2QY6A

Crystal structure of the n-terminal domain of upf0209 protein yfck from escherichia coli o157:h7
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
246
structure length
244
Chain Sequence
SLKHYSIQPANLEFNAEGTPVSRDFDDVYFSNDNGLEETRYVFLGGNQLEARFPEHPHPLFVVAESGFGTGLNFLTLWQAFDQFREAHPQAQLQRLHFISFEKFPLTRADLALAHQHWPELAPWAEQLQAQWPMPLPGCHRLLLDRVTLDLWFGDINELISQLDDSLNQKVDAWFLDGFAPAKNPDMWTQNLFNAMARLARPGGTLATFTSAGFVRRGLQEAGFTMQKRKGFGRKREMLCGVME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords UPF0209 protein yfcK
publication title Crystal structure of the N-terminal domain of UPF0209 protein yfcK from Escherichia coli O157:H7.
rcsb
source organism Escherichia coli
total genus 89
structure length 244
sequence length 246
chains with identical sequence B
ec nomenclature ec 2.1.1.61: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase.
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05430 Methyltransf_30 S-adenosyl-L-methionine-dependent methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2qy6A01
2AN3A 1IXKA 2FK7A 2B78A 4FSDA 2BZGA 2BM8A 3A25A 3FUUA 2EG5A 5GM1A 3G89A 2PLWA 5B1SA 3WSTA 3LDGA 5HIKA 2NXNA 1ZQ9A 1ZG3A 3KR2A 1EIZA 4HTFB 3VSEA 1DCTA 1XCLA 2AN4A 2GLUA 1L9KA 2VDUE 3B89A 3MTIA 3NJRA 5C1IA 5T67A 1JQEA 5ICEA 1KIAA 2ZTHA 3R6TA 4LWOA 2WA2A 5E2BA 4C07A 4AZTA 1VP9A 2FCAA 3P9NA 3Q7EA 1FPQA 4R6WA 3VC1A 4PGHA 1VE3A 3QOXA 3BWBA 4ISCA 3DXYA 4DMGA 1X1BA 5E8JA 3BKXA 4WXHA 2ZWAA 3P9CA 4KRGA 5FHRA 2PSSA 4R8RA 4QDKA 5C9ZA 3O4FA 3I5UA 3OPNA 4AZWA 4E70A 1M0EA 1IM8A 1MHTA 2PXCA 4QQNA 2P1DA 2QRVB 3UJ9A 3P2IA 1O9HA 3SSNA 3TQSA 3UJ7A 3E8SA 3FYDA 2QM3A 5CVDA 3A27A 2YTZA 4BLVA 1NW3A 3SSOA 5EKUA 5K0GA 4IV0A 4PYLA 4RVHA 4RYLA 5EEHA 2QRVA 3EVAA 4AUKA 4AZVA 2Y1XA 5LQJA 3SR4A 3G2PA 3E7PA 3HP7A 5DTMA 5K0NA 2JH8A 3P9KA 2CKDA 1OR8A 4RVFA 2IH5A 3M33A 1KR5A 2NP7A 1RJDA 3GWZA 4AZSA 4GQBA 3ORHA 5FQOA 3G8BA 2Z6UA 2V74B 2G70A 4GBED 2NP6A 3IYLW 2OB2A 3P97A 1JTEA 2B9EA 2ZSUA 4QVGA 3UJBA 1WZNA 3M6UA 2B25A 1XDZA 5EZSA 3KPUA 2ZIEA 2CMHA 3SM3A 4YV0A 4MIKA 2ZZKA 4ER6A 3P2EA 2PT9A 3JWGA 1XDUA 4R05A 5CVJA 1L3CA 4RWZA 5ICCA 3OU7A 2AOUA 3L8DA 5DRTA 3CGGA 5EMJA 2ZZMA 2PXAA 3DR5A 4IWNA 4RTOA 2I62A 1EAMA 2ONZA 3EMDA 4L7VA 4LG1A 3UJAA 3CBGA 1KPGA 1X1CA 2YXLA 3UJCA 1FJXA 4DCGA 3HCCA 4DCMA 1AV6A 5LR6A 2JHCA 3HCEA 3OE4A 4CTKA 3NWBA 1ZGAA 3M70A 1AQJA 3ER8A 2PV0A 5MHTA 1P39A 4OBXA 4F85A 4MHTA 5EZQA 3FPFA 2ZLBA 4CKEA 5K0LA 3BWYA 4GEKA 3NW9A 5KVAA 5JR3A 2O0LA 3GU3A 5K0EA 2IBSA 4PIMA 5E1OA 3R3HA 3E23A 1Z3CA 2JG3A 3D2LA 5GIPE 3MCTA 4IKPA 3TLJA 3PFHA 3HVHA 3MHTA 4RTKA 4DA4A 3MERA 5T64A 5LQKA 3CKKA 3KQMA 3VC2A 4YV1A 4V0QA 3KQYA 3B3JA 3G5LA 5EIWA 2O06A 4PIPA 1YB2A 4C06A 4YUXA 3KR9A 2PX2A 3GRZA 4B17A 4C4AA 1QANA 2CMGA 4M7RA 4M36A 4P7FA 5JUWA 2PKWA 2G71A 3M6VA 1QYRA 3DLCA 3FUVA 3KPJA 4KIFA 4ZTBA 3UZUA 4CWAA 1SUSA 1DL5A 3SGLA 2HR1A 5FQNA 3RW9A 2UZ4A 10MHA 2OKCA 4E31A 3HCAA 3MTEA 5K05A 2I7CA 2EX4A 4KDRA 2IDKA 2JHPA 3OCJA 3MGGA 3OU6A 4RTQA 1JQDA 3DMFA 1KP9A 2ZBQA 3A7DA 3CCFA 3C3PA 3EVDA 3KPWA 3NWEA 3R24A 4XUEA 4JXJA 3TRKA 2ZWVA 3I58A 1SQGA 3FPGA 1SQFA 4CKCA 2UYCA 5E9JA 3A7EA 1RI4A 5CVEA 5U4XA 3PVCA 1VBFA 2AOTB 3AY0A 4BP1A 4DF3A 1FP2A 4P7KA 2C7OA 4PYOA 1HNNA 5E1MA 1NW5A 3A26A 3FZGA 4YMGA 1XCJA 4P58A 4P7JA 3HM2A 1B42A 3EGIA 3LCVB 3MB5A 4HGYA 3THSA 1WXXA 2FK8A 1XTPA 4EKGA 1UIRA 2FHPA 3PX3A 4GC5A 4RTPA 5KQSA 2ORED 5CVVA 1T43A 1TW3A 1JG2A 3DULA 3EPPA 3ELDA 1JG4A 4QTUB 2UYQA 3TR6A 5E9QA 4C04A 3ERCA 1WS6A 1G8AA 3CJTA 3T7TA 3LECA 5C0OE 5EEGA 3ELWA 3PTAA 2PX4A 1Q0TA 1VLMA 3AWIA 2XBMA 2YUIA 3HCFA 4KIGA 1NW8A 2P41A 2PWPA 4HTFA 3HVIA 3HTXA 3HVKA 5FULA 3TFWA 2BH2A 5EIFA 1N7JA 5KQRA 1X1DA 5K8VA 2CWWA 3BGDA 1RJEA 4P7GA 2IIPA 4BP3A 2YXDA 4DM3A 1NW6A 3FTFA 1G8SA 3G7UA 5FUBA 4RVGA 3BGVA 3DH0A 3UJDA 1PRYA 3FUWA 5EGSA 3NDJA 1L3IA 1SVUA 3IEIA 1BKYA 3LX6A 3AXSA 3JWHA 4PYIA 5IH3A 3KQSA 5EHGA 3BKWA 4FZVA 3IHTA 3GRVA 3P8ZA 1L1EA 2IP2A 2GS9A 3F4KA 1VQ1A 2NXJA 4NECA 2YX1A 4RTSA 1VL5A 5M5BA 3FRHA 1NBIA 4C08A 3NMUF 1TW2A 5FA8A 3LKZA 4PYMA 5HILA 1TPYA 1KXZA 2NNWB 3UWPA 3O7WA 1I9GA 5ICGA 2DPMA 1G6Q1 3PLAE 2PY6A 1D2GA 5K09A 4U7TB 3P71T 1EQAA 3KQQA 3B3FA 4MWZA 4EQZA 1M6EX 2AZTA 3OFJA 4E33A 3CVOA 2R6ZA 3GNLA 3OZRA 3E05A 3JWIA 5CM2Z 1U2ZA 2B2CA 3NVKI 1RI5A 5F2KA 5F2NA 3MCZA 3THRA 3UJ8A 1BC5A 2ZBRA 3GRRA 1M6YA 3BWMA 1RI3A 2R3SA 3CJQA 3PX2A 3SX0A 3HA3A 5DX8A 2FYTA 3REOA 1R8YA 5BW4A 1N2XA 2AOWA 2ZFUA 4ER5A 2HWKA 4FSXA 3S68A 1JG3A 3FUXA 3LSTA 3G2QA 3KHKA 4GOLD 4RX1A 4Y2HA 2OPBA 3BXOA 2LD4A 3TM4A 3B3GA 3U81A 5EMKA 2IPXA 1XVAA 2GH1A 2YQZA 2Z6QA 2HV9A 4E2ZA 2PX5A 4GOND 3C6MA 1YUBA 3EVEA 3HA5A 2P3LA 2AN5A 3DMHA 2AVDA 2EJUA 5EOVA 3UA4A 2ZW9A 2FRXA 3HEMA 3SMQA 2IH4A 3LGAA 1VPTA 1AQIA 4HC4A 5EVJA 5DXAA 1KPIA 5LSAA 5CD1A 3G2OA 5LQCA 5E1DA 1RI2A 1XDSA 4E32A 1ZKDA 1UWVA 5CIYA 4GF5A 1NBHA 1X1AA 1YZ3A 5GWXA 2IGTA 5HOQA 3EMBA 2VP3A 2G8NA 2PJDA 3LL7A 2PBFA 2PVCA 2VDWA 4E2YA 3EVGA 4POOA 3BT7A 1O9GA 4XUCA 3DXZA 4DQ0A 4PYQA 2P3OA 4X60A 1SUIA 1F3LA 2P40A 4X1OA 3SVZA 3TKYA 1FBNA 1O54A 1Y8CA 3ELUA 3OZTA 5DPMA 4RTRA 2OY0A 4OX9Y 4OBWA 1INLA 4RV9A 2Y1WA 4QQKA 1EJ6A 2GPYA 2BR4A 4U7PB 3PB3A 5DSXA 