2P0YA

Crystal structure of q88yi3_lacpl from lactobacillus plantarum. northeast structural genomics consortium target lpr6
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
324
structure length
240
Chain Sequence
RPKIVVIGGGTGLPVVLNGLRKQAVDITAVVTIRNVMVALSSWPDLYKDIFQGNLIGVFDAVQELSNMMQVDGHVYPALTLHGKFSDGTHKSLERVWVTPQAVQPVIDAIMAADQIVLGPGSLFTSILPNLTIGNIGRAVCESDAEVVYICNIMTGETDNFSDADHVRVLNRHLINTVLVNTEKVPEDYMDFHSKQVSHDFRGLREQNCRVISSNFLKLHDGDQVVAELMNLVGHSDVFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein lp_0780
publication title Crystal structure of Q88YI3_LACPL from Lactobacillus plantarum.
rcsb
source organism Lactobacillus plantarum
total genus 50
structure length 240
sequence length 324
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01933 UPF0052 Uncharacterised protein family UPF0052
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10680 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold CofD-like domains 2p0yA00
3C3DA 3CGWA 2P0YA 3C3EA
chains in the Genus database with same CATH superfamily
4NEQA 4DMKA 3PIRA 5KTKA 3CB4A 5ADWA 1DGQA 3H5WA 4X8MA 1AD2A 3DDZX 3G9QA 3S5JA 1E3JA 2QD1A 2IVFA 1GUFA 2QR3A 2Y0CA 3E5RA 5LQCA 1M2HA 3DBVO 3U61B 4Q4AB 1KFCB 1MVNA 2V6MA 1P3JA 4CL2A 4BAGA 2IL1A 4DGQA 2YMLA 2FSUA 2R87A 4PS1A 3GH1A 4XSVA 1GZ6A 1X1AA 2DPYA 4C2AA 4UUOA 4O4LF 3JAKA 2DH6A 3K0FA 1WUKS 4EPWA 4BBZA 4LCJA 3I73A 2W2VA 2VJCA 1JG6A 4M0PA 1UXOA 5IWAB 3I45A 2HL6A 3CW2A 3NETA 4CEJA 1ZISA 1EQAA 1D8TA 3LGXA 5CVTA 1V1JA 3PHLA 3R3YA 4BN5A 1OU0A 1SULA 1IZZA 4MRRA 4RVDA 3GT7A 5EP2A 3RT9A 2VJLA 4FCCA 1B2RA 1VI2A 4FILA 1XTVA 2C0PA 4CG1A 3AL2A 5HR5A 3ZHUA 1ZCJA 1UJ6A 1G8AA 1PJQA 1CTQA 3BCUA 4PINA 1IN5A 2Y77A 1XCJA 3MERA 3IQHX 3LY7A 1XEXA 3IDQA 1FQKA 1NVDA 4HNSA 4CMEA 2JLYA 1CVRA 3UF0A 1P1CA 1MTZA 1MB3A 3A3NA 5CJ2A 1GV1A 1EB8A 3H42B 3PKIA 2Q4RA 4DPKA 2OV4A 3SMVA 1N0HA 3NV9A 1U5BB 2PGJA 4HBGA 2M32A 4MSUA 3SYLA 3RC2A 3QX3A 2IZ7A 2PZGA 3NHMA 3HP4A 4WPGA 2FEXA 3RU3A 1GRVA 4G5GA 1VE1A 3D5QA 4EY8A 1DXQA 4UC0A 1ZUD1 3RUPA 5TQVA 2W71A 3F78A 4FNOA 3STXA 1IJFA 5JZVA 3BGSA 1R4MB 4BU0A 1EVLA 3A27A 1SAYA 1DKNA 3SE7A 4MWOA 3LECA 4P82A 3GB9A 1K6XA 2HZBA 1YI0A 