2QY6A

Crystal structure of the n-terminal domain of upf0209 protein yfck from escherichia coli o157:h7
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
246
structure length
244
Chain Sequence
b'SLKHYSIQPANLEFNAEGTPVSRDFDDVYFSNDNGLEETRYVFLGGNQLEARFPEHPHPLFVVAESGFGTGLNFLTLWQAFDQFREAHPQAQLQRLHFISFEKFPLTRADLALAHQHWPELAPWAEQLQAQWPMPLPGCHRLLLDRVTLDLWFGDINELISQLDDSLNQKVDAWFLDGFAPAKNPDMWTQNLFNAMARLARPGGTLATFTSAGFVRRGLQEAGFTMQKRKGFGRKREMLCGVME'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0209 protein yfcK
publication title Crystal structure of the N-terminal domain of UPF0209 protein yfcK from Escherichia coli O157:H7.
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 89
structure length 244
sequence length 246
chains with identical sequence B
ec nomenclature ec 2.1.1.61: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase.
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05430 Methyltransf_30 S-adenosyl-L-methionine-dependent methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2qy6A01
5ICCA 5EKXA 2YX1A 3LBFA 1OR8A 2JG3A 4C08A 3FPEA 4YV1A 4GC9A 2XVAA 4POOA 3HCDA 2PGXA 5B1SA 4QTUB 5CVJA 1Q0TA 4KW7A 4R6XA 2AS0A 4AZWA 5EHIA 4CTJA 2Z6AA 4DF3A 5E1MA 2XYVA 1TW3A 5F2OA 2ZW9A 2CMGA 2NXCA 2PX4A 3EVEA 5CCBA 2G71A 5FHRA 1L3CA 3V97A 3PX2A 3KPWA 4XUCA 2JH8A 5EGSA 2QRVA 4FSDA 2PXAA 1XDZA 4QPPA 1O9HA 2IP2A 2H1RA 2YVLA 3WSTA 4QVKA 2P40A 3EEYA 3KQYA 3DXZA 2HTEA 2OXTA 3VC1A 1NV8A 3PVCA 3T7RA 3I58A 3EVAA 3MERA 4PYMA 4RSRA 4XCXA 5DSTA 2GAFA 3EVBA 7MHTA 4V0QA 3GRUA 3REOA 4YUZA 3NDIA 1ZGJA 3FTFA 1P1CA 1X1AA 5EIWA 5K0BA 1AF7A 3KU1A 5LQAA 4OBWA 1SKMA 1NW5A 1DUSA 4PIMA 4YUXA 3B89A 3U81A 1SQGA 4MIKA 4OQEA 5EMMA 5E2AA 4BLUA 1RI4A 2O57A 1WS6A 1XDSA 2V74B 4RVHA 3L8DA 1ZQ9A 2ADMA 2PX5A 2QRVB 3LDUA 5CUQA 1PJZA 5E2BA 1IXKA 3O4FA 1MHTA 1BC5A 2IBTA 2NNWB 2ZIFA 3B7PA 3K6RA 3QOXA 4M7RA 3M4XA 5T64A 3BT7A 2UYOA 5EMKA 4FS8A 1DCTA 2EFJA 1JG3A 1G60A 3KR0A 3IV6A 2HMYB 3TQSA 5ICFA 5CIYA 4MTLA 4CXMA 1QAMA 3NWBA 1RI3A 3E8SA 3O31A 3EVFA 2K4MA 3FPJA 2WA1A 1L1EA 3G5LA 1DL5A 2B2CA 2PJDA 4LWPA 2XYRA 4UOEA 4P7KA 4NECA 4E33A 1R8XA 4HGYA 3LL7A 4C4AA 1HMYA 3GDHA 3ANXA 4QQNA 3GXOA 3EEOA 4RX1A 3T0IA 4ER6A 4RTLA 3KQVA 1RJDA 5DTMA 1Q0SA 1HNNA 1YF3A 1XXLA 2ONZA 1R8YA 2P1DA 3HCBA 3P9KA 1SG9A 2O0LA 4GUAA 1JQEA 2CMHA 3FUVA 5DPMA 3FUUA 4KRGA 3FPGA 4PYOA 3LDFA 3THRA 5BW5A 3TR6A 2BR3A 2PLWA 2UYCA 3AWIA 3BKXA 3S68A 3PFGA 4PCLA 3H2BA 2QYOA 3HCEA 3P2KA 2IH4A 3NW9A 4G56A 2ORED 2PT9A 2PKWA 4PYQA 5HFJA 1AV6A 5CVEA 5DXAA 2OO3A 3EPPA 2ZSUA 5HZMA 1NW8A 2AOWA 3SM3A 3C3PA 1RJGA 5C0OE 5F2KA 4F85A 1TW2A 1ZG3A 5HIMA 2DULA 4BLVA 3I53A 2PXXA 4GQBA 2P41A 3CVOA 2BR5A 4RVGA 1RI1A 4R8SA 3P2IA 2GLUA 1KHHA 1FPQA 3FTDA 3KPYA 4WVLA 3ORHA 5FADA 5FULA 5LSAA 1D2HA 4PGHA 1X1CA 1YZ3A 2PXCA 3FYDA 3DXYA 4GC5A 4FR0A 4EKIA 2ZIEA 3EMBA 1JG2A 4R05A 4E70A 1WZNA 3G2PA 3B5IA 4P7JA 5KS2A 3SSMA 2C7QA 4GF5A 2FK7A 2H11A 2PWPA 4O29A 3EVZA 1G6Q1 4EMSA 5LQJA 4PYNA 3LHDA 5EVJA 3SSOA 3BKWA 3NWEA 2IDKA 2CL5A 3DMFA 2OZVA 3MTEA 1NE2A 3EMDA 1G55A 4QDJA 5T67A 3LKDA 2AR0A 1KYWA 2YR0A 3FRIA 2OBFA 3GRYA 4RYLA 3GO4A 3V8VA 5KVAA 3GRVA 3SXJA 4RTKA 1RI5A 5FWDA 2VDVE 2IDJA 5BW4A 2LD4A 3HM2A 1KP9A 3G88A 3P97A 1KPGA 1JG1A 2G8NA 2IIPA 3AY0A 5K0LA 3ER8A 3ERCA 3UA3A 2Z6UA 4H0NA 1XCLA 4IWNA 4CTKA 3UWPA 4DMGA 3DMHA 4X61A 3P9IA 2KW5A 2P3LA 4AUKA 4CWAA 3G7UA 2ZWAA 3JWJA 4PYIA 3UJ8A 4E2XA 3C6KA 1UFKA 3BWMA 1VE3A 3CJQA 5K05A 1UIRA 3KQMA 1VBFA 5LQCA 4A6DA 3GNLA 1XCJA 3LX6A 5EG5A 2VP3A 2HWKA 1F3LA 3HVHA 5GINE 4M38A 3TKYA 2ZLBA 2O05A 3BGIA 3DLIA 2NYUA 1R00A 5DWQA 3BZBA 3RIEA 5DM1A 5EZSA 3SSNA 4DCGA 2UYQA 4EQZA 4FP9A 5DTRA 2FHPA 3PFHA 4DZRA 1X1DA 5CVVA 5LQKA 1EIZA 4OBXA 1PRYA 1QZZA 2C7RA 2AOVA 1EQAA 2PVCA 2JHCA 1M0EA 2PX2A 3I9FA 3ELUA 3DR5A 2ZWVA 2FPOA 3B3JA 1R6AA 5HILA 3DXXA 5HIIA 5DTQA 4ATNA 2QM3A 2JJQA 3LCUA 5FUBA 3MCTA 5U4XA 2JHPA 3FPFA 1KIAA 5M5BA 4YV2A 4DKJA 2P7IA 1D2GA 2ZBRA 1KYZA 3OCJA 5GM1A 4DCMA 2F8LA 1TPYA 3PTAA 3OZRA 2NP6A 4GOMD 1G38A 3HVIA 4L7VA 3VYWA 3GRZA 1VP9A 3GGDA 3CKKA 1F38A 1KR5A 3QOWA 3OPNA 3HCFA 4IV8A 2PV0A 4KVZA 4P58A 4QVGA 3EGIA 2AOTA 1L9KA 1I1NA 3KR1A 3FUTA 5FQOA 5CCXA 9MHTA 3PX3A 5P8WA 4HTFA 3THSA 3KPVA 3PB3A 2FCAA 4CKBA 2AVNA 4ZTBA 1I9GA 3LGAA 2GB4A 3SX0A 4V0RA 5FTWA 4RTMA 4M36A 2CKDA 2GPYA 2OB1A 1R18A 3TKAA 2G72A 2QE6A 4X60A 5K09A 2OB2A 3G8AA 3DLCA 3LCCA 1D2CA 4IV0A 1X1BA 2O07A 3B3FA 5K0FA 3AXSA 4RTRA 2JHAA 3G89A 5LQRA 2UZ4A 3NMUF 3VC2A 4ISCA 1L3IA 2IH5A 3E23A 3ID6C 1ZHFA 3CJTA 1BOOA 3KR9A 4GOLD 3KKZA 4MQ4A 3UJ9A 3KQTA 2AOTB 4QTTB 4C07A 3KQPA 3VSEA 4RTQA 3ME5A 1NT2A 1WXXA 3M70A 4U7TB 1R74A 4ER0A 3HEMA 4HTFB 1UWVA 4CKCA 3HA3A 1YFLA 5GWXA 4YV0A 5GP1A 5CD1A 2XBMA 3KHKA 3F4KA 3HP7A 5EPEA 4PNEA 5G02A 5DX0A 1G8SA 3MTIA 3NDJA 3T7SA 2YUIA 3T7TA 4P7GA 3HCCA 3Q87B 1RJEA 3KQSA 3LDGA 4X1OA 3TM5A 1BKYA 1JR4A 1L3BA 1VQ1A 1N7IA 1YUBA 2DPMA 2QY6A 3PT9A 4WXHA 2Y1WA 4PYLA 4RWZA 4EK9A 4RVDA 3CCFA 1RJFA 3R24A 8MHTA 2FK8A 2IPXA 4FGZA 1VPTA 3ELWA 3AJDA 3X0DA 3OU7A 5FHQA 5D1NA 1XDUA 2XVMA 2GS9A 3KQWA 3GU3A 3TM4A 2IBSA 2BH2A 1RI2A 2YTZA 4LG1A 3UA4A 2HR1A 2ERCA 5DM2A 5LQUA 5FA8A 1JSXA 4XUDA 3LCVB 1EJ0A 