2P0YA

Crystal structure of q88yi3_lacpl from lactobacillus plantarum. northeast structural genomics consortium target lpr6
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
324
structure length
240
Chain Sequence
RPKIVVIGGGTGLPVVLNGLRKQAVDITAVVTIRNVMVALSSWPDLYKDIFQGNLIGVFDAVQELSNMMQVDGHVYPALTLHGKFSDGTHKSLERVWVTPQAVQPVIDAIMAADQIVLGPGSLFTSILPNLTIGNIGRAVCESDAEVVYICNIMTGETDNFSDADHVRVLNRHLINTVLVNTEKVPEDYMDFHSKQVSHDFRGLREQNCRVISSNFLKLHDGDQVVAELMNLVGHSDVFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Q88YI3_LACPL from Lactobacillus plantarum.
rcsb
source organism Lactobacillus plantarum
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein lp_0780
total genus 50
structure length 240
sequence length 324
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01933 UPF0052 Uncharacterised protein family UPF0052
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10680 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold CofD-like domains 2p0yA00
2P0YA 3C3EA 3CGWA 3C3DA
chains in the Genus database with same CATH superfamily
4PZEA 1J97A 4EFKA 3IAM1 5AUOB 4CM9D 2IWRA 3IDQA 4WK2B 3FWKA 3VM6A 2QY9A 3U7HB 2MMCA 3NWPA 1EKXA 1GOTA 2BKVA 1ZINA 2OYSA 3SHTA 3O26A 4OK5A 2Z3WA 2ZEJA 4HLUC 1BVYF 1GZ7A 2ADMA 4MZXA 2BDTA 1PGQA 2XE8A 5FQOA 3BHIA 4C7KA 3QLUA 4AURA 4CT0A 1I3MA 1G7SA 2OWDA 4KV9A 2FMTA 4JKIA 1U2TA 4PFJA 2D2VA 3A37A 4PSCA 1U5AA 3O4JA 3DOEA 3MG9A 3GNTA 4P92A 4CMJA 3SHFA 3L8ZA 4OKSA 4PX9A 2F17A 2NUPB 5KKNB 2JIPA 4RFLA 6ABPA 2WKPA 1RJGA 1KU6A 3IVRA 3BXZA 3OIDA 1H1LB 3G2MA 4Z8XA 5FPSA 2ZBVA 2ZSIA 4ZMBA 3AJ9A 5JNUA 5EIBD 4YHBA 4EB6A 3R7LA 4UFOA 3I5UA 1VYHA 1N6LA 5F1YA 2VNJA 2RAUA 2BSAA 3FHOA 4RFSA 1XRNA 1G16A 1JXMA 3THRA 4DBVO 3D5EA 4U39A 2FZEA 5B3AA 5C37A 2H2IA 4H08A 1QFZA 3I9NA 2GERA 3CIOA 3OT4A 4OQ4A 4RLSA 1V43A 5EIWA 3TJZA 3L1IA 2BDUA 4YP9A 3DFUA 3WL5A 1YQTA 2HO5A 1DVRA 2JHCA 1ZNXA 2FPRA 1DO8A 2C9BA 2DFNA 4ZC8A 2OKCA 3W05A 4EZEA 4MB2A 3ZEAA 5JNWA 2XMDA 1E7RA 4WCFA 2IYTA 2DU8A 4L15A 4M1YA 4MVJG 4KR6A 1U2DC 1TQ4A 4BTVA 1G0OA 1TCAA 4NZ9A 4AZSA 2C2MA 1LFDB 3T3OA 1ENYA 3FCOA 1QH8A 4P93A 4I4TB 3I6ZA 2G36A 1FTNA 2GYYA 2Z6QA 1EJ6A 4C0XA 5CVTA 1PJ2A 5B2ZA 5MGBA 4BATA 1XK6A 4MRPA 4BNLA 1B0PA 4HB4A 2X0NA 1CS0B 1MMFB 3ABIA 3EMBA 3WFJA 1C2YA 1ULAA 3WQSB 3K31A 4PLWA 3U3RA 1TD9A 5BR1A 1D2AA 4B47A 2PFGA 2EFGA 3GZNA 3UBTA 4HTAA 4NCXA 1G0NA 3NCTA 3L07A 2IPXA 4DIOA 2Y8EA 2NU6A 2X3UA 3KLBA 1YDWA 3IEIA 4EB3A 4ITUA 1VGVA 5CLLA 1XRQA 4C3VA 1NY6A 1WETA 1WEKA 1SUAA 3H84A 3M1AA 4EGCB 2XMZA 4JA2A 4RM2A 3UKOA 2PFSA 1T6ZA 1IULA 1QRDA 1FYVA 3PC4A 2B0JA 1RAFA 4WY8A 5JS6A 4EGQA 1DRWA 1KHHA 2ARKA 2GAFA 3G85A 3K15A 5AKIA 1WB4A 2TMDA 2C2YA 4EMBA 3WZMA 3ZN2A 4X54A 3RC2A 2ZI9A 2NX2A 2WD7B 1USKA 2C42A 1TC2A 3T0IA 2AI3A 3FBGA 1DBIA 1XZKA 1LPNA 2HWWA 3V1YA 4Z54A 5CD1A 4DN6A 2AXEA 3IQEA 4MR7A 4MA5A 3LFHA 3PFNA 3RLFA 1RZRA 4IQ8A 5BQ3A 2QM3A 2B4AA 2AR7A 4D96A 2H57A 1QUFA 3AVUA 4PQYA 5THQA 5KJEA 3MEQA 2POCA 4PQRA 2KX7A 3GXOA 4U9UA 2XPCA 3M1IA 2JDID 3U0BA 4WKBA 3FOWA 1MX3A 1LJLA 3OZVA 2JAHA 3EGXB 4JEMA 5DE3A 3UT6A 4D44A 4GR5A 2LGJA 3SWWA 4R9SA 2F8TA 1ZN8A 2C9MA 3TTYA 4EEZA 2H8KA 4YAKA 2W11A 3S55A 3WHPA 3IJ5A 2HLHA 5JPDA 1WXEA 1RC8A 2CF5A 1BH2A 1TIBA 3OO0A 4TMXA 3QYFA 1CNMA 2ABWA 3RRZA 2CLDX 1KOGA 3K9QO 4KNYA 2PCLA 3ELWA 3ONWA 2XGGA 2Q9UA 3HR7A 3A27A 5AM1A 5JSQA 1ISIA 1TM2A 4CR6A 3P4UA 1W19A 2N0SA 3KZOA 3OJOA 2NXJA 4WZAB 1FXSA 1NXXA 2IYFA 3G49A 5E0KB 4DCTA 3QF4A 4IKEA 3ZGYA 4ZOLF 4BNKA 4K26A 1EMDA 1Z7YA 4UVDA 5BVGA 3EVAA 1TX4B 3QHPA 5AWFC 2CLHB 3WK6A 1E6CA 4EEXA 1N6KA 5ICGA 5ERYA 1XQWA 1VRVA 2XGMA 4JB0A 4BDSA 1SU4A 3DDUA 5CLGA 2GVNA 1JTFA 3SOZA 4IJ5A 3ESZA 3ND5A 5CLIA 3LO5A 1A9SA 4MW0A 4MHSA 4Z86A 3WB2A 1JLSA 1SUCA 3DZ8A 2W6JA 3DTTA 4TWIA 1NQAO 3GV0A 4PHHA 4CI9A 3VU9A 3ZE8A 2NYUA 4W4TA 5BSUA 4KX5A 4XM0A 1Z25A 5DBGA 1VJ0A 2PPLA 4UZEA 2YOHA 1GGHA 2VTKA 2H2WA 1A7UA 1GSAA 3K1TA 2OFWA 3FMVA 4MQ6A 1VMAA 2QRUA 3VU9B 1NQUA 5LJIA 1JR6A 1AY0A 4N5IX 3C3EA 4RETA 1WZNA 2XQFA 1N3LA 1PR5A 3NAZA 3L4EA 3OZUA 2VDWA 1G59A 2NUPA 1OPXA 2J7KA 4LXXA 5E4JA 1L4YA 3U49A 4F1WA 2W2MA 3QKTA 1B76A 3A1DA 4FQ5A 4WGGA 4KDEA 3ZBUA 3ZW8A 4ISBA 1GJRA 4RIHA 3UW3A 1OH6A 2SCUA 2G82A 3E3NA 3HXLA 4G26A 5JU6A 2WIFA 5K0GA 3D8RA 4BBJA 2G25A 2FFBA 2Q5CA 2R97A 2BEKA 1EK0A 3F6CA 3ZCRA 5EKSA 2VZ0A 1TYZA 1EXVA 2J8ZA 1QK5A 2OGSA 5KOHB 4D25A 1EFPA 4QNRA 3QFCA 4LZAA 1VLZA 3IT2A 3G0HA 4JI3B 4P4LA 3KD3A 3DMYA 3FGNA 3PL5A 4KO8A 3GH1A 3AVXA 3V7YA 5LQAA 3T7DA 2AD5A 3OLZA 4F3RA 1X1DA 1EA7A 1DAEA 4AMYA 3BWDD 1NAHA 1DTSA 5EIFA 5CX1B 3IB3A 3MOSA 4EDHA 5B7QA 2ZCUA 3HYLA 3EPJA 5K51A 4ABYA 4O2AA 3BCUA 1FLVA 2QUJA 1GTL1 4PIVA 1UKZA 3ZCQA 1UEJA 1JMVA 3D8TA 3ABRB 3ESXA 1V16A 4IDBA 4WDQA 4AS3A 3G1WA 1O9HA 3VC1A 3ZGXA 3ZBTA 3VKGA 3KFXA 2B2NA 5KSPA 2B5WA 5FL3A 4P3XA 3CB4A 4WLVA 1GNLA 3QLEA 1JQ3A 2IXDA 2ZIWB 3B78A 3F96A 3D9QX 2LDXA 1EBUA 4Z1OA 3NVKI 3DV9A 2VTEA 4N3GA 5FLKA 1QTNA 1WO8A 2W58A 1KMIY 4QUDA 2YDYA 1QG4A 4DMLA 4OLAA 4FKZA 1OV4A 1PDOA 4R3UC 1HLPA 4J8PA 1NP6A 4AF6A 3IHTA 2HPAA 2F4VB 1DXYA 4G8CA 4N54A 1OFTA 2Z83A 4F3KA 2EGUA 1T4BA 3INNA 3UC5A 4H7PA 2QZSA 3ZD9A 3EZFA 2QUIA 5AI6A 4BX2A 3A26A 