2QY6A

Crystal structure of the n-terminal domain of upf0209 protein yfck from escherichia coli o157:h7
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
246
structure length
244
Chain Sequence
SLKHYSIQPANLEFNAEGTPVSRDFDDVYFSNDNGLEETRYVFLGGNQLEARFPEHPHPLFVVAESGFGTGLNFLTLWQAFDQFREAHPQAQLQRLHFISFEKFPLTRADLALAHQHWPELAPWAEQLQAQWPMPLPGCHRLLLDRVTLDLWFGDINELISQLDDSLNQKVDAWFLDGFAPAKNPDMWTQNLFNAMARLARPGGTLATFTSAGFVRRGLQEAGFTMQKRKGFGRKREMLCGVME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0209 protein yfcK
publication title Crystal structure of the N-terminal domain of UPF0209 protein yfcK from Escherichia coli O157:H7.
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 89
structure length 244
sequence length 246
chains with identical sequence B
ec nomenclature ec 2.1.1.61: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase.
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05430 Methyltransf_30 S-adenosyl-L-methionine-dependent methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2qy6A01
5E1BA 3OZTA 3HP7A 3TRKA 4CTJA 2EX4A 2IIPA 4RVGA 3I58A 1DCTA 2YXDA 4EQZA 1B42A 2YVLA 5EEHA 2Z6QA 3HCFA 2IPXA 3KU1A 2BR4A 2O07A 4KVZA 3T7SA 3DH0A 3DXZA 4QDJA 1IY9A 3GU3A 1NBHA 3KQMA 5FQOA 1XDSA 3G2PA 1NW8A 2JHCA 2OBFA 2PXCA 4WXHA 2NXJA 3KR1A 4R8SA 4EKGA 5EKXA 3MHTA 3KQWA 1R8XA 2AS0A 1VPTA 2IDJA 2O0LA 2QRVB 1HMYA 2WA1A 5DX8A 5DM0A 3UWPA 4HSGA 3LBYA 5HEKA 2BH2A 3FUVA 2B2CA 2VDUE 4R6XA 2I6GA 3EVBA 5FADA 2EJUA 1R00A 2GPYA 3MCTA 1SQGA 5DX0A 3EVDA 3T7TA 3B3GA 4FT2A 3LGAA 3SXJA 4AZTA 3BKXA 1D2HA 2AZTA 2PJDA 4R8RA 4RVDA 5ICFA 5CD1A 1G38A 1R6AA 4HGZA 3FRIA 3KPUA 4DQ0A 3TPZA 3HTXA 2G8NA 3HVKA 3KQYA 1RJFA 5EMKA 2NNWB 2UYQA 1WZNA 3A7EA 3F4KA 1KXZA 1YUBA 3AJDA 3PVCA 4P7JA 4YUWA 3MTIA 2O05A 3NVMB 3KPVA 4JXJA 5LQAA 3E05A 3B3FA 5LQKA 1KPGA 1KR5A 3CCFA 5DTRA 8MHTA 5E8RA 4FSXA 3E8SA 3RODA 3GCZA 3LL7A 1NT2A 3PX3A 3NW9A 4YUYA 3U81A 1AQIA 4ER7A 2ZWAA 2OYRA 2ERCA 5KQRA 4OQEA 5LQRA 1AF7A 1JSZA 1R18A 1RJEA 1R74A 3M33A 1KYWA 3B5IA 3OU6A 5GP1A 3CJQA 2P7IA 2N47A 4RTJA 2CL5A 2I62A 3K0BA 1FP1D 1XXLA 2O06A 3EVGA 1P1CA 1XCLA 3KQOA 3PB3A 4PONA 1VBFA 3IV6A 4LWOA 2GH1A 2YTZA 1M6YA 5CM2Z 4UOEA 2ZCJA 2P35A 5CUQA 5EGSA 4YMGA 3NTVA 3ELWA 2P7HA 2PXAA 5FHRA 4YUZA 3B89A 2PBFA 2JJQA 4CKCA 3THRA 3EGEA 4GOMD 1M6EX 3GXOA 4P7FA 1JQ3A 3ELUA 3GO4A 2OB2A 2FK8A 3A27A 3R0QA 5K05A 3UA3A 2C7PA 5DTQA 1Y8CA 4RSRA 4PCLA 5H02A 5CVJA 1L3BA 4E2YA 5HOQA 1XTPA 3C3PA 1ZHFA 4XUDA 1RI2A 5CIYA 1VL5A 2FPOA 2ONZA 2AN4A 1EQAA 2PX5A 3HCBA 2C7RA 3CGGA 3KQVA 1X1DA 2ZZKA 1L3IA 1RI5A 5BW4A 2VS1A 5F2NA 3VSEA 5LSAA 2VP3A 3E23A 2BR5A 4PYNA 3RW9A 3P9NA 1SG9A 3SSOA 3FUXA 2XYVA 1QANA 5EMLA 1Z3CA 4HC4A 2OXTA 2O57A 4MQ4A 1UFKA 2ZVJA 5ICGA 3A25A 2XYRA 3DULA 1JG2A 1WS6A 3LDFA 4RX1A 4PIMA 4B17A 5GIOE 4AZVA 4F84A 4GBED 2IH2A 3O31A 3EVFA 5HIJA 3TM4A 2PX2A 2ZWVA 4LWPA 2HNKA 4E33A 5EIWA 1IM8A 2YX1A 3TKAA 3Q7EA 4IKPA 3CJTA 1WG8A 3KQTA 2GS9A 1L3CA 4NECA 4YUXA 3PLAE 4E2WA 4DMGA 3E7PA 3GWZA 5K0CA 2OB1A 3LPMA 2ZBRA 5EHGA 4FSDA 4Z2YA 1NBIA 1ZGAA 3R3HA 4OQDA 2ZULA 3IHTA 5EMMA 4E30A 2G71A 5ICEA 1G55A 2PGXA 3UJBA 3C6KA 3M70A 5E1MA 5K0BA 2AOTA 4HGYA 2HV9A 3UFBA 3EGIA 3G7UA 4OBWA 4F85A 5CCBA 2PV0A 1YF3A 3M6WA 4QQNA 4Y30A 1G8AA 1RI4A 4KWCA 3G5LA 5GM2A 4PYJA 5EVJA 1INLA 5DLYA 2OY0A 2ZTHA 3MCZA 2JG3A 1NW7A 3TKYA 2P41A 2EJTA 4MTLA 4X61A 3O4FA 5CCXA 1P91A 3FRHA 5D1NA 10MHA 2H11A 2ONYA 2IDKA 3VC2A 3JWGA 3GJYA 3DXYA 9MHTA 4M37A 4E70A 3MQ2A 5HIIA 1M0EA 3KQSA 1NW3A 1G60A 1XDZA 2PT9A 1UIRA 3D2LA 3EVEA 4FGZA 1DL5A 3DLCA 3HM2A 1VLMA 3ELYA 4PYMA 4QTUB 2B78A 3BWYA 2C7QA 4PGGA 3GGDA 3QOXA 3L8DA 1P39A 2QY6A 3CBGA 3JWJA 3RIEA 4ER3A 2AVDA 3A4TA 3I64A 3A7DA 4BY9E 4BLWA 4RYLA 4C03A 2E5WA 3GNLA 3OFKA 3SSMA 4V0RA 2PX4A 3KPYA 2R3SA 2YQZA 4BLVA 4DKJA 2ESRA 2CKDA 1NKVA 3UBTA 1EJ0A 2XVAA 5E2AA 2IBTA 3C3YA 1VP9A 2V7EA 3LX6A 4XUEA 4PNEA 4C08A 4M36A 3G89A 4OX9Y 1I4WA 1ORIA 5IH3A 2QYOA 3OE5A 2AVNA 3FPEA 4H0NA 2P1DA 5HIKA 2PLWA 5HZMA 5LQNA 3B3JA 1PJZA 4RTRA 3FPJA 4C06A 4C4AA 2PSSA 5T67A 1JG1A 5KQSA 5GINE 3KR9A 2K4MA 4A6EA 2AOTB 5B1SA 2ZBPA 3NJRA 3KQQA 4YV0A 5EOVA 2NXCA 3C6MA 2P3LA 4X1OA 4P7KA 4L7VA 1G6Q1 3HEMA 4YV1A 3MAGA 4CKBA 2YXEA 4HTFA 2Y1XA 3TR6A 1EG2A 5GM1A 2NP7A 2UZ4A 4FS8A 3GRRA 3ANXA 3ORHA 3GRUA 5C1IA 3EEOA 5K09A 2BM8A 3KQPA 4RTOA 2VDVE 2PXXA 3BWCA 3KR2A 2JH8A 1F38A 1VP3A 2P40A 3KPWA 2H1RA 2CWWA 1QAOA 1BOOA 2OO3A 3BWBA 2ZIGA 1FPQA 2UYHA 1AV6A 3TOSA 2GA9A 4R6WA 3LCUA 3P2EA 5DM2A 1Q0SA 3TQSA 4LECA 4POOA 4V0QA 5LR6A 2AOXA 4WVLA 4CXMA 4M7RA 3G2OA 2AOUA 5EPEA 3UJ9A 4GOOD 4RTSA 5K0JA 3GIWA 5EHIA 3UJ8A 4AZWA 3HVIA 4QPPA 2GLUA 1QZZA 3AXSA 3FTEA 3MGGA 2G1PA 2IFTA 2ZW9A 3NWEA 2PWYA 2NXEA 2UYOA 4PYLA 3X0DA 4C04A 5DRTA 4AZSA 1NW5A 4RTNA 1WXWA 4YV2A 2P8JA 3EVCA 4DCMA 1JQDA 5CVDA 3UJ6A 1T43A 5U4XA 4E2ZA 2QE6A 2HWKA 1XDUA 2NXNA 4AUKA 3SM3A 3O7WA 3NDJA 4A6DA 1O9GA 4RTQA 3BUSA 3G8AA 3IEIA 4CKEA 5DXJA 3T0IA 5DX1A 5E9JA 2I9KA 3ERCA 1WXXA 4ER0A 1ZKDA 5HILA 3V8VA 3P71T 2OKCA 5FWDA 3I9FA 3UJAA 3MERA 1U2ZA 5ERGB 3PS9A 3LKZA 1P1BA 4PWYA 3DOUA 4FZVA 4QVKA 2PVCA 3AY0A 5EIFA 4C05A 3UJDA 2PX8A 1PRYA 4XUCA 2C7OA 1UWVA 4HG2A 1SVUA 3NDIA 