5K51A 1DRWA 1L5NA 1CPYA 1M2WA 3V1NA 3WGGA 1J49A 2Q5LA 1I3OA 4M89A 2D4AA 1CNFA 1FB5A 2DPMA 1OH8A 2N9UA 4KWCA 1MQ8B 3CWQA 2XNHA 1FJ2A 1TZKA 5DRYA 2IEAA 1PZNA 5F52A 3JW8A 4GVLA 1MZPA 4QXMA 3ZHQA 1MVNA 3BQMB 9ABPA 3NIBA 1P4JA 4H1VA 3OE1A 3UMBA 1BE1A 3IFSA 1L5YA 2H8GA 3L8HA 4LZNA 4HDQB 4HBZA 1XNHA 2YUIA 1GYRA 2PSEA 2I80A 1JG4A 2V4MA 1V2HE 2XWSA 3IQHX 3IT0A 2O05A 3IR5A 4KSYA 3FKSA 1GCAA 4P7FA 1NBAA 4RM2A 1I24A 3QBVA 5T3YA 1N8KA 2H2GA 3GEPA 1KJ9A 1X1EA 2HLPA 4CIVA 3DF9A 1KDOA 1N0IA 4WT7A 2ID9A 2VSNA 1ZDMA 1VMEA 4QXQA 1CDOA 3LT5A 4MICA 5LYJF 3SKYA 1QAQA 1AK2A 1NP7A 1OGYA 2WF9A 1LTHR 3ILXA 3EDQA 5BUQA 1BU8A 1TM1E 5JR3A 3L8GA 2BGIA 4A8PA 2FAXA 4GPBA 1W48A 2ZIGA 2I3GA 2UKDA 4JP8A 4ZARA 5TDHA 2C5SA 3KBBA 5CX1A 4KCGA 4EZBA 1NVDA 1C9MA 1K97A 4BAUA 3ZCSA 1SC3A 1MHPA 3NYWA 4LJ8A 4LECA 4KL8S 4C4PA 4N7JA 3EGDA 3GMIA 1DE0A 2GJ8A 4EENA 3ZHZA 3TSWA 2OZLA 4EGJA 2ZRAA 4Y2SA 4ENSA 3LX8A 2UZAA 3MPOA 2ZGVA 2OXRA 3H11A 2H31A 1DARA 2X2PA 2Q4BA 5CXXA 1NN0A 2R62A 1RWWA 5EWMA 2XCTB 4KQXA 1I3KA 1YI0A 2EVWX 3VKVA 2W6ID 5JS8A 4DR7B 4GE3A 3II6X 1UZAA 4LTDA 2FSPA 4E2ZA 1IQRA 5AVYA 4I2NA 1ATIA 2G7MC 2E2HB 1GPYA 1M34B 3RFVA 1TUEA 5A3RA 4A2PA 2E5LB 3IPRA 1MH9A 2W58A 5AOCA 1KI3A 4MMXB 2HMVA 4V0SA 3T5MA 3M1YA 4RW0A 4ARCA 1LPAB 1Z82A 3IJRA 3OKFA 3ZGVA 3HQ4O 1R9JA 1SULA 3H5NA 2QLJA 1BDMA 2WVJA 3KXKA 1KERA 1PNQA 3KUUA 4OGKA 2Y1LA 4TKMA 4ZWNA 3DZCA 3IPAA 2ZR8A 4RY8A 3UH1A 1N7HA 1YO6A 3D6HA 3QKWA 5FBZA 1GVNB 3K05A 2IYXA 3AV3A 5KIAA 4ZU3A 4X8LA 3Q85A 3ORQA 2FMTA 2XMCA 1C5KA 1KO8A 2QTWB 3I01M 2HDHA 3OU2A 4JYMA 4RPHA 5BW8A 1HXHA 3KKPA 5A62A 4A3GB 4OYLA 3KU1A 1HBJA 1ODTC 2DFKB 1WDLA 2ACVA 3MJHA 3TTXA 2IH5A 2DQZA 3G0GA 3AM4A 1PNRA 5B2ZA 2JA7B 1ZJJA 3BK2A 3QOFA 1QGZA 4HEJA 2ZCUA 2C0PA 4OOFA 1LPMA 2V7EA 1JAZA 1ZK3A 1UDXA 2ODPA 1I0LA 5KWVA 2YUTA 3BE5A 2JA2A 1NXTA 4MKRA 4KX3A 4BVFA 3BS4A 3I9OA 3V1TC 2EGGA 5LN1A 4ESVA 4AKHA 3WYCA 4ZMSA 3BK1A 1NX6A 3NOVA 4MVXA 3T4EA 1YUNA 4GPZA 4LYJA 4GOND 1W94A 2MR6A 2O2XA 2WM3A 4AO8A 3H6KA 5B37A 1GHTA 4E3WA 3R1IA 3L8MA 2ZROA 3DBRB 2R6CA 3CLSC 1Y1KE 3OMLA 3U62A 2AR0A 4FR2A 2OV1A 4RTJA 4Z4QA 2O8FA 5TS2A 1D07A 5D5HA 3D3WB 2PE5A 