2P0YA

Crystal structure of q88yi3_lacpl from lactobacillus plantarum. northeast structural genomics consortium target lpr6
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
324
structure length
240
Chain Sequence
RPKIVVIGGGTGLPVVLNGLRKQAVDITAVVTIRNVMVALSSWPDLYKDIFQGNLIGVFDAVQELSNMMQVDGHVYPALTLHGKFSDGTHKSLERVWVTPQAVQPVIDAIMAADQIVLGPGSLFTSILPNLTIGNIGRAVCESDAEVVYICNIMTGETDNFSDADHVRVLNRHLINTVLVNTEKVPEDYMDFHSKQVSHDFRGLREQNCRVISSNFLKLHDGDQVVAELMNLVGHSDVFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Q88YI3_LACPL from Lactobacillus plantarum.
rcsb
source organism Lactobacillus plantarum
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein lp_0780
total genus 50
structure length 240
sequence length 324
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01933 UPF0052 Uncharacterised protein family UPF0052
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10680 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold CofD-like domains 2p0yA00
3C3EA 3CGWA 3C3DA 2P0YA
chains in the Genus database with same CATH superfamily
4FE7A 1UMDB 5FWXB 4PGMA 5I4KA 4IIVA 3RFVA 4ITVA 5T8KA 3GMSA 1JHXA 2ZJ3A 1UBMS 4MUKA 5T67A 3WSTA 3ZQKA 3PQ3A 5C81A 2BONA 2Y92A 1UWCA 2H7XA 4JLKA 4REMA 1PJSA 4YRDA 3IUMA 4ASUA 4KNVA 4D81A 5CCBA 1H4SA 1OTXA 1UPAA 4N82A 1E7MA 1G5RA 4KRYA 1FDRA 2Q1TA 3QBDA 1T1JA 4C6HA 2FUG6 3JD1A 4UBLA 1Y4DE 2QSYA 4OMFG 2IP2A 1VHLA 5FOSA 5D01A 3DL2A 3GQBB 3U3RA 2IYTA 3KVYA 2UYOA 1F14A 5K0NA 2G06A 2ZTHA 1E1YA 1O77A 1N2XA 2ECQA 2HU2A 2GZRA 4DIDA 1GU0A 1U94A 3K96A 4BASA 1VRVA 1NMEA 3LECA 3QMPA 3M3DA 3V4FA 2O57A 3ZWKA 1HSZA 1T8WA 5BNIA 4GX2A 3NB0A 4QG7A 2F3QA 2VNKA 1BHQ1 1V16B 5CDSA 4MOWA 3LT1A 4EJFA 4P86A 2P9HA 1VYTA 3LTNC 2F59A 1R0LA 4MITA 3UGQA 4IYJA 3LLUA 5AVTA 1G2OA 2O0KA 4PICA 2CNWD 2UUAB 2O8CB 1F8GA 1V41E 1OA1A 2XUQA 2ZK7A 4C21A 1XDZA 3RQIA 1KMMA 3Q4GA 3DM5A 4BNTA 1T1IA 1U8EA 2DBQA 3QU4A 2QTGA 4GXRA 2JLXA 4OTZA 1Z2NX 1Z7GA 1TU0A 4I0WB 4ANFA 4J4BA 5IT5A 1JEEA 2IY9A 2DWPA 3CUKA 4GL4A 2ZCVA 2W9XA 1SK8A 4GR4A 4GQBA 4DDHA 1U9CA 3KVNA 1US8A 4BYGA 1XJWA 4FEYA 2W2PA 3JQ6A 1J1IA 3IAS1 4CR8A 1XMPA 5LMUB 2BTQB 2FNAA 5D3KA 1RQXA 4GX0A 3LDUA 3H2KA 4H9GA 4QPCA 4NBUA 2ZUFA 1GTG1 2OO3A 3LMKA 1M8GA 2EW1A 2J9ZB 3DLCA 4FZ5A 2PKXA 3HO8A 3LUAA 1UC5B 1T36A 3OZWA 4PWZA 2DKOA 5JPIA 1Q74A 4L85A 4WOPA 5I7RA 4EYOA 1X39A 1LZKA 3V4RA 3SYTA 2LCIA 3WGGA 4FFMA 4AP9A 3QUAA 3GPLA 2QRNA 1ECPA 2D4HA 3NDJA 2J85A 3BFXA 2M6LA 4UBNA 1WXEA 5FNVA 1W4ZA 1NUPA 1WZ2A 5DHUA 1Q17A 4UFOA 4LXHA 2Q5JA 5ALDA 1N36B 1Y9DA 1U1EA 4OGFA 4K2AA 4YV7A 2QM3A 5ECYA 2A0UA 3M4YA 4GXNA 1BHSA 1UFQA 3D6NB 2JIDA 3DAGA 7YASA 4LF8B 1HDXA 2XHEA 2FEAA 3F8TA 2BBOA 4OQXA 1I5RA 3IDAA 2J6HA 4KH0A 2IZ0A 4JNKA 3GDGA 4IDEA 4LC9A 3BGIA 4F5YA 3D1JA 3UAOA 2Q3EA 4B3FX 2EDCA 3WJ1A 4ISCA 5C1IA 2GNPA 2UZAA 3KEOA 2ZYTX 1KR2A 1XEXB 1WV0A 1LRKA 1AZWA 3HU3A 1YI8A 2I6XA 5KAMA 5TS3A 3D3JA 5KOJB 2ECKA 1MV5A 1VIAA 2IYVA 1QH1A 3GGGA 4K6HA 3BMQB 4IV0A 2WYVA 1KSJA 2X86A 2HEGA 4XYMA 2DULA 3GAFA 3O90A 2ZZNA 1C7ZA 4N8EA 3ZJ5A 4I4NA 3W06A 5IVKA 4FYKA 1BWQA 1WNTA 5DHRA 1F3LA 4IJQA 2PFGA 5KREA 3FB4A 5JXGA 5I51A 4PSKA 1GJRA 2P90A 5FR1A 1MDFA 4O02B 2I1VB 4QGAA 3WKCA 4D6YA 4C0JA 4EEKA 2JFYA 3ZVKA 5LN1A 3OP4A 3NP7A 1G6KA 5F76A 1ZJJA 5CGZA 4ETIA 1USVA 4RDIA 3OG9A 3N2ZB 4WD3A 4ZHSA 2B1GA 2YC4C 4KPEC 2NVWA 5KOJA 1LBTA 2Y1XA 5BXQC 2HWXA 2WPDD 4ZO7A 3V1YA 1K98A 2N1MA 4XOIA 1X87A 5CYPA 2IW3A 3MWEB 1BGWA 2JGKA 2WT8A 3PGKA 4M0PA 4QEKA 3WVNA 5KU1A 3BM5A 5AM2A 5JMWA 4FP9A 5TQ0A 5LU9A 4RY2A 3WLJA 5JZOA 2XYRA 4EA7A 4DMLA 3AR6A 1VCNA 3O8OB 1RLOA 1JALA 3CB2A 3PIIA 2P2CA 4MJ7A 5EP3A 1TVCA 1H2XA 3ETCA 2F64A 1IM2A 3OLWA 1FFWA 1Q77A 4JOSA 4MCJA 2AEMA 3H3JA 2XTAA 4JQSA 4WXRA 1TT5A 3RW9A 4JT4A 2FPIA 1N6NA 3FGOA 4MR7A 5FL7A 3RV3A 2X5JO 3DJFA 1J07A 1I8TA 3Q7RA 4KLNA 4DPKA 1RHJA 3JQCA 4KXVA 4D02A 4BX3A 4RTNA 4XSVA 4C5CA 2CUTA 2EU8A 3QMVA 2IZ7A 1HT0A 2GZMA 2IU6A 2BUCA 3IDFA 4JB8A 4PO9A 3ZCXA 3D3EA 2V9CA 3IDZA 1J0DA 1M34B 1OX6A 3HKCA 2W4MA 1SBNE 2FA9A 3DPIA 2KX7A 4DABA 3QE9Y 3V8MA 1LV7A 2NSLA 3M1AA 5DTMA 3TD9A 1AGPA 2HHAA 4CCSA 1M1NA 4F4HA 3H0CA 4Y2GA 1H2EA 2H5IA 4D3SA 2XWQA 3D2AA 3UOAB 1XEWY 2B2XA 3H4MA 1YNSA 1Z07A 2IUTA 3DMPA 2CJWB 1BDMA 2AN3A 3L6CA 4FGSA 5MN6A 5IDWA 1FX0B 3JQEA 3FVVA 2N1BA 1XQ9A 2O7QA 3LPDA 4EHLA 4JR0A 3H2SA 4NBLA 5EIWA 5HFNA 1ULTA 5LYYA 1U7TA 2HQ1A 2QG9A 3OOSA 1ZIPA 4KUHA 2ZITA 2GEUA 2XITA 3NZEA 2MSLA 1GA4A 4MVJH 4EM6A 5AESA 1WMSA 4DG8A 3FLEA 4XRGA 2P5UA 1P73A 3RWBA 2XNHA 2SICE 4NNOA 2XE7A 3IJ5A 2DCMA 4MI9A 3U61B 3BFVA 1AHNA 4Q1FA 2BKAA 521PA 4KE8A 3RODA 1G20E 3JQ8B 3ZXXA 5B53A 4CIAA 4M54A 4QEZA 4LECA 1TXGA 2O2GA 2YXPX 1GNQA 3CTMA 2XCOA 4M0CA 3NMUF 3KE8A 4AC9A 2QE6A 4RULA 3KSMA 3UAVA 4NENA 2P68A 4RJKA 2ZVQX 2MMCA 2V7EA 5KPJA 1DKUA 3FLMA 3QVWA 1Z8FA 5DU2A 1TOAA 2Q29A 4CMBA 4C4TA 4F2DA 3B1VA 2RAPA 3PQ4A 4CRWB 5K3EA 3LRPA 4P3PA 5BWNA 5ALNA 3KQKA 1KKUA 4L22A 4F4IA 2CLEB 2F4VB 5F1PA 4PFJA 2QN2A 3QXGA 4ARSA 3SS7X 3ETHA 3UXEA 1D2NA 1QHSA 4RF3A 4D46A 2IKSA 5C1BA 5LA6A 2DWQA 4IUDS 1Z4QA 3T1HB 2R3SA 3EF1A 4ZYYA 5F9MA 4TXJA 1TJPB 3BVPA 4OQDA 1C0EA 3RRMA 3DWGA 4AI6A 1EGVB 1YC2A 2QXTA 4BKRA 1AQJA 