2ZSUA 3P97A 5IKMA 4PINA 5T64A 2FK7A 4DCGA 2VDWA 2HMYB 3FTCA 4GQBA 1TW3A 3HVHA 4K6MA 1NW6A 1KYZA 5E2BA 3TFWA 3FUTA 2IP2A 4HTFB 2R6ZA 3EGVA 2A14A 1NV9A 1XCJA 2QM3A 3DLIA 4PYQA 3ID6C 4X60A 4FR0A 4RVHA 3KKZA 5P8WA 3OFJA 5F2KA 1N2XA 3NWBA 4MIKA 3WSTA 3BGIA 4EKIA 2ZZNA 4FP9A 4PYKA 5FULA 2AN3A 3CC8A 4GEKA 4Y2HA 2FCAA 4EVIA 5LQCA 4PYIA 3BGDA 4LG1A 4X63A 1ZGJA 3TLJA 4IWNA 1KIAA 2ADMA 2KW5A 5DWQA 1L9KA 1X1CA 3R24A 2PKWA 5EKUA 3SSNA 1VE3A 1IXKA 2EG5A 3BZBA 2XYQA 3M6XA 1JTEA 2AOUB 1D2CA 2DPMA 1I1NA 3T7RA 1RI3A 3NVKI 3HCCA 2JH9A 3MTEA 5CVVA 2I7CA 5E8JA 4DZRA 1SKMA 2BM9A 1VIDA 4OBXA 2GB4A 3K6RA 4E2XA 2BR3A 3EEYA 3PT9A 1RJGA 2AR0A 1X19A 1WY7A 1ZQ9A 5CVUA 3FUUA 3LBFA 3FTFA 2H00A 1YFLA 5GOZA 4RTMA 4RVFA 5DM1A 5DPMA 4CTKA 2Z6AA 5F2OA 1V39A 4MWZA 3G88A 4G56A 4XCXA 5FQNA 3M4XA 2ZIEA 1ORHA 4KDCA 3BT7A 1KP9A 1JTFA 1N7JA 2ZLBA 3DP7A 5DXAA 3QOWA 4QDKA 3FUWA 5FWAA 1JG3A 4HRAA 3REOA 4RTLA 3FYDA 2P3OA 1X1AA 3EPPA 1YZ3A 4AX8A 3ELDA 3C0KA 2CMHA 3I5UA 3FZGA 2Y1WA 1FJXA 2HTEA 5K0LA 3DUWA 2B9EA 5E1DA 2YUIA 4KIGA 1G8SA 1H1DA 1XJ5A 3LCCA 3DMFA 3G2QA 3PFHA 1O9HA 4KIFA 5K0NA 1BC5A 1BKYA 1SUIA 5GIPE 5BW5A 3AWIA 4GC9A 4PCAA 7MHTA 1D2GA 2UYCA 3LDGA 2GAFA 4PGHA 3UJCA 3EMDA 3FPFA 3OZRA 5EG5A 3OE4A 2G72A 5C0OE 5E9QA 4M38A 5EQJB 3PTAA 5ICCA 2P3QA 5EEGA 1L1EA 5CVEA 3VYWA 3KHKA 4BP1A 4QPNA 2AOVA 2PWPA 2DULA 4QTTB 3DXXA 3G2MA 3P9IA 4RTPA 3JWHA 4RTKA 5HFJA 4ZTBA 3UA4A 3HA5A 3LHDA 2B3TA 5K0EA 1QAMA 3GRVA 3HA7A 2OPBA 3OU2A 5BXYA 2XBMA 5JR3A 4P58A 3M6UA 3G8BA 2FRXA 5K8VA 3UJ7A 1N7IA 2WK1A 2ORED 2PT6A 2ZIFA 3OZSA 2FYTA 5DM4A 4ISCA 3DMHA 3ER9A 2PY6A 4OA5A 3B7PA 4PIPA 2JHAA 2LD4A 3CJRA 3HCAA 4OA8A 1HNNA 4RV9A 1X1BA 3G5TA 3AXTA 2AOWA 3THSA 1DUSA 4GC5A 4GOLD 5KVAA 1R8YA 2ZBQA 1TPYA 5FA8A 1AQJA 5G02A 2Q41A 3GDHA 5KYGA 2V74B 2XVMA 5FCDA 5HIMA 2AN5A 1NE2A 4DM3A 4U7PB 4FT4A 1TW2A 3EVAA 3HCEA 4MHTA 4DA4A 4QQKA 5K03A 3MB5A 2F8LA 4HH4A 2IGTA 3LKDA 5E1OA 1KPHA 3TMAA 2HR1A 3LECA 1YFJA 3P9KA 4GUAA 3M6VA 4BLUA 4U7TB 3P2IA 5LQJA 5EC8A 3V97A 2Z6UA 3GRYA 4IV8A 3SGLA 3P2KA 5DT2A 3HNRA 4BP3A 3H2BA 1MJFA 1YZHA 4IV0A 3SR4A 4KRGA 3FPHA 5GWXA 5T6BA 3A26A 3FTDA 4PYOA 5C9ZA 5FA5A 3SX0A 3DR5A 1KPIA 3EVZA 1FP2A 3NMUF 5E9WA 5K0FA 3IYLW 5EZSA 2IH5A 2WA2A 2YR0A 2B25A 3S68A 3I53A 4KDRA 1EJ6A 4DF3A 3CKKA 5D1HA 5EZQA 4YUVA 3BGVA 3R9XB 3HCDA 3LDUA 5DTMA 5DSXA 3SMQA 2OZVA 4P7GA 5MHTA 2QRVA 2FHPA 4E31A 4ER5A 3KPJA 3OPNA 1BHJA 4RWZA 3PFGA 4CWAA 5FHQA 5BP7A 1SQFA 2VZ9A 3TM5A 1F3LA 3CVOA 3P9CA 2EFJA 5FTWA 3GRZA 2IBSA 1O54A 5M5BA 5DSTA 1KHHA 1RJDA 3UZUA 1SUSA 3LCVB 3LSTA 3BWMA 3HA3A 1EIZA 3BKWA 1QAQA 2G70A 4R05A 5EMJA 3DTNA 5K0GA 1MHTA 1FBNA 3SVZA 1EAMA 1QYRA 1JG4A 2JHPA 5FUBA 2ZZMA 4GF5A 3VC1A 3KR0A 1OR8A 2NYUA 4ER6A 2ZFUA 3HVJA 3P8ZA 1JSXA 1RI1A 2BZGA 3JWIA 3DMGA 3ME5A 3QV2A 4O29A 4C07A 1I9GA 4E32A 4YMHA 5JUWA 1Q0TA 3ER8A 2CMGA 3BXOA 4X41A 1XVAA 5K01A 3OCJA 2YXLA 4F86A 4QVGA 4KW7A 3R6TA 1NV8A 3PX2A 1ZG3A 1YB2A 3Q87B 4ATNA 5KS2A 2NP6A 3EMBA 3OU7A 4EK9A 4EMSA 5DRYA 1JR4A 5LQUA 1VQ1A 3FPGA 2IH4A 3FYCA 4GOND 1JQEA
chains in the Genus database with same CATH superfamily
2C9YA 1I6KA 2DMRA 3EXEB 5A1TA 1E1CB 3FZNA 4ND1A 4QDTA 1SULA 2BI8A 2QN1A 1DCTA 2VYNA 4KFCA 4Y6PA 1B42A 4CM7A 5DHAA 2FSHA 1FPMA 1R66A 2BR4A 1OWLA 1B1CA 1SHJA 4LMBA 1ZA1A 1IY9A 4AG5A 2B99A 2QORA 1QRSA 1MNQA 3BB3A 4KIUA 4CG1A 3GV0A 3JQQA 1XDSA 3AUJB 5FBRB 2I2XB 1QRDA 4JQSA 5H70A 3V1TC 4QRDA 3CVVA 1XLUA 1RACA 2P2SA 2CB9A 4ID9A 3SBOA 2GVZC 1SOUA 3KQLA 5EZYB 4N8EA 3NTUA 4MX8A 5AJWA 5DX8A 2Q8NA 3SD7A 4DUGA 2EWWA 3JQ8A 1CJBA 1G98A 4KVAA 3B5EA 4NJMA 521PA 3T7TA 5EIBD 3MCTA 4C0LA 4WAUA 1R4ZA 3BKXA 3IMCA 1GUAA 4R8RA 5EE3A 1GSOA 2VQ3A 5TGDA 3N9IA 4IQFA 1H4QA 2K6GA 4P34A 1QU3A 1PP4A 1U3WA 1RJFA 1W1UA 2E49A 4TM8A 5CFLA 3L1HA 4YUWA 3PLRA 4E08A 4RXMA 1P3Y1 1XXHA 3EFEA 1LS6A 3O0DA 3WGQA 2GYWA 5B4TA 2ZAOA 2FG7C 4IVQA 2JIPA 4FYXA 3BERA 3PX3A 3IOCA 3N58A 1EJ2A 4INZA 4UCFA 1V4VA 2CXOA 4ZOLA 4LWZA 5J2TB 1ZK3A 1JSZA 4EVSA 1IG0A 1L4BA 1Y5RA 3MRSA 5GP1A 3FI9A 4JT2A 3GLHB 3UXEA 3ZE1B 2A9RA 1B8UA 3COWA 5B6JA 1U2QA 5FUYA 1CFJA 2J7PD 3PDUA 1GO2A 1QIMA 1QH1B 2DWQA 3BQ9A 3PFKA 1YQQA 3DZIA 3E3NA 3KKEA 2WTAA 4YJKA 2C2GA 1QUEA 3PB3A 5FFFA 2XMDA 1QHYA 1XEAA 4TUYA 2I80A 2J9RA 3HI4A 3KB6A 4IMJB 5CAEB 3ELWA 4DN6A 4DM4A 4DNPA 5JY1A 2DM6A 1PJTA 4IKOA 4Z8XA 4OHBA 2CCJA 2AUNA 1RU3A 1KY2A 1S7CA 4IZOA 4QXRA 1MW9X 3SC2A 4C2BA 3GJ8A 5LMUB 2JCYA 5JRJA 1A9TA 3CXUA 3ML1A 3A27A 4LDJA 3MNFA 1PUXA 4EL5A 1ZR2A 2Q4EA 1ID8A 4I6EA 2AG1A 3C4JA 4RSRA 3LM8A 1EHYA 1PQYA 2R6JA 3AIKA 3W9SA 3WGLA 4N54A 1LBEA 1P4SA 1SUAA 3TCXB 4KXNA 5CIYA 3NDPA 4AFNA 1DB3A 1SC6A 1G3QA 2XQGA 3GELA 1JG6A 2C07A 3AU8A 3OLCX 2PD4A 3K16A 3N2ZB 1D0SA 1Q92A 3L7AA 3S99A 3KRTA 4K46A 5IF9A 2Q5CA 4L8WB 3R3VA 3N2KA 3HGQA 3GG2A 4ZVNA 3RW9A 3DB1A 4LF9B 2C31A 3OFSA 4GKKB 4A0RA 1CRQA 5BYJA 3E3AA 1CZLA 3OY2A 1ISGA 3BM5A 1N1MA 1HE3A 1OASA 3N2NA 1J99A 4R7ZA 3ITNA 2HU7A 3KEMA 1KEEA 5IBCA 1PJ3A 3PI7A 1BDJA 1LPSA 2R751 3PG5A 4XSVA 3PYXA 4M0UA 3ZHBA 2ODNA 2RHMA 2NT3A 3CRMA 5J43A 1ZD1A 3OX1A 1JR3E 4ED9A 1OZHA 1KDTA 2H9AA 13PKA 4JBIA 5AVYA 5F78A 2I34A 1TKRA 2Y4OA 3C1AA 3I05A 5FLKA 1PVDA 1RVV1 4B2PA 3KDSE 3GBVA 4KNYA 