4WEQA 4RPKA 4MEBA 1NNSA 4MQ6A 5C4IA 4KQCA 1EXVA 4UOEA 1FTSA 1V1RB 1IN7A 1DMRA 3GUVA 1WBBA 3HCBA 1HNWB 1Z5ZA 5KYUA 2ZJZA 2B0JA 3CG4A 3CKLA 4LUCA 4OK6A 4WW0A 1PFKA 1R6XA 5DGDA 5ALGA 5IDWA 1OZHA 1KKMA 1G5PA 3WRXC 2RSLA 3HJBA 1RKBA 2LD4A 1JFVA 2VF7A 4NBRA 4M76B 1SQSA 1W5BA 5AM1A 1KDYA 4YRNA 4XRGA 4DYDA 4NOMA 3NALA 2GCOB 3KTDA 2YINC 1MJGA 2EP5A 4YS6A 5BWOA 1X7ZA 5HS6A 2BH2A 1AH2A 1IUOA 5KNDH 3RVOA 2IQIA 3A8TA 1L4KA 3FRJA 3MGCA 2FZLA 4YUVA 1ZD2P 3EW9A 4NX2A 5DTRA 3IIEA 4K6MA 2PUWA 3QKSB 1MOPA 4QQFA 3AUXA 5T6BA 1VBFA 4DBLC 2WPDA 1ULZA 2XKJE 2YWXA 3TZEA 3BK7A 1E1CA 1TVMA 2OBBA 2LCFA 1Z38A 4JT2A 5SZJA 4ER3A 3BSSA 4BLOA 2VLIA 2VA8A 2X8LA 2A1UB 4C21A 3LLCA 3Q8MA 2INGX 5AJVB 3SC6A 4DWJA 1ZJWA 2GM5A 4YRGA 2GCEA 2P3SA 4G3XA 2GEKA 3I92A 3WGLA 4O4JF 1KC1A 4XARA 3BTUA 3EPPA 3UGJA 2O4CA 4RGQA 4LY3A 5CU7A 3FHCB 1K92A 1W85A 3NYRA 2R1TB 3NATA 4NC9A 5EE0A 2EW2A 4AL4A 2PRZA 4HN9A 2I87A 1G2IA 3EA0A 3G7SA 3DAHA 3W0LB 2HAEA 1OXMA 4AI6A 1T1RA 3L7AA 4R16A 1JQKA 3PUZA 4KE8A 4ZI5A 3KQVA 3C3CA 2Z2XA 2Z8YM 3KZMA 3E5NA 3NT2A 4MV0A 3O4HA 4JR2A 4HWTA 1T8YA 4BQIA 4M1ZA 3VYWA 1E0KA 4IY1A 3MFQA 4U1RA 3UT0A 5A5DA 5KVSA 1W19A 1YB5A 3ZIUA 4MVJP 3M6UA 1GTG1 5BWCA 1J0XO 1HDRA 4I3HA 3W2FA 4I4IA 4D5EA 2EBUA 3FWKA 2C57A 3FPHA 4A3IB 1WQ1R 1TIPA 3P9CA 4X20B 1ZONA 1VSTA 3TRDA 1M0WA 1IAQA 2A9VA 4X1YB 4B73A 5IBCA 4CEIB 5ICGA 4OAPA 4LHXA 1YWGO 2N3ZA 2L19A 4M1YA 4MYUA 3SEZA 3T7AA 3PGXA 4G36A 4EI2A 4RTPA 3KDSE 5B6PA 1WXWA 1JLMA 1O1YA 2R5NA 4I36A 4ZXPA 4TQAA 2WSMA 2D06A 3AB3A 1R0RE 2FZWA 1XC7A 4LFCB 3ASUA 3I28A 3PHGA 1MO3A 4XR4A 5CNKA 4FOLA 2ZRJA 1YRQA 2CFIA 4EB3A 1J21A 1ACMA 1ZITA 1B42A 5EIFA 3VPBA 4ESEA 2O0HA 4XVHA 5JQGB 1UM9A 4MGKR 3OZAA 3LXXA 2B21A 2PQ6A 5LYJB 3N3BC 1J7JA 3BZWA 1LDEA 4EDFA 1NNI1 4UVHA 4XWKA 3LCJA 6CHYA 5E4TA 2AVNA 2Q4EA 3D7RA 4O4HF 3STWA 2IUUA 1Z26A 3L4BA 1J4AA 1G7CA 3FMFA 4MQ4A 1B4DA 4RF5A 5I8ZA 3B3AA 5CGQB 4X8OA 1UBJS 3D0OA 1Z73A 4RY0A 3CH7A 1KDVA 4CL3A 4H3KB 2O2JA 2JF0A 4QOSA 2X9QA 5DKFA 1G2PA 3HH8A 5EZ6B 4CG3A 5HGJA 5IVHA 4QYIB 3JX9A 3P32A 4BLQA 4IIVA 5U4XA 4IZOA 4TZTA 4WTOA 1SUSA 1WUIS 1RHMA 1NBWB 1KYWA 4O2AA 2WYOA 4FLEA 4ECAA 