5KNDH 1Z0DA 1IHYA 2PT6A 1ZZEA 2OXEA 4Q4HA 3CEPB 4TTVA 3AF3A 4KPEC 4RPCA 1PFQA 4UMVA 1BFUA 1Y4SA 3EC1A 4RNDB 2GJKA 1JE0A 1X7HA 3QLUC 1FNBA 4WFIA 1AHIA 4Y2UA 3Q3IA 2PMFA 1L7AA 5EE3A 4GXQA 2OZLB 2WG0A 4ZD6A 4KWTA 4RDCA 3D6JA 1K8RA 3VYTB 4J6EA 2W2XA 1OFGA 1OIWA 1ZOIA 3T34A 2UVQA 3ADKA 5KOJB 1B6RA 3TLZA 1N5IA 2AYXA 5TGTA 1YRLA 3GF4A 3DVLA 3L41A 1K7FB 3K6SA 2ZT7A 3HJTA 5E0KB 3MYRA 721PA 1JB9A 3NWBA 4KWHA 2GJSA 2JIMA 3DYIA 2D0OB 2R8YA 4LRTB 4OK3A 3WC4A 5F7XA 1C8LA 2ZEJA 3OD5A 2WABA 3M4ZA 1OZGA 2P30A 1Q0QA 3CLHA 5F1OA 3RTEA 1BCSA 1PSWA 3WJAA 3IR6A 3FPLA 3PC6A 4XOUA 1WEKA 1IIBA 4OHUA 4P92A 2JLZA 3BB1A 1VIDA 3EXHA 4CRWB 3L8ZA 1E2EA 4GI7A 1JMYA 2CBGA 3BH0A 1GSIA 3K73O 1U7OA 2HKIA 2OHXA 4I36A 5KMGA 2H0AA 3TGPA 2H65A 1MF7A 3PZBA 3RKSA 4O2AA 4FOPA 3OM0A 4HLUC 3FDJA 3O3NB 2PRSA 4CTKA 1WMDA 3P9NA 2RGYA 2A57A 5FL7A 5A3JA 2JAXA 1J0DA 1OFIA 1OXSC 1RI4A 2PRKA 3C39A 2GJ4A 3LPDA 4MQFB 4NF2A 1KDYA 3MTBA 2YWXA 5CK5A 3UB4A 3HSKA 1W5TA 1C9NA 3R6DA 5IUJC 3D3EA 4TQ9A 4G85A 1E7YA 3DMPA 4X5OA 4BNUA 4Y98A 3DZJA 3UVEA 3WGVA 1TZKA 1WNFA 2FR0A 3A58B 4PXSA 4AZSA 4JJGA 3ETDA 3QQ5A 4LSZA 2BHNA 4H77A 3ZPXA 4YAUA 1U0LA 1QFZA 2H1IA 2C9ZA 3K5WA 4YAJA 2Q9AA 4L9RA 1QE3A 1Y6ZA 4BKOA 3MQ4A 4H0FA 1Y5IA 3HXPA 5LN1A 2PLFA 3O83A 5CAEA 4LF7B 2BFDA 1WW3A 1M2OA 1R6VA 3HFRA 5EZQA 3SEFA 2I91A 5K99A 3IS3A 3JQ7A 1ZGHA 3HCWA 2OHVA 4JWKA 1GZ3A 1TM2A 2BTEA 2PANA 2JI8A 3RS2A 1AUVA 3SYMA 2CDAA 4HRYA 4XIYA 1WXQA 2ZJ0A 2HOQA 1IWPB 1LPOA 4K7JA 4ZHQF 2I0FA 2PL9A 1ELOA 4V02A 3D7KA 5IDYA 5FOQA 1ZC3A 3DHYA 2OGWA 2W2QA 1S8NA 1MD9A 4WT7A 4Z51A 1N7IA 4XM1A 4BLPA 4GOKA 4D4KA 1Y81A 2NU8A 1FNDA 3K9WA 3EX7C 2D0PB 4NBTA 3FD8A 4INAA 4Y1EA 2ZWMA 3GJ7A 3PUWA 1E9VA 4JLMA 3DZIA 4YI3A 5FTJA 1JTFA 3VYVA 1EM6A 5IK2D 4W5QA 5A9RA 4DR7B 3BTUA 5DT9A 3B6EA 4AY2A 1Y6QA 2QZSA 3FMFA 2JFVA 2EFHB 2PAFA 4LYFA 2PXCA 4XUEA 3EGOA 2EX4A 3CX6A 3U5ZB 4PSKA 2G5PA 2O8BA 3IUEA 4F12A 1E98A 1RTKA 3BE5A 5EJ9A 3BWMA 3PUXA 4M1YA 4PLWA 1QRRA 4YT5A 2GPJA 1L5GB 3SNKA 5F9HA 3H0EA 3HJGA 4MJ3A 2IVZA 2FEWB 1NW7A 1E3SA 3HBJA 3TO5A 3WWZA 4XCXA 4DR3B 3ET5A 2B7LA 4L28A 4HUJA 2Q4DA 4GOMD 5LPNA 5GM1A 4K9PA 2N46A 2I6FA 3FSEA 3BSYA 1P1IA 5AR1A 2N47A 4GR4A 4PE5B 4XX0A 