2QY6A

Crystal structure of the n-terminal domain of upf0209 protein yfck from escherichia coli o157:h7
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
246
structure length
244
Chain Sequence
b'SLKHYSIQPANLEFNAEGTPVSRDFDDVYFSNDNGLEETRYVFLGGNQLEARFPEHPHPLFVVAESGFGTGLNFLTLWQAFDQFREAHPQAQLQRLHFISFEKFPLTRADLALAHQHWPELAPWAEQLQAQWPMPLPGCHRLLLDRVTLDLWFGDINELISQLDDSLNQKVDAWFLDGFAPAKNPDMWTQNLFNAMARLARPGGTLATFTSAGFVRRGLQEAGFTMQKRKGFGRKREMLCGVME'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0209 protein yfcK
molecule tags Structural genomics, unknown function
source organism Escherichia coli
publication title Crystal structure of the N-terminal domain of UPF0209 protein yfcK from Escherichia coli O157:H7.
rcsb
total genus 89
structure length 244
sequence length 246
chains with identical sequence B
ec nomenclature ec 2.1.1.61: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase.
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05430 Methyltransf_30 S-adenosyl-L-methionine-dependent methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2qy6A01
2VDVE 2LD4A 4A6EA 4AZVA 3EVDA 1JTEA 1M6YA 2PJDA 5EHIA 2YR0A 4PYLA 4X1OA 3P9IA 1NW3A 3BKWA 3SSOA 3T7TA 4F84A 3KHKA 4PYJA 1SG9A 1NW6A 1SQFA 2P8JA 4YUYA 2PVCA 5HIKA 2HTEA 3EVZA 2IDJA 3K6RA 3LX6A 4KVZA 3HEMA 3TM5A 5BXYA 5CIYA 2Y1WA 1HMYA 3AXTA 3HCDA 5E1DA 5GM1A 1JG2A 2GLUA 4K6MA 5FCDA 3CBGA 3ME5A 5LQKA 2ZWVA 3O4FA 2PXCA 5EMKA 2G70A 3PX2A 4KDRA 1RJDA 1QYRA 2AVDA 1KPIA 3EMBA 5HFJA 1OR8A 3RW9A 5K01A 3BGDA 5HEKA 1G8AA 3PS9A 3C3YA 3GRVA 5F2OA 3T0IA 3PLAE 3LPMA 1BOOA 1MJFA 2XVAA 1IM8A 3GRRA 1RJGA 3TQSA 3REOA 2EX4A 3HA5A 1P1CA 2O06A 2PT9A 3G7UA 3A26A 3KPYA 3M33A 3NW9A 4FP9A 4HGYA 4QDKA 2C7RA 2G71A 3FPEA 5FHQA 3OZTA 2Y1XA 2ZULA 3I53A 3LDFA 1SUIA 2PWPA 3EGEA 1VBFA 2PX4A 3KR9A 5FQNA 5ICCA 1ZG3A 3F4KA 2Z6AA 4P7GA 2GB4A 2I7CA 3DXXA 3C6KA 4U7PB 4AZWA 3G8BA 4IKPA 2DULA 3SM3A 3HVIA 3KKZA 5K0BA 5GINE 2ZCJA 1RI2A 10MHA 5H02A 1L3IA 5K8VA 2HR1A 1RI1A 4RWZA 2P40A 5GM2A 3LCCA 3HTXA 4AZSA 1L3BA 3LKDA 3ELUA 2UYHA 4ER5A 2ZIEA 1WZNA 2CKDA 5U4XA 1NW7A 3KQTA 1AV6A 5ERGB 2JH8A 5K05A 1AF7A 3VC1A 1EIZA 1Q0SA 3P97A 4GOOD 4R8SA 3UJ7A 4ATNA 2OO3A 3A4TA 3UJDA 5DT2A 2BR3A 3G2QA 2PBFA 3EVAA 5M5BA 4QVGA 2XBMA 3EGIA 4GQBA 2FK8A 5DSXA 2YVLA 4E30A 1XDSA 4YUXA 2AOWA 1NBHA 2O0LA 1P91A 3G2MA 3GXOA 5CM2Z 5K0GA 3BT7A 2ZZKA 4KDCA 5K0NA 1QZZA 2AS0A 1UFKA 5FQOA 2QRVA 1JG3A 3CJQA 3JWHA 1VP3A 1N7IA 2JJQA 2EJUA 2V7EA 1RJEA 3EPPA 4RVFA 4EKGA 2IIPA 2OKCA 2GPYA 3FUUA 3KPWA 3O7WA 3DOUA 5DTMA 1ZKDA 4RX1A 3IEIA 4E2ZA 1YFJA 4GC5A 2PY6A 3P8ZA 2OBFA 4XUEA 5K0FA 5LQRA 3ANXA 4RTOA 1KR5A 3KPVA 4PWYA 4R6WA 5CVEA 1KHHA 1G38A 1HNNA 2OB2A 3P2EA 2OPBA 2AN5A 4P7JA 1XTPA 1XXLA 3A25A 4EQZA 3CC8A 2V74B 5DM2A 3UZUA 4YMHA 3B3JA 3NJRA 5FA5A 1WXXA 2ZBQA 3JWGA 4HH4A 3HCCA 4MIKA 2IH2A 2NXEA 1IXKA 5FWAA 1JTFA 1Z3CA 5F2KA 3BGVA 5GP1A 3IHTA 5K09A 2ADMA 5DX0A 2I62A 2AOUB 2PKWA 3NMUF 3BWMA 4R05A 1O9HA 2GH1A 1ORHA 3DULA 3GIWA 3I5UA 3IYLW 3E23A 2B3TA 2VZ9A 4FZVA 3E05A 4HTFB 8MHTA 5MHTA 1VL5A 2Q41A 3GU3A 2OB1A 5DRYA 4F86A 5EEGA 5CCBA 3MHTA 3G8AA 4P7FA 3ERCA 5EKXA 1JQDA 1R6AA 1YUBA 3EEYA 4C04A 3CGGA 3SR4A 1V39A 4FR0A 3KQYA 1KYZA 1NV9A 3MTIA 3NTVA 4PYQA 3AJDA 4E70A 4OA8A 4QQKA 4V0RA 5DRTA 4RV9A 4RTLA 1XCLA 5CVDA 5GIPE 4C07A 4PCLA 1SVUA 2O07A 3LHDA 5HIIA 4PYMA 3NWEA 4DMGA 3JWIA 3KQMA 4KIFA 2PT6A 4U7TB 5G02A 5EVJA 2WA1A 4PIMA 5E9JA 2CMHA 2O57A 1G55A 5FUBA 5EEHA 1KIAA 1JSZA 3M70A 3T7RA 3TKAA 3PB3A 4KIGA 3LL7A 2DPMA 3OU2A 5IH3A 3FRIA 2XYQA 5BW5A 2G8NA 3AWIA 4OQDA 5EMLA 5JUWA 5DM0A 2BM9A 4UOEA 5CD1A 4QTUB 4BLWA 4E2WA 2R6ZA 4X60A 5IKMA 3FPHA 2H00A 3HNRA 3AXSA 5T6BA 5EZSA 5K0EA 3KQVA 5EKUA 3LDUA 4HRAA 5DPMA 3CJTA 2I6GA 2XYVA 1BKYA 4P7KA 5C9ZA 2JHAA 2YTZA 4QDJA 4RTMA 5BP7A 3NDJA 1FP2A 3E7PA 4PIPA 1RI4A 3UFBA 4CKEA 4DKJA 3HVJA 4ZTBA 5ICGA 3DMHA 3DUWA 3HA7A 4YV2A 2IDKA 3EVFA 3MCZA 5EZQA 4RTKA 3MQ2A 4EK9A 2QYOA 4A6DA 3VYWA 5CVJA 5ICEA 2NP6A 2FCAA 3HCEA 5T67A 1VLMA 3PTAA 2PV0A 2JG3A 4C05A 2EJTA 2NXNA 3V97A 3C6MA 3HA3A 3HM2A 3DMFA 3B5IA 3OFJA 1EAMA 1SQGA 1ORIA 2OY0A 3GGDA 3HCBA 5K0JA 3ER8A 2JH9A 1JQ3A 3TLJA 2AOVA 3VC2A 5DWQA 3SSNA 2G1PA 2PGXA 5LQCA 1X19A 2NP7A 1RJFA 5E8JA 1ZGAA 3S68A 2AOUA 4BY9E 1INLA 3NVKI 3BGIA 1F38A 4OBXA 3MCTA 4WXHA 2H11A 5EMMA 5KYGA 4EVIA 4M38A 2I9KA 5E2AA 4RSRA 1QAQA 3B7PA 1G6Q1 5C1IA 2GA9A 5CVUA 1IY9A 2ZVJA 4PGGA 4BLVA 1ZGJA 3G88A 4CKCA 3EEOA 4M36A 1R18A 4PONA 2ZWAA 1X1CA 4DCGA 3DTNA 5E9QA 1KYWA 3PFHA 4POOA 3OCJA 3P71T 5BW4A 9MHTA 5HZMA 5GIOE 3DMGA 3GRYA 2VDUE 3NVMB 2AZTA 3SVZA 3LSTA 1XVAA 1TW2A 1Y8CA 4G56A 4GEKA 2JHCA 3CJRA 1AQIA 3MERA 4X61A 2PX2A 4AUKA 3HVKA 5LQJA 1KXZA 1AQJA 4MTLA 1DCTA 2CL5A 3LCUA 4EMSA 5LSAA 1H1DA 4DZRA 3FTFA 4GOMD 2IBSA 2ESRA 3LECA 3OU6A 2C7OA 1BC5A 4GOND 5HIJA 3DLCA 4PCAA 2IBTA 1I4WA 4YUWA 3AY0A 3UJBA 4HSGA 1FJXA 3GO4A 3UA4A 5EPEA 5KVAA 1D2HA 3M6XA 3P2KA 2QE6A 1R74A 2OXTA 4X63A 5DTRA 4F85A 4DM3A 3OE4A 3LBFA 1NBIA 4WVLA 2ZBPA 2HV9A 1SKMA 2B25A 1D2GA 4M7RA 4GUAA 4YUVA 4C06A 4RVHA 3OPNA 4R8RA 3EVEA 3KQSA 4CTJA 2UYQA 1X1BA 2P7HA 4HC4A 5DX8A 1RI3A 5C0OE 1WS6A 5E2BA 1O54A 4LG1A 4E2YA 4QPNA 3THRA 1P39A 2O05A 