4QHTA 1FA9A 3GCXA 3F6SA 4CT4B 3JYOA 3PFNA 1UBCA 5TB5A 2FZGA 4EFKA 4IKEA 4YACA 1U8YA 4YMUA 1EM6A 2C4MA 3UMGA 1N6LA 3QA9A 4IWYA 4EX7A 2V6FA 1FJXA 3WL7A 4JLBA 2RGNA 3ZIUA 2DYKA 2GM4A 1E0KA 3TSAA 1IK6A 1A2KC 3AP3A 3LBIA 4FT2A 3WL6A 1GR1A 4ZAXA 1HNZB 5K0BA 2PMFA 3NBYC 1ECJA 4QBTA 1VYUA 3LYHA 4CIVA 1T3SA 4ZVQA 4LMBA 4CW7A 3AVVA 1DT3A 4KP7A 2G5PA 2QJFA 1NAIA 5KI6A 2LPMA 5IKOA 2UVPA 1DO0A 5DIFA 1RTKA 1EVYA 1LSSA 2WBLC 4NZNA 4RKRA 1M2NA 3OKFA 2Y05A 3ROZA 1ORWA 2DE0X 4CIWA 1PGOA 2CZCA 2AQ8A 2IGBA 4HEA1 5L4LA 3JVVA 3T7IA 4D4JA 6ABPA 1IUPA 2W48A 1SC3A 1V39A 3ASZA 4NCKA 1YS6A 2QTFA 4M0DA 3SPXA 1N9GB 1UXHA 2XMDA 2HLDD 3M83A 1GRRA 1N3BA 3RFTA 3W5CA 4AU1A 1QV9A 2XQIA 3FUTA 4LE1A 5CFOA 3EYWA 4G24A 1PNQA 4LISA 4FDLA 1VCOA 2JHAA 2O20A 1Z17A 4DADA 1EX9A 2OMEA 5H3CA 3EXIA 3A1NA 1NN1A 2PL5A 1J09A 3GZNA 4MV4A 4I3HA 5ADHA 4JNCA 3I52A 3O4RA 5AUPB 3QEKA 1GUFA 4I1VA 4BMYA 2AE1A 4FW8A 1JPNA 3I2GA 4ABTA 1LSUA 3RU9A 1CUJA 3LXMA 2PPLA 3F9IA 3FTPA 3DTVA 1PR6A 2CHGA 1VYHA 3P2JA 3S4YA 3SDZA 3V1MA 1EWKA 3I4LA 2X8BA 1JLLB 5KQMA 4AY2A 3F8SA 1IN1A 2A78A 2Q6IA 3OFJA 2EF0A 1HE8B 3L0DA 4W1PA 4NARA 5D6OA 1WXWA 4YJ2A 3C3BA 3IUPA 3LLCA 1NBEA 2I33A 1U6JA 2PXHA 2EFGA 4C2AA 4CEHB 3NRBA 4EHHA 3Q3EA 2ZAYA 3OZSA 1F06A 1VMDA 1YZQA 3NAMA 4H7IA 5BSMA 1PHPA 4RD1A 2P9QA 1ECBA 2V7QD 1UJ6A 2I7VA 3BD9A 7REQB 1E3JA 1ES9A 5CNJA 1CJCA 4BE7B 2NG1A 1K4MA 2WF6A 5CB6A 2E5WA 2V4UA 3P2IA 3FPAA 4KFCA 4UPVA 1NJ8A 1TGVA 3DCJA 4URUR 1PT5A 4BUJA 4NYMQ 1V3TA 3LQYA 3OZEA 2QD1A 2BL4A 4XX0A 4ALJA 3T61A 3OT1A 2LRHA 3PNVA 3VC1A 1QCDA 4KTVE 5HRUA 1ISFA 1UINA 2P6UA 1B8NA 2ZIGA 2WUEA 2O4CA 5FOXA 3UCFA 2DVMA 4FYXA 5IC5A 1UDCA 2W2TA 1Q3KA 2ZS9A 5K0LA 3UYLA 5ITZA 3ZVLA 5LZ9A 5JJIA 2YMQA 1YZFA 2RGGA 3UB3A 5IRCD 3NHPA 2CXTA 4HVTA 4OKSA 3BA1A 3IDSA 2FEOA 4PINA 3SAJA 1AKTA 4BY9E 1RM3A 1E5XA 1T25A 4Z5XA 1G8YA 1LEHA 3KOUA 4WEOA 2GFHA 5CTAA 3R9KA 4Z54A 1M67A 5AVRA 1B2LA 4G84A 2UZ3A 1T4MA 1YZHA 3NBXX 3PPVA 4XVUA 2GUWA 2VJDA 5JCJD 5JLJA 3A2KA 1ZD5A 3RVJA 1OZFA 1LTKA 2YDYA 4KR7A 4F1WA 2YZMA 1IB0A 1U1FA 2FOLA 2FSIA 4TXNA 3JQAB 4WBNB 4YCBA 1YS4A 3N75A 2ZRBA 4II7A 3WLKX 5F23A 1X0XA 2IUEA 4FMBB 2BDEA 1JNYA 1HDEA 3QJGA 4QE3A 3VZBA 1Z29A 1IOWA 3N59A 2WUFA 4ZVKA 3T94A 1T4CB 3EGXA 3RSHA 3KHUA 3PENA 5J40A 3WBKA 4O1HA 4OHFA 1PFYA 3TRJA 4DA7A 3RJZA 4BAGA 3SQWA 3IP9A 3KVOA 2WJWA 1NE2A 3IT1A 3QJ5A 1J33A 1XXHB 2WIFA 4MW4A 3V7NA 3VR4H 4XCQA 4N76A 4FI3F 1DG3A 2IOQA 2H59A 4LY0A 4L4SA 2FFJA 4LXXA 2UZ0A 2QN9A 1XV5A 4GXQA 1XLUA 2XA1A 4MQEB 2VYCA 1HRDA 5TV2A 3TDKA 2NUTB 3W4JA 2YKGA 4JI7B 1JIJA 2HQRA 4WWHA 1XK6A 3AY7A 3EMDA 4V0LA 5DIZA 2YYYA 5KWEA 2Z4SA 4AN4A 1EBUA 1VJ0A 2VDWA 2A88A 3CW9A 3JATA 1BE0A 4OB6A 4UFNA 5DGCA 3D4IA 5TVKA 3EFOB 3THWA 1HC7A 4NE9A 1ZM9A 4ZOEA 1CZHA 2EC5A 4F45A 1OX5A 1RI4A 1S1CA 3KD2A 4V2UA 3EZXA 4BKPA 3ZJUA 3OIYA 1TF5A 3CMCO 3EUAA 3S2SA 2XT6A 2RE8A 1NJ1A 1PBTA 4HKTA 4JBLA 1P81A 1C2TA 3PUIA 5CYOA 1GRCA 3WR5A 1I1QB 4CNQA 3CU5A 5JCZA 3I05A 5AVOA 5K01A 3FRJA 1KZ7B 2REQB 2PXXA 2B4TO 3D0KA 3IQDB 2OD2A 2GN6A 4INJA 1JA9A 1T2EA 1J8MF 1IOZA 4Q1VA 4NBRA 5CHYA 4AJKA 4G0OA 3HA5A 1Y4UA 2UZ1A 2XMGA 3LUHA 3T4EA 1U0HC 2EJUA 3UHOA 2NACA 4H4EA 4ZK2A 3HHEA 4U7PB 4TZ0A 1OBVA 1X8JA 4MUIA 5ULLA 1K2VN 1UBGA 3GJZA 1HI9A 1QU2A 3DDNA 3PFBA 4AZ3B 4D9NA 2ZAMA 3IV7A 1DXYA 4DVJA 3TQRA 4D0SA 2ZLBA 3ZKWB 3AESB 3R0VA 4L02A 2ATIA 2E4VA 5E2IA 4OAQA 4IXTA 1XROA 1ZL0A 4EI9A 3IS3A 3PK0A 4YO8A 2DBYA 5AW7A 3CX7A 1DSSG 3UJNA 4P3OA 1P7CA 1AGXA 2JJ2D 4BTEA 1MIOB 4DC1A 3NHZA 4UVEA 3NDBB 1UZUA 1ZGAA 2XDQA 4XIFA 1SFRA 4GPTA 5BURA 3ZWPA 1FLDA 4EFDA 2AQHA 3WL4A 1RYBA 3Q8KA 2QM0A 1VLZA 2DQSA 4AZ0A 1YACA 3ZTTA 4ALKA 1M54A 4PHGA 2AIRA 3NAGA 3CVVA 1N8TA 1QC5A 2F67A 5D86A 2R6AA 4G9EA 1OKKD 2DPMA 4YJHB 3VR3D 3HUTA 4P2BA 5I3CA 4ZDKA 1N7IA 3I4FA 1QFJA 3OZGA 4FKZA 3VJLA 4P80A 2EQBA 2RGXA 3V55A 4PCUA 4Y0VA 2B5VA 4LTMA 4FNAA 2LP4Y 3ZDRA 1MV8A 1S2LA 2QN7A 1EP1B 3R7BA 2O05A 2L69A 5EJ8A 2P2YA 2FVYA 3KQTA 1K7YA 1N92A 2P1ZA 3G17A 3KEGA 1FP6A 5SY9A 3EOZA 3HJHA 2C58A 1P1FA 1R66A 3F5QA 3NVMB 4KXFB 4HGNA 2V03A 4U2BA 2QR5A 1K88A 1U8CB 2WK1A 3ZX4A 1FS6A 5MN5A 3CTPA 4RENA 4O59O 4B0OA 2X3FA 2GAFA 4KGDA 1PT8A 3LX5A 4FJ1A 2E82A 3D6HA 4MX8A 1RIIA 4Y1EA 5DNCA 5GJVC 3KYBA 1Q95A 4M0LA 5JCJA 1FJHA 2ILVA 4NK4A 4IIYA 3CA8A 3VXKA 2B7CA 3INGA 3BGOS 4Q0MA 2O9JA 3D1LA 2QL6A 3D0QA 4EELA 4EABA 4WLUA 4D0LB 3IEPA 2YJ4A 1ILEA 3AUJB 3EE6A 3C2QA 4YRPA 3OIFA 4IW3B 5H02A 4BX9A 1U3WA 3L3BA 1N2EA 3DAPA 3WV5A 3U37A 4CLEA 2D7DA 3ICOA 1WMEA 1D0IA 2G9QA 1NZJA 2IF2A 5EN4A 2QW1A 3NANA 2E48A 1Y3IA 2FWPA 3NNNA 1BOOA 4DSOA 2QZ4A 1XB2A 3V6LA 3LT5A 5GOZA 5AKIA 2QW0X 4YO7A 1AGYA 1GAEO 3CZQA 3UJCA 4OAPA 4C2BA 3IAHA 1DAEA 3L01A 3RFCA 4MUGA 4TWAA 2B94A 3LGAA 5GP1A 1HT2E 2D13A 4C6SA 1MB9A 3W6UA 1RP7A 2O2ZA 1JSCA 4U5QA 1MA3A 3G7SA 3S3TA 4C6RA 1I4DD 1I7PA 1JZTA 2AFVA 1C7RA 4MP3A 3JU3A 2OWEA 2F8TA 2YTZA 4M60A 3OWXA 1E2QA 1LBIA 3HYTA 3TEJA 4M46A 1Y5MA 1WXHA 2PZBA 2ZP1A 1ACMA 5DEOA 1IU9A 2Z9CA 3WA7A 1DTEA 4RS4A 2I2AA 3P19A 5BNTA 5T8KC 1EK0A 2ZB8A 1YBVA 2A4KA 3CONA 3CY6A 3K1YA 3FOWA 1KI7A 2CFIA 3LC0A 3VNUA 4XM2A 3V8PA 1HLPA 4Q6BA 1TDJA 1PJ4A 4HPJB 2M6KA 3L0OA 1WU7A 2J33A 3FOFC 5LLTA 1FS4A 3L02A 4ER7A 3TMYA 1MB3A 2WZCA 5AM1A 2VNIA 4HAOA 1SXJA 2CVOA 3EMVA 3HXKA 3P2MA 4PZPA 1N4DA 1HUQA 5TF0A 4HDCA 4BAUA 2GXAA 3K53A 2J0UB 3F5FA 4P0TA 4YDHB 3I1FA 4N0DA 1ZPDA 2R48A 2TMGA 4W1QA 5AXAA 3U7IA 5IDYA 4HV4A 3RS4A 4N6GA 1GNPA 3GAMA 3UV6A 4DAOA 2X8WA 3VO8A 1M6YA 4X93A 4HDNB 5ALGA 1Q84A 1ZIXA 2O23A 1H0RA 3DS8A 3A1TA 3BSSA 3L7BA 4FD3A 1MG5A 4YUVA 4J2HA 2HU7A 1KMHB 3DE5X 3QOFA 4G0YA 3UMBA 2GCEA 4W5NA 5KUTA 2GXSA 2X1HA 1HOTA 4KWHA 1DWPA 1HT1E 4CR7A 1M1YA 3AHIA 3T7EA 3TSWA 5AR1A 3WSWA 1CQXA 1MENA 2CXOA 4U7DA 1B3BA 1VPWA 3R5SA 3V8QA 1MF7A 2ATEA 2YH2A 2FUG1 2IU4A 3F49S 4KUGA 3TL6A 2IXAA 1IFXA 1XX6A 4TYWA 1KZGB 1CEQA 3NOVA 4PF1A 3DMTC 3Q6NA 4CYMA 3R0JA 4DG5A 3OPYB 2AFHE 2D2EA 4KX5A 1SIOA 1TM2A 4XB1A 1NBME 1NMQA 1S89A 4E3WA 3PF9A 4QULA 1ZOLA 3RSLA 2DUWA 2OHVA 3D3WA 4G41A 1C9EA 3FFWA 4HDSB 3R8CA 1FP4A 4QNRA 4Q3CA 1OIWA 3DOIA 2XNDD 5FLEX 3U7EB 4NG5A 2RI1A 4JT8A 4BMZA 2FZEA 4BB9A 2PUEA 1J4AA 2ODQA 5HVNA 4IDPA 1RQ2A 3ZHXA 5I9NA 1UBFA 1V48A 1N6PA 2AMLA 3IEUA 3GLIB 1QGUB 3NC1C 1R6VA 3NYRA 1UBRS 2XDWA 1EXWA 3G9TA 1MFZA 1VJCA 3KYDB 4L9WA 4LHSA 3HJTA 4X63A 4F8EA 4EG3A 3PLAE 2OUKA 3PHCA 4ZU3A 2JIMA 2YVAA 1P6UA 2WSMA 4RTOA 5AJUA 2V7UA 4X00A 1R4NA 3GX1A 4W1RA 5MHTA 1U0EA 13PKA 2W8ZA 1C4WA 2H4FA 1NX6A 2QMEA 1SQ6A 5DGXA 1CY4A 3O1LA 1G9XA 3HDGA 2ZJ1A 1BXGB 1EP3B 4R40A 4BFTA 1DADA 5H81A 4O4HF 1Z6AA 1ZR4A 5B7QA 3O03A 3R4CA 4U8HA 3IMCA 5H9WA 1RR6A 4I1UA 1SCUB 4YQEA 1QK4A 1I1NA 4V3BA 1QORA 4DS3A 3RM3A 1XA4A 2QRQA 4C4ZA 3GJYA 2ZSBA 1QDUA 1DDIA 4XB2A 2C61A 1XTZA 4AJ4A 2AFIE 3EZ9A 4B35A 1O1YA 2V3WA 1K0UA 5BYKA 1GUAA 4Y2JA 1YVDA 3C16C 2Z6UA 5HTKA 4N5HX 1U9IC 2PUGA 3TPZA 2NNWB 4J2OA 2QTNA 2W2MA 2WV7A 2PTGA 3EUFA 3TTTA 4ARZB 4IF6A 1CE8B 4FR0A 2E4ZA 1W75A 4FM9A 1NFQA 3BRCA 4L07A 2AJDA 2B4RO 2NUPB 4AMYA 4OH7A 3MBIA 2YICA 3U9SA 3GVXA 1V7QA 4AZ3A 2VCEA 2JNWA 3IO5A 3SKXA 2FP4A 3HXOA 1S3FA 3ZZTA 5HCNA 4IXMA 5EHQA 1M8JA 4MCAA 1FUIA 5K6AC 2MMGA 4ZDIA 3A9RA 3U6KA 2VXYA 3K05A 1XZJA 3N3BC 3Q2KA 4G36A 1T10A 1NM5A 4Z8XA 1AQIA 5TVGA 1BE1A 4FK8A 3FYCA 3NTOA 1JQJC 4UVGA 5BWCA 3Q2IA 3MILA 2BZ0A 2O2DA 1WUHS 4IIXA 4ARIA 4YP1A 5LMCA 2JH8A 1NJ2A 3SNKA 2PLFA 3HBAA 2CNNA 4R2IA 3UM9A 2ASEA 4RFSB 4LFBB 2FJPA 2VNSA 3NNDA 2XUZA 5EWMA 5CA0F 5KWSA 1ISPA 1G291 3HGMA 1RLIA 4HP8A 2B9VA 3ZDEA 5KMGA 3AVWA 1NMYA 3DEHA 5KYXA 1LC3A 4K0RA 1IOLA 1JXMA 1U0FA 3AR8A 3Q15C 1QAOA 4NS4A 5AVJA 3BPSA 2JK0A 1ENYA 1QPGA 2YWRA 4G89A 4L5IA 4QD3A 4U00A 5LC1A 3RTAA 4DSUA 3DXXA 4DMGA 3ZLBA 1PLKA 4CL8A 3GNQA 1HORA 2OCDA 2V7GA 1ODSA 3EIQA 3F7MA 5M7EA 1Y1KE 3FGNA 1KVSA 1XLTA 2WTMA 3EC7A 2DHDA 1P1CA 5CLLA 3ZCVA 3PUYA 3HLKA 1L5RA 2PLAA 5AOBA 3ZV3A 4UNRA 3NHRA 4L7QA 2YY6A 4DJAA 3GLIE 1J24A 4E5MA 1CSEE 1WJGA 2QNRA 4XLLA 3T6KA 4CHGA 3PEVA 1CB0A 5EWMB 3E18A 3ND7A 3QPVA 1LF0A 3UCXA 3RIGA 1N2SA 3DOUA 4TN5A 4EFLA 1ZJWA 3G9QA 4ZA2A 1W85B 2W6MA 4LNUA 1M0TA 1SBTA 2G28A 2O7VA 2Y68A 1E0DA 2AMVA 1Y5IA 4V0RA 3ESRA 3C5HA 3ML1A 3OKPA 4RKEA 3MLEA 1UWLA 4K3VA 1JMKC 3F7TA 1SCKA 3IXLA 2G5TA 3LA6A 5ALZA 6LDHA 4ZMRA 3L41A 2VVTA 5H82A 1DCFA 3T0FA 3RPEA 1SU6A 3BS4A 1Q0PA 4HEA6 4W5OA 4ZVLA 1ZRSA 2PR7A 2XXJA 2IEIA 4MR9A 2V97A 1BHJA 2FGJA 2ZUBA 2HR1A 4IQ8A 1DBSA 4LZJA 4Q7QA 3SHQA 1F1BA 1T2NA 3VYVA 1VM6A 121PA 2ODTX 1JAIA 3ZK7A 3IQFA 1NF2A 4TWJA 4JLNA 1COWA 1DEAA 2VZ0A 4QWWA 3I23A 2VF7A 2ZYSA 1UK9A 4YECA 3CZAA 1GU1A 3SICE 3IHWA 2ZATA 1KSFX 3VU3A 3GPIA 1E62A 2WKQA 4IXNA 1ZG3A 2NOAA 2C82A 2OSBA 2W6IA 1GVHA 2VIIA 3UWSA 1TM4E 1DOZA 5CVTA 1C2YA 4POAA 1B7GO 1N2CA 1TTHA 2GA9A 1SBZA 3BMCB 3OCVA 4HQNA 4K1LA 2VHYA 4F3KA 4V1CI 5JU6A 1ADBA 2Z6VA 1A9PA 4ZJZA 5I9MA 2POQX 3ICQB 5ECGC 4X71A 4CEIA 4FZVA 5FOWA 3DE7X 3O4JA 4B5KA 3L1HA 3TQOA 3TAXA 1CR1A 4HB2A 1JBKA 2PSFA 1SCIA 2F55A 5KNCH 1H1LB 1SNYA 1PZEA 3FI0A 5HQTA 3VHLB 1XLWA 3BCHA 1ZMXA 2REXB 1JVNA 3ADKA 3PPWA 3V8RA 1J39A 3WRYC 4CV1A 3QZUA 4CI9A 1UFRA 3L07A 4YRSA 3LWDA 1I3NA 4TTRA 5EMJA 1QKJA 5DI9A 4MS1B 1ZSNA 3WLOA 2P1RA 2W37A 1CP3A 5EJEA 1UOEA 1TF7A 2OYSA 3I04A 2AJ8A 3SF0A 4AYXA 5ISMA 4KVZA 3R3ZA 3AKYA 4G37A 5G0SA 5KTOA 5FV4A 1OJ7A 4PVCA 3DMRA 4KSCA 3PWZA 1L4BA 3PHBE 4MGKR 4ZWNA 4NLLA 1M1YB 3DZKA 5MF6A 5IFLA 5LD2C 2MYTA 1XG5A 5EY5B 2X8JA 3LIIA 1S6YA 1ODFA 1O7JA 2INGX 1IDOA 4WZBA 1DIHA 3BL8A 2FFAA 5BUSA 3PEWA 4X20B 3V4SA 4EB3A 3ZQUA 4BJHB 3L6OO 4RL4A 3DHNA 4W82A 3SZMA 1QGED 2OZPA 3RT7A 1OD6A 4JXKA 1Z45A 4DV6B 2AKAB 4HWGA 5A06A 2AXPA 2O2JA 1B6RA 3LE8A 3Q10A 1QOQB 3JATB 3GCWA 2ZB4A 1ADCA 4NMWA 2QLJA 4MW5A 1E4VA 3PGXA 4HLQB 2IP4A 3KU1A 4UXIA 5EMMA 4ERXA 2EIHA 1QF6A 2FPOA 4HVAA 2GS9A 3P9SA 5G0WA 1AGRA 3QTBA 4M4SA 3TAHA 4LDJA 5JAIA 5JDCA 2ZXFA 4IZHA 5IVHA 3RVRA 3E03A 2IYFA 4NATA 5ILQA 3RROA 3VYSB 1Z8HA 4RPLA 4Y6GB 5AVZA 2A35A 4EQ6A 3FMPB 1RXEA 4M9UA 2OCBA 4RAQA 3TH5A 5JD6A 2BGKA 3QI7A 5BT8A 3T9DA 3C14C 1YZLA 3MTDA 3SOZA 1GQYA 1UMKA 1XFAA 4HK4A 4P58A 3PR1A 1Y8ZA 2CKMA 1RZRD 1FFBA 4NMMA 2BRUC 4FC6A 1Z5OA 4ZTBA 2G1AA 1O94C 4RQTA 1ZVVA 1R0KA 4FMDB 1WF6A 3WOHA 3JTEA 4CM4B 2FWIA 1JLHA 3CEPB 2FR8A 3CGGA 3E9ZA 4UJ5A 2E87A 4I1PA 4R8KA 2AEJA 1RVDA 2ZIWB 2VJBA 5CJJA 1ULHA 2ZRKA 5BN1A 5E1BA 3UA3A 5JJCA 3DTYA 3H1AA 2Q1WA 3I42A 4F4UA 1D1SA 1WUKS 1JAXA 3AFNA 3C85A 3HN7A 3LBYA 4JC8A 1P17A 1NC1A 2C8VA 4N9WA 4OLFA 2QTCA 1DIGA 3IV9A 5GJWC 3VH1A 5KTPA 2RGDA 4KFUA 1PHRA 1IN5A 2PYDA 3NTRA 1JF8A 1OASA 5JNSA 5E9JA 4HDRA 2XBMA 1A27A 3RRXA 1JLMA 2CF6A 2XD9A 3PCXA 4S1OA 4ITRC 1NBIA 2EHJA 4EYKA 1HDGO 3IUQA 3PQ5A 4IGFA 2JD1A 4ZGWA 4GC5A 4E33A 2F9MA 4MULA 1VP9A 2XYGA 3HWRA 3KZNA 4MI3A 1ZJ4A 4YPOA 4JR1A 4ZAFA 4BQSA 4LJLA 3UXHA 2OFPA 3B70A 1NSYA 5BVHB 1GNTA 1S0UA 1E0JA 1AUQA 2IE0A 1YJQA 4CI0B 5HOQA 1D6JA 5EIXA 1N78A 1JTEA 3WL8A 4RPCA 3LHSA 4EATA 1BZYA 1DX6A 1QZ3A 3ADDA 2CW5A 1K5PA 3A3KA 3O8QB 5TJ9A 4BLSA 4I7EA 3RK1A 5LSAA 2VQ6A 4RE5A 1ZNXA 5K3FB 1U28C 1UZNA 2ZRDA 4Q39A 2VQ3A 2Y1DA 5ICSA 3C3YA 1TQ2A 1B26A 4BYMA 3TIFA 5I9LA 3LPMA 1JQAA 2H1HA 3FYTA 4Q4JB 3VNRA 4LF7B 2XVYA 3OOYA 1LNSA 2FSVC 4I6JA 3BIJA 3F73A 1HZZC 4BNGA 4W8HA 2RIPA 3PI7A 1BDBA 2DH6A 1XOIA 2Q5QA 4LJYA 4MK4A 4RPKA 1W5SA 2Q0XA 1KDOA 3N2IA 1Y5NA 1H1TA 3QFSA 4FKBA 4M89A 4N9QA 5J5AA 3TQIA 3WXBA 3X2EA 1EDBA 1MORA 1XZEA 2DPHA 3E05A 4Q5IA 3PUZA 1EWVA 3COVA 4BFWA 5EQJB 3PNYA 4HNGA 2QUJA 2AJTA 3BN3A 2EFYA 1INLA 4YS6A 4LBVA 3ZD7A 4K26A 3Q8WA 1YQDA 3U3XA 3PDHA 4WUVA 3EXFB 1KVTA 4BO8A 5JH7F 1A77A 1NN5A 4Q82A 1O94D 2AD1A 3PQ2A 2ZANA 3ZEIA 1DPFA 2OCAA 3O0DA 5ED4A 4IX9A 5JAZA 1H6AA 1XQWA 3DLAA 4AG3A 1UKBA 2GPBA 5EUQB 2XVMA 3ITEA 4CKCA 3B7WA 4HYYA 4Q12A 3HCWA 4X1IB 3S2ZA 1RCTE 2VCYA 2D0PB 3H5AA 2EYQA 2FPWA 2JI9A 4DB4A 3R7FA 3UAZA 1LNQA 5IAGA 3QELB 5KC9A 3PVCA 4DLRA 1H4QA 1IY2A 5F7JA 3ZDQA 2YWJA 4I2VA 3CNHA 4NULA 4Q3KA 1RBYA 2QD2A 3WWOA 4DAEA 3WIUA 5DGTA 2AOWA 2YWXA 4LPSA 3AVQA 4HUTA 3QSGA 3ZY2A 5HRAA 2CYCA 3EZNA 1PW7A 2ALJA 4IDHA 3TUZC 3OZAA 3SHWA 4AM8A 1C8KA 2FPMA 4LVOA 1YJAA 2D59A 2IH4A 4D41A 1GYPA 5IM5A 2Z4TA 2JKZA 1WPRA 1TC1A 3CPEA 4CM3A 1FTWA 1QX3A 2FMFA 2HA0A 1QFZA 4X84A 3KXKA 1H2ZA 2ZIZA 2V6MA 3BXPA 5JNTA 1U0TA 3QF4A 4GT1A 5BYJA 4RTSA 1QX4A 3F3KA 1E2EA 3TLKA 3EIFA 1Q0SA 3W9YA 3X44A 4AJ1A 4UTNA 3J7AC 5FT9A 3R9WA 4KRFA 4N40A 5AW4A 2ZAGA 2BELA 1Y9AA 3ZDZB 4LRWA 1P8AA 4MVJP 3BAFA 4OHVA 5FA8A 3GHYA 4HG2A 4CF4A 2BSQA 5CAEB 3GLTA 3KYIB 2EF1A 1ZZGA 3VKFA 2XNSA 1KDYA 3U3KA 3B89A 1RM4A 2O2IA 5FTJA 3GOQA 1FMTA 6GPBA 3OF2A 4Q02A 5IX8A 1ZICA 1XD9A 4I1YA 3GUUA 4CQMB 1TM7E 1T6XA 3I9NA 2R65A 3RGGA 3PU6A 1LCIA 1K08A 1QAMA 4GKBA 2FRXA 4XRRA 5KDOA 2PX0A 3KQWA 1KK2A 2VPYA 4UEJA 2HRQA 3RSFA 5JBIA 4ISBA 1WZIA 1WDLA 1AKUA 2AWOA 1AXRA 1L5FA 3FY4A 3NYWA 3QOXA 3DMDA 1N6KA 1Z5UA 4LHEA 1W48A 4QECA 3W5JA 4E1BA 3OQMA 3OA2A 1Q20A 2EGUA 5IFKA 2V7WA 5JRJA 2YIVX 1F9AA 3HLYA 4KBFA 1PNVA 3G5TA 2VHTA 3SVTA 3ZWOA 2RHDA 4RTRA 2Q3HA 2J67A 4Z2AA 1HBJA 3FNGA 5L3VA 3VZPA 3L0ZA 2FJ0A 2XUHA 4EI2A 2J09A 2JBHA 1FVOA 4CFZA 5M04A 3I1JA 4P4NA 5K8TA 4QT4A 3BE4A 3LCJA 2OVFA 1HH4A 4MSUA 1FBNA 4BJ5A 3BE8A 4U7TB 1TEXA 3LPNA 3PJDA 4K9RA 1BEUB 3O7WA 4NYIR 1FDTA 4JL6A 2PS0A 2YCBA 4D0RA 3KQNA 1QBKC 3MWFA 3K09C 3L0CA 1LX6A 2JB9A 2W6QA 3Q0IA 3OJXA 1EDZA 4YAGA 1L4MA 4BNDB 5CIYA 3O3OB 1R6XA 2G0TA 3BB4A 1L7XA 1OBCA 1X7GA 4UHDA 2XIJA 3EVDA 2R6R1 3FVWA 3FPSA 1A9XA 4IOJA 5BRAA 2PZAA 4HDAA 5JBNA 4Q1BA 5DSZA 4PAGA 3W8FA 1BIFA 2X5NA 5INTA 1L8QA 2GF9A 5H7XA 4WCFC 4KOEC 3QVMA 3A4NA 1AA6A 3L7KA 5CVCA 3SC3A 2DH5A 1LI4A 2H4XA 2BEJA 3C8MA 3I9V1 4RXUA 3BXFA 1ILWA 2C5HA 5AW9A 1U6KA 5E1DA 2R0QC 2QGFA 4O8CA 2GB4A 2W4QA 1A4RA 3C6KA 3B6MA 2JIOA 3H5OA 1KE1A 1A2QA 1YL5A 4C06A 3TZHA 1T8RA 4Q3EA 1XWIA 1MIOA 1PR1A 1E79A 5GOTA 3RSQA 3I53A 3A6ZA 1KYQA 2D7JA 4MP6A 4UBKA 4ZRNA 2O7NA 5CH5A 3ZY4A 4HNAA 1S2IA 1C7EA 1JJAA 4EDFA 1R18A 3U62A 2GPTA 1C3OB 2XCLA 3O75A 2IHJA 3C7TA 2FN7A 3ZQJA 2QMYA 1HV8A 3V00A 1GAQA 3NCTA 4OHBA 1VJ1A 1Z16A 4NBTA 4EUKA 3NHAA 1TIPA 3GRFA 3V34A 5JS6A 4CL2A 3NTVA 5CPFA 1XZHA 3RBVA 4F6LA 2Q1XA 3CLUC 5FH9A 1IEVA 1K0FA 1N7JA 4M7PA 1SHLA 4QJ3A 4ARBA 1YQGA 3G0BA 3UMVA 2GN4A 2WA2A 2F1IA 5DV9A 4ZIRA 1QYXA 2V7QA 4C3UA 5GADl 4Z53A 2GNOA 1DUVG 3M7IA 3OFNA 1PJQA 1QMGA 2H18A 3RARA 3UZUA 5TGZA 1ZK0A 4EUNA 1GRNA 4P0QB 3WX0A 1Z56C 1PJBA 2P9BA 1KFEB 3C3XA 2BFBA 4G1CA 5F64A 3TSCA 5CLIA 1NM5C 2E6UX 2CL7X 5D3ZA 3EFOA 3IBFA 3ZWDA 1F2DA 1OTHA 1YZVA 3W04A 4HXFB 2J3DA 4RLQA 3VZQA 3PUJA 4MAFA 5JCXA 3D9QX 1JXOA 3QE3A 4JYCA 5IUJC 1Y4AE 5C5IA 2C2GA 3TB4A 3GJ6A 3UK7A 1DG9A 4N03A 2NUTA 4GYWA 4MYSA 3CKLA 3PG5A 4FCTA 3T5MA 3U5TA 3NGXA 3A6HA 4IIHA 2GEFA 2R4QA 3QKSB 3EZ6A 2CMDA 5ALPA 5TPZD 2QT0A 3K31A 4CQMD 1MNAA 3V46A 4QGHA 1SHJA 3PHJA 1VB3A 3HZRA 4F1JA 1XQVA 5I7FA 1E63A 4L8LA 2R1VA 3TR6A 2WTUA 1N33B 2HA7A 2ZYDA 1XVAA 4RHEA 2BMEA 2FOIA 2XCIA 2ZWVA 1USUA 4XQEA 5IARA 5K2MA 3W05A 3ZX5A 1JE1A 5DVZA 5E8JA 4A2WA 3VSBA 3EC2A 4EG0A 2J9XB 4LJ5A 3LHDA 3E9EA 4E5YA 1JG4A 2Q6LA 2QTRA 2Y4NA 3QMMA 5K6RA 1CVIA 1E4YA 3DDHA 3ZVNA 4P84A 1GGNA 2UVPB 3EPPA 5C7OO 3M6XA 1PT7A 4G4IA 3DXYA 4J94A 3GJQA 4BLQA 4CIYA 2W11A 4HH4A 4W8GA 4F5ZA 3ZQ4A 1N1GA 4KQCA 2XEDA 3HKDA 1GKIA 2H4HA 1CD5A 1GCUA 4PWYA 4B3SB 3F74A 3FDZB 3KPUA 3KOMA 1VBMA 4PONA 1Z3IX 2CEKA 1W36B 4MVJM 5FTWA 3QMWA 4TL9A 3KWMA 2FQWA 1GCAA 2EL7A 3RC7A 4BE4A 1RRMA 2Q2NA 4G0XA 4ENWA 3EMBA 1N2CB 4YR9A 2VHCA 4OQLA 1KERA 3THOA 1Y34E 4DXDA 3LD9A 3WB1A 1PL8A 3TKAA 3K9WA 4Y6OA 2UZ1B 4Y9UA 3ZK9A 4G4SO 2AOXA 5L3QB 3AR9A 4KL8S 2OKCA 2PHZA 3INRA 3K5PA 1E9SA 4QBFA 3X2SA 5K4GA 1EFTA 4NONA 1IQ0A 2BR4A 4QXAA 5D3MB 4K81B 5CFMA 2AKEA 2RK6A 4WUTA 1JSZA 1XKXA 4IX1A 4DL9A 1JEQA 2ZGVA 4LMPA 3D8SA 2UXDB 4ED9A 1J5XA 1KJIA 2VH1A 1YR9A 4L1KA 3U5ZB 1L5VA 4YLGA 3FLAA 5H3HA 5LIPA 1Z8DA 4BMCA 2RKOA 3IAAA 2VKQA 1FNCA 1GUYA 2VAVA 1GLVA 3W2EA 5J4HA 3TLXA 2GEKA 3D4NA 1ND5A 2RCYA 2WIAA 1UH5A 4O8ZA 5JSZB 3C7KA 5JPDA 2YQ4A 4BNMA 5IJXA 4WNAA 5AKHA 2W42A 3U4MA 2GBLA 4YGYA 4DGQA 1P2DA 4MI1A 2Q2VA 3BCUA 3ZV6A 4MR8A 1YR7A 4I8IA 1W52X 4EH1A 1U2RA 1YBFA 1XZNA 2G7ZA 2YV3A 3EXG1 4ER6A 1KFKB 5HKKA 4BNNA 5K8VA 1HTTA 1KQ3A 5COAA 3UQYS 3OJ0A 4Q9LA 4X20A 5DZSA 1NF8A 1WZEA 4PHCA 3WNBA 3GPBA 3WLQA 4IGKA 5C1OA 1GCGA 1QZTA 4M3NA 1H8EA 5DHSA 3W8NA 421PA 2SECE 3OOHA 5EESA 2KLHA 5E1MA 2AG5A 4UHJA 3TBFA 3G79A 2LDBA 3ACCA 2ZPUA 4GZ5A 2C9MA 3GQVA 4OATA 1RRGA 3RUFA 5BNZA 4BLVA 1J22A 4TQ9A 3JQRA 3WFIA 5KTYA 2HBRA 2JK1A 2QYSA 4AUMA 1YZNA 1H22A 2JFPA 5DYIA 1V9CA 3PNQA 5LQMA 1CXZA 3OMLA 4ZQCB 4X64B 4X8OA 3Q6MA 1XTTA 1LPBB 3KXPA 5C8YB 2R8OA 4OHXA 3DKPA 4GH5A 4NCXA 4RFVA 3HDVA 4A1OA 1HYEA 3MB8A 3HNPA 2H31A 2VHEA 3PUWA 4ZJPA 1PEYA 2N42A 1L1QA 2PZKA 4HMPA 1RCUA 3DOHA 4N5IX 5AK3A 1SVNA 1EX1A 1XIVA 3N6VA 1OKKA 4AJIA 3REQB 2A86A 5I9TA 3QEBZ 4IIUA 1B00A 2ZT5A 3TNJA 1LH0A 2XUDA 1T4CA 3EGXB 3RS9A 4O2BA 1DO2A 2H52A 2RI6A 4NDZA 4UHBA 3R6TA 1TLTA 4OU5A 1TZCA 3LIPA 2VLBA 4TUYF 5EI5A 4YCLA 2WAYA 2IDKA 3ZBTA 3ZDXB 5AM3A 3VPBA 1J70A 3WMFA 3WDMA 4BVHA 4C4RA 2HO4A 3OU2A 2FG7C 3N86A 4S1TA 2GHQA 4TLBA 2ZJ7A 3A37A 5J5VA 3VR4A 4C88A 5J3JA 4CDGA 4EJSA 2P0AA 3A4YA 3L46A 3DDZX 4R7TA 1CUUA 1HEYA 3AB7A 4I4TF 4H4CA 1Q0UA 4IXWA 2GAAA 3LC7O 1GNRA 3QK7A 1QGOA 5IK2A 3F9RA 1ZCAA 4QXRA 4Y1GA 2GSDA 3QITA 4OB8A 4D97A 1NBOA 2IOYA 2EFJA 1DAFA 1LBQA 4UEWA 1ZU4A 5ABPA 4KITB 4HAZA 5B7NA 4O2BB 1T0HB 1ZD2P 4O4LB 3WWPA 2Y1GA 3TI9A 4HS9A 4R5HA 1P4GA 5TR9A 4H1WA 4YR7A 3UTCA 4IO0A 4IGAA 3NTLA 4NOMA 3MPOA 1T5SA 4NPAA 5F3DA 1DQRA 2WAMA 1LB1B 4PNPA 4B40A 1CNMA 2Y1KA 1JHDA 2DHCA 1XKLA 1J42A 3LFTA 4EJSB 1P60A 3BSYA 2R68A 3AG6A 5SYNA 2HF9A 2G82A 2Q5LA 3RHSA 2EV9A 2A3NA 1JI0A 3NFRA 4IKOA 2ZXEA 4DR1B 4LSGA 5DE3A 3KSBC 3UATA 1SUWA 3SMQA 2WHEA 1E2IA 1TK2A 2Q9BA 4WOBA 1SZPA 2WD8A 5FYDA 3RGWS 5KYUB 3ZHRA 1BQ3A 4I1IA 2C5AA 5IUNC 5P21A 1IVYA 1FFYA 2P4HX 1QQBA 3E82A 1U3VA 4EG6A 3DV9A 3MMZA 3IKTA 1FBTA 5KCMA 1AKQA 2VDMB 5TMEA 3R76A 1G4UR 2ZBDA 1L5QA 1J20A 1HFKA 5A2GA 4H18A 4Q1EA 1Q57A 1CZNA 2HJ9A 1D7AA 4CDRA 3C1TA 2BBWA 3KTOA 1VGVA 4IEFB 5DM2A 4YUWA 2WFZA 1DHTA 4IVPA 2QAGC 3PEYA 3D2LA 5KTSA 4GUAA 3WB0A 1TK9A 3GRZA 3ZR4B 4MAAA 1QFYA 2ECFA 2ZYWX 4P4TA 4G5XA 3DZCA 1M2OB 1ZEJA 3PNKA 4RXMA 3V2GA 4L3OA 3VPAA 1M7BA 4DV2B 4QGGA 3ZD8A 4QVIA 1RWQA 4MDYA 4R8VA 3VO2A 4FKMA 4Z3DA 3FHTA 1DEXA 1SUPA 3M0EA 4KIUA 3PQEA 2RSLA 1ST3A 4LXIA 4GVLA 4E2XA 4RKWA 1HYHA 2V98A 1AQUA 4E7PA 3H83A 4DUGD 1ODKA 5B2EA 3P0JA 4U9IS 4DF3A 1JMYA 2VJQA 3EGIA 1NQAO 3IMGA 1AM4D 1KC3A 3JRNA 4FZJA 1G2PA 3WHKA 4FTWA 1VPDA 2JFVA 3A1FA 3I6BA 1D1TA 2OCXA 1I2ZA 1YRAA 2HT6A 2QE7D 1EFRD 1KJYA 2ONZA 2WHRA 3FSRA 1E6WA 3TLJA 1JWBB 1Z0JA 4RORA 4DMUB 5JAOA 3NHJA 5JLAA 4EY5A 2J5XA 4EO7A 3B53X 4TRNA 5T7BA 2O8FA 5JUWA 4RPIA 3FAKA 3HCCA 4KVAA 5EUCA 4ZOLF 5TEWA 1DG1G 4HPXB 3LDFA 1DWQA 1J23A 1IUKA 1X42A 5DLPA 1T9HA 4DWWA 4QDJA 5BQ3A 4YK7A 3FXAA 3NG1A 3HN6A 2YFQA 2GBIA 2Q45A 3PXBA 4MB6A 1OLXA 4BRZA 2ZREA 3IODA 4DDWA 1VTKA 2FPGA 4RHUA 4F7DA 3KSDO 3O1JC 5AKXA 1V37A 2ZT6A 4BFYA 3VVMA 4BRWA 3VOBA 1YL7A 2X77A 1JG7A 1OAOA 1VBNA 2JEOA 5G4LA 1EYZA 4P4LA 4XIIA 4KQEA 5ANRB 4BLWA 2I6FA 2Z1MA 3PB3A 4JDPA 1EM8A 2CNDA 3S8YA 4J90A 1SKYB 1Y98A 5BPHA 5DNUA 3UPUA 3NEPX 1KSHA 2JJ8A 4IS3A 5KSYA 1ZJZA 4Q1CA 4UU7A 1A8PA 1NVXQ 3B8EA 5EYPA 4AECA 2V3CC 1KEZA 1VIYA 2G8NA 3PX7A 3PL5A 1AC5A 4D8WA 2ARKA 2HCRA 3G6WA 2VK1A 3NHKA 1CU1A 1ZM2A 1Z5VA 1H8HA 1JVBA 5E0OA 3BH7A 1FF9A 1AG9A 1R3UA 1XMSA 3NO4A 3UICA 1WCIB 1NTOA 5LUBA 5AW0A 1O97C 1M6EX 4BFLA 4ZDJA 2P2ZA 1XU4A 3FN4A 3F3YA 3P9XA 3ZWYA 5L40A 1DGQA 1T0JB 2QRLA 2PTHA 4A6XA 2L19A 4RAOA 2FGKA 4G56A 3QQ5A 1J00A 4MARA 4ZV9A 2OYRA 2F8SA 3K4PA 1CRPA 3O84A 3AR2A 2JEYA 2WU4A 3R5TA 5TF4A 5D2CA 5FWYB 5THKA 2ASVA 3GQBA 4AS2A 3PQ7A 4B4KA 4OXKA 2WM9B 3AEQB 3VPDA 4E7OA 1N32B 3GU3A 5DP1A 1BU5A 5CB8A 2G3YA 3A8TA 3KB6A 2IRWA 5KYXB 2W83A 1CUIA 1QE3A 1SCNE 2VT6A 3B5EA 4HVLA 4KXYA 3QY0A 4RF2A 4DQVA 5KSZA 1CUXA 3FBGA 3IULA 4UUQA 3S27A 3IDQA 1V5WA 2OBXA 4MVJA 2H8KA 3X1JA 4QDOA 1CJTC 2R2GA 4V0ME 5U1PA 1A2OA 3L7YA 4HLDA 5GZ1A 2O8DB 2WG1A 2QQFA 1M2JA 4NAHA 5C32A 4EKYA 1TYAE 2IUFA 4QDUA 3VH4A 1R3DA 1IEWA 1KYVA 1TK3A 3AT1A 4KLAA 4YHBA 3QV2A 3B3JA 3EGCA 1KEEB 4E5VA 5K5EA 4TL6A 1XCGB 3TCXB 3G0IA 1LRJA 2ZYHA 4JUBA 1RRCA 4X61A 1BDIA 2AZDA 1V9LA 3ETDA 3R7SA 1X2BA 4WCDA 2CJYA 2OORC 4HWRA 4V0QA 4ZU1X 1QYDA 2OP0A 5B3JA 2HL6A 4TKUB 3ROKA 3JZMA 3T7AA 2J4CA 3TRHA 2A9RA 3I30X 4G1FA 2UV8A 3COJA 1P6QA 1DRUA 1ZK3A 2X2FA 5FKJA 2C83A 4Z1MA 3VH3A 1LS1A 5BVGA 1WBBA 2BV3A 5F5NA 4DJEC 2BM9A 4JLJA 4RV5A 1H0HA 1QLJA 4HNTA 1DTWB 3MZ0A 1NT2A 1RKVA 3G1UA 4X95A 3SIRA 2BMDA 3OPNA 2H65A 3AJ8A 4PAQA 3K9FC 1XNHA 4DRYA 1TTTA 5M29A 1J9EA 5F9FA 4PC3A 3H1TA 1L7PA 1EWTA 1ZVKA 3CG4A 3WLRA 4BV8A 3L0SA 4DM4A 4EIWA 1VL6A 2XRYA 1G60A 2LCFA 2VAMA 1TECE 2EEPA 3EG9B 3PA6A 1MOQA 3B1YA 1JR4A 3K1TA 4Q19A 4TVKA 4WJZA 1A5SB 2C2HA 1BRMA 4IIBA 1ST2A 5F5LA 5CLFA 1FU8A 4CQMA 3WNQA 1G3QA 4BWGA 4NX2A 4C1BA 3INTA 4OGLA 2XWJI 2JVKA 2QD4A 2WA1A 2UVDA 5E4YA 1QG2A 4EARA 4HWTA 1UP4A 4KYUA 3I2IA 2ZCJA 4TQUS 3Q3JB 2I87A 3GRYA 2AN5A 3I9OA 3D64A 9GPBA 1EDOA 1UT5A 1NSTA 3IC5A 4OUDB 3PJGA 3A14A 2CLOB 1AA9A 3L5KA 5D6NA 3PR3A 1IY9A 2BBSA 1J0XO 2O0HA 3DVAA 5U4QA 3FSGD 2EX1A 1FTNA 5GINE 3D4OA 4DGSA 3KV3O 3B8HA 3IH5A 1X8XA 1CLUA 2QG4A 5JY1A 5K8IA 3DVQX 5AXDA 3A4TA 1QHIA 5ESRA 4JXXA 4BEWA 2ISSD 1PQUA 2Z83A 4JBXA 4JOCA 4COKA 1BX0A 2J8ZA 3T15A 2GCPA 2C54A 5F12A 2PUFA 5D1HA 4Z8YA 4RV4A 2PQMA 2VSXA 2HRZA 2QRPA 2V1XA 3SC6A 1HZZA 4RTQA 3S2EA 3VJRA 3Q12A 2A30A 2CCJA 4HLUC 3M2TA 4M0EA 1P1HA 3H7IA 3TIGA 2WUWE 1D4FA 4NCIA 2JCYA 2J1LA 3GGJA 4MS1A 5BR7A 4Z0HO 4U3JA 2ZDGA 2FLVA 3RIMA 3QX3A 1Y8QB 3DSRA 2CJWA 1CDOA 2I2BA 1G63A 4ZHQA 3KJFA 2WJAA 4H59A 3WK6A 1QGDA 2P2GA 1V11B 5KVSA 7MHTA 4NFHA 4A8PA 1W2GA 4OAOA 3UBMA 4UTZA 2HXYA 4PY2A 1MBZA 4X90A 2HW8A 4OIMA 4MKGA 1SA0B 1XL1A 2CUZA 3K2IA 4GZMA 4K3UA 1E79D 5ALVA 3B3QA 2B30A 1FW6A 1YWGO 3PUHA 4PRZA 4I4CA 4S24A 4CF6A 5BQPA 1S3GA 3TRDA 3WKBA 3UA4A 4H35A 5BSEA 2PA3A 5JANA 3TFOA 3N8GA 5DI3B 2XB8A 2DPXA 3K92A 5MGNA 2NIPA 3IT0A 2GTPA 4YCCA 4QBIA 4MVJE 2VTDA 2I66A 2KM1A 1K8RA 3BGDA 2H85A 1GQOA 4RGBA 3N2NA 2CVFA 3H5WA 1JHAA 2GZ3A 4WBSA 4KYTA 1Y1LA 3HKDB 5GM1A 4DBLC 3DFZA 4DV0B 4OSEA 3W2IA 2PWAA 4IDCA 1CUSA 1I6LA 4TV9B 3TKYA 3EBOA 4MGEA 1W8IA 4M86A 4OHCA 2BY4A 3DDSA 5AJWA 2JKYA 4K6FA 1PTJC 4FD2A 1WTCA 5CIQA 1ZMRA 1X1BA 2HYDA 3KQMA 2IYEA 5AFSA 2B3DA 5FI0B 2EZ9A 3HVIA 1USGA 1N2HA 3R0XA 3LKDA 2PGJA 3CLHA 2IZZA 1NFFA 1VKNA 4EENA 2XECA 3IL2A 5EQDA 4Q93A 4DIEA 1L4GA 3NHMA 1Z0IA 3OMXA 2B6HA 2C7VA 1B6GA 3LKBA 1Z6PA 1UPBA 3FMOB 2A5DA 4Z9YA 5A4AA 5HK9A 3SD7A 2TRSB 1WVIA 3PD0A 1RXYA 4OHRA 4CMKA 2FX3A 2VF5X 3D3QA 4H15A 3H84A 4NOJA 3U17A 4IDAA 2J32A 3MTBA 5EIAA 2LUOA 2Q9AA 1H0KA 3HFRA 3P9PA 4XXHA 1GGEA 4Z4QA 3PVZA 5TQ2B 1BKDR 1M8FA 4EK9A 2YXLA 2F3SA 4REQA 2ZVPX 1U2ZA 4DNXA 2Z9BA 4UQLA 1PE0A 1VBKA 1Z7EA 3DP7A 4BU1A 3S5JA 3UH0A 1MOSA 4LZNA 3RO7A 4KR0A 5EZSA 4YRZA 2H48A 4MV9A 4GDFA 4FOLA 5D00A 1KQOA 1E7WA 3DR5A 4CPDA 3TSZA 2RHBA 1QB8A 4O5AA 4WI1A 1KPHA 3QVGA 1SOAA 1T4BA 4BPBA 5AP9A 3UWPA 1ETUA 2PS9A 4QJIA 4ZVNA 4WADA 4CMCA 3OI7A 1T43A 2XA2A 3EUWA 4Y7DA 3RSZA 3RJ5A 4CL0A 4CU2A 3K0FA 3VR6A 4LXGA 5G3ZA 3WYDA 4YLEA 1I0ZA 3E1SA 2I76A 4V0KA 1UQTA 2D5IA 3N5CA 2FQ1A 3KPWA 5JSFA 4ZT4A 1E3WB 3TXAA 2PZFA 4ICIA 1MAVA 3TJZA 1IJKA 3LLSA 5EJ5A 2YQ5A 3B48A 4Q9AA 4UW9A 4ENSA 3UNXA 3TSYA 1XHLA 3KJQA 1Y3AA 5EJIA 1NQOA 2C59A 1UC4B 2HAEA 3DO8A 3KFVA 4L2IA 3ZH9B 3ZWCA 1ZO8A 4CT5A 1I9GA 5DM1A 3AR5A 1EFKA 1ZD4A 5FEMA 4ZAGA 2OHGA 4TTSA 2J07A 2BHNA 3AVTA 1E5LA 3NIWA 5JD3A 1G8PA 3CLSD 4ZO4A 5CXSA 5JAPA 4AKHA 1HDCA 1XEWX 1LBEA 2O1SA 3V7FA 2ODPA 2J5KA 1E9EA 2WR8A 1MCZA 3GGPA 3DMHA 1XTIA 3GN1A 1D2EA 3K9CA 4EUEA 3IAUA 1U7DA 3DFMA 1D6NA 1YZGA 2GBFA 3AM3A 1BS9A 4X60A 1W4BA 1EK2A 3O4FA 2O0JA 4GM1A 4X3OA 2P79A 4L9RA 5DBEX 3CX3A 2D0IA 3E58A 1O0BA 2WEKA 4AWXA 4J3FA 3D4BA 2J31A 1YKGA 3KAKA 3DKVA 1FL9A 1F8FA 1UM9B 2XT9A 2W2QA 3LBNA 4M76B 1RE1A 3VRHA 5IDQA 3OT1B 4OP2A 4TM8A 4UEQA 5A05A 5JWHA 5CB4A 2XKJE 2VF8A 5K8JB 1SQ0A 3TE7A 4DYVA 5JJ5A 4XFJA 1L5GB 2VH2A 3DEYX 2PWZA 1DV1A 2I3DA 2DFLA 3EXAA 4MZXA 4KV7A 3T7KA 4S05A 2IH5A 1Z33A 1WQ4A 5FPKA 1JDZA 1WO8A 3DZ8A 4K6OA 3MSXA 1O96A 2XVAA 3AOEA 5JECA 7MDHA 4CM9A 1D5CA 1YC5A 2AE2A 1UPUA 3A26A 4Z4EA 1KJZA 1I6MA 2WI8A 4J8PA 5KKAA 3M3PA 1PD0A 1G8HA 3FNIA 4QYSA 4F21A 2JAHA 4DLLA 4Z49A 5B4VA 2VHJA 1ZXLA 5JSZA 2ZYAA 3CEAA 3MAGA 1JEJA 3SR3A 2TECE 2Z08A 1F4VA 1UDBA 2RCNA 2VPIA 5CG1A 5LWHA 3T1VA 4F4DA 1KYIA 2J4DA 2RG7A 4FYYA 5E6SA 3PV0A 2WHPB 4RQBA 4BNJA 1SGWA 1YQTA 2FTKE 2GTIA 3P27A 1BA2A 5L95A 2JGDB 2OXRA 1IWBB 3F0TA 4B9AA 4D42A 2ZKLA 5TT0A 1XNGA 5J4YA 2Z2KA 3C5VA 3I6QA 1BXRA 4Z9AA 4C4SA 2FE1A 2D4AA 3QYPA 4I6EA 4XVHA 1R6TA 5JT1A 1PDVA 4X66B 2JFUA 1EP9A 5E6RB 3GO4A 1IHYA 2DY0A 4RHYA 3G85A 1PGPA 1XR3A 2BMFA 4RH3A 4RA6A 2BUBA 4YY3B 1SKUA 2IS6A 2I5PO 3OEHA 4R1QA 4EGJA 1U98A 2W4IA 4QOJA 3FDFA 5L45A 2QVXX 5HIJA 1YBAA 3AVOA 4YAJA 3S68A 5CDFA 2IHKA 5JARA 1VXRA 2IVFA 1EINA 4X1YB 1VPEA 3BH6A 3MA0A 4FDAA 4YCJA 1MOZA 2AW5A 2BMVA 2HWKA 2P67A 2R8RA 4I9NA 4QLBA 2YWCA 4F9GA 1NBWB 1RBQA 2CLDX 2QD5A 3DOCA 3EVNA 4FN4A 2QDXA 2VDWB 4QXOA 3MWLA 4YIKA 5CR9A 4EI8A 1TNDA 3O1HB 3A10A 3BWCA 3A9UA 3KSRA 4NAUA 1Y7LA 3AU9A 4RK1A 2R751 4OJNA 3I8SA 4DKJA 4YP6A 4FDVA 4JJ6A 4GBED 3NUGA 5CW1A 1AU9A 5AVKA 3BGWA 3REGA 1P7PA 4UNSA 5JDCC 3SMVA 3N0TA 3LC2O 2PZ8A 4WHMA 3RFXA 3KJHA 1TX4B 3AV3A 3ICPA 2QY9A 5FD8A 3WRXA 3ESQA 4D7AA 1AJEA 1YJ5A 4NBNA 4NL4H 3RRJA 3E9RA 4KLCA 3VSDA 4Z7OB 4C7OB 5BQXA 2ZSIA 1E1KA 2FPIB 2W6JD 4MR7B 2E4YA 3IAM1 4QVGA 3WYAA 1HWYA 1WXQA 2ZU0C 2WF9A 3NIDB 5SZHB 3GWZA 3E2MA 1GSAA 3B6JA 5A7HA 5KDDA 2OQVA 2RGYA 4P5PA 5C7IO 2HFKA 1G8SA 1PX2A 4WXYB 1ZWKA 1X13A 5JVDB 4ALIA 5FLYA 4F2PA 1CFJA 1FYEA 3KQHA 3LT4A 3ONVA 3C3WA 1PGNA 2VPZA 4GPBA 3HKBA 4NVRA 4YJDA 2C4KA 1QBGA 3WBJA 5COBA 1OXSC 5AW8A 3B6EA 1BW9A 2LNDA 1TJ4A 4LSMA 4JUIA 4QBGB 2NUBA 3KFXA 4LJKA 1TQ8A 1TM1E 4JJGA 4KU4A 4Q66C 5FBLB 3A6PC 3Q7EA 2J7PA 4OYRA 1A98A 3HVUA 3PYXA 4AROA 3PD1A 4CKBB 3GJ4A 1EZ1A 2Q5HA 3WIDA 4J7AA 4XEHA 1SXJB 3CUYA 3VR5H 2GJSA 2Z2XA 4GO1A 5EEHA 4B85A 4HAVA 3AERA 1RXIA 3QNWA 2YINC 3VKWA 2QVCA 3IP6A 3FTDA 3DVSX 1YCGA 2XKBA 5T6BA 1TPZA 1UOQA 3MLAA 1K9VF 4PQGA 3INYA 3A31A 5JYBA 3CC8A 1D1PA 1K75A 1R8QA 3E7WA 3DQZA 1NU6A 2OD7A 3BMXA 1YVRA 5AQEA 2IWRA 3LUDA 2JA1A 3HEMA 2BFEA 1QH8B 1UJMA 3NHLA 1X7HA 5H1YA 1PW5A 2ACWA 2GUGA 3KFLA 4KI7A 5FIUA 1II0A 5TNXA 2A5FA 3U0BA 1MTZA 3HZOA 5K3BA 3ELBA 3JD4A 1KAMA 2YOFA 1PQYA 5EHIA 7REQA 3N2KA 2ET6A 5KYWB 2VEDA 4JX9A 1A7UA 4HMQA 4E2YA 1TGYA 3EA5A 4DBVO 2FW8A 3OIUA 4J0KA 3KBOA 3CLRC 2D5BA 3I12A 4QLAA 2HCJB 4L16A 1X3SA 4D9JA 4YMLA 5FBWB 3IQHX 3U19A 1YR1A 4URHA 4II3A 5HZHA 3QUBA 4P38A 3URKA 4B6RA 2GERA 1DC8A 3AZOA 2VDKB 2QWXA 1Z25A 1M2KA 2AFHA 2NVOA 4PAOA 4QJ5A 2HIGA 3V7WA 1NW4A 2C8JA 3AB8A 3BWBA 1XXHE 1U02A 2B1RA 4Z86A 3D5EA 5AK5A 5A3RA 4B4OA 4Z7NB 3MERA 2P4UA 2CD7A 2HY7A 2FW9A 3VX4A 2GLXA 4EW3A 4CKXA 3IYLW 2XOXA 4F38A 3UGKA 5KVVA 1MG0A 3DXZA 1XVVA 1MUUA 3FOCA 1EHCA 3LL4A 2X9NA 4MVYA 1N7GA 4RVUA 1ZWLA 3OCYA 4XGRA 5KNLA 1WNFA 5CLJA 3QLJA 1Z6YA 4WVLA 1GQSA 4MVXA 3KL2A 1H9CA 5CP8A 1N5IA 1RJDA 2QAGA 4E12A 4HH0A 3K2QA 4K28A 1DKOA 1OX4B 2MINA 2QROA 4G97A 3UUWA 4IIDA 1YK0A 1FP2A 1TYCA 2ID9A 2OVBA 2HDWA 4TT3D 3O91A 4KQFA 1A4UA 2RHCA 3PQCA 5JMPA 2WFLB 2F1KA 3LK6A 4TV8B 5DKFA 5ARCA 3WGOA 4HGOA 2C7OA 1QRSA 2GI4A 4GOJA 1WHTA 4UMEA 4C5BA 4OV6B 2YL2A 1H6CA 2Q3FA 3ENQA 4N1AA 1YOVB 3FZGA 3K0KA 3RV4A 3SVZA 5JQWA 1COZA 1ACJA 1ZUNA 2ENUA 3ETLA 3FMGA 4FXPA 1ECLA 4JA0A 2VQEB 4K0KB 1YQ9A 2BFAA 2C8KA 2FN3A 3JVUA 1L7NA 4OMDA 4DA0A 3OJWA 3S8MA 1MP0A 1Q19A 4W8OA 4EY4A 4G0VA 4BMVA 3E5MA 3OEEA 3H42B 3OO0A 3EJ6A 1U63A 2OZLA 2NT4A 4Q9KA 5TS2A 2WNHA 1G5HA 3LDGA 1PSZA 5K3CA 1N5LA 1V4VA 2Y71A 3NEJA 2GJ8A 4R8MA 4AKIA 2BC9A 5D3MA 3WHIA 2AW3A 3GZNB 1BS2A 1YA8A 1Z0KA 3NYQA 4S1VA 3ET5A 5A9SB 4OQEA 4DCOA 3UC9A 3HV0A 4GAEA 4NWIA 1M0EA 4LJ8A 4XWTA 2O07A 3HXQA 5MDHA 3DAHA 1QQTA 2FRDA 4F97A 4KXNA 2GYWA 3TW6A 1P2GA 3VU9B 4BP1A 2PX6A 3UAWA 1KAHA 1ZUNB 3OICA 3RLFA 4G5SA 4KJXA 5CB4B 5JS8A 3V4ZA 1EX7A 1I2AA 4RU1A 3N39C 5DB4A 2AS0A 2OV1A 3BWXA 3PC2A 3U7JA 4BNDA 2ZOSA 1XQXA 2IYNA 3HV2A 4JB3A 4TX1A 3ETEA 4B8WA 3L7AA 3D43A 2PMDA 1G0NA 1R0BA 1O58A 1EFLA 5EXSA 4Y9SA 1C0IA 1VCHA 1U8XX 1G66A 1YFJA 2OZEA 4DV1B 3F90A 5FEUA 1N0WA 2FPRA 5HFAA 1B0AA 1Z5PA 4L6AA 4O2AA 2PH5A 4DHEA 5GVSA 4ND3A 2ZAOA 2BDTA 5HS6A 1BMFD 2YBDA 4MUHA 4B3DA 2RKBA 3QX7A 3TOXA 1DXQA 1BFKA 1W94A 3K3PA 4NTZA 1YFLA 1WKBA 4Z7QB 1RAHA 4KN6A 4ZVTA 5K0ZA 5IP5A 1NBMD 1Q12A 2E18A 1NMZA 1OH6A 4AS1A 4X3CA 3AKZA 4BNUA 1ZSVA 1VJDA 1E3DA 3JV7A 2FDCA 2P5YA 1AQ6A 4IIJF 4JMLA 2E4WA 1UXOA 3A58B 3AUXA 3L8ZA 4PO1A 3QU5A 4PXYA 2XTJA 5J5CA 5C4GB 5A02A 4OYYA 3W7BA 4A23A 4DWVA 2E4AA 2DY1A 4C89A 5F2EA 1XCJA 3CF2A 4GRIA 3GLIA 2ZWMA 4L4YA 4BCDA 4NYMR 4WEQA 1E1MA 5LFAA 4NFLA 1AV7A 2VDUE 1ZH8A 2I6SA 4RIIA 3O3NB 4EPTA 2I62A 1Z47A 3O8BA 4RIFA 3I9FA 3NR2A 4PQEA 3EARA 2IPAB 4TMVA 1NVVQ 5ICFA 1U0OC 4Q3AA 4MKXA 1IVSA 2JJ1A 1VSQA 4BGDA 3DAOA 3FYUB 1DOHA 1GPNA 2GMWA 4EO9A 5DBHX 1IZZA 4C7XA 4NZ9A 1U2PA 2HSJA 2DQKA 3ESZA 3HO6A 4LZLA 4MLZA 1EWYA 5BRJA 3SZLA 2JLZA 5JSYA 4GPEA 3ELWA 1NVUQ 3K4QA 1Z74A 3RYTC 3P9RA 3ZHCA 4AJEA 2QPTA 1XDBA 1RYYA 4GMHA 3SQOA 3P4YA 3HYNA 4M7WA 4BMSA 1OTYA 3GGSA 4FFOA 1WG8A 4KSYA 2Q3LA 3JALA 5F5XA 4HZIA 3D8HA 1E2GA 2K5UA 4LG1A 4P7FA 4MI6A 5DX8A 3BORA 3NI2A 1PCXA 3QVUA 3PPXA 1CRLA 5KSOA 2B0JA 4UHKA 3WLAA 1SBHA 2XOKD 1FUYB 3HRKA 2W0MA 2GK6A 3L8FA 3PYLA 4QO7A 4AAYA 3L6RA 2CT8A 1U80A 3KPJA 4HRVA 4UCXA 3RYHB 3CINA 4XUDA 1DT5A 3ANLA 2BGMA 5A2QA 3VYUB 1XT6A 2BEUA 2FP4B 4HEHA 1W88B 2I0FA 4GNKA 5J47A 2J0SA 3DAFA 1Z62A 1I4WA 2VDJA 1A69A 1B41A 2NN3C 3Q8LA 5LXTA 2I03A 2XE6A 3PP8A 1AY0A 3ANNA 4JC5A 3TG8A 2I8LA 4E30A 2XTZA 4CUKA 5C18A 5LJLA 1X7YB 2FR1A 1A96A 4ZCLA 3UKDA 2ZR7A 3WGMA 1PL0A 3U4GA 4O63O 2CFCA 3V8VA 3HB4X 1QK3A 4ROTA 2NZWA 1NKSA 4PNHA 5BV0A 1P1KA 1N5JA 5HIIA 1T15A 1S8AA 1QZZA 4QDZA 1JQDA 1SCUA 3HFJA 1OFHA 4N41A 3N70A 3VZSA 2VK2A 1OZAA 4CT0A 5CM9C 2G36A 1NLUA 4H7FA 4PLVA 1FU4A 4RK0A 3SCZA 4Z3KA 2O8BB 3KYCB 4RL6A 1N2ZA 2IPLA 2ZR0A 3EF3A 3IFSA 1R50A 3MGGA 3UANA 3ZOKA 1RBZA 2O3UA 3HYCA 4ER0A 3VNSA 2A9KA 3I6ZA 1PR2A 2HLHA 4C14A 5AUNB 3TL2A 4J75A 1JG1A 1CUAA 2C2KA 2YZ7A 1KA9H 3N0VA 1RYMA 1E64A 4HYTA 2GYYA 3RVQA 4KQWA 2NUPA 1QC5B 3PQFA 2PN1A 1G7SA 3G0HA 4L6IA 3ILSA 1RZ3A 1OR8A 3Q3GE 4PIMA 2DETA 4NE7A 2OGUA 2SCUB 1IZ9A 1O95D 1OLSA 4IMRA 4K8OA 1GG2A 5KQLA 2R2AA 2AJBA 3H65A 1F7VA 5K51A 3ZIDA 4P7BA 4X94A 4BQQA 3UK1A 1P0FA 2Q7DA 4J6FA 4JYPA 2D1FA 4RQUA 1JPUA 4N39A 4TPKA 5DISB 1KKLA 1U3DA 3MJSA 3QFTA 4RMHA 4KFSA 4JXZA 2GZ2A 1WXGA 1E20A 1I7LA 1Y9ZA 1GDDA 5LOVB 3EN0A 2OXTA 1RWBA 3K0AB 4O4JA 3L05A 3UK0A 1MAUA 1PGQA 1Q7TA 1IE3A 2VJNA 2I4TA 2OT3B 4B5LA 3VR3A 1LFAA 1G4HA 1ZIDA 2FPPB 2OHHA 3JARB 3KUKA 4RSHA 4A26A 2SHKA 3CRVA 3IAEA 5DN6A 1T8TA 2G07A 2G08A 4ZYWA 1RQPA 3SR4A 4TS9A 4H3HB 1Y42X 4YRQA 2QU7A 1P3Y1 2BGLA 5FTLA 4DR5B 4YAWA 2ZTUA 1IH8A 3QF7A 2J3HA 2SKEA 1NRXA 1Z4MA 1Y4SA 4KB5A 4QX6A 2EG5A 3QV1A 1EXDA 4DEYA 2PU7A 5CJPA 2OV4A 5EPOA 3BHJA 1JHZA 2VP9A 4MB0A 1TQ4A 1JUDA 1U0RA 3QPAA 4LDZA 4EEXA 1M33A 2O1WA 1KY2A 1OAAA 2W71A 1HDYA 3DGEC 3EW9A 4MVJI 4YRTA 2PWBA 2ZROA 3C8HA 1L3CA 4KKVA 1M1YE 4LHZA 1G41A 1D5WA 5H3LA 3EPHA 3KL4A 3OQIA 3UF0A 1M7HA 2WMOB 4PLHA 2P11A 1JT9A 4ECAA 4DWJA 5G41A 1MNQA 3NETA 1PJZA 4CM7A 9ABPA 1X3LA 4KAXA 3HJRA 4WN9A 4GWGA 1SC9A 2VTEA 4MGIR 2R62A 1BXRB 3FPEA 3PNSA 1JHOA 1LSOA 2BN4A 5D7NA 1RAFA 4Q24A 2XB4A 4H17A 1XJ0A 2YFHA 3ZD9A 2QORA 1AF4A 1E3WA 1JIIA 1KO7A 1L7EA 2JAQA 4PYKA 3D02A 5DHPA 1JEYA 1EK6A 3D59A 4EKIA 5KC8A 2QBYA 4Y30A 2EKLA 1THTA 2DLCX 3KDPA 1H93A 4BUZA 4Y0NA 3S29A 2J0UA 1W0KA 4S2UA 4BFSA 3RAEC 3GNTA 1UKAA 3T1YB 1GM5A 4IZOA 1XU7A 4TYMA 3ZE6A 4FB4A 2LDXA 3EFBA 1KTIA 4BFXA 3RUPA 2JFFA 1U90A 1UBHS 2R7AA 3DLTA 1IHDA 3VM6A 4LHYA 2O2EA 4JH0A 1ENZA 4JU8A 2BKXA 3WLHA 2J3JA 3H0EA 1T3HA 4AKSA 3JR7A 1OQAA 4G6ZA 1QH0A 2HBQA 2VYNA 4BNIA 3UT5B 3BCSA 1XRLA 2H9IA 2YHBA 2PX5A 3RAGA 2WE7A 2ZQ5A 2C29D 3AGQA 3UJAA 1V5IA 1CC1S 2WJIA 1X9HA 5C37A 3BDVA 3GCDA 3PHHA 5CA1A 1PFGA 5K1ZA 3I6MA 5FWYA 3ST7A 2WWRA 2HK9A 1CZOA 2WJ3A 1V1RA 3GEIA 3I37X 4KAJA 1YZYA 2XNJA 3TZLA 5HW0A 1SIWA 2H2WA 3V5NA 2D3TA 1RWOA 1VMKA 3K72B 2D74A 5JZ9A 1W4CA 4PC6A 2W8BB 4WPGA 1KL7A 2KB0A 1DKMA 1RS0A 1X9GA 4D0NA 3ENVA 4HRYA 3Q72A 4LRYA 2PX2A 1U8ZA 3AFIA 4DCJA 1M0SA 2IUYA 2ERXA 1F5NA 3K9NA 5IKXA 1Z0ZA 2H51A 2ZUVA 4CM4A 5ALIA 2H5EA 4JB0A 3ZYZA 4PTLA 3GL9A 5U4XA 3UENA 3UT5A 1R16A 3A9SA 4M88A 3K7EA 1F0PA 1QFXA 4DT1A 5DCWA 1ISGA 1FRNA 4M37A 1LS6A 5ERGB 2GD0A 2SNIE 4WZBB 1N6RA 5TE9A 2BGTA 5AHWA 1PV2A 1MJ5A 1N57A 2JHGA 1CK4A 2C3YA 3AUTA 1O8CA 3H3FA 3O2SB 4DMCA 1NRIA 3CZRA 1C3LA 1Z4NA 1C7JA 1LDYA 3FHCB 2IX9A 4EVIA 3EAFA 1WXIA 1SCQA 1Y7PA 4GP6A 2H08A 2VQDA 4O2AF 4RHCA 2O7RA 5CEEA 2OWDA 2AR7A 3H05A 1AVTA 4OLAA 821PA 4ZRDA 3ZDFA 2PGDA 5IJ0A 2GCNA 3ZV5A 5EZYF 2V5AA 3DHWC 3C1AA 3M5DA 1F8YA 1EDEA 4NR0A 2NZUG 3V32A 1MZVA 1S8OA 1I3OA 1FSSA 1JX6A 1R74A 3SJ7A 3T06B 4GVXA 2PD6A 4A8JA 3D1VA 3LV8A 4LRXA 3UFBA 1G3IA 3IB3A 3VC3A 2AR9A 1VKJA 1YU6A 4CZ2A 3TQCA 3AETA 1PVDA 4MJXA 5BN5A 4KIWA 3G6KA 3H9CA 1JI3A 1R0XA 3PGJA 1DBRA 1W8DA 1TM5E 3T9EA 3PTZA 4B3IA 1BX1A 1HM5A 2J3MA 3L1KA 1DCTA 1EVJA 3EEBA 3GAAA 3FLBA 3HL0A 3R5FA 1ENOA 1ACLA 3RFFA 3TPCA 2UUPA 4RHXA 4DIUA 5DT9A 1Z6ZA 3TUJC 4C04A 1ZD9A 1W1UA 3M9LA 4TOIA 1ZN2A 1XRQA 3MTGA 4N3GA 5FORA 1UJ5A 2OZVA 3FPFA 4IUBS 2CBGA 2NGRA 2HJVA 2O8NA 3CJRA 3K0SA 1IEXA 2GILA 4LK3A 4I50B 3NT4A 4CUZA 2YZKA 1QKKA 3CX6A 1MABA 3SHTA 3TIIA 4YT2A 2QTLA 1YUNA 3CZCA 5LPNA 3UHFA 1JU3A 1SVMA 2ZTVA 5ETJA 1SB9A 4AQDA 4H08A 1BJRE 5EE3A 4FT4A 4B48A 1XVTA 1E32A 1PZHA 1A7KA 2HLDA 4E2FA 1GGJA 4E07A 2FCRA 5IBQA 1R88A 3AI1A 1DEKA 3V42A 4YMHA 1C80A 2CYBA 1X19A 1XK7A 5EE5B 2ES4A 4M55A 4I46A 3SHOA 4YCNA 3ICCA 4G0WA 1N2GA 5LDDC 4PR3A 3IO3A 2X58A 1XYYA 5TRTA 2UZIR 2ORED 1W6RA 3HABA 2XQFA 4DIBA 1IL0A 5EIOA 4PU0A 1QO7A 1CUCA 2P5TB 1AN9A 1HA3A 3M9WA 3NGMA 4PG8A 2MYNA 4B3JA 3CB4A 4XDHA 2ZJZA 1KIFA 1DX9A 1ZGJA 2VP4A 3DE2X 1W0JA 4QTUB 4D4MA 1K8YB 3O8OA 1K7XB 4MUXA 2H3EA 4OU4A 2GRUA 4GU5A 4PZDA 2ZUSA 2V0NA 3JQGB 4QJBA 5ALHA 5JEEA 1QQ6A 3FTFA 2J6IA 2QX8A 5IJWA 1VIMA 2M32A 1R9GA 1Y9EA 4D1YA 3TGWA 1EFAA 2PVCA 2I4LA 1C14A 3DDWA 3R7NA 3S44A 3JTMA 3W9SA 2PSJA 1DWOA 2B8EA 2JFZA 3F78A 3KQPA 1C9DB 2V6IA 4TTTS 3ZY5A 3DOFA 3GGDA 3J81k 5AT1A 5IUKC 4TTIA 2ID4A 4I1OA 2M2IA 4BMXA 1Z73A 1FPMA 2I4MA 3AEUA 3K0AA 1OI2A 2QAIA 1WSAA 1TAGA 2WAAA 3DT8A 3PICA 4LN1A 4MA0A 4DA8A 1QU3A 2QUAA 3FR7A 2R6FA 4JOQA 2A4MA 3ZCPA 2P4EA 3AR4A 1IN8A 3P4UA 1RZRA 2R8YA 1RKBA 1EG2A 4IDQA 3DA8A 2AX4A 2HGZA 1FX0A 4PVDA 1UXKA 3VPFA 1U0BB 1KYZA 1J7JA 1HLGA 4I55A 2ZJ0A 3SN6A 4EEZA 3VDRA 4UQOA 3RB8A 5HKAA 2GRJA 5H68A 3EQ2A 4N6OA 1SUSA 1SRRA 4KPFC 2G71A 3CVYA 4F5EA 4QXMA 2HQBA 4WN3A 3WK5A 3E2IA 4JI6B 1WQ1R 3VOTA 3BZBA 2B1JA 3HCOA 3D4LA 4JI1B 5EL0A 3C4JA 5FWXA 1ZI8A 1X9IA 2Q3CA 2R47A 5C31A 4BNHA 4IFEA 3VSAA 1VHJA 2HOQA 4EMUA 1P5JA 2FMTA 1R6DA 3ZI0A 5IXYA 1UUFA 2Y3IA 1JRLA 3KUUA 3OTQA 3DUFB 1NX9A 4B6GA 4LF6B 1H8ED 3WB2A 5BV7A 6REQA 3L0IB 4KWEA 4A5OA 3BTSA 1I80A 2QI9F 1I4TD 2HF7A 1U2TA 3K1JA 3RVPA 4LUCA 5BWBA 2AYXA 1CQZA 1ISRA 1MO2A 3FYSA 1NF9A 1A5AB 1V9SA 1BQEA 1VC2A 3EWNA 1TD1A 4MGZR 4LRUA 1BS1A 4CV0A 2OSVA 1ESEA 2F17A 2HJGA 5JRDS 4PCVA 4DILA 2D2XA 2GN2A 3A9WA 2XXBA 1ZA1A 3CSSA 1DKQA 2CXXA 2XAAA 1R4MA 3MAJA 4GBMA 2R8BA 4FOTA 3WBFA 4H3KB 2NQTA 2P9CA 3KC2A 4HD8A 3HLTA 2OQIA 3NRCA 3OQPA 4ATNA 1XNJA 2IZ1A 3KAQA 4WFQA 5ALJA 4XJVA 1SUIA 5EERA 3IR5A 1E0AA 2WUDA 3Q85A 3W9BA 1JFSA 5C9ZA 1E1RD 1ODCA 2PA0A 4CLOA 2DXIA 4BLOA 4DDMA 2FFQA 4BVKA 4M0KA 1TJNA 3EDRA 3OT5A 2HHHB 3L77A 1WZCA 3CXUA 2GEVA 3AIMA 4CMGA 3P2YA 1WTAA 1RMYA 2MSKA 3WAKA 1A9XB 3EQ6A 1ESZA 3NHFA 5IZCA 1WR8A 2AG1A 2Z98A 2YYZA 4LYJA 1SEVA 2Q5CA 4YJKA 5HF6A 4BVJA 5JXJA 1SG0A 4FHEA 4LW8A 4UASA 3PA8A 5LOVF 4XEUA 3O8DA 3H2YA 3DYVA 5CVDA 1JJVA 2BISA 5HPYB 5CEJA 3KV1A 3LA8A 4HN9A 4TGLA 3DH0A 1Q91A 1WZNA 4Y9RA 3DF7A 5K4HA 2ZXUA 5ELLA 3UKJA 3JASB 1PEKE 3FD8A 4ZO8A 3O3CA 3TDNA 4KR3A 2QM8A 2A5LA 2A5JA 4Z4FA 2JIRA 3PGMA 4KPGA 2AXNA 2ZRFA 4ZHQB 3OX3A 3THXA 1DLIA 1M8PA 1DIRA 3R7WA 3K8QA 2YXDA 3ZTWA 2BIFA 5IAKA 3TF5A 1WV1A 2AEEA 2OPHA 1EVQA 3KR0A 1XF1A 1EJ6A 5CLGA 1VA5A 1QHGA 2BAGA 2HZBA 1IAVA 1SHUX 2OHOA 3B20A 1OOEA 5DN9A 2BKEA 3VZDA 2BSAA 2ETVA 3H6HA 3I73A 5HNKA 3M1LA 4RK6A 1QPZA 2MR6A