5IKMA 4DM3A 4MWZA 5E8JA 3B3GA 4E30A 2I9KA 4JXJA 2BM9A 2P8JA 2HNKA 3JWHA 1B42A 4ER3A 1M6EX 2FYTA 3RODA 4YUYA 2OKCA 4QQKA 3G8BA 1YZHA 3E7PA 3HTXA 3GIWA 3HVJA 3A4TA 3P8ZA 4HSGA 1KXZA 1T43A 3CGGA 5C1IA 3TFWA 5BP7A 2H00A 2NXNA 1IY9A 2VDWA 2B9EA 3JWGA 3OU6A 4XUEA 3SVZA 5BXYA 1QAQA 2VZ9A 3M33A 4RV9A 4X41A 3RW9A 4B17A 4U7PB 2IH2A 5HEKA 10MHA 1EAMA 4GBED 1KPHA 4QDKA 3HA5A 3NJRA 3IEIA 1N2XA 5DM0A 5FCDA 2C7OA 3EVGA 1QAOA 1IM8A 1QANA 3HVKA 3MQ2A 4KDCA 1WXWA 2EJUA 5E1DA 5DT2A 4Y30A 4LWOA 4RTNA 3LSTA 4PGGA 3HCAA 5T6BA 3TOSA 2OPBA 2B78A 4PYJA 4IKPA 4OQDA 3LKZA 3KQOA 1ZGAA 3A7EA 2ESRA 1JG4A 2AOUA 3OE5A 4PINA 4E2ZA 1YB2A 4RTOA 2AVDA 3R6TA 1NW6A 2AN5A 2PX8A 4PYKA 4YUVA 4OA8A 5K03A 3OZSA 3HA7A 5H02A 1AQJA 2OY0A 4BY9E 4R6WA 2XYQA 4KIGA 4RTSA 5EZQA 5DX8A 3DULA 2ZTHA 3G2OA 3EGEA 4FT4A 2ZULA 4AZVA 2E5WA 2N47A 1XVAA 3KPUA 5EOVA 3C6MA 5FQNA 1YFJA 2IFTA 3SR4A 1JQDA 4AZTA 2B3TA 5DX1A 2GA9A 3HNRA 3A7DA 3EGVA 2I6GA 2EG5A 3FUWA 1NW3A 3M6VA 1VL5A 4HC4A 3UJAA 5JUWA 5HOQA 5HIJA 5CVUA 5DRTA 1ORIA 5K0GA 1MJFA 5DLYA 2AOUB 3MGGA 2V7EA 3D2LA 2P3QA 3QV2A 3G2QA 4E2WA 3GCZA 2ZZKA 4R8RA 3ELDA 5EMLA 5GIOE 1WG8A 3IYLW 3GRRA 1EJ6A 5ERGB 4ER7A 5K0JA 3R9XB 4OA5A 4KIFA 5EKUA 4C04A 1V39A 1N7JA 5E9QA 5EC8A 4CKEA 4DA4A 3NVMB 4PIPA 3O7WA 4GOND 3P2EA 1WY7A 3TLJA 3ELYA 1FP1D 2FRXA 3CJRA 3MB5A 1JSZA 1FJXA 3PLAE 3UJCA 4HGZA 4KDRA 5E8RA 3BXOA 3ER9A 3OU2A 2B25A 4ER5A 1SVUA 2R3SA 2JH9A 3CC8A 4C03A 1Y8CA 3MAGA 1AQIA 2ZZNA 2IGTA 4YMHA 2AZTA 4GOOD 4KWCA 1SQFA 1BHJA 1VIDA 3GJYA 5K0NA 3I64A 2ONYA 2Y1XA 3UBTA 2ZZMA 4EVIA 1JQ3A 2NXJA 1FBNA 1NKVA 4K6MA 2EJTA 4PONA 2BZGA 3LPMA 3UJ7A 4PCAA 4HRAA 4Y2HA 5E9JA 3DP7A 3IHTA 3KQQA 4AZSA 3SMQA 4C06A 5ICEA 5K01A 4BP1A 2ZBQA 3R0QA 5EEGA 5K0EA 2HV9A 2WK1A 3OFJA 2ZCJA 5GM2A 3TPZA 2ZVJA 4YMGA 5GOZA 5MHTA 3OFKA 4FZVA 2P3OA 4GEKA 3G2MA 1KPIA 1O54A 5EIFA 3SGLA 3G5TA 3UJBA 3OE4A 1XJ5A 5D1HA 3BUSA 3LECA 4C05A 2GH1A 2Q41A 1JTEA 4RVFA 2BR4A 3FUXA 2PSSA 1NW7A 3DUWA 5HIKA 4BP3A 3DTNA 4OX9Y 1QYRA 3NTVA 2I62A 5DM4A 1P91A 2OYRA 3FPHA 3OZTA 1SUSA 4RTPA 3CBGA 5IH3A 4MHTA 4PWYA 3JWIA 5DSXA 3TRKA 4M37A 3M6UA 3AXTA 4FT2A 1U2ZA 2P7HA 3PS9A 4HG2A 4QPNA 3FRHA 1JTFA 4E2YA 3UJ6A 3NVKI 1G8AA 1SUIA 5ICGA 3DOUA 2AOXA 2G1PA 1P1BA 2G70A 3E05A 1P39A 2YQZA 3R3HA 2AN3A 2VS1A 3M6XA 1H1DA 2O06A 3FTEA 2A14A 4X63A 1EG2A 3KPJA 1VP3A 5E1BA 4EKGA 3P9CA 4LECA 4F86A 5KQRA 2I7CA 2P35A 1NBHA 5LR6A 2WA2A 2Z6QA 2PWYA 1FP2A 5C9ZA 1XTPA 1VLMA 5CVDA 5DXJA 5FA5A 5JR3A 3GWZA 1ZKDA 3K0BA 3UJDA 4DQ0A 5LQNA 4BLWA 3BWBA 3BWCA 2NXEA 1O9GA 4FSXA 2YXEA 4AX8A 3A27A 4E32A 2UYHA 4P7FA 1NV9A 3DH0A 5EMJA 2ZFUA 5FWAA 4A6EA 3BWYA 3P9NA 3KR2A 3FTCA 3FYCA 5E1OA 4Z2YA 4RTJA 3P71T 3C0KA 2CWWA 3I5UA 1M6YA 5EHGA 2PT6A 3EVCA 5KYGA 2ZBPA 5GIPE 2YXLA 3LBYA 4F84A 4YUWA 2VDUE 2PY6A 3MCZA 2C7PA 1I4WA 3EVDA 5F2NA 3BGDA 2PBFA 4E31A 2NP7A 3A25A 3M6WA 3UZUA 5K8VA 5KQSA 2BM8A 3C3YA 1INLA 1NBIA 1ORHA 2AN4A 5EQJB 1X19A 3BGVA 3FZGA 2R6ZA 2ZIGA 4HH4A 3A26A 5CM2Z 3UFBA 2YXDA 5DRYA 3DMGA 3TMAA 3Q7EA 5K0CA 3MHTA 1Z3CA 5EEHA 2EX4A 5E9WA
chains in the Genus database with same CATH superfamily
1P61B 2WU0A 3PL5A 3RFUA 4C4PA 1M73E 1Q2XA 5ICCA 2Y0BA 1ORWA 2ODPA 1ZVJA 3UHOA 4LN1A 4NCIA 3UMMA 1G291 3HYSA 4YT5A 4W8GA 3WXBA 1Y6JA 5MN4A 3GUCA 5B3AA 4JFAA 1RACA 3LDHA 1BRMA 4Z49A 3OLZA 2ZW9A 3UPDA 1D5WA 3SD7A 2XUJA 3B1VA 3DD5A 1GQSA 3WRYC 3O95A 1ZIPA 2V6IA 1QJ4A 1X13A 3KPWA 4PLYA 1N2IA 3DS8A 3U4AA 3T1HB 1Z63A 4ODIA 3RS0A 1LBQA 3SQWA 1OREA 2IYQA 3CH7A 1XDZA 5B2ZA 3BVPA 4MUGA 3ZVMA 3H1EA 2P40A 5AHOA 1RRVA 1K86A 3AHFA 1YS9A 4Y2QA 3ZHOA 5CA0F 5JAHA 1ZY2A 1F6WA 3W5SA 2VUIB 5DBHX 4BZQA 1TCCA 4LHZA 4X92A 4Y2TA 2X0EA 4CODB 2NZWA 2NUTB 2JGMA 2R47A 4YUZA 1G7TA 4KAAA 3QPUA 1P1IA 1ZGJA 3RJ5A 2BFCA 2XA9A 4BO7A 3BH6A 4R0MA 2Z8YA 4OAOA 2J7PA 4TS9A 5BVGA 4DYVA 4OQEA 1NVTA 1XZQA 2AMLA 2ID9A 3DEIA 3C6QA 4J9UE 5D87A 3VR4H 4ZMRA 1L6RA 1KY2A 4PHHA 3QY9A 4S0ZA 2HT1A 1P2TA 2QRPA 2IBTA 4AKGA 3OD1A 1E1CA 2O7RA 1G4AE 3E48A 2ZM5A 2I3AA 1ZRMA 2WWHA 4YQEA 1GILA 3S1LA 2F3UA 5DP2A 1Z8NA 4YCSA 2Q0SA 2FX2A 3KUKA 4GKAA 4H17A 4F12A 5KYYB 1ZMRA 3TGPA 3QE0A 5AHRA 4F1WA 2BGMA 4NCAA 1KZ9A 1Q3TA 3IV6A 5LU8A 1W5AA 3MXTA 4YP9A 421PA 1T1GA 4AG6A 3T5TA 3SNKA 3DFUA 1BWQA 1EA5A 2JVJA 1DDIA 2BEVA 5LMZA 4HT3B 4G4IA 4D4LA 4QUHA 3OQ1A 4W9NA 2WPDD 2FQXA 5JH7F 1UJ5A 3MG9A 1FMFA 3V8MA 2VEOA 1J56A 1NTRA 4KUEA 3ETEA 4C4AA 1CR1A 4D9CA 3GDHA 1H5UA 5TS2A 4OK6A 3H99A 4AJOA 4X93A 2F59A 4HWTA 2VLBA 4MX8A 4ZPXA 2ONKA 3L8GA 3RIMA 3T3NA 2YNMC 4Z4QA 4QUIA 1L7NA 1YKFA 2QX4A 4UBNA 1C1YA 4G86A 3DL7A 4UTZA 3KVYA 5CB4A 3WGGA 1P9WA 3BN3A 4GUAA 1JQEA 5AW3A 4TTPA 1H2WA 2CL6X 1RWOA 5AI6A 1YZQA 2B8JA 4XIJA 4JJFA 2PLWA 5FBQB 2A0XA 3BKXA 2QAIA 2EZ8A 2RHOA 1PQUA 3CNEA 3PFGA 4I5GA 3FUCA 3RAGA 4WGFA 2C4MA 4G8DA 4LDPA 4MLCA 1FUEA 1TIBA 2ATVA 3IAM6 4C7XA 5A9RA 4PAQA 4JGGA 3EPPA 2FSIA 1NYLA 1PSZA 2VF8A 3VOAA 1R64A 3IQXA 1Q83A 5FO1A 3LVFO 5KHAA 3VAYA 1QS0A 2DBYA 2M98A 4X1KA 2H1LA 3D8SA 4OYRA 1OFVA 1DEHA 1R50A 1QJCA 4UJ5A 5B7GA 1VJTA 2C42A 4NK4A 4CUJA 1B6SA 1W8DA 2ZBUA 4GQBA 1ICEA 4OIFA 1QPZA 2ZI5A 4WRRA 1XLTA 3OLCX 5IM4F 1OBOA 4JLJA 1KO1A 5FADA 2XB2A 2RAFA 4TWAA 4UC0A 3ND5A 3LLUA 3VO1A 1SOWA 