3TOSA 5KS2A 3FUTA 1AF7A 5FCDA 3LHDA 2C7RA 3TMAA 2E5WA 3M4XA 1I4WA 4DKJA 5BP7A 3K6RA 4RVDA 2PGXA 2B3TA 1JR4A 2O57A 3H2BA 5D1HA 5EHIA 1YFJA 3DLIA 5DX0A 3C3YA 3OU2A 4LECA 4RTNA 4F84A 3HA7A 5DSTA 4HH4A 5EMMA 2GA9A 4V0RA 5HEKA 3P2KA 5DWQA 5K01A 4XUDA 3B5IA 3PFGA 5HIJA 4PYKA 2ZBPA 4PWYA 1V39A 3C0KA 3FTEA 1F38A 2OB1A 3RIEA 3ID6C 1ZGJA 1ORHA 1R74A 4GOMD 5BXYA 1JSZA 3TM5A 4IV8A 2XVAA 4PCAA 2KW5A 4QVKA 1SG9A 3T7RA 4GUAA 1N7IA 3FPEA 3LBYA 4X41A 5LQNA 2AOTA 1YZHA 2NXCA 1QAQA 2OBFA 2XYQA 1NKVA 2WA1A 3I53A 5K0FA 4H0NA 2I6GA 4GOOD 3UJ6A 1G55A 3GIWA 3I9FA 2ZZNA 3DOUA 2IBTA 4QPNA 5FWDA 2G1PA 1ORIA 2AOXA 1MJFA 3EEYA 1P1CA 3EVFA 3LCUA 3LDFA 3BGIA 4OQDA 2IH2A 1NV8A 4PCLA 1EG2A 4LWPA 1NT2A 5DT2A 5E8RA 5H02A 1KYZA 3UA3A 2OYRA 1FP1D 2FPOA 4EK9A 5CCXA 4QTTB 1D2CA 1EJ0A 3AJDA 2ONYA 4A6DA 3QV2A 5K0CA 4PGGA 2AVNA 2ZULA 4FT2A 4PONA 1QAOA 5DTQA 4MTLA 2NYUA 4ER0A 2JJQA 3KR1A 3BWCA 3GRUA 2AR0A 3FRIA 3QOWA 3X0DA 4BLUA 3G88A 1SKMA 2Q41A 5EKXA 2Z6AA 2ERCA 5K03A 1R8XA 1PJZA 4Y30A 5LQUA 3HCBA 5GOZA 5DX1A 3KPYA 4A6EA 3P9IA 1BHJA 5CUQA 1JQ3A 5DXJA 5E2AA 4CXMA 4F86A 1KHHA 3LPMA 2EJTA 4OA5A 2H00A 2NXEA 1NV9A 2G72A 1X19A 2O05A 4CKBA 5CCBA 1BOOA 3DP7A 1ZHFA 4X63A 3TKAA 1YFLA 1RI1A 2C7QA 3R0QA 5GM2A 3EEOA 3NDIA 5DM4A 4YV2A 2ZVJA 3EVCA 3A4TA 3DTNA 4OQEA 3GRYA 1NE2A 5G02A 2GAFA 5GINE 3DUWA 3GGDA 4ER3A 4G56A 1NW7A 3EGVA 3NVMB 4R8SA 3K0BA 1R6AA 2HMYB 4EMSA 3FTDA 4E30A 3O31A 4RSRA 4FP9A 4FT4A 4HG2A 4YUWA 3GO4A 1YF3A 4E2XA 2UYHA 2P7HA 3NTVA 3R9XB 4ER7A 1XJ5A 2P35A 3KQWA 4FGZA 4C03A 2JHAA 4PNEA 5HIMA 2IFTA 3CC8A 3DXXA 2ESRA 1QZZA 3RODA 4BY9E 2UYOA 1QAMA 2PT6A 2HTEA 5EQJB 2BR5A 3TPZA 3KQTA 5EC8A 4DZRA 5DM0A 4YUZA 5E9WA 2PXXA 2AOUB 5DRYA 4RTMA 5LQAA 5FHQA 2WK1A 4QDJA 1KYWA 3AXTA 2O07A 4BLWA 2ZCJA 3EVZA 3KQVA 3ME5A 5DLYA 1H1DA 4EVIA 3GXOA 2ZIFA 3EGEA 4CTJA 2OZVA 3LBFA 3G5TA 3BZBA 4YUYA 5HIIA 3OZSA 5F2OA 2PX8A 2P7IA 1JSXA 2P3QA 4OA8A 3B7PA 1IY9A 3ER9A 5BW5A 4UOEA 1JTFA 5FA5A 3PT9A 5LQRA 1UFKA 4K6MA 1Q0SA 2OXTA 2HNKA 5T6BA 4HSGA 1RJGA 3HCDA 2AS0A 3JWJA 4KDCA 4R6XA 3M6WA 4RTJA 1HMYA 2CL5A 4RTLA 5KYGA 2BR3A 4M38A 3PS9A 4HRAA 2EFJA 1P1BA 2YVLA 1P91A 2YXEA 3CJRA 4KW7A 2A14A 3I64A 4X61A 5EMLA 2P8JA 3KPVA 3SSMA 2BM9A 4M37A 2XYRA 3FYCA 5DM1A 3V8VA 4KVZA 3UFBA 3KU1A 2H1RA 3MAGA 4GC9A 3T7SA 2IDJA 1L3BA 1WXWA 1JG1A 2ZIGA 5HFJA 5ICFA 1G60A 4PYNA 2PWYA 4AX8A 3GCZA 7MHTA 2QE6A 3BUSA 3T0IA 1WY7A 2VZ9A 3LKDA 3LDUA 2QY6A 1I1NA 3G8AA 2V7EA 3ELYA 1R18A 5DM2A 3C6KA 3HVJA 3VYWA 5K0BA 2F8LA 1KPHA 2GB4A 3SXJA 2H11A 5EPEA 8MHTA 3IV6A 3G2MA 5GIOE 4ATNA 5DTRA 5E1BA 3FPHA 4YUVA 3ANXA 4PINA 5EG5A 2JH9A 5D1NA 4PYJA 2I9KA 2XVMA 3GDHA 3HNRA 2C7PA 5FWAA 5K0JA 2OO3A 1R00A 3OFKA 4QPPA 2XYVA 4Z2YA 2K4MA 5ERGB 4HGZA 4YMHA 1RJFA 3EVBA 3KQOA 3MQ2A 2YR0A 2ADMA 3Q87B 5FADA 2DULA 2N47A 1DUSA 1VP3A 1WG8A 3OE5A 4O29A 1G38A 5CVUA 1XXLA 3LCCA 4MQ4A 4WVLA 1D2HA 2VS1A 3KKZA 4FR0A 4C05A 5GP1A 4EKIA 3KR0A 5FTWA 5HZMA 3FPJA 1VIDA 3KQPA 3DMGA 2VDVE 5P8WA 4KWCA 9MHTA 4E2WA 3V97A 3M6XA 5IKMA 4FS8A 3GJYA 4XCXA 3FTCA 2AOVA 2QYOA 3UBTA
chains in the Genus database with same CATH superfamily
5K8UA 5SY9A 2YJTD 2ZJ4A 1UL1X 4G1EB 3S6JA 3WLAA 1UKAA 1V2GA 2G80A 1N7HA 2ODTX 1MOZA 1WE2A 2EBUA 4LZLA 3AMVA 2ONKA 5AVOA 3VPXA 2JLXA 4ZOLA 4FDTA 5FPTA 1VL0A 1DCTA 4GS5A 2I4RA 2WJVA 5LBIA 8LDHA 2O3SA 1KIAA 2VTKA 3CEAA 5DM70 1XDGA 5CX1B 4E22A 5IFLA 1ZJZA 5KI6A 2OGUA 4RDXA 2JGKA 3H5AA 1FPQA 4RM3A 1VE3A 2ZATA 1D6MA 4H3SA 1QV6A 4QREA 4YCDA 4XJXA 4UTOA 4K6FA 5CX1A 4RF5A 4OGKA 4X8HA 1FXWF 1CKEA 3I0MA 3DTYA 3RWOA 2QK4A 3IPXA 3PKJA 2IU6A 5J4HA 4BX9A 1RP7A 2EFDB 1P33A 4HJRA 1SKYE 2IHTA 3CIOA 2PSFA 4Q1FA 2XA2A 1K6IA 3W6ZA 3S70A 3K70D 2HAEA 3GUZA 5G2OA 4O59O 4JOQA 1NW3A 5HF6A 1ANKA 4PYLA 4N54A 2W2PA 2W2XA 1QUEA 3O1HB 5IWAB 4OLAA 4FVTA 2JH8A 4RVFA 4PE5B 3M33A 5IXSA 3LA8A 3ONWA 1UJCA 1KQFA 4YR7A 1I5RA 2X3YA 2VHQA 4BAZA 4C4ZA 4G97A 4QVGA 4RZHA 3M6UA 1CZHA 4PGMA 1CF4A 4BNFA 5C1PA 3ICWA 1ZXBA 2B5OA 3ECSA 3ZIDA 4ER6A 2PSDA 3GJ3A 3RYIA 1EM8B 4S1VA 2X7JA 3MELA 5CDFE 2V6JA 1U98A 3HLKA 3MMZA 2GLTA 3E7DA 3O3NB 2YZGA 3TKLA 1KU0A 4OG2A 5F51A 5EMJA 5LOVB 5ADWA 4ND8B 5JS6A 5ALLA 1N6HA 2I34A 5C4MA 3BREA 2XITA 2C5HA 1OASA 1X92A 1MQAA 1BXGB 1QTQA 2H2AA 3U3XA 1HV8A 5JPIA 3CBGA 2VDOB 3Q3CA 3HPRA 5LOVA 1UJMA 4MR9B 2I1VB 2F90A 2FSUA 4EPYA 1KHTA 3QM1A 4I3GA 1BXGA 4J0GA 1YIOA 1ZLYA 4AYTA 4FGSA 1E1QD 3NT4A 4HZUB 1N2SA 4B3GA 1ZGAA 3JSXA 2BKVA 2IXEA 5MHTA 3H5OA 1MC4A 3Q7RA 3W06A 4CBVA 2I99A 1N25A 3JPWA 3D54D 1Y6JA 4KXMA 1L5YA 3ISVA 3B6MA 1MO5A 4X9XA 1H1TA 4RZ3A 2HCFA 1JQJC 1H3NA 2P6MA 3ROTA 4BE4A 3O8CA 1NUHA 4MYDA 1OKKD 3D8UA 1L7AA 2Q0QA 2R8OA 2ZRIA 3W8FA 3K0SA 1DBQA 2GO7A 4LVNA 3SBDA 4B35A 3S2SA 3WFJA 2GHIA 4TV8B 1UXGA 4FN4A 4LXXA 3WHKA 2M2IA 3U7HB 1DKUA 1R6UA 4RA6B 4ZV4A 3L7NA 1HDZA 1YWGO 3IHLA 4NH0A 2X23A 3JVUA 2CCJA 2PHZA 4YUXA 4KXQA 2B9VA 3LZCA 3VR2A 1E66A 4GM4A 3FYSA 1O03A 1PDOA 1YB7A 3L7MA 1YJBA 3KTDA 4B3BA 1ZIDA 3JYOA 4ZOBA 4V38A 4E31A 5ESWA 2X8JB 2J3MA 4TMFA 4DDKA 2Z8ZA 4WBNA 1XTIA 2BHSA 1C8BA 2OGZA 3WKBA 4CKCB 5KZMB 2H59A 2QQ0A 4LXUA 1JQDA 2PSHA 4JDPA 4OMCA 3VTZA 1ODJA 5KC8A 4LC1A 1VA5A 2IEDA 1KAMA 2QENA 3C3PA 1RRCA 2FP4B 4NG5A 3DE7X 5CX4A 