3MB5A 3G5TA 4KW7A 2ZIGA 4AZTA 3BWBA 2OYRA 1WG8A 4DA4A 5E1MA 1X1AA 3THSA 2AVNA 1T43A 2NXJA 4Y2HA 5B1SA 1BHJA 4RTRA 2YXDA 4YUZA 4CKBA 1JG1A 2ERCA 1N2XA 2R3SA 5CVVA 2Z6UA 3GCZA 4YV0A 4XUCA 4MHTA 5E8RA 3FUTA 2AOTA 2PXXA 5DM1A 2YUIA 2IGTA 4V0QA 3TMAA 1VQ1A 4DF3A 5KS2A 5FA8A 3FRHA 1R8YA 3GDHA 4GBED 3UJ6A 2BZGA 3BXOA 4FSXA 1YB2A 4BLUA 2HWKA 1NW8A 2GS9A 3ELYA 3U81A 2IH4A 3SX0A 4E33A 2PSSA 2QRVB 4HGZA 4PGHA 2AR0A 2P41A 2IP2A 4RTSA 1L9KA 1R00A 1EJ0A 1MHTA 5CUQA 4QPPA 3DXZA 3GJYA 5DXJA 1L1EA 3DLIA 3P9NA 3V8VA 3QOWA 5HIMA 5K03A 1I1NA 3A7EA 2IPXA 4CWAA 2ZIFA 7MHTA 2ZFUA 3R9XB 5EIFA 2ZZMA 4H0NA 1VE3A 4C03A 5JR3A 3C0KA 1ZHFA 2HMYB 3UJ8A 1F3LA 2NXCA 4B17A 1P1BA 2UYCA 3OFKA 4LWOA 5FADA 3TR6A 2NYUA 1QANA 3GNLA 2IH5A 4XUDA 2PX5A 3ELWA 3MTEA 1XDZA 1KPGA 1YZHA 2EG5A 4HG2A 1JSXA 3DR5A 5E1OA 1Q0TA 3RIEA 2PXAA 4OBWA 4CXMA 3EVGA 2WK1A 3DH0A 3KQOA 2QM3A 4HTFA 5EC8A 4E2XA 3KQWA 3OE5A 1G8SA 4FT4A 1UIRA 4RVGA 4GC9A 2FK7A 5HILA 3NWBA 3M6VA 4BP1A 1O9GA 3KPJA 5LQNA 5E9WA 1SUSA 3SGLA 4FGZA 2YX1A 2ORED 4GOLD 3SSMA 3L8DA 5DLYA 3TOSA 1TW3A 3A7DA 3R6TA 3BWYA 3VSEA 2PLWA 4QQNA 2AOXA 4PYKA 3QOXA 2GAFA 5EG5A 3UJ9A 3CVOA 3EGVA 4MWZA 1JR4A 1R8XA 5T64A 2FRXA 5FTWA 3SMQA 1D2CA 1NT2A 3QV2A 1FPQA 5K0CA 3M6WA 2B2CA 5GWXA 2WA2A 4PNEA 4FS8A 1YF3A 5F2NA 3LDGA 3KQPA 1RI5A 2ZZNA 1DUSA 2ZLBA 2FHPA 2NNWB 5EMJA 4LECA 4PYIA 3TM4A 3HCAA 3CCFA 3E8SA 3MAGA 3X0DA 2B9EA 2FYTA 4PYNA 3B3FA 3HP7A 2C7QA 5LQAA 1FBNA 2UYOA 3FZGA 1UWVA 3R3HA 2FPOA 4ER3A 1TPYA 1VP9A 3OZRA 1B42A 1XJ5A 1XCJA 4LWPA 1NE2A 2VP3A 2AN4A 3M4XA 4P58A 1QAOA 1NKVA 4QTTB 1YZ3A 2BR4A 3FYDA 4IV0A 3KR1A 3TKYA 2K4MA 3P9KA 4PYOA 3JWJA 3LKZA 4XCXA 1JQEA 3P9CA 1M0EA 3FUVA 3DP7A 2CWWA 3RODA 4E31A 5LR6A 2YQZA 3PVCA 1VIDA 2XVMA 2P1DA 5DSTA 1KPHA 2QY6A 3EVBA 3R24A 4OX9Y 3ELDA 2H1RA 5GOZA 4RTPA 5FHRA 5EQJB 3BWCA 2PX8A 1EJ6A 3K0BA 3LCVB 3I64A 3GRUA 3C3PA 3ID6C 2ONYA 2P7IA 2YXEA 4PINA 3FTEA 3ORHA 2YXLA 2BR5A 5EOVA 4AX8A 2ZTHA 3G89A 3KR0A 1KP9A 3EMDA 4Z2YA 2VS1A 4O29A 3WSTA 3CKKA 3FUWA 1WXWA 1XDUA 5P8WA 4QVKA 3PFGA 4DCMA 3FPGA 4RTQA 4RYLA 4BP3A 4RVDA 3LGAA 3NDIA 1U2ZA 3BKXA 1NW5A 2AN3A 4RTJA 4NECA 4OQEA 4YV1A 2ZBRA 4ER6A 4FSDA 5EGSA 5KQRA 5DX1A 3FPFA 2ZW9A 3BUSA 1G60A 3Q7EA 1NV8A 4L7VA 3HVHA 5DXAA 3UJCA 2OZVA 1I9GA 1M6EX 4OA5A 3PT9A 3O31A 4YMGA 1EG2A 4FT2A 3FYCA 5FWDA 2IFTA 4ER0A 2UZ4A 1X1DA 4DQ0A 2KW5A 3HCFA 3FPJA 5K0LA 4JXJA 5D1HA 4ER7A 1YFLA 1VPTA 5CCXA 3KPUA 2F8LA 5LQUA 2AOTB 1PJZA 1QAMA 1DL5A 1N7JA 3FTCA 3UWPA 2P3QA 1WY7A 2HNKA 3G2PA 3GWZA 4MQ4A 5DTQA 5E1BA 3OZSA 1ZQ9A 3ER9A 2E5WA 2EFJA 2PWYA 4R6XA 2VDWA 5D1NA 2BM8A 5ICFA 1PRYA 3I9FA 3DXYA 3TPZA 4EKIA 1EQAA 2C7PA 3PX3A 5EIWA 3KU1A 2BH2A 4KRGA 3OU7A 2N47A 4GF5A 3TFWA 3A27A 3UA3A 2JHPA 3H2BA 3P2IA 3G5LA 3BZBA 5EHGA 5KQSA 2XYRA 3Q87B 3GRZA 2P3LA 4IV8A 3UBTA 3B3GA 4KWCA 3T7SA 2P35A 2P3OA 5DM4A 3MGGA 4Y30A 3KQQA 3G2OA 4X41A 3FUXA 2CMGA 3FTDA 2A14A 4ISCA 2ONZA 4IWNA 2ZSUA 2B78A 3EVCA 3M6UA 3SXJA 5HOQA 3LBYA 2Z6QA 1L3CA 4E32A 4C08A 3D2LA 3IV6A 4M37A 1JG4A 4C4AA 4CTKA 3KR2A 4RTNA 1FP1D 3R0QA 3UJAA 5FULA 3B89A 3I58A 3TRKA 2G72A
chains in the Genus database with same CATH superfamily
2JI7A 5EWLB 4JYCA 4WNAB 1CY0A 1TJPB 2X0KA 3EVDA 3PQ8A 4I3FA 4GD3Q 2JLYA 1OW3B 1H8EA 1CZHA 4MEJA 4P82A 5DP2A 1EFAA 3FMPB 3WQRA 3DKIA 2NUBA 4D4GA 1RQ2A 5H83A 4B35A 4ZCLA 5CB4A 4IIGA 4OHCA 1QH8A 1LVHA 1O6GA 4GMFA 4OGFA 1YTUA 3AXTA 5I9SA 1M34E 2XMSA 3HSYA 2G88A 3LO8A 3LU1A 3JAWB 4S1NA 1U1FA 5EMKA 2G70A 4MX8A 3DWFA 3ZD8A 2BKLA 3C3JA 4G0PA 3QOYA 3QSGA 4J8PA 5KYUA 1J7JA 1F20A 1RVDA 2HBZA 3E3NA 3JX9A 3LXUX 3OUZA 2WV9A 4PZUA 3SBEA 3DTVB 3QQ5A 5LPNA 1W34A 2ZG6A 2XVAA 3GFGA 3P2YA 3GRRA 3L8YA 1RJGA 1YNSA 4KTVE 3UMRA 3ZHOA 4CM8A 4CUKA 3LUAA 4QDKA 2IUUA 1QGUB 1K89A 2VT7A 4Y9RA 2Y1XA 3MWLA 3JASB 4I0WB 3EGEA 3L0SA 4NG5A 1Q16A 1X7YA 5GOTA 1MEOA 4WECA 2QPLA 1QHEA 3VPFA 1YMQA 4YRKA 5IZCA 1BSVA 4KQCA 3FFXA 3ENNA 4DDWA 4RNCA 5C5DA 2EFGA 1L4EA 2PGDA 3IP7A 2VKQA 2ZSDA 3GDGA 2WIBA 3A2LA 1NMYA 4Q1FA 2Q9UA 1AQ6A 2I34A 2I2CA 3GMIA 3T5DA 4AN4A 5B55A 4YT2A 1LRKA 1DLIA 3EHEA 2A1UA 3H6GA 2CLCX 5E6SB 3RG2A 3ROXA 5K2OA 3V4LA 2ISQA 3D7LA 5EPUA 4B8WA 3F74A 4X66B 1Y7TA 2WG0A 4RY2A 2K87A 4NOMA 5AIBA 1C0PA 4P5PA 1BCRB 2APJA 3GUZA 3HXQA 3DFIA 1Q7CA 1SUPA 2BP7A 1RC0A 4BKMA 2C59A 2HYDA 3LRTA 4GPZA 2R4QA 5DKFA 2NN3C 4Q7LA 4FMCF 3D81A 3O3NB 1U3VA 2IDZA 4CHTA 5IASA 4L08A 3HJBA 4D3ZA 4CETA 4EPXA 1IZ7A 2QW8A 3PYMA 3RYHA 4LY9A 2QYTA 5T8KC 1RRKA 1Y9EA 1NBHA 1FVFA 3GXBA 5G1OA 4QL3A 1LSUA 3M82A 1K75A 2HC9A 4Y3UA 4KN9S 4AJKA 3GG9A 1S2LA 5B7NA 2OKCA 1GCGA 4DMCA 5JNWA 3DOUA 5BV8A 1ZJZA 3H2SA 4PHCA 1W4CA 3EXG1 4IUBS 3I45A 1K7FB 3VNSA 4LXIA 3ANXA 4Z4GA 1JKFA 2A84A 3DCJA 3PGMA 3LZCA 5CVEA 2NOAA 3I4FA 3L4KA 1EP2B 4PRYA 4EGFA 5M29A 1Q1GA 5DM2A 2V74B 3U7RA 1L8XA 1KYVA 1CY7A 1UFQA 1ZSNA 2V59A 3ZE8A 5JJLA 3HO6A 5BNWA 2EWMA 3U7JA 4L2IB 3PVZA 3IHTA 2CNKA 5JQGA 3LHKA 3QVGA 2PV7A 4KXXA 5FR1A 1ORHA 2P11A 3D3JA 3GIWA 4K03A 4CN8A 4DQLA 1GU0A 3F5DA 1ORRA 2ZAMA 1OBCA 3OTQA 2YZGA 3PGVA 1UDWA 4AS3A 1PL8A 3HACA 1ESNA 3K9WA 4FC6A 3EGOA 1CSEE 1S02A 2RJ3A 2H31A 3GOQA 4FE4A 4JI1B 4LMRA 4CM9D 2VBGA 4RC9A 4UULA 4TKVA 2D59A 3FCEA 3OM0A 3E0XA 3IBYA 4R84A 