1FP4A 2XADA 2Z58A 5CFOA 4V38A 2GYUA 2FWPA 3CF6R 2QORA 2RHTA 3D3JA 5JXIA 2XWJI 1IC6A 1F2VA 3ZZNA 1O1YA 5EJ7A 1E8MA 3CEMA 4LSZA 4RD6A 2WJIA 5BRAA 4G5YA 1BXGA 1XZEA 4UM9D 1C41A 2AMVA 2ALJA 3FNIA 3VR4D 5IAKA 4TN5A 1EUYA 2OBLA 4NJEB 4HNHA 4L72A 1OF1A 4G97A 4YR9A 1A5SB 2VN8A 5L95A 1FSZA 2HGZA 4V0MA 4Q4CA 5FWDA 3CX6A 4P22A 1YL6A 1CUBA 1K68A 2LD4A 2NO0A 3T9FA 2PGJA 2WTXA 2AYYA 2IZOA 1JDBC 3CSUA 1KPGA 1JG1A 2HEIA 4ID3A 1ZK0A 3EC7A 5CCDA 4JV5B 3QFHA 2IKSA 4IYRA 1RWNA 2O9JA 2GEJA 2CMDA 4Q01A 5DBFA 1O4WA 2C82A 3HJTA 2CL0X 4IWNA 3F73A 3D64A 2F8TA 1ST3A 2X2FA 4HX5A 2VYFA 1W49A 4N7BA 4QAJA 4BGDA 5FUVA 1PWXA 3KKLA 4P4UA 3EQ7A 2XBLA 4NEQA 4HWKA 4QEZA 2ILVA 1A7KA 4DJDC 3BMOA 4MA4A 3V4SA 3KKKA 2QNBA 2A5LA 2R9VA 2C9ZA 5G0WA 4ZV7A 4CKWA 3BGIA 1X7XB 1ZA2A 2L19A 2NYUA 2Y1LA 5AH0A 3ISJA 2MR5A 3DPUA 1HKHA 1YZGA 3OQJA 3TUIC 5CLHA 3HJRA 4OB7A 5EUQB 4WZBA 5AUOB 1X1DA 4HJRA 5F33A 1VLZA 1U7UA 2JHCA 3EYAA 2R4TA 1CY8A 1U5BA 2X22A 1V16B 3QKRA 4MCHA 1SXPA 1V5IA 4LF6B 1K97A 1PK7A 1ZH6A 2ORVA 3R2JA 4BKPA 3E7DA 2I5PO 3O9ZA 2WWVD 4ZOBA 3TYXA 3LLCA 4U9HS 4V0KA 4JVNA 4V02A 3JRNA 1EVQA 1W2GA 5KNCH 3JQGA 3OCJA 2AFHE 5M04A 1HZZA 2CK3A 4RSMA 5EJ9A 3S6JA 2QLNA 3F49S 2YJZA 2PA0A 3I6ZA 2P75A 3WJ1A 2H16A 2V7TA 1EESA 4EG0A 3RQIA 5LYYA 5I51A 4F4CA 1T10A 1U6JA 4JNCA 3SC4A 4V1CA 3QU7A 1ZIYA 3REGA 1FZQA 3G2HA 3ZW9A 5AVQA 2HJWA 3ND8A 1Z2PX 2EGHA 4HDAA 5SV2A 1N8SA 1VRCA 2XXBA 1Q0LA 3SS8A 3VNBA 4PO1A 4LZZA 2RB5A 1E6UA 2EKZA 2HGSA 3I9MA 3FDFA 3T06B 2QUKA 1IAQA 3THSA 1U0HC 4YJGA 1T0IA 2GKOA 1COZA 2F3RA 1VRVA 4PZEA 5COAA 3CLSD 4J4TA 5ALRA 3U44B 3G8AA 4IM7A 1FUIA 2HJRA 4KV9A 4DXHA 4J0KA 1KZ4A 4ZARA 1D4FA 1E59A 5BT8A 2XGJA 3TIGA 4IZ6A 2O07A 4N9QA 4BAGA 4XX0A 1G4HA 2CXNA 1OIVA 5IG2A 3KYBA 4ND5A 1BOOA 3EARA 3UJ9A 1W76A 3ZDBA 3FYUC 4IWXA 3A6PC 5DNVA 1U1IA 4PC3A 2Y6VA 2PZAA 2CLLB 2EFHB 5FORA 2OCBA 3Q11A 4GZLA 2EQAA 5C32A 3VKHA 4E1BA 2GPSA 5EXXA 3HP7A 3HR4A 4A2CA 5CYPA 3L6DA 3AEKA 4W1RA 4XH9B 1IHYA 2GM3A 4G0OA 4GYYA 4RZ3A 3UIEA 2PJRA 1M2GA 3AVQA 3LC2O 1CEQA 1UF9A 4AP9A 2NUPA 3LDGA 2MHCA 1JDPA 3PSHA 4W7IA 2DQSA 3DOOA 4B4DA 5HKKD 1L5OA 4L73A 4YWJA 1E9VA 3PFKA 1E4YA 2BGNA 1VJ0A 1TYAE 1YIDA 3MBKA 3M5CA 4KI0A 4LNHA 4AN1A 4DLWA 5JSFA 3CPEA 2K87A 4NMWA 3RTCA 1DU4A 4CKZA 2CFIA 4TL7A 1KEEB 1S7CA 3CS3A 4UUAA 4DCJA 4RACA 1Y3IA 4G07A 4Q21A 1JR3E 1SC1A 2I33A 2CBXA 5KYVA 3IT1A 3KM0A 3D7LA 3L01A 3RUIA 3TTSA 4PGAA 1BHO1 1JA1A 2VNKA 3H9EO 3JWHA 1U7PA 3HXPA 1X80A 4RV5A 3RODA 5KTTA 3G8BA 3IQWA 1WHTB 4F71A 1OXMA 2G9VA 2ZJAA 1AKQA 2JIPA 3KDPA 3CGGA 2CXOA 1HLFA 5KWEA 1Q3KA 1RCUA 3U3JA 5B2EA 3IR6A 1AS3A 2YV1A 4Y1RB 4ZK2A 1NJ5A 3OCZA 1JZQA 4G8CA 1Y8QA 1W36D 2QRLA 5EP1A 3FWZA 4HH1A 4LHSA 4NQRA 4JUBA 1XALA 3L7KA 4KDCA 4CCAA 4RNDB 3OIDA 3VTZA 3QHQA 5T6BA 2J3QA 3ZU2A 3P9YA 3UY4A 1IN8A 2ADFA 1ZBDA 3JW8A 4Y1FA 5BWNA 2VWGA 5KTPA 3T7IA 4B4OA 1K92A 4OQ4A 1BMDA 3DA8A 5DLQC 5A5GA 5GTDA 3M7IA 1T0UA 4LVNA 1WMDA 4JLVA 1Q0QA 4UDNA 3Q7SA 1JHYA 3TLGB 4YJ3F 5AHXA 3EGEA 1VE6A 1YVDA 4R9VA 2G40A 2CMFA 3KPUA 1UANA 3EPLA 3V1LA 1FUYB 5HJ5A 3ROTA 3H1FA 5CBPA 2CNBA 3OY7A 5EMHA 2RGAA 1T9AA 1Q0RA 4GNRA 1QIDA 3IP9A 3NDRA 3E7XA 4G84A 4KG7A 2X1VA 1B43A 3UM9A 5A71A 2IYXA 4DIMA 4DSAA 5AUPB 5BR7A 1LWNA 1KJYA 4FBLA 2JIOA 2Q46A 4URXR 3HQ4O 3IOCA 4D42A 2P5UA 5LOVF 1IY0A 3KRTA 3QV2A 5H9VA 5E6UA 2D06A 2J3DA 5GIOE 1BE0A 4HADA 5AKYA 4M9RA 2O2IA 4F4HA 1J25A 2IU3A 2WFAA 5HG0A 2RGEA 2PZ8A 1UBEA 2EP5A 1THMA 4RF5A 3ZK8A 3O4HA 4ERNA 1LLCA 2CVPA 5T4BA 1V9SA 4DHEA 5CXUA 5JZOA 4AYTA 3AERA 3H5LA 4N18A 3RFVA 3R3JA 3LLVA 3UUWA 4CNQA 2EX1A 5JBQA 1QCYA 2O1XA 2HSEA 4PSAA 4V03A 3SQXA 3UJCA 2E87A 3AFHA 3AJEA 3ZGNA 3NVAA 4ARUA 4ZIRA 1AQ6A 2W71A 1NR5A 1W5EA 3PQDA 5BMOA 3C45A 1HOXA 4OJNA 4TQ9A 4B2PA 1GUBA 2CB9A 4C88A 4BDSA 2QYHA 2XB8A 1B8PA 2QAJA 1QV9A 4ND6A 1JIXA 3I2FA 3NEYA 1TGYA 2AZTA 4RA6B 2CFTA 1VMKA 3VKUA 1BE8A 3HJGA 4KWCA 2IUFA 1RWQA 4M9CA 5ECDA 1H6CA 1T4MA 1XX6A 3RC1A 2WB4A 1ISIA 4HYYA 2GKGA 4DTIA 1B41A 1HDXA 2I3ZA 2UUPA 3GK3A 1GSOA 1HURA 1I7NA 4J29A 3LHSA 5I9TA 4D9GA 3QWBA 1BDJA 4PFQA 3TAXA 3PNVA 1E5XA 1D09A 1ZKMA 1GYQA 3OF5A 1UJ6A 3T7AA 2PSJA 2Y76A 1EDOA 3GHYA 1N8KA 4PX3A 4R1UA 3K9FC 2BGWA 4PLCA 1H3FA 4Y2RA 4NH4A 4RVFA 3TWOA 4YXFA 1IPHA 3OVMA 4TMYA 4DWVA 4DV7B 1SCAA 4B6OA 5GQSA 4AM8A 3I5YA 2QZ4A 3IR5A 3OSUA 2WVHA 1IULA 2FSVC 2JGKA 2VDOB 3RVPA 3F46A 4MHTA 3CBGA 3U3RA 5F1OA 2D0OB 2HA3A 4K3UA 3QLJA 2OZLA 3AY6A 1Y6ZA 2BHTA 4OMUA 3PGXA 3RBAA 3U4CA 1FP6A 4P3NA 4RZ2A 1OV6A 1MXFA 4WK2B 1G8AA 3CLKA 1J2EA 5HCIA 1II8B 3HHEA 4X8OA 2RHMA 2VAVA 5LA6F 4LZWA 3C48A 5KDOA 2Z08A 1AS0A 1A8HA 4J2TA 3WMRA 4LF5B 3WV4A 4FM9A 4MULA 2GD2A 5E1BA 3WQRA 1J42A 3PWSA 1EZZA 5BSGA 1VPDA 3JAMA 4JOSA 3UV7A 1IEQA 3MNFA 1T4DA 4EHBA 1VHLA 4L9AA 4YAUA 3ZE1B 2C2XA 2I8AA 4LOJA 5BSWA 4MJLA 1LI5A 3CRW1 3NHAA 4C7BA 4BLWA 6NULA 3BSYA 3AU9A 4FPXA 4E32A 1S1MA 5KZMB 4ZCIA 1CZOA 1E2BA 3H5OA 3DH0A 1YBFA 3T3EA 4A6EA 2I4LA 1V11A 1TZKA 2AYZA 1PHPA 1OSNA 2IWRA 3FYCA 4A2WA 5C1OA 1E9AA 2AFHB 3S2IA 2C78A 3KB2A 4EVQA 2HKIA 1XZDA 3QVLA 2WYVA 4KRXA 4KVFA 3I5UA 1M6YA 2QUHA 4E09A 4ZO4A 2AC7A 2BM0A 2MINA 2VDUE 2FTKE 2ZRCA 5AKLA 4BMCA 2FA9A 1UOOA 1XEXB 3UMVA 3BQNB 5JQGF 1GQOA 3DBHB 1ZEJA 