4ND4A 1H9BA 1SUPA 1T8PA 1C8BA 1USUA 4KAAA 1XCGB 1Q19A 3L7KA 2W5UA 2G17A 3KQTA 1QC5A 4QKQA 1JJAA 3ZY3A 2DULA 3DZCA 2BFMA 2DWOA 1Q1AA 4CI0B 5DXFA 1TUBB 3DCIA 4M37A 1XTPA 3VR4D 4ER3A 2JIDA 1NM5C 3A7DA 3RADC 3AOGA 1RJEA 2GEJA 2BLLA 2O0KA 3JD3A 1M10A 1O89A 3ESYA 4HQ0A 4XWTA 5AKGA 5AKJA 5U1PA 2VHJA 3VYVA 1YS9A 4UZSA 5I8PA 4XJXA 1Q3HA 1KAEA 1CJSA 1D09A 1NUPA 3BF7A 1RI1A 4KYVA 1BVUA 2IC5A 1RCFA 4R6WA 1DMSA 1HH4A 3BGWA 3E0QA 3TNLA 1FW8A 3M4ZA 4AWXA 3KQVA 2VK2A 2OAQ1 3GGCA 4OM7A 2OWEA 2R1UA 4LJYA 4X61A 3FSGD 3OZSA 1Z4OA 1FRQA 5D3KA 2X9VA 4ZQCB 4CM8B 1ENOA 3PA8A 1H65A 2PUAA 4ZOAA 5EOVA 3JQ9A 3BSWA 4YAOA 4BNDB 3D5QA 1U7OA 3OKPA 5EKTA 5B7PA 4L0QA 3FA2A 1LLQA 1HURA 3HXTA 4YRPA 1Y7PA 4GKAA 2RCYA 4MQLA 1TNDA 3TLCA 4KFSA 3UB2A 5CCEA 4D0SA 5EHZA 2BHNA 2ZIEA 4F06A 1OUMA 2OHVA 2B37A 1RWNA 3ZH2A 4MJ3A 2ODWA 3ZE7A 1LWNA 1FFCA 4CKEB 1UZUA 5KINB 3ZWMA 1SU6A 3UPTA 3DVAB 3WX0A 1KZYC 2V96A 5JVDF 1FFWA 3FD8A 1T8SA 3LWBA 4XIFA 2HF9A 5HRCA 2VT2A 2P91A 1D4FA 1ZPDA 4ZZ1A 1QZUA 4RULA 3PJRA 3A4IA 4RQUA 2O5CA 4Q3KA 4BTEA 1IRXA 2OGWA 3H8WA 3T3PB 1EB8A 1IDOA 1OJ7A 3GD7A 1NJ2A 3O0DA 1L5NA 3PUHA 2BEWB 5FNZA 3JVIA 4XRGA 5A7FA 1XUOA 2CXRA 2X0RA 1VIAA 2JGNA 5AXCA 3HY4A 3SD7A 4ZYTA 2HA6A 1BEUB 4K6FA 1P4SA 2OKGA 5EWJB 1R15A 3ZPXA 2X5OA 3N7UA 3OX4A 2CLCX 5JCJA 2W48A 4OB7A 3ZGLA 3QVMA 2R66A 3UHOA 3V8VA 3N8HA 4WFQA 3GPCA 5BYBA 3SZUA 4BFTA 4CMIA 4IIHA 4DLTA 1MG0A 2XIQA 3E6AA 1K7SN 4TQUS 3DE4X 3A11A 2O14A 1JHXA 3LYLA 4ZYUA 2CDAA 4Z0HO 2CVQA 4AQYB 2DTDA 4B4KA 2CHQA 2GLTA 3HFSA 4YMIA 5KAMA 1E2UA 2GCNA 1VE7A 2ICAA 1E89A 2YIJA 3AP2A 3GQBB 3WI7A 1WX1A 1M8KA 2DM6A 3UAOA 1Q84A 1OFGA 4HLNA 5A0TA 1XKLA 2B8TA 2XVXA 2PR7A 5FULA 3T5MA 4W5NA 3TDNA 4F84A 3J7AC 3LU1A 1MD9A 3QVVA 2DH5A 4BLQA 4NCNA 4EVIA 1ISJA 3HWRA 3ZXUB 1N78A 2QTCA 2J30A 2YN0A 4R7ZA 2XDAA 3D0OA 1GPWB 4MMYB 1YIDA 1OFVA 1HQDA 4G89A 4IG4A 3DAOA 5PGMA 5JSZB 5K0FA 4F6LA 1FC0A 4OOEA 4C1BA 4X66B 1QR2A 2OL4A 2Y05A 1EEHA 3GJ0A 1T5OA 4X1IA 1VFNA 2Y0DA 3JCZA 3EEIA 4OI2A 4RHTA 4MQFA 3FWHA 3AW8A 4ALJA 1FP4A 1YL7A 3NETA 2XUZA 1FVFA 1CF2O 2HA7A 3IKMB 2Z1MA 5JZOA 3RHFA 5CCDA 5DGXA 3AKCA 3PX2A 2MMGA 2H4FA 1NN1A 1ZS9A 1VL6A 3F6RA 3O03A 1CY4A 1Y9JA 3B70A 1EWQA 4KV7A 2PUGA 3SJZA 3UK0A 3PQ3A 3P9XA 3PTAA 4E1AA 1JEDA 1JR2A 3NVMB 5T64A 2HIGA 2ZSHA 2RK4A 2HMWA 3AC0A 1GR0A 1VYVA 3THOA 2IH2A 2AGVA 5KVCA 3PR3A 1TM4E 4O4HA 1IOWA 1E2FA 4WI1A 2AQ8A 1RYFA 2IBMA 4HNHA 4WFKA 2JLZA 1T5DX 1UK6A 1YUBA 1D0SA 4FFNA 2C7BA 2GPTA 5DYYA 1NJSA 5EZQA 2BKEA 3MS4A 1GLNA 4KUEA 4R9VA 3R5KA 2UYCA 3OH8A 2ZUDA 1EJ2A 5C46F 1EFLA 3R9KA 3RHTA 4YA6A 3I2FA 3O38A 3TECE 5DX1A 3WKDA 3AHGA 1P4RA 5TQ0A 4LWPA 4AG3A 1D4AA 3CE9A 2O2CA 2H1WA 2ZJ4A 4EWLA 1CNFA 3FROA 4DQVA 3OQMA 1B3RA 3PIDA 3T52A 4D1YA 5IU6A 1DJNA 2W83A 1W6RA 4XQ0A 5CP8A 1DJQA 1TAGA 4H2DA 3WRYA 4ZVNA 4Q7MB 1BQ4A 3DB2A 2O2SA 4OTZA 3TBKA 3PWKA 3C48A 1SEPA 4LQ4A 5ICFA 4IGIA 1JQDA 1KMNA 1TGVA 1ZY2A 5DI3B 2HJRA 2FEOA 3FNHA 3RC1A 1G9TA 4F5YA 1MOPA 2XF2A 2WU8A 3DOJA 4OP2A 3RUIA 1SA0A 3VNRA 4CKWA 3H1PA 4WK0B 2JJ1D 4L8YA 3IESA 1EFPB 4W9NA 3ZS8A 3COJA 4R3NA 2AEFA 1M3SA 2LE0A 3D2LA 3LP8A 3TCKA 1VI2A 3ZNNA 3I3OA 4DXDA 2FMXA 2REOA 5HUHA 2BMEA 2KE5A 1QK3A 4IINA 2QTLA 2W71A 1FDWA 3EA5A 2AW5A 3N58A 4US1R 3SS8A 3TVYA 4D4IA 1GKLA 3BJEA 3PD7A 2R96A 1JH9A 4PZAA 5FBLB 4GECA 3TNDA 4XPIA 2WF7A 4ZQIA 2GNOA 4Y2PA 2QRZA 2BEUA 2VWHA 2CGEA 4AFNA 2Y66A 1JWLA 3N0XA 5TMDA 5EJEA 3WKBA 3VH4A 4WXYB 2FDRA 2HQOA 4GI7A 1Q6ZA 2IZ0A 4ARCA 7YASA 1X77A 1SH7A 2XUDA 4G0YA 2F48A 3IUEA 1UPCA 4R2XA 3S2FA 2GRJA 1YB6A 5IKMA 2DBQA 3ZGNA 5TVKA 2ECKA 3USZA 3VSEA 4ZCPA 4KPUB 5KQSA 3GU3A 4J9VA 3KQQA 5B4VA 2OFXA 1RW4A 3GRAA 3ZW7A 4HX2A 4GWLA 4X94A 4NXMB 4EI9A 3L2OB 1P5JA 2PX6A 3DAFA 4GLBA 3E8XA 3LM8A 1X80A 2RHCA 3OOJA 1G7RA 1PKEA 1VHJA 3CRQA 3RTDA 4CF7A 3L1JA 1EZ4A 4GC5A 4PBTA 1SUDA 1TOAA 1E2NA 3QKIA 5JSHA 4E11A 4EHFA 2WFAA 1N2CB 3HN2A 4JVSB 5CB8A 4QUEA 1CIJA 4MWTA 1NHGA 1JDZA 1QVAA 3KJGA 2VSOA 4FGJA 1JIKA 1DQZA 3I2JA 3QVTA 3NEPX 2OHHA 4LYFA 3EDYA 5JQGF 4LY3A 1N2CA 4ZAYA 4EMTA 4GKBA 1U1GA 1SVUA 2PKCA 5ES3A 2PU5A 2CE7A 2A9PA 2I91A 3T3EA 3HU5A 4UMVA 3JYNA 3PFFA 5JH7A 1XLUA 3JYPA 1CUIA 2BGRA 4TVSA 5FBRB 3SJBA 3K0KA 3ROZA 4S2EA 1SKMA 2E4YA 4TWZA 5IF9A 1ZD5A 4L9AA 2O06A 4W5TA 2OG1A 3FAZA 1NN3A 3WAKA 3ABZA 4KNVA 3UHPA 5BSHA 3NKLA 3EZGA 4E5SA 3PHLA 4R1OA 2B7LA 3EA4A 4PLCA 1R2QA 1UFQA 2E4XA 1AA9A 4OQXA 1PR3A 2WE7A 2X8JB 2VTDA 1GL9B 3GWGA 4RHFA 2BFNA 3H11B 3DM5A 1NBEA 1M7BA 1ISPA 2G70A 2NU7B 4PE5B 4Q47A 4B2PA 4C05A 1GZ3A 3E84A 3L18A 1U9IC 4PNPA 3E3AA 5AW0A 1JJBA 3MLBA 2Z4RA 1URPA 1IPHA 5IASA 1QIJA 2HA5A 4Q18A 2FB9A 4BMCA 4UASA 1TQ8A 3TF5A 1R4ZA 1VKRA 4I9GA 4RVGA 3WMEA 3RJZA 4BMXA 2PBLA 1GYRA 1ZMOA 5EP1A 2QJTA 2HTFA 1D6SA 2Y71A 3EWAA 2H51A 1VP3A 4P6VF 1R6AA 3PJGA 1Y4UA 1YQDA 5EY5B 1QOZA 1DU4A 1Z0ZA 2I3AA 3O75A 4Y9UA 3CXUA 4WVFA 5AKLA 4BLWA 3GHYA 3AHEA 3BL6A 2H3EA 1V7PC 3L4KA 2YZ2A 1KDPA 1UOPA 4FDLA 2G71A 1DAOA 2GBGA 5F2OA 5KYYB 2BUCA 3DEKA 4JLOA 4B4VA 1EP1B 1NRXA 1XLTA 3H3FA 4G41A 1VKOA 4S24A 4RKFA 1KRWA 3GRKA 1Y98A 1BWRA 2YXBA 4YV2A 2OQIA 3R3VA 4GGOA 4MRVA 1BGWA 3EH1A 4PYJA 1F06A 1SVIA 4JUDX 2IQ5A 1EUYA 3RUHA 3K1AB 4HWPA 5FI1B 4L8WB 2QL6A 