4H3KB 2EX1A 5DRTA 2NZVG 4OCZA 3K1JA 3HDQA 2NU7A 3A1EA 3NTOA 3ENWA 4MUAA 4LGMA 5DK4A 2QD1A 3L1HA 3OF3A 1E60A 2G06A 3TLYA 1QP7A 1PJBA 1W1UA 4Y6LA 3IPRA 2O5EA 3SDBA 1W0KA 3JARA 5E9JA 4AUNA 1PJTA 4L9WA 3IAHA 2Q6KA 3ETDA 1SOUA 2VZ0A 5AYVA 1ABEA 2NTNA 2O14A 3UUEA 1KVTA 1F4VA 2QRGA 1R8QA 3FHJA 4W5OA 2V1UA 2HHLA 3AOGA 3EIXA 3R4CA 2JJ1A 4H7DA 2G1UA 4Z8XA 2BM9A 4EGCB 3GGGA 3CX3A 3LK6A 5AKGA 1Z6ZA 1R9NA 2OZLB 5D2CA 3KALA 1USUA 2FR8A 1N3IA 4TKVB 1VSVA 7ABPA 1AS0A 5CYPA 4IDNA 5T6BA 1MP0A 2VHJA 2F00A 2PS3A 3ZGVA 4CF3A 4KGDA 5JJKA 1DMSA 1ICIA 2A5JA 2Z30A 1S9DA 4J75A 4OSOA 1KZ9A 1G5FA 3COYA 4PLCA 3S0JA 1YT5A 4Q5IA 4DKJA 4AY2A 4QXRA 1UT8A 2WDPA 1L7VC 1E2EA 4EOGA 3U31A 3GGJA 3LS2A 2FZ5A 3N75A 3WQQA 4YV2A 1QNLA 2H7YA 3FCUB 2VZ8A 4DNXA 5AXCA 1DAFA 4LOJA 3RVQA 3VYWA 5L3SA 1JIIA 2JIZD 3VKGA 1CW2B 3LLMA 4G85A 4C05A 3PKJA 1IY0A 4ZP1A 4PQFA 5DN6A 2O1XA 4G0VA 1GZSA 2WJGA 4MULA 3REGA 2JFZA 2OORC 3F7MA 1N5MA 2YW2A 1U9IA 2F62A 1Z7YA 5LYJA 3JATA 4LDZA 2HJRA 4TZKA 5CFOA 1QFXA 1K2VN 1PFYA 4R9NA 1IY2A 1DELA 3O92A 3ZYZA 1CEYA 3K96A 1OV6A 3MMNA 1AZLA 4FBMA 3FIUA 1F17A 5AHRA 5EMMA 3ZCRA 3N28A 3WK9A 1FFDA 4O2RA 4KEAA 2UZ3A 4KR0A 3W8DA 2I9KA 4IZOA 1CUEA 1D2NA 3QYFA 3QY9A 3NNSA 4BO7A 2F3SA 4BEBA 4BPBA 3INGA 4B6RA 1EQ2A 2B8WA 2E9SA 5KWVA 3KSZO 1UMCA 1FUKA 1GQ2A 1N2CE 2ODWA 1R18A 3EXIA 2ZGVA 3EUWA 1TF7A 4LX8A 4OQYA 3R76A 2ZK7A 3C3KA 3I83A 4Q93A 4TQUS 5KTMA 1EWQA 1OGYA 1J8DA 2IUFA 3OAAA 4XSVA 1SZPA 1E7MA 3TQOA 4ENWA 1DBWA 4FFMA 2RIPA 4Q82A 3ZV7A 3T54A 3A32A 1I1HA 2QRUA 3BBLA 4J4BA 2YL2A 3UFXB 1AQIA 2C82A 2GYYA 2VZLA 2W37A 1VCIA 2V8OA 3RJZA 2VF7A 1FMCA 3HVKA 4B4VA 4ZQIA 5BVGB 4EMSA 2KMLA 1PV2A 4IDDA 1RAHA 3W6NA 2IZZA 2DWPA 3DG9A 1MXFA 4ZICA 4DZRA 2A9OA 5P21A 2V5VA 1JJIA 4JJ8A 1E61A 2BMVA 4GOND 2ODBA 5D3QA 4UHCA 3S40A 3TEMA 3V3KA 4ZI7A 3QX7A 4XEHA 2OCKA 4DJJA 5C7LO 1EM8A 4ID3A 1FSGA 1T0JB 5FPKA 1GQFA 1L7OA 3N2LA 1IC6A 2XTAA 4BKOA 4WBXC 4LC1A 1T91A 1KI8A 2JCXA 4I81A 3TLCA 2GK3A 2H4YA 2HHCA 2PUWA 3GVPA 2EF1A 3KHTA 2C20A 1CPYA 5DTRA 2EWWA 3GGSA 3RVNA 2QNBA 1UJ6A 2HA6A 4LUCA 5F5LA 1YDGA 2CHFA 2GZ1A 4Z9FA 2AMFA 2G9ZA 2WG1A 1REQA 4D9CA 4DUZB 4TWZA 2R4UA 4CTJA 1J9ZA 3KZNA 5BUZA 2P7HA 2PUGA 2R5NA 2C9BA 4K46A 5TGTA 2JFYA 4GT1A 2AUNA 3CPJB 2F8MA 2F8TA 1XAHA 4E2YA 1ODFA 1NLUA 4AZTA 2L18A 1EDBA 1Y42X 2YY5A 2ZIGA 4H6PA 3H1EA 4JA0A 4KFRA 2XA9A 1V7ZA 5K7SA 3NR2A 3ICOA 3V42A 2F9LA 2FJPA 5IBQA 1W19A 1P81A 1QPZA 4UUQA 2AG5A 5A9TA 4HLNA 5JECA 2YHIA 1WMFA 3CISA 4LOKA 2J9XB 3M7IA 1G8JA 3HZRA 4ZRMA 1VQ1A 5FPSA 1HGXA 1Q2XA 2YNMA 3E2MA 4N9WA 2QUHA 3CB4A 2GDJA 4CG3A 1UP7A 3ABOB 3BXOA 4LE1A 4ENUA 2HWKA 2GS9A 2P6NA 4Z53A 3T1TA 4KYUA 3ETHA 3LY9A 5ICMA 1Q11A 1S96A 2PSSA 2RIRA 2AR0A 2P41A 3AM5A 3AEKA 4JOBA 1MHTA 4EG5A 1TMGE 3NTLA 5LQMA 2EC5A 2BLNA 2YMMA 5COQA 4CM9A 2IUSA 3EZXA 5CB8A 1R0SA 1MW9X 4WLEA 1NG1A 3SQXA 1EX9A 2GPNA 3Q2KA 5KX5F 5TNXA 1YQTA 1KERA 3IR5A 2QG6A 1M2HA 1KY4A 3C39A 3M34A 3LFHA 2QBYB 4IHQA 4DM4A 1A27A 3GPDG 4M88A 1DKUA 2XXAA 4CQMB 3MWDA 5BSMA 2IOFA 2N42A 3BC1A 1I9CA 4QFDA 4QLAA 1RXSA 3WDSA 3IH5A 1ZH0A 2WJ6A 1Q22A 2ZRMA 3WAJA 3L02A 1JSXA 4JROA 4L85A 1SA0B 1PK9A 4HNTA 5ESWA 3RC7A 2P4QA 3KD2A 4N54A 4OV6B 1U90A 1NMEA 4FYJA 4CKWB 5JATA 3CZAA 5CDTA 3HHEA 1RQPA 3C1AA 4KN6A 1BGWA 5T3YA 1NOKA 2C3YA 4PN3A 1FL9A 1Z8FA 2FK7A 4TTIA 1KORA 1KH1A 1MFPA 4YDHB 1WZIA 5DULA 3SSAA 3AKDA 5IYZF 1HWYA 3NGXA 4WN9A 1LF5A 1LDGA 3K8YA 1UDAA 5CB4B 1WB9A 2J0EA 5KAMA 3SGLA 4P86A 1Q0ZA 3X1XA 2Z4SA 3KTFA 2WVJA 1JVBA 3BA1A 3IPCA 4HMOA 4JHXA 2BDEA 3KFVA 4EECA 2ZAYA 3HYLA 1NWCA 1Z7EA 1NHGA 4JMPA 4QOGA 3BQMB 1NQOA 1ZHHA 5T64A 4HDCA 4D5GA 2J33A 1SC3A 3SMQA 5HZGA 2ALJA 4C7KA 4ENTA 4JNCA 1TA9A 4PLPA 3T7CA 2FPSA 2E18A 4PZAA 5D87A 5BMOA 2FG7C 2QPAA 3TTXA 3PNKA 4WFJA 4LDQA 4D9FA 4JK3A 4AN0A 4ETMA 1CDOA 3C85A 5L7WA 3U1VA 1T2DA 4KGZA 4AWXA 3CH4B 4MQLA 3FWKA 5TS3A 3KAQA 5HP4A 1UPFA 2FW9A 3DV0A 1LQTA 2O1SA 3TPFA 3ROPA 2O8DA 3VU1A 1VP9A 2HQSA 1WXEA 1E7YA 3GGCA 4J7CA 1NRWA 4RPJA 1PNQA 5DYGA 2RG1A 4E1BA 3D5QA 3G5AA 4W1RA 3TBHA 4JZYA 1NKVA 1BXRA 3C74A 4EYQA 4QYWA 4D41A 2FFQA 1M5UA 1HYHA 2J7PA 4BGVA 1OMOA 3NAGA 4L76A 4HN4B 2IPNA 5ALYA 1IMOA 4EY8A 3OEHA 1A4XA 1FP4B 2I4OA 3C43A 4R4JA 3RBXA 2R00C 1KDRA 5FR2A 2PX0A 2HCRA 4F4JA 2J4DA 2QM0A 4CF7A 9ATCA 4FFPA 4IH1A 4OSPA 4D46A 4KNWA 2Q49A 4RTPA 4RLHA 2YIDA 3K6JA 2F4VB 4CMEA 4BV2A 2DHCA 3TL2A 1TTPB 4MV0A 1AMUA 4DJEC 2ZUWA 3P0RA 4EHIA 1QH8B 4H9GA 3FDXA 2JD2A 5JYDA 1BDMA 2BWJA 4LYHA 2TECE 4DYHA 1SHKA 4CLOA 1ZIYA 4RADA 1T1SA 2ILVA 3LGAA 4RTJA 3W5DA 3MTAA 2Q1SA 4OQEA 3A1NA 2XECA 3NS7A 4FSDA 3EE6A 1ZN7A 2ACVA 2H0RA 4HDNB 3DE4X 4EPYA 4QATA 1I9GA 1X13A 4V02A 2A8YA 4J16C 5BSEA 1QE5A 1KNXA 1YMUA 3ETLA 3JVIA 1FRZA 2PL3A 1WUYA 4PSKA 1SUDA 3BJRA 3NJ8A 1ZU4A 4R5HA 5BNFA 2V7QA 5K0LA 4F5DA 5JH7A 4OKIA 2HO5A 3NKLA 3MVEA 1RQRA 4CJXA 3AIIA 3AEZA 1COWD 3EXHA 3D7MA 5EQDA 4ZCRA 4BQNA 2CVPA 3SNHA 4YT5A 4EELA 5IH7A 1E4OA 2P27A 4QUKA 2ZB7A 4K0RA 3BA6A 5HIAA 3R75A 4FFRA 1C7JA 2EW8A 4KE7A 4MEBA 4LJ5A 3GOHA 4QDUA 5AJUA 4I1PA 1VKJA 1Z82A 1OZ0A 1R0LA 4QU0A 1E5XA 3H5NA 5BW8A 4EA9A 2ZITA 5THKA 1C0EA 1X7ZA 1B4DA 2ZE7A 3PHLA 3PXGA 1PUIA 5JQGF 3OQIB 4BP8A 1RYNA 3CONA 3RSLA 2AGVA 2KB0A 4LSWA 