4K6OA 4HB0A 3SYTA 3UZUA 1VIVA 1YMVA 3G3EA 4DL9A 1FQJA 1Z4KA 1GAQA 2P30A 3G68A 4NBLA 5EIBC 2YJ4A 4ZZ1A 4PFKA 1LXCA 1YHNA 2R6ZA 4FMBB 3PDCA 2JLSA 2XGGA 4DIDA 4DY6A 1JKFA 4EJSB 1EGQA 3LTNC 2WG0A 1Y1PA 3P9XA 4WY8A 3ZU5A 3GJ6A 2VWQA 4QDOA 1M2WA 2H9IA 3ZE7A 4EHLA 1HXHA 1B6GA 1XE3A 3R0ZA 4JA2A 4ZDWA 4Z4CA 4TYNA 4POOA 3SF8B 1RXUA 3A6EA 2PGXA 2HYDA 3FCSB 2IS4A 4KXUA 3HBAA 2P1ZA 1LH0A 4WSOA 2O8VA 2NV2B 4XVQA 4UXIA 2NU7A 2AGVA 2F6RA 2C3YA 3OMLA 3S81A 4CR8A 2G1JA 3JQFA 3AR6A 3QFTA 5FHRA 1EZ4A 1FNMA 2JH8A 3TK1A 1RAFA 5LA6B 3JR7A 3HACA 3VNVA 2PXAA 4KXMA 3F8WA 3PC4A 3NEPX 2CL7X 2FLVA 1ZISA 1MHPA 2A5GA 4XWTA 1RHMA 1RCFA 3PYXA 5BSRA 1J22A 1SXJD 4TRMA 4LUCA 2BLNA 4LE2A 4E4RA 1NZFA 2VDJA 3A8TA 2XJ4A 4JEHA 4Z4FA 1J09A 2DJIA 3VI3B 5FOVA 3ZIDA 3OA2A 1BYUA 4D46A 3DYIA 2A30A 2X7XA 3F8TA 3GRUA 3VUFA 1H2HA 1QQAA 4XWYA 4XZ3A 1P1CA 4JJ6A 1C5KA 1DEOA 5HJ2A 4EHKA 2ACEA 3D4IA 4C0BA 2ZKLA 3I01M 3K20A 3H11B 3KEFA 3NIWA 3Q8WA 4OBWA 3WZ2A 5LQAA 4D8VA 1GL7A 1SVNA 2GN0A 3VQTA 4H0CA 4EPXA 4Q4HA 3IAS1 4GFDA 2R2AA 5BPFA 2BMFA 3HH8A 2ZBGA 2OCKA 1EK1A 5K4HA 4Q12A 3Q2OA 4WCFA 2Z3VA 1C8KA 5AJHA 4F3RA 4NU6A 4AY3A 3BT7A 1ID1A 1G2IA 3V2HA 2EFJA 5L7YA 5CDYA 1MB0A 4B2LA 1RJ9B 2HRDA 3CUYA 2XE8A 4JUDX 3VR3D 5JQGB 1A9QA 4UM9B 2OMEA 5CIYA 3OECA 1W0KA 5J2UA 2REBA 3CF4A 4XB2A 3H7AA 1T8TA 3L1IA 4DJAA 4YJ2A 2XYRA 3AEQB 4TTQA 4WXEA 4ZQCB 2O2EA 2XOKD 4DA8A 1A8QA 4IJKA 3IT2A 1Z08A 3DW1X 2OC9A 5C2JB 3IEKA 1F60A 1YDHA 4U7HA 1ZK2A 5JWOA 1QQTA 1TCBA 2ZJ8A 3BM5A 3I39X 4M46A 4QQNA 2OBNA 3ENQA 3GXOA 1LNSA 3A6KA 3GLHB 3U37A 3ZWKA 5C52B 4RD1A 4I3HA 2JLUA 3ZD6A 4D1YA 1GL3A 3DT9A 3PFWO 1VSVA 2V6JA 2CLHB 2BFNA 3C85A 2JCYA 3CKLA 5J5CA 1JIKA 1I3LA 2C4HA 2W00A 5CR9A 3P9KA 4R0NA 4IILA 5A06A 2CMHA 3VDNB 5A1TA 2BJHA 2II6A 4CQMD 2AZDA 4UBJA 1OFGA 1PT6A 3OTWA 4PANA 3TG2A 3G8CA 2WUWE 4DV3B 4UBLA 2WD9A 5F1PA 1XZJA 1JFRA 2BKEA 3GP3A 5DF1A 3MHPA 3AM5A 4OHOA 1YRQA 2LZ0A 5DK4A 3QTBA 3DONA 1S2OA 1BE6A 1Z15A 3NRBA 4ZYLA 3AIOA 3KBOA 5EKSA 2Q5JA 1L1RA 3AL3A 4WZBE 5CT9A 3R0JA 1JN0A 2VSNA 3U7EB 1P1FA 3QVSA 1I30A 1V3VA 4WX2B 4ALMA 4EW2A 3JTEA 1IOLA 3S55A 2NZ8A 2JLWA 3O26A 3N2NA 4OP3A 4KKVA 1PJCA 3RNLA 5C3MA 2XA1A 3S7TA 2BHLA 1HYEA 2SCUB 5DHQA 4BQEA 2R1VB 5CGZA 3UFXA 3AR7A 2ZJZA 1MRZA 4WXRA 4HGRA 2X8LA 2IXGA 4JQYA 1GEGA 4N0PA 4E70A 3CO5A 5D00A 2PUJA 1PYDA 3LZDA 5D84A 5TB5A 1PZHA 4I4IA 3T9AA 4JNKA 2KJQA 3U4DA 3SLRA 5U4QA 3QK7A 3SYRA 2Z30A 2OO7A 1IN1A 2VL7A 3IFSA 3NWEA 1ZGZA 3QVWA 1MX5A 5D8DA 3EW7A 4NAVA 2GHTA 2X40A 4Q9DA 3AJ8A 3AM3A 4QDJA 2JGAA 1QV6A 4Q9AA 5FPHA 5L4NA 4NYMR 3GWGA 3B9BA 3OOSA 5PNTA 2WD7A 3QBJA 1GGFA 1GQ2A 2D74A 1R4AA 3L8EA 3EOZA 1VMEA 2PTHA 4CRWB 2GD0A 2GJKA 3DMRA 3G0BA 1PNTA 4Q7EA 5DASA 4AICA 3V4VB 2XECA 5CA1F 5TQVA 5KC9A 4TYYA 1IBKB 1YR3A 1KK1A 2FJUA 4E7PA 5FI0B 2ZYUX 1DBPA 5HR5A 2FWRA 3TRIA 3CLRD 3DL4A 3L1UA 1TUBB 4NCXA 2GASA 3UH1A 2P4UA 4AUKA 2OC4A 1SU6A 3E58A 2D2EA 3BWMA 2O20A 3TEFA 4ABYA 3ROXA 1CNMA 1K08A 1GTL1 3QY0A 4L8VA 4YROA 2IUEA 2OAQ1 3R40A 1YDWA 1ODJA 2QE7D 3CR8A 1QOZA 1BFDA 3N58A 2GUGA 3ABRB 2HBRA 2VP9A 2YHSA 3BL8A 1OYOA 5EWJB 5HFNA 3UW3A 4AJ9A 5A4FS 5JNSA 3EFBA 4Y7DA 4JC5A 1MR3F 3RIEA 2VJAA 1ZDMA 1Z3IX 3QSYA 2H4HA 2KS6A 2CLKB 4BUJA 1ISMA 3LK6A 5LQKA 2NAFA 2B4KA 1GT91 1M2OA 3IPXA 1U1FA 3TMYA 1CY4A 2Y1FA 2ZRKA 5JSQA 3LQKA 5EGNA 3WLJA 3FTPA 3GT7A 5DHPA 4JCOA 3B3JA 4UEJA 4DR4B 4QBIA 1GEEA 1NUAA 4DPLA 5DTQA 4XWOA 2D5IA 2QM3A 3E5RA 4RMHA 1SCJA 2AR9A 2JFNA 5ALMA 1XT6A 4C0KA 9ATCA 2O8FB 4M54A 2OZPA 5CB4F 3QFCA 1Y4SA 2AIRA 3FPFA 5M5BA 3S29A 4XGIA 5KSOA 4DKJA 1QZ3A 1SA0A 2WAAA 1OY1A 2WQZA 3TNYA 5I3CA 5E7JA 4CTMA 4N3CA 5EUMA 4L7VA 4TZKA 1U3VA 4X5OA 4E21A 3CQ9A 3RAJA 4I0WB 2RJNA 2V3WA 3T52A 1SGWA 1B8UA 3PKZA 4JBLA 3HBMA 4FOTA 4JFRA 2QTLA 1I6KA 3E3MA 3MWFA 1IEVA 2OGUA 3ABZA 2P79A 2PS9A 4FOLA 3PHLA 5AQEA 4LFAB 2AZXA 1M34A 3GRCA 4TWIA 1WQ4A 4PLHA 2BV3A 1E92A 1YFKA 2RK4A 4JBYA 1X15A 4MQEB 5EHXA 5I45A 3H5WA 3AFMA 5ALXA 1SR8A 2FG6C 1EZ1A 3TKAA 5CA1B 3SICE 1GCGA 4OI1A 2OB2A 3SFTA 4QT4A 2QQ5A 1E6LA 4PPNA 4UVEA 1XB2A 4R7ZA 4NFYA 3A9RA 4J9VA 5FYDA 3DE3X 4JVLA 3IBCA 1U0SY 2SNIE 3ETJA 2UZ4A 4OFWA 5TMDA 3IDZA 1HE2A 4JUAA 4E94A 2QZSA 2NZYA 3O2SB 3G2KA 5JMWA 4CI0B 1BDIA 1I14A 1OX4A 1PJRA 4IVPA 3R8XA 4AMUA 3HSSA 3VSEA 4PG7A 2ECOA 2R7LA 1REQB 1YCFA 1P18A 1DX4A 3FI0A 4LISA 5BW8A 8ABPA 3JVVA 2Y05A 4G01B 3H1GA 4JQSA 1QU3A 1NXSA 5SYNA 5LKAA 1N2CA 3BSWA 1MEEA 4F92B 1U7OA 1CHDA 3D6FA 4J7UA 1VSBA 3ZHTA 3R44A 1ZVQA 3K73O 1J8QA 4XGKA 4NPHA 2DFDA 3W9UA 2EQ5A 1CJUC 3QEMB 2JS7A 4DDMA 2MSLA 3EXG1 3KQSA 5DYYA 1WD5A 3VO2A 3TRKA 2YN0A 3O8NA 2VRBA 4Q9HA 3PT9A 4Q1AA 3GRFA 4RMJA 2CY0A 4JAVC 2IHZA 1T8SA 3DHNA 4Q3KA 2CD7A 4TT8A 1QTIA 4ZVSA 4BE4A 3TSAA 2F3PA 4MKFA 1G8KA 2ASVA 4Y2YA 1O8BA 4NBSA 2V7QA 3BWVA 3NYRA 3DMPA 3ZWBA 2G1UA 3D1LA 2Z1NA 3IP3A 3GZJA 1MC5A 2FETA 2P2LA 3PUHA 4IH1A 4R7TA 1DC8A 3L77A 4Q15A 4EVRA 4I8XA 5E8JA 3D02A 3LYLA 1JI0A 1R8JA 2GSWA 1GN9A 2OV3A 2PX0A 4AIIA 2BBTA 2WIKA 1UBSB 1PGOA 1YZHA 2A88A 2HSGA 3HJNA 1FXWF 2V7VA 5AW9A 3HTXA 3PC3A 4WADA 5JSUA 1T43A 2ZAGA 5LZ4A 1MGOA 1Y98A 2D8MA 2GZDA 3SC2B 3T6KA 4WKGA 1BWSA 2VIIA 2IX9A 4YV7A 2NXWA 2C8VA 3ZHXA 1N77A 4MA5A 4U7PB 2NSYA 3LWNA 3STHA 