1SHUX 2QNBA 2GM9A 3ZCXA 3JQ6A 5CR9A 1GZ5A 4DCJA 4ZO7A 1ENZA 4ZGGA 4CKWA 2TMDA 2JH8A 3EEFA 1DRUA 2UXDB 2QTBA 1YF3A 1H2HA 1EK1A 3STHA 3LH5A 1XTUA 3GCXA 3S1AA 5THKA 4L5YA 2NTEA 4RDXA 4HQ0A 1DINA 3LKVA 4R6WA 3NASA 4NQRA 4WFQA 3ZZUA 4G5OA 4DLBA 1XDWA 2C7QA 1O6GA 1L4YA 1RPNA 2WEKA 4WUVA 4YASA 4INZA 4XFDA 3AOEA 1ES9A 3KT3A 5AK6A 4ND4A 5BN4B 5K2OA 1P4RA 3NC0C 3UMYA 2QYOA 1DAMA 5KCZA 1A2KC 3I9NA 4YRJA 4N76A 2BH9A 1JI0A 1U0OC 4IV8A 5KQGA 2HK7A 1EFDN 2CLOB 4TLBA 2EWVA 2EKPA 5J63A 4IKEA 1X94A 4N3BA 3Q7PA 4OHUA 3U7HB 3EG9B 4IFBA 4D4KA 3UYLA 2AOXA 2QPOA 3DNFA 4EGAA 2JFUA 3HCNA 4P31A 1DDOA 2YJZA 4R2XA 3CZMA 3QQPA 5JYDA 1IBLB 2O5VA 3N2EA 4BDSA 4P3YA 1D0IA 3T4XA 5KNCD 4KQ2A 4RJ2A 2VT6A 3CSSA 1W7AA 3D7NA 3FGOA 1T9GS 3ZV3A 3U44A 3R0VA 1BD4A 1SO8A 2W6CX 2F1RA 4WE3A 4AJPA 4F56A 5EEGA 1FFYA 1PQ4A 1RYNA 4YJ2A 2F3SA 2WUDA 4IJWA 4ZEVA 3T41A 3IE2A 5C53B 4DCOA 1NBMD 1G5RA 1FP1D 1E8DA 4HAXA 4CMGA 3ZS8A 2Q4DA 3AL0C 1ONOA 2Z30A 1V9LA 3AF2A 3QW2A 1DJQA 4WEOA 4CLRB 3ZD7A 4O3MA 1UC4B 4TYQA 5LB4A 3RLFA 5A04A 4G07A 4IMIB 4QNRA 3O8QB 3SFTA 3MS2A 4X61A 1I32A 1LDNA 3ESXA 4YAOA 5DI3A 1QQ7A 5EMJA 3S8EA 4MA0A 2DPLA 4B45A 1UFRA 2QS9A 2YHBA 2NU8B 5KOHA 4DIOA 4LVOA 3ZD9A 3PJFA 3L6OO 3NVMB 3W4JA 4U7PB 3G9QA 1C80A 3TAUA 3AHFA 3HA2A 2QY6A 4YPOA 1DC4A 3U3ZA 1ZM3A 1HYGA 2DBRA 1F06A 2G09A 2NTVA 1CZKA 2RJNA 4BQEA 1WABA 4NR0A 4GECA 3FZQA 3QF7A 4OK5A 1CFZA 1MMFB 3R7WB 3A4VA 3EQ7A 1M1YE 2C5EA 2ZJFA 3ECSA 1VG8A 1ZWKA 1JJBA 3GEEA 2QRMA 4M9SA 1U0RA 1WUHS 3FTFA 4GSLA 3PWZA 2FUNB 2P11A 2H48A 2C5HA 5LQRA 3KTFA 3JY6A 5JNUA 3N70A 3Q1LA 3WADA 3A0RB 3NX4A 4IGIA 1XKTA 2QM3A 5F1PA 4MA4A 3ZVLA 4LF6B 4D8VA 3E23A 5HJEA 2H11A 4NPAA 2FFHA 3FB1A 2PGXA 2UVPB 4PLPA 1XVVA 2HA7A 2O0JA 4FGZA 4O4JB 5F76A 3X1MA 1AUPA 4C3ZA 5I7OA 1CSEE 3ZJVA 5HTOA 5I3ZA 2QR3A 3OJWA 1ZOPA 1PQUA 3FZNA 5AVVA 5DJ5A 5EIHA 1ORDA 3UMJA 3FWPA 2ZYDA 2GAOA 2CL6X 1WD5A 1KMNA 3F46A 2ZBRA 3UATA 2Q9BA 5FBVB 2IHKA 4NZYA 4UBLA 1FSPA 2X5KO 2YVUA 4UDYX 3SJBA 5HGXA 1CR4A 3I30X 4OREX 4XPZA 2UXBB 1F5SA 4QVIA 1SD5A 3H6GA 1VSUA 5EYPB 3QX7A 4X8HA 5JNVA 13PKA 2Q5QA 3ABIA 3NV9A 3CVWA 1N5LA 2AUMA 4QTTB 2CHFA 4QQRA 3KXPA 3UUFA 