4DXDA 4Z1MD 2J5XA 4JB8A 5A0FA 5BY2A 1UEIA 2PGJA 4Q3EA 4BO9A 2PH3A 2GN2A 2X76A 3MGGA 2J48A 4NDZA 4XFJA 1JYEA 3G2OA 4X41A 2Q5HA 3VNBA 3T15A 2AX3A 4QOEA 4WIAA 3QITA 2UYGA 4C0JA 1U0HC 3QUQA 3EF0A 1NGSA 1ZW1A 2HLDA 3PHGA 4GOXA 4J0HA 3K70C 4GBJA 3V4VB 1S8NA 2P0YA 1EUQA 1MHPA 4L4XA 5BYKA 3W5AA 3M81A 4M37A 1R64A 3SC2A 1L7XA 4AQ7A 3L7BA 4QU8A 3EQ8A 5CAEB 3G68A 5KYNA 1GA6A 3DAHA 3R7BA 3ABQB 2W2OA 1QCZA 2R6CA 4JVLA 1CR1A 1NYTA 1R9GA 1UOQA 4NPCA 2RCYA 1JIQA 2R6DA 3AFOA 3NYRA 4L22A 4R8LA 3W2IA 4EF4A 5JCPA 1S1CA 4BBJA 4IIXA 3WJAA 5AHKA 4RO0A 3K4PA 4K3VA 4MVJD 5CX1B 4OAOA 4WHMA 4JQCA 4QYIB 1DJQA 5KJ6A 1E9CA 2OHJA 3IV9A 4J7UA 3HU5A 1SBQA 4R3UC 5DEOA 3WGOA 1KP3A 2ACEA 2EF0A 2J5KA 2WWTA 2ZWVA 3GEMA 1GQSA 3LWDA 3M9WA 3QENA 1QV9A 3WLIA 4CMCA 3NGMA 5FJIA 4WI1A 5JD5A 2D1QA 3PHJA 3I09A 2Q4TA 1T24A 2O3JA 3GMDA 1DFGA 4GZLA 3BCUA 2GCOA 1BXKA 2W6JA 1I4OA 4NZ9A 5IAKA 2GNOA 2P65A 1LK7A 5M3BA 1IM8A 4BUZA 3V2UA 2QMHA 5LBIA 4AVYA 2PBZA 2JLRA 1N4AA 5AI9A 4MDFA 1R6VA 3V8EA 3G7UA 1SXJE 5FOVA 2DGDA 2EBWA 1X38A 2I4TA 3FPEA 5FHQA 5I3CA 5KTPA 4C6HA 3BK7A 1SUIA 3TUZC 1Y5NA 2Y4NA 4WVFA 4KAAA 1DS6A 4Q37A 3HVUA 3VTKA 1QKIA 2ZUFA 4PFSA 2IL1A 3K35A 5FB3A 2Q8PA 4JZKA 1AM4D 4B4DA 3Q7TA 1TKAA 2CYAA 2XR1A 3D9QX 1YCGA 1OLSA 4U6QA 2UZAA 3COVA 4C4RA 3E3MA 4KQHA 1RI1A 4HDQB 3HUEA 3D4OA 1LPSA 4YQZA 3GEHA 3AFIA 2P40A 1HLFA 3D1JA 1P5HA 3R0VA 1A2KC 5JNTA 9ABPA 1L3BA 4I5FA 5AM0A 1OHHA 5DF1A 1Y8QA 2JFQA 3WL4A 4UZEA 5I47A 1ZGBA 1EFUA 4A6XA 1RAGA 2GBLA 2BSQA 4LFBB 1E6LA 3QUAA 3B6EA 4MUXA 2A1IA 2XQVA 5JSYA 1QP0A 1XO1A 1Q0SA 4R8SA 3ZKAA 4XIFA 4COKA 4R1MA 4UNIA 4X7RA 1D8AA 5HW0A 2QNIA 3B2NA 1ORTA 2AFHE 3F2IA 3WGKA 2P6PA 4HN9A 3RT1A 1OXXK 2NZ8A 3AOEC 4FW8A 4JC8A 4GQBA 3FVTA 4LJ6A 2O20A 5DBFA 1T8SA 4IHJB 2O3SA 3GLHA 3PXCX 1G3QA 2EJBA 1Z34A 5BR4A 1LJ8A 3QVVA 2WVHA 2JBHA 3SI7A 4NU5A 3COSA 5IG2A 3QWIA 4P4GA 3RIHA 3GT4A 1PK7A 3HP4A 3SFZA 2IIPA 4ZTUB 2XCSB 2Z09A 5JWHA 1H0HA 4C5CA 2O8CB 4IIJA 1KJJA 4RTOA 4A5SA 4XVRA 3UJ3X 3A06A 2UXCB 5K20A 4DLXA 4HUQB 4IQGA 1XEFA 2VXCA 4ZVUA 3ZVNA 2ZCUA 1TOAA 2OAEA 3VKWA 3ZUPA 1VOTA 4EQZA 3VHXA 2BTOA 2IIBA 2Q3LA 1HFEL 4LOIA 5EJGA 5BN4B 4RKRA 4D02A 3GP3A 1FUEA 1WWKA 2X9VA 4QNNA 4ZOLB 2B4QA 3A11A 4B8YA 3PWKA 3REQA 3DE5X 2LTAA 3SZGA 4ZQBA 2RGNC 1ESEA 4OPMA 3FPSA 3W9YA 1YC5A 4MUBA 4UJ5A 2BD0A 3L8FA 1NI3A 3YASA 2Z3ZA 3IUEA 4F86A 1TUBA 3RSGA 3RVOA 1UFVA 2OORA 5BQXA 1SVLA 2OK7A 5F1YA 3EEYA 1O87A 4F12A 5IJAA 3ZBUA 1V39A 2KHZA 1CQZA 5F78A 2M6KA 3D0KA 4AZ3B 3AJDA 1KU0A 4E70A 5HF8A 4V0RA 1U2QA 2N3ZA 1GCIA 4RJJA 3AT1A 1C7IA 5T3UA 3OKAA 3SYNA 5H4GA 1MB2A 1W76A 4LF8B 1JEEA 5T4FA 4D82A 4H18A 1JKJA 4F2PA 4O4HA 4U7TB 4DCSA 1ADCA 2JA2A 2Z1MA 2H9AA 5G02A 4HEHA 1KHTA 2CDCA 2EFHB 5JD3A 1KEEA 1QDUA 3EBOA 4R9SA 2LE0A 5JRDS 3OOWA 1H6DA 3AEXA 4UVEA 3ZBQA 4MRMB 1TGVA 3VR2A 4EBFA 5B4UA 3KQNA 4KUGA 2XDAA 2OGZA 4AX4A 4YT8A 3QBEA 1XZGA 1ZL2A 3FPHA 1DEHA 2HEIA 2GD1O 2YWEA 2GFHA 2QN2A 3WIVA 5EIXA 2C3MA 4Z5XA 4Q3KA 1CQIB 1U81A 4F93B 3JZFA 3ZS9A 4UBKA 1H9BA 3PTLA 1FP2A 4XQ9A 3GUVA 4OKNA 2RSLA 4MVJA 3HVJA 2DWOA 1K0UA 5AVVA 5KWJA 1PLKA 3DVQX 3L6BA 4Y6OA 4RTKA 2CLEB 4KIUA 1T9CA 1UBFA 4L8VA 1XTZA 4XM2A 4K88A 4NMXB 4HS4A 3HN6A 1CUXA 3IBGA 4E5VA 4IRXA 1G98A 2D0OB 3QFSA 2J5RA 4TL9A 2IHNA 2YRWA 2Y2UA 1TYAE 4TYPA 3B38A 4B09A 1EXVA 1EKXA 3S29A 4QUBA 4YROA 4OK5A 4BFLA 3OTIA 3H5TA 3HM9A 4YWJA 3ER8A 1VGQA 4FW9A 1RQLA 3QF4A 4UE2A 4NC9A 1RXWA 3BRQA 2G4LA 2P2SA 3UMVA 1X19A 1DUVG 1QYWA 2P30A 3U4MA 1NBMD 3EA5A 1ZGAA 3IIKA 2B3DA 3G2IA 3S68A 4B2YA 1JJAA 4BGUA 3CO5A 2DG2A 3ZHTA 1I4TD 3I9V1 4CIDA 2CCGA 3EVTA 4A15A 4N0EA 2Q50A 2GZAA 3GQBB 1G8FA 3RRYA 1MENA 2BHNA 3RSOA 5C7IO 1NQXA 3G2JA 3MWGA 3OOHA 1GP2A 5JG7A 2ZSAA 1IY9A 1LLCA 3GJ0A 4B2IA 3I0NA 5FORA 4PX9A 4C78A 3EEOA 4JXZA 1XTIA 3DTNA 5A7HA 1KYWA 2KBEA 3MJVA 2YJTD 3T7EA 3OLYA 4HQ6A 2YDYA 3S99A 1N34B 2AZTA 2ZS9A 3ECCA 3I8OA 4LCBA 3LSTA 4HZGA 1KOFA 2W8BA 5G0WA 2H85A 3WKAA 5JPDA 4BCBA 1AQJA 4A16A 1WKBA 2GF0A 1FVHA 5FOUA 2BGRA 4DSTA 1KMHB 4OH7A 1U5BB 3L82B 1FSFA 1JAYA 4OFXA 3DNFA 3ZKWB 3A6EA 2ZT7A 3O38A 1KKLA 5IWAB 4F3TA 1UANA 2W6QA 2PU7A 2XDYA 1NPYA 4PCAA 2HK9A 3SKYA 3M4NA 4YUWA 1RACA 5IXSA 1WA5A 1P7VA 4OYHA 2PO7A 4TXJA 3AONB 1D09A 4RHCA 3V6LA 3UA4A 1J90A 1TDJA 4BNJA 3O90A 1UL1X 4YGXB 1ZEJA 3V4FA 3F3MA 4TYQA 4P5EA 4MPPA 1DKOA 2AJCA 3LBFA 5SYMA 2JCBA 4RFSA 4EQ6B 3DLHA 1GYPA 3GYGA 1KOGA 1OREA 1VI2A 4M7RA 4TKUB 1RQ7A 1H2AS 5AK6A 5CA1A 1FP6A 1Z25A 3I01M 4NI5A 4NNPA 4UAJA 3FG9A 3WIBA 5HVNA 3MPOA 1P0FA 4BU0A 2EKPA 3KS9A 3L4BC 3RWOA 4F3RA 1VLJA 4FR2A 1WS6A 3CRW1 2DTEA 1Q7EA 2GTHA 3GC6A 3ET5A 4GX5A 2I6TA 4AIIA 2QRLA 1Z68A 1XTTA 2PKEA 1QO0D 1XTKA 3AIOA 4KR6A 4N01A 1QGAA 1T1GA 3RSFA 4DV6B 3HCNA 4HFNA 1UOPA 2FEWB 4RK4A 5B1SA 2CV0A 4HYYA 2BOVA 3NBYC 3NDRA 3BJMA 5M34A 1CKEA 3HJNA 2QP3A 2R3SA 2ZJ4A 2ZWIA 3GCZA 3I28A 1FC0A 1XWFA 2VYVD 3E6AA 1XEWX 4TMZA 4YDRA 3VOAA 3UV6A 1L4HA 2AOTA 3AR2A 4ZOLF 4ZQFA 1ZL0A 3LI2A 4ZDKA 1GUZA 2VYFA 4MS1A 4QYMA 4O08A 5F73A 1UZUA 4OXXA 3GDHA 1EB9A 1EK6A 3DBHA 1U7WA 2J8ZA 5EL0A 3TCKA 1QQAA 4G6ZA 2ZJOA 4UHFA 3PCXA 3RVLA 2B4RO 4U7FA 3R8CA 1KY2A 2IP2A 1B2RA 1ENYA 1Y6JA 4TVKA 4UUPA 4Z0TA 2IZ7A 4CKCB 1LV8A 3JSAA 4CM7A 1NYLA 2VIIA 