3IR7A 2KPOA 4NR0A 4PR3A 3Q2KA 4IW3B 2YHUA 1EK0A 4MQMA 5ECDA 1SG0A 1Z4LA 2XSZD 4JITA 2Y4NA 2YWRA 3UMBA 4H1UA 5LDGA 1QOPB 1NKSA 1T2CA 1VHQA 3E48A 1ABEA 3FF4A 3TOVA 5KYUA 1HT1E 3JQFC 4KK4A 1C14A 1UDAA 2O5VA 5G2OA 5JMPA 3E2MA 3ZEAA 2PMBA 4CIXA 5B2FA 1Y9JA 3ACBA 4AXXA 5CDUA 2OQRA 2YV5A 2JK1A 3CX7A 3DDNA 2O1WA 4OHPA 4Z4HA 5KNDA 3KBOA 1LWOA 3UBMA 5KVVA 1YZYA 4B34A 4ALJA 4XVRA 3TMKA 3R7NA 3EDRA 1Y3DE 3TNDA 1F9AA 5CYGA 5KKNB 5G0UA 1M2NA 1EHYA 2QSUA 3GPCA 3RYIA 1V2GA 3ZCSA 1CYDA 2W5UA 2O2ZA 2ZRKA 4MRPA 5F51A 1XJCA 1XXLA 2NZUG 1NY6A 1XYGA 3MOGA 5I9BA 3B1WA 1KSHA 4P1ZA 1LNSA 3DHWC 2HR1A 2EEPA 2QAGB 2YH2A 4OL0A 3DR5A 5C5IA 5BNFA 2IYPA 4LF4B 2QQFA 2GJ8A 2FZKA 2HCTA 2RK4A 5IYZF 3JARA 1G4UR 3OJLA 3ZD7A 2BZ0A 5C5CA 5ADUS 2XYQA 5A9TA 3SEAA 4RLFA 2XTMA 3HEMA 3PEVA 1AT1A 2FUNB 1G5HA 1ZRMA 3INYA 1WXXA 3DMGA 1YVEI 5DXJA 4PBRA 2V74B 2GN2A 3UJ6A 1XU9A 3F74A 2FMKA 1OT3A 1TU3A 5K0LA 3EF0A 1QQ7A 4WK0B 4NK4A 3SQXA 1LI5A 5KYWB 3EUFA 3Q7TA 4RFVA 1JQKA 4XAQA 3UUGA 1I94B 3B1YA 5LU9A 5AUNB 1HRKA 3KJFA 4JL6A 2GBGA 3DE0X 5CM2Z 4KPFC 5LWQA 2PIDA 4RY9A 5CCXA 4LVUA 4EY3A 4W8OA 1R6DA 3UV3A 2CBZA 1F4VA 5TB5A 1BEUB 1XD9A 4BZQA 2XAAA 2AUNA 1F1JA 2W7TA 1OFUX 1WR8A 4HZUA 1NM5C 3C14C 2ZG6A 4LBZA 4KUGA 2AEJA 2YWHA 3BKWA 5EZYA 1OTYA 3TD2A 2KLBA 4O4LA 4BB0A 1NY5A 1SG9A 2GN6A 3W8RA 1XQXA 1PG5A 2BM1A 2P3QA 1USIA 2P1RA 3A3KA 3R3JA 3U4IA 4IMPA 4YP0A 5ALLA 3SR0A 5J23A 4YRGA 2Y1WA 1NUUA 4BS9A 4ZTUB 4MR7A 2FQYA 3B6IA 1M7HA 4S12A 5AKGA 4CV0A 3UJCA 4A1OA 4MW5A 3LBHA 4Q1FA 1NP7A 3FCYA 1PWHA 4HGNA 4O8ZA 3H1EA 3ZXUB 4Z1OA 1TB4A 1SXPA 5EKSA 1GZSA 1CS0B 1R4ZA 3ANLA 3Q5EA 1B23P 5NLLA 4KXYA 2PKEA 3ORRA 3T41A 2HRRA 2AKAB 4UTPA 4UE3S 3SZGA 1HKHA 1N7JA 2ZJ8A 4M9QA 1Q7RA 4JJIA 5KYKA 3FPKA 1U0EA 1YZVA 3GFFA 3MWLA 1ZD1A 4JMLA 5B6IA 1T91A 1M1ZA 1N5DA 1KQGA 5CFNA 3PEEA 5EWJB 1FF9A 4YMTA 1UC8A 2CV1A 5JISA 3NLLA 5J1SB 3AM4A 3KK0A 3DBRA 5M2QA 3KJZA 2RD2A 3AHEA 2NTNA 2V0CA 1KKUA 3O4GA 3TLBA 5CBPA 2HF7A 3PUZA 1X7YB 4Q66C 3TL2A 3QK7A 4A0HA 3ZWYA 2CMDA 1A7UA 1GP2A 1K66A 2A3NA 3E18A 3LBYA 3PF9A 3QVVA 3EVDA 4OUKX 1X3LA 2HB6A 3TL3A 3I58A 2HADA 2YW9A 1QH9A 3EISA 4QBFA 4C4SA 5AFSA 4KREA 2XNDA 3Q7SA 1ADJA 4MVCA 4OUDB 1TTTA 2VDWA 