3VJKA 2LUOA 1YJXA 4E5VA 1V6CA 4J16C 3W6ZA 1MB3A 1JDUA 2W6JD 4Z9BA 2OZKA 1QYWA 5L8VA 2V55B 3M6IA 4E1VA 3M5DA 3OOWA 2ZS7A 3HEBA 3LGSA 4FUQA 5FOSA 5KWEA 3K53A 4KDEA 4D57A 4FM9A 4C4SA 2PGJA 3IPLA 4PGMA 1XELA 2UXCB 4GD3Q 3VVMA 3K7EA 1CQPA 1NAIA 1ABBA 2CLIB 3LS2A 1QK5A 2QGZA 1LS6A 2AZTA 4ZRNA 5JAUA 4LSGA 2PH1A 3VFDA 1E1RD 3OY2A 3RRJA 1KU0A 4MW1A 4RNCA 1DFIA 5LP6C 3VNAA 3IR7A 3PQ6A 3HCCA 3I45A 4WOBA 3KHTA 3MT8A 1S1MA 3O03A 5FFFA 3V7WA 1N0UA 1WQ3A 1U7XA 5A03A 1VC2A 3TBKA 4O4HB 4B8ZA 4QPNA 2XWQA 3NUQA 1KQNA 3JVVA 1T4BA 3IERA 4MYSA 3E5RA 3EFOB 3OZSA 3EXIB 5F5NA 5A4MS 5KQSA 5KYYA 3RAEC 3WK6A 3K6SB 2FP4A 2VATA 3EXEA 2NYUA 3VH2A 1CQJB 4WBSA 1YE3A 5CCEA 2B36A 1YQEA 1V7PC 2J5BA 3EVEA 2HD4A 3K0FA 5CVEA 1Z56C 2OVBA 2WTXA 1XU7A 2PSJA 5EZQA 4RX1A 1KYZA 5BO5A 1X9HA 2BY4A 4BBPA 1L5RA 3HVKA 2SKDA 1JQBA 2EJBA 1GFZA 3F5QA 4V0QA 4XYGA 4M1OA 3VDRA 4CKBA 4DIUA 2H1LA 3OJCA 1XQ6A 4BLSA 4WJLA 1F20A 4M1QA 4KLRA 4A16A 1OR8A 4FSXA 5G53C 5JPDA 1JLRA 1E2JA 2HWYA 2I03A 4MQEA 5BR1A 1FQWA 5LZ8A 5E2AA 1GPBA 1N3LA 1MIOA 4GX2A 2ZRMA 3LT4A 2R7AA 3UGQA 2GQ0A 4DM4A 1T10A 2EZ8A 2NO5A 1GTRA 2C5GA 3LP6A 2YJNA 3MG9A 4YMIA 4RF4A 1KOGA 3D3EA 4PHGA 5IT9A 3T15A 3RYTC 5I45A 3HCDA 4Y2YA 4RKEA 5LQKA 2JBHA 2JL1A 3FDZA 5ALWA 3RWBA 4HD8A 4GWGA 4BMCA 1R8QA 3AEUA 3TX6A 3S1MB 3UPDA 4AJ9A 2ZYAA 2H9YA 4PS0A 3L1VA 2F8TA 1MQ9A 5DM4A 4DDTA 1L5HA 1ZVKA 2J32A 5H02A 2IOFK 3PFNA 2O57A 4DMLA 1AHNA 1Z4OA 4ND7A 5EHQA 4EG5A 3PWSA 1E9AA 2X4IA 1WCXA 4JUCA 1PEAA 2O7SA 1VE6A 4B75A 3CLHA 4P5DA 4EDHA 2CV1A 2PZAA 4D74A 3EJ6A 4UKDA 2FPKA 2BOVA 2KWIA 1HSOA 2WVHA 3WLTA 2ECPA 2H2IA 3I62A 1TC2A 2F1IA 1X7YB 1ZZGA 1Z5OA 1XYGA 1OXTA 2G76A 1IN6A 3RS0A 5H9VA 3VR4D 5IN5A 5L51A 2CL0X 4IVQA 1KYYA 1NW3A 1LPNA 2RAPA 4LWQA 2NU6B 4N5HX 4N3AA 4BAGA 4ICIA 4OIFA 4WN9A 421PA 2BR5A 2XBMA 2W6NA 1FP4A 3GAAA 4OFBA 2OGZA 4IGFA 4YT8A 3OUZA 1XAHA 1QFYA 1YUMA 1XZLA 1PR0A 4KO1S 3IV6A 4WLVA 5JTUA 2FDCA 4EPWA 3TPFA 3O95A 4MWDA 1Z12A 1T0UA 3LVBA 4EW3A 1V11B 1GG8A 2IHJA 3ZD8A 3WGVA 1DUSA 3IALA 1AURA 2ZFUA 4RVGA 1XCLA 1AUOA 3RWOA 1PYGA 4ZV7A 5EKTA 1Z28A 1OV4A 1TK2A 1YDFA 1TM7E 3Q7RA 1IM2A 2C5BA 2P9EA 4LYAA 4V1CA 