1L1EA 4JFRA 2EKZA 3I76A 2FE1A 2ZIFA 5FFFA 3CN9A 1LSSA 3RUIA 2X86A 7MHTA 3DL0A 3U09A 1LI7A 5ESXA 3OFND 1RHKA 1VMKA 2YHIB 1JEDA 3SYKA 6AT1A 1D5WA 1PHRA 4IYJA 1MC8A 4R81A 2AI3A 2BJWA 2PKQP 2VDNB 3I2GA 3H7IA 2NUTA 3S1SA 3L4SO 4OI2A 1GPMA 1A8HA 2BT4A 2CW5A 1ZA2A 3O3OB 3HYCA 1YOVB 2GZSA 4HAZA 4MQEB 5FOWA 1BWPA 2FEMA 4FBLA 5L3QA 2HHHB 4G4SO 4YQYA 1X0XA 4YJ3B 3LLSA 2AZXA 3DYIA 2F1RA 3FWZA 2XMRA 1AGPA 2M98A 2YS7A 1OTXA 4R8KA 4AJPA 1I0ZA 1QLHA 1U3DA 1VJGA 1MABB 1W30A 2P4EA 5G4LA 3UATA 3V7YA 4YT4A 1NR5A 2GPJA 1WTCA 3H04A 4CMEC 3A6PC 1W46A 4N48A 1GNRA 4J90A 1ELOA 1ADGA 2IOFK 2H6EA 3M6VA 1V96A 1O8BA 2W0MA 2OC9A 4FNAA 1O0SA 1ZZEA 5T41A 2NVWA 2ZBEA 3KNZA 5IU6A 2AMLA 3TOSA 3A1SA 4JI2B 1EESA 1NHWA 1T4CB 1QQ6A 1M2VA 2GBCA 4QQNA 2P1RA 3DNMA 3NOVA 4UPVA 5FBLB 1X86B 4K6OA 5KB3A 3HZOA 1FS6A 1JE1A 3MSXA 2O54A 8LDHA 3D6HA 2XDQA 4G37A 4BYMA 3X1DA 4BVKA 4YONB 2ZI9A 4IY1A 5A3JA 5K0CA 1UKCA 1T3SA 3DEFA 3FLAA 3JQ6A 4QREA 1N8TA 3GAMA 2FQXA 5AJZA 1GR0A 1QS0B 3INNA 4RDIA 2GBIA 4IDAA 2AYXA 1VFPA 4ZAVA 1T5OA 5KSZA 4J4TA 2PKQO 2ZR0A 4U5QA 3IP3A 4HK4A 2VN8A 4J9VA 5EAIA 5FWNA 2W42A 2VI5A 3HNOA 1JT9A 5HQ3B 1UBJS 3U4IA 4B74A 3TFOA 1TMKA 4V0KA 1H93A 4ZO6A 3ZDXB 1LPAB 1C1XA 1XCJA 3BMQA 3WNBA 1QIGA 1KZ7B 1SZDA 2YNMD 3HJGA 5K3FB 1XNJA 3OX3A 4MS3B 3HXMA 3PNQA 1UK6A 5E7JA 3ICQB 1Q21A 1GAXA 2TSYB 3F2VA 3P4UA 1KR2A 3TD9A 2Y3IA 5KTSA 5D84A 4EHDA 3EPHA 1Z2NX 4ZOQI 3B6MA 3P9CA 3B7WA 4F2DA 2PWAA 3RQIA 3WHKA 4MWSA 2V54A 3RODA 4W5NA 3HU2A 3CX4A 4AY3A 4NCAA 2YINC 4NENA 5ALGA 1BS1A 3WDKA 4X85A 1N2GA 3LQ2A 1YZTA 5EQJB 4OHUA 3T9BA 1MMFB 4PFJA 4Y7DA 4DADA 1RKXA 1JAXA 4MUMA 3CX6A 1X8XA 2QQGA 5TXGA 4LHZA 3PI6A 4P36A 3ZIUA 4IVQA 4YYEA 1P4AA 3WXMA 4YCJA 5KOHB 1NVMB 2GJKA 2WNHA 4XIJA 3BD6A 4DEXA 5G4KA 1GNTA 3PFGA 5G0UA 3KAJA 1LS6A 1KJQA 4ZZ3A 2NPIA 1QJCA 2XXJA 2Q9CA 1HT1E 2VPQA 3L7CA 1H2HA 3NALA 4EHKA 2XKKA 4J0CA 3Q7EA 2EL7A 3T8YA 4ZTZB 1YR9A 3EG9A 1M6EX 1ZJWA 3O31A 4YMGA 5JC8A 1T3TA 1D4OA 1KZ4A 1C0LA 1XZLA 2ZBDA 1S0UA 4KVGA 5KEIA 5LD2B 1LH0A 2OWDA 4IO0A 5H7XA 1BTOA 1L8LA 4MK4A 1Z37A 2IUTA 1E2GA 3FHTA 3OEEA 4Y8VA 4BMYA 1R0KA 3EN0A 3K71B 3LF2A 2J3JA 3IILA 1AKQA 2Y92A 1O6BA 2WAYA 4PS1A 4ND6A 1AMNA 2HNKA 2FRVA 5DHUA 3NYQA 1NONA 1U8XX 4MGHA 1IG3A 1GM5A 1Q0HA 1BU8A 1FLNA 1HT2E 2QZZA 2WC1A 3E8XA 3KYDA 4LQCA 4ZGGA 2OILA 4K9OA 4GICA 4EG6A 2GJ4A 1GRRA 4Z7OB 2C04A 2MSCB 3DHWC 4G1MB 2B69A 4FLFA 3IDOA 3E58A 5U9CA 3W6OA 4X5OA 1IBLB 3UBTA 3UV3A 3LP8A 1JPNA 4IGAA 1NQTA 1XMPA 4H4CA 4EUNA 2JFGA 4RIHA 1MTOA 5KYWA 4EUSA 1JKJB 3G8YA 4DV1B 2EP8A 3M0EA 1LRLA 3JYQA 2V7PA 1BCSA 1QP4A 1XT6A 3BX1A 3QYAA 3RAGA 4V0SA 2PUDA 1OLUB 1T9AA 3IV6A 4IFIA 4UUAA 4DCTA 2HY7A 3JQBA 1IHYA 4QPZA 4YRPA 3L41A 4P80A 5BYBA 1AGRA 3TRKA 2LD4A 1NTRA 2BMFA 1VRCA 4UEJA 1U4OA 4AJHA 4LZOA 4YDQA 2D7JA 3P0JA 3VR0A 2VAXA 3CLUD 4LOAA 4JL8A 5TQ0A 4Z4EA 3QPVA 1V8OA 4O1MA 4OLJA 4PSUA 2AIRA 3EVZA 4EY3A 3PHBE 5A6VA 2Z57A 5C34B 2IY8A 4DCNA 1VBMA 3HCDA 3I2IA 1UQRA 1DFHA 4O4LF 1JG2A 4XEUA 4ODIA 3RVMA 3VHXB 3PC3A 1PNVA 2PKXA 2ZVQX 1I5RA 3H5IA 3O4FA 5IF9A 2FZWA 5TJ9A 4YJGB 4GEGA 4MKHA 4EMTA 3W5UA 5J4YA 3H9JA 2RI1A 3WQHA 1CJVC 3DBOB 2ZIZA 3N3AC 4TSFD 2VWHA 4X54A 4IL5A 3THOA 1U0SY 2XRYA 4REQA 4E6PA 1WKVA 4LSZA 5CH8A 3TCNA 3AHCA 4DRXB 2FLKA 1C1DA 3NTRA 4LHWA 1P77A 4M7PA 3SJUA 4B3XA 2O2GA 1TUBB 5CLFA 1I32A 4ZCSA 3VBCA 2J31A 3KPYA 4G0UA 4JOQA 3T34A 1YZQA 3H16A 3WGTA 3X1WA 2JIBA 3L3BA 4S2EA 3OQBA 3B53X 4CQMA 2ZULA 2O19A 4WOPA 2DWUA 1IYZA 2PUVA 2PX4A 2BZ0A 2V4UA 4L8WB 4L51A 4XYMA 5JXGA 2XWSA 1HPLA 1RWOA 1YR8A 2WMDA 1J24A 3DXXA 3HXKA 3P2MA 2XOKA 1GNQA 2WAOA 3HXPA 1EJ2A 1GXSB 2H1FA 1RRMA 1EX7A 1HF3A 1VJCA 2D8AA 3KV3O 4RH0A 2IYOA 2IZ6A 3VR4A 2HH9A 3PUYA 1N2CB 2AK2A 4IMRA 4CKWA 1RPZA 1L5RA 2P4UA 3T3OA 2WIJA 1NPTO 2VOEA 4F97A 2CF6A 2ZR8A 1VHJA 1GTG1 3DOIA 4C7JA 1I0LA 2Q5LA 5A5DA 4F6RA 1PWHA 2FOXA 4BFYA 3HMKA 3NIDB 4A92A 2HAEA 3F6RA 1OYVA 3HO8A 1PG2A 4YCDA 1YDEA 5AKXA 1ZI9A 3L7YA 4ZJZA 2H9YA 5M5BA 5IMSA 1BE1A 1JQLB 2EERA 3HU3A 3RFTA 1P5FA 3WL6A 2HCJB 4ENRA 1DKMA 2CZCA 2O0LA 4RVNA 3TAXA 3WRXC 6ABPA 1NOIA 1RCFA 1TQHA 3NTQA 1QF6A 3WYDA 4DVGA 1VBNA 2NV0A 2RAFA 3CJQA 1ZRNA 5B3LA 2BIFA 1N7IA 5BQ3A 2OQ2A 4DR1B 2GPYA 4CL8A 2W2MA 3CRVA 1DQYA 3DT9A 3PQFA 3LGSA 2CK3A 1OX6A 2P6UA 4BU1A 1B8NA 1U2RA 4FEAA 4XOIA 1HNNA 1HDZA 3R6WA 3RFFA 3KJNA 4IAOA 4K9DA 2Z4TA 4HDRA 4FNMA 5F4ZA 1UJMA 3DO5A 4N0QA 1IL0A 4QBIA 1PVDA 4QO8A 4UAGA 5AKIA 4ONEA 4NBVA 5KCMA 4MIKA 1XCBA 5J9FA 3I2YX 4D6PA 3JAMA 4PX3A 2CSUA 4D8UA 2A5GA 2ATXA 5HK9A 1B8UA 2ADMA 2GPBA 2PR2A 3R2JA 1T26A 3BL6A 4HDKB 3FFAA 3HE3A 1FUUA 2BI7A 3J7TA 3ESAA 1BX3A 3GG2A 4QEDA 4FNGA 4X8HA 2IHJA 4CV0A 1XDGA 3ZU2A 3GU3A 4N5LA 3ZR4B 1Y9DA 2FZEA 1YCHA 1ZWLA 4C7OA 1LBHA 1J97A 2IUEA 3LT2A 1JHDA 1U80A 4RPKA 1NV9A 3A3PA 2V0GA 3KOXA 4BX8A 2GZ2A 3EZNA 1CU1A 4IJ5A 4ALLA 2IS4A 1FNCA 3U26A 2Z1DA 3UMGA 2EIHA 3ZOZA 3LRXA 4CHGA 4BNTA 5JTUA 3H2KA 2FJUA 2PT6A 4S12A 2WE7A 5DTJA 4QU5A 5K3BA 2WA1A 1RWXA 2O57A 3C3MA 3LV8A 4PG8A 1OBHA 5EEHA 3ZY4A 1KIAA 4IIUA 3T3MB 2G1JA 4XGNA 4NCXA 1XMIA 1A98A 4PE5B 3NUQA 3UHAA 4NOJA 3D2AA 4BNZA 5JSUA 2G8NA 2A9VA 4IIHA 1G21A 2JFOA 1P2UA 1LQ2A 2XWPA 3OPMA 4UVIA 5JI2E 2Q7DA 3N1UA 1G5HA 4ANFA 1ENOA 