4S0XA 3WLQA 4B40A 3AR6A 5ITZB 1Z88A 1LDGA 2QY9A 4UBKA 1K2VN 3KVYA 5WRFA 2YWXA 3RS5A 1I36A 4GM1A 4TKUA 2EJBA 3TR0A 1CLUA 4BRZA 4FMCF 2PLFA 4QASA 2H51A 3OC0A 5U1PA 2ZK7A 2ZBDA 2G28A 3EXIA 4GZ3A 3LPAA 2F43A 4XEHA 3T4UA 2ZRJA 1MTZA 2JKVA 2ZSKA 3LQFA 2XE7A 3L0OA 3PF9A 4G4SP 4F5YA 1A5ZA 2OY0A 5AW2A 5ILOA 1KGSA 1B8VA 4X61A 2PR7A 1ZC3A 4WZ6A 2H11A 3HO1A 2IDKA 2Z2JA 4IUBS 4YHBA 4FM9A 3JWGA 2J0UB 4DLPA 3DXYA 3DOIA 1T4GA 4HNSA 3C74A 2DQYA 3QWAA 4K3UA 1MOSA 3AKEA 5C8ZA 1PWYE 1WPQA 4UNPA 1BD4A 3O1HB 3AINA 3BB4A 1G63A 3JD1A 5HFNA 4P4TA 4X44A 4ZEOA 5GVSA 3R3WA 3TXYA 4AF8A 4WBNF 5CT4A 1PT8A 2WMOB 3PXCX 1WW3A 3OZXA 4DMRA 4PGGA 5C18A 4R2XA 3QOXA 1L5SA 4LZZA 1BW9B 5H3CA 2B3DA 1P39A 1YUMA 2CCGA 2ZCVA 3CLRC 1TM1E 3MHPA 4GU5A 2HCFA 2XMCA 1ESZA 4RMJA 3GCXA 1EVJA 3RSOA 4RJLA 3HM9A 1NL3A 2V4UA 2WG2A 3I2JA 4DY4A 4Y9DA 1P4JA 2I66A 4MRNA 5EY5B 1MRZA 1CDDA 1A9RA 2R3SA 1A95A 1N3LA 2FUNB 1K8RA 4G9EA 4QJ4A 3RFTA 4BLVA 1WKVA 2ESRA 5BSWA 1HM5A 4Q3BA 3U31A 3KSUA 4PRZA 1VHTA 4NYJQ 3SPXA 1GDHA 3PUXA 2VJCA 4YONB 4I66A 1H0SA 2GNPA 2IT1A 3PZBA 4XUEA 4OHOA 2W6JA 2PRIA 3X44A 1KDVA 3KEFA 5CTAA 2MU1A 1FUYB 1GRRA 1NFRA 4XXHA 4RDIA 4XWGA 1QHGA 3N8GA 1X3SA 4TRMA 1Q20A 3ZWKA 1PJZA 5ENZA 1VB3A 2C77A 3EARA 3CM0A 3QWIA 3IKVA 4G85A 1W94A 3DQZA 5T4FA 5EJEA 4KRXA 3QLTA 1A9PA 4LZOA 4Y9RA 2I54A 1GZ3A 2NV0A 1O6ZA 2B7BA 4Q00A 4U9IS 1W25A 2ZETA 5EOVA 3T5GA 1G5HA 4KV7A 1M2NA 1AH2A 1XOIA 3NX4A 1JEAA 2VCEA 3T3MB 3ND7A 3CH4B 1PWXA 4JU8A 1XVLA 3ROTA 4F9GA 1XZQA 5C1IA 1CLEA 3WV4A 1ZH0A 1JMVA 2C8LA 3L4BA 1N2GA 4MJXA 2IHBA 3AR5A 4PN7A 2H1RA 2I4NA 4BV8A 2Z95A 1L5RA 4R0VA 4OQZA 3FKSD 1DCMA 1CS0B 2Q46A 4R54A 1OFTA 2DUUA 3SVLA 2AOXA 2XUGA 3TL2A 4M7RA 2AMLA 3HJHA 4XWWA 1PYOA 1FP6A 1DAGA 4M9ZA 4PIVA 4AZWA 3EIHA 5JJBA 5F7XA 4KFSA 2AN9A 3NIDB 1JDJA 2ZW9A 1VMKA 4NYIR 4WN3A 1E9EA 3R7SA 3ROQA 3WWCA 3AGQA 4C04A 5CA1F 1EFPB 1X2BA 3ZZUA 4EX6A 2PFKA 4L8YA 4G8CA 3O75A 1RXUA 1JLSA 4GBMA 4IDQA 5G0TA 2DR2A 2CLLB 3LQ2A 4OHRA 4ROTA 3OLQA 2ZRIA 3Q7SA 1LFDB 1MXHA 1QH8A 3ZU5A 4C78A 3KWFA 3GEBA 1Z26A 5J4LA 1X7WB 1H4TA 3KFXA 5BMVA 1VG8A 4ZV9A 1DBRA 3AESB 4G67A 2ZYVX 4Z3KA 3WLTA 1K5DA 1TFUA 1ZVMA 2WMYA 3R20A 4TV8A 2Q7DA 4CKEA 5JFOA 2VWPA 2JGKA 4MV6A 2A5JA 5E4YA 2FB9A 3DBVO 1WHTB 3O8BA 3VFDA 5HILA 4BBZA 3JARA 3L7MA 5FA6A 1VRVA 3ENKA 4ZEXA 2JEYA 3ZCPA 4QTZA 2X2PA 3LQ1A 2K7FA 2M9MA 5CYGA 1RLJA 4Q9KA 4H59A 2PX8A 3FF1A 9LDTA 1ZSYA 1ZUD1 1U28C 2YNMC 4EFKA 4HYEA 5IKMA 3L4JA 3ICPA 1W48A 2W2NA 4PG5A 2ECKA 1IM5A 1CJKC 2ZM5A 3EEBA 2WLSA 2J3IA 5EYPB 5A62A 2ZREA 3NTOA 1AGPA 3NKVA 3RT7A 4CMCA 3QFFA 4PANA 4XJXA 1EXMA 1NIPA 4YGYA 1Q6YA 4RGQA 2A9PA 1CPYA 2AX3A 3OICA 2GAAA 1D1PA 3PRHA 4BVBA 5HGXA 1DARA 4B47A 1JKJA 3HXPA 2Y0BA 1POXA 5EESA 2FZEA 4LG1A 1QGUA 2BCGY 3H1GA 3LDAA 2EEPA 4DFDA 2HUPA 1QIIA 2RHBA 2YZGA 2FI1A 3B13B 3AR3A 1SIUA 2EG5A 3A4NA 4NY1A 4EJ0A 1ATZA 3UPDA 3GUUA 4GYYA 1RI3A 1WHSB 1YL7A 3MTEA 1MN6A 2WG1A 5HBGA 4YX9A 1VG0B 2PTHA 1TU3A 3AFOA 3HU5A 3OM1A 2ZT8A 4I6JA 4YDHB 1II0A 2IDZA 4A2QA 1L5GB 4QBGB 4B7ZA 5BORA 3QG1A 3PT9A 2AR0A 4OAOA 1X19A 1ECLA 1FSSA 1WY7A 3F5DA 3U60B 1RXIA 2VJMB 1FRFS 1P17A 5DPMA 4LKOA 4Z8YA 5B37A 1F6BA 1V39A 1UBCA 1XNQB 3N8NA 1T1JA 4UM9B 2VSQA 3WYNA 1SRRA 4RO0A 3NWJA 4KDCA 4PCVA 3TLBA 1KP9A 4ZHSA 1W0KA 4D4HA 4ND7A 5JNRA 4DB4A 1G8JA 3DCIA 3LIPA 3GGOA 1O8CA 1C1DA 1E3WB 4R9UC 4TVSA 4Y2PA 1YNSA 3HFGA 4AY4A 1FRNA 1PFKA 3BILA 1U3UA 4TT3A 2QEQA 3IEPA 3GEMA 4J2TA 4KN6A 1A8SA 2YRWA 3HL4A 4F3TA 2BGKA 3WA6A 1NOJA 4YYZA 2HDNB 3LCCA 2NQTA 721PA 2VDWB 4MDEA 2H4XA 3FWPA 3IURA 4FYPA 1ODFA 1DRKA 5FNVB 4LTDA 4B6OA 3K5HA 1UBHS 3P20A 1RLTA 1IHDA 3A1EA 5JH7A 3COZA 4D1YA 2QXUA 3UJCA 3DAYA 1EFKA 1L8OA 1XLVA 2OCAA 3U7JA 1SC3A 4MRRA 5A2GA 3IC5A 1G8PA 4M38A 2P2YA 3UWDA 5LDDC 3MT7A 5J9FA 2QL5A 1L1RA 1Z6XA 2V5UA 3ZY2A 3TGPA 1RLOA 3TLAA 1JLHA 1KI6B 3C3JA 4LE2A 5H5JA 3RF6A 3AQIA 4LPSA 4V1CI 5HFJA 5ITWA 1DZIA 2QX6A 2QG4A 5HQTA 4MIEA 2JBAA 2B1GA 1XMVA 2P2DA 1BVRA 2C4UA 3F46A 2RI0A 2QL7A 3O3CA 3Q2OA 5BURA 3TQOA 4BKRA 4L85A 3M6LA 1T4CA 2YV4A 1AIPA 4MHOA 4XDZA 2JHAA 2D7DA 2JZCA 1YVRA 1C3OA 1HNNA 4TQ9A 4L76A 1CR6A 2H92A 2V58A 3AXTA 3VI3B 4D25A 4N9QA 4X8LA 3RJTA 4K2HA 5T41A 1E79A 3MIZA 4JA2A 3OTOB 2FPSA 9ABPA 4IX9A 1W9MA 2Q41A 1T6XA 4RC9A 4DGQA 1IHXA 1SBZA 3EQ6A 3Q3JB 1HFWA 5A4AA 3SHVA 1WULS 3V4SA 4G37A 4Q93A 4R9VA 2XH8A 1GM5A 5JISA 3KZVA 2W2OA 4MYRA 3CLTC 1VHJA 1T5SA 2V65A 4G0PA 3LECA 4P8RA 3RCBA 1P5RA 2GERA 4YPOA 3AEUB 3V97A 3WWZA 2JIOA 1QFXA 1U2PA 1JSLA 1UBSB 2CHFA 2OD9A 2W6ZA 1RIIA 3KLMX 3M5WA 2DPLA 4KGVA 1QFMA 4Q4JA 2XXAA 2PZ8A 5GJWC 2BEWA 1VA4A 3K09A 1RHUA 3NHPA 3FIUA 4K6CA 1MZVA 2C5FA 1AZSC 3COJA 3U16A 2G63A 4L51A 3CZRA 3EVZA 1ZINA 4D4LA 1TX4B 1ZU5A 2R1UA 4JB0A 1KJNA 3KZNA 3DDOA 5DCUA 4A5SA 4ZK2A 3M3HA 5DXFA 3MTJA 3W0LB 5EWJA 1K6EA 1OFUA 3ZDAA 4U7WA 2WILA 4QXMA 3I30X 4OFXA 1RYDA 1YR8A 5ALEA 4IH1A 1V5IA 1GFSA 2O23A 1R9JA 4E07A 3IEXA 1LK0A 2N3ZA 4JSTA 1V6CA 1E8DA 2ZBEA 3EODA 1BHJA 3G85A 1D9XA 3JASB 2FMUA 1XHFA 3IBSA 4JASB 3BMOA 4PR3A 4RACA 5D2CA 1C5KA 2QG9A 4KAXA 4DE5A 3KOOA 2PSEA 1NQVA 4M8KA 4YRKA 2EX0A 1BCSA 1CUEA 4GRAA 4NI5A 2HMWA 3CO5A 4AG6A 3AR4A 2QV0A 5KREA 1QG4A 3AYXB 3BWMA 1OLUA 4QOGA 4RPLA 