2XKKA 1H3EA 1ZUNA 1EVYA 1DQYA 1L7QA 3TBFA 4RTKA 1QV9A 4GOXA 2GFIA 4DT1A 2FQYA 4O2LA 5CGZA 5CBPA 3FSJX 3G23A 4W1QA 1X3LA 3TQHA 1U63A 4X64B 2JEOA 1E2GA 2PH7A 3VR5D 2PNJA 4B7CA 2GLUA 1P1KA 1UBTS 2B92A 4TV8F 1TQ4A 2XNDD 2DPGA 4G5FA 3OPQA 1CZOA 1D4AA 1P6UA 2PXHA 2CB9A 3GL9A 4KVGA 4MPJA 4LVUA 5C8DA 3AW9A 4ID9A 2WU3A 4NV1A 1OBFO 1PYDA 1H1TA 2C2MA 1Q14A 3EA5A 5HHTA 1NA5A 1QDEA 2MT9A 3IXQA 3KYDA 5GY7A 3WBKA 4WVFA 4ZEMA 4DNQA 3EVNA 4CODB 2KBFA 1QBGA 1P3JA 3LWDA 1Z06A 5KKAA 4EKIA 4RTOA 4PG6A 3R0XA 3A0UA 2X0FA 1JFRA 1B26A 1ORVA 2KI5A 2BKAA 2YBEA 3GGJA 1BCRB 5JCXA 2XQIA 2I6FA 3LPDA 4UVDA 5IUKC 3EN0A 4IWNA 2X1VA 4C43A 3JYLA 3E8SA 3U7EB 2X13A 4OEHA 2AD1A 2VUHB 1N5IA 2DJIA 4GKAA 4HLDA 4OQDA 1CX9B 1A9RA 1IN5A 2AQIA 1VHTA 2ECOA 3VTFA 2K2QB 3AEXA 2V96A 2VHVA 3ZHXA 1D09A 4OX9B 4GBGA 4Y98A 4AG6A 5JFOA 2D1RA 5E6SA 4TWBA 5KYNA 2YS7A 1JFTA 2I2BA 2XCQA 1HE3A 4MRPA 3DT8A 3KWFA 5BRNA 1AKNA 2GFHA 1MC8A 1BXGB 3TJZA 1M2NA 3R7FA 2JLAA 1QC5B 3C1TA 2PQ0A 2QSZA 1U1DA 3PC6A 4FEYA 4DZTA 3T1YB 1P0PA 4BZQA 3M6XA 1Y8ZA 2C8VA 3LCVB 5ES4B 1UJ4A 1X87A 5LKAA 3IL2A 2AC7A 1EQ2A 1PZEA 1VKZA 2FR1A 3DD1A 4UNPA 4LXGA 3GTMB 1P7YA 3GNTA 1MB2A 3S70A 2EEZA 5CNIA 1XNGA 2PX3A 1IXSB 1MHTA 3VU9B 5COQA 5ALMA 2XW6A 3A4LA 1PVOA 5DEIA 3E2MA 4TKUB 5KJFA 1SD1A 2QY9A 1QHNA 2J0VA 5K8CA 1GZ7A 1IEVA 1LX7A 1UR5A 3GT0A 3O38A 3B1WA 3R3VA 5AHRA 1ZK0A 1FYFA 4ISBA 3TVTA 1ISSA 4Q1AA 1HLFA 1U99A 4OM7A 2Q28A 2ZR7A 2DLNA 3EDCA 2CKDA 2W5UA 3PXDA 3UH0A 5IWAB 1J7KA 1P5FA 1TJ5A 2DCUA 2I76A 3AF1A 3NANA 5U1PA 3HXLA 4RZ3A 5DWDA 4BWGA 1BFUA 4WNIA 2AJTA 3CB4A 3F78A 2D13A 3UWPA 4D8UA 5LXTA 3OZDA 4K9QA 3H86A 4YDQA 2V6BA 3PX3A 4W5NA 1U7WA 2HCTA 2QSYA 4YALA 4TZ6A 4GDMA 1DOHA 1T2EA 1V1MA 4F6LA 1QGDA 1PZGA 4FX2A 3CZRA 4UE3S 5FBQB 4MRMB 4PLCA 3W2HA 2OBYA 5KEIA 2NMVA 1DS6A 3R7BA 4CTKA 3RREA 1KP2A 4CUJA 1OJLA 1RLUA 2MU1A 3BCUA 3ILHA 1Y5NA 4J0CA 1DDIA 3MJRA 4JB0A 3DFUA 5JCZA 1CRQA 1PJBA 3CPHA 3MLAA 2FX3A 1ZK2A 5JRJA 2ZW9A 3U09A 3P52A 4ZVPA 1YZ3A 1GDTA 1GLVA 3UWKA 2SICE 3D31A 4BFXA 1VKRA 2AG1A 5B3KA 4RKFA 3WQQA 1XVIA 5CEFA 3G8AA 1IZ9A 1NL3A 1SBZA 2ZG6A 3FUWA 3QLTA 2QL9A 1YIDA 3PC8A 1UZLA 1JHQA 1GNLA 