4YIKA 1DKOA 3K20A 1SQFA 4CKCA 3COZA 4M7OA 3AKEA 2DWCA 4XA8A 3FFAA 3G1WA 2FWAA 5AXCA 3DV9A 1SVWA 4EBBA 4GXRA 2QX9A 5J4VA 5KPJA 4DJJA 3JQAA 1DXOA 4BVLA 2FR0A 2R96A 4M1KA 4XLTA 3OT5A 3BD7A 3ONEA 1JHXA 1BMTA 1JR3E 4K9DA 4OX9Y 2Y6UA 3MWEB 4DV2B 1AKUA 3HA2A 4JOBA 4IL5A 4F5EA 1WBDA 2K7ZA 1HQDA 2WEKA 3ROXA 5AKZA 1N6OA 5LIRA 2YWXA 2C3YA 5AM5A 3G6KA 2FOXA 1J06A 2GGSA 3EB9A 3YASA 1QE5A 4QM6A 4K9LA 4PHFA 1FFHA 1KH2A 1T8RA 2X7HA 4C04A 3SF8A 3OBIA 2Q49A 3GOQA 3PTAA 3IBTA 5H8WA 3NOXA 4NI5A 3WK8A 4C5CA 3IEVA 4KIGA 1GA4A 2JAHA 3ZX5A 2JD2A 4BNDB 4C29A 3BTVA 5AOVA 4V0OA 4YAIA 2V7TA 1O9BA 4CM9A 2Q2VA 4YCMA 4AJKA 2F6RA 2YXDA 3OEED 3ZQJA 4BP3A 1W93A 1X2EA 1N6IA 4Y2JA 1K7YA 5DH9A 3RFVA 3DH0A 3VXKA 3WIOA 3KD3A 1EUZA 4MI1A 5LU8A 2P75A 4E7OA 2CHUA 4IX9A 3ZE9A 3GRVA 5TVGA 1JQBA 1L1EA 2RK3A 1X7XB 5HJ2A 1TU0A 1N4AA 2REBA 2ZR0A 3T34A 4UEKA 3WGKA 4E7PA 3KTOA 1S5PA 1H66A 2GPSA 4PAOA 5BWLA 3UHAA 4PHTA 1EGAA 3BGSA 3IKLA 4OIFA 4UBLA 5BNFA 1CQPA 5CRIA 4CLHA 1KH1A 1NBIA 1V95A 2FFAA 4MPTA 3WMGA 4C3OB 4Z7JA 3BIXA 3NOVA 3NMUF 4PYMA 2R1UA 2NZWA 5B1DA 1QU3A 2V59A 3AR6A 2C9YA 4X6XA 4NZNA 1W4LA 3C3JA 3HJUA 4JJGA 2JLUA 1T9BA 3IALA 4X71A 2VCEA 1Y8ZA 2QSZA 3BS4A 3W3AD 3W5JA 2JEYA 5KMGB 1H2AS 5EP3A 3G2KA 2GF0A 3LMKA 1KVTA 5DNUA 4HNHA 1G7SA 4DDMA 5DEOA 3HHEA 3INNA 4LE1A 4QHYA 4WDRA 1SPBS 3EY9A 1YO6A 1BYIA 3K0CA 2G36A 1JXOA 5BSVA 2G7ZA 4YT5A 1XPRA 2RHTA 1M2KA 2R1VA 5REQB 4O4LB 1X0VA 3Q10A 4BJHB 5EJMA 2Q28A 5C5DA 2M1XA 3LQYA 5K7SA 5CPBA 3RKRA 3NT2A 2Q45A 5ALHA 1ZH8A 2BZ1A 3DJFA 4KQ1A 4E6PA 2F3TA 3ZU4A 5JCPA 5K3SA 1YZLA 3EGXB 3UA4A 4X6LA 4AC9A 2B2XA 4BNLA 3BQNB 1PT7A 1VPTA 1W19A 2BFDB 4H0CA 2GZ2A 2QUZA 2A67A 3A6EA 4NH4A 3VO9A 4B9EA 4D92A 2CVZA 4NBVA 1V4NA 3EGXA 1WPQA 2PKXA 5DLDA 4IJQA 3W4KA 4NFYA 4CM4A 2QRZA 4E32A 5BSFA 1YGPA 3CF6R 3GNTA 1YI8A 2ZSIA 4HWOA 4P5EA 2FPUA 5AJYA 3VDMA 2QTHA 5TVKA 3NBFA 2QRJA 1JHRA 2QRUA 4KPFC 5KSWB 2IDZA 1VPLA 3P94A 1BRMA 3BK1A 4QDUA 3DXZA 3TPFA 3KX2A 4OJNA 1W75A 4PG7A 2R751 5GAJA 3SVZA 4BO0A 3WAJA 3VKWA 3HXKA 5C5CA 2C9MA 3FDFA 1D6JA 3OTHA 4TWRA 2A58A 3PEFA 1TJ4A 4CM8B 3RK4A 2F62A 2FN4A 4EAQA 5IVKA 3LVBA 4WKGA 1LPMA 3ZWYA 3ZW9A 2COKA 4QT0A 3GJSA 4CM8A 3QXGA 1AZTA 1NXPA 3GMIA 4A8HA 5EJ8A 1ETHA 1E1QA 3KM0A 3QU7A 5KSYA 2EW8A 3OU2A 5K3AA 3SS9X 3W5SA 3EIFA 3DC2A 5KHOC 3FY4A 1G4UR 1KAEA 3B8HA 4W9NC 3QA3E 5JVDF 2WIGA 4QTXA 4Q1EA 4G5YA 4HEJA 1XZCA 1E2JA 2FR8C 3AY3A 4JBNA 4PYKA 1V39A 3N7UA 3FTEA 4QLAA 4KHZA 4R9UC 2DAPA 2XOEA 4NS4A 2IPNA 1V1RB 4RV5A 3I8SA 4S1OA 3TR0A 3SVTA 2WTBA 4GUAA 4W7SA 3U13A 4RE5A 4XIYA 4GVLA 5IYZF 5SZHB 1B43A 1YBVA 5F7ZA 1PVOA 3A9RA 2GVZC 3GIDA 2H2GA 3UYKA 2J3HA 4XVUA 4F4DA 2AWOA 1V1RA 4IGKA 5JS2A 5KSZA 2ZZNA 2QS9A 2XZTA 4G1FA 5FB3A 4W5TA 2IHNA 2CLIB 3C85A 1RADA 5IARA 4F3YA 5A62A 3D3NA 4Q66C 4D0SA 3HJGA 4LFBB 4Y9SA 4PCLA 1Y5NA 5TQJA 3TW0A 5AKHA 2C7VA 2XZDA 4IVQA 2XKKA 4MV4A 4AJNA 3TLGB 2OBBA 4YQFA 3TLCA 2V98A 5HS4A 3MT9A 5H4HA 1Q1BA 2QE7D 3BF8A 5BORA 2HQRA 3MRTA 1PGJA 2FWBA 2NYUA 3TLGA 4ZQFA 5FLKA 3BWCA 3K09A 3X0DA 3T5AA 1KJWA 3C8DA 2PXHA 4K1LA 4RZXA 3V4RA 2IS4A 2QWXA 3HPQA 4YRSA 4GR4A 1V8ZA 1G59A 1OXSC 1FX1A 2OSVA 3EK2A 4Y30A 5JEDA 1XAJA 5JY1A 1EHCA 2FPSA 2PGJA 3JQFC 3ZZUA 3U16A 3FSEA 2DOKA 3KB8A 1JGTA 1JQ3A 2YWBA 3BK7A 1OC4A 1HT2E 4IDPA 2CVPA 4AJOA 5C4IA 1GRVA 4XQGA 5KEIA 1QKJA 3G1UA 5A0FA 3MRXA 2XGJA 1I3CA 8OHMA 4EIWA 3WLLA 1I7QB 2R8PA 3HUTA 5AR1A 1PGQA 4KH0A 3H0KA 3PDIB 5I01A 2PRIA 1ZL0A 4MW0A 4HOYA 1N8NA 1MJGM 4ND1A 3H3XA 1P62B 1TE2A 1A5AB 4OQEA 4ZHQF 4LZJA 1E99A 4WFJA 3LUAA 3HJCA 1P9OA 2R68A 1NW7A 1QNLA 3ZNQA 3OEEA 1GTMA 4FCCA 4TWIA 3KU4A 5DHFA 1L7OA 2O7QA 1BVUA 3PQ3A 4I8IA 4R0MA 3RRYA 1BA2A 1CY4A 3UQZA 2ZIAA 4N48A 2EKQA 3KDAA 2HF2A 4EY4A 4L4XA 3K72B 3KQWA 9LDBA 3MILA 3MMNA 3PUVA 1DE0A 2J6BA 4HZGA 3DXXA 3FCXA 4KN6A 4XJTA 5LZ9A 3GQBA 2PT6A 4ZAFA 3G0OA 3U3OA 1LX6A 5EC8A 4YHBA 1RVV1 4WK0B 1TM1E 1WCYA 3U7QA 2BOVA 4K9QA 3OZVA 4GR9A 4PSDA 1K5DA 2H63A 2CFIA 4UDYX 5GQSA 3TO5A 4MLZA 3R0VA 2D54A 4G0YA 3U2QA 4KXVA 1M2GA 3LBFA 1Z5NA 4G0NA 5L7YA 1UZLA 4H7HA 4LK2A 5T3YA 3W3AA 4C2AA 1S2MA 3UO8B 1Z06A 3OPVA 4QFCA 4AF7A 2IODA 2PUAA 2OFPA 3EF3A 3GVHA 3ZDEA 4CE6A 2C9ZA 1V5GA 1GZHB 2VEDA 3OJCA 2OXTA 1G8PA 1L4EA 4Y2SA 1EJBA 3GG9A 3QTLA 3CRMA 4JDUA 2RKBA 3NDPA 2W2MA 3SNHA 4EHLA 3V2GA 1Q57A 4N6NA 4RF4A 2YVLA 1EFDN 3FIJA 4YCJA 1ZVKA 1G6KA 3VPSA 4DS3A 1K88A 4A27A 2XCQA 2QZJA 2Y0BA 4P35A 5I47A 3H5NA 1TEXA 4I14A 4ZARA 5ICFA 2M32A 2VP9A 3GELA 1L7QA 3KS9A 2A4MA 3NHPA 5ALWA 4ALLA 1G5RA 8ADHA 2VH2A 5FUXA 5FBVB 2MCFA 8ABPA 2UUBB 2C84A 5B53A 4JI8B 2PT7A 1RWQA 4OQLA 4LHEA 2YZ2A 4LMBA 3WL3A 3ZJUA 3GVPA 3OIFA 4I4CA 3W5DA 1Y4SA 4BDSA 1K75A 2JZOA 2ZIZA 2VK1A 3CURA 2ZGVA 3RAGA 2WMOB 1FXSA 4OJMX 3H6GA 5EG5A 4PYJA 5JSQA 2A5YB 3AEXA 3N5KA 5JHHB 4C7BA 3GJQA 1ZSVA 3NG1A 4UEQA 4B43A 3CN9A 1B0AA 1K8RA 5IW8A 4KNVA 4QFMA 3I6IA 5B1YA 2J07A 5I9LA 4G0MA 1WABA 4ZVRA 3AILA 2OV2A 1A9YA 2BMFA 3IMGA 1XAHA 1XCOA 2YR0A 3OPYI 4V3BA 4XOIA 3ZYCA 4TM7A 2QW0X 5FADA 2PS3A 2IIBA 3B7GA 3E9MA 5IVHA 2NVUA 1QRAA 1Q15A 3JQ9A 3I9KA 1CS0B 3O9VA 5KOHA 3UOWA 4C05A 2PZJA 4RJ2A 3S1AB 4ZV9A 2WWTA 3FPJA 4ZQHA 2IEAA 2D13A 4G1BA 4KSYA 4E2WA 3TWOA 9MHTA 3L8FA 1AB5A 1WXGA 