2C97A 2A94A 2PZGA 5DULA 4OYYA 3UGQA 1N1DA 4XUDA 3IX7A 1DLIA 4P2GA 3NONA 2GCPA 4DC1A 2GM4A 2C1ZA 3E5HA 1TUGA 4YRAA 1U6IA 3NVAA 2VJBA 2PKEA 5CNMA 1KMMA 3FXAA 5B3KA 4N39A 4R7TA 3K6SA 4URXR 1P7ZA 1I80A 1XAJA 8AT1A 2HHHB 4ZHQF 4DHWA 1YJBA 4O08A 1BWSA 5EHIA 2FOLA 4HL6A 2HLDD 1VGQA 2IIBA 2QX7A 3ZCXA 3ZZ1A 4QULA 5J5VA 1CKEA 1RRKA 1SXGA 1ZUWA 5KVQA 2QZPA 2H9YA 1VLHA 4TV9B 2P4UA 4RXMA 3I05A 4XYEA 2L2QA 3KTDA 3NHLA 3JD0A 4MVCA 3HK2A 1Z4KA 1EUDA 1WZCA 4OXIA 5JISA 2H2AA 1QP8A 1HO3A 2VHXA 3GZNB 3RRMA 4CLXA 1SBIA 2WHYA 1T1SA 3BJRA 4HD8A 5F4ZA 4FHDA 2JJ1A 2PSHA 1E6MA 1C8VB 1KJQA 3EGDA 1YUNA 5EJGA 1IY8A 1L5WA 3PXCX 3NHSA 1FU4A 1FFHA 2QLMA 3PHBE 1QIGA 3AY0A 5J2UF 1Y3IA 1I3CA 4QOGA 4GLJA 2JFHA 4JFAA 1AURA 2QPOA 2WVGA 3K1YA 2VDUE 5DLDA 3LL7A 4A2CA 4ECEA 1GNQA 1KZ6A 1OXKB 5TX7A 2Z6AA 4MZDA 4AY6A 3C3JA 4GM4A 4TM8A 1FCJA 4CMAA 3WWDA 4IPTA 4TYPA 5KNBA 2GTIA 3ZD8A 4U3JB 1PWYE 4NBUA 1DTWA 3IJPA 1KMHB 1N77A 5K8UA 4OKNA 4EABA 4PSKA 1N1EA 2WWGA 5GVRA 5JLJA 1EFTA 1ONNA 2PZAA 3X1MA 2VBCA 3ZBQA 4RH0A 2WTBA 4K05A 3HV0A 3WLSA 4DJAA 1YNOA 2QKYA 1IJKA 1YRBA 1MQ9A 3AR4A 3LUCA 2LPMA 3NEAA 5FORA 4DLWA 4C43A 4R9RA 2GKOA 1A5AB 5IBCA 3FE2A 4HNAB 3PT5A 3DULA 3Q98A 4JN6B 5FP0A 5B53A 3QI2A 6Q21A 5A9SB 1QG2A 1K86A 2Q29A 4LC0A 4Q4DA 3I6IA 1RABA 3EQ6A 5KWVA 2PZLA 3QWBA 2X0FA 4ZZ3A 2I1VB 1KI3A 1QGYA 1DAHA 2BTQB 3IILA 1KE1A 1RBQA 2V45A 3IS3A 1B43A 1A2OA 1JFLA 1Q22A 2OPBA 3I09A 1YO6A 4ME6A 2DT8A 3TW8A 4F4CA 3GCGA 3TL3A 3X1ZA 3ZDBA 4Q9IA 1LJUA 4IWYA 4K2AA 2DBZA 3CM0A 1P2DA 4IUYA 1OIVA 2Q3HA 1QIDA 1OMOA 1RHKA 1XWWA 4PCUA 2QZZA 2YBEA 5CVDA 2YHUA 3KSMA 1ZGGA 2PDAA 2H59A 3BGIA 3ETLA 3V4SA 5KNCA 4DUZB 1ZXXA 2FY8A 4B3GA 1M8JA 2NO5A 4NNPA 4PO9A 2PL1A 3L8EA 1G8YA 2XWQA 4Z9AA 4MS4B 1DG3A 1ZVMA 2GBCA 1GUDA 2OZEA 3G88A 5GZ1A 2A5LA 4IDPA 1K9VF 3HB1A 1L5LA 4QRDA 1IWBB 3KVOA 4UAGA 3ZHOA 4C0HA 2IUTA 1X38A 4ITRC 3HEMA 2B30A 3FGOA 4PEVA 4IICA 1I24A 2Z4SA 3DPIA 3NOOA 4HQNA 1E1RA 3O2QB 3PQ2A 4RY8A 3EG5A 1Q7CA 1PZFA 3UICA 1ONSA 2AOTA 5ICCA 3W8EA 1N6PA 3KTOA 3PDIA 2QE7A 2BFCB 1EJ0A 4S35A 3R0IA 4E2ZA 2IBTA 4WH0A 1RPAA 3B8HA 4UJ5A 2ZUEA 1K7FB 3JRNA 4CT5A 4E2WA 3PQ5A 3HTXA 1DKNA 4QAQA 3CUVA 2OXFA 2G9ZA 4GM1A 4FU0A 1A88A 2QX9A 3C8DA 3GLVA 3OESA 4E1VA 4MV0A 3HO1A 3H5WA 3KELA 1NRWA 3FNEA 1J8VA 3GEIA 4YN3A 1L1QA 3RIXA 3ENNA 3JQ8B 4RZIA 4AVYA 3IDOA 3LUGA 3HS3A 4JSRA 1MOSA 5CRIA 1G6OA 2G7MC 4GXNA 1KVSA 1W87A 2HQ1A 5AH0A 2QGNA 3TQRA 1DEKA 4ZMSA 5A7GA 2ILTA 4C5BA 1G17A 3GCWA 4M46A 3QVSA 5T8KA 4B81A 1M7HA 4TQAA 1CZOA 1FU8A 1E4OA 4HX9A 4BNMA 1UP6A 3CNOA 1W5FA 5DEOA 1KAQA 1WBDA 3B82A 4MUNA 1I14A 3X2EA 1AB6A 2X9NA 1I7SB 1QCYA 1QHYA 1ODLA 4LF5B 1FRVA 1KQ3A 3F9IA 3LDGA 5EGSA 3QLVC 4L2IA 4MROA 4KU4A 4PQFA 5L45A 1Y48E 1TZKA 3NHZA 3SQXA 5TXGA 1RC0A 3ZE9A 4DIBA 1DI0A 2J09A 3Q15C 4BGVA 1XHEA 1A95A 1UMDA 3L43A 2D1FA 1NNLA 1ZGCA 3EVCA 1IG0A 4WEQA 2ZJ7A 2QLTA 5IX8A 2IW1A 3BWCA 3ID6C 3OOHA 1SIOA 2P4EA 2GHRA 1ZLYA 1F2TA 1VECA 1CRWG 2VHEA 4GZ3A 1NBWB 2PUFA 1I7PA 1CUAA 1U0SY 5JZMA 2QZ4A 2VZEA 3VVLA 2YY5A 4IDFA 3VR2D 1MRZA 4I5FA 3FMIA 3FNQA 1F0NA 4AWBA 1A4UA 4NAVA 2DY1A 2QVBA 3LTEA 4JGGA 3FDJA 2ZSKA 5K8LA 4FLEA 1X7HA 3WHKA 3QE2A 1EE9A 4NCBA 1KYWA 1C0IA 5D7BA 1AZSC 3CX7A 1LLCA 4R01A 2FK7A 3CZMA 2OHJA 2HQSA 2VPPA 4HYQA 2R6GA 3AJDA 3G5TA 5EJ5A 4FMDB 1IUNA 1YJQA 1VTKA 2G1KA 4WA7A 4BN0A 2L42A 5D5HA 4EKNB 4DV1B 1W2WB 2ZSBA 5IAAA 1X7XB 2CHVA 3IEKA 4X9XA 5TGZA 2DR2A 3BE5A 3HJRA 5J5AA 3PHIA 1GL3A 3JARA 3WGTA 3GLHB 1CT9A 1RPJA 4I5GA 4ZAGA 1P72A 4YRJA 4M9UA 2W2LA 5REQB 4GYKA 4PN7A 3BDIA 5CFNA 2XDQA 3P97A 3X1KA 4DMGA 3KQOA 5J2TA 4JLNA 2AC7A 4WLUA 4E94A 3L6BA 3CJTA 5DYIA 3UANA 3R7BA 4GQBA 1R4NB 2JBAB 4GPAA 5FB3A 4WT7A 1WXQA 1T43A 1YOVA 3G13A 1HYBA 1ZMTA 5K0ZA 3GYGA 3P2EA 2PO5A 3LXUX 2PO7A 3QNUA 1C0PA 5EJ2A 5F1PA 1AHIA 4MOWA 1D03A 2ZANA 4YCDA 5IBRA 3TDKA 4KIGA 5I8WA 3BE6A 1EDOA 4RX1A 3JZDA 1G98A 4EARA 3CH4B 3DKPA 4OJNA 4CLRA 5EE5B 2L18A 4Q4AA 1A76A 3RYTC 1AOXA 3QU7A 4O02B 1PGPA 3OY2A 4MMZB 1CLUA 4MI3A 1JZTA 4C6TB 4CM8A 3LXMA 2WKWA 3S6JA 4E7OA 4L5IA 3IEMA 5HKAA 3C7KA 5EZYB 3FOZA 1GU1A 3FPBA 4PS1A 2YOGA 1ZW1A 4LRQA 5IAJA 5JAQA 1GGNA 1T0UA 4A27A 2OHIA 4B75A 4ENPA 2PGDA 3ZU5A 5K8JB 1E3MA 2P9BA 1G55A 4JBWA 1IVYA 3A25A 5KTKA 2KLHA 3DCYA 2FWIA 1KC3A 4B1FA 1T8TA 1ODJA 4L9WA 4YBZA 4B0PA 2PA3A 1GPAA 4CMCA 4EHJA 2QDKA 4OO3A 3TQHA 3A70A 2A92A 5BP7A 1XALA 3EXEA 3SAJA 2YN2A 2YJ4A 4EYEA 5TMBA 1I4OA 3F49S 2DUJA 1JBKA 3N3BC 2B0CA 5JWHA 4MKZA 2A8YA 2C9CA 4EAQA 1U11A 1P4HA 4KXQA 4F85A 4XSGA 1BCSB 2YZKA 4N40A 1RADA 5DI9A 1QHNA 2CBXA 4IM7A 1PYDA 5G4LA 3IBSA 2O6LA 5ELLA 3H6HA 4Y1RB 3ZHRA 4BQPA 4NE7A 1AO0A 3I37X 2W2QA 4O8ZA 3ENVA 5FUVA 1KK0A 3QXHA 1CWUA 4NULA 1KWKA 1Q16A 2I9KA 1T9HA 4RXUA 5MN5A 2PMWB 3N2KA 4PZLA 5JROA 1CVIA 3UJCA 5FQNA 2N42A 5AVYA 4GG1A 4INJA 3WTCA 1RQ7A 1J70A 2RGAA 4ZJZA 3UPUA 1SOUA 1FJXA 5F3WB 3QBDA 4UTXA 2RGEA 4RTKA 3I8XA 1GUYA 3LK6A 4Z7OB 5TMPA 1QO9A 2BWJA 2G3YA 3ANSA 1U8AA 1OXTA 5EPEA 3EFBA 2AOUB 3FCAA 3LRXA 3P2JA 2JAWA 4ZCTA 4C14A 5CDFE 1L5ZA 2WSMA 4PG7A 4ROTA 1S3FA 1ZBQA 5AI4A 3ZHBA 1FP1D 3FDFA 3PEWA 1S2MA 3N28A 4B79A 3U56A 5DBHX 3A31A 3JQBC 2BT4A 3RAJA 4B33A 3IBTA 3KFVA 1B4DA 1PWZA 4QAJA 4DR7B 4CEHA 