2HJ9A 2AEJA 2MYTA 2H2AA 3QEOA 4GVXA 3TQCA 2EBFX 2WAOA 1PUJA 2R8BA 4DNOA 3A4MA 3D6UA 4EKGA 3AV0B 1HZZC 1F0PA 3LBHA 5FUYA 4C88A 1E1NA 3EH2A 1T5BA 1NDUA 5ED4A 4ARAA 5JYBA 3K1AB 2W4IA 3AH8A 5ENVA 1JJAA 5C4GB 5AVSA 1WMEA 2R4TA 3IAM6 2FFJA 3OQHA 2WUFA 5CK5A 4LTNA 5JS7A 5FBLB 4AXXA 1UXGA 2VH1A 3I12A 1R9NA 2HBZA 3VR2D 3RQSA 4DCUA 3D3NA 4NCNA 1Q7RA 4F5WA 4Y6GB 4YRAA 3EGXB 4V38A 4A3JB 1E1DA 3QKRB 3OLQA 4XGQA 1NQAO 3H05A 4FYVA 2QUIA 1VYHA 4MRAA 3PVCA 1A1VA 3ZJ4A 2JD1A 4HRAA 2ERCA 1G9SA 4A6PA 4TS9A 1KEKA 1CHDA 4LYEA 1R6TA 3HJHA 2GJ9A 4IH4A 2IV3A 2QXYA 3KYCB 2BGTA 2ZE7A 3AEQA 4CTOA 2WFLB 2QTCA 4OXQA 1E92A 4NS4A 1R64A 1QGED 4EHAA 1H9CA 2NU9B 2C88A 3P8ZA 2A9FA 3IXMA 2QP4A 4QVGA 2OLJA 3VNQA 4DG5A 1ABFA 3HS3A 5FV4A 2D62A 4GSKA 1IJEA 1VRWA 4FKZA 4BNVA 2CYCA 4YRKA 3VUFA 1NPDA 1ID8A 3PNVA 4INPA 5JD6A 1TEHA 3S8MA 5A4KA 5JMOA 1R7RA 5BT9A 4Q3AA 4NJEA 1FYDA 5FBHA 4JC4A 1TWFB 2X5NA 5BORA 3ETLA 1NMYA 2GBFA 1H0SA 2WHEA 3C4QA 3MRSA 3TOSA 5EEHA 1PJZA 3BGSA 3KEGA 1TYZA 4H6PA 4QJ3A 2ZE8A 3OPYB 2SCUB 1WZCA 2ZR9A 3KALA 3ZLTA 1YCHA 3I4LA 3QVTA 2IHUA 3VDMA 3QYJA 1S02A 3P0IA 3NBXX 4IXMA 2R7MA 4A6EA 1J8MF 5JSHA 1WETA 4HDNA 4Q12A 3DLBA 1ZRMA 2ETXA 4JYPA 3AB8A 2G4VA 4TV8B 1BNCA 5DGIA 3HCFA 4C22A 3QXGA 3KWLA 1K6JA 5AJWA 4Y2PA 5DASA 4LIPD 2Y99A 2EBHX 2FSUA 2GO7A 1TUIA 3BSWA 4X7BA 1WSAA 4UW9A 4CHGA 2NN3C 4LMAA 4UUNA 3LDGA 4H0NA 4DA9A 1DBQA 4H7DA 3KVOA 3VPAA 3O6VA 5KNCA 1E0JA 4M9RA 2QN1A 3LW8A 3RVQA 4I6EA 3BFXA 3K9NA 1UJ2A 1P1HA 4L75A 3T9AA 3SYTA 1QS0B 3UK6A 1ZA1A 1X1CA 2UYGA 3VI3B 1NBMA 2PKYX 4EHKA 3D59A 3L4KA 3AY3A 4DKJA 2XH8A 3RGGA 2J1LA 1XL1A 4IJQA 1W88A 5D87A 2IYVA 1N7GA 1DKOA 3CGWA 2GTHA 3EF0A 5IJ0B 4XWTA 4YRCA 1L1QA 2C1EA 1A7KA 1Q1EA 2JIMA 1FMTA 1RRGA 2O06A 1W1UA 2WINI 2I2DA 1UXIA 2HTFA 1E5XA 2C2HA 3L41A 2AIRA 3LWBA 4EITA 5ALDA 5ELXA 2QVZX 2PZ8A 4Y6QA 5DYYA 3BFPA 4GOMD 2YQZA 1GG5A 1AJEA 4BUCA 3ZI0A 2BHNA 1T6NA 3IUJA 3KFLA 3LPMA 3C6QA 4NZNA 3HM9A 2Z4RA 3ISTA 1U7ZA 4FOOA 1R5BA 4JLVA 4IIHA 2X0DA 3VPHA 1QGYA 3C48A 3ST7A 5TY0A 5A5FA 5AMXA 3AKEA 2O7VA 1K06A 5KQMA 3PQEA 2GEJA 1IBMB 4TTJA 3K0AA 2DTXA 2R1UA 3KLPX 4R1QA 1I30A 4CU5A 1NM5A 3LCUA 4FXPA 