1L4LA 2FQ1A 2R79A 3I8XA 1J0AA 3KB1A 4GE3A 4K8RB 1CS0A 5J40A 3TQQA 4B75A 5TY0A 5C80A 4GX0A 1Z08A 4V03A 4WT7A 3S1AA 4KI7A 3IAXA 4BLRA 4KO4S 1U0HC 5JD4A 4WTOA 3COWA 3Q8LA 4DR7B 4N03A 1K06A 1PS0A 3A9UA 5CK5A 4AI6A 1DXQA 2BZSA 4PPGA 5K45A 4LOIA 1RT9A 1BDJA 4AWBA 3PNBA 4Q1CA 5JBNA 1AH2A 4ZI5A 2IXGA 3IOYA 3INYA 2A1UB 2GJ4A 3UGKA 2ZJBA 3NBXX 3K9LA 4DLAA 2G82A 4DB4A 2JFGA 1IH8A 2NV6A 3G8CA 4PQYA 2FGJA 4QEKA 3O3OB 4M8LA 2NPFA 2ZQ5A 2GUWA 2RC5A 2F8MA 3SYRA 3TLMA 4ZIRB 2A1UA 5CDYA 2YYYA 4M1SA 1JKXA 2BH9A 3FYUB 2EDAA 1W2HA 3O4FA 1NF2A 3O0DA 3MGKA 5JDCC 3GHHA 2QE7A 4LV5B 5CPFA 4CKXA 1DEXA 2KBFA 2RB5A 3MWGA 2EKLA 4FLEA 4FOPA 4JKOA 2NTNA 4OHKA 2NSDA 3LV8A 4QE3A 2Q7OE 3RDPA 2RHDA 4C9BA 4KE7A 4U6QA 3FYUA 3D59A 1TLTA 1KZ4A 3A27A 5HMLA 5D3ZA 4AUKA 4RYLA 1MA0A 2AJLI 3Q1KA 5CA1B 1P7ZA 2Y1XA 3LP6A 3D0RA 3EARA 3E7PA 1VTKA 4YAWA 3DF9A 1QOZA 3V7FA 5FJIA 3ZDYB 2BDEA 1GQRA 2HBYA 5AHRA 5H5JA 1KR5A 2CHQA 1P7VA 5CA1A 4O5OA 1XTVA 4CPDA 3OEHD 1E7QA 3NFRA 4KQMA 3LHIA 2B9EA 4FMPA 1JQKA 2AC2A 1KZ7B 2O6HA 3NXKA 1FPMA 4RMGA 3TQFA 3UK2A 4AJ4A 1UXOA 3KPUA 4DEXA 3KL4A 1WZIA 3O21A 1PR1A 1RQLA 4DCCA 4D8XA 5M29A 5JAOA 3FBGA 5MFZA 1A8PA 3EA4A 3INTA 4I4TF 5ICCA 1RACA 2CN1A 2EERA 5THKA 4DXAA 1HSOA 1YH3A 5BT9A 1HDIA 2GD0A 1N0HA 2OCAA 4XM2A 5BSTA 1THZA 3DR5A 4A1FA 1WDTA 2B5VA 3OAAD 2CCKA 3B6IA 2HKIA 3TLXA 5JFTA 3LBHA 4JP2A 3WQQA 2IC5A 3DQQA 2WVAA 2KB0A 2VYFA 1JMKC 1Y6QA 2R85A 4A0QA 3CYFA 3CSSA 5L45A 2E6KA 1NAIA 3SF0A 1SKQA 1KC1A 2C03A 3O84A 1EFVA 3GROA 2ZSBA 3Q3EA 2WWGA 1M1UA 3VR3A 4ZVMA 4LXIA 1QR2A 4PO1A 4HPWA 3ABQB 1P6UA 2OV8A 3O75A 2BD0A 4PLTA 5FTJA 1FSGA 3GCDA 1KEZA 3ND9A 3KLNA 1AGRA 1YS2X 5FH9A 2LIVA 3X3HA 4HRVA 5JPDA 3B9PA 2W6JD 3IUPA 1H4QA 1EZ1A 4ETWA 3ZJ5A 1SBTA 4Q3OA 1YJAA 3MCVA 3VDRA 2A3RA 1N2GA 3HXLA 2Y0PA 3AETB 3DAPA 4BFXA 5B36A 5CDHA 4GSYA 3ZCRA 3I09A 1A2QA 4PPNA 2FFHA 5EIBD 5EERA 4LV6A 1JVBA 4OHCA 1QYRA 2FFJA 3DLCA 1TO2E 1DJOA 4JUBA 1RKVA 4ZAVA 2Z30A 3EQ2A 3N07A 3AETA 1QBKC 5EE0A 4EZEA 5A1TA 4QECA 4LGYA 3MEQA 3WYAA 3LY9A 4US1R 4S0XA 2FW7A 1W85A 4XH9B 5DWVA 2RAFA 3A36A 1XEXA 1K9SA 3CRRA 3GHYA 2GCGA 4O8ZA 4RA9B 2FVXA 4IILA 2H65A 2LXNA 1J25A 3I04A 2FZCA 3N53A 3I58A 5I9TA 3OKAA 5IN4A 2HYIC 4RF3A 3IOMA 3RUPA 2BI4A 2IV2X 2ZBVA 2QRQA 4RK1A 4GKBA 1JNXX 4Q3EA 3WYBA 1FDOA 1XEWY 1XX6A 1Y3FE 2ETVA 4TWAA 2C7OA 4KRFA 4HH0A 3HB5X 4JNKA 1V5WA 3OLWA 2GUGA 4BU1A 2QLBA 3VNBA 3X1DA 4EJSC 5DNWA 1EX7A 3T5MA 4BMNA 3HB9A 1GR0A 5A3QA 2C4VA 4MGYR 3M2TA 1W34A 3GZNA 4IWXA 1T43A 4JIGA 4TT3D 3A6FA 3UM9A 4MGKR 4Q9HA 5AOBA 1ZK1A 4GI5A 4YPVA 1XMVA 4JGBA 3H4TA 4MQBA 4TRNA 1B3RA 4LNUA 2IWRA 1Q84A 4HAWA 3SSAA 4R8MA 4BHTA 4R1LA 2JGLA 2PZEA 1A95A 1ZWLA 4IHJF 3W5IA 3QJYA 4GSKA 1Q1GA 3HH8A 4FGKA 3X1YA 3UWMA 2QBYB 1A7AA 3AFIA 5SYAA 4O1HA 4F96A 1HMPA 3IP3A 3T5TA 5C7OO 5IG2A 3SS7X 3D0OA 2X4LA 4G5HA 1EA7A 4DM3A 3PFBA 4O1IA 1H3EA 4I9HA 3G7UA 4LX8A 1NN0A 4TLLB 3ZHBA 2XXAA 4JYAB 4IXTA 1OJ7A 1ZUD1 2QUBA 1GUAA 3RHFA 2DBZA 2IWHA 4EI9A 1FUKA 4D9FA 5TRTA 5HUQA 3A8TA 4MCJA 1SVUA 1Z2CA 4YAFA 3JWHA 1ZR4A 1P9RA 1X1EA 4U1RA 1W7AA 3TFOA 3HJAA 1JAHA 4QRIA 2WVGA 1DDOA 1XU7A 4Z2AA 1Z4JA 1E2FA 1KSJA 1OWLA 4EY5A 4W5RA 4G1UC 1JHAA 2I78A 3QZUA 3AJEA 4RPCA 1FRNA 4Z4GA 4LYFA 5KDLA 5KKNB 5JCJD 1E92A 4O4HB 1AZLA 3A6LA 4TKZA 1PIWA 3RVPA 5ENZA 2H31A 3FFTA 3P4UA 3VSDA 3ENNA 2QVBA 3ZWDA 2FH5B 5CMLA 4QDXA 1XCMA 1QK3A 3GNLA 5LMUB 4I4TB 4O4HA 1OFVA 1ZW6A 3HU2A 1EBUA 4OUKX 5KOIA 2BAGA 4RGBA 4EKNB 1PLLA 1RI3A 3HYTA 4DNQA 5BW4A 3HA3A 3U9TA 1RM4A 1GV0A 2HI0A 4I36A 1KEKA 4J90A 3WGLA 5E6UB 2PUHA 5JQWA 3PYXA 4EW3A 1ZOLA 4FI3F 3E1GA 3ES9A 1JIJA 3N7AA 3WLMA 4NSNA 2Z6QA 4OP1A 4WZ6A 3PGMA 2O5EA 1T35A 1PVDA 1G20E 1H2YA 2EZ9A 2PVPA 3MVEA 3Q0IA 4K7JA 4PWZA 2QMOA 3GYGA 3H4MA 4YRJA 1OBOA 3E7FA 1XNJA 2XNDD 2IH4A 4QUBA 4ZVNA 3ITEA 3L46A 4HC4A 1KFBB 3H6HA 3LG2A 5TPZD 3H4VA 1YFZA 1AGNA 1J23A 2QRMA 5AI4A 3OEHA 4RADA 1SBQA 2HRBA 2XUDA 4H27A 3DOEA 1HFWA 2YJ3A 3E9EA 1Z39A 4F3KA 3TEJA 4YFVA 1XKQA 3H9QA 2PJDA 5B4TA 3KB2A 1EE9A 1ODFA 5JJLA 2LWIA 2VPWA 2FCRA 2ZR7A 4IEIA 4QPJC 1W6RA 3GLGB 2FG7C 4M8IA 3P9SA 4R2WA 4HBZA 1G3QA 5AKEA 4MA4A 4JT4A 5F9HA 3EGDB 3EZYA 3JALB 3D7LA 3H9CA 4JODA 1O97D 4NIMA 1ZC3A 3M8KA 2Q1WA 1YKFA 3WGIA 3OAAA 1BN7A 2C58A 4JUFA 4QQKA 5FUYA 3AR8A 1DLIA 2XEDA 1VHDA 5J2UA 3JALA 4MO9A 3WGQA 4UPEA 1TGYA 3F3SA 3S81A 2WAAA 4TL6A 5L8VA 4UAUA 4YRLA 4N39A 3IX7A 3SBOA 2GESA 2QSUA 2ZRDA 3HZHA 3JZDA 4YREA 5I7VA 4B6FA 5C53B 1TZ2A 1XVIA 1XMOB 1RZVA 2C0CA 3PDJA 3SJUA 4LRSB 3SY8A 4F6CA 4P0TA 3B5JA 2WPDD 3V1LA 2JVJA 4WOPA 3DEZA 1NX9A 2A59A 4REQA 3IMCA 4GOMD 2W6JA 5J59A 3MJSA 4Q02A 1OROA 2QR2A 2PQ6A 2Z2ZA 2AZ4A 2X15A 4QVKA 1B6SA 1NWCA 5ESRA 1E2NA 4KN5A 1HM5A 4LGCA 3UMCA 5E2IA 5TEVA 1N1EA 3AV0B 4GOOD 2ERXA 1O4VA 4L2IB 2WTMA 3GIWA 3SLGA 5H1YA 1KZYC 2XOKD 3RH0A 3WLRA 1V5IA 1NVVR 1W5BA 3IOBA 4AUMA 1ZD3A 2ZQYA 4MW1A 5KNBH 1EFTA 1JPUA 4PLFA 3VPDA 2PFSA 4L2IA 3SWWA 1J0EA 2NNLD 3IUEA 4J7UA 1AKEA 1KYZA 4GOKA 4L28A 1XXHB 4UAJA 1B26A 1L8OA 1P80A 2VHUA 3F4BA 1C9MA 3P5BA 3H13A 4RFLA 3STWA 3GUCA 4B6QA 1WAMA 5BOVA 3PQFA 1E6EA 1QGAA 2H5JA 2ZCVA 1GARA 1XXHA 1DAIA 2VJYA 3D3WA 1WUHS 2LP4Y 4MI3A 2XIQA 3MYRA 4MVXA 5FBZA 5JG7A 3VGJA 3ZHXA 2FKAA 