1RWPA 1G21A 1NW4A 2GXQA 3R5HA 1JBEA 3EVGA 3MQ2A 1G6HA 3RSOA 3FY4A 5CCEA 4BJ6A 6REQB 2O0JA 2P0EA 1QB8A 2WSMA 3G59A 3LX8A 5EXSA 4WLNA 1IM2A 1FFXA 4KXWA 5J47A 1E2MA 1PK8A 3E53A 3SBXA 3A4VA 2CCKA 4KQKA 3AFIA 3NIGB 5E0OA 5EPUA 3T3DA 4BNYA 4XYEA 3U6BA 5F51A 2I3BA 1RQRA 3WK5A 4EYKA 4QGSA 4J75A 4TXLA 2J08A 3DKRA 2IXFA 2ZRHA 4OD0A 3LWBA 3G2OA 4CN8A 5CFLA 4FWTA 2FDRA 1EWQA 4QL3A 1RVV1 2D2FA 1AV7A 3ZZ0A 1EBFA 1XHEA 5BUQA 2W6OA 1Q1GA 3WGKA 3W8RA 1DT5A 4ZOQI 4ESHA 4FCCA 3Q3IA 3R0VA 4HS9A 2O1WA 5I5GA 3LGXA 1GUDA 2ZPTX 2JZOA 3KJFA 3FMIA 3QXGA 4Q0MA 1LNZA 4UUQA 4BBJA 5HSGA 5KOIA 3THYB 4MIYA 2AX3A 2QLJA 3GLTA 4HDRA 4Y9RA 2HA7A 3ELDA 4RFSA 1GLNA 4DZZA 4QSMA 1WZ2A 1DUVG 1P5RA 2O19A 3WL4A 2DE0X 2HL6A 1QFSA 2FJ0A 3C24A 4MVJM 4EI7A 1IHUA 1WUHS 4GOND 1XDGA 2QTRA 2FZEA 1C0PA 2XNCA 4YAJA 2WWGA 4Z0PA 1YI8A 3PDIA 3IESA 4N5IX 2O8EA 4LHEA 5HCNA 3F5QA 3WRXC 2LGJA 2JK0A 4Z2AA 3ER9A 3QEAZ 3V9AA 3HM9A 3WRWA 3NHYA 4MV7A 2QF7A 4ZC8A 4LRWA 1OOEA 1SZJG 2ZJ6A 1E2UA 4BBZA 1B0ZA 2I2FA 3PR2B 1OILA 5IAGA 1QTNA 1KR2A 3KAKA 3VPGA 3ZVLA 2GF9A 1YA4A 1YZLA 3LQFA 1KSFX 3UUFA 3BXZA 1W4BA 1H0SA 3AUYA 4MS4B 2GN1A 2VYVA 1USKA 3BRWA 1SQFA 2C83A 3I8XA 1FRZA 3V7NA 1CZNA 4JR0A 1DO0A 4FNAA 4KQFA 4RHXA 2NXJA 5IN5A 4AWBA 4B3HA 2JGFA 4RC9A 4CMHA 1SHKA 2EKQA 1OC2A 1HEYA 1DAGA 2A9KA 4HAIA 4G0YA 4Y2HA 4YFYA 5CX1A 3UJ7A 4E1VA 3ODPA 1I1HA 1WSWA 3PFBA 1SULA 1V8ZA 5JE8A 4HCJA 4P34A 1HFWA 1RCTE 2E1PA 1XVVA 2QW1A 3OFKA 3KYCA 4GEKA 3ZBPA 2WAMA 5I48A 1Z68A 2GOYA 1QCCA 2J4CA 3BH7A 3CRQA 4GRAA 2JIDA 3SS7X 3WLPA 1XYGA 4DMRA 3OIVA 4ZCRA 2XB4A 3RI3A 1EK6A 2WR8A 3A4YA 1K88A 4KFUA 4DA6A 5C4MA 2J3IA 2W70A 5HIKA 2GXSA 3MS7A 5FWYB 1K0UA 3AK4A 3IE0A 3M1LA 3ACCA 4LNUA 3P96A 3KEMA 3BPSA 4OU4A 1XWIA 221PA 3I2IA 4LVOA 1UZLA 4YALA 2XCLA 2VJDA 4W5WA 4CM1A 2GUWA 4DDUA 3ZEIA 1SIUA 2CUNA 4IIBA 3CBQA 3NOQA 5DZSA 4ZT5A 2HBYA 3KDAA 3THWB 1IUKA 1RQ2A 1SXJB 2XNDA 1E3TA 4HQ6A 5DULA 3HJUA 5LQDA 1K7CA 3H87A 1H1DA 3UK7A 5ELMA 4RH1A 4U0KA 3P9ZA 3AO0B 3I6MA 5EJ2A 5EWLB 1E6EA 1HA3A 3P9CA 4LECA 5FPTA 4B83A 3I1JA 3FXAA 3INRA 3KYDA 3MCUA 3N0TA 4P4SA 1CUDA 3OCWA 4XYBA 5AJYA 1BXRB 1VLMA 4S12A 1CUJA 4LGYA 5DXJA 2P2SA 4V39A 1H65A 2P62A 5LZ8A 1V6SA 1I7PA 3M81A 4M0CA 3EZ2A 4R31A 5EINA 3BK1A 2ZYDA 4JLBA 1QHSA 2QA5A 3I61A 1HDOA 2H2WA 1L7VC 2VTDA 4OQXA 3BE8A 5GJWC 2HF2A 5TARA 4MIEA 3ISTA 4D8XA 4RPHA 1VJGA 5E1OA 3I28A 2PIDA 4KOAA 3Q6NA 2XQKA 1N3LA 1OFTA 1OROA 4NFHA 2EKBA 1IN4A 4HXYA 5D3MA 2WTAA 1RE1A 4IF6A 3ZY3A 1MVNA 3CMCO 1DBIA 2FMUA 3TQFA 3ASUA 3OCXA 1UPCA 3LQYA 3K16A 1P19A 1FOEB 3EXHC 5KNBA 5GAJA 3M6WA 5HBRA 2H2HA 2NO4A 3ZE6A 2WWXA 3RD5A 1CS0A 5I4CA 1CB7A 1HDRA 2PU5A 2I2WA 2ZQ5A 4EFLA 2WJVA 1CUEA 4ZAGA 2IVZA 3M5DA 2GEUA 4G0WA 1YQXA 3LO5A 5L51A 1P7YA 4M9ZA 2JG3A 1NR1A 1MO6A 2R0QC 2N46A 3ZQJA 1H5NA 3IHLA 2NPIA 2NO6A 4FI3C 4QTUB 5IT9A 1E3DA 4LOLA 4FILA 2XPCA 2C20A 3O2NA 3ZDXB 1YRYE 5CIQA 2WYUA 4RLQA 1BEZA 2YVKA 2CZQA 2W9XA 3Q9SA 4KE6A 3H2GA 4ZXPA 5IAJA 1E1RD 4NF2A 4ARZA 2YYZA 4DXDA 2VPIA 4NONA 1TO2E 4C5BA 4W5HA 4D9MA 1DBWA 2OSBA 5EGSA 4MW9A 4FSDA 1P0CA 2B5VA 4GAEA 4R9RA 1S4QA 4I1VA 3KZMA 1O9HA 3L0ZA 3O84A 4MB2A 4TVKA 1D9ZA 1MBZA 1UBCA 1DKUA 2XV1A 2Z2YA 4YCCA 3WSTA 4A8JC 1KK3A 2UZIR 1JBKA 3BHJA 1QLHA 3IELA 4M8KA 3T99A 4PRKA 2OOSA 4EGFA 1W0CA 5AKZA 2OCXA 4FHFA 4P35A 3HN7A 4D3FA 2GXUA 4F8EA 3KVVA 4I8IA 1T3LA 1U31A 3O94A 1H66A 3NNNA 2BHRA 1BS2A 1ZD3A 3PGA1 5EIWA 2AXQA 1QF7A 3EW9A 4PLWA 1V1MA 4ILKA 1XRNA 2GR9A 2G7ZA 3D0KA 1J4AA 3RUDA 1MXHA 4AZ0A 1SQGA 4JOQA 5C37A 1TA4A 3D3EA 4CLEA 5D3KA 3D6JA 1U28A 1R6BX 5HGJA 4R9NA 3V7FA 5E2BA 5ARCA 4EX6A 4X6YA 3L4BC 1DI0A 1E1MA 4CTOA 1Q84A 1JEAA 3UGKA 2IHTA 1DQYA 3ADPA 2JIZA 5GONB 1H1TA 4X3OA 1QZTA 4LE0A 3GJXC 4GMHA 4JJ8A 2Z5FA 5DU2A 1DBVO 2D7JA 4QGHA 5B36A 5JJLA 2H4XA 2HLNA 1FSGA 2XAUA 3DNMA 3R3VA 4LGVA 5T7BA 3JX9A 1RI3A 4TMTA 3HB5X 3OQNA 4QC2A 5KYWA 1XC7A 2L2QA 4TRNA 3KC2A 3MBIA 5AM3A 1J2RA 5JYCA 5EJ8A 4HGYA 2G4CA 4CGZA 1XD9A 1L5SA 4QGAA 1D2RA 2IYZA 3O4GA 4CLOA 3R4CA 5AK3A 4KPEC 4PR0A 3ZJYA 1PWZA 4F2DA 1HEUA 1DAIA 3T0IA 4ER6A 1P74A 1HPLA 5KYTA 3RROA 1OH8A 1HNNA 2HF8A 1YF3A 4NFSA 2ZAIA 1VA5A 3RH0A 2BFFA 3ORYA 3ITEA 4PZUA 4PZDA 4QVIA 5IF3A 3L40A 2LRHA 3PQCA 4OL0A 5TS3A 1NZDA 3DE2X 3GBSA 4UNRA 2J3KA 1L5KA 2VHYA 3KSZO 1W85A 2DQYA 3G1UA 1E1DA 4HNQA 5BSKA 5JAZA 4XEHA 2QU8A 4TZTA 4BLOA 2Q9AA 5BW5A 1LLQA 2HO4A 1KGSA 1OXSC 1N8NA 2I2DA 4UW9A 4FB5A 4FHGA 5DIFA 4NOMA 3BE5A 3ZGYA 2NO5A 4QOFA 3ZQ4A 3BIWA 4X20B 4KGVA 5JYEA 2P9FA 3LP6A 4NC9A 2EZ4A 5BN4A 4WEOA 1KOFA 1XG5A 1LK5A 4R51A 3TRFA 1PLJA 5AOAA 5A3VA 4NV1A 1A27A 1Z75A 4GU5A 3TCNA 4D43A 3U7FB 1UFVA 1QG0A 2H1IA 3EWNA 2A0FA 1LPAB 2GCNA 2JBAA 2NSLA 2WPDA 4MMZB 3IIKA 5FBWB 3CVOA 1ZK1A 1T9CA 2HWYA 3E7FA 3O8DA 4R8SA 1E1NA 1PFQA 1VB5A 3SPXA 1MO2A 4BCBA 5SZHB 3NFYA 2PZLA 1KHTA 3RLFA 2BTQB 2XZTA 1NN5A 1VHQA 2CLIB 2G8LA 2WKWA 3LXXA 4P3XA 3ROPA 1EWVA 3M6IA 1YB6A 4C0JA 2VYQA 3L8CA 3OIUA 4P7JA 1YS4A 3IP5A 4O4JA 1BVYF 1K3TA 5KJ6A 2VDMB 1MH9A 3HLTA 2IEZA 1VOTA 2O5VA 4MS3A 5EVJA 4U2BA 2HSDA 4QNNA 1W6RA 4R7GA 3HUDA 3L7JA 3EG9A 1WD7A 5AKKA 3UK2A 1NPTO 3WGZA 4DLLA 5K8LA 3E9NA 3PC7A 1WA5A 4GL2A 1U2RA 2C1XA 2AR0A 4H3SA 3UC9A 4A4DA 3V8VA 5KVAA 4PX2A 1M0WA 2HMWA 1M34E 3INYA 2DPLA 4P7BA 4Q66C 1A5AB 1RI5A 1T8WA 3D6MA 3PL1A 4QUGA 4GLJA 3RR2A 2BKVA 1GPWB 3JCZA 4G0PA 2CJWB 4BE7B 2BEWA 5K0LA 3AB7A 3R7BA 3I2JA 4EB8A 1EX7A 3L7YA 1RYYA 2E5FA 4ND2A 3HV2A 5F4ZA 3A31A 1XCLA 4RHEA 3CLUC 4GUDA 4ICIA 1P7VA 3N8DA 1G6OA 1LPPA 3A6ZA 3GLSA 3X2SA 3D54D 4TKVB 4K2AA 4FEGA 1IRXA 4H18A 3DDWA 1VE3A 4JL8A 4DMUB 3H9CA 1UIRA 1WOMA 1YMUA 4UTOA 4MVWA 3RANA 2W48A 5J2UF 1YQTA 3QBTA 5EG5A 2AK3A 2JFHA 1SCIA 3S28A 2C9YA 1C3JA 1QVVA 3C6ZA 2VNAA 3PRYA 3LQ2A 4N39A 1G5HA 1R00A 3NASA 1CU1A 1YJCA 4QEDA 4PO9A 4WJZA 5DM1A 2C5FA 1Q3HA 4JI5B 2AN9A 2LUOA 3OQMA 4A1FA 4BXOA 3QF7A 3VA7A 4TV8F 4A0FA 4EECA 2GPBA 1N9GA 4YACA 1NL3A 1L5LA 3VR4A 2V3CC 3D6AA 1AZWA 1PEDA 3SE0A 4O3FA 2X8AA 2DHCA 2XUQA 3ILHA 4J3JA 5KNDH 1E7QA 3BMXA 3PGLA 3DLBA 3UJNA 1HYQA 3JQBA 1CNEA 1J2YA 3OJ0A 4F9EA 1TOAA 4KAFA 4BB6A 3K09C 2F3SA 5E6SB 5FUBA 4TS4A 2B1GA 2I2AA 5IWCA 4YK7A 4EW3A 3E22B 5SY9A 4WASA 4EF5A 2EF0A 4CEJA 2OP1A 1D0VA 2WV7A 3IT0A 5DHAA 4N3BA 2ENUA 4OHRA 4PV7A 3BEDA 4OHKA 5H7XA 5JTUA 3VYWA 2D00A 2LKDA 3IVXA 1MABB 1VRWA 1TK2A 1VXRA 2F1OA 2GZ1A 2ZXEA 3GGDA 3PNKA 4INZA 1KR5A 2ZYVX 1UC8A 1IVNA 3BXPA 3HL0A 1PR2A 2F1HA 2MYUA 1G2PA 1C4OA 2VNJA 3HUUA 1QR6A 3N2ZB 5B2FA 1JU4A 2FHSA 2FNAA 3PCRB 4WOCA 3RSGA 5A6VA 1BMTA 3OH8A 3G0DA 2V4MA 2IYSA 2XQJA 3FG9A 4K2HA 4IXDA 1RYNA 4U2CA 3OOYA 3KPVA 4MVXA 1ZJWA 3DZKA 4ZICA 1O3YA 3JVIA 5TGTA 2Y0CA 4N48A 3QVJA 4HLDA 1FDUA 2ZBDA 4DEXA 2HZ7A 4IKOA 2XHEA 1Z37A 4MGZR 4F04A 1Z83A 3ESCA 4F2HA 4HNSA 4JKOA 3VR6H 5I4IA 1Y7IA 4BDTA 1CQIB 1KQOA 1YWGO 4HAYA 4HN4B 2OHIA 4QOHA 4DG5A 1Z5GA 4Q1FA 2R7NA 4CG1A 1B73A 3FSGD 2NPOA 2ZXFA 4PQYA 4JDPA 3ZH2A 2EG9A 3KOUA 3MYYA 4WKCA 4U6SA 2HFJA 3OWOA 2VRNA 3O2JA 4HEA1 4KTTE 5LB2A 4HSEA 1KYQA 3RPEA 2E5LB 4C07A 3DB2A 4C9BA 3N8HA 4GH5A 5CDHA 2CV1A 3R3ZA 2SBTA 1FTWA 5A5VA 3TZQA 1DRVA 5IK2A 2B36A 4RL6A 1SXIA 4URVR 4F56A 1AM4D 1FSSA 3AONB 2CDAA 4TV8B 2XMSA 1O95A 4D4HA 1TZJA 5JNUA 2LR0A 2PMDA 2PZKA 3PHGA 4ZCPA 2FPIA 1SUPA 4YXWA 4EA6A 2M9MA 1WM1A 2HF9A 3BORA 1EXMA 4YRJA 1U04A 4MQBA 3T7TA 1GPUA 4QPCA 4OBEA 1XLVA 4PN7A 3EXAA 1YUBA 3TZKA 4EG1A 1XZAA 1E2EA 3WK9A 4W9MC 4KX3A 1GY8A 1YR8A 3UXHA 2CXQA 2Q99A 4KQHA 3T1OA 1P2VA 3D0RA 2WZBA 1PR0A 3IEMA 5IJ9A 1F1BA 4RXMA 1NG1A 1H0KA 2XVMA 4BVBA 3KQWA 1BVHA 1BCRB 2HQ1A 3FGPA 3OD5A 1K9SA 4FFMA 4MLZA 5A5DA 4YJHA 2PBLA 3JQ9C 2QRZA 4S2UA 3ZHRA 4EG4A 5LQUA 3ENZA 1KZ6A 2XNKA 5FF9A 3EGXB 4DT1A 5H3LA 4S1TA 3R76A 5K01A 1FB5A 2A9QA 3WGJA 2C07A 1QU2A 1LJ8A 3CVVA 2IPAB 4BFWA 1S3GA 3ROGA 1C1HA 2OHVA 5ANRB 2JGEA 4V0OA 3H9GA 2Z5VA 3JWGA 2GBGA 4M83A 2B9EA 1DAOA 4FQ8A 1XF9A 1YB5A 2OLKA 4X8LA 2IH2A 4LQ4A 2XTJA 1HE5A 4IHQA 1PJLA 3FVVA 4HN2A 4OH7A 5ALQA 3OEYA 4UOQA 3KVNA 3MTAA 4JQCA 1IM8A 2OCAA 1TT5A 4RF4A 1CRLA 4BVJA 1HLDA 4I55A 4LWOA 3P0FA 4N0MA 2FZCA 4EB6B 4AYWA 4GOJA 1FF9A 1S2LA 3BMCB 3TZ6A 1MIHA 4UFOA 1X1RA 1RLOA 1S2NA 7AT1A 5L3QA 4BNUA 2W98A 1TTTA 4TLBA 1DIAA 4BWYA 3SX2A 3I2GA 2HLPA 3EUFA 1ZSYA 1G42A 2XYHA 3FKSD 1JECA 3NHBA 4JI7B 4C7OA 2UZ0A 4MDYA 3A0UA 2XQVA 3TB6A 2R8RA 5SYMA 4D3SA 5REQA 3SXUB 4KN8A 4QOSA 3MT0A 4AROA 4B7UA 4PPGA 1JQDA 1VG9B 3LIIA 1UMDA 1Z38A 3PNYA 1JT9A 1X7YB 4AKSA 1VL2A 1VE1A 4QYIA 2I6GA 1CJVC 1WSDA 2EG5A 2WU4A 1VL5A 4JP8A 4PG6A 4B79A 5KNCA 1RQLA 2EGUA 4X6XA 1L4EA 4RENA 3SOZA 2AG0A 1Z5ZA 2OHXA 4G5OA 1MJFA 1WDKA 1GTG1 3ZCUA 5CTAA 3JYQA 4RHUA 3K5PA 1MAWA 2FR8C 2JEZA 1EFVA 1I3OA 3RV3A 1TCUA 2CNOA 3KB6A 2FWBA 1D6SA 3KELA 5ENDA 4FGUA 4F5ZA 5E4TA 3JYHA 2C2GA 4XXHA 2YJ6A 4DIOA 1NXTA 1R9JA 4Q1EA 5AM1A 3TLJA 3PQ7A 3EZ9A 4MGYR 5CDSA 1A9XA 1L9XA 1LNQA 1TYCA 1U2PA 4KDRA 4ZYTA 5LDDC 4ZVTA 3OU2A 4DUPA 2B25A 2DXIA 1RQ7A 1QKKA 4C2TA 1JEEA 3CC8A 1XPOA 3L6OO 4XSVA 1KDYA 3MPUA 3I30X 4CLRB 3UKOA 2FMTA 4C78A 1CZKA 1UOQA 3LE8A 1ZJ6A 3CWZA 3OT4A 1Z0DA 4GLFA 3NTQA 1Y6QA 2EJWA 4ZAWA 1FRNA 1IB0A 3CEPB 5LIRA 2OVBA 1Q2UA 2YXNA 3BMQA 5IRCD 2QBYB 4E07A 1US8A 2V55B 1O8CA 3EIXA 1YAJA 3ZUPA 2HPHA 4J0DA 5E9JA 2QGZA 4C06A 1C9NA 4LS3A 2VZ8A 4OFZA 3RAPR 4LW8A 4CYMA 3HYLA 2MSEB 4MUMA 3A6DA 4J7CA 4HNAB 1MJNA 2D59A 4JD5A 5LXTA 1KMHA 3JQ8A 2DUWA 2GEDA 3SGLA 3GGJA 4OAPA 4LJSA 4I8DA 2DQKA 1XJ5A 2Q45A 4MEBA 3K0CC 4PIVA 2ZSKA 1B00A 2P6OA 1JTEA 4A8PA 1F0KA 2FPLA 3GZNA 4RAOA 3ZZ1A 3UPUA 2F90A 2TRSB 1PS0A 4CMGA 5FDFA 1I3NA 1NHGA 5ALEA 3WDKA 3F5DA 4DANA 1EFHA 3C3JA 1M8JA 4FYWA 5BOSB 1UBJS 2XKBA 5C51B 1VDMA 3VAZA 1JH8A 1VYUA 1Y5IA 2PGAA 4RTPA 1FU8A 4UQPA 2ZTLA 2BSXA 3RC7A 2B8NA 2PSHA 4RY2A 3ENVA 2ZUVA 4D74A 1N5RA 2FEOA 4QPNA 2WF7A 3FRHA 3RHZA 5IK2D 1VKOA 4KDFA 1TUIA 1KRWA 3KSDO 4L75A 4UD2A 2QI9F 3OJCA 4CNBA 1N1GA 4CHTA 5JROA 3EWAA 4MSUA 1IPEA 1FFEA 2HH9A 5TIIA 2PLFA 1AH2A 1VP3A 1NXXA 1Z16A 8GPBA 1D3AA 2P35A 5FUMA 1EWYA 2Z6VA 4RQUA 2F64A 5IP5A 4ZDIA 4JXKA 2JJ2A 1VLQA 1QLJA 5GPBA 2QOEA 3MLBA 5AVZA 2W6ZA 3RT1A 5IBPA 3TFQA 3NJ8A 1JKJB 4Q16A 3CWCA 3ZDDA 1YR9A 4Z0NA 4AAYA 3ESZA 4QU5A 1OFHA 4II7A 4P32A 4N03A 4OJMX 3ZWXA 3RFXA 1E2JA 4D0LB 3U48A 2HNBA 3C7KA 3KETA 1QSGA 1PNOA 4BRZA 1DX9A 3GJ5A 2NT3A 2NG1A 4PTLA 5IJXA 2KWIA 3M3DA 4AJLA 2Q62A 1O4VA 4G0MA 3FETA 4KXVA 5LQSA 3DW3X 3AF0A 3ZLJA 1BAPA 3QELB 3AUFA 4D25A 2DWQA 3PXGA 1GZUA 4H0FA 1R0LA 1ZMBA 5EEHA 5HQ3B 1QFZA 5IKPA 2CBZA 