4C9BA 1GITA 3H16A 2LXNA 4ZOAA 4KQIA 5FH9A 2C4VA 2VT7A 1QF7A 1PUJA 1UBFA 3WGJA 5IEJA 4NARA 3T61A 3OJLA 5HUJA 1BN6A 1P1HA 3EUWA 2YJ5A 1K4YA 4RE6A 4O29A 1T8WA 3KM0A 1E1MA 1KO4A 1MP0A 2VLBA 3LUCA 5K01A 1HMPA 2HRBA 1UXHA 3EHEA 4NPAA 1NV8A 4ATNA 1U0FA 4EF5A 2CLKB 3UGQA 1DQSA 4MUXA 4ERNA 5AVTA 2BLNA 3ORYA 3H1TA 2HLDD 3C6XA 5B55A 3C4VA 3DF9A 3ZUGA 3IEMA 1Y34E 3FYCA 4GOND 4G5GA 1JQEA 1DGQA 1L5YA 1LRLA 3RS7A 1FMJA 3I6BA 1FFHA 3H5RA 3GBPA 3T5BA 5AR1A 2RGDA 2O3UA 2PZFA 3BTUA 3HCFA 4H7HA 2QUHA 2R6AA 5BWBA 4W1RA 4XX1A 1HYBA 3BXGA 3QX9A 4DM3A 1GZVA 4ARZA 4CU2A 1USUA 2VHWA 4N7MA 4BFSA 1E60A 4ZCMA 1DQRA 2GF2A 2XOKD 4M2LA 2ZDGA 4P1ZA 3YASA 5AI5A 1IRXA 1IB0A 1P60A 4C7MA 4DV7B 2MYNA 1JFRA 4QAQA 4OI4A 3D6UA 4A2CA 2QRVB 1HMYA 1XMOB 1XPJA 3UAWA 5C2JB 5CYFA 2FX5A 1C50A 5ALSA 4KPFC 3ZV3A 4JYPA 4B3CA 1SQGA 5IDYA 3TIIA 3WNBA 2QMYA 4DILA 1M6WA 1E4EB 4QBHA 4W5TA 1TEHA 4Z6KA 4BAGA 3QE4A 2Q4OA 3A28A 3EIOA 4WBXC 5AQ1A 3KCQA 4BQIA 2P0EA 2P77A 2FR8A 5TRTA 4O2BA 4JI3B 3RHFA 4TKLA 3HB0A 2GDZA 1O77A 1U0NA 4NNOA 4N39A 3UMFA 4UBNA 4D02A 4JKOA 3D3EA 2PVSA 3AKCA 4UHHA 5LUAA 3JQAD 3W4IA 3OWHA 3IVXA 2HT1A 4YCSA 3KLPX 1U0JA 4ECAA 4D97A 5DI9A 1WMFA 1O89A 1UPTA 1YKFA 4O25A 1UEJA 2C1XA 4C3UA 4OK5A 2OYSA 2Q0XA 4X6YA 4ZEMA 1Y3FE 4COOA 1JHXA 1XYYA 1QIJA 1X80A 3FGOA 3QQPA 4KWTA 5JCXA 3ESDA 5JO0A 2XKKA 3ORQA 1COWA 5AO9A 5I7WA 2DH5A 3CMMA 4AS1A 1VLQA 4DDKA 1DFGA 2KPOA 4BRUA 1Y9JA 2YHAA 1H6CA 1XXLA 1C8KA 4K9QA 3I5AA 4H4DA 4I9GA 2OENG 2D7CA 4X00A 1BE8A 5EZ5A 1Y9AA 1QIGA 1VBFA 3FSEA 5FRDA 5IUNC 3BJRA 3OP4A 3RAGA 5A04A 2WKPA 2P35A 5IFKA 5EGSA 3FIJA 1L4HA 2FAXA 4WN9A 3HY4A 1MQSA 2XHEA 2IELA 2COEA 4QUBA 4HRVA 2VPWA 2MMGA 2ZYDA 2BGUA 4MVYA 1FXUA 1I6MA 2V1XA 4P7FA 4X1KB 1EAYA 5E7QA 4Z9XA 3L1IA 4Y67A 4TROA 3VX4A 2FH5B 3DKIA 3F3KA 3GUHA 4HFMA 2YCLA 4KV9A 1CJTC 5LMCA 1L3BA 3E81A 3P0FA 3JTEA 2V96A 3MD9A 4JI2B 4XFKA 4A6PA 1TF7A 2OV6A 2LDXA 3OQIB 1CHNA 4NXNB 1ODSA 2ZDHA 3EMVA 3D3KA 3NH6A 5DW0A 1TXGA 1PSWA 5FWYA 4ITUA 4I55F 4A8JC 4DDTA 1R6VA 1CZUA 2J0SA 3FZQA 1BROA 1ZH8A 2HSWA 3QU4A 1XWWA 1V8OA 3FUXA 4LFCB 3WYGA 2C92A 3TLYA 2X5NA 1SHKA 4R9SA 5CW1A 1Q2UA 2YY7A 4O4JF 2CDNA 4HNTA 4AMYA 5J58A 3QPAA 4P38A 4G0XA 4C0JA 4A36A 2C58A 3FETA 3TTTA 2PO7A 5KYXB 1PEDA 4CUZA 2JI7A 3IT1A 1Y4DE 3LWZA 1VXRA 1Z2CA 4PG7A 4GYJA 2PX2A 4ZI7A 1CUBA 3PWSA 3ZDZB 1IM8A 5CB0A 3TAHA 4U9UA 1KEUA 4B9AA 4BTEA 1UADA 2VLIA 3ER6A 1NR7A 3Q6MA 3L41A 1JRLA 4QC2A 4ACBA 1XBTA 2I8AA 1CR0A 4ZT4A 3CR7A 3U0BA 3E7PA 1PBNA 2WT4A 2XMGA 3BAFA 2JZOA 4U0KA 1KERA 4LF8B 1QFZA 4LBZA 2B9VA 4DC9A 3KSDO 3ZVKA 1ISHA 3UJBA 5I8PA 3FFTA 1KJQA 3QW4B 3GI1A 3P9SA 5C7IO 4YAEA 3IHKA 4REMA 2Y0PA 4UU1A 2W48A 1YR6A 4QQNA 3A6EA 4D5EA 1U8YA 4CEJB 4E5UA 4L8LA 2HF2A 1AO3A 4IZ6A 3TIGA 3THXA 1XQ6A 4WX2B 4QDOA 4Y2SA 4LHVA 2V7BA 3O8QA 4DVGA 4KBGA 2EZ4A 2KLBA 1E1KA 4UVEA 4E70A 1A9OA 1YS4A 2AFIB 4Z3DA 1ACLA 2HA5A 1XMPA 1G60A 4DA7A 2GFHA 1CQZA 1QB8A 4FGUA 2FSFA 3CF4A 3OHPA 4CM9D 2HYDA 1DEKA 2BBOA 6NULA 2DF8A 3EZLA 2BFFB 4RSGA 4QT4A 5JJ5A 3OLWA 2FFAA 4PLTA 4DPLA 1IG3A 1SZCA 1B16A 3ZU6A 3INTA 4NHOA 2XYPA 3LNTA 1M2GA 1KSHA 1V45E 3CUEF 5FFNA 4WBNB 3KLOA 1NY6A 2RK3A 1SCDA 3Q15C 1UAYA 2JI6A 1MJGA 4E22A 3W5HA 4BKMA 1A8QA 1JJFA 2OO5C 4CKYA 3R6LA 4RL6A 1ZS9A 1MW8X 3SF0A 4N6GA 4DLVA 1N0VC 1W0CA 2IW3A 5TNXA 1JLMA 2PUWA 2OOSA 3NOVA 1GPJA 3K1AB 1UP7A 3VV3A 3EBOA 3C6ZA 2Z43A 3LQ4A 4EHFA 3IULA 1CUWA 1R0YA 3KNZA 4NK5A 1GPBA 3SF8A 4AO8A 1OZGA 4HQ0A 2R8YA 1Z47A 1LQUA 5JSYA 2PJRA 2ZRDA 1Z73A 1N2JA 1OKKA 2UZAA 3WB9A 2K4MA 1PHRA 2YY5A 3HDGA 4J0DA 1T9BA 5DK4A 1RXVA 3W5IA 1DC5A 4RF4A 4RQAA 3GWGA 1EM6A 5EE0A 2QTHA 5J63A 3EGCA 2G4VA 3OCYA 1QYWA 3KJIA 3ZXUB 4CKBA 2C9BA 1A27A 4TSFD 1VJTA 2K7ZA 3IA7A 4TRJA 4A23A 2YIJA 3K6SA 2HT6A 2VF8A 5HCNA 5FPPA 2BTEA 2KBFA 2C84A 1RM4A 1X8XA 2IV2X 2CNDA 4XDGA 5IU6A 2MSWA 5DEOA 3JQAB 1VIMA 4YQEA 1WRBA 3KPWA 2V5AA 3VJKA 4EGQA 1NATA 2R4UA 5JIBA 2GA9A 5DM2A 1H22A 1WTAA 2OXFA 3B6EA 2DJ5A 1XHEA 1IPFA 1KVQA 3JQ7B 3ZKWB 3G2OA 2BH9A 3T1QA 1QKIA 1B8NA 1NBWB 4JB2A 5DIZA 3LRPA 4IIHA 2ASEA 4ZFNA 2G1PA 2J07A 3L1KA 2ADFA 2J48A 4OX9Y 4BNVA 2PWYA 4JELA 4JLNA 4LKRA 4LSMA 2PZBA 3DFUA 4AZSA 4TLDA 2WJJA 4J7XA 4YV2A 5ADUS 1X1RA 4AMBA 1YZUA 4LI3X 1UJBA 2ZYUX 5CA1B 4TWRA 1MGPA 1PT9A 3WRXA 4F6RB 2QPAA 4KPYA 1FE8A 2I3GA 5C8XA 3G0HA 3IB6A 2RC6A 2ZWMA 3KYDA 1JR3D 4PRKA 1WVIA 3HB4X 3N07A 1SU4A 2BC9A 1JW9B 4E7OA 1R16A 2EC5A 4D3YA 2W6NA 3O4JA 3SHWA 3JALA 3WY9A 3V2HA 1TTTA 1DO0A 3DL2A 2GD1O 5E7MA 1JE1A 3JAKA 1C0LA 1S7GA 4US0R 2FPGB 3U7QB 2OBNA 3VOTA 1LX7A 4R2LA 4YCNA 1FYVA 4QJIA 4FX5A 3NYWA 4QYSA 2A9OA 2QRLA 2YIMA 1OBVA 3DOUA 1OPRA 5EIFA 5G0WA 3CE9A 1GARA 5KOHA 4J1NA 1SCBA 1A1SA 5KSPA 4E12A 3OY7A 1ABBA 1AN0A 4GMXA 4Z1OA 3Q0IA 3IDAA 1ITZA 1KYZA 4Q1CA 3DLAA 3FUTA 2W0SA 1Z33A 3IIJA 3LA6A 4RHYA 3IUYA 4GSLA 3F6BX 3IQEA 5EXDA 1I2DA 1XUOA 1NYLA 5A7FA 2D54A 5KX5B 1X14A 2YWRA 3L0DA 3AB7A 4FGLA 1KAOA 3AHIA 4GGPA 4KXVA 4MVJH 2QAGB 2ZI5A 3CPEA 2Y6UA 3MG9A 1XRNA 5IUJC 2PKWA 3EGDB 3PR1A 1JNYA 5AXAA 3VYSB 1RP1A 2E89A 1G20B 3C8HA 4M0DA 1JTEA 2OCGA 4K9RA 4UUAA 3RS8A 2QN8A 1ZL0A 4ZICA 4JC4A 4F1WA 5FWNA 2JIBA 4Z86A 1KO8A 1PYGA 3HBLA 4R1OA 5I4BA 3BJIC 1TVCA 1ORDA 1YZKA 2DWOA 