3WLFA 4EHKA 4ZO9A 4NL4H 2ZIUB 1P0FA 1SCBA 4YR9A 3ESCA 3KXDA 2EWMA 4UTZA 4R2HA 3V4VB 1SIUA 1WMBA 3C7DB 1NZJA 4A16A 2OXCA 4ABYA 3ONFA 4DXDA 2J87A 3KQKA 4R1SA 4MVJP 3F67A 2ODAA 2BW0A 4GIBA 3NC4A 1PV1A 5A02A 1DEHA 2BGLA 5F21A 1XZGA 2ET6A 3JR3A 4MLPA 5HPYB 1K2WA 3QKWA 3K8QA 4QUIA 1UZMA 1TDJA 3V2HA 3O1LA 3II6X 3NTQA 4LYGA 1MAWA 5LYJF 3N5CA 1AK1A 2OGWA 4E88A 1QFYA 1G18A 4ZQCB 2EC5A 2KMLA 2WJ3A 3LO5A 1S3IA 5I9NA 3E8MA 1E4OA 2DWUA 2XDQB 3TH5A 5GM2A 4DAOA 2ZQZA 5MGNA 1G42A 4GXQA 1Z6XA 1XK7A 3WL8A 3WICA 4A91A 4G0WA 4BV2A 4IO0A 1QLWA 1W46A 3HKBB 2G5CA 3VKHA 1S01A 2GDZA 2EFEB 5I7AA 5EESA 2IYVA 3P5SA 4R8SA 1ZMBA 2VCHA 1IPFA 3L7CA 1QZ3A 2Q3MA 3QU2A 1PFWA 3AWDA 3C4JA 4MAMA 4MH0R 4KYTA 4RSRA 3HACA 4E2FA 4GKJB 1CERA 4LSMA 3T1VA 3HKBA 5KTNA 2I4TA 1G2PA 1M8FA 2WR8A 3MPOA 4F38A 2UUCB 2EG9A 3FCUB 5CYFA 2OV6A 4YP5A 3RODA 3AY6A 1N5RA 3GJZA 3IQXA 1VLQA 3PNSA 2PMKA 1XTBA 2OO7A 2PUJA 3KQTA 1HYBA 3KAKA 3LPCA 1DIGA 3OTGA 3P0EA 3P9QA 1AK2A 2P30A 2AOUB 1ELOA 1EDZA 4NF2A 5LQAA 3KD2A 2VBIA 5TJHA 3K9CA 1TQDA 1T0BA 1M6VB 4ZAXA 2P11A 3COYA 2EZUA 3EVZA 5JCJA 3LOQA 3QF4A 1GTVA 4JMPA 3FTQA 3TZCA 5JZBA 5H3LA 2WU3A 1U0TA 4BZQA 4ZO6A 4ZT6A 1P5ZB 1O6BA 4OVKA 4OATA 2F3QA 3H7AA 4OA8A 2XE6A 1NURA 1KI1A 4MMZB 3WOVA 3G8DA 5JFOA 3OD5A 1PU2A 1DAMA 1SUAA 4ZANA 4R8LA 2ORVA 2IE8A 1IULA 1T6XA 1UPTA 4XIIA 2IV7A 3UH1A 5T6BA 1ZI6A 4ND6A 2APJA 4OPMA 5JNLA 4OLBA 1L7RA 2WJWA 1RHRA 2KLHA 4KDCA 3VTFA 4ARSA 1MNQA 4AP5A 3OLVA 1BU8A 2ZJ7A 4BNTA 4YO8A 3GGPA 4QT4A 2C9CA 1H2RS 2EFJA 3MAJA 5HK9A 2KSQA 1OAAA 2YXEA 3GT3A 2HCRA 3K5PA 3I64A 2XB2A 3CLSD 2D3WA 1RMTA 2EVWX 1OQAA 1E9SA 1MO6A 2Z4RA 3FYCA 5L3ZA 4WN9B 3LQKA 1N77A 3IBFA 2VPIA 1KY4A 3I1JA 2ZAMA 4S1PA 1M74A 1T4DA 2P2ZA 2DWPA 3IQWA 4L27A 3IV7A 4P4NA 2DUWA 4LMPA 4BVEA 2ATCA 3UYLA 2JGMA 1I0LA 3FR8A 3BJIC 1M8JA 5TPZA 3LT1A 3N05A 3RO7A 2VP4A 1I1NA 3FW1A 2HBRA 3C3BA 4MP3A 4MYCA 4UM7A 3RFUA 4G3XA 2NADA 3W7AA 4UUNA 2DB3A 1NX6A 1P2TA 4L0DA 3L7JA 1GTJ1 3C5CA 2WAYA 1OWMA 5EPEA 3EPJA 1RQ2A 1LBEA 2PYIA 1JKIA 5JWHA 4P4TA 3ZGVA 1G4AE 2HQOA 1L5OA 5J47A 4N5NA 4POAA 1NI5A 5DIZA 1QPZA 3CR7A 3NRBA 3KWLA 3FHTA 2XE7A 5PNTA 2C7PA 1T9DA 3AUAA 3CMMA 1IXYA 1IM2A 4LYEA 3BTOA 1V11B 1H8HD 4BE9A 2WTUA 2XUHA 3C3KA 1D1QA 4WXMA 2QAJA 4FDLA 5I9SA 4Q4CA 4ZD6A 2XGOA 2C5LA 4G63A 3U5ZB 2FZKA 3M6MD 1EDOA 1WNFA 3WWPA 2GZ3A 4RD1A 3MTQA 1CZLA 4BUZA 4LF5B 3O9ZA 3LCCA 1AQUA 3EGOA 3PXBA 3GR6A 3WYDA 1KL7A 2IJGX 2B21A 3V46A 2QG9A 2P67A 3KR0A 1CR4A 2VXBA 2A30A 2O0KA 3U39A 1IG0A 2WQ7A 3JYQA 1M2VA 2YIDA 3AEKA 3HMKA 2WPDA 4PRKA 3OIUA 4OHXA 4Y1RB 3T4UA 3VU3A 3SAJA 3E6AA 2Q1UA 5BN5B 3WYEA 3M2PA 2OK7A 1JT9A 3ZDFA 4QOIA 3DZFA 4Y1RA 4C6HA 4GPZA 1OAOA 2CJWB 4S35A 3IC5A 4IVRA 4IOLA 2E9SA 2I4OA 4BYMA 2HH9A 6AT1A 4BFZA 1OYVA 2XAUA 5BV2P 5TMDA 3MWDB 1SUDA 2XOKA 4ZO7A 5ALJA 3OP4A 1VA4A 4Y2VA 1YVUA 5JLAA 2JJ8A 4JT2A 1XYGA 2GRUA 4WXHA 1JS1X 3NC0C 3MWDA 3OESA 1FXUA 1WMDA 1R2QA 2NMVA 2PSSA 4KK4A 4KR7A 4N5LA 1M0EA 1HNZB 4DCOA 4PHHA 3OCUA 4FMDF 1IM8A 4ZICA 1KVRA 2NZVG 5CLIA 3OUTA 4UQPA 2HHCA 3T5DA 3Q85A 3WQBA 2IUFA 1W36D 2F1OA 2J3QA 4KAAA 1JL3A 5L40A 2GN6A 1EVZA 1TKCA 3INRA 1FMCA 3C8HA 1ZHHA 2FPPB 1UJ5A 1G21A 2QXYA 3K70C 3G2PA 1JR2A 4ETNA 3DFZA 2XIJA 2N75A 3BPSA 2PMFA 2ZB4A 3W0LB 4LHXA 3DL7A 3RJ9A 2FQWA 1L5SA 2ODBA 3DOFA 4R41A 3FMPB 4C0BA 1NFFA 1R0LA 3KXIA 1P2SA 1HT3A 2RAUA 2H2IA 5LVAA 1JB1A 3TZHA 1J39A 1EVLA 1JXMA 2IF0A 4MS1B 1T6YA 2WAXA 5A5GA 1HLGA 1JNYA 3FVVA 3I52A 3ANNA 3QX8A 2GK3A 1GGMA 2Q62A 3QXCA 4EL0A 5DBFA 4EA9A 4R1QA 3DEHA 3KKEA 5ER9A 3UOGA 4WE3A 3L8MA 1M3SA 2PXAA 3KYBA 1JYEA 4YRDA 4IWNA 4NU8X 2GNAA 4YROA 1W0KD 2UYGA 1EAMA 2XA1A 3GK3A 2PAFA 2B7CA 3IODA 1MFPA 3D3QA 1VCIA 1CJBA 3C87A 3R09A 4OHPA 4TMTA 3WFIA 1VL6A 3P9YA 4DCGA 2W42A 5IM4F 4UMFA 4KQJA 3ZWWA 2IQ5A 4AG6A 3U3DA 4IDBA 2GERA 5A9RA 4K6OA 3GH3A 1R8QA 4J4BA 3VX3A 4EO7A 1KIFA 3QU9A 1X8KA 2WZCA 2XTMA 2QVXX 3K4QA 2YJGA 2P1ZA 4U8GA 3OY7A 1W0CA 3EUEA 2C57A 5C8VA 3SQLA 3THOA 2EL9A 3C6QA 2O0LA 4U3JB 1Z4NA 4TKVB 1ZJYA 1UBUS 1QCYA 1WEHA 2JCYA 4YWJA 2JG3A 5B3LA 4Q37A 2PUGA 4URHA 2ZUWA 2HBQA 3WRWA 4P0QB 4Q03A 5EE9A 4K81B 5IDQA 3VOBA 2BN4A 4AJIA 5J4KA 2ZRLA 4RCVA 4TKLA 1UT8A 4GWGA 3B3JA 1I6WA 4C06A 4J16C 4D26A 3CUVA 5K99A 4C7OB 3TNFA 3BHIA 2HEIA 4G4SO 2JAUA 2WHYA 2QZZA 2ADFA 2CDCA 4WD3A 2NU7A 4MV5A 4YAGA 5MN5A 2GPNA 1J9GA 3WHIA 5EJAA 2OKCA 1AQNA 4TL8A 3KUCA 1DTWA 3KEFA 1GGKA 1WCXA 4GGOA 5AW3A 4DR2B 4C7OA 4MJLA 2NO0A 1ULSA 3IBCA 1SVNA 3ZLVA 4HDCA 1X14A 2ZBQA 2J6CA 4XUEA 3IO5A 1PFGA 5U9CA 4FD2A 5JAQA 3H7IA 2EBFX 4ZMBA 1SQGA 1GPNA 2O2IA 3ESAA 4PCVA 3ZXUB 2C00A 3E18A 4PBTA 5DNEA 5LP1A 1A5ZA 1OTXA 1J8YF 1JLLA 1VKZA 3UK0A 2XNKA 4V0MA 2GETA 3L7LA 3JTEA 1CZOA 4C0JA 4HB3A 2V6IA 5J1TB 2VHYA 3AOEA 2BMWA 5AW0A 3K09C 4OK5A 1OWOA 2MSDB 4XLZA 1Y4ZA 1E4VA 2CLFB 4HGYA 1U9IA 4K1XA 1OXVA 2BKAA 1GT91 4LQCA 4X3CA 1R50A 3PV0A 5KSPA 5BSMA 4I1PA 4HWSA 4YT4A 4HS4A 1VPVA 4Q1DA 5I9MA 4D4KA 4PC1A 3PXXA 3H1TA 2JIBA 2IA5A 1VL1A 1Y1LA 2WSBA 3DWGA 3EDOA 1AUPA 1HDXA 1EIWA 3PXAA 3K73O 5E9QA 2IOYA 1SVMA 1A5SB 5CG1A 3FFBA 2XBMA 1K5HA 1X8LA 5C0OE 3ZI0A 4JSTA 1GY8A 2HEGA 2PO5A 3PGKA 1H8HA 1L8QA 3RIHA 4EP1A 2CXOA 3AFHA 4W1SA 4FC7A 2N1MA 5COBA 1MB9A 2AG8A 