2H92A 2BBTA 4BZQA 1XMOB 3LLVA 1IAVA 3OZDA 4PHFA 1OFVA 4C9BA 3TLAA 1K86A 2W6IA 2BZSA 2QHXA 5EUBA 2HFKA 1Y1RA 1MAWA 4EI8A 1Z45A 1E2JA 5IK2D 1KI7A 3KSRA 2AFIB 5J5CA 2B1GA 1QFMA 2HU7A 4RS3A 3RR2A 5BP7A 3ZX4A 1PFVA 2W2KA 3E7PA 4GXTA 4ZVLA 4CKEA 4Z4HA 5FD8A 3L6RA 2JFUA 3BF7A 3O9ZA 4WBNB 1KAEA 3V2IA 2FP4A 1Y6QA 4EK9A 4YRJA 1SCNE 3HY3A 3JQRA 2PRJA 3GJ3A 1F8YA 1LI4A 2AFVA 3ZDDA 3ZI0A 1KY3A 4AKIA 4M60A 2ZJ1A 2JASA 3HY4A 4O4IB 5BMVA 3ZXXA 2OBNA 3BE6A 3A9CA 4UM7A 1BEUB 3B5IA 5K8UA 2RBEA 1SQGA 1ZI6A 1GZDA 2BGNA 2HGSA 3A0RB 3C8DA 4CM8B 2WOOA 1GSHA 4YRQA 4EENA 5E3IA 3E3LA 1MLDA 1RWNA 1JI3A 3Q88A 4LNUB 1ESDA 4Z8YA 3ZHUA 5TQVA 1FW6A 1YR1A 1E3TA 4KR2A 2PVSA 3C8MA 1T25A 1RDFA 4ZAGA 3DP9A 3QMVA 4J1NA 1GZ4A 2PQMA 1NG9A 1LU9A 1ML3A 2VQDA 2X42A 3C6ZA 2RMKA 3E22A 3K4QA 3JR3A 3QG1A 4E21A 5MN6A 3GBPA 1LLQA 3G5MA 1DV2A 1O2DA 3OCVA 1EVKA 5HJ2A 1LDBA 4C7MA 4WZ6A 3L6EA 3FTPA 1E1RA 3B7PA 3Q41A 4OI1A 7AT1A 4D3SA 2WU0A 4CTOA 2PUTA 3BN3A 5JPIA 4Q1CA 4G1FA 3X3HA 2VYND 1KRWA 3QA9A 3OUTA 4O6VA 4DCGA 2DFKB 4ES6A 2ZIUB 5JVDA 5KQGA 3SPXA 3LUKA 3GLGB 1C9MA 3PDIA 3HCOA 2VUSA 1E1CA 2B7CA 2BP7B 3HCPA 3NIWA 4X7PA 4BQRA 3Q3HA 3W04A 2OFWA 2JHCA 2QWXA 3DE1X 3I3SR 3IS3A 1KFJB 4AUKA 1QGYA 1VLLA 5K8IA 5LM3A 3AJ8A 3EFBA 3LCUA 4FD2A 1JQ5A 2F9MA 3HJHA 4K26A 4KQ1A 3KCNA 4MRSA 4FDAA 2VQEB 3FTFA 3CS3A 4Q3OA 1XD2A 4UE6A 3PITA 4PXAA 2F90A 4HVTA 1SKMA 3U6KA 3JAKB 1POWA 4O2BA 1X7WB 2OLJA 5M04A 2IYQA 1XMXA 1AE1A 3KXLA 2II6A 3GBSA 2H5JA 3IAUA 3L0CA 4LJ4A 3SS7X 5T7BA 2P91A 4ABTA 5KHOC 2BMDA 3IP8A 3LCJA 3LG2A 4JV5B 1UZMA 3DW1X 2FVXA 1B76A 2BHLA 3PUHA 1QTNA 1QZUA 1IDN1 3PEWA 2XNKA 3QYPA 2FZGA 3BERA 4M9XA 4L16A 1GTRA 3CIFA 3Q40A 3KZXA 5TJHA 4DDVA 5C4IA 4XX0A 5C0OE 4WCDA 1GLVA 1EWTA 1TPZA 2HMSA 3B7GA 2BBWA 2YQ5A 4DV0B 5ERXA 1ZJ4A 3J81A 4YIKA 4J2OA 4NEGA 1LLFA 5GV8A 2GKSA 1RAFA 1G21E 3NHWA 4R1PA 2DBZA 2NXJA 4I5GA 4JJGA 4JQSA 5EWMB 5TX7A 3RASA 3TZQA 4B0OA 3C8UA 4FJ0A 5CJ2A 1TK9A 4Y1RB 4I55F 2IYEA 2ERCA 3ESZA 1US8B 4ZWNA 5LQSA 1W96A 4UTRA 1EK1A 4KO2S 1Z0IA 4ALNA 5TGZA 4TYWA 4PRKA 3AJEA 4I50F 3VV2A 4E5NA 4EYEA 1QB8A 1E59A 3A6ZA 4KG7A 4LYDA 5HMMA 1V9CA 5KDDA 2ZB3A 3AERB 4FSXA 1R9MA 1SMKA 1VG9B 1E2PA 3IT2A 3LOPA 4G0XA 1KQNA 2OEPA 3GFOA 3MJCA 4NBTA 1QPGA 3UW3A 3OMLA 1QFSA 5JNLA 2MMCA 3GJ8A 3ZJUA 1EJ0A 1ACMA 1G5RA 3JRNA 3PGJA 3HLKA 1E5LA 4XB1A 1MC5A 4Z3OA 1HLGA 4QPJC 4YP1A 4QBKA 3QOWA 1CLUA 1I01A 1LA2A 1CTQA 1GYRA 3KYJB 4I08A 4IILA 4OK3A 4DHEA 5A4AA 1TQ2A 2VJKA 3DE2X 4BRZA 3RFUA 4R2XA 5HOEA 3OFKA 4N8SA 2OQRA 4Q3BA 4EBBA 5TSDA 1T9BA 2VF2A 1XG5A 5F7ZA 1BWQA 2YYSA 3ELWA 3L05A 4WK6A 1DKLA 1JJFA 4HG2A 5KOHA 4TQAA 1DRJA 4L0QA 2QQ5A 3MINB 2B4KA 7ADHA 4UOZA 1KS9A 1JVNA 4CU2A 2QD5A 5LJIA 3TQFA 2WIKA 1JKXA 5KNCH 2RGNA 2ENUA 4MZXA 2A1UB 3CW9A 5ADUS 2HF8A 4INZA 5F4BA 3JQPA 1Y34E 3AI3A 2OOSA 2P67A 3NRJA 5DFAA 5EJAA 1U2DA 2NQTA 2OBYA 4AZ3A 1ORDA 4MGIR 1CHDA 3KPJA 4OXKA 1LW7A 1PSDA 5ILQA 2CJYA 2Z43A 1OX4A 1C41A 2AUMA 3F1KA 4TXLA 4TN1A 1P18A 3AVYA 2WLSA 1AQLA 4OSEA 2P2ZA 4INJA 4WBNF 4DANA 3GCDA 3GA0A 3MHPA 1WD7A 2JLAA 2HREA 5LKRA 3O8OB 3ZLVA 5BV7A 4LKRA 2HOQA 5LOVF 1CJKC 1G20A 4C2AA 2B2CA 3S5UA 4BXOA 1D2RA 3LBIA 6Q21A 1A4IA 1L7QA 1KMNA 4ZREA 4B9AA 4CR7A 3W1EA 1EDZA 2CL0X 3HZHA 3RUCA 1YZVA 3I6QA 1N5JA 2L69A 3RRMA 2Z6QA 3RTCA 4MI1A 4GLBA 4KQWA 2VUTA 3UKOA 2QNRA 1FPMA 4NULA 4R2HA 2G9RA 2UYOA 3BB1A 2RGBA 3DOFA 3ZWBA 1JA1A 2FPOA 3ACBA 2QR5A 2P5UA 3V46A 5F64A 3VH2A 3ZQ4A 4HQLA 1X1TA 4AF8A 4DBLC 3AUYA 3NGLA 1W2WB 5T4HA 3VH1A 2QMOA 2IP4A 4TZTA 3ZZTA 1ILEA 3EXEA 1ZXBA 3VKFA 5BPHA 4WLOA 1T4MA 1YB6A 1T4CA 2XE6A 4TMYA 3S55A 3W8EA 4FNOA 1PDOA 2QYSA 4OXYA 4BV8A 5ALXA 2BONA 3PT5A 2BGIA 1M0EA 1S5PA 2YQ4A 3H0CA 4E31A 3G0BA 2WAXA 3R4VA 4OJNA 1E9AA 1WPGA 1H5QA 2JRLA 2E5LB 3OZXA 2CHEA 3NNNA 3C5VA 1MVLA 1RYMA 1KDVA 1X70A 1WTAA 2O48X 3ZGXA 4EA8A 5C5EA 1KK3A 1WNTA 1R4ZA 2I71A 3L7AA 1Z6PA 3NT4A 4IXMA 2WT4A 3IVAA 4ML3A 1NMXA 4UBNA 2W4MA 3I9KA 5IKXA 1DO2A 1PZGA 3C1UA 3HDTA 5JCZA 3EG5A 5EZ5A 3S2SA 5CH5A 3HI4A 1OT3A 1ZS9A 4AX8A 2I4LA 1ZM3A 2WF8A 3CVXA 2WHYA 1GLNA 3KE9A 4G5QA 2OCYC 3LQQA 1A8PA 2JJ2D 1AZWA 3DV9A 5L4LA 2E55A 1RXVA 3BUSA 1T6XA 2I66A 1NV8A 3H9CA 4KRFA 1AQYA 3T4EA 3OO1A 1M10A 3QI7A 3R5KA 3EDQA 4MCJA 5CXUA 1AS2A 2B8TA 5FWDA 1JAIA 3TZEA 1E8NA 1NRXA 2HJGA 4HUQA 4CCYB 1MW8X 3QW2A 1UDCA 1PR5A 3NOXA 4ZYXA 1V37A 2X5OA 5KKCA 3D0RA 5DOZA 4JYZA 2GAAA 1FFHA 5IUKC 3SS9X 4YPOA 1VL1A 3F8TA 2GJSA 5IYZA 1MVNA 2R6HA 5HZHA 3ROMA 1CF4A 2P3QA 5EQFA 3LFUA 1IIBA 3G1UA 3W7BA 5FPTA 2C2BA 2QTZA 2PWYA 3P0HA 3WDLA 2DTXA 4WNIA 4XGQA 1I2DA 3RVBA 2V98A 3K72B 5G40A 3INTA 5AW3A 3WYFA 2B8JA 3QUCA 1NMZA 1QCYA 4J1SA 4J3JA 4KI7A 4NABA 2WM3A 4QDOA 4Q9NA 5EIWA 4C4PA 4IOLA 4F4CA 2DH5A 2O23A 4DWWA 1J0DA 1A04A 3TFWA 3A27A 3ZZNA 2CLMB 2WW8A 2ONJA 2O6HA 5LVAA 4ZZ1A 2EARA 1DAEA 5DB4A 5K9ZA 3JWPA 3T7SA 1WF3A 1XXHE 1FRFS 1S3GA 3IQXA 4IQ0A 1OJ7A 2NO0A 1SOMA 3GAZA 4MV3A 3X1YA 3ZBTA 2VP2A 4BV3A 4EHLA 3NCTA 4J3NA 5B2FA 4K6CA 3KC2A 2VHTA 1L7NA 1MOQA 1V8DA 3EIQA 4LJYA 3KQHA 2XBUA 4DWJA 2GEVA 1P1FA 2HJHA 2H3HA 3LIPA 3I6IA 1GHTA 1D8TA 5KVSA 3FPBA 2DBQA 3COJA 2PHZA 1TCAA 2WHPB 1YUNA 4H60A 9LDBA 3HMQA 1JX6A 2W71A 3B9PA 4AKSA 1DRVA 2YFHA 5AW0A 3U4QA 3IVMA 