5GIPE 4V0MA 3S28A 4BTLA 1RPTA 2IBSA 1ZBDA 1EJ2A 2WOOA 5IYZF 3V48A 3NTQA 3WIBA 2VN8A 2WHPB 2NOAA 4FU0A 1OX4A 4PQEA 3SJUA 1Q0RA 1KZ9A 1USUA 3Q3IA 1NN5A 2RGNA 4HEA1 1A8QA 4I1RA 4UHDA 4B87A 4A2CA 2I67A 4J91A 5LKRA 2GHQA 4YUAA 1IQUA 2I71A 3SKXA 2B2CA 1W5AA 4TL9A 3HACA 3U17A 3IAHA 2J45A 4BNIA 5B7NA 4IR7A 2BCGY 3ICQB 1J22A 4A1FA 2QX9A 2IVFA 4BX0A 2A2ZA 2O3RA 2I7CA 1W29A 2VNAA 4GX0A 3UBMA 2H2FA 4X6YA 4K0KB 4HFJA 3EXHA 1GTZA 4KRYA 4BBJA 2XT0A 1RBQA 2DQKA 2G1JA 2ZI3A 5TT0A 5BWBA 1WUTA 4R31A 2XRZA 4BTVA 3H9BA 2C78A 2W0MA 4TUYF 4HAWA 3AKCA 3HP1A 1YXMA 3CUTA 4XLTA 2A33A 2D5IA 3HP7A 1UXKA 4NIMA 1VI2A 4RCYA 2IIVA 4YWJA 3LY8A 3JD4A 1QBKC 4MLCA 2JJ2D 4W6ZA 5MFZA 2OQIA 1RXSA 5J3JA 2RH9B 3CISA 4R05A 5EVJA 3AG5A 3T99A 2PQMA 4ZT6A 3B85A 2EQ5A 4I3GA 1KQOA 2V7WA 3ZQUA 2WA1A 3VNRA 2RC5A 4DV3B 3KVVA 1G38A 1TA9A 2JIBA 1G6KA 1U2DC 2ZIZA 4X7PA 2QW8A 1T26A 2E6UX 8OHMA 2I2CA 3DQQA 1F3LA 5T67A 4YFYA 3AKZA 3R0JA 2AXEA 1YVEI 3GLSA 2BGGA 2JA8B 1UAGA 3DXFA 5M7EA 2CNOA 4RD0A 4JGIA 5MGBA 1RP7A 2W6JA 5KOYA 5PGMA 3KWMA 1SHTX 3HFSA 2AMFA 1DUVG 2G06A 3JRXA 2QX4A 3K8QA 4O4IF 1DBPA 1PGOA 2WE8A 4LRXA 5AI5A 1C7IA 3HB7A 3NM6B 5EJ7A 4QM6A 1TO2E 3IVRA 4JEHA 5SICE 2PBLA 2X7HA 5ELLA 2ZSUA 1ZOSA 1Z68A 4FX5A 5FOXA 1XZKA 4MS4A 1FDRA 4B79A 5KNLA 2EG5A 2Y6UA 2X4GA 3EVBA 3KSBC 5K1ZA 3SS9X 5M5YB 4C7XA 1E1RA 1L2TA 1T8SA 3AU8A 1IOWA 4DN6A 821PA 1H2YA 1Y6GA 3M4ZA 2BFFB 5L3VA 1Q19A 3BWBA 3V4RA 2FPIA 4L8GA 1M34A 1JLLB 1B8PA 3DJFA 4CLXA 1BE8A 1W581 1XT6A 2GPBA 3R3HA 4AMBA 1Q7EA 2OORA 4FONA 4XIGS 5AIAA 4UNIA 1CUBA 1YH3A 2X0JA 3N0RA 5AW7A 5JJIA 2NXWA 3MJEA 1V35A 4YT4A 4XUDA 3CJQA 1YS7A 1OZ0A 2ECKA 1QZZA 2PMCA 1IXRC 4NYMQ 1DKUA 4BMNA 3GRYA 1OGJA 2ERXA 2ZULA 4FDUA 4D92A 5KWSA 2FZEA 6NULA 4OK3A 3B3QA 4MUJA 5D3ZA 1TK9A 1UDBA 4LXQA 4HDOB 4HXGA 1AB5A 5F21A 1WBDA 4FILA 3E3AA 1CZLA 3QVJA 2C42A 3CVUA 1XP5A 2YZGA 1QJCA 1Z75A 2B8TA 4YRFA 2DCMA 1DKLA 1RLTA 3HZHA 3V97A 3UPUA 4ZQEA 4EF4A 1KDZA 2VNKA 3ROTA 2QG6A 3ACDA 5C5IA 3GHHA 6ADHA 1USIA 4PS1A 2ATIA 1IM5A 3OU7A 1E3DA 1F8UA 1Q0SA 2CB0A 2D5CA 4CQMB 1N4AA 2QZSA 4FNOA 4MINA 2R68A 4G85A 4PQGA 3R76A 1HWYA 4AJNA 1R0ZA 3V4FA 1DXYA 