4IIXA 1TIPA 3CEMA 5D6OA 3CXUA 4F97A 1Y6FA 1YFZA 1HWYA 2OCDA 4EJSC 1PD1A 3RUFA 3OCUA 1CDOA 3JQ8B 5LB2A 5JBIA 2Y71A 3I1IA 3JR7A 4OQXA 5I9LA 1R8JA 1RWKA 1AX9A 5KYTA 3ZBQA 1OBOA 4AY5A 4CTMA 4EDHA 4DVJA 3FNEA 1U5CA 3OY7A 4MPRA 1ZSYA 5A1JA 1JTVA 4BHTA 5P21A 2XE6A 3FF1A 3VR5D 3L7JA 3KLOA 3N7UA 4HDMA 4D5GA 3E7XA 4N5LA 4AZVA 3H11B 4PONA 4W63A 5JDCC 3EPRA 5KHAA 3CINA 3NWEA 4YMUA 5KYNA 3NS7A 5F23A 1A27A 1C2YA 4MTLA 4DLUA 4AMGA 4EZEA 1N2OA 3WSVA 2PL1A 2EKLA 1TVKA 2CNNA 2QJRA 3AH8A 3H1PA 4IHKA 2I8AA 3ZCRA 1J97A 3OQJA 4I1SA 4UHJA 1Z2EA 1JHMA 3SLGA 2BGMA 2F64A 3PIIA 2E0IA 3E2IA 1VE9A 4J94A 4ZT2A 4BCCA 4RTJA 5LR6A 2ZT5A 1UJMA 5REQB 1QQAA 3BVPA 1RD4A 1A0OA 2ODTX 2RHBA 3UJDA 1NNSA 1D2EA 4QSMA 2XQKA 4LRXA 1EM8A 1H4VB 2PYZA 4B7ZA 5DCWA 5EMNA 2VR1A 2EIXA 2ZPUA 1IM8A 1PKEA 3E9QA 4II7A 3VZDA 3OFVA 4A03A 5FBQB 1G9SA 4BZWA 4EUHA 5BNZA 3SQMA 4JA2A 3VNRA 2WW8A 3MJRA 2OQ2A 5FPSA 4CM8A 2XKAA 1GRCA 3BWCA 3SHOA 5JHHB 4P35A 4LDJA 1XJ0A 3OJOA 5A06A 1YA6A 3H4IA 4GNKA 3CZRA 1O6ZA 3R0JA 1UZAA 4JUCA 4OLFA 1K4MA 4AJOA 4JLDA 1T2NA 4KMRA 1XQ9A 1Y4UA 4JSTA 1QYWA 2WJIA 2IWHA 3NONA 3L5KA 4YRCA 3H1BA 3O91A 1C4XA 1JJAA 4ZC1A 1CJUC 1ZK3A 2PGLA 3FTEA 3ELDA 4EGAA 1L4NA 1NFFA 1XYVA 3N8KA 1YI8A 3GLQA 4X92A 4R71A 3DKPA 3QUCA 1U0BB 3BL6A 1V5IA 2OORA 4OYRA 1EQUA 4ZVLA 2OD7A 1DEKA 4FZRA 4DA6A 3FGOA 1GYPA 4X45A 1XT6A 1I4OA 2H4ZA 4PYLA 3A25A 3E9YA 4ZHQA 5BV2P 821PA 4D46A 1WMFA 4RFSA 1FS6A 3DJFA 2EKPA 4CFZA 4MA5A 1RM5A 3I5MA 2WIFA 4DMRA 3EAFA 1VSBA 3ACDA 5H9WA 1A04A 5AOAA 5IS2A 3W8NA 4DA9A 1RQRA 2XBUA 4JC0A 1FQJA 1YUBA 4U0KA 4BO0A 2XUHA 3FNIA 1CJBA 1SWVA 3R6TA 2QTBA 3C8ZA 3FYHA 4UXIA 2IOYA 1FS5A 2OV8A 3O2JA 4Y2VA 1U3GA 3CZ9A 4KSYA 4QLOA 3H7AA 1NXOA 3WRXC 1OB5A 1E2BA 1O87A 1PVOA 3AHFA 1N2CE 4WI1A 5I7WA 3FZNA 1R74A 3STHA 5K5EA 4KJXA 1XVTA 1OFUA 1GUZA 3DHEA 4OVKA 3VPDA 4M8NE 1UKVY 2WHXA 5B7NA 2V6JA 1VJGA 2IS2A 1U94A 3N3AC 3HGTA 4EBFA 1FYEA 1FDIA 2FUCA 3D4PA 3ESQA 3HU1A 4HLNA 2IT1A 3GMDA 2IYLD 1YXMA 1N0VC 3SIPA 3VOTA 4L08A 2WWXA 3AHIA 1ST3A 4FLEA 3U49A 3GLUA 1SXHA 4MGHA 3VGPA 2CSXA 2V1XA 2MSDB 2PMWB 2RGNC 1K5HA 5JO0A 1KZYC 4Y2SA 5ULLA 1OXTA 3SZLA 1RP7A 2VRNA 1KR5A 2I62A 3FSJX 1HG1A 2J3JA 4MH0R 1L0BA 2X7XA 3B12A 