3I01A 1J8VA 2JD0A 5KSYA 3EZXA 3QELA 4GKVA 4PCUA 3A37A 4ME6A 4ZCRA 1ZQ9A 2PM8A 3BL8A 1ZSNA 1HDYA 3IE0A 5A06A 5CDGA 3FTFA 3LS2A 2O7VA 3RTDA 3BWXA 1QQTA 3ESAA 4MWZA 4W7SA 2OXEA 3ESZA 5FQNA 3O84A 4MLPA 3DO6A 4CM1A 3V6MA 3CUUA 1ORHA 5EP4A 3ZWCA 1N7JA 4BE9A 3CX7A 3K7EA 2ID7A 4K6FA 2ADOA 2HMVA 4N5MA 1TE2A 1HLPA 1R1DA 3SMVA 1EHIA 1E2IA 2VDQB 2CMHA 2X2OA 3C6QA 3T4XA 3SX4A 2BGWA 4KPUA 2WTNA 2OGTA 4EG5A 3L79A 1BMFD 1B3RA 3COSA 3SEFA 2WPDD 4N18A 2SNIE 3ZIDA 4R2MA 3CQ9A 3P4UA 1SUIA 5DMHA 4UAUA 2NUAB 3O95A 4JI4B 1OLOA 3ANLA 3L8EA 1HETA 4BV9A 2ONJA 2H7YA 2XUPA 3O8DA 4I3GA 2UYCA 1D6JA 2G88A 1IJKA 3KTAB 2WF7A 1XCGB 2EZTA 3IMFA 5TVGA 4GLFA 2A9VA 2B1QA 3IVRA 4ZXPA 3M9LA 1QIEA 1SU6A 3WQQA 3NJ4A 4V1CB 1Z74A 5BVGA 3N0XA 4JYCA 3LZCA 3RYHB 4DQLA 4A0QA 2HREA 3WRWA 4E4RA 1Y5LA 3MTGA 4WZAA 4Z0PA 5BQXA 1L7EA 2Q3EA 2YVUA 4NOLA 2R5FA 5BV1A 2VEOA 4TQUS 2NZ2A 3OJCA 2AKEA 4WA8A 5KNCA 4E94A 3VKUA 3DOCA 4LK2A 1JDUA 1VJRA 2D5AA 1KMIY 2W8ZA 3AETB 5DASA 5AJXA 5BYBA 2F9FA 1E2FA 2XWSA 4FDUA 1D5CA 3G0DA 1HZJA 4RNCA 1CDEA 1QHEA 1UBUS 1PTJA 1WXIA 3IIIA 4TLMB 2EL7A 4UE6A 1EEXB 1TPYA 1SCKA 4GSKA 2RH9B 4LXQA 1D2AA 4MVJF 1WXDA 2QSYA 3OSZA 4EHDA 3LT4A 4ZVMA 4MSUA 3T5DA 4JI8B 4PSUA 3U4MA 8ATCA 3TFOA 1VMIA 1XA3A 1VL8A 2HJSA 3EMKA 3H2IA 2I5PO 4BEJA 2Q3MA 3JAMA 1NBMA 1RRGA 4X3OA 1K7SN 3UC9A 4AMUA 2EF1A 4IDEA 4JK3A 1M66A 2G7ZA 4V0OA 4MVJI 4PLWA 5LWHA 1QMPA 3A2MA 1Z0IA 2HFKA 3BIWA 3GAAA 3VSDA 1PG5A 1X70A 3FWYA 4MYSA 4H9GA 3SGLA 4B32A 4BVHA 1CQIA 2QVCA 1MJFA 2ZROA 2BF7A 5DGCA 1NM5A 1QHHB 1O6BA 1E2EA 1QG2A 4MZDA 5T6BA 4RYDA 4MWCA 3SJBA 3MSXA 3S55A 2AUMA 2NVOA 2PA0A 3EG5A 2HCRA 2QUIA 1QPZA 1NFFA 1PI3A 3IDFA 3BGSA 1AS3A 3RSHA 3RTGA 3A0RB 1QP4A 1Q14A 1DDIA 2WA2A 3IEUA 3NTQA 2A1IA 3OEEA 4Y8VA 3U9SA 1VMEA 4LUCA 2NX2A 3UCFA 1ISMA 3G2KA 2CLFB 1YZGA 3BXPA 4ZA2A 5DGIA 1DZ3A 1V1RA 2BUCA 3W6ZA 5A2QA 3SMQA 4J0CA 2NO1A 2G1JA 2JGLA 4EY5A 3BMQB 4MQMA 3ZI4A 3GYBA 2IEBA 4ZP1A 1XX6A 2GM9A 2UXDB 4UM8B 3D3JA 3TW8A 5BPHA 2H17A 4KQ2A 4YWJA 5FHQA 4CWAA 1ZOSA 2EBWA 4RSMA 4QOHA 2OSBA 3V8BA 1QYDA 2A9JA 4Q4HA 3UUWA 4B9EA 5HRUA 3GQBB 4HNHA 2CNWD 3CVOA 2OGUA 5ALGA 4BQEA 1TT5A 3GA5A 4YH1A 1SO8A 1ZOPA 1UMCA 4GLLA 3NDRA 4MUAA 4BMPB 3LAWA 1SUSA 2YC2C 4KMSA 4PSVA 3A4YA 5HG0A 2GN0A 4HXFB 4M88A 1C8VB 1O57A 5KC9A 5HVNA 1QYRA 2GEDA 5IK2D 3Q8KA 3VC1A 3KR0A 4Q24A 3IQDB 4IMRA 3HVJA 1A82A 2QM8A 4Z4IA 3IQXA 1I9GA 2ACKA 2X9NA 5JYCA 2C9ZA 4CL3A 4F4JA 4ETIA 1VYVA 2W4QA 5A05A 1IM2A 1L5NA 5CCEA 5BV0A 3VQTA 2NP6A 3FDIA 1CULC 1Q5PA 4XSHA 4YNBA 4B46A 2BFCA 1VECA 3DZHA 4D3SA 3NHZA 2P9CA 1FNSA 3MRXA 1Y8ZA 1XKTA 4XQEA 4GM0A 3GJ0A 2IIPA 3E27A 3SC3A 4MV8A 4HDRA 1Z5OA 2PSFA 1ZJ4A 2A5FA 3PLNA 4KYUA 4G1FA 2IPXA 4N7BA 2AZMA 3DH0A 3MJVA 4RAOA 1E96A 1CZNA 3N0TA 3GU3A 4JQCA 1MRSA 1KMHB 4FFPA 4S1WA 1DEOA 2OBFA 2V7QA 4M0MA 2XXBA 3KKNA 2XCOA 1A2QA 1YVEI 3QWBA 5IJ0B 2FVXA 3GLFB 3MHTA 2C0CA 1TVMA 2ZRKA 2V7WA 3FTNA 1J56A 3MS4A 4JCCA 2IKSA 3FNGA 3R7NA 1DLJA 2Y6VA 4NULA 3STVA 1LPMA 2RH4A 2VYVA 4RIGA 4U7JA 2HWYA 5FADA 3VTFA 5MGNA 4M9QA 4YJDA 1IOZA 2YFKA 4FT2A 3EAQA 4AICA 3OJWA 3PE4A 2H54A 3AY6A 1VBNA 3NHLA 4FCWA 4LW8A 4UBJA 3EISA 5FI3A 3SAJA 1R6AA 2V8OA 4R9RA 3ZCSA 1FUKA 1QCDA 3Q10A 4N01A 1PNRA 4YS6A 4C0AC 5KTYA 3A0UA 2DSTA 2M2IA 2CN1A 3RG2A 4MB6A 1WD7A 2A2ZA 4HH3C 2LVBA 4EHKA 2IC5A 1JHVA 2BGTA 1H93A 5T57A 2H1OA 2Y1CA 1FTSA 2F1JA 5G1NA 4I3HA 1UPAA 2ZANA 1PFYA 3D6AA 1NFQA 4LOLA 2C5LA 4U3JA 1QUFA 5JZVA 3U44A 1WDKA 1DKPA 1TJ3A 4OI0A 2OYRA 4YEDA 2KS6A 4I8DA 2IZ5A 2JAHA 2WSYB 5DLDA 4NFLA 1FLVA 4A26A 1VKOA 2Q3JA 2VXOA 2R9VA 3PNOA 3VTZA 3A6FA 4L50A 3ZWYA 3SIRA 1YQEA 3A6GA 3BRWA 3QVJA 3WFJA 5EJFA 5G4KA 1O96B 3CJQA 3WGYA 1G5PA 3LGSA 2CCKA 1LI4A 2CNLA 3CRNA 5F3DA 4Q37A 3WK8A 5LN1A 5F9MA 3AUYA 3KB2A 4KI7A 4F93B 3PQ4A 5CEFA 3ETLA 4H6WA 2IKQA 1UBRS 2O06A 2C57A 4FN5A 5HKLA 2XMRA 4LNHA 4D6XA 4D3DA 4TTSA 3HU2A 4PONA 2VAXA 2YTZA 1MXFA 3C3XA 4ZO6A 1JEOA 3D4OA 5L3QB 2FSVA 2P4EA 2ZE8A 3L6UA 4UXJA 1I2BA 2P9GA 1PZNA 3GRPA 2KM1A 4PM4A 1CEXA 1B6SA 1TCUA 1OZAA 2GVNA 2MJLA 3U80A 1HYQA 2HIGA 3R0QA 3SE0A 1SOVA 3W3AH 3D3NA 3ZLUA 2IQ5A 5J2UB 5AIBA 5J4VA 2CD7A 1E8NA 1G7TA 2ZI9A 2WT9A 2A0UA 3C15C 4B3XA 1M6HA 4DIUA 5CJJA 3C3PA 1ZHFA 2BSAA 3FDJA 4L8VA 5J5AA 3T7EA 4RHTA 1SK8A 2OECA 3DEZA 4KH0A 1R0CA 4KPGA 5CNIA 3KQVA 3RAJA 4EGFA 5EIEA 2BZSA 4PGAA 1IBCA 2ZPTX 1DHRA 3CGWA 1RQRA 3IKMB 5JW6A 1W7AA 4YRCA 3ELBA 2WWXA 4K9MA 5FBQB 2YVKA 5JPCA 3AEZA 4I55B 4B73A 2HQBA 4LX8A 5FP0A 4UATA 2BEUB 3S2UA 1DIBA 1KI8A 1YMVA 1PFGA 4TLBA 4U00A 4DAEA 4L15A 4RUKA 1UXJA 3MWEB 3Q6IA 4GQIA 2HPHA 4ZALA 5BPFA 4O4JB 4X7RA 5BR1A 4JIGA 2EQ5A 2IIVA 4C0XA 5BXQC 3HMQA 3OETA 1LSSA 4QD3A 4E33A 1ZXXA 5K6RA 2P9YA 2WIJA 3GD5A 4M87A 3Q7EA 3PR3A 1GFIA 3R5KA 4HN9A 1JUDA 3KQTA 4O1IA 5EQTA 1EE2A 1M2OB 4UEWA 5JZMA 4DMGA 3DBOB 1W1WA 2X9VA 3CKYA 1CY1A 3CCCA 3TRJA 3OKPA 2RHLA 1QFYA 2CXRA 4IOMA 3SZLA 4OQDA 4PSCA 3U62A 1DG1G 1WF6A 1SXPA 1N6OA 1DBQA 3E9CA 4ND4A 1WVGA 1I7NA 1ZYUA 4NBSA 2D1QA 2PGXA 4Q82A 3WGVA 1J2RA 2OD2A 1P1KA 3A1FA 2FQYA 4EAAA 5FAKA 5T7BA 1X8JA 2WSBA 1UP4A 1SCAA 1GZ6A 4Z9FA 3I5MA 3PYLA 1ZCZA 4MMYB 5CT6A 4OHVA 4WGGA 3WL8A 1T8RA 1PJQA 3MCZA 3SP1A 2ZYSA 3DEKA 2GJ8A 3N76A 4TMVA 2D00A 