3HU1A 7MDHA 5CXQA 1HKHA 1TTQB 1CUBA 2IIPA 1UBNA 2V6GA 2AMJA 3KIPA 3RVQA 1C4XA 4LHVA 4C7KA 3W6OA 4YJGA 2QTVB 1Y89A 5BPFA 2ZJZA 4R1MA 3T1NA 1NBMD 3HCRA 2C92A 4D02A 2JIPA 4XX1A 1M5UA 1QVVA 2P9YA 2G1KA 2VJPA 4FZVA 4J7XA 2AFHE 4J9UE 4N7RA 4HK4A 4BJ3A 4B5KA 5B58C 5FNVA 4RQBA 1FP6A 1WHSA 4KLZA 3VU9B 2HA5A 3ZE0B 4U9HS 4EM6A 3RBVA 3NR2A 4YCAA 4TTPA 4HWKA 5ENDA 3SHWA 4UZEA 1MJNA 4NULA 3AHCA 1XN4A 1Y80A 1X7YA 2PY6A 3AX6A 4F3RA 1WB6A 1SXHA 4MWZA 2GRAA 2IHKA 2YXNA 1HEUA 4WW0A 5ILGA 5IUKC 4EQZA 4OHRA 4RJTA 1XFDA 2UYYA 1S3GA 3J80A 5LXTB 1RI5A 5JYEA 1AMOA 5J2TA 1GYPA 1SB8A 2IXTA 4CMBA 2G67A 4D96A 5JMWA 4LC9A 1UOQA 4FNMA 3GRRA 3QVOA 5ADHA 3HI4A 1WP9A 1XMSA 2JGDB 3KWFA 2IYZA 3IQEA 1YIDA 2GWRA 5LXTA 2GYYA 4CFSA 1FJ2A 3IAFA 3U1TA 1TCVA 1T8WA 3SQWA 3LXUX 2HIGA 4Y9TA 2Y99A 2Z9DA 5JMTA 1CTQA 3VNAA 5CNKA 3DB1A 2YWFA 5AICA 2DFNA 1DQNA 2X0RA 3IQFA 4KZPA 5FBRB 1ZVMA 4R2IA 4HUJA 4QBIA 4ZQBA 3SQMA 2EARA 3GPLA 2VDKB 5M04A 1F17A 2ZRJA 3OIDA 1OTHA 1Q2UA 3BMQA 1Y42X 4Z1MD 2R62A 4Z4IA 1HWYA 1IN4A 2JNWA 5IEBA 4Y7DA 4ZN6A 1RFLA 2C2KA 1QFZA 4I5EA 4P08A 2E0IA 2FOIA 1XZKA 4ZC8A 3A37A 2NZYA 1C9YA 2PU5A 4AMUA 2CNOA 3IDSA 2NACA 1CXZA 1AM4D 4EFKA 2I4MA 3GRFA 1JIIA 1PS8A 4IBOA 1KI6A 2EHDA 3EMBA 1SM4A 2VP3A 3OIYA 5GWXA 2BJWA 2V58A 3BM5A 3WLTA 7YASA 5ALNA 3EVGA 2UVPB 4G84A 4MRNA 5FOUA 1E6MA 1E6LA 3OJFA 4C5AA 4KXFB 1O9GA 1E4YA 4NDAA 4DQ0A 2PL9A 1WXDA 3GPBA 3QEMB 4RTRA 5HNKA 5NLLA 3S7TA 1J97A 3THXB 1W0KA 2LE0A 5CLJA 3BG5A 2I3ZA 1G0NA 4ALIA 5AVWA 4HWTA 4R9SA 1K5PA 4URFA 5FCDA 1OLUB 1TIKA 2E5WA 3ANSA 3ABZA 3FD8A 1U2EA 4WRRA 1Y8AA 4DKJA 3THXA 1TTTA 1T10A 1E9RA 3K6RA 4IJWA 2PEYA 1VE1A 5FO1A 4BVBA 2BBWA 1E3EA 4LVUA 3C3YA 5TR9A 5JCOC 1OLUA 1I0IA 2XMZA 2XV1A 3E7WA 4UKDA 1CJCA 1PD1A 4R40A 1M6WA 3DNFA 5TNXA 3ZD7A 3F97A 3FCAA 4C3UA 1OX5A 1E6UA 2FZVA 1ND6A 3JQ9C 3MGAA 4KFTA 4UM9B 2A1IA 2QX7A 2ZYRA 1R9GA 3NBYC 4HXFB 1YL7A 3E2PA 4IHKA 1YC5A 4M2LA 2PRKA 1ZGJA 5SY4A 3RIEA 2BGUA 5KTYA 2ZM5A 2E6UX 4D4GA 5DULA 1Q17A 4DNPA 1TEVA 1TMKA 3RTAA 4CMAA 4DQDA 2ZUEA 1PT9A 4TM8A 2OBFA 1TI7A 6ADHA 1RRPA 4TYWA 3I53A 4LA4A 2WSLA 1QONA 2EZ4A 1YDFA 1SVIA 2FW0A 2I1QA 4EF4A 2XMSA 1XF9A 3PTLA 2OK8A 3RS9A 4ZYUA 1QDUA 3VSCA 5JCZA 1QYCA 1WMFA 4UCXA 1F9EA 1N75A 5E8RA 4X6YA 4J0FA 4CUZA 2J59A 4L5YA 3W5HA 3OQJA 2IY7A 3QW4B 2QTFA 3DD1A 3WVNA 3EULA 3C6YA 4GZ3A 4L57A 3I05A 1H5UA 4RD0A 2VXOA 1UP4A 3SLKA 1JFRA 1ZISA 1QYIA 2CFRA 4O2BB 3QOWA 2C4UA 4JLUA 1L5GB 1T5BA 1USUA 3FI9A 3MSXA 1UPFA 1SKMA 2GF9A 2PLFA 1R8XA 2QPLA 5HSGA 5L4SA 1T8YA 1XMQB 1VJ5A 3FYUC 3AM3A 4QVIA 3AESB 1YCHA 2VYQA 1YL5A 3OOEA 4ZC1A 3CH5A 4BMVA 2G1JA 1V7QA 1W0JD 2LKDA 2YXBA 3G23A 4YP1A 5EJ6A 3FLEA 5DXJA 4QHSA 2CD7A 3GJTA 2WHPB 5DCWA 4J4TA 3W8EA 3LYAA 1LWOA 1PNTA 2ZJYA 5IJ0B 5IJ9B 2PRJA 1BOOA 3E82A 4N0DA 2ZI5A 3DQPA 1R4NA 1L5MA 2DPGA 5K5EA 3OTQA 1NUUA 4UU7A 1Q3KA 4GPAA 2YV5A 3OH8A 3A4TA 2UVDA 2E55A 2IIVA 1URPA 3OUUA 4F4CA 4FFSA 1PTKA 1BW9B 3P0JA 5D3QA 3RUCA 3WB2A 2R8YA 4D97A 2YFKA 4YJ3F 3OQVA 1LI4A 4G56A 1QRDA 1G8MA 3CZ9A 1P2FA 4GL4A 4BQEA 1R6AA 2BBOA 2I76A 2F1HA 2ZUVA 3GNSA 5FOSA 1JYFA 3RVOA 4F4HA 3U4QB 2XQVA 1BW9A 3L3BA 5D5QA 1N5DA 1UKVY 3AP2A 1NBMA 5AVXA 4AJHA 1M2JA 4R2XA 4IRMA 5ESXA 1FDUA 2WSIA 1IUPA 4C03A 5HF5A 4DBLE 4LDPA 4AO6A 3U4QA 3U56A 3DEAA 4UE3S 4ZZ0A 3A2KA 1B8NA 3EFHA 2C77A 3TD2A 1O95D 2HTEA 4F5DA 1TFRA 3DCJA 3PD0A 3W6NA 1QIGA 4RXTA 2YFYA 1GILA 1ZIYA 3LNCA 5DRYA 5FHQA 3HBFA 3W8RA 4RTMA 4D3DA 1D3AA 4YDHB 3HFJA 1T2FA 1OZGA 4BLWA 2H18A 4B2IA 3A6GA 1GEGA 2I54A 2JK1A 2XCLA 2XUOA 3BEDA 2B61A 4HXEB 4ZYXA 3L8CA 3WDKA 4BO6A 4QSHA 1KIMA 3MXOA 3AFMA 1NY6A 1XCPA 1R66A 4UHKA 4C3ZA 2CBZA 2R65A 5AW1A 1HGXA 2IYRA 3K6SB 1Y5IA 1QFMA 3IE0A 3LYHA 3C8MA 2WNIA 4UHDA 2JGFA 1EM6A 5DXFA 4KBGA 3RS7A 3NYWA 3K6SA 2FAXA 3Q7SA 1GGEA 2O5RA 3OOWA 4HNRA 4EVQA 2OBXA 4E5KA 2CL5A 5IZCA 4M38A 1GFSA 2WM2A 3A4MA 4MTCA 1Q0RA 1KI8A 4HNGA 3U80A 4X61A 1CQXA 1TQ2A 4ZI7A 2BM9A 3NP7A 1XA4A 1YDGA 3AJRA 4DM7A 1M2WA 2H1RA 3L0SA 2WPNA 2H2WA 1TL7C 4K9OA 3AL2A 4U2CA 3S44A 3VR4D 4ESHA 2D5CA 3GUVA 1IOWA 5AOCA 4JFAA 1Q0HA 4Z1MA 4KKXB 4YQZA 3QH4A 2ZJ2A 4G09A 2P5YA 1KAHA 2WICA 1NULA 2QMEA 3FOAA 4NBUA 3K0KA 4YACA 5ERXA 5IN5A 4INJA 1E18A 3LC1O 3NIGB 4HB4A 1VLJA 2Z2JA 1C4KA 3HVJA 3IERA 3ZZTA 4KXUA 2F8LA 2YRWA 4AWAA 1YR9A 5BYJA 4XWAA 3IURA 2VC2B 1YL6A 3PSAA 3HDGA 4TN1A 3T1QA 3V9PA 1VRCA 1CETA 4QBKA 5E1BA 2H1OA 4YUVA 4K9MA 4PRZA 2FEMA 2DPYA 2YDYA 3ZEIA 2P91A 3V5NA 3DAFA 3CKYA 4YCCA 1B6GA 3LQQA 3MD9A 3MLBA 1EGMB 3AVUA 3D43A 1XD8A 3KEMA 4DLSA 4G0OA 1N2IA 1DO2A 1R3UA 1KQPA 1QH1B 3U7FB 3IDZA 1AJEA 1D2NA 2NO1A 1Q20A 2PMWB 4BIIA 4E5YA 1S8FA 3IJ5A 5L53A 2DE0X 3STXA 1WG8A 2P4HX 3L4SO 2IBMA 3QPCA 3PC6A 4E3WA 5KTSA 3AVTA 1QH1A 2GN4A 4D8UA 1GP2A 5FNZA 5BXQC 1BVRA 1LK7A 3A4LA 1XMXA 1Q0QA 2CFSA 3DKKA 4I55F 4NFHA 2QRNA 4RIIA 4U7HA 5IKMA 1GNLA 3X2SA 1Y5MA 2OV1A 1XD2B 4FSDA 4Q12A 4RAQA 5F1PA 4V1CI 2PLNA 2BM8A 2IU3A 3FUUA 3K0HA 1AUOA 3WLJA 3AF5A 1VECA 5A0TA 2JB9A 1KFKB 1RQGA 1Y7TA 2C8KA 3LDGA 1ZQ9A 4KVAA 4Q1VA 3ZNNA 1L9KA 3K16A 1NNEA 1SRQA 1YQTA 4URXR 4PO3X 4TMVA 4XVCA 4IIEA 1G5HA 4XB1A 4XAQA 4PZCA 1GKIA 4RY9A 3VUFA 2JFYA 4DJFC 4AN4A 1YNOA 3TTTA 2WF9A 2VWQA 3ZY2A 2B7LA 4Q93A 4EECA 