2O5EA 1FDTA 4PLVA 2PUVA 1KS9A 5CA1F 3V48A 3L7MA 1ZCZA 4MW1A 4EVIA 5L7TA 1ZGGA 2ZSHA 3CQ9A 1V48A 2NUTA 4LMRA 4EI7A 5TIIA 3IHKA 3RYHB 2B4AA 2OUIA 1AV7A 2RB5A 3CUUA 4DV4B 4HP8A 3IDOA 4BMOB 3WQQA 5KHLB 4UCQA 3K0AA 1L8AA 1OI2A 4MUHA 5CX1B 1FUIA 1XDDA 3L7OA 4PZUA 5BN4B 2DMRA 2FLVA 1ST2A 4QPNA 1Q92A 2DR3A 3I04A 3TCKA 4ML3A 3R6WA 2O2EA 2ABWA 4B46A 5C8YB 3AU9A 3C6MA 3E3MA 1JPVA 3PXEA 2VPQA 4TTTS 3W9YA 2XQJA 1ZJ4A 4KDRA 4MDFA 2ZBRA 1GG8A 3DDWA 3RYCB 4BNXA 1FDVA 3U7RA 4IZOA 2GESA 5BUQA 1FYWA 1VKNA 4TL7A 3C3KA 3FHLA 5IYZA 3PEFA 3PDIA 3BFJA 5F7JA 5T41A 3V2HA 1VGQA 2C4MA 3JAWB 5HRAA 1W85B 4ZT7A 3HL0A 3N0TA 1SD2A 1JYSA 2C07A 2FSPA 2QMYA 4CIDA 4HV4A 4V0NA 4F4FA 1I0LA 4A8JB 2R4UA 3L6DA 4Q1AA 2GYWA 1YS2X 4W9NA 1IHDA 2OXTA 1W36D 3AERB 5CT4A 5E1OA 3DT9A 3F6CA 4D9NA 3K6JA 1DWUA 1ADYA 2QI9C 2RHMA 5ESDA 4S0ZA 3EARA 3U9TA 3G2IA 3KAQA 1H05A 2XUIA 3GPDG 5AKXA 1MAUA 1MA3A 2DTXA 2KBFA 3D3WB 4J1NA 4V0OA 3U0VA 3QLTA 1YF3A 4WVLA 4EUKA 3WG9A 5SICE 4REMA 1EPUA 1HLGA 5A4IS 5CLJA 4ID3A 1RXUA 4S0XA 5IAGA 2WPDA 4BB6A 2LCFA 2IY7A 3U7QA 2AG8A 2H92A 3RTGA 2CVHA 1HY3A 5J4HA 1MEEA 1GVNB 3BXZA 1UMKA 4RVSA 2X6TA 1B6SA 3BF8A 4MVJD 5AK0A 3BQMB 1NIPA 2QZJA 3WYCA 2WTEA 3E9MA 4F7WA 5DM4A 5AOVA 4ZOAA 2G67A 2AG1A 3IUJA 5ERYA 3AYXB 4TKMA 2UYOA 2VT3A 3NHFA 3KKMA 4WJZA 4BATA 2EKZA 3QPWA 5DKFA 4CR8A 3OOHA 4L8VA 4W6QA 2FHPA 5HBRA 1UBHS 3R2JA 4DCPA 3LBFA 2BZGA 4UBIA 3B85A 1C2TA 5DSXA 4BX9A 1HZZC 1MIHA 1SY7A 5AHWA 3ZS8A 5KSOA 1ECPA 4XM0A 3THSA 3ZE6A 2YJ6A 1SCAA 1EXVA 1QFJA 4O4JB 4DNOA 1M34E 4DYVA 3CR7A 3HFJA 3WIUA 4E4RA 2CMKA 3KYBA 2WI8A 2FWPA 3CNQS 3DZBA 1AQYA 1YONA 2CXNA 5BSUA 4EPXA 1UAGA 2FP4A 2V0GA 5CXSA 1WEHA 5DXFA 5G0VA 3TSZA 2E6UX 3G6KA 4QDOA 3K92A 1KNQA 1UP4A 5E8RA 4EFMA 3QXGA 1DIAA 3HU5A 1FYDA 2J7PA 3GNLA 3VPXA 3WQSB 4CM9D 2AFVA 1U6JA 2VSQA 1EQ2A 1KDPA 1LI4A 4QDZA 4BKRA 5JANA 3N0RA 4M76B 1WU8A 3CJRA 3TM4A 4UJ3A 2XDYA 2P9CA 2JVJA 5CITA 4S04A 1HT0A 3I8OA 1KJQA 4IX1A 3GNQA 1WDWB 2Q4TA 1L4LA 4XLLA 1GTRA 3EQ9A 3X1YA 1F2TB 4B3DA 3PITA 3WK7A 2XRFA 2XWQA 4JUBA 5CURA 2WE7A 2R9VA 3JQRA 2WJJA 5JBQA 1TYBE 1SHLA 4URYR 4WSOA 2F43A 2VJOA 3B1JA 2HV9A 3MFQA 2JANA 3CUSA 3KR0A 2G09A 1C8BA 1HEUA 3PP8A 4LGYA 2WC1A 