2BH2A 2WSIA 1JBQA 3CXRA 3RRJA 3DVAA 3FMPB 3PRJA 4KTVE 4Y1EA 4DY4A 2QQFA 3MRXA 4ENRA 4HZUB 1JFTA 2OCDA 2FPGA 2FN8A 2NM0A 3KTFA 4NBWA 1LSOA 2ZR7A 3DQPA 3RVSA 4R6XA 5D5HA 1MQ9A 4US0R 3FB4A 5TEWA 5AW8A 3OEWA 1Q6ZA 3GEEA 4FGLA 3CRZA 1QNLA 1BQ3A 1RXCA 2J31A 2Y0PA 2ZSDA 1JW9B 4URFA 1VL1A 4GYWA 1GT6A 1Y0BA 1SBCA 1Y9AA 2BGTA 2V0CA 3CKMA 3F4BA 2EERA 3CTMA 4IDAA 4GLBA 2F43B 1E5LA 2SKDA 3AEUB 4KPUB 1J39A 3OA0A 4QPPA 5F73A 3AB8A 3WBFA 2HXGA 2WKRA 1M3SA 1ZZEA 3MAAC 2G08A 3I32A 4O4LF 3IDAA 4J0EA 2X3UA 3MD9A 1UBGA 3L5KA 4JHLA 2ECFA 2R60A 2DHEA 3QUTA 2V6MA 2OV2A 5DSTA 1EU1A 1U9IA 5GZ3A 3WGUA 2BBSA 2H6EA 3ZEAA 4PBRA 2VR1A 2RAPA 3X43A 2JIQA 2QSJA 3AHCA 4Q3CA 5BVHB 3PXEA 5LC1A 2QZJA 3WGLA 3MIZA 5JS2A 1DCKA 1CZRA 2ODBA 3D8BA 4NS1A 3U81A 2YZMA 3HKDB 3JALB 1TZ2A 3Q5DA 2XDQB 1JPNA 5HX7A 2ZTSA 1IXKA 1P6XA 1FE8A 3QXHA 3OE7D 2NNWB 2HHHB 2OO5C 3K6RA 1J90A 3TNLA 3F3KA 3TGWA 2XB9A 5M29A 4GDMA 2I87A 4YRBA 1E4EA 2WSSA 4E4YA 5FEUA 4WQMA 4TKZA 1ST2A 4R9SA 4DLAA 3I2HA 1QAMA 4TRRA 4UZFA 3DYBA 4OGWA 2VOJA 3O31A 1KEUA 4YECA 5K8TA 3FF1A 1B74A 2O5EA 5B3KA 3G5LA 4XAQA 1DL5A 1U3WA 3TTXA 4YTEA 3GELA 4A1OA 2X7JA 2C5SA 2Q3CA 4EGSA 3QXSA 1LDEA 1WV0A 3V7UA 2FV8A 2XT0A 1R8XA 2ZSFA 3SEFA 1RD4A 4N0DA 1NW9B 2GPAA 1QQ5A 4OHVA 4CCYB 3L7DA 2W2TA 4JJ7A 3E5NA 5E3HA 3VKFA 2AUMA 4NV3A 2PHZA 3NV7A 4TLLB 2IS2A 3PNMA 2JAPA 3MWJA 5KWVA 3DFKA 2P1DA 3EDOA 2EFCB 3ZK9A 4X6LA 2R8ZA 4HQKA 2P9BA 2PDAA 3FUVA 2H7VA 1H9AA 3TB4A 4PYOA 4M9SA 1UWCA 4O4LB 5TR9A 3H2IA 4P33A 3O74A 3FOZA 1M2JA 1QC5B 4W1QA 4LZOA 3KWLA 4HEA6 1MD9A 4IRMA 1SCUB 4OHBA 4HLUA 4LY9A 4AFNA 3E61A 5DCYA 2NUAA 1P2SA 1U8EA 3VR3A 4ZEOA 1K7SN 1UMCB 1RLMA 2PKWA 2VXOA 3KSUA 1XJQA 4P5DA 4PYQA 3WHIA 3BCSA 2OO3A 2QP9X 3SHWA 3WKBA 4S24A 5EL0A 1HX7A 1H8EA 1M1NB 2TMKA 1CUZA 3GFPA 4MGHA 3AUXA 3QE4A 1T3ZA 4NENB 3K15A 1CJCA 1NULA 2WFMA 5B1YA 4MLPA 1JNYA 3OPYB 3U7QB 1C8BA 3RIGA 4O2BF 2P41A 2CXRA 1RI1A 4ZI7A 3AKYA 3ODGA 1E79D 4FE3A 1X92A 1QYDA 3WIBA 1F0PA 3S5JA 3DFIA 4MDEA 2ZJ0A 3T1QA 1ZAKA 2HDNB 3SYMA 4ZMBA 3HGQA 3MCVA 1K6IA 1ZR2A 3G2PA 2YWJA 4R9UC 4WN9B 1NVMB 3LXUX 1R4NA 1H2ZA 4D2IA 3HGTA 4DLYA 1V5EA 4ZT2A 4JZKA 1ZNXA 4UATA 3EVZA 2OYSA 4H7HA 5DHFA 3RT9A 4J0HA 1K5PA 4M4SA 4XOIA 2IX3A 1YVRA 3Q9NA 3SSOA 3EFOA 1UADA 3MJ4A 3VAAA 3CW9A 4CQMA 2OGTA 5LDHA 2O54A 1QO9A 2E4XA 3ICOA 3PKIA 1MGPA 3BXFA 3EMDA 5B4UA 1Y4DE 3HU3A 1U11A 4REQA 1FDWA 2Y68A 5TQJA 3T1NA 3DP9A 3RCBA 5GZ6A 4X54A 2JANA 3HM2A 3PT5A 3AJAA 3RSHA 2XRYA 1XROA 3VX3A 1C4KA 1JX6A 1KY3A 2XR1A 1I5RA 3ANNA 3ECAA 4ENTA 1YQDA 3NC0C 3KSMA 1Z6XA 3FDJA 4MV1A 5K6RA 1EFPA 2XOEA 4DMGA 1U0OC 2Z1MA 3A2KA 1QNFA 2Z43A 1EUZA 4BKQA 3TBHA 2XYPA 4KI7A 2IZ5A 1KEWA 2D5BA 1CYDA 5CFZA 3C6KA 1U81A 2OM2A 3GARA 3OESA 5CVTA 3BYZA 2UXBB 4TT3A 1KO7A 1Z4JA 2RI0A 4NIMA 2NX2A 4YT2A 2HIGA 3T7JA 3TFOA 3TKYA 4WACA 4GKJB 1F4VA 1PT7A 1BZYA 4J16C 2OA0A 5KQPA 1CVRA 4FLEA 2WIFA 1ZH0A 3B51X 3PFNA 5KVCA 2GEBA 2AK2A 3KU4A 4FJ0A 1W7AA 2H54A 5DYTA 4DZRA 1FTGA 1EIZA 3FCAA 4NATA 4BIMA 1OT3A 4EHIA 1UZMA 1NQ5A 3UTDA 3ITDA 5DCWA 3DBRB 5BYJA 5I7RA 2C1EA 3H9QA 3B6EA 5FUWA 4O2BB 1F9EA 4CMKA 5JARA 1ISGA 1BSVA 2GK7A 2RSLA 5ILGA 1DXHA 3SDBA 2B8WA 4JYMA 4RETA 4GZ3A 3GNTA 2P4HX 3QHPA 1C7FA 3ESRA 2FPXA 2ZE5A 4YT8A 1JHRA 2F8LA 3RNOA 1VTKA 4B6PA 3A9SA 3HDGA 4R4JA 5JADA 2J32A 4CIWA 2DPHA 4RHFA 4Y67A 5ITZA 1SIWA 4RLSA 2EWWA 1DOHA 3UCFA 1FLVA 3QTLA 5DE3A 4FOOA 3OPNA 2POQX 4MKHA 5JVDA 1JDUA 2GKSA 3B2NA 4QVGA 4ZVMA 1DPGA 2WZDA 4ILEA 3RB8A 5JTTA 4N0EA 2QE7A 5C7LO 3KR1A 3MINB 4AF6A 4A2QA 3TZBA 2Q8NA 3AJ9A 1K9VF 3FSJX 1CERA 3OZGA 4IEEA 3WWCA 3IAAA 4ITRC 3U4GA 3GJ0A 2ZREA 4ZODA 3QIAA 2IS6A 3VFDA 2XRZA 3KQKA 1UOPA 3LGAA 3IXMA 1DWPA 4XGRA 2D0IA 2RIPA 4RYDA 4MRSA 3PC8C 1P9RA 3N87A 3M9WA 2JI8A 3UT0A 4ESEA 2JD0A 3WA6A 2Y6UA 3PWTA 2FMXA 1VPLA 2ZRPA 3G7NA 4HDKB 3RV4A 1Z8HA 1XTJA 4CMJA 1U0JA 4FWBA 4MWEA 5AVXA 1N5IA 1Y5RA 3G89A 1UMBB 2ZT6A 3JSAA 4O4JF 5IJZA 1DV1A 1H69A 1MF7A 1A5BB 1JUDA 2F67A 4WA7A 3LNTA 1ZHFA 2J6CA 1PD1A 4Y9DA 3Q7IA 2AD1A 2C9MA 1G9XA 2P69A 3KCNA 2J46A 4MQ4A 1CRWG 3KQPA 1NMQA 1A7AA 2PRZA 4UNQA 3M70A 1NIJA 2GYYA 1N1EA 3ZLTA 2JJ8A 3LXRA 2I91A 3H4IA 4K8OA 5LP6F 2VHUA 4G2TA 4P53A 3M6FA 4UEWA 3TRDA 5A4AA 1VSUA 3X1DA 1A98A 1DJPA 1ODFA 5BWOA 2UU9B 5K6AA 1T36A 1XZHA 3QWFA 4HDNB 1TLLA 4UUNA 5HFAA 5T8KA 2CLEB 3SK0A 1Y37A 4PNEA 4YJFA 4YMVA 2ABWA 2FZ5A 3DWIA 4LHXA 3BFPA 5I9NA 2NSJA 5IVKA 1FNNA 1V4VA 2BI8A 2RC5A 1V6CA 4F7WA 3W5AA 2X42A 3AEXA 4QT0A 4P7GA 3ZI7A 3P9SA 1NURA 4A6PA 3SLKA 1BKYA 1JR4A 1L3BA 3FHCB 3DEAA 1QOQB 4LOAA 3WKDA 3UUEA 3KOMA 3V46A 1UKZA 4RJJA 3QWIA 4RA9A 5B1EA 1RRPA 2GYVA 5EJ4A 2I65A 2BEKA 2ISCA 3DT6A 4YI3A 5B7QA 3MVEA 1BH2A 1W59A 5A6SA 4MP6A 5CURA 2GS9A 2MYNA 2BFBB 4XTCS 5DTJA 3UMSA 3LMKA 1RI2A 3ZGVA 4ZT4A 2JFFA 2WHPA 5A9TA 3LLSA 2H17A 4KMSA 4IVQA 3F71A 1QONA 4RGVA 3CFYA 3K6JA 3NNSA 4NG5A 1YNOA 4K9PA 3R7LA 1IZZA 3AIIA 3B3GA 3A32A 5I4KA 3HJAA 2ZCUA 1B42A 1M75A 1CZUA 2CLSA 4C0QC 1TZMA 2ZATA 4TYQA 4BLTA 1NJ8A 3MD0A 2NO9A 2V0NA 3GIWA 1CUUA 1WO8A 2OK8A 3P8ZA 4Y2GA 1Z8FA 3IPAA 4AL4A 4COKA 2NXNA 1IY9A 2ZIUB 4F3CA 4IZOA 5F2EA 4CM8A 1QQ7A 2W6JA 5IBRA 2C3UA 3RWMB 2JCVA 3C1UA 1MAAA 2R1TA 3IEIA 1B1AA 5AVKA 3TSWA 1ECJA 1TYBE 