3TKYA 1U4SA 3UNXA 3V80A 3IGFA 4RK7A 4IDGA 4ZYXA 1E94E 3S27A 1GN9A 2OT3B 2ETXA 4JL8A 1JECA 5AM1A 4JT9A 5TARA 3VUEA 3CVWA 1ONOA 2EYUA 3B70A 3DNMA 4HZUA 3S44A 4BE4A 4EPYA 3WIBA 1C2YA 2JL1A 1IQUA 1PG0A 2D5LA 4I9FA 5MFPA 2VFAA 4FHEA 3QE9Y 2GJAA 4UXIA 4QSMA 1RCFA 3FSGD 3ENWA 3LP8A 5IVHA 4KLNA 2H1SA 3R1IA 3F9RA 1JEJA 3QTTA 3OE7A 3W2EA 4L4ZA 2XNKA 3BEDA 4DIDA 1IQRA 2M1XA 2XRFA 3CBGA 3M82A 4X62B 2GRAA 2DP4E 3DDSA 1ZD2P 4BLWA 2W2LA 4BY9E 1W2WB 4TYYA 1OH7A 4EHAA 4YCLA 4FSHA 1Z13A 2PX4A 4V0RA 1Y3HA 3NS7A 1U5BA 3QVMA 1S2MA 1RQGA 4RABA 1KAMA 4ZAXA 3REQA 5HZGA 3WIVA 5JADA 1TA4A 2G6BA 1EDOA 4QDXA 4MLZA 2ZPAA 3WADA 1FA9A 4H2DA 5AKYA 2X19A 3NHWA 3A4IA 2OFOA 2XITA 5DOVA 4UCWA 2GJ4A 2GYUA 2HGZA 2HCBA 4L75A 1H1LA 4B81A 1K0FA 1VKJA 2R4TA 4J29A 1YQWA 2FWNA 3KQUA 3D2AA 3TYXA 5DHUA 3AP2A 2AOTB 1YFKA 2W6CX 3FPAA 1E9SA 3AF4A 5I7EA 2HY7A 4MLCA 2P3LA 1M33A 4P7KA 1YOVB 4RLFA 5LQSA 3TPCA 5DLQC 2O5EA 4L9AA 1IN7A 3K71B 2GN9A 3D2CA 1E1RD 2HWXA 4L5YA 1SQ5A 1FQOA 3BVPA 4CQLA 4I2NA 3KQPA 5CURA 2VDVE 3BWCA 2OAEA 4QGFA 2YQ4A 1C14A 1DC3A 3LRXA 4Q4AB 2QZSA 3GT3A 2WKQA 1ZI9A 4JNKA 4V3BA 2IUFA 1R0WA 3PEVA 4Q1FA 2D2FA 2R4QA 4ZT3A 3K9BA 4ZU3A 3TQSA 4CLRA 3JD2A 3OMWA 4LECA 3UICA 4POOA 1I0LA 4EW6A 3AR9A 1GG5A 3JXEA 3BJMA 1J1ZA 4GOOD 4KXXA 2IYSA 1B0ZA 3RVDA 4MGIR 2QE7D 2B21A 2DUMA 2J9FB 2ORYA 2Q2OA 3NWEA 4K28A 4L6IA 4WY5A 1YS1X 3TTYA 1ZFNA 3X0DA 2V6GA 1G59A 2C98A 2P9HA 2BSXA 1T36B 1X7ZB 2CFSA 1E92A 4X1IA 4GAEA 5JO9A 5B2FA 2IE0A 2IY7A 5LBUA 5BN1A 1N9KA 2MYPA 3UUFA 4IS2A 2BL4A 3IPAA 1DOAA 1ZUNB 2G4CA 4FDLA 2A5LA 1NRJB 4URVR 2WOJA 3O7WA 4LOHA 3GBSA 3NXKA 3Q8MA 1NLFA 5DXJA 2C8KA 2ZIZA 1VTKA 3L0ZA 5ISMA 2LDBA 2WTBA 3JVIA 4YRZA 5CITA 1ZKDA 2XHZA 4HAUA 2UXCB 2H9YA 1WNFA 5JCPA 3EW9A 3PGA1 4Y9SA 3GVXA 3AL2A 4JB3A 4V0KA 1V9SA 3EF1A 4KB5A 1JIVA 1IPEA 2WWGA 3HJUA 2J41A 4NU6A 3UV6A 1CE8A 2EJCA 4U02A 2ZSUA 4C4RA 2G1AA 3I2HA 3PNBA 2REQA 4NDNE 3SCZA 4D0RA 4D8TA 2XV1A 4H0CA 3TFWA 2NV2B 3NIGB 4RS3A 3OZDA 4ALJA 1P1JA 3SJ7A 4E4TA 1O6CA 2J3HA 4HTAA 4X60A 1CIVA 1V9CA 1QOQB 1C9DB 1VSQA 2IYAA 3ZHQA 4ZHQA 4K0KB 1JIQA 1ZI8A 3NM6B 4U2FA 1YRAA 5AVJA 1SA0B 2NQ8A 3OQOA 1DIAA 1ML4A 1W52X 5EXPA 4ZN6A 3L6BA 3PGXA 1F9EA 3W6PA 1IN5A 1B74A 2ADMA 1SVWA 2OVFA 1R9GA 5D51S 3MAJA 1C4XA 1HOTA 1N6IA 1Y1TA 1ZCFA 3DBLB 3PFNA 4QEZA 4XYBA 2VL7A 3HPQA 1I1QB 3MAAC 1O03A 5I3CA 3A6HA 1OH6A 4FFMA 2JH9A 4N5NA 3ZZNA 3GX1A 4DZRA 5LB4A 2DG2A 1SCJA 2Q1XA 4NZMA 5DVZA 5ESRA 5IAOA 2H29A 2H7CA 5LNK1 1RJGA 3QXCA 5B2EA 3JAWA 2P5TB 5CVUA 1UUFA 5ELMA 4CMGA 4ND2A 1LI5A 4OQYA 1YFLA 2NU6B 2WZCA 1H8EA 4N3NA 4GBGA 4GVLA 2INGX 4MVWA 3UYKA 3VISA 5DHFA 2ZWOA 4HDNB 2CDBA 6LDHA 2HMUA 1CVIA 1C1XB 4PW0A 1CZOA 3TTXA 3AI1A 2GTPA 2Z2YA 1FVXA 3GFVA 3OCXA 5TY0A 1ZP6A 2IWHA 1FLAA 2C3UA 2QNRA 3ZV7A 2C9DA 1NY5A 3IAM1 3FFXA 1MOZA 1PK7A 2HSJA 1BXRB 1O58A 3K6JA 4WADA 5E1DA 1MVLA 2Z3WA 3IHLA 1U7TA 1QFSA 4TV9A 3TQCA 3G2QA 3P4YA 4IMPA 3DAFA 1O9HA 4KIFA 5EJ9A 2WTXA 3VPHA 3K9NA 3QYAA 3MTAA 2I2DA 1BEZA 4ENSA 5BW5A 4FIDA 1GLNA 3GLIA 5DNUA 4ZDIA 3KWJA 5CX1A 2CVPA 3FPFA 4LI0A 4BMNA 5JWOA 3PUHA 3PNLA 4FHDA 1MFZA 3IH5A 3O8OA 5D6NA 4MRAA 5IXSA 1UJNA 2KBEA 2NU9B 3UFXA 1KFBB 2QKYA 5E9AA 4OHCA 1YB6A 3PVSA 4C6SA 1U8AA 4RTPA 4Q5IA 1XZGA 4LYHA 4EFMA 821PA 1X7GA 3WOVA 1T5IA 3G8DA 2RGCA 4CLOA 4CEIB 1UMDB 1OBCA 5JR3A 5CR9A 1ZM9A 3G8BA 4ZOEA 5I7VA 1MR3F 4FIZA 1WBJB 4CLXA 2PT6A 4EZEA 2EGGA 3FF4A 3JY6A 2FWJA 2O2GA 3WGOA 3WGTA 4E5MA 1M6NA 2IOQA 1TYEB 4LDAA 2AHOA 3HCAA 1G8MA 1Z08A 3H5AA 3CH6A 1U90A 2DFDA 3O5AA 4QBKA 4RMGA 4S35A 1XEXB 2HXGA 4REQA 5BQOA 5SZIA 1QVWA 3VNQA 3BC1A 2RHJA 3EK2A 2OTCA 3NBUA 1SKQA 3PITA 4FMPA 3U4QB 3FY4A 5KYGA 5KYUB 2XVMA 2PKQP 3I8SA 3SXUB 3UANA 1R0ZA 3VYTB 4DIFA 1J23A 1JHYA 3UAYA 4FT4A 4ZVRA 2GKGA 4J1QA 2O0HA 4I1PA 4Z53A 1H2HA 4KMMA 2VT6A 1QYXA 4HVLA 3OPQA 1BJRE 4L16A 3DKKA 2QRNA 4EX7A 1E9CA 2RG1A 3PWKA 3ITDA 2Q4TA 1ECGA 1H6BA 2HGSA 3T5MA 4DPMA 1PGPA 1MX9A 5KYNA 1XNHA 4GRIA 1RP7A 4XIGS 1JKFA 3QF4A 4GE0A 2O2XA 1WSBA 4IV8A 1TO1E 3P27A 2OWEA 4G23A 4BFXA 1E1NA 2ZJ7A 3EXEA 1E1CA 1TO2E 1U3CA 3PQ5A 3D7RA 1XRJA 1AZWA 1G5IA 3REFA 3VKFA 5BMOA 2BGMA 3H87A 5JXJA 1C3XA 4C5BA 1MX1A 2E7ZA 2DQSA 2GWHA 3WO1A 2DCMA 4O63O 3I5YA 3MT8A 1JKIA 1IUNA 2A33A 2JJ1A 3I53A 3QPCA 4LCJA 4W8GA 4RD2A 3DKRA 1KFJB 5AH0A 5NULA 3RFFA 4A8JB 2VHJA 3BXHA 5THXA 5DFAA 2JIZD 3KKOA 3LDUA 4EPWA 5EZYA 3AZOA 2KLHA 4P7GA 4EUKA 3QEMB 5AOVA 1ZN2A 3SR3A 2WU1A 5IWCA 2VQEB 1U65A 1XJ0A 2WSIA 4ZOLF 3PFGA 1L7OA 1RM5A 2COKA 2HUNA 4FFVA 4ZAFA 5FAXA 5IW8A 1EFRA 4P2GA 2BBSA 1VGVA 1ZVQA 2AQKA 2HJVA 4LQDA 2PYIA 4RF5A 2F55A 2O4UX 3GFGA 3RYCB 4JDUA 3UW1A 1NJ5A 4UD6A 1N6HA 5FTWA 1U81A 4F3KA 2I33A 2Q5IA 3FVVA 2H2HA 3AM4A 4K87A 4GUDA 5DYNA 3RBXA 4IIBA 5C1BA 4G0YA 1QAQA 1L2TA 3HBJA 3IXMA 1MQ8B 2GCGA 1RYMA 1NIJA 3K94A 1P6UA 4DCVA 1I5RA 2V8BA 3A4VA 3CR3C 4OQFA 2FZWA 1YB4A 3C1UA 1SVSA 3HYNA 4QECA 5ALIA 1JSXA 1U2GC 3AX6A 4DJTA 3DMGA 3S29A 4LRTB 4XYLA 1R8SA 4YMHA 5I7RA 3ER8A 3RT1A 1XC7A 9LDBA 4JDPA 2YOFA 4B8ZA 4A15A 5J2TA 2IA5A 2NSJA 4XPZA 1JBKA 3QE0A 3HXMA 3W5VA 4ROSA 1JKMA 1E64A 1E99A 1U2RA 4XJSA 5ERXA 1UKEA 1WCYA 3T1OA 3HU3A 1QQ5A 1SR8A 2LV8A 3GLHA 3H2SA 4BIIA 3QVSA 3SFVA 3FYUB 4MVCA 1R5OA 2O5RA 3CN7A 3OBIA 1AX9A 5FO1A 3UAOA 4OOEA 3QRWA 1QH1A 1U3FA 3BH6A 3FXAA 2YBEA 3BYZA 4H6XA 3V1UA 4BLQA 4EQZA 5CBKA 1C0IA 3W3AD 1HLGA 4FC6A 3LYHA 1N5KA 2OZLB 3H97A 3K09C 5EL0A 5I7SA 5CAEA 3RD5A 1C1HA 2XYGA 3ZE6A 1M2EA 3D0OA 1S3GA 4ZKDA 5IG2A 3DZGA 3QSYA 1DOZA 1WA5A 2D0IA 2GJSA 3BS4A 1BCRB 1DRJA 1KFEB 1T0JB 4TTPA 4V39A 1XALA 4MQEA 5HCIA 4A1FA 2O0LA 2O2ZA 4JP2A 2QI9F 5F73A 5C4GB 1NF9A 1O3YA 1KC3A 5EJ2A 3H75A 4C4PA 3ISTA 1H5UA 1RWKA 2O7SA 2QNIA 4QNRA 3L6EA 3C3BA 4WINA 1IXYA 3R5FA 3DOFA 4AUNA 2BDEA 2HU8A 3AW8A 3JQBA 3K1JA 4TLCA 3SXJA 4RHUA 1CY7A 1XLTC 1NUQA 3KKMA 1ISRA 3HCPA 5BWMA 3OZFA 1M10A 1ZJJA 3LC0A 4P0PB 5JFTA 1XL0A 7REQA 3GCGA 3M3PA 2FCRA 3F4KA 5EMKA 5SICE 4BCDA 1QLHA 4RLQA 3T4PA 3FTEA 3DHEA 2SKEA 2XT9A 2OE2A 4NXMB 5IBQA 4D4GA 2M32A 4HGPA 1U3VA 2J9XB 1KR5A 3CIFA 5JCOC 3TCKA 4BKQA 1CUUA 1KZ1A 3RODA 4G0ZA 1ODIA 2AA3A 2VK2A 5HE9A 1EVIA 4DEYA 1Q3TA 3WAJA 4JI1B 3EXHC 3JPWA 3JX9A 4F91B 2N1BA 3A1TA 4U39A 4H7EA 4CIAA 1AF7A 2PGLA 3A9SA 4F2HA 4XIYA 1QP0A 4ZJPA 4MV9A 2HCJB 5M29A 1EFDN 1HFEL 3OU6A 5BUZA 1QG0A 5FPQA 3O4IA 2L0XA 1M2KA 1XF1A 3FWZA 3K0BA 3LXMA 3B7GA 1UDAA 4HN4B 1ODKA 4L02A 5ITZA 1FFCA 4JAVC 2E4AA 4X64B 4U2GA 4RPGA 4BAZA 1MAUA 2GH1A 4UOEA 3TBFA 1JFTA 1AGYA 4ON9A 1YS2X 1FIUA 3CU5A 1Q22A 1TF5A 2VQ6A 2PBLA 1RPZA 1QV6A 4MI6A 2A78A 2IU6A 1GZHB 4QG3A 3I61A 4NAUA 1SURA 4HX5A 3H2ZA 4FDVA 1T3SA 4XIFA 2VPPA 4CCWA 2DFNA 3AGPA 1Z6AA 3E5NA 2FW0A 5TXGA 4D9KA 3ZHTA 4KGZA 1Y1PA 1A8UA 2X40A 3BEOA 2J0UA 3TL6A 4XUDA 1RI2A 3W78A 5SV2A 3QNUA 4YCCA 1GNSA 3W79A 1TJYA 2JCGA 2X7XA 3DAOA 2GPSA 3DDZX 4ZZ2A 3NYIA 5A3RA 5BW4A 2XEXA 2FR8C 3AY3A 3INRA 3E23A 1NVUQ 2FUG1 1IL0A 3H42B 3KJZA 2AZXA 4QQ8A 4MQ4A 3EH1A 1AKQA 1IY2A 5ED4A 1BW9A 4P93A 4PC1A 3G68A 4RX1A 1GGJA 2ZJZA 4HS9A 1CJCA 4MQUA 3D9QX 4AZVA 2V7PA 5HKBA 3S6JA 5F77A 4KN5A 2A9FA 1KJIA 2TMDA 3L2OB 4TYPA 4DNFA 2EWMA 4G0UA 1W5FA 3D6TB 1J9ZA 2YVQA 4L0DA 1YQDA 3SG0A 3VOSA 3HKBB 3DGFC 2RGRA 2X6RA 3AIIA 2QP9X 4RJJA 2UUOA 1J7KA 4DDVA 2X9GA 3PLAE 3AY7A 2GZDA 3IV9A 4QA9A 2OB1A 2IGBA 4BNMA 3K70D 3GLTA 4L5CA 1IAVA 2Y1FA 4LYEA 1QQBA 2C59A 3B6ZA 4ZGBA 4RBNA 2PRKA 1F8YA 3SZOA 2EGUA 4LPKA 2CF6A 2MTBA 1Z4LA 1WQ4A 2PQ6A 2XTNA 1POWA 3PKIA 4LZPA 4WOBA 5J1TB 3TO5A 2BYTA 2VZ0A 3Q8WA 3WTBA 4OIMA 3BORA 3IUSA 4CUJA 1JA9A 1T0IA 5E95A 2P6RA 1B4DA 4DMMA 1YACA 1SHZA 1NUAA 3K9QO 4PYJA 5JAOA 2Z2ZA 4YI5A 5DLYA 1DPGA 3NT4A 4HATA 4G0NA 1UT5A 2PUAA 1YQTA 2XNDD 1AA9A 4QXPA 5IC6A 3I34X 3AI2A 5BT8A 4Y1EA 5IM5A 1N77A 2R7NA 3QVLA 2G08A 2JDID 2IK8A 4FYMA 3FMOB 1E32A 3N5CA 3KQSA 1LTKA 3NASA 3KJXA 4KXQA 1XDZA 1CS0A 2WWWA 1XL1A 2ECQA 3NHJA 1TL7C 1VXOA 3DKVA 2QU7A 3EVEA 3I4LA 2IYLD 3GVIA 3OA0A 4UREA 1P0MA 4S1VA 2AQIA 4UNIA 1WBBA 4IHQA 1AVTA 4YACA 2PMDA 2Y2UA 2HRZA 2XNJA 3FBGA 3OT5A 2C7QA 2JRCA 1OUMA 1EFPA 2K2WA 1IY0A 1EXWA 1AT1A 3VZBA 3OIWA 3WXBA 2E5WA 4NLLA 1CEYA 4CZ2A 4EELA 2X77A 1AHHA 1QVAA 1X7WA 2ZJ8A 3IDOA 3ZIAA 1DXYA 3AESA 3F2IA 3JW8A 2MT9A 2I4TA 3FVRA 3L01A 3EXAA 4MUHA 1DKUA 3HE3A 4R1SA 2BFWA 2A0WA 3NEPX 5JHHB 4UBIA 1WHTA 3BMCB 2DUNA 2QD4A 3KXLA 3V46A 4N8SA 4MCJA 1OLXB 2KB0A 3G89A 1LNZA 1NOKA 1ORVA 2NVBA 3DEHA 1ZH4A 3DMTA 4HI0E 1T91A 2PLWA 1A9QA 3B3JA 4C4AA 3ONNA 5ER6A 5A71A 3UVEA 2JI4A 1W96A 2XQFA 4B6SA 4DLUA 3U3MA 5ILGA 2FSPA 4L7VA 3HH8A 5EYPA 2I2CA 3X43A 1KDZA 2W7TA 2JFHA 3QBEA 1GQFA 5K6AA 3U26A 1NW4A 2QK4A 4JA0A 3U6KA 2VYFA 1O97D 3A2KA 2V45A 2FX3A 3AFNA 6ABPA 4E5NA 4RD1A 4UARA 4I1VA 3DBHB 4CM4B 1FOEB 2EFDB 5AW6A 4JV5B 2WNSA 2OM2A 2YHSA 2OO3A 3O4VA 3H04A 4JQOA 1FMCA 4LGMA 4QODA 4R6WA 3SHFA 3PA8A 2YW2A 1N2ZA 5KYKA 1YKGA 1LPBB 4I5FA 4BFVA 2QJTA 1W4AA 3KZXA 4EAQA 2I7TA 3HS3A 1WHSA 3E48A 3GJ3A 1E98A 4ND8B 1WU7A 4O2RA 3DZJA 1JIIA 3QSGA 4OQQA 3JU3A 1BZYA 1FMLA 2ABWA 3DGEC 5ALOA 3BWEA 3GGJA 1HQCA 1C0EA 1C29B 3V1LA 4GD3Q 4P3NA 2W6OA 5HF9A 1T43A 2NT4A 2VJMA 4MRMB 3VYUB 4E2ZA 3GK3A 1IY1A 5FPTA 2ZYGA 4IJVA 1G17A 1OVGA 2WZQA 4HY3A 3BUSA 3LOUA 4IOJA 1GGNA 3U48A 2XVYA 5L6MB 3T0IA 2JAWA 3PNMA 1IMOA 3HDTA 3MQ4A 1R3DA 3PWZA 4BO6A 4DVJA 1YBHA 3L8GA 4R1PA 1XJQA 1N2EA 5TMEA 1DQYA 1E3WA 3MCWA 4JOCA 1HNWB 1P0QA 2EBUA 4EGSA 1ND6A 2JJ2A 2O0MA 2XKJE 3JRXA 3LKZA 3HZZA 5JUWA 1J25A 1K9VF 1UXKA 3RG8A 4MKRA 4DC0A 4FB4A 1U8TA 1U9IC 1FDVA 3IMKA 4DA0A 3MWFA 2WFLB 1VSBA 3LBNA 2VDWA 1IHPA 2IPLA 3NALA 1SCUB 4WOKA 1WTCA 2VKTA 4IXDA 5FNVA 4N7JA 4HTFB 1P2BA 4BO9A 4KO1S 1P9NA 4CLHA 4M53A 5CH8A 4YQFA 1EUYA 2Y2VA 2QW0X 4UASA 2H1CA 2SKDA 1WDWB 2WZDA 1WF3A 3X1KA 2PL1A 2RGXA 1B0PA 2VIIA 1UH5A 2IEYA 4L9WA 5B4UA 5L4SA 1TQDA 3BGDA 2UDPA 2JFVA 1VJCA 3MBOA 3OTIA 3W7BA 5LMZA 4CV2A 1XO1A 2FPUA 2AFHE 3F6RA 1V8DA 1KI6A 2P6OA 2ZQYA 1KP2A 3STXA 2AMYA 3GP5A 2BRUA 1HX7A 2G9RA 2ZAIA 1OGIA 3RE1A 4QUGA 3A1CA 1YZYA 4HQLA 3V8NA 2VI5A 1I3MA 1LBTA 3BPSA 4NJOA 2J5KA 4PR0A 4Z9YA 2SHKA 5K3SA 2Q7XA 5KVQA 2EJVA 2PS9A 3NHKA 4M9CA 1QKKA 2QD1A 4RLSA 2B8EA 2FEPA 2NO4A 4I1RA 4IL5A 5EHZA 5KYVA 1VFNA 4JLOA 1K6JA 2ILVA 3K70B 1XDDA 1AHPA 4XCXA 3RVBA 3TDMA 3TQHA 2ZYRA 4YLEA 3RLIA 4B3BA 1H3EA 2OC9A 4RK0A 5JBIA 4YRIA 3BRSA 2VTKA 1E59A 3TTVA 1KKMA 3QVOA 5EHNA 1AKVA 1L4FA 4NESA 2BEVB 5HF8A 3AVTA 2R8BA 1NVBA 2P3OA 4Y7DA 4UHJA 2ODPA 1AKWA 1YB1A 4PLFA 3KKPA 4S0ZA 1KOLA 4G4JA 5HKAA 