5ALFA 1C3EA 2Q9AA 4WY2A 1NW3A 2PGLA 4JNKA 1RWQA 3T7TA 1II8A 3IAEA 4F84A 3HA2A 1MT3A 4FD3A 2LIVA 1FDRA 4JUFA 4MYTA 5HIKA 3GT7A 5E7QA 4AJLA 3A36A 1VCOA 1L5HA 2Q2WA 1GCUA 2IZ1A 3CKYA 2AB0A 5IULC 5FCDA 4E94A 2CXSA 3X1KA 2IQIA 1KBQA 1ITZA 3G5UA 3TE7A 4KHPB 1EDOA 2BISA 5IEJA 2FUNB 1MQSA 3TLBA 2BL4A 1QYRA 1QIMA 3GPIA 3A3KA 4WADA 1F3OA 1N1DA 3W2FA 4P98A 2QRHA 1EYZA 2FKAA 2JW5A 3FJOA 2VT3A 2DBRA 4HQRA 1C4XA 4M49A 5ICSA 1VIVA 2WD7A 3EULA 3QM1A 5F2OA 3LE8A 3WGGA 3GLIE 2WWXA 5AUNB 4WNYA 4IWNA 3M33A 5AUQA 3NP7A 3ZHZA 1UZNA 1X77A 4MW1A 3WNQA 2QJOA 2PWPA 3DVAB 3P27A 2I2DA 3ESXA 4R1LA 3SC6A 4QNMA 3P0EA 2I3DA 4UHKA 3FFWA 1GD1O 3OQHA 1ORWA 4BX3A 2YFKA 5GINE 3KKZA 4X44A 5JS1A 2GYWA 4Q12A 4TRJA 3I2KA 4HNVA 4BVEA 1TC2A 3H9QA 3RIMA 3BAZA 4CM4A 2QDXA 4YFYA 3RI3A 1XWIA 2O0MA 1IHXA 3RVDA 2KX7A 4HDOB 1XJCA 3HTXA 3P1JA 4QAJA 5L45A 3L7MA 3ELUA 3GW8A 3K9CA 2CKDA 4EZEA 3R6DA 2IZOA 2GTIA 3DM9B 3H4TA 3TTVA 3F6YA 2BCEA 1EVZA 2JH8A 1NSFA 1NF8A 4ARIA 4BWVA 1Q19A 2V3VA 3QA3E 5HJ5A 3P5SA 4J6FA 1OAOA 4IM7A 1MZVA 1XMVA 4Y0VA 3WNZA 1IEVA 1IUNA 2RGYA 1U7TA 4R9RA 1PL7A 3NJ4A 3KZMA 1CLEA 3FNHA 1P91A 1UXKA 4QUGA 1BS2A 1KEWA 1KGDA 5F9MA 3ZHXA 2Y1GA 2Y9MB 4P83A 5FBKA 4FB4A 1RU3A 2A58A 3DR3A 3F7TA 3RROA 4CLHA 1KOJA 1WCWA 2YN2A 3DE6X 1JHUA 3BICA 3MCVA 3COZA 1O7JA 1YQUA 4IRMA 4V0ME 3JVDA 3B20A 5LZ5A 3ROZA 3TTYA 3ILVA 1PR1A 2C5AA 4U2KA 4QXPA 3U62A 2FGJA 3AR6A 3GLKA 2R9VA 3T6KA 1XA0A 1KR5A 2QUIA 3FCOA 1IEXA 5ALPA 2IGBA 3IKTA 2R86A 4YP0A 3OH8A 1XTPA 3A25A 1VG8A 2PWBA 2BCGY 1OZAA 1XTBA 4KFTA 4H59A 1V5EA 1TT5A 1DCFA 2HDNB 3E9EA 4AKGA 3R8XA 3K94A 3SF0A 5KWSA 4A8JC 3IUQA 5BWOA 2XIJA 3DAOA 1SVKA 1M8KA 3CXUA 1TX4B 1H3FA 2GH1A 3DULA 3GL9A 2VZ9A 1CZRA 2CLFB 4JELA 4R0NA 3V33A 2HRQA 4DLRA 2IXBA 3H5WA 2MU1A 3HBJA 5EE1A 1S01A 1RWBA 2QOEA 5THXA 2VTEA 3RSZA 1P2FA 1ESCA 1SU7A 4CW7A 4Y9SA 4GGPA 2X40A 3ZV4A 1L7RA 2D0DA 1JQDA 4Y1RA 1ULTA 3RVJA 4QBGB 1UBGA 3WMXA 4NBLA 2O2SA 3BE4A 5BSRA 5AESA 3PIDA 2FNAA 4NMHA 1RE0A 1Z13A 4YR7A 3WBBA 5JQWA 2AFHB 1SZJG 3LOQA 3O74A 3QE0A 2CE7A 4D2IA 4LJ7A 3GEGA 5AVUA 2AJ8A 3T5GA 4DMLA 1M6VB 4BUCA 4NDAA 3CPHA 3CZ9A 2G6BA 4BC1A 4DDHA 3M70A 3SR3A 3SM9A 2B82A 1I3KA 3H4MA 1SB8A 3EG9B 4LISA 2IHVA 1E3WB 1MO2A 4GWKA 4C0HA 4YMVA 3G0HA 5DM0A 2H16A 1L5QA 1BHSA 1Z7BA 3I34X 5H3HA 3TXXA 1S2NA 3ZHYA 2ZVDA 4RGVA 3AWDA 2AD5A 5TVGA 3ML1A 3QPAA 1NUHA 1H94A 3DLAA 5IBCA 1IONA 4KKVA 2O2JA 3QXXA 2FFHA 5IXYA 4FGSA 4UFOA 1U7UA 5A4KA 2BJHA 2JHAA 521PA 1ZITA 4ZXFA 2C0QA 3DOHA 2CVOA 1GR1A 1QHHB 2HJVA 3QEMA 4TKMA 5F77A 3AJAA 4M1OA 5FX2A 4UJ3A 2ZS8A 2PZGA 1J2JA 1IWBB 1NKTA 3GLSA 1Y80A 3VUEA 4L28A 2ZRJA 3SS8A 4CCWA 4MYCA 1ECLA 3PD7A 3FSJX 4IOKA 4EWLA 5AKJA 3KDPA 2EJTA 2NXNA 2NUAB 3V97A 1TCBA 3C6MA 4DCPA 1Y6ZA 3TJRA 4NYJR 1K88A 1RWVA 1RYHA 3FCYA 1MA3A 4J1TC 2OR3A 1B6GA 1P5RA 4RBNA 4F2WA 3HCBA 2MMGA 4BEJA 2GEKA 3WWCA 1VKOA 2GX6A 2BC9A 4L0DA 1KI1A 5BQ5A 4LY0A 5BVGA 1GKYA 1QU2A 2J9FB 3C14C 3CRRA 5D5QA 3MT0A 3UO8B 2DKFA 4W6QA 5DP1A 4W5WA 5IC5A 3SC2B 5JI3E 4KR9A 4ZAYA 3TX2A 4QQRA 1FZTA 2V6MA 2C61A 1QHXA 1V8ZA 3MUNA 2NSDA 4LTDA 1AKUA 1QS0A 3W0LB 3WMRA 4R0MA 4GYYA 1S2DA 1H2EA 4EUEA 3P4XA 4MWEA 4ARSA 3N0RA 4POOA 1ACLA 4E09A 1DX4A 1A8QA 1WNFA 4HXFB 4F1JA 4US1R 1YQXA 2JZCA 2M9MA 2X0EA 1C1XB 3OP4A 5CDFA 2C5FA 1Q0UA 1E6KA 4GEKA 3C8HA 3FIJA 3MERA 1MX1A 2OBBA 1JLLB 4MUEA 3T5MA 1KXZA 1PQ4A 1PTJC 4L74A 1KQOA 2DOKA 3DSRA 3QVLA 3VSCA 2MIIA 4N0DA 1NXVA 1O95D 2MYPA 3ONWA 1V7QA 3BHNA 4MP6A 1NVEA 4D97A 2AQHA 2X22A 3R7WB 1U3WA 2VJMB 4CTNA 5BN3B 2IYSA 2XUPA 5KU1A 4UEQA 2FQQA 2I29A 5BT9A 5LMNB 4M0FA 4DJ5X 2EZ9A 2R1UA 1EK2A 5LU9A 3PE3A 5FPPA 4FMCB 3TK1A 2DUMA 4B80A 1VYHA 2NYRA 3CR3C 1AGYA 2PL1A 3I9OA 5JISA 2F48A 1A4UA 4BNLA 3OPNA 3N7UA 3VNVA 5ALLA 1WZCA 3QEKA 1W0JD 2B6NA 2FR1A 1E3SA 4MQ5A 2CC2A 2IZ5A 1J1IA 3BIFA 3JPWA 4IDQA 4Y2XA 2XUKA 1O54A 4NH4A 1Z22A 2VRBA 3BMNA 1JU4A 4H7HA 1U6IA 4KW7A 4IIDA 4JP2A 3GJ5A 4HLQB 3KAKA 3W2HA 4LRXA 1X1AA 2OO7A 4FE7A 1VCMA 3IURA 3ZOKA 2X8BA 1DQNA 3FNBA 4TZ0A 4L8LA 3VVBA 3VHLB 3C5CA 4CFZA 2XODA 1RZ3A 1TU4A 2XKBA 3AMVA 4O02B 2FFBA 3OQVA 4Z51A 3DKKA 5BNIA 4DLLA 5IS2A 1IBCA 4LN1A 3D43A 2PE5A 3L0YA 3KKNA 4IUYA 2IHBA 4Z9XA 2WG2A 5EYPA 1RM0A 2GHTA 2HBYA 2BFBB 2EBHX 1ECBA 3QELA 1YQDA 4A2CA 2PXHA 5DSZA 3U81A 1ICEA 2FG6C 4M83A 1II0A 4NEHB 4PFQA 4YVFA 2J32A 2ES4A 3D8NA 3BMCA 3MF4A 3WRXA 4NBUA 2QIOA 1XHEA 3QX8A 4Q7JB 5FI1B 1U1EA 3P9PA 3LX8A 1UADA 2VYCA 4HWOA 4HX9A 1G4AE 3N8IA 4U8HA 4N5DA 1S2OA 1MRSA 1DHRA 3P2JA 3NTUA 3OQ1A 4RA6B 2CYCA 3DE0X 1JQBA 1Q20A 3VZRA 2C4KA 3GLQA 5CP8A 3FKSA 3KXKA 2V6BA 1RAAA 1EFRD 1E9EA 3A3NA 2Z2XA 3OPVA 1P1BA 2ZRKA 4LWOA 2QN9A 1HQDA 4RMHA 4DJAA 5B7GA 1CR6A 1SQ0A 3ETGA 3VYSB 3C70A 1LC3A 1JEOA 3EDRA 5KYYB 1XCGB 3MAAC 1O3YA 3F97A 1B43A 1OLUA 4MR7B 4TWJA 4BO3A 3SKXA 2DWCA 3L1JA 5E1OA 5EXXA 1E9BA 2WK1A 5CK4A 2HBRA 3ZY6A 5AOCA 4GL2A 3AKEA 2QX4A 4IDGA 2DZDA 4C14A 3OI7A 1T6YA 3G02A 2QSYA 3ON5A 4JJEA 4ZAWA 5JSKA 4F46A 5FBVB 2IEBA 3SEFA 1OFGA 1JFVA 1TFUA 1CYDA 3SN6A 1XJQA 2J41A 4GWGA 4FGZA 5J2TF 4WEOA 2ORED 4JC4A 5B1YA 5IEBA 4HS9A 1EP3B 2AJBA 1O4VA 2QP4A 4QXAA 3LCRA 4TKLA 3IA2A 2FSSA 4KUEA 5DLYA 3V1UA 3VSEA 3KDAA 2CL6X 4BZZA 2D1RA 2V65A 4MUYA 3LO5A 1SUAA 