4MIYA 1XVLA 2R7KA 2VOEA 2B7BA 3IUPA 3NGLA 3T3DA 1WPRA 4DRXB 1CJTC 3OECA 4E08A 5CH3A 3V8MA 4UZSA 3BORA 2BUCA 1KC3A 5E4JA 2CV0A 2XITA 5DTJA 5EP3A 4HAYA 1GRCA 3MGBA 4RDHA 1UBGA 3TZLA 5C51B 2YIJA 5T4BA 4ARBA 3R77A 1Z0IA 3HWWA 5L4SA 5BSTA 2YV1A 1D2CA 5LJLA 3ZDYB 1A7UA 1FQOA 1I13A 1GNQA 1O89A 1M33A 4OM8A 4RU1A 1HT2E 3K6KA 2HF7A 3GJXC 5JJ5A 4LE0A 2FUCA 3JQ7B 3CKYA 1A9QA 1RRVA 1V5IA 2VTDA 3N0WA 2W6MA 1GCGA 2G1PA 1DG3A 1E3LA 3F3MA 3EG5A 4JU9A 2CVOA 3TTYA 2A30A 2Y6VA 1NHWA 2DT5A 4LDNA 3VR4A 3A3YA 1CY8A 4D8XA 1QRUA 2NSLA 2L69A 3QVWA 2GYUA 1AQIA 4RWZA 2I8AA 3G0DA 3ORHA 1GUBA 3LFHA 4JKYA 4IIDA 4KO2S 4AQDA 4DJ5X 1GNTA 4DLRA 4IOLA 5BUZA 2X8AA 4HQRA 5EIBC 5IFLA 4DA8A 4EG6A 3HJGA 3GY0A 4YCBA 2GCOA 2ZIFA 4EZEA 3VOSA 2JGLA 4HB4A 3GLFE 1HYHA 1N25A 2WSYB 2XZPA 4L57A 1NKTA 4RFLA 3RYCB 5C7IO 4KQFA 3I1YA 4LW8A 1SUFA 3C43A 4HYTA 4QOFA 1NQTA 3VC3A 4LISA 3QKSA 1I94B 3HPRA 3KKZA 1GT6A 4MITA 4ZEWA 2Q7DA 4C14A 3A6KA 2B61A 3BMOB 5G02A 5JAZA 5A4IS 1G4HA 3PJRA 2A1UA 5JAHA 3OT4A 2H4FA 2WMYA 2QRJA 1N1DA 3JQPA 4KXNA 3AI2A 1JG2A 4OGLA 1Q0HA 1EDDA 2GZDA 1H5UA 4CQNA 4ZAFA 1DX6A 1M54A 3JQEA 3ZOKA 4CMJA 2FKNA 3HXOA 2C5LA 5EFZA 5I01A 3V4SA 4A8TA 2AC4A 4J0GA 4BUZA 2ZJ6A 4IV5A 2R1TA 2NT4A 2VQ6A 4RYLA 3G7NA 1ZRNA 4TQ9A 5ALYA 3VR5A 5IYZB 2O4UX 3DFFA 1ZSVA 5K3EA 5KDDA 3LKBA 1VMKA 3V1UA 1CETA 1KMHB 2XNDA 3LBAA 3ZX5A 4MRVA 4F92B 2FWNA 2EOAA 4W5HA 3SF0A 1VLZA 1PR4A 1CUAA 3UXHA 2RKOA 3AYZB 4RH0A 4WAUA 1H6CA 3E7DA 3CRVA 3WIEA 1GT91 3ZNQA 5IN4A 4TN1A 4MUIA 3GIWA 4YACA 3WLAA 2P3OA 3LZDA 3PXBA 3QOWA 1FXWA 1A3CA 5TQ2B 5K4HA 3KYBA 4U39A 5M34A 2CHEA 3MB5A 1F2TA 3N7AA 2ID4A 3WYBA 4JLBA 1PKXA 1E9BA 1ZIDA 3G5AA 5LUBA 1QFSA 2HB6A 1LFDB 3CZ9A 4FBLA 4H59A 1GU0A 2VF2A 5JWOA 1DBVO 4ONEA 4X20A 4YJDA 2WF6A 3HB1A 4YUXA 4LN1A 4TT8A 4X1YA 2CD9A 4NEGA 1V37A 1R8YA 4TUYB 1QIKA 5FPSA 1NLUA 4ENQA 1IY8A 1LLFA 1YB4A 2DBVO 1NLYA 3RSGA 4DJDC 2AG6A 4GICA 1U94A 2OV8A 1E2DA 2X9GA 3GH3A 5IC5A 3G8BA 1UOPA 1HZJA 1Z36A 2D7CA 3JTEA 2B5VA 3HUUA 5ESXA 3M34A 1NRWA 2IE8A 4A82A 4I66A 4BL5A 5CCBA 4QG3A 3SQOA 5IAOA 2Y8EA 2HF9A 2YWCA 1MJFA 3RT9A 3ZQ4A 1MOQA 5JQGA 2RE8A 3P9KA 1RM3A 4GS5A 3DQZA 3TIFA