5AFSA 3JQGA 5H81A 3GJ4A 1W1IA 2HDOA 4GGPA 4MGHA 1X70A 4MUIA 3TQOA 1ZSYA 4CM1A 1K98A 1PWHA 6LDHA 2B92A 2J7PD 4I99A 5JDIA 4QUDA 1W4AA 1N5IA 4ETMA 1OH6A 3QKSB 5DLPA 1OC2A 2VF8A 1U4SA 3SDBA 5TMBA 1SWWA 1TYDE 2YTZA 1DMSA 1GNSA 1E0SA 2GBIA 4G1CA 1ZH6A 5TQVA 5K0GA 1BDIA 3QKSA 2JLVA 4EI8A 3MJHA 1BIFA 3KKLA 4KU4A 5EQFA 3SR4A 1QR6A 2CDRA 4YRFA 1RIIA 3I45A 4QU0A 1W0JA 1FYXA 5DTEA 2NP7A 1WKCA 3OCZA 1XTSA 1C3JA 2YW2A 3WR5A 3D8RA 4L4UA 4OYLA 5TE9A 5BN3A 2C0PA 2IVZA 3ZGYA 1KYYA 4CM3A 5EZSA 4OGWA 2C7BA 1DZIA 4RF2A 4AS2A 2BFFA 1K7EB 2O20A 4N7BA 4GMHA 4DMRA 5L3VA 4IIJB 1J21A 4KGDA 3A1DA 3IGFA 4PG6A 3ZU6A 4F2WA 2J5QA 2PFGA 1YMVA 2VWGA 4MIYA 1DCMA 4QAQA 3IKVA 4BS9A 3BZWA 1ONSA 4Q3LA 1LTHR 4HAZA 2XB8A 3SKVA 1PQWA 3SQOA 1QGYA 2VKQA 4JAVC 5T3UA 4I66A 2LV8A 4GRDA 4G4IA 2DBYA 2DFPA 2B0CA 1V6AA 2FQQA 1G7RA 3GAAA 3HCCA 3IPCA 3MIIA 3VJLA 1MPXA 2QI9F 3NYIA 1LSUA 3L5OA 4G9GA 4RYDA 3LHSA 1G2IA 3NOQA 4LJ7A 2GEVA 4HQFA 4LN1A 4M9QA 2P3SA 4Y1EA 5DI3B 2HK8A 4R16A 2WJYA 3W1VA 4CV1A 2CF5A 1MB0A 1NMZA 2YOHA 3O4GA 1O95A 1PWZA 4GEKA 4KQEA 4WCFB 5JR3A 3IPYA 3KL2A 5COAA 2BHTA 4PIMA 4INAA 4DIKA 1XTKA 1T9HA 2V5UA 1UP7A 3E23A 4LNHA 2X6RA 2YFHA 3NEAA 2YKGA 5KINB 5JZSA 4Y2PA 1UXKA 1H2XA 3EF1A 3W2EA 4P3PA 3HRHA 5T64A 3QE0A 1ATIA 5LQKA 4G5OA 2R2GA 4RHYA 2NVBA 1XKTA 5I4BA 1TIBA 2LPMA 2GDJA 4NOJA 2O23A 1KP3A 1H6BA 5DK4A 4AJJA 2RFLA 4H7KA 1GNQA 3KBBA 4AURA 3KLPX 3CX8A 1EUCA 4MW7A 4RMNA 3QUBA 3H9GA 2IT1A 2UZ4A 2WUWE 1Z36A 3ETJA 2Z3ZA 3MTEA 2I7VA 1S96A 5AK5A 4CKWA 2FSPA 4LKOA 4CIYA 1BEEA 1H0SA 3KJZA 2UAGA 2OAGA 1I2AA 4BECA 3OC6A 5F1YA 3QPUA 4I19A 4M89A 2W83A 2G0TA 4B31A 3ZCTA 2V0CA 3EVDA 3KPWA 4H1HA 1NNLA 5C7IO 5INTA 1P3Y1 3R0IA 1Q3TA 4IRUB 1JSLA 4RGQA 4MUGA 1XQ6A 4PN7A 4NZMA 1RI4A 4R81A 5EIHA 1WA5A 3VR4A 4DHEA 2FSFA 1EI9A 4OCZA 4FXOA 2O3JA 1QG0A 2O1EA 3IVMA 3ZZNA 4XX0B 4BP1A 4E03A 1OZFA 3OM0A 1QJCA 4OSOA 5E4JA 3QKTA 1P45A 1XZBA 1JF8A 3PHHA 1QIJA 3IILA 3FZGA 4P58A 4X20A 2C59A 4YGXB 4ZMSA 2HIHA 1XU4A 3ROEA 1XTPA 3HR8A 4TMWA 1SKBA 4C4PA 4EKGA 3PC8A 4EQ6B 1M2HA 2ZT7A 5DGHA 1EXVA 5J2UF 1R0BA 3HVUA 2X13A 2H85A 3U31A 3QLEA 3A4VA 3ENVA 4LJYA 1JWBB 4P5DA 4RKRA 3EPPA 4E5VA 2PIDA 1L5RA 2Y9PB 1C1YA 4U9UA 3U7IA 3KXPA 4P98A 5AW6A 5EVCA 1L5VA 5KYNA 5CITA 4DT1A 3TOXA 2HGZA 1SC3A 4J3NA 3T7TA 5A5FA 1OT5A 3UJ9A 2ZU0C 4XIGS 3WBJA 1CJUC 2I0FA 2AKEA 3DZBA 3ZDRA 3ZY6A 1GGHA 2I67A 1JR3D 4IQ4A 3RVNA 5EIFA 3W5AA 1N7JA 4Q9KA 4C21A 1E1RD 5GJVC 2QZ4A 5I7WA 1XRNA 1A1VA 3ORSA 5CLGA 1FYVA 5M7EA 4DQVA 4F5WA 1MO2A 1P4SA 2FMFA 1SUBA 3ZHCA 4UFPA 3UJDA 2R7LA 1YUNA 1V16B 5EGSA 2DH5A 5C8YF 2EJWA 3S3TA 4UZFA 3AXSA 1X7DA 1G3MA 3GD7A 4XYMA 4ZO4A 4QATA 5IBCA 3T0FA 1ESDA 1XZJA 1UBHS 5FPYA 3V7NA 4D8TA 2W6QA 3I4FA 5FX2A 3MCUA 1V16A 3HNPA 4RTSA 1UEJA 3E70C 3NAGA 2O7NA 3WADA 2WIJA 4MR8B 1J6UA 5YASA 5DHPA 3G3EA 3AIMA 3RGGA 1I3LA 5HILA 2HJGA 4DPMA 4XYLA 1UK8A 2VPXA 4DIUA 4E12A 2A5GA 4HDMB 2J9XB 3QXHA 5ALIA 1I9GA 4RHFA 4Z3DA 1ZRSA 3SPXA 3UXYA 1ULHA 5DP2A 4AM8A 4HGRA 1LRLA 5DEIA 3P71T 3J81A 4FYKA 1MTOA 1PX0A 3NHBA 1SOMA 1TTPB 1PW7A 2BRUA 2R11A 4HDMA 4R7GA 4JR2A 2B36A 1KC3A 4HN4B 2G9RA 5KAMA 1E2DA 2ZRAA 4H6PA 3TTSA 3SIXA 2WD7B 3TN7A 2ZBRA 2RH5A 1Y1QA 1JN0A 1IJKA 2J7PA 3BK2A 1G9XA 3I04M 3OLXA 4RNCA 4RZIA 1A9SA 1J99A 1N6KA 1ZJ5A 1U1GA 1PFQA 1TIPA 2NZ8A 4ZU3A 4CCYA 5FOQA 3AUKA 1T26A 3LPLA 2QP4A 1E3QA 3S29A 4BGUA 2H4XA 2FTKE 4TKUB 1N3YA 2OHIA 4D9GA 4MXDA 3ZWNA 5JBIA 1CY2A 4G5XA 2SBTA 5EMKA 1JVSA 3LI2A 1RC1A 3CCCA 1RFGE 2FWRA 3PHLA 4W5WA 1CY1A 5F2EA 1N2CB 2HPHA 1GCOA 1UBTS 3WV4A 2C42A 4TKUA 4BQRA 2AN5A 2VXYA 3C4VA 5GV8A 4PZEA 1UCFA 5TT0A 2JFZA 4ZTUB 2B1JA 3ZY5A 3V8EA 3I9JA 2XZOA 1N2CA 3EBLA 3GD5A 2FHSA 3UW3A 2EGGA 2M6RA 4G0XA 5DVZA 4WWHA 4KTTE 1UM8A 3MW8A 1H05A 3UMRA 1A9TA 2OLKA 1C41A 1R0KA 2HRZA 3DMDA 1Z8FA 3RT7A 4EABA 3PYLA 4W5OA 1B74A 1YE3A 3DOJA 4KYUA 5LWQA 1Y8CA 2YWEA 1F48A 4IMRA 4L22A 4QG3A 1INLA 1PG5A 4MI9A 3TSAA 4TKVA 4MQEA 4Z9XA 2BC9A 3NATA 5JVDA 2F55A 1N36B 1BJTA 4GI1A 2SKEA 3C7AA 5CXUA 1XOIA 4HRXA 4CL2A 5FI5A 1W25A 3JVIA 1GVHA 4ND2A 1SOVA 4Q4AB 1KVSA 1WTCA 2N46A 4E94A 4RVDA 1Z83A 4JMLA 4AO7A 5H83A 2CLSA 4TV9B 1F51E 1ZNYA 5A6SB 2XWJI 5TC4A 4YBRA 2ZYHA 2QTWB 3FVRA 5IYZA 2F8TA 1E9FA 3TLZA 5ALQA 1ZU4A 4Q4AA 2H7CA 1R10A 4H18A 1E7YA 3WGZA 4XUDA 1J5PA 4TV9A 2X4DA 1L4HA 2OT3B 2Q29A 4DV6B 4UEOA 1Z8HA 3B1ZA 1T6ZA 5IM5A 3JQ6A 2PKCA 3G7SA 3D1VA 1ZD4A 2Q6VA 4QQRA 1C0LA 821PA 1JALA 1I51A 3Q4GA 1K8QA 3Q6MA 1X2BA 2CWDA 4XDGA 2O9JA 3HKDB 4XWTA 5LC1A 2QQEA 4XLLA 2SKDA 5FUMA 1PE0A 4AY5A 2BFOA 2Q3BA 4PO9A 4PXYA 2PMCA 3A70A 5LB2A 2P0EA 5CG2A 3CLRD 3CLUD 2Q5EA 1NGSA 3EXG2 3HKDA 2AOXA 2IU4A 3LBIA 4LV8B 4LY3A 4OLHA 1FW8A 4JLJA 4OMUA 4BQNA 3FYTA 3I9MA 4NP6A 3D6HA 3HM9A 1Y34E 2QMQA 3G0HA 1Z6AA 2QM8A 3CF0A 3W77A 1GN9A 2PT5A 1RYBA 3ZWOA 3ZVKA 4INPA 2OBMA 3AJDA 2NSLA 3QV2A 3HXPA 1FSSA 1PTJC 1GQFA 4MYSA 1GA1A 1I9CA 4N82A 1GPLA 1V47A 1UXJA 2KS6A 4Q21A 5GONB 2PFKA 4R2JA 4N3NA 1PL0A 3HQ4O 5I45A 3D4NA 5HDBB 2RBGA 4O5AA 4JELA 3VYTB 1RHUA 3W2GA 2XMBA 1TA0A 2H9YA 4XJSA 4YCNA 2E21A 1C3OA 4DLUA 5E0OA 2OG2A 3N9IA 4UULA 3WKDA 1VIVA 3OTIA 1MNAA 4XUGB 5GGXA 4TVSA 1UH5A 3RFTA 5E6SB 1BHJA 4C7JA 4CNBA 1T0IA 2VJBA 3OWOA 3UV6A 2QIPA 