3C8DA 2VK1A 3I5UA 2HRDA 2OLKA 3AEUA 1SCIA 3AUTA 4M3NA 2OFFA 2BM0A 3RYTC 1ZOLA 1PV2A 4RM3A 3WK5A 1UBEA 2G76A 4YMTA 5IH7A 5KHOC 3K73O 1NKTA 1X1TA 4MKIA 1JFVA 1JU4A 3L7LA 3D4BA 3LDGA 4L3WA 4XYEA 3FKSA 2CVOA 4PZPA 3EMDA 3H9CA 4WH0A 4AJNA 2PAFA 2IZZA 3J7AC 1GZ4A 1PGQA 2A9QA 2F90A 3CWQA 3BK2A 4TS4A 5EQJB 5G1OA 1F7VA 3AVWA 4AM8A 4DBZA 2Q0QA 2X8JB 3BCSA 2DHEA 1L5ZA 2GWRA 3KHKA 3ZDFA 2WABA 2M6RA 1KP3A 4J94A 2IF0A 5CXUA 3DXXA 4D81A 1KI9A 4IO0A 5EKTA 3U39A 1YBFA 4UVIA 5A3SA 1PZGA 4R0NA 2RAVA 2B3TA 5HWSA 3JASA 5HRCA 1JWLA 1TRKA 4F9FA 1Y8QB 1FZTA 4FFOA 1YCFA 2ORED 5FOWA 1FQJA 4Y1FA 3RAPR 3K0FB 4L6CA 3NGXA 1D09A 1EU1A 3U7EB 1OH5A 1EB9A 1TA9A 1KS2A 2OQ2A 3NWOA 2F3RA 3G59A 3G5TA 1LQTA 3W90A 3AFHA 4BNTA 1R8YA 4M6WB 1D9ZA 2PMFA 2ZE5A 1X77A 3O83A 3RWMB 2PVPA 1ZCJA 2EFGA 3ICCA 5FCDA 2XIQA 1B6RA 1IYZA 1TK3A 2YMPA 5AKEA 3QKIA 2VR1A 3V1KA 1U1EA 2TYSB 4LOKA 4QQKA 4N03A 5F23A 1ZMBA 2IYFA 1D6SA 3MB5A 3T1TA 1KYIA 3EVTA 2NXWA 2QLTA 3LKDA 4RV5A 4X97A 2NTYC 5IAKA 3TMAA 1TMYA 1J24A 3TUIC 3OIDA 5DNEA 4DLWA 3R7AA 5PGMA 1YR3A 3ITEA 4Q3CA 4YT5A 3TNDA 1YZHA 4YRPA 1TLLA 3ZHCA 1FVHA 2MR6A 4YI3A 3STUA 4YRNA 4L9RA 5AVOA 2PS1A 1ZM4A 2CUTA 3ZX4A 3ZVNA 2WFZA 2A1TS 1KGDA 4Q7KA 3I39X 3DS8A 2F00A 3KD3A 3S68A 3V5NA 4W9MC 3UC5A 4D99A 1EJ6A 2O54A 2FZ5A 4H31A 4B4UA 1V71A 2GXUA 1H2EA 4JHLA 2CXHA 3UB3A 4MUNA 4N0MA 1ZK4A 2QRVA 3GCWA 1U3TA 3K0CA 4Y6QA 4W8HA 3VPBA 3V34A 1UKYA 3VUFA 1J49A 4CFZA 1Z07A 1HL7A 1USVA 3PPIA 5IVIA 1LBSA 3PCRB 2HJGA 3LQRA 3M5DA 2OESA 2JNWA 5IS2A 3G5AA 1YO6A 5CDYA 3CLUC 1JMKC 3SEAA 1E4EA 5CNKA 2G40A 4X94A 1RFGE 1QRTA 5KQGA 1GNVA 2EFJA 3VH3A 3F3SA 4YAIA 2IBSA 4ETNA 1U2EA 1AKYA 3MELA 2XGMA 3H5LA 3JD0A 1OH8A 1GCOA 4NFHA 3WQSB 1OSNA 1Z3IX 3PENA 4NG5A 4D43A 1T0UA 4FEAA 4DLRA 1MHTA 1MTOA 2EVWX 5AVVA 1VC2A 4DDMA 4E5KA 3OLVA 1Q7RA 3LUGA 1E58A 3GLKA 1OR8A 1OFVA 1P4RA 1PTJC 1KH2A 2QN6A 3SYTA 4ALLA 1O95D 2G1UA 4GEGA 4XRRA 1UCFA 2R11A 1XN4A 1NQ5A 2ZR0A 4INPA 3SXPA 2CMGA 3WR5A 3AIMA 4QVIA 2IU3A 4Z7QB 3ZGVA 4PLZA 4R0MA 2ZB4A 5H59A 1XRSB 3CG4A 2YXPX 3IP7A 1Y6ZA 4YCDA 3QYPA 5FL3A 2QLFA 3CX4A 1JEYB 2JEOA 2SECE 2BFEB 4IJ5A 4JLSA 4QUKA 4WLEA 1UBJS 3OA2A 4RCYA 2UKDA 3I58A 3L6OO 3QI2A 4CI9A 4YY3B 3EPJA 3FOZA 3RHTA 1ZW6A 4KAFA 1TD1A 3DXZA 1B15A 2XDWA 6ADHA 3ASVA 4D8VA 5E6UB 3LKVA 3VV2A 4XVCA 2R8EA 1VE5A 3L9WA 3QA3E 3F3MA 3GJZA 5ELXA 2I6SA 2RHHA 1RHMA 3GGGA 3RPEA 2H1VA 1BU8A 2CHGA 4OYLA 3KVOA 3RRYA 3O1IC 4WOCA 1GCIA 2OBLA 1JIKA 3H9QA 4X1KA 2V97A 3PXUA 2ODEA 2VHVA 3WP1B 4WNYA 4BEWA 3ROPA 2B8WA 2H57A 1JB1A 2G9QA 4G65A 1Y98A 3EOZA 5BSMA 4ZI7F 3SFZA 5F1OA 2AH5A 1O8BA 3OQIA 2R6FA 2C82A 4HMPA 3TECE 2FFHA 1KEEB 3ETCA 3H3JA 1KWGA 4KBYA 5CRIA 4PG8A 1US8B 1EVLA 1SBNE 3HVKA 3FAZA 3H2YA 1VG1A 3ZWQA 4P7JA 5COQA 2AMVA 2IXAA 1MBZA 3PVCA 2HK9A 4IGEA 4M1KA 4GG1A 2V4ZA 1GL9B 4F2DA 1GPDG 3PRKE 4JX9A 4O0MA 4E15A 2Q3BA 4TS9A 4D0GA 1SG0A 4IJQA 2SCUB 4TT8A 3DVAB 3K4PA 4YUYA 3DWGA 4LZNA 5DISB 5KYXA 1E61A 1AQIA 1KNQA 2IYTA 1SKAA 3FBWA 2JLBA 1FTWA 2XECA 3ITKA 5B7GA 5KQRA 1J09A 1KZ6A 1XZBA 4Q19A 1NYTA 2EZ9A 2PUEA 3DHNA 3T12A 2I65A 3N7UA 3QY9A 2P7IA 4NBRA 1MO4A 3AR8A 4J9UE 4EJSC 5DCYA 3AMVA 2R48A 2I62A 5FUXA 2Y05A 1FP1D 2GK6A 3BOSA 1NXOA 2M6SA 1CUVA 3LX4A 1Q17A 1C3LA 3VU8A 4PAQA 3OTQA 3RRFA 4CV3A 2WKWA 2B8TA 4XFJA 1B7GO 1C0PA 1NTOA 2FETA 4BP8A 1U6IA 2PXAA 3UKDA 4TS1A 4ZYVA 2WFAA 5AHWA 2C3OA 5BW8A 4LISA 5GMOA 5M3BA 4GR9A 3I32A 3FNIA 4C4TA 4BFZA 2YXNA 3RM3A 3ELUA 2CVFA 2FQQA 2OB2A 2PANA 1PLKA 2AG8A 4CEJA 1UINA 4X3PA 1X42A 4YAJA 2PQMA 2CF5A 2R86A 4E2YA 5DM70 1BNCA 2FN8A 1O6FA 3E5HA 1LB1B 3HRHA 1T8YA 1SK9A 3C7AA 3D4LA 4BLPA 1LPPA 1X1SA 4UAVA 1IVSA 3WQRA 1N1GA 1Z5NA 3PFIA 2AFIA 3CGGA 5CX4A 5ALDA 2ZZKA 1FQWA 2HSEA 3A14A 3FKQA 1QTNA 2QTFA 4I50F 4NRDA 4QFCA 5F1KA 3VSEA 5A5VA 1JFSA 1KJWA 1JSRA 5JS2A 4UQLA 2PYZA 2FWIA 3GOQA 4ALKA 2AR9A 1XNRB 1ZIPA 3H6HA 1J6UA 1NVGA 2BFFA 5HJ5A 3PQDA 2WJHA 1JDBB 2VSNA 2ZYHA 2HLDA 1GQYA 2XYRA 3REGA 1JG2A 4KP7A 3H7IA 4RD6A 3RK1A 4WBNA 2JI9A 2X0IA 3IQWA 3PRYA 1YZLA 2ALJA 1R0LA 1OXUA 3H1PA 4D9FA 3AVXA 3ZKAA 2OAP1 2YX1A 1QGED 1QLWA 3E3MA 3N7TA 4F1JA 3JCZA 4G25A 4HRXA 4IRXA 3VR1A 4M22A 5AVWA 3A6ZA 4RPCA 3PC2A 2D2VA 1OXBB 5T4HA 3F1KA 4PPFA 3TOZA 3K1AA 3T7CA 4E2WA 1E2MA 4IDDA 3KVVA 2FOXA 2GA8A 2WD7B 1LUAA 2PUBA 2AI1A 2H31A 5LYJB 1LF5A 3Q7IA 1NBIA 3R3HA 1SC1A 4L7QA 2EQBA 4FTWA 3S7TA 4YMVA 1G55A 1I14A 3H65A 3H0CA 3IMGA 4IDHA 4WECA 1YQGA 4AKTA 4DLTA 1BHO1 5SYAA 2FSVC 1CRLA 2PCJA 2XCUA 3MM4A 3OIFA 3PIDA 1MT0A 2XLBA 5BQPA 4DOMA 3AG6A 4FILA 3MJDA 1XTQA 2NO5A 3QWHA 2AYZA 2EBFX 1I1HA 4QIHA 2J3KA 3DDCA 3MJEA 4GX5A 4NMLA 2ZVPX 3WZLA 3P2OA 5HPYB 1LV8A 3E9QA 1OI3A 4PBSA 3AH8A 4BEBA 3JQAA 1QH9A 5IZCA 2WU3A 5HIIA 4YAOA 4TLAA 4QWWA 1T8SA 2CDRA 4M1SA 1E63A 2NVWA 4TL9A 1KIFA 1C9EA 4DANA 3JQ7A 3ZKWA 2AUTA 3LOQA 4PLYA 4FFWA 1AMUA 3HM2A 1NVTA 2C4TA 2QVLA 4HQRA 3WYDA 4TZ0A 3P5SA 5FPSA 5IT9A 4B3MB 1AJEA 1RLIA 1W8IA 2JFOA 3R9KA 5FBVB 2FMFA 4D9EA 3QBDA 2P6NA 1P2VA 1YMQA 3HUEA 3L8CA 1ADFA 4ZC8A 3LX5A 3TRHA 4ABYA 4ZVUA 3ASZA 2HA2A 3HC7A 5CA1A 4F6RA 5T8KA 5CFZA 2A5DA 2JIDA 3WLAA 3ZK8A 2DEUA 5C7OO 1SKBA 2PG3A 1G3IA 4G2TA 3FGZA 3T5PA 4QNMA 4HNUA 1K98A 1N2CB 4ZJZA 3K1TA 3UBTA 1G5TA