1MQ9A 3ICWA 4Z86A 4EO9A 3ZGOA 4UD6A 2J1LA 8ABPA 1DRVA 4Q3DA 4HWPA 5D1NA 5KEIA 3NC1C 3P9PA 4Y1GA 5K0GA 4AQYB 3ZQ6A 1AV6A 4LZOA 4ETIA 4JR1A 4BKUA 1D1TA 1JMVA 4BVKA 3L8YA 4RK4A 1D4OA 3P9IA 1GITA 5K0CA 1V71A 1LQ2A 3OBIA 2OQIA 3N8GA 2WVJA 5FUVA 5KAPA 4AJHA 1NXXA 3EDYA 1EAYA 1UMCA 3R0QA 3V8BA 4A36A 1ZM9A 1TO6A 3RC3A 3TK1A 1FP6A 3GJQA 4UUAA 2FJPA 3S0JA 3DZFA 2JHCA 2Z9DA 3EQ7A 3DPUA 3L6OO 4QGSA 4C6TA 1F2DA 3QKRA 1UDCA 4QYIB 3FWHA 1A8PA 4AN4A 1YZKA 3PHIA 2UZ4A 5EMMA 4XX1A 5LLTA 1IBMB 1EVKA 2X9QA 1O1YA 2P79A 4DUGA 3H9JA 4L8GA 4EEXA 2A8YA 4BYGA 2OT3B 2WVAA 5T6MA 5LZ2A 4EJ0A 4BFXA 4MP6A 1TJ5A 4X84A 3A6HA 5EQTA 5KHOC 3MIIA 1CF2O 3IQDB 3T7IA 1E3WA 4DC1A 1XIVA 2VDRB 5H82A 2YVKA 5BOVA 3EGDB 5K2MA 3STUA 3ASZA 2GBLC 4G8JA 4C4XA 1FNNA 4FLMA 4RSRA 2QTNA 3D8RA 4BAZA 2XUPA 1DBPA 1C3LA 4RZXA 4TMXA 2JGEA 3U7JA 1T9ZA 5AI5A 1OH8A 2AG6A 3QPBA 3I05A 1ZY2A 1SCNE 4B3HA 3NOQA 4D4GA 2J31A 4R16A 1YUNA 1JEYB 4BKQA 1D6NA 2IDKA 5U4QA 1V7ZA 2XYPA 1JLRA 3MJSA 5ALFA 4YUVA 5IJ9A 3IMKA 5EA2A 2QNBA 5B1IA 3R7AA 2WWYA 4DB4A 1RAEA 3ZWBA 1V4NA 2AXEA 1NJ1A 1DKQA 3D31A 1YZLA 3H9GA 3V8VA 4JLSA 4KLRA 3WFJA 4BDTA 5MDHA 4WLUA 2QAIA 5JO9A 4BEJA 5BV8A 3O92A 4WERA 4A8PA 2OTCA 5DK6A 2IS4A 1V8DA 1YRYE 3OT5A 1N7GA 1NPDA 2VATA 2FXVA 4F4CA 1UEJA 3E9DA 4PAMA 1XTZA 1CQIB 3W9BA 4ETWA 3RS7A 1PG0A 4L5CA 4D8TA 4BXOA 3ZHZA 1TJNA 3KSZO 3JPWA 3G2JA 1D0VA 1J24A 2QRZA 3EDQA 3LQFA 1U8UA 4B35A 4NCKA 4YP6A 3D64A 5FUMA 5EHIA 5AJHA 1OIVA 1W1WA 2GPTA 2V8BA 3G7UA 4QUEA 4D8YA 1IRIA 4JXXA 1DNPA 1U3VA 1BQ3A 2C9BA 5T67A 1DHTA 1DU4A 5DFAA 4E5SA 3A9RA 1H23A 1PYGA 1MX3A 4CKEA 1MJFA 2XE8A 4CUKA 1TCCA 4KN5A 3ISJA 2EVWX 4KV9A 5GP1A 4DDVA 2B34A 4BLWA 4Z7OB 1ILWA 3KB2A 1YGYA 3KJHA 1F48A 3KUDA 1SK8A 2BGIA 1K68A 3E5HA 1XTPA 2F4VB 4AS1A 4X24A 1QMGA 3VOAA 3Q8LA 4W6ZA 4HLQB 5EUBA 4W5HA 2K4MA 3WLEA 1CRWG 4ZYLA 2OLJA 4FDMA 3R75A 5AUPB 5BN5B 4RVOA 2RGAA 3ZGYA 1JLLB 3C87A 1AGYA 3USES 4DV7B 1LK0A 4EARA 1JPJA 5DNCA 5AKZA 4EGSA 3I5XA 1Y9EA 2AA3A 3ENNA 2ZRIA 4QVGA 1BG6A 2WD9A 3OZIA 4JL8A 2W8BB 1N8TA 1ZW1A 3RSCA 4R0NA 1G64A 1F3OA 2FSVA 2PD4A 5CNKA 5DIFA 2AJDA 2ZK7A 3PPXA 2VUIB 4HX9A 4IG4A 3OTIA 1OBVA 3IKVA 2CY0A 2WILA 3QI7A 2OYRA 1C1DB 1JFFB 1R6AA 