4GU5A 4B83A 3V00A 2GJAA 5E6SA 4QLBA 4XE5A 1NV9A 1RLOA 2O05A 1FQKA 3QG5A 9ATCA 1MVNA 4MA0A 3TVYA 4ZJZA 3A6ZA 1Y48E 2GNOA 2IZ1A 2BWJA 2VJAA 3K9BA 4TQAA 1SELA 2ASVA 2FX3A 3GRAA 1ORDA 3Q5GA 4LI3X 3QY9A 5BVGB 4Z4QA 3GBVA 3PNYA 1NBEA 1O58A 1E1RA 5CGZA 1WXHA 1XU9A 2X9LA 1LDGA 4YRQA 1ZCAA 3C45A 5D8DA 3SJ7A 2H4WA 3QLUC 2DFTA 1T1GA 5BVGA 1MV5A 3FCOA 3PGVA 3QXXA 2DRIA 3WNQA 1KZ9A 2V97A 2F3RA 2ZJ0A 5DNYB 5CYGA 4JXXA 3TW8B 2R6JA 1MC5A 2SKCA 4MV6A 5FPKA 5HWSA 3NJ4A 4UXHA 1A97A 2B3DA 2GAOA 1V6SA 1QYVA 4DFDA 1NY5A 2DX7A 4OB8A 1DMRA 5JSKA 2J85A 3EH1A 5IPFA 1V2HE 5DNCA 4Q3AA 4WZBE 4EKDA 3QHQA 2BFWA 1KYTA 4DSZA 1NVUQ 3ZWVA 4CR8A 4A6XA 4N5HX 2VRBA 2QF7A 3BZBA 3CQ9A 3KJGA 4GNRA 1A9RA 4RK4A 4AYWA 4YCLA 3GLIB 4W5NA 2C54A 2P3QA 2QQFA 5FAKA 3AK4A 1QFXA 2JVIA 3JQ8B 3RKSA 4A2WA 1LU9A 4UOEA 3ZVMA 1K66A 3UC5A 5PGMA 2KM1A 1XTZA 4H1VA 3UN1A 1IN1A 1R6TA 2H5LA 4PSVA 1PQPA 1I6LA 2UUOA 3H83A 4D9BA 3JQ8A 3QTTA 5FI1B 1U0SY 1IWBB 3JWJA 3RAEC 3VI4B 2RIPA 4UAGA 3NHZA 4HRAA 1HLDA 3GCWA 4WEOA 3PNMA 5C7YA 1A5TA 2OHJA 3KPVA 4RD2A 4TLBA 2QL9A 5KYKA 2DFVA 4LY0A 1WIWA 5IMBA 3UXHA 3F0TA 4X1YB 3KVVA 1ECCA 1PWEA 1NMEA 1IZ0A 1QG4A 1E62A 3BQMB 3P52A 4GYKA 1XIVA 2J3DA 3CLSC 3PDUA 4LEIA 4NCXA 5G0SA 2J3LA 2PWYA 3K9WA 3RBXA 4AX8A 5JJBA 2H3HA 1A71A 2I7DA 1YTUA 4HB2A 1NFQA 1XR3A 4NJOA 4X1YA 4Y67A 3PU6A 1Y6GA 4TN5A 2C2XA 3GEPA 3ELYA 1TFUA 4LJSA 4NWIA 4D3ZA 5LZ5A 3FSRA 3O4JA 2I03A 3LPNA 4M1ZA 4M0FA 3ZCPA 5BMOA 2VPYA 2H11A 5GGYA 1EFHA 2I9PA 5SZIA 3FPSA 4O0MA 2XSZD 1DTSA 3KJIA 4ATNA 3RJ5A 1B41A 3AUUA 4G8BA 3RSZA 1PZEA 4NDZA 2RH9B 4ILEA 1OXMA 5JTUA 4FX5A 3BL6A 2NUAB 4U00A 1ES9A 1LVGA 3BD8A 1VCNA 4CKYA 4HVLA 3BSSA 2ID9A 2Z04A 3LZDA 4DILA 1BE8A 2NO5A 2Q50A 1XRJA 2I66A 4NZYA 5GZ1A 4DXHA 3OPXA 4WNAA 5IASA 5ELMA 1T9KA 3HBJA 5KX5B 1YXMA 1FFAA 4A73A 4K2HA 3WMWA 2C3UA 3ECCA 5H68A 1UBCA 1B14A 1NVTA 3BIOA 4GVXA 4LAFA 4LOLA 4P86A 4TSFD 4WASA 3MC1A 4ZZ1A 1C14A 1VZ2A 3ZTWA 1XLWA 1J42A 1PR9A 2F3PA 3ANYB 3PWZA 5KX5A 4CLRB 1DIHA 3NWPA 4EKIA 1ZOPA 2J46A 4BMSA 1NONA 2DERA 3HWRA 2ZRFA 3DPIA 3PC7A 3F9IA 3KG2A 2WW8A 2Z08A 3FTCA 4JLOA 2D0PB 2AN3A 4NAVA 2YHAA 3NEPX 4XGRA 2Y1EA 4MO2A 3SEAA 4I9FA 2RONA 4F4FA 1MW8X 1LF0A 1ZK4A 4JQZA 5FTNA 2GZMA 5B57C 1IPHA 2AN4A 1NN3A 1PK9A 1AUXA 4L76A 5K0TA 4CF3A 3PJDA 3E61A 1QX4A 3UXMA 2WA2A 3I2YX 3NZEA 5ECDA 4C07A 2R6HA 3O5AA 3Q7EA 1ZPDA 4OBBA 2QVZX 4MWEA 1QS0B 4RELA 2CMDA 3K5WA 4ZRNA 3BJRA 2O0HA 3HB4X 4D9NA 4Z6KA 3R7LA 4L5CA 3VZDA 1SK9A 1CUZA 4DIBA 2VK2A 4CGZA 2J9FA 3COVA 1I7LA 1Y3IA 2GKGA 2R00A 4QQNA 1M33A 2W6MA 3K15A 2P2DA 1M1YB 1DWPA 3WWOA 2I91A 4OHYA 2PZBA 3W05A 1TCUA 4LHSA 3UCFA 4ND5A 2L18A 3S40A 5JNWA 5A4MS 4B3JA 2BEUA 3STVA 1GOTA 1M1YA 1UZUA 4OHMA 4Q3NA 4DMCA 5LQJA 4CEJB 2X76A 4D99A 1I3OA 4RHXA 4XIFA 4PHGA 1VCOA 2IVFA 1WHTB 2RHRA 5IDVA 4KODA 2A5FA 3L6BA 3WK7A 3B1JA 4IH9A 4CEJA 1E98A 1YS9A 2YCLA 3F8WA 5JAUA 2Z6UA 1M0TA 2OB2A 1WHTA 2INGX 2X8AA 4P84A 2P9EA 4PS1A 4YJ2F 2B25A 2EEZA 3W5BA 3AJ8A 3SM3A 2CMHA 2WE8A 3O8DA 4HFMA 4TTRA 3RD5A 3L0DA 2OAP1 1BXRB 1FNDA 4DCVA 1VDZA 2KJQA 1QU2A 2FPMA 3P0FA 2NG1A 3VZQA 3OU7A 4NENB 5EGNA 4FYHA 4O4JB 4ZK2A 1QHEA 1BXRA 3SHQA 4N8SA 3NHRA 3LLCA 1W2GA 2D0IA 1N5MA 4NENA 4I1VA 4TWZA 2ARKA 3ZK7A 3RVDA 4K88A 1IZYA 4O4JA 4E14A 3CE9A 4IGIA 5M3BA 1PR5A 4LCBA 4B3MB 2OZLB 1B1CA 2YWCA 5T4EA 4RIFA 3UMYA 1ONBA 3DFMA 4GI2A 3L7KA 3AB3A 4A8JB 3ER8A 2PV0A 3KWJA 3SR3A 2YXPX 4DIMA 4RSMA 1S7CA 1CHDA 2OWEA 3GGSA 2EYQA 4GDMA 2W70A 2Q8PA 1RHQA 2ISQA 1AF4A 1F2VA 1MVOA 2MSWA 5FFNA 4QGSA 3C2QA 4A8JA 1AGXA 2V7UA 3D6AA 4XVHA 1YAHA 5BSHA 3LYUA 1L7XA 4IIBA 2JFNA 3M1LA 1TVEA 1LI5A 1WW8A 3MCTA 3HFSA 5BWBA 1WETA 1ZL2A 3O8LA 4DA4A 5IDXA 2EYUA 3L1JA 2DKOA 1LWNA 1IY8A 1P0CA 3NIBA 1CIVA 2PCJA 3ZNOA 3LQRA 2ZI6A 2PZLA 1Z3IX 2GAIA 1CUAA 1JX6A 1UT5A 1Z0SA 2QB5A 2EU8A 3KR9A 3OE1A 4GMKA 1QANA 4GBGA 4TLCA 4TQ9A 4WL0A 4XSVA 3V7YA 4J2TA 3WXMA 4DLNA 1NR7A 3ONDA 3FUVA 3ETCA 1U7PA 3D5QA 4RVOA 4WFIA 2QYSA 1NQUA 3O8NA 4ISBA 3S2YA 3CEJA 1QPBA 1E1LA 4TS1A 10MHA 4U2KA 3G68A 5EHNA 1NJ2A 1XK6A 4KFRA 5COQA 2DUMA 2VBCA 2PU7A 2QDKA 3LWZA 4J8PA 4KEAA 3S1LA 3WRYC 2F8SA 3OCJA 1ZRNA 4BEBA 3MGGA 2QW1A 2P1RA 4AX4A 1GU7A 3PP8A 3Q11A 1J22A 4ZCRA 4HX9A 1RXYA 5EN4A 1CZKA 1E2GA 4ZDKA 1RAIA 2RK6A 4KLRA 2I3BA 1UMDB 1X7HA 2BP7B 1N3LA 2X9NA 4H1UA 1NVVQ 3HL4A 3NGMA 4TXLA 1RAGA 1IEXA 5BOSB 2VBGA 5D3MB 4EJFA 3B78A 4NFLA 4AXBA 3JD2A 4DJ5X 1NATA 5KHAA 4AKSA 2H8GA 4F9EA 1ZOIA 4QD3A 2AX3A 2DP4E 2NTEA 4AULA 4DWWA 1HNNA 3WIVA 3TG2A 5BOSA 1MKYA 1NTOA 3CPHA 1XCJA 4M83A 4KGVA 5AM0A 2PWAA 3LCVB 4IFBA 5EP4A 1WXXA 2A94A 3OSZA 4ZXFA 4BWYA 1EP9A 5KQSA 2QEQA 3O83A 1W47A 4HDRB 2A5DA 5LDHA 2AEJA 1EJ2A 1FDSA 3L06A 2XSZA 5GVSA 3ELDA 5LP6B 4W9RA 5AH0A 1T5LA 3LUKA 1I6MA 1QE3A 2VPTA 3NEJA 1BQ4A 1C4OA 1WS6A 1CW2B 1LQ2A 4HDRA 4JB2A 4LQDA 4P1ZA 4BE7B 1VYHA 3L4BC 2VHWA 1L4GA 4P3KA 3TOCA 5LP6A 3SHTA 4HAXA 1TYAE 1JDZA 1IN5A 1HLPA 3ZJYA 2W2VA 4MPRA 4MUAA 4WXYB 3HVKA 4ZCMA 5I4IA 5I7HA 3AIKA 1CULC 4BXOA 4LF4B 4H59A 3USCS 1FNSA 1J2TA 3RRBA 4J0EA 1ILWA 2QX6A 3KAPA 1HEIA 2JFXA 4RH3A 4FBGA 4TSFA 4PQFA 4FHZA 1FLAA 2R4QA 1AY0A 2ZYGA 5BR7A 5JXWA 1SXIA 3TG8A 1PZHA 4X45A 3LP5A 4GWKA 3ZBTA 5KB3A 5F4BA 2NYRA 1TM2A 2P9TA