1Z4PX 2YHUA 3JQQA 3WRWA 4E88A 1DC6A 3FVQA 3K9HA 2IT1A 1R5BA 2YJ5A 1ZR4A 5DYWA 4A6PA 2I03A 4MMYB 1PQYA 2DR3A 2GZHA 3ZPXA 2R2AA 4DMRA 4OHKA 3FMGA 1N8KA 2A9JA 1PCXA 2WU3A 1U3CA 2IY7A 1VI6A 2KBFA 4RHXA 4ER3A 4GL4A 1VYUA 2H8GA 4K5QA 2VP4A 3OD5A 2D6FA 4QDXA 5LC1A 1OXUA 2CGEA 2CLDX 3KUXA 3M3PA 4E4RA 1KVSA 3M4XA 1ADFA 1G5TA 1W93A 4N7BA 1RQNA 2WIDA 2G7MC 2X9GA 3KCQA 2MYNA 4NPHA 3I6MA 4BZPA 1GZ7A 4PYOA 5AJXA 4CBVA 4E5KA 4N18A 2C9ZA 1H6CA 4H7IA 4YJ2F 4DYDA 4M89A 1GOTA 2JI4A 1XRLA 2BMEA 2WHPA 2Y68A 3MWKA 3UAGA 1TD9A 3A70A 5AUOB 3OMXA 4O4IA 2GRAA 4H0FA 1Z4IA 2QY6A 2ZWMA 1XRQA 4IMPA 4PGMA 2NU8B 2FX3A 1N5LA 2IOHA 3D02A 1W6UA 4FMDB 4WMLA 3ZGNA 4GHWA 2B35A 1EJ6A 3HB1A 4XJXA 1X7GA 5BQOA 3ZW9A 1P1IA 4HTAA 4M8NE 1V11B 1XQWA 3CEPB 1I3NA 3TSOA 3K0CA 4D25A 2R68A 2W58A 2Q28A 3C15C 4TKUA 3ZDAA 2BN4A 1OLXB 2VSFA 3F8WA 3TLKA 4TL8A 2W90A 3VBEA 1YRAA 2GHQA 2WDZA 3NM4A 4ZCTA 1L5VA 1HC7A 4NHOA 3AUTA 4UU8A 2ZBRA 4RELA 4L7VA 1Z83A 3EC7A 2WB4A 2R751 4GGOA 1O94C 2Z2JA 4OF4A 3O7MA 1P4GA 1IJFA 5K5EA 1XRNA 1K9SA 2UZ4A 3GVIA 2R6JA 3VJMA 3BRWD 4M3NA 1V2GA 2QGNA 2A35A 4U0KA 4ZJUA 5JHGB 5BRAA 4ZU6X 1I3MA 3EAGA 3MWEA 4EIWA 1DBVO 3KPUA 3A6FA 4MPTA 1EFHA 2OYSA 3OIGA 5KVQA 4B8ZA 1CQIA 5DYIA 2GARA 3QVKA 2VDLB 3S2UA 3ER9A 4CLXA 2QPTA 1R4AA 2R96A 5KJFA 3FOAA 1KIFA 1RPNA 4ENSA 2JI8A 2B1RA 1XVVA 2WF5A 5GJWC 4EAQA 2G80A 1PRYA 3N2NA 3DXYA 3T12A 1EQAA 4XX1A 5ED0A 2JDID 1E1QD 2ZRDA 4MARA 1K7YA 5KTOA 1KVQA 3D7RA 3RWBA 5K4HA 3H2BA 3P2IA 2Q0HA 2YWJA 3BZBA 3CE9A 3IT3A 5GY7A 1WLYA 3F8SA 4AIRA 4DR2B 3Q87B 4W63A 2FGKA 2P3LA 4WEQA 4BDSA 3B3GA 2OE2A 4HI0E 1XZKA 1PLLA 1P9WA 2CL7X 1T8UA 3MTJA 4PPQA 1EXNA 3GEDA 1C1YA 1K66A 2W2PA 3LUFA 1GG8A 2UXBB 4I8IA 2R62A 3PC2A 3PUWA 4EATA 1NXXA 3QTTA 1GL9B 2AMVA 1YUMA 2A67A 4XIGS 1DLJA 2EQ5A 3FYTA 1U3GA 1IJEA 2J6IA 2Q3HA 1EFPB 4KACA 3E22B 4MUNA 3QBVA 4FYWA 4GDFA 1VLQA 2VTKA 3E2PA 4REOA 1JAHA 4QU9A 4E13A 3W5SA 4ALIA 4DIKA 3KOWA 4MCIA 4MVJE 4MCHA 2VR1A 4BO4A 2E4UA 2FPPA 1LDMA 1OFTA 3SZLA 4C5AA 1JTEA 2HRBA 1G6KA 1VHLA 2ZRNA 3SSOA 4EITA 1V7PC 4TTVA 1NW6A 2LCFA 2DQ4A 2Y1FA 2BKUA 4AUMA 1HDRA 3HFSA 2G9NA 5FLYA 4B3GA 4OGWA 2HCTA 3IHLA 4UE3S 3HH8A 5SY4A 4COOA 3HEMA 5IZ4A 5AKLA 5F1OA 3TOXA 3QMWA 5GM1A 3LPCA 3PQDA 3TDMA 1W5EA 3FA2A 4IOJA 4K6MA 1UDXA 4XA8A 4E5YA 5LQKA 5D8DA 2PD3A 3W2TA 4KBGA 4ZMSA 1HNZB 4G26A 1VE7A 3EW7A 3PQ4A 5F2EA 4JLVA 1DX6A 1DDIA 4MS4A 4KZKA 3C97A 5A1TA 5LKAA 3PWZA 1U04A 3DTTA 3L8MA 3OEYA 4PX5A 1V43A 3EMBA 3Q0TA 4DR7B 4ZC1A 2GYVA 4WKOA 3T0IA 4LJRA 3K6SB 4Q05A 1J9EA 3G2KA 3B48A 1VI5A 2B5WA 4OQPA 4V2UA 4BS9A 3BGSA 4ZVPA 1OQAA 3REOA 2PT9A 1U7DA 3NW9A 3A26A 4XLTA 4NTZA 3FI9A 1K8QA 3O93A 1ISIA 3HYRA 3QFRA 1TYZA 2XRMA 2BRUA 1T6BY 1ZWKA 3CSDA 3DZJA 4D4KA 4JXKA 2P3SA 3EFOB 3WADA 3U56A 4M76B 2GPTA 2XKJE 4PZ0A 4YA6A 3UAVA 5LNK6 1H0SA 5EJ9A 3QHAA 4B3TB 2LW7A 1EGQA 2PIAA 1GA1A 1HMPA 4URHA 3QUSA 5FAKA 3TS1A 4UW9A 3K31A 4ZT7A 1LY1A 3FPLA 3IEUA 1KDOA 1ZX1A 4D3FA 3MILA 3DZGA 2ZWOA 4KJXA 1KMQA 5U4XA 4DS3A 3OIVA 3OJFA 3ZXYA 2X6RA 1AV6A 3LW7A 1QKKA 2IEAA 4AO7A 3KG2A 2Y9PB 2F1IA 4GOOD 1FFAA 2AQ8A 2Z5LA 5KOJA 1ZICA 3WFJA 2ZYSA 2ERXA 1PJ3A 1IBMB 3L92A 4FEEA 5KQPA 5KC8A 1ZBQA 4RZIA 5KBYA 4KQKA 4A4DA 3TYXA 2FK8A 1T0BA 3WLTA 2YVLA 3G9QA 2EKDA 4BQIA 3DBHB 4ESOA 3F98A 4X64B 4MR8A 4G36A 4KDCA 4Q9JA 1UFKA 3UBMA 2XZTA 4GMKA 4R2LA 2DX7A 2QQEA 1LPPA 1Q3HA 1RJEA 2VBCA 2ZJ5A 3D8HA 4RS4A 4YACA 1OB2A 1OSNA 4E2FA 4C7BA 3DWEX 1N0IA 4BIMA 5EP2A 4RORA 2VZEA 4XUEA 4CV2A 5DI9A 4PS0A 2A5LA 2E0IA 3GEIA 4JBWA 1SXPA 1GFSA 1SXJB 2ZRIA 4HGRA 2QZPA 4N1AA 3ZZUA 1BCRA 5JD6A 1QMGA 2O1WA 2PSEA 1DQRA 2B6HA 3P2EA 4I6JA 5AKYA 5TPWB 3UKJA 3U9LA 1PJAA 2G5GX 2R6R1 2QN8A 4AY5A 3LT1A 3NDBB 4HH4A 3MD9A 5AUPB 4RUKA 5DXFA 1RPAA 4FXOA 3OZFA 4XLZA 4BGIA 1O5TA 4WXYB 4FZRA 4QECA 4OVKA 2ZS7A 2CD9A 4K2AA 3NHSA 1O9HA 5AJTA 3MINA 2PTHA 2NQ8A 1FFYA 3W5VA 5KC9A 2J6BA 3EPKA 5DTIA 3AO0B 3K5WA 4NF2A 4MUJA 3LFTA 3O8LA 5G3ZA 3I23A 2LDBA 3M2TA 4B5LA 1K9VF 1XTRA 2FSGA 3O75A 3RC3A 3NTVA 3FGNA 3UAZA 2GAIA 2I2WA 1AKTA 4JR2A 1WMAA 4OA8A 1GARA 2BW0A 3ZJ5A 2ZRQA 1GUYA 1HK7A 5TMDA 4YX9A 1WCYA 2HQBA 2IHYA 2PLAA 1DXOA 3B1WA 3CU5A 1Y1KE 3QVSA 4TYMA 3CLSC 5J4LA 4PYMA 2Q0XA 5L4NA 4LNAA 2J09A 3FSGA 5WRFA 2A86A 4BKPA 4ZV7A 1EUZA 1IJKA 1IMJA 1HEYA 2XT6A 3T3PB 1E5DA 1WUTA 3RE1A 4BO5A 3T0GA 4DNPA 4IOMA 4PU0A 2G0AA 1GKLA 1TLLA 3G8DA 4OGLA 1EBFA 4R9VA 1FLDA 2H2IA 3IPXA 1YS1X 4HZUB 4ZQCB 3RKSA 3UMCA 3HXTA 3E5MA 4NV1A 5KIAA 1CRWG 3SX2A 3EAFA 2C1EA 3WL5A 3BBPA 4YMWA 5IKMA 4G5XA 3HNRA 1GQYA 4XTRA 1L1QA 1ULAA 5YASA 3KQKA 3R6LA 2DM6A 1F12A 3I3OA 4LC0A 4MNTA 4UNPA 5DGTA 3W77A 1I7QB 2W6OA 2I6GA 2YWCA 1HUQA 1F5NA 4DV5B 1PBNA 4G97A 4YI5A 4J49A 2WMOB 1TM3E 3AUSA 1DOAA 1U9YA 3TD2A 2FG5A 4X7BA 2NSJA 3ORYA 1LFAA 2QYOA 3FCXA 3ADOA 1MPTA 1YL7A 3JTMA 1EP9A 5CD9A 4JLSA 2BF4A 1ZOIA 4DARA 1VLMA 2PS0A 3ADBA 2VHYA 3ZHCA 2HRCA 4JYBA 1HE8B 4CR6A 4F0JA 1K08A 4Q03A 4RAQA 3NHAA 4NV0A 3IXMA 4FLEA 3H42B 5AJYA 4HAUA 4G23A 5KYWB 3DT6A 3M2PA 4RKWA 2FWPA 1XFDA 4TLAA 1LZLA 2RAPA 2WIFA 2NU6A 1SCQA 3KYBA 4GS5A 4N12A 1F6BA 2A9KA 4Z99A 1CDEA 5MGBA 3RRZA 1H2FA 2NP7A 4B45A 3KJHA 3VZQA 2FEKA 1NBOA 1L4KA 1NJSA 4YHHB 1TVCA 1EFTA 2JEZA 3PQ2A 2A5YB 4N6GA </