2C57A 2I8CA 2P2ZA 3D7NA 3GFOA 3G2KA 3KPUA 3M5WA 5E7JA 5B1SA 3NBAA 3VXKA 4AF6A 1WG8A 4DCTA 5HRCA 1P4SA 3RG2A 1J1UA 5KSWB 4Z9YA 4BQRA 1TAGA 3KALA 3X1ZA 4YAKA 3UWDA 5KCZA 1MDBA 2WF9A 1Y34E 5K3SA 4PEVA 4K0KB 2IZ0A 1IY2A 2DCUA 4CR7A 2OCAA 1FSPA 1OTHA 1O89A 2C0QA 3BWVA 1FVXA 3LUCA 4LVCA 2ZU0C 4RU1A 1J4AA 1I7PA 5BYKA 4G0PA 2Q7XA 2E6KA 1BOOA 2WIGA 2UVPA 2X7HA 3GLTA 3D0QA 4HYTA 4Y67A 2XD9A 1II9A 3C8DA 2XOKA 3DUFA 3KPVA 1KJIA 1VP3A 1EFCA 1G63A 1KK2A 3SJBA 5CYOA 3Q0EA 5AVZA 3VNBA 5H3HA 3IDZA 3A6LA 3OIUA 4IH9A 2ZCJA 4B5LA 1QS0A 1II8B 2YWFA 4HWGA 4MRMA 2HREA 3UFXA 5F1KA 1Y3AA 4FNAA 3CBGA 4P4TA 3ID6C 2H5IA 1GN9A 3RSFA 1K5PA 3RI3A 3T7SA 1Z29A 4N6NA 5AYVA 1PS8A 1HFWA 1B43A 5HUHA 1NN0A 5EJ5A 5ALGA 5K3FB 4UBKA 1TM7E 1US8A 3CNBA 4IHJB 3HBAA 2PKXA 4ZVMA 3CN9A 3DWFA 1FFSA 1JI0A 4RTQA 3PENA 4BNTA 1K27A 2QLJA 1Q1GA 2YCBA 3FOWA 1HMPA 1OJ7A 2BISA 3U19A 4RORA 1KJ9A 2BC9A 1YTLA 2J0UB 3KQOA 3P7MA 4W8HA 5IG2A 2FUG1 3NHPA 1E3DA 2R6ZA 3BCHA 1QZ3A 1TZMA 3NHLA 4C7JA 2VZ0A 4QT0A 2DF8A 4X63A 5ENZA 1FP1D 3LPAA 1PR4A 2PGOA 2WJZB 3O1IC 3G17A 1ZG3A 4ZO9A 1YOBA 4Z54A 3HY4A 4HO1X 2IQ5A 1T4DA 4BLUA 3HEAA 2C82A 1P9NA 4IIUA 4DZRA 2H0RA 1I9CA 3CLUD 3LPNA 3OEED 2HAEA 4QUIA 3H5TA 1JEAA 1UBEA 5LD2C 4HKTA 4JC8A 3M2TA 4LY0A 2PUHA 4YCBA 5LBTA 1V2HE 3I2GA 4E03A 521PA 1MNAA 2MSCB 3AR7A 4PF1A 1C30A 1BWSA 1L4EA 4ZOQI 2ZDHA 1RZRD 4BVAA 2Q4EA 5JCPA 1XB2A 2VXOA 1Z13A 3GEBA 3PK0A 3MOSA 4HXYA 2FMIA 4OTZA 4PSCA 3ZXIA 5GIPE 1YDFA 4WASA 1PT6A 1W5AA 1IHUA 1PL8A 1XC7A 2NO9A 4JVOA 2YY5A 3QNMA 6AT1A 4ZAVA 3W3AD 5CD1A 3ZWMA 4HR7A 4YO8A 1GFWA 5H59A 4RAQA 3DQQA 5LQUA 2FSHA 2V9CA 3CPEA 3KEOA 3G68A 3ND8A 3ZCUA 2ZBVA 2P6RA 1GG9A 4NL4H 3IVAA 2IZ5A 2M98A 1M2GA 3AB8A 1NW8A 1I13A 1DBWA 2CE2X 2CDBA 2BRUA 2PQ2A 3SMQA 3PFCA 2O05A 3HJBA 2X0FA 1GHTA 1XEWY 1ZSVA 2CHQA 1F17A 1SFRA 2O4CA 2RI1A 3JZAA 2Q1WA 3K20A 3ON5A 3IXMA 2X2FA 4TKUB 3SXPA 3WLLA 1E5QA 4NENB 2HSWA 1QU3A 3LDFA 4QU5A 1S2LA 4BECA 2JGDB 4YLEA 4PTYA 4BNMA 4TYMA 4IRUB 1RLMA 2NVUB 3GOQA 2XMCA 3CEJA 4L07A 3B7PA 2OC4A 4CDNA 2A0FA 4TXNA 2G1UA 4XWYA 5LP1A 4WINA 2AFIA 2X3YA 1R4NA 3BXXA 5KUTA 1D07A 1EJ6A 3IP3A 3UG6A 2F8TA 3B9RA 1L4MA 3JV7A 1GU1A 2H48A 4XZ3A 2FPOA 3FYUC 2EJUA 