1A2BA 1PP4A 1YDFA 1X1BA 2QQ0A 3R5HA 4R7GA 3DQZA 4F3NA 4TS3A 5TRTA 4G84A 2IS4A 2AN5A 3O6VA 2CV0A 3F97A 3ND6A 4IFBA 3JV7A 1GZUA 4J1QA 4UBOA 3CH7A 1U9JA 4YRBA 1E1LA 5AVWA 4BMYA 5C9ZA 5JY1A 1Y6RA 4LY6A 1NR5A 4OH1A 2QXTA 4YV0A 1LBQA 3W4JA 1QX4A 3NYRA 4G9EA 2FWJA 4XM2A 4A16A 1EM8A 5EI5A 4R68A 4GO1A 3DE0X 2W6CX 3E2PA 3RS4A 3AF0A 4DXHA 1K8ZB 2PQMA 2VDJA 2JF0A 1CC1S 4DYDA 1RXSA 1YXMA 2IZ1A 3MOIA 3VR0A 1VLVA 2V59A 3K20A 1XRMA 4KXXA 3MUFA 1Z2CA 3BULA 1A9TA 3DFFA 5I9LA 3A2LA 2PBRA 1WXIA 2CMDA 4GZ6A 4TGLA 2Y9PB 2OA0A 2IZ6A 4WFJA 3RC9A 5FWXB 3RF7A 3F5QA 4P32A 3ZDRA 1RAHA 4ZZIA 1SZJG 2GOYA 1DKUA 1H6CA 4U5QA 5AI5A 3IPXA 5E3IA 5FOTA 4CDMA 3UM9A 4DNQA 5J58A 4DV3B 3AXSA 4XQEA 1TT5B 1E66A 1WMAA 3LVFO 2Z0MA 2VDQB 4PZPA 4Y2HA 2K7ZA 1YAJA 5EFOA 4IDQA 1D04A 4BBZA 5I4IA 3SC2A 4V0LA 1KJYA 2D0IA 4LS3A 3AM1A 3QMVA 1J5PA 2DLNA 1P73A 3DDZX 1UDAA 3UCXA 2WMOB 1QM5A 2QAGC 3T7CA 1QTRA 2HQBA 4HQ6A 4XLZA 2G5PA 5FADA 3CISA 4ZVQA 3RAFC 5HFJA 2C54A 4CN9A 4EM6A 1AMOA 4RV5A 2C2ZA 1RYDA 2RJNA 1EVIA 4GOKA 4JASB 5HCNA 1F2UB 1MX9A 3OJEA 1Y8QB 4QXAA 3LUHA 3PI6A 4CGZA 1ESNA 5B57C 5L3SA 1HXHA 3EXIB 5C31A 2ZQYA 3DBHA 4DBZA 1AC5A 2H00A 3E9QA 2VJDA 3LC0A 3MZ0A 1WCIA 4WOBA 3ZLBA 2HBZA 3NT4A 2DWQA 2CL6X 1TKAA 4BCBA 4CR7A 1SC6A 5BR4A 4YUWA 3IPCA 4M9RA 4NYIR 5DCLA 3M82A 9ATCA 1UMCA 2XE6A 4GR4A 2W2KB 5K4HA 1Q7GA 2VLBA 1UDRA 3SQNA 1L2TA 3STUA 3CLHA 1U8ZA 3SYTA 4BEWA 4A10A 3MINB 1U80A 3EG9B 2ZRFA 3IHKA 2Z98A 3PGXA 3D6JA 3T5CA 2G80A 2ID9A 3AEKA 3MWDB 5HRUA 5BVHB 3WRXA 2EBWA 3RBAA 3I28A 2E48A 3EH2A 2VZ8A 4WNYA 5I9TA 3TG2A 4F4UA 2H8GA 2NIPA 4EGAA 3I9LA 1NVTA 3KNZA 4O2AB 4BO6A 2BGUA 3FNRA 4CEIB 4KN9S 4AJKA 2JHAA 3C1TA 3PP8A 4MR7B 1CY2A 4RYDA 1R12A 4FYKA 2HA3A 4YJ3F 3GW8A 3THWB 1Q0HA 2C7QA 3NBMA 4LOIA 1S4MA 3AEYA 4B7CA 4GAEA 4X1YA 1NDUA 2FW9A 2Q07A 4YCBA 4CKBB 4CYMA 5AJXA 2QN3A 3ZU4A 4DEVA 4Q3DA 4PTYA 1BD3A 2Y2VA 2HYDA 2RHWA 3RJ5A 2P2SA 2LBPA 5C3UA 5ALFA 1N9ZA 1ZGBA 3OPQA 1NLYA 2GLUA 4I2NA 5DNCA 2NPIA 2HL6A 1ZI6A 1ZMRA 5H59A 5HCIA 4NICA 5HVNA 4JEIA 1NVDA 1PT9A 2ZB4A 1U90A 2WSYB 1PIWA 2DPXA 2CF6A 4BLPA 3N86A 4IH9A 4M76B 4KPGA 2FZKA 3ITDA 4PSVA 4RZHA 5B1HA 4EUKA 1V5FA 1T8WA 4N18A 1QQ7A 3BICA 3RANA 3S99A 4D42A 4MAAA 1EH5A 1RJ9B 2C4MA 2Y6VA 4DZTA 3K32A 3IXLA 1OPRA 2ST1A 2FSVC 2ZVPX 4C6RA 2QENA 1Z6QA 2VATA 4G24A 4OH7A 4AJ2A 1HBJA 4ZKDA 4NFSA 2JGRA 3F2VA 3JWEA 2HMAA 5AW6A 1GN9A 3T5TA 3PEFA 3ODPA 4ZT5A 4CMGA 3BHMA 3PENA 3QVUA 1DB3A 2DE0X 4J4TA 1AHPA 1FBNA 3E8SA 4FCCA 2PZKA 2VZ9A 4R1NA 3WK5A 4AKTA 2P35A 2YQZA 1PQPA 3KG2A 4WV3A 1Z5GA 4XDGA 4XR4A 4C6HA 4L72A 1MRNA 1ESMA 3DXXA 1ODIA 1BE0A 1A27A 3OHSX 4GOLD 2FP4B 2FP4A 2OC9A 3B53X 4XASA 4BVHA 2ESRA 1RWQA 1XD9A 3EFEA 4LFBB 1JYEA 1P1KA 4WBNB 1BG6A 2YJTD 5JALA 3PV0A 1M33A 4WZAA 1Z26A 2CMFA 4L0CA 4MVJA 2RHHA 3OD5A 4RFSB 2DTEA 2IA5A 3KSZO 3UHFA 2H9IA 3OCZA 3WOHA 3I2YX 4QL3A 3G2PA 4TT3A 1P60A 1ORVA 2QTRA 4ERNA 1NVWQ 4N41A 3E7DA 1WCV1 5IPFA 1EVEA 1FZQA 1DO2A 1OR8A 4CM1A 1NNUA 3MFYA 4IHKA 2V7UA 4R1TA 1E2EA 3E4CA 1KJWA 1A69A 1K98A 1X7GA 1RWVA 2A9FA 4FCWA 1O95C 1H0KA 5CMLA 1E3EA 1FSPA 4IQGA 2XQGA 2F1HA 1U94A 2PS0A 1XZBA 4DB4A 3JQBA 1XPUA 1OI2A 3A7EA 3PYLA 1YRHA 2BL4A 1VSTA 4EJ0A 1WKBA 2BC9A 1Z5UA 3GGOA 4BO3A 1MF7A 1J7KA 3VNSA 4A03A 4DAOA 3U09A 4B3TB 4LZPA 3WO1A 3FNGA 2H9AA 4V1CB 2ACEA 1UQUA 3QTTA 1QYVA 4FYIA 2IUEA 1E61A 3L77A 2E6KA 2D5CA 2E4UA 3VAAA 3AZOA 4MLCA 2MSLA 3VJKA 1P3Y1 3A3KA 1C9NA 2DOKA 3LD9A 5F64A 4EJMA 3FCCA 2CK3D 4IVRA 2F1KA 4A0GA 1J25A 3QY0A 2QIPA 3QEAZ 5BSFA 3QMWA 5J43A 2IELA 4FGWA 5EQDA 3UT5A 3L93A 2GRAA 3HA7A 3KWFA 1L0BA 16PKA 2RHMA 1KQPA 2BJWA 3L40A 1ZA2A 1PD0A 4PQEA 5JD3A 3R3SA 1HEYA 2DPLA 3OETA 3PICA 5KNDD 2PLRA 3KZNA 2WJ4A 3TE6A 3RGGA 2YJ5A 3AV3A 1C9YA 3ICQB 3S1LA 2UDPA 4OQEA 5ERGB 2XI4A 4Q37A 4DJEC 4K9OA 1T91A 5CDHA 5J5CA 3Q8LA 3D54D 1J8DA 4DV5B 4E5KA 5BUCA 1C8KA 4O63O 2LVBA 4EA9A 1J21A 3N07A 5G4KB 3AVYA 3UKDA 2P9CA 4OHZA 2WYOA 4E5UA 3P0FA 1YGYA 3RVQA 2VPYA 4IDEA 1UFRA 4RWZA 1IQRA 1RCUA 2D13A 3CLUC 2D74A 3MYYA 4P3PA 5AKYA 5CD9A 2C4TA 2QK4A 1WUIS 3CUWA 1U3TA 2WNHA 4Z9BA 3WRYC 1VZ3A 4H31A 3BJZA 1RWKA 1D07A 1K6XA 2PSFA 1NA5A 2G0NA 2VYNA 3AL2A 1NLMA 2HA2A 3LLCA 4K87A 4NZPA 5GV8A 1REQA 3VYWA 1EFUA 2VJQA 4JR0A 1NF8A 2VQFB 3Q88A 2LCQA 3VDRA 3EYWA 1MB9A 3JQAA 4MB6A 1ZRNA 1IVNA 3CIFA 2X8JA 4HQFA 4OB6A 3SFVA 4XH9B 3PQ4A 5CM9C 4CQLB 2FWMX 2VAMA 3A6FA 3TOCA 3KOWA 1U0TA 4EENA 4IZIA 4JSYA 1G21A 4NBLA 1UBCA 5CXSA 4JQOA 4Z9FA 3VPHA 1VB5A 4L2IB 2DQZA 2HDNB 2YINC 3BB3A 2DEUA 1ZQ1A 3FYUC 1US8B 3ONDA 1YTLA 2DR3A 4MYHA 5GAJA 5K3EA 5CLFA 4DLAA 3WGHA 1M2EA 1HG0A 5BSGA 3F3MA 5AOCA 2GJ9A 4AUKA 4DARA 4UM5A 3H3XA 3JPYA 1HG1A 4TV9F 1KH3A 2QM0A 4JYZA 4B76A 1BN6A 3GX1A 3VDNB 1NKSA 4ZCSA 1K5HA 2H31A 2I1WA 3KL4A 2BRUA 1KYZA 2IS6A 5BSEA 3DD1A 5CDTA 1T8YA 2G1JA 2NNWB 2IYVA 3R3XA 3FHTA 1IE3A 4NG5A 5AI8A 2R5FA 1AT1A 4Q6WA 2O8CA 4MO9A 2C8VA 4O25A 3PWZA 1Q95A 1P33A 3R6WA 2CNWA 1IIBA 1XKTA 1B00A 1TQ2A 3I52A 3LPCA 5HIJA 3W2GA 4LW8A 3ANLA 1FLAA 2P5TB 1KNXA 3A1EA 1E5VA 1UJBA 1ZRSA 4FGKA 4JYPA 3W5CA 4RGQA 2VH1A 4PM4A 1KRHA 3QFSA 5JJBA 2PWYA 3WRWA 2Q8NA 4MPDA 4NWIA 5L6MB 4DDVA 3LQFA 1JIVA 3H83A 2WAXA 3WGMA 4X8LA 3TS1A 5KU1A 2HRZA 2NZ8A 1C30B 1QKKA 1UXKA 1S3SA 1IN5A 2YYZA 3EUWA 3OPYI 4FD3A 1ABEA 3COZA 4ND5A 3U48A 5BMVB 5BUZA 4HFJA 4AF7A 5IJ9A 3D0KA 1O0SA 1FVXA 3NHAA 3CPSA 3F6BX 1GGVA 3KT0A 2IIQA 4UBKA 3DXFA 2BMAA 4AP5A 1V8BA 5IDQA 2GHTA 2WSIA 3WNVA 5HQ3A 5ENDA 2NADA 4M89A 4D8XA 4ZANA 2CUTA 4QGHA 3SU8A 5CCXA 2MHCA 1GDDA 4RF5A 1J9EA 1KPIA 4WTOA 4A82A 4BZWA 4EQ6B 4EBBA 3R3YA 3VGJA 1VE9A 1VCIA 3R3JA 1AN0A 2VLIA 2AG0A 4URVR 3JATA 4HO1X 3MMNA 2VAWA 1P0IA 1QGUB 1Z36A 3OF2A 4U0JA 5HJ2A 4E3WA 4Z4EA 3ZVNA 2WVHA 3MAGA 5JH7F 1JG2A 4P08A 2WT8A 2VOEA 4DJTA 1ZN2A 1OI4A 3RT9A 1XC7A 4AUMA 4Y0VA 1LPOA 3D7SA 4ZDWA 4DIUA 1JPVA 2V0CA 2AHRA 1SUEA 1OBHA 1YL5A 3AUXA 1PGOA 3EWNA 1PR6A 3KYCA 3Q0IA 4RV9A 2UYQA 4ATNA 5KC8A 1V1MB 3DP9A 4KXUA 4MUEA 1EFVA 1UH5A 1F5NA 4NEGA 4OMFG 3OTOB 5JAIA 1KA9H 2DAPA 2EKQA 4OJMX 3Q8KA 2J5BA 1J39A 3R41A 3AONB 2E82A 2ACVA 1NRIA 4AECA 2QR2A 3B6IA 2VAXA 4G56A 4ZYZA 4UMDA 3DTVB 4Q19A 3AVPA 4LRSB 2D1YA 2EKPA 2R4UA 4RGVA 2R60A 2F64A 3LWNA 5IANA 3R6GA 4W9RA 1OSNA 2LIVA 1P2UA 1UPXA 3HADA 2Y6UA 2IJGX 2WINI 3LZDA 4L95C 5IKPA 4IP0A 3AKYA 2BM0A 1LBIA 2W43A 1Y5IA 4EOGA 1ZIYA 1YFLA 2NUAA 2P11A 4B8WA 1QHXA 3NTOA 3JQ7B 2Z5GA 4RCVA 1EQ2A 4QA9A 4YJ2A 1RKXA 1THMA 5ALQA 3Q3HA 3D8BA 3PK0A 2B5VA 2HV9A 2PLWA 3AFGA 3C3XA 3GRYA 3C6KA 1G3QA 1WB5A 5K4AA 4TKLA 5KHAA 1ORRA 4BNXA 1G2QA 5D6NA 1W0KA 1WQ4A 2EHJA 3AESB 4A0FA 4DE5A 2D1RA 1WBBA 1AKRA 4QUJA 2QD2A 1G8SA 2I5PO 2JGJA 2C5GA 3CG0A 3RTBA 4BMDA 3E81A 2AMLA 3CLVA 4OBEA 2QT9A 4HB3A 4BQFA 2PA0A 3VNQA 1ARZA 3NBZC 3QFHA 4J0JA 3MILA 1N0UA 1VC2A 1LPSA 5BNWA 4MCIA 1TK3A 3DEAA 3ZHYA 4CU2A 3RT7A 4GDFA 2VI5A 2RAPA 2DBYA 3BXPA 1JPNA 2H0AA 3PPXA 3JQCA 4BJHB 5D51S 3H0CA 3UJ7A 1AQUA 1BQ3A 1YRLA 1UOEA 4FDTA 4AS2A 3NU1A 4HWOA 1P8AA 2OO5A 3DXZA 4U8HA 5LA6F 3O8LA 5C4GB 1PW5A 4CLOB 2OD2A 4NOKA 9GPBA 5BV1A 1RD4A 1NPDA 1T1RA 4RPLA 3FYSA 4JI5B 3PKZA 1HSOA 1OFIA 4ZYLA 1B23P 1V3UA 5CBPB 1FQKA 2DFKB 1PLJA 3I58A 3KJFA 1QB7A 3HMKA 4KE7A 4KRXA 4RHXA 4F5EA 3HVJA 2W00A 4WOJA 2FMHA 4DSZA 2PGIA 3UVEA 1JU3A 1KGSA 2G83A 3K0FA 1AHHA 1GT6A 3BQNB 3OWHA 4J16A 4UBNA 5HG0A 3SX0A 2FPMA 2X40A 1FYFA 1B8OA 4EUNA 1YQXA 4XB6B 4RIIA 3T06B 1RWPA 1ZITA 3AY6A 5HA5A 3FB4A 2IV2X 4KBGA 3TL2A 1PFWA 3TQOA 3FVWA 4HAYA 1HWYA 2XWBF 1WUHS 4FYMA 4M22A 4BIIA 5LZ2A 5DNDA 1QE0A 2R7NA 3DBRB 4GX1A 4I9FA 3FR8A 2SKDA 4C21A 3WKEA 4D9HA 5IJWA 2IEBA 1ACJA 2GM3A 5ARBA 3SC6A 3ZU6A 4GE3A 5CB4A 2FJ0A 1ZKDA 4MUHA 4Y67A 2G0AA 3J7TA 3LP6A 1QH1A 3QELA 5JJLA 1DEAA 3V8QA 1J0DA 2GZ3A 1OX4A 2Z9DA 3FI0A 2GF9A 3E15A 1YZQA 3GG2A 3R5SA 4KN8A 5JJIA 3I73A 5F5NA 4K9PA 2ID7A 4YNBA 5E2BA 5EUCA 2WA1A 3IT3A 4YP0A 3ABSB 1WVIA 3CTPA 1P0QA 3L9WA 3GAZA 4UBIA 4F9FA 1RM3A 2Q7OE 4HQRA 5ITZB 4OX9B 1U2DA 2QA5A 2LIPA 3V4LA 1OTXA 3AR2A 3IJRA 3I2IA 4R2IA 3B6ZA 5JYDA 2HR1A 3BWVA 2OEPA 3R4CA 5KOIA 2JAOA 5REQA 1Q14A 2WI8A 1P8JA 3KE9A 1L8XA 2PMKA 4PZCA 5D84A 1Z38A 2APJA 3P4YA 1AGRA 1KI4A 4LA4A 3RF6A 1A71A 5EWLB 1M2OB 2I7TA 3C6ZA 3MERA 5K3FA 2KYRA 1XDSA 3EVNA 4YJ2B 2UZ1A 4LKOA 3BK2A 3GLFA 2PTHA 3JQ8A 1KZHA 1WULS 4KMSA 3GWZA 3P2YA 4X1OA 5LYJB 2JAQA 4URFA 3ODGA 2I4LA 1IYZA 3PE6A 1G20B 4XPZA 4LY0A 4NY1A 1IMOA 1TKCA 1BQEA 1P4AA 4ZI7F 2X8WA 3WDSA 3SQLA 2R7LA 1LSUA 3EW7A 3QPVA 4OCZA 2GEUA 1N2JA 3BJMA 3SQDA 4BFXA 1UOOA 5I5EA 3QQPA 4H7HA 4W9NC 1H9AA 1XRPA 3DDOA 2NXEA 1F0PA 2ZAOA 2CZCA 2ETXA 3BE8A 4LV6A 4DF3A 5AXAA 1XA3A 3H2JA 3P26A 3AETB 3NPMA 4X1KB 3B1XA 4Q9JA 3UIEA 2VF2A 3QG1A 4TLDA 1J99A 3KT6A 1N9GB 3JW8A 4EKYA 1QZ3A 2ZGVA 4Q5IA 2B92A 1N5IA 2LCFA 2QTMA 3TOVA 1K5PA 1S7CA 3QXSA 1YVRA 4KNWA 4FYXA 4KXMA 4BQEA 3AYZB 5K4GA 5KUTA 1VLJA 3TW4A 3CH5A 1NN5A 2Z8XA 2ZJYA 1YDHA 4YJGA 5DW3A 2H1IA 3ZKWA 5LP6A 4Z0TA 1C1HA 1B2RA 1E6WA 1TYCA 2QU7A 2DP4E 4LE0A 2EQ5A 4NLLA 5B1IA 4P0PB 4DLZA 5L95A 2JLXA 1ZAYA 1YB7A 1QYDA 3O90A 2IHBA 4MS1B 3ZOKA 2QP4A 1UDBA 5A4JA 3JZAA 1CLEA 1SXJE 3DOUA 5HIKA 4J6FA 5CFOA 2WSSD 1W73A 3CSUA 3NM6B 3Q7QA 3LSYA 4IJKA 2P6UA 4O2LA 3GEBA 2JKYA 3NPAA 1L7OA 1P7VA 5H68A 2B4TO 2GETA 3EFOA 5BN4A 1BN7A 4JT2A 4DKJA 4F3CA 3ICPA 5IMBA 5A3QA 2PAFA 3TZBA 3W78A 2PHZA 3UXMA 3TMKA 2D7DA 2EYUA 1ZEJA 4KLAA 3MT9A 3IR5A 1NURA 4FFWA 3WK7A 4F8JA 4NI5A 1QZTA 4LJ5A 3KLPX 1XNHA 1BXRA 3C6MA 3ZU3A 3QUAA 2PJUA 1X1RA 5JXJA 4RTPA 2XBMA 1OZAA 4OQLA 2XITA 4HBGA 1PTJC 3FHLA 3K0SA 3JARB 1N5MA 3EXG1 1W5EA 3L79A 1C30A 1GGEA 1YFZA 2WF6A 3FMOB 5AVOA 1ESDA 1UC8A 3DUFA 3EW9A 2DSTA 1NSFA 2QZ9A 1QTIA 1LPPA 3KAJA 3OLQA 3UPDA 4F46A 6PFKA 2XMSA 4HFMA 4DCCA 1QH0A 5CDUA 1CRQA 1JEQA 4TUYA 1H2EA 3QVOA 2IPOA 4HEQA 4MRMB 1DCTA 3EGOA 4FMBB 1POWA 3I6MA 3QMMA 4G85A 3ZXIA 1CUWA 3AU9A 3U3KA 4FFBA 1JV2B 3SIRA 3UMBA 2GS9A 4B7AA 4W1SA 2ZAYA 1VCMA 3SIXA 1OLUA 1PK8A 1CR6A 1H5UA 2POQX 5SY6A 3RAEC 3FTNA 1GCGA 4I3HA 3DT8A 3EAGA 4IX1A 2ZJZA 4ALNA 3M49A 4QU8A 5HCUA 4CM7A 2X8BA 4EUSA 2XIJA 1XR3A 3C5CA 3TPCA 4GGPA 3E5RA 1JJVA 1XCJA 4FR0A 3GLHE 2XXAB 3ETDA 2O7SA 3IGFA 2HO4A 2R6AA 4UOEA 2WJAA 2QAIA 4HMPA 5LNK1 1ZDMA 4ZI7B 1S2LA 3E9DA 3COWA 4AY2A 1NW3A 3MIZA 5HOEA 8ADHA 3Q4GA 3HWWA 4RKEA 1U7ZA 4QDXA 1O7JA 1KQFA 1XD2B 2VF8A 2VA9A 2WKQA 2R2AA 1T4CA 2IDZA 2Y1DA 3JY6A 2NG1A 2WJHA 1RRPA 5CIQA 3CQ9A 3WV5A 2GD1O 3PUIA 1RXWA 3BX1A 3S1AB 2WIAA 4NP6A 5EMKA 1EWYA 5HF6A 2O59A 2A67A 1M6YA 2X9GA 1AM4D 2H16A 3OOYA 5KCMA 3AUFA 3CRVA 5KX5F 1ICEA 2V0GA 1ZVVA 2FQQA 2GPYA 1HDZA 4QU9A 2CHGA 2J45A 1FBTA 2YWDA 3K0CC 4G0WA 4TTJA 1I3KA 1XU7A 2BTEA 5TPWB 4UNPA 2OBNA 4HPWA 3ZVLA 4Z53A 2D2FA 5EHQA 4N76A 4N5LA 3KOYA 1WHSA 3KEQA 3REOA 4GOND 1J5XA 1XEAA 4ZCMA 3ZXYA 4UXIA 3T3HA 3QKSB 3ANYB 2QX4A 5KYYA 4EYKA 2O8DA 2NSJA 1U7DA 2W98A 2Y67A 3H16A 1XVLA 3HKBA 2PUJA 3K05A 3PQ8A 1IFXA 2CD9A 2ZDHA 4GPZA 4WIAA 3U44B 3KOMA 2FR1A 3OJLA 5K09A 4K46A 4M1TA 4NH0A 4K1LA 4I1PA 2IXGA 1Y5LA 2Q2OA 3EVTA 1X94A 4MQ5A 1D8AA 1JU4A 2VFAA 1T5IA 4S3MA 2TYSB 4YRKA 3IL2A 3R20A 1RAAA 2XUGA 3U1VA 2QQGA 3I34X 1LBSA 3ORRA 2XODA 1H0RA 4D9NA 4DM7A 3DMDA 4UHFA 2VCHA 3VSBA 2OHFA 1JA9A 2GPWA 5JJKA 3SFZA 4ZPJA 3UGJA 5A6SB 3IO5A 1GUFA 1QK4A 3AR9A 3ZLUA 3HL0A 3OLVA 2HXGA 2VG8A 3KCNA 4TL8A 4HDMB 4Z51A 2GT1A 3QYPA 4CR8A 4X8OA 3UH0A 2FPIA 2NSHA 4AMBA 1I7LA 5MN6A 3HZOA 1OBCA 4F2HA 4IRXA 4OXXA 3W04A 4FNMA 1Y4ZA 5F9HA 3SOPA 1U1EA 3AKEA 3AUJB 4QOHA 4M7RA 4FHGA 2QUZA 1ODTC 2RK6A 2ZRDA 4FYYA 4CKBA 3ER8A 3CBGA 4HN4B 2YWCA 4AKGA 3ZZNA 2FSSA 3RABA 1R8JA 1YH3A 1ELOA 1GZVA 1CRPA 3B9BA 3SC4A 1LBEA 2KB0A 4JJZA 4Z99A 1VYUA 1BCRA 5DSTA 2HX1A 3FLEA 2F1RA 3U4MA 3WGUA 4LSGA 1G8AA 5JCXA 3NH6A 1VIDA 3R5FA 2Y0PA 4UEQA 4Y9DA 3WAJA 3JQPA 1E9DA 4FZJA 3BH6A 2RGXA 4PFSA 3SHOA 1SB8A 4N3CA 5HW0A 1K88A 2B4KA 3TD2A 1G1AA 2XMGA 1TMYA 1JBEA 2PMFA 1KR5A 5K05A 1RXUA 3DMFA 2GNAA 2WD8A 1BXKA 1C4KA 1GQQA 3AKDA 3HYSA 4QQRA 5CU7A 2Q8PA 3MJFA 5DGHA 1DRJA 1MJFA 2IXAA 4GBJA 4KJXA 2WZBA 4GX5A 4QSHA 3U40A 1T26A 5BQXA 3HSSA 5JWRA 821PA 5KHOC 1UPAA 2JPDA 5HX7A 1JFVA 2LP4Y 3UBMA 2MDTA 2OFOA 4JQCA 4AZTA 3THXA 1W6UA 1ZCZA 2CFCA 3A32A 4KXYA 4LRTB 2QM8A 3U13A 1FJ2A 1C4WA 3GFQA 3VJLA 3W6UA 3WLAA 4S04A 5CXQA 2BH9A 3C4VA 3P2KA 4YRTA 4QT4A 2YWGA 2B5OA 2XYHA 5KKAA 1Z62A 1ZUHA 4M1WA 1E1RD 5AM4A 4C7JA 4JEUA 1QKIA 1ABFA 1EINA 3L0PA 3OA2A 3OC6A 3MXTA 1CQXA 4U2EA 1D1TA 2PR2A 4B32A 4I7EA 5IN4A 1WSDA 1ZOLA 3QHQA 3AVWA 2OUKA 2ZB3A 1YKFA 1SJ9A 3GRUA 3QIAA 4NECA 4X97A 3ICVA 1I2MA 2UUCB 4I50F 3Q40A 3KQPA 4NQRA 4D74A 5JXIA 2GK6A 4NDZA 2YV4A 2CLOB 1Z6GA 5ER9A 4NK5A 4GI2A 4F21A 4CM3A 1PSDA 1HDYA 2C4WA 2PCJA 3GMDA 3QY9A 4HNSA 1P5RA 1W94A 3AJRA 5I7HA 1O0BA 3DM9B 3RU9A 4WZBB 2O5VA 2IS2A 5JH7B 3MC1A 4Y7CA 4BEVA 4YQZA 5BYKA 3PGA1 4UTNA 5JY6A 5ED0A 2EJUA 2NN3C 4JB3A 4C0JA 5J4LA 3SE0A 3BE4A 4IBOA 2C9ZA 1B6GA 3BEOA 4GXQA 3ZHTA 3EZ2A 4PAQA 1LZKA 5JQGA 2NT3A 1QDEA 1P7PA 2WMNB 3WISA 1MZPA 2F6RA 3EEYA 3IQHX 1UWVA 2FF7A 3SSAA 1K5DA 3RRNA 3P27A 2ZJ0A 3N53A 4JENA 5GADl 3UGTA 1I6KA 1OWOA 3D8UA 2CNLA 3T1NA 1G66A 3MQFA 4J0DA 4AY5A 2X4LA 2HMYB 4V3BA 1PSZA 4AAYA 5KQMA 4XEHA 3ZZUA 1FYXA 3P19A 5KJ1A 4G0PA 1H3NA 2Q7XA 3NV7A 1VM6A 4FQ7A 1QHFA 4NV3A 4PLTA 4GP6A 5IVPA 1HF3A 4MW5A 1Y1QA 1UXOA 4D0GA 3LKZA 3H2BA 3G23A 4R1MA 4PYMA 4DVGA 2QW0X 1PQWA 4WDRA 3W3ZB 1MQSA 1PJ8A 5FEMA 3H04A 2TRSB 4NBRA 5LD2B 4B6FA 1U3UA 1GTG1 1OCEA 3Q3VA 3DGEC 1UFVA 3UG6A 4KIFA 1P45A 4LISA 4RYLA 2PYIA 5EJ7A 4M0KA 4OJYA 4Z7JA 1E9VA 2KHZA 4YTEA 2HXSA 5BN4B 4CIBA 5JYCA 1TAQA 3RVDA 4YJHB 1ISGA 1JF8A 8OHMA 2B4RO 5J40A 4IXNA 3E18A 4B6OA 2NO7A 2VJMB 4NJEA 3B8EA 2HU2A 1G4UR 5AKXA 4JP8A 4AO6A 2EX4A 1TKRA 1U3DA 1U8TA 2J41A 2A1TR 2FH5B 2NLOA 2PQ2A 3FWNA 3K4HA 3N3AC 3QW2A 5TQVA 5TQJA 2WMYA 3WDMA 1GXSB 2MJLA 2CLFB 1BAPA 2B36A 1A72A 1TXGA 2P9YA 1KDZA 2VYVD 4M83A 4LHEA 3HXMA 1HX7A 1B74A 3TOSA 1YRAA 3SC2B 4AX4A 3PWTA 1U8UA 1G1MA 2XE7A 4BRZA 2Y1LA 2Q0XA 4YJKA 4BDTA 1G2OA 3ZIAD 3DE5X 5IDWA 1OH7A 3BQ9A 4X1IB 1GLVA 3IQGX 2DCMA 3ZGVA 3UV6A 3ZR4B 2CT8A 1JAHA 5EEGA 2QSZA 2PRKA 3EVFA 2DFPA 3JZFA 2RG1A 4YRGA 1H3EA 4RY2A 3ZY2A 1MO3A 4B4OA 3QE0A 4QYTA 4X91A 4BGIA 2WTXA 2I80A 4TMVA 3L1VA 2NQ8A 1Z22A 1H93A 4ND1A 4EJSA 4URWR 4MCAA 4BE4A 3PHJA 2BEVB 2GUWA 4KI7A 4QDTA 1B0UA 1FP7A 2FTKE 2J08A 1IEQA 2M6SA 3GJ8A 3HDTA 5T4HA 3W6OA 4Y2UA 5ENVA 4AF8A 1RAGA 1UP4A 1YQEA 4FOTA 4NENB 5LL6P 1SPBS 2EARA 4TLLB 1AGXA 2XYVA 4O4HB 2FLVA 3OM8A 3Q9NA 3UT0A 4A26A 4F9GA 3FCEA 5FYQA 1EZ1A 2F8LA 3SF8B 1NYTA 3CUUA 3M4YA 3GVIA 1T0HB 4Z2YA 2ZS9A 3BIOA 4YH1A 5B37A 4F1KA 1G38A 1Z75A 4BNGA 2J3MA 1JR3A 2J6CA 1IN8A 1NATA 1BHSA 3DV0A 5DOZA 3RIHA 5ILGA 1BXZA 2WJIA 1L9XA 4KWEA 4XW2A 1CZNA 3TTTA 1SBTA 2QMHA 1NBMA 3AINA 3IAM6 4ZZ2A 2AE2A 2NT4A 4LYDA 5H16A 1JRLA 1ZXBA 3FF4A 3K9GA 3FFBA 5CVCA 2JLVA 1CD5A 2ENWA 4XUEA 1OLSB 1VA4A 1ZJZA 2HRRA 2O20A 3TQFA 1PF7E 3W8DA 4BAUA 2I6TA 3MTBA 3GJTA 3U7IA 4ZT3A 2I8LA 2AKYA 2PJZA 3CZPA 4RJKA 1M6WA 3WV4A 2X4DA 1VHLA 2NU8A 3T5PA 1VHWA 4B3RB 1KS2A 2ZS7A 5H7XA 4DDWA 2JKVA 3IP3A 3LBAA 2J1LA 1X7XA 1MB3A 3KSUA 2V4UA 4TLAA 4DGQA 3KPWA 1CUUA 3ZY5A 3EDCA 3TQTA 3RVMA 2XOKA 4YRZA 2QU8A 3NBQA 5EJMA 1P9LA 1RP1A 5K3DA 4DRXA 1BKDR 2BMDA 3PC7A 3MAJA 1O54A 1BS1A 1FA9A 2PXHA 3NFYA 4ZYYA 1L3IA 3K1JA 4GSYA 3WLJA 1VDMA 4PG4A 4PXYA 2XT0A 3OD1A 4WE3A 2ZZKA 3K0AB 5E38A 3GAAA 5EE0A 1T9GS 2DPHA 1BROA 1TEVA 3KHUA 4R9UC 2ID8A 5CA0A 4R83A 1WLSA 4D9IA 1BCRB 1GU7A 3OPVA 1JG3A 4RA9B 3G9TA 5HQJA 2VDLB 4L5BA 5EKDA 1DIRA 5L7YA 2CVOA 2H4ZA 1NDQA 2GAIA 1HRKA 1U6KA 3AKZA 1LRKA 1GRQA 4RF2A 2WT4A 3ZI7A 3MIIA 1NVKA 1M5RA 5CVUA 2HV8A 3UXEA 3V2GA 1OYOA 2JI9A 3OU2A 1M8GA 4KK4A 1RRVA 2ORYA 4FNAA 2JB9A 3LPMA 1J22A 4FKMA 5FFMA 4G0XA 2OQRA 3PC6A 4CN8A 4HDMA 4R3WA 1KE2A 4DCGA 4BO9A 2VJNA 1IBKB 1H8EA 2E89A 4JT8A 1PJ3A 2C7GA 4RWEA 3RVJA 4IV8A 4U8GA 1NG1A 3B2EA 2H5EA 1G8PA 2WUWE 4ARSA 1X9HA 3UC9A 1US8A 4TTSA 4C22A 2NXCA 3TRKA 1E7QA 5A5GA 1P1CA 4DV0B 5EJ4A 5I7AA 1XROA 3L1UA 4JP1A 2VVTA 2B69A 3WWPA 1Q44A 4JK3A 4R2LA 4U9HS 4BO7A 3A9UA 3WLHA 1R66A 2ZJ8A 4MIOA 3D7MA 1USWA 4DLXA 4DMCA 1XZLA 3B6KA 1ZH4A 5AESA 3KL2A 1IY9A 1IMJA 2ZPTX 3PRJA 5FWYA 4OX9Y 1JVSA 1ZVQA 4C0WA 2ZWMA 1JHMA 3QP9A 4LDQA 4MJXA 1SD2A 2EF0A 4JGIA 5KTSA 4NVRA 1ZGZA 2WNIA 5TV2A 2K2QB 5BWOA 4L4XA 5IXSA 2H08A 5LCXA 2EKDA 2QTVB 1G5QA 3GB9A 3U4AA 1K66A 4XWWA 1FSSA 1M1YE 2H1LA 1Z73A 4XKJA 4Z9YA 3T54A 3FPSA 1ZLXA 3FVVA 4MGEA 1JIXA 1HMYA 4EYSA 2CFOA 4TSRA 2DQKA 1D0IA 4UU1A 3W2EA 5JE8A 1KFBB 4KPUA 2QTHA 5ALRA 2REQB 2BFEA 2O57A 1Y6JA 3BRCA 1RKQA 5AW5A 4L02A 1AN9A 1Z34A 2WKRA 3PF8A 5HBGA 1Z0IA 4EIWA 2VNIA 4E03A 1LK5A 3EDRA 4YFVA 1DEXA 3F6EX 5I3ZA 3ORYA 2RGRA 3LUKA 1Y1RA 2NYVA 4MVJE 5AI9A 4OFBA 1V1JA 1RTKA 5EA2A 3CVJA 1NBHA 2FMKA 3RU7A 3ZHVA 1Y33E 5KWIA 3NIWA 4Q0MA 1Q92A 3WIEA 1L4MA 3E82A 4EL5A 1SEVA 5DTRA 3TW6A 1D8TA 2OAEA 3OIWA 4RPHA 4EPRA 1WRBA 2W4MA 4RDCA 4GKVA 4X64B 3BEDA 5ALWA 1GARA 4EECA 3FHCB 2Q5HA 3JATB 1NW7A 4WFIA 5I7VA 1M0TA 4OHFA 1KFCB 3L06A 4YAFA 1YIOA 3IMEA 2EJWA 2ZTMA 3MPOA 3L6UA 3Q12A 3N2LA 1WVGA 4MLDA 4RSHA 5C8ZA 4HAUA 1RRMA 4J1SA 2FDCA 4KLNA 1HQYE 3TVDA 2NGRA 4JL8A 5LFAA 3ROGA 3CNBA 4NFYA 1G60A 4V1CA 5KTPA 1NTRA 1T29A 5EQFA 1KBQA 1OLSA 3MB8A 1AO3A 3VSDA 2AHOA 2YIMA 3R5TA 2JHPA 2NVWA 3QOWA 1HNXB 1NX6A 3NBAA 3NH9A 1OZHA 1IL0A 3BILA 5IJ9B 5KX5B 2ONKA 1KPHA 2Q5EA 1YT5A 2WVAA 1NXWA 4PYIA 2V3CC 3A3YA 2CFSA 1JQKA 4M9SA 4FC6A 1NI4B 1BZYA 5B6PA 5FOWA 3ISTA 2XKAA 2Z4TA 4XOUA 5FUXA 1NBMD 1T2AA 5B1SA 1HT0A 1U7WA 3WB1A 1NBOA 4J3JA 1QRTA 2W22A 3AIKA 3ETHA 2XEXA 1DFHA 1DIHA 1XDDA 1DIAA 2EFYA 3BD7A 5CFMA 1YQWA 1G291 2GM9A 2O1SA 2WG2A 3OZBA 3VU0A 2I34A 5LYJF 4DIFA 4CM4B 5L3QB 2C9YA 3BAZA 4YJ2F 1TEHA 3N0RA 1X74A 4DWOA 4UEOA 4RIFA 3A1VA 1DHTA 3BZUA 4G63A 2M98A 4LJAA 4BZQA 2HU7A 3D1JA 3OF5A 4WZAE 3FKSA 2E1RA 2WICA 4B87A 4Q16A 4Y0AA 1U2SA 3FM9A 5E95A 4QDJA 1ETHA 1N2EA 3JAKB 4X7RA 2OPHA 4PHTA 4Y7DA 1A9ZA 3EGDB 1Y8ZA 1F2UA 2OCYC 1DNPA 3NRBA 4ENUA 4X44A 4EG7A 3G2NA 4XYLA 4YCNA 2QLLA 1DLJA 3G5UA 4H0NA 1PTKA 2HBRA 3AHHA 3BBPA 4NU6A 1XNRB 4GPIB 2CXHA 1V8ZA 4URZR 3W3AH 2IPAB 4P4GA 3EZYA 4RF4A 1QB8A 4QPJC 4H1VA 2VP6A 2OGUA 4K0KB 4UU8A 5DISB 1QLJA 1ULHA 1UKYA 3KXLA 3RQSA 2NPOA 2HRBA 2XY4A 3K6JA 3ORFA 1WXFA 2D2XA 1KORA 4ZQFA 4CM9A 1HDRA 2PUHA 2AMVA 4QGAA 2IOYA 3R7SA 3TGPA 2FEKA 2QEQA 4FFVA 4OUKX 3O3MB 1W93A 2XNJA 4WY5A 1XDBA 2AN4A 4G8BA 2DQYA 1D9XA 1O1YA 3O8QA 3FPFA 4MUJA 2EJBA 5AK5A 5EL0A 5FNVF 1Z5NA 2B94A 3GJQA 3HRHA 4BZPA 4DMKA 5AW3A 2A1TS 3ZLJA 4EW3A 1TIPA 1A8QA 1VLQA 3NNNA 1K5GA 3MLAA 4FE3A 2FRDC 4TYMA 5ALLA 2OLKA 721PA 2HH9A 3EIXA 2PKXA 1ML4A 2JZNA 2B78A 3TB4A 1KTIA 4EYGA 3HBNA 4B6GA 2C83A 4BJ6A 1YVDA 3ADPA 5AW4A 2B61A 2VJYA 3ZGZA 2AG5A 3V9PA 3RU3A 1P6QA 2FAXA 3MGCA 2HU8A 3V4OA 1Y4AE 3C7AA 4GE0A 3AZQA 5D3MB 3SYNA 3ZW9A 2E2WA 4DDHA 1UXGA 2QTZA 2Z57A 3B38A 3D5TA 5TSDA 4BXOA 4DUGA 1V41E 1W2HA 2PZBA 1G21E 1V95A 1RCTE 3V1UA 2F1OA 3UUFA 4AP6A 2PRZA 2I6GA 3O4VA 3JYLA 5F7ZA 3WYDA 2XADA 3BD9A 5G0VA 4J9UE 2JFQA 1OKKA 3M9LA 2XX3A 2WJWA 1R16A 1QGZA 4YRFA 1T3LA 4ERXA 1NUTA 4AJEA 5ITZA 1HM5A 3JAMA 2OV4A 3OMWA 5GJBA 3M4XA 2JATA 4F5WA 3DDSA 2VC2B 3E8MA 3KE8A 1AXEA 3E0XA 4XUCA 1C1DA 3TD6A 5BSTA 1SGWA 1F2VA 3WBKA 1BXGB 3KR9A 5CIYA 3NAGA 4CCAA 2IRWA 4BO5A 1DIBA 4L85A 1PR9A 4W99A 3H1EA 2IXTA 2JFBA 5DOVA 4X0EA 4EUHA 4AZ3A 5DZSA 1G19A 3ZWBA 1P1JA 1U3GA 2XYPA 3PG5A 2GFIA 4ZI3A 3PD1A 2YVAA 4PAWA 3EB9A 1UBUS 4DQKA 4CKXA 1ZRMA 4R1LA 4HNUA 1ZM7A 5LP6C 5JYBA 4KQHA 4Y6QA 5K5EA 2HSJA 2VPQA 1T6NA 4A92A 3JYQA 1XZAA 4JI6B 2BGIA 2HLPA 3LY9A 4FMCB 1QPBA 4JDUA 2ZSDA 1B2LA 2IPNA 1RQXA 1T35A 1XELA 2Q1XA 2A7XA 3KKPA 4LTNA 3QVJA 5CDFA 4I08A 4A5OA 9MHTA 2NZ2A 1TPYA 3GROA 6REQA 1I9CA 3E05A 1T34A 1JNYA 2OV6A 4QU5A 3RROA 1PWHA 2C5HA 4HS4A 2HWUA 1LDGA 1GGFA 1SCDA 2JEZA 3MINA 4KPFC 1JEEA 4B46A 1FP2A 2C8JA 5LMCA 2BP7A 1CE8B 1RYEA 3AEQB 4J3FA 4FWBA 2O7QA 3PGMA 4RGYA 1S7GA 4OFWA 1EXDA 1V48A 3EDOA 3H5IA 3S8EA 4CGYA 1LW6E 1QX3A 3HVIA 4XCQA 4KXWA 3EGIA 3T9EA 3UENA 4P35A 4QSMA 1XMIA 1R0LA 1JNXX 2ECQA 5DGCA 3LCMA 3WFIA 3ZWNA 3NHMA 3LW8A 5KOJA 2AFHB 4ZYVA 1GHTA 1A8UA 1BHO1 3PITA 4Q7KA 4RXTA 1XDUA 4COKA 4DKXA 6LDHA 3WYBA 3OQIB 1ZOIA 1J2JA 5DYTA 1Y8AA 3Q5DA 1BX1A 2H1SA 3JR7A 2VQ6A 1N2GA 1XMVA 1M6EX 4I1SA 5K8IA 2GDZA 4Y9SA 3USES 1WXXA 1QMPA 3VUEA 4OI1A 3S2SA 1MZVA 4F7DA 1QP7A 1ATZA 2VUSA 3TFOA 1WNFA 3EZNA 4QDOA 4LI3X 2QMZA 4RTMA 1TA9A 3RLIA 4XA8A 4MCHA 4CLRB 1E0JA 3PB3A 1QZXA 1WXWA 3QU5A 4BNUA 1LX7A 3RV4A 3R9WA 1HT1E 1KZGB 2QDXA 2ATXA 3S81A 4UUMA 1NI5A 2C3OA 5L3VA 3DOCA 4N7MA 4MLPA 5EWJA 1CDDA 5JAZA 3TZHA 5E9AA 1PT6A 1NBIA 5FFNA 3URKA 3ZWQA 1RFLA 4A8HA 2OSVA 1YUMA 2ZDGA 4BV2A 1PNVA 2H2DA 2ZWAA 2BFDA 3PC2A 2P69A 3QTLA 3LUFA 1LDNA 5GVSA 4HHEA 1O95A 3UTCA 4CKYA 3R3ZA 2JI7A 3AL0C 3QEMA 3I01M 2G4VA 4O4JB 3UMYA 4W7SA 5AJHA 4KE8A 2I8AA 4ZZ0A 1FQOA 4FN4A 1F4PA 4AU1A 2RBGA 2AFRA 1OZGA 5AVJA 3GDWA 1QHHA 1VHDA 3TMYA 1WPRA 1M5UA 4MGHA 5FPQA 4B3IA 1Y6GA 4XGRA 1DARA 1KH1A 2EZ9A 1O03A 2RJOA 3E9EA 5DM60 4LXGA 4BAZA 1RRCA 2IF2A 5LIRA 1F7UA 1KEPA 2JG3A 4DLBA 4WBNF 1DJPA 5T57A 4AW9A 3IMKA 1K0FA 4YRCA 2CJFA 1DUIA 3LWZA 4P4SB 4QOSA 3AUYA 1YE5A 4BGUA 3WHIA 4F0JA 5DBOA 4Z1MD 2NM0A 5DIFA 1DAKA 3PUVA 5IBQA 4Y2GA 1E5XA 1VB3A 5EHNA 1K1EA 1QZZA 3V42A 1XAIA 4IXMA 1RBZA 3QPCA 1VSQA 3JWIA 2HBQA 2IXEA 4KR9A 2Q5LA 1Y34E 5GGXA 1KIMA 1XQ1A 4MITA 4FWTA 3U5ZB 1C3OB 2O2JA 2PKYX 5EJIA 3RBXA 1O3YA 2KW5A 5LQNA 1OXSC 4WZBA 5JC1A 2JLWA 2P27A 4L4UA 5IDVA 1XMOB 3ZVKA 3ZQ6A 4G0VA 1TEXA 5CH5A 3JQFA 3ZTWA 4UDOA 1KGDA 4HDNA 1A50B 2P2DA 3O3CA 3THYB 5C18A 1E3IA 2IHKA 1J0CA 1A98A 4AO8A 4CIYA 3T41A 2QM7A 1AUVA 1UMBA 3OCVA 5KTYA 1G18A 3U26A 4IHJF 4UTOA 2OESA 4OHCA 5F2KA 1T3ZA 4OXYA 3SYRA 2WZDA 1VG0B 3LDFA 3QIVA 2OTCA 4XZ3A 5IKXA 4EX7A 5SV2A 1X42A 3OLWA 1YFJA 4JLDA 4GXRA 5JSYA 2R751 3OEYA 3U3XA 3BIJA 3LOUA 4YV7A 2H2GA 1T3HA 3C7CB 3Q72A 5LZ5A 1II9A 3A4TA 4CL0A 5I48A 1GZDA 1NTOA 2VDRB 4FNGA 4EX6A 2C95A 1KFKB 1PR4A 3Q10A 3UAXA 3HJUA 1GFIA 2VCEA 3EGEA 3IH5A 1F60A 3KKNA 3KQMA 1DCKA 4MW7A 4Q15A 1SXJB 3KKQA 4ZEOA 3PI7A 3DV0B 3Q5EA 1BCSA 3RWMB 3KPVA 1Z17A 5IJXA 3DC2A 1QNFA 1X1QA 1CY8A 4HDCA 3UMRA 1KETA 2V98A 3D1LA 4DY6A 1JS1X 1ST2A 1DO0A 3DNFA 1J0EA 4MKRA 1JWBB 4DT1A 5BVGB 4M8IA 1HE4A 5AVXA 2GDJA 5LLTA 2XXAA 2GN6A 5CDYA 3HV2A 4AL4A 3VNUA 4FYPA 1TKBA 2WRZA 1Z4MA 4S1PA 4M0CA 3WBBA 3M6AA 3WL3A 1Y8RA 3ECAA 5KDOA 4YAUA 1YE8A 1GPYA 1DC7A 1J8FA 1RYYA 4U7GA 2G07A 4YUXA 2Q3LA 4JU9A 3ZHXA 4HJXA 4R8SA 1L3CA 2FZ4A 2PJDA 2YWBA 1XZ8A 4PU0A 3UGKA 4ZDJA 1OGJA 3ENWA 2EP8A 2J9GA 4XGKA 3O0TA 2PGJA 5JAOA 1FNCA 1OAAA 1IXKA 3RYFA 1J00A 1PJSA 2WP8J 4UTRA 3DV2A 4WXPA 2V97A 3QPUA 1DG9A 4TL6A 3CLTD 3CURA 4NBTA 4D9FA 3K70B 2YZ7A 2VT7A 2W37A 2X86A 3LX4A 5CA0B 3M34A 4ER6A 3EXFA 5AFSA 5FUMA 1D2RA 4H60A 3W2FA 3FUXA 4HN2A 4R81A 4OGWA 4EA8A 4BV3A 1DJMA 2NZVG 5LQJA 4CDNA 1Q2UA 2AK2A 1DQRA 3K5HA 2DC1A 2H0RA 3QNWA 2FQYA 3W7BA 1C3LA 4RNCA 4EGJA 1JEAA 2P2YA 1JA0A 3V8MA 5ALJA 2XKKA 5IFLA 5AM5A 4A8JC 4E70A 2PUBA 3UOAB 1FFEA 2P9ZA 4Q7EA 3I62A 3KR2A 4IKPA 4D99A 4PZYA 1U5BB 1Z45A 4S2UA 1J09A 2CW5A 3OOSA 4AWAA 1YF3A 3RRBA 1E99A 2AMYA 3W5UA 1U0RA 1IHPA 4BNYA 1CSEE 2GAAA 4R1QA 1XZHA 2FR8A 1OC4A 5LMUB 5KZMB 2C58A 4KYUA 4X20A 4ND8A 1YVUA 1JHZA 1TRKA 1CJVC 4HG2A 1M75A 2WSLA 2XB8A 2M1XA 4HRAA 4IQ4A 4K9SA 4CKEA 5CAEB 1W0KD 1X8JA 2ZRPA 3OZGA 1NF3A 1DC4A 3DL7A 1JWAB 1VL8A 2VSYA 2ZRMA 4BMZA 5KMGB 2OOKA 4OGGA 2VHCA 1MHTA 4M2LA 1QVRA 3FCXA 3C14C 1OXVA 2L69A 2CEKA 4Q66C 4QEKA 3C15C 2GTPA 3IURA 1E3TA 3PVSA 3KXIA 3A14A 3CUKA 4DGSA 1YR8A 2JJ2D 5A5DA 4D6YA 1SWVA 5JECA 4J7CA 1FLDA 1Y3AA 4Y1GA 3UWMA 5A04A 1C29B 1O9GA 2GPAA 5EAIA 2B20A 3DAPA 4CTNA 1VKNA 3BKXA 4M9ZA 2WAAA 3F6SA 4WK6A 3ZDDA 3AILA 4UFNA 4XIYA 3LC2O 4P7FA 1CUEA 2ET6A 1GA1A 1RHJA 1S2DA 1VJ5A 1ZIPA 1ZYUA 3E58A 4MKIA 4XYMA 3V46A 3FVQA 1E2LA 2C4KA 3M5WA 4L5CA 2PS3A 1NE7A 4JA0A 2ZKLA 2FX5A 1WLYA 1X1CA 2QP9X 2ZI7A 3BREA 5C5EA 4KFCA 2VJAA 3QTBA 4RC9A 1PCXA 3KFLA 4GYYA 5I47A 4HLQB 1E3JA 3OM9A 3Q9SA 3TDMA 2CYBA 3QFRA 4PRZA 1H4QA 3NUZA 3VO2A 1VYTA 2CXNA 1E6UA 4Q7JB 1YOBA 3CF6R 2FPGA 4AN0A 4B3CA 1ENZA 3KBBA 2R4TA 1ZW6A 4HCJA 1R18A 1CQJA 4MA0A 2ZWOA 4RZSA 5IHXA 3GFPA 5A7HA 3HCWA 3PXXA 1JDTA 2HF2A 3W1EA 4X8HA 4IR7A 4N9WA 3UKJA 5E6SB 2PNFA 1UDXA 1ONPA 1PFVA 1C7JA 2N46A 3CZ4A 3FPJA 4OK6A 2C57A 3TRDA 4DOMA 3TQQA 3OE5A 2J9ZB 2HGSA 5IP5A 1CUXA 5CW1A 4GU5A 1IIRA 5AIBA 2EZ4A 3TSYA 5CEFA 4HWRA 1ZMBA 2FWPA 3ZQKA 2ZXEA 5TF4A 1L4HA 3AR7A 1CRZA 2DGDA 2JI6A 3I9V1 5FV4A 4V2IA 3QWAA 4Y1FA 2VEOA 1EWRA 1FU7A 2MINA 1GDTA 5IDXA 2W93A 4KXNA 4AJHA 1EGQA 2Y1XA 5BN5A 1W8DA 2Z8YM 2ZRIA 2Q0HA 2VIIA 2X58A 3O4IA 4MNTA 3EFHA 3KQYA 4MKGA 4YAEA 2GFHA 2WG0A 2VP0A 4OLJA 4BJ1A 4BX8A 1PHPA 1UFOA 3ESQA 4JSTA 3U7RA 3E5MA 3JYHA 1ZSNA 4FINA 1EFRA 5A4FS 2BVNA 1GVNB 3LG2A 5KDDA 1U3WA 1W52X 2INGX 2ZR8A 3F7NA 1TYAE 4PZDA 4DYHA 1G4HA 4P7BA 1AQLA 3NIBA 4IJQA 3RV3A 3T9CA 1G3IA 1N5LA 3H2YA 1NQ5A 2QTFA 4QLOA 5LBTA 4B45A 4M7WA 5ITWA 1XTZA 2JJ8A 1ESEA 4CTOA 3QBVA 1RJ9A 1LDYA 1T9GR 1P75A 1ACMA 3AJ8A 3MMSA 1LNQA 3BFVA 3BSYA 3WSWA 2UZ0A 5TIIA 3O8QB 2ONZA 3JWGA 1EAMA 3E7FA 3O4RA 4Q3LA 4EPYA 5KSZA 4K40A 3KZCA 4Q3EA 3U7EB 3I30X 5HMLA 1E3DA 4FUQA 3PEUA 1KEKA 2J0SA 4X6YA 2C4UA 4ZRMA 4PGFA 1KK2A 2XB6A 1F51E 3P8ZA 1EGAA 4MQUA 1YS4A 3TX6A 4D5GA 2ZCVA 3U61B 2ETVA 1K63A 4L51A 3VR2A 3G2QA 4KE6A 2VPTA 2AUNA 2C2XA 3SBXA 2WYHA 4ALMA 3JD4A 3HLTA 1PL7A 2PIAA 3CZ9A 1PJAA 5CNJA 2H2HA 5JNLA 4JQSA 1RJFA 3ZWDA 2BBWA 4JJ8A 3K53A 1YD7A 1G3MA 1FYEA 2XCOA 3HYRA 3FPKA 3MWEB 4NPHA 4PPYA 4XCVA 5THXA 1X7YA 3W34A 4PTLA 2BJVA 1ZOPA 1CYDA 1E77A 1S1CA 4I81A 4A91A 5ALDA 3I9MA 4UREA 2JJMA 1MA3A 2P7HA 3A9TA 2C59A 3WA6A 3RKRA 4H77A 3RVBA 5BRNA 3CBQA 2OZPA 3A9VA 4UMFA 3M8KA 4TTTS 1S2GA 3GLIA 2FPPB 4WESA 3UB4A 2AVNA 2CLEB 1KAGA 1X1TA 4YMHA 3MCUA 1DPFA 2E0IA 3T9FA 3WZLA 3W2HA 4WJZA 5C1OA 1Z39A 2QMEA 4RMHA 1E5QA 4NYIQ 4WKNA 2DPYA 4C30A 1T8RA 3SKVA 2O8CB 3CZQA 1I01A 1VJRA 4JJKA 3N9IA 3H17A 1XKQA 3HI6A 4M55A 3BN3A 3LT0A 2FHPA 4JJFA 4JYCA 3BUSA 3F1KA 3KWMA 1M8PA 5CG2A 5HOQA 1T1IA 1U0GA 2NZJA 3TRJA 4AIIA 1JKIA 3F7MA 4UM7A 3WVNA 1UM8A 4TKUA 4YJFA 1ISMA 2Q4TA 1L1RA 4Q1DA