4C7JA 5JS6A 5JXHA 1FW6A 1D2EA 5E1DA 1GOTA 1CJSA 4JWKA 3RU2A 1ZRHA 3LD9A 1JKMA 3HJFA 1MCZA 4QU9A 1KRHA 1ZGAA 1D6MA 1JG4A 4XB6B 1ICIA 5JXJA 1LS6A 2QP4A 3G23A 4XD2A 1NVKA 1FXUA 2CVZA 1Z2NX 2JLAA 1CY2A 4OA8A 4F60A 4YMLA 2OY0A 2HHLA 2FR1A 2Q21A 4UCFA 2NACA 5LP6B 4EBBA 2X0DA 5DX8A 4LOKA 3G9UA 3ZGXA 1Z0IA 4NXNB 4DARA 1K06A 4LXXA 3COPA 2BVNA 3GC6A 4ES6A 5JC8A 1UPAA 3WRYA 1RBZA 2GF2A 3VZRA 1XZNA 4OUDA 2WU3A 3UK6A 4PN3A 1D4OA 2FUKA 5HOQA 2IT1A 3USZA 1Z12A 3QLTA 1ORIA 3OEEA 1W9MA 1SUCA 2XUDA 5DLYA 4ZAZA 1N2JA 2TS1A 4BMNA 2R7KA 1T9BA 1UMKA 2O2XA 3V8RA 1QV7A 4QTXA 5KU7A 1EJ2A 4TL8A 3TVYA 1ZUWA 3HO6A 3M6LA 1RTKA 4WLEA 4C04A 3DJYA 1PNVA 3A36A 2JLZA 5A5EA 2DECA 4YGXB 3FNFA 2O2CA 4QQ8A 4U9IS 1R3UA 4PW0A 3TO5A 4Z7NB 2WKQA 3WI7A 4YIHA 4E5MA 2R84A 3UF0A 3DOCA 4MDHA 1G66A 5JT1A 4LJ5A 5H9WA 3IMKA 1CRZA 1JEJA 1KI1A 1O5TA 3OX4A 4LRTB 3KVRA 2X3FA 4J49A 1ULZA 1SVUA 1ZN9A 4JJZA 2R3SA 4LNAA 4QXPA 4ZQBA 4C5CA 1IVSA 1SHJA 2GM4A 3AZPA 3IO3A 1P2FA 4EF6A 3V42A 1NBME 4I4CA 1UJNA 5JANA 1RYEA 1RC0A 3ONWA 1GIAA 1JQBA 1XV5A 3IS3A 3E81A 4JUCA 2VCHA 1C3VA 3QZUA 1WCXA 2VDRB 1PT8A 3KJGA 3S3TA 2ONYA 1KQPA 4JI8B 2RHBA 3R74A 3IPRA 5I7OA 5A03A 3IE1A 3PUIA 1K3FA 1PCXA 3DP7A 3DTVD 4B7ZA 4PHFA 4MCJA 2EU8A 2PT7A 2XUGA 3R0QA 5EEGA 2GCGA 3O4IA 3OFJA 3PGMA 3VR1A 2GBIA 2ZVJA 2ZRBA 4HN9A 5FL7A 1ANKA 3LC7O 4UEOA 3GFRA 3QPVA 3G5TA 4QARA 4H1UA 1QP0A 2A9RA 5CEJA 3PIDA 2YNMA 5C8DA 1DJNA 4N3AA 5CBKA 3KXLA 3OCVA 4MW4A 5KVQA 2H8KA 5EPOA 5LUAA 4G63A 1A7JA 1M7HA 1NNSA 1XNHA 2QLTA 3LZ6A 4OXXA 3KJXA 1ZW1A 3N2EA 2FPPB 3UJPA 3HXQA 5JCOC 5G1PA 1ENZA 1KERA 2XWSA 4NK5A 2H06A 2JZNA 2BDTA 2OYRA 2B5WA 3ZR4B 1NQOA 3D7KA 3IUMA 4G0QA 3NBAA 2R8XA 1P17A 2AC2A 2FMHA 2WTEA 4KWTA 2GEVA 4LXTA 4KYVA 1PX2A 5JSKA 2P0AA 1AIPA 5L3SA 1GVHA 3KYJB 1X39A 3OZAA 5FTJA 4M21A 1JQAA 1DC7A 2WWIA 3NTLA 1RRKA 4LOHA 4BX0A 4JDUA 2V1UA 3UWOA 1JMVA 2Q5IA 1V26A 1GARA 1P9OA 2Y93A 3QA9A 3SC6A 4WBNA 3NS7A 4MW7A 3CLUD 3FGNA 2JF0A 4W99A 4A8TA 3KKQA 1BDMA 3KOOA 3K2EA 4I1PA 3OQVA 2QQEA 5JR3A 1ZKDA 2HPZA 3QBDA 4GOXA 4MRVA 5JISA 4KO8A 4AJPA 3V7WA 2C4VA 3ZUGA 3CLVA 1IIBA 3GGPA 4JLMA 1T26A 5EMJA 3UT5B 4RF2A 4F97A 4AS2A 1WW2A 4Z53A 3C3DA 4GICA 4G0ZA 3P9PA 4NNOA 4QYXA 3EZ6A 2JH3A 5AK6A 4LGMA 5ALNA 3VPHA 4IIJB 5HUJA 4YUWA 1KZHA 2BGRA 4DV1B 1RIFA 3JD2A 4HRVA 4XRRA 3RM3A 4IF4A 3ILSA 1RKBA 1TVMA 1WVIA 2BJWA 1K0FA 1D1PA 4YT4A 1A4IA 1CB0A 4OFBA 3JARB 3ZWDA 4AURA 4CL0A 3BIJA 2XTNA 3HY6A 1CUGA 2ZRLA 13PKA 2AEFA 4ZKDA 4FEEA 4X9XA 1QOPB 4G89A 4JWTA 1BEEA 3HVJA 1RMTA 5KI6A 2WZCA 3KLNA 4MVJE 2TSYB 1XI2A 3PVZA 2YX1A 1EDDA 1OR8A 2VLIA 4JITA 2VJNA 1ZITA 2FPKA 2HQBA 4HGOA 4ZO6A 2IYUA 2HMVA 4HUQB 2VQSA 2GZMA 2D13A 3ZLVA 4FX5A 3IOBA 4BNJA 1IJFA 2QDKA 4OEHA 1KOGA 3B5JA 4LBWA 4YAGA 1DZ3A 3EXEB 5L45A 1BCSB 2VXCA 1AK9A 4MW1A 4LYEA 3RG2A 1PDOA 1TUGA 3SFZA 3SR3A 3N5KA 4BUZA 5ADWA 5KNLA 4KJXA 2OGZA 3FYTA 1H5QA 3AUSA 4IMRA 3QPWA 4X7BA 5ILQA 3B82A 4RK7A 3C5WP 3P0EA 1L5FA 1UM8A 1TM1E 2ZJFA 4D3YA 3KQYA 2OXTA 5TE9A 2HTEA 4BV3A 1QH1A 1DKOA 3EVAA 1X7HA 3HXKA 2ZROA 4B7AA 2DFVA 2QU7A 4HTAA 4JC4A 2PG3A 3GRKA 4G5FA 2B20A 4RZSA 1GNPA 5JLJA 1TMKA 2P4QA 1TC1A 3H2ZA 4IJMA 4KUHA 4P4LA 2QZ9A 4TMKA 4GI5A 2HAEA 1DAFA 1X7GA 4H2DA 4MIKA 4Q48A 4RELA 4WXYB 3TOCA 1ISRA 4LXUA 4M7PA 2FOLA 2R8EA 2P65A 4BYMA 5JSZA 2OCIA 3DPSA 3L06A 2QRVB 3L8DA 2WYIA 4N01A 1Q7TA 4OXIA 5IDXA 4OXYA 4TSKA 3DDHA 3QXXA 3VVMA 3K72B 5KJCA 4NE7A 1GKIA 3GLFB 3UAWA 4RABA 1G60A 2G17A 2YKGA 3LHIA 1ODKA 3EMKA 4LMAA 4MO2A 1E4OA 1J97A 1W5TA 1PV1A 1OXUA 5AI0A 1R0CA 1J07A 1O7JA 1ZMOA 4N8EA 1GO2A 2NTNA 1L1EA 5FWXA 4YDHB 4GE3A 4DV5B 2J5RA 2H4JA 4OM7A 1Y9ZA 1O6GA 3Q2IA 5M2QA 3U40A 3OKCA 4ZAVA 1CQXA 1J0CA 2VF7A 4MUBA 3TLZA 4B4VA 1Q91A 6Q21A 1ML4A 2DUMA 1T4GA 2G82A 5BMVA 3U7RA 4H6XA 1PGNA 3N6RA 5BQ5A 5IBCA 2ZE7A 3HA2A 1RJDA 4WTOA 5BSFA 1ZU5A 2W4QA 3FNBA 3FYUA 4JJAA 1ZUIA 4EZEA 3FOFC 4ASUD 1C3OB 4YQYA 3B1KA 1Z6PA 2XUOA 1G19A 2IHUA 1KFEB 3A1VA 3M9XA 3EULA 4HOYA 1BOFA 4LQCA 1CUSA 3CKYA 4R1PA 3R7NA 2F7SA 2N1BA 4O2AA 4QIHA 3AG6A 4GWGA 1NSFA 3OPYI 3GRAA 1E1QA 3SG0A 1P7CA 3MJHA 3ZWOA 1U94A 4QOJA 1E9DA 1Q20A 5KSWB 1T0JB 1DUIA 1Y5LA 1OYWA 4BAZA 3B53X 3UHPA 1J1IA 2DU8A 1VFPA 1I6WA 1MX9A 1QHHA 1CIVA 3DOHA 4EEKA 5AVTA 3EWIA 4K05A 3UMCA 3DWGA 3TQCA 2XMGA 4YRMA 2CW5A 3LYAA 4FDVA 4GW3A 1Y33E 3ML1A 4G41A 5TNXA 4J3NA 3UOAB 1IZ8A 2GLUA 5FO0A 2YZGA 4RV4A 5DGIA 3L0IB 5BWMA 1L4HA 1X1CA 1L5QA 4DSTA 1M6VA 3IRVA 2OHHA 2O1EA 3HVRA 5GY7A 4PLVA 1JG2A 2WRZA 3CZMA 3L5OA 3N6VA 4MUIA 1H0RA 4X8HA 5E95A 3YASA 1XF1A 3MMNA 4FMCF 2O6HA 2ZVQX 3RS2A 2HQSA 2P4SA 4O3MA 4CL3A 4H15A 1UPTA 2J30A 2VK1A 4LRQA 1QX3A 4ZO7A 1VJ5A 5KSYA 3STVA 2G63A 4XUGB 4L9WA 2IUUA 3SKVA 2Y27A 3RRYA 3ZIUA 3E3AA 3V4OA 3I0ZA 4B45A 1UEXC 4BC0A 1M8PA 4BP8A 3ZNNA 2Y4OA 3SNHA 4GE0A 1SPBS 3BG5A 4NBNA 5BR4A 2XDYA 3JZIA 4M1MA 1OWOA 5BW4A 1KI6A 5GJBA 3O3MB 4OOEA 1J21A 2CDBA 4OXKA 4INPA 3E9CA 4IX1A 4QBFA 1YCDA 1XKLA 1EVZA 1XWFA 3GFVA 2FCRA 2Q5LA 3WYNA 1DTEA 3MOIA 1C3EA 1NUTA 1GLGA 2Q0QA 5B57C 1SOVA 5ERXA 2IY7A 4BCCA 4Q02A 4XIFA 4Q1DA 4G4SP 1W47A 3EPHA 2PMCA 2I80A 3C3CA 2JKYA 2NADA 4FC7A 4TL9A 1RYZA 1VGVA 3CJQA 1V2GA 1BFKA 3H19A 2UUCB 1RWKA 3MWEB 3I9V1 1XCJA 3VV2A 1NJ1A </