2DXIA 3G8DA 5HZHA 4JYAB 1IZ8A 1SVSA 2JBAA 2Q2VA 4IQ0A 4TWJA 3DCJA 4WAUA 2WSSD 4UD2A 2FMUA 4G1CA 3P20A 3QVOA 5BNWA 3I6IA 3UPDA 5D3QA 1W0CA 3R44A 2YW2A 1KZ1A 1YL5A 4B2IA 3M1YA 4BVLA 4E46A 5C53B 2XXAA 2DKOA 3GP5A 5JE8A 2QMUA 3MRVA 1ULSA 2IOFA 4I4TB 5BVGB 4L5BA 3L6CA 1IWOA 1EWKA 2P5SA 3P27A 4GR5A 1TQDA 2ZOSA 3FTCA 2UAGA 3I72A 4BX8A 1O0SA 3PG5A 2IUYA 3DYBA 5HMMA 2GZRA 4B3GA 1SIUA 3HB0A 1BXKA 1KEWA 1YB4A 1W30A 2WAAA 2YWBA 3R5TA 3KG2A 4OHKA 5FTKA 4ZHSA 2HRZA 3AI2A 5IASA 1Z17A 5DLQC 1SHKA 1KDVA 4DUZB 3GLIA 1RTTA 4OP3A 2BR5A 4LQLA 2XR1A 3RIMA 3GLFA 4GVLA 2DB3A 4MGEA 1PBTA 2P41A 1UC4B 3HGMA 4B3XA 1X0VA 4ISBA 4KX3A 2QJFA 3MW8A 4EI8A 1KIFA 1TT5A 3LX5A 2A0YA 3AKCA 4TYYA 5IBPA 2YBEA 1N2SA 3I9NA 3CLUC 3HYNA 1CD5A 1HLFA 4LJKA 2YC2C 1U8ZA 3BEDA 4GRDA 1DIOB 5K3OA 3GMSA 4FJ2A 4PSUA 1RC1A 2CXOA 1MX1A 2QKYA 4HC4A 1F20A 4ITRC 4C2UA 2E5WA 2HJHA 4QODA 5E6UB 2XX3A 1OLUA 3CCFA 3I37X 1JKIA 3B3FA 3K4HA 4TRNA 3VU8A 1TQ4A 4WLOA 1GA6A 1HSOA 1YQDA 1JVSA 1ZUHA 2ID9A 2SCUB 2WUDA 3OF5A 3F7MA 3FZYA 4GSYA 4PWZA 1R4AA 4R7ZA 5DW3A 4BP3A 1DJOA 4BDSA 2NACA 3SOZA 3TQOA 1GWNA 3RBZA 3DW3X 4LIPD 4N3CA 1E7SA 1S2GA 3IUBA 5JZSA 3V9AA 4HDNB 1A96A 3IPAA 5FWDA 3RAGA 1T1GA 1X15A 1RYBA 2BGNA 2OBYA 3VPCA 1ODFA 4IJUA 4AWBA 4CKZA 5LDDC 4X1OA 2IIQA 4N9QA 1SD1A 3DH0A 1CDZA 1EJ2A 4G1BA 4HI0E 5LOVF 1EIWA 3RT1A 4ND3A 3C41J 5KWIA 3IC5A 2CXXA 2I3DA 3OZCA 3M82A 4NRDA 4F2PA 2UUOA 1IPHA 4LZWA 5IN4A 3MCVA 4O4IB 3TQHA 1TF5A 2HLNA 1WDMA 3H1GA 4H4DA 3LXUX 2FN8A 2FF7A 1EXDA 3KZMA 2NSHA 4EO4A 1IXKA 1TM5E 2BMDA 4MKZA 1NXTA 1X8JA 2ZI3A 1Y8AA 2FY8A 2NNWB 3PQ7A 3QJ5A 4N18A 3F9IA 4N7BA 5CW1A 5EWLA 5AVTA 1CF4A 3DBLB 2JI4A 3HJUA 3L4BC 2I34A 1W2WB 3L79A 1NONA 1Q1NA 1MX5A 2DSTA 2R4QA 3NP7A 5IN5A 1AZTA 2FYTA 2V7BA 2NIPA 4JUFA 5KU7A 2QLLA 3QGMA 4PLGA 1MKYA 5DGCA 4XGQA 3ZDBA 2JS7A 2JD1A 2O2YA 4PSDA 2AN9A 2IGTA 2XITA 3WKBA 4CKBB 2ORWA 2BKAA 2WM8A 4YCMA 1OGJA 4I3GA 1TTHA 1T3LA 1V1RA 1BC5A 3CRQA 3CUEF 1ZMTA 1OWLA 1FRVA 1RACA 2HN9A 2VBCA 3IYLW 1C0IA 4JLPA 4DMHA 4KVZA 1T0PA 4L2IB 3TIVA 4PYQA 1EAMA 3ZHYA 2VJBA 4A6DA 1ZP6A 1G5FA 2V7PA 3BKXA 4P8RA 4MXDA 3EQ8A 3QU9A 4RE6A 1Y4DE 3ZGZA 2RGGA 3NCTA 1X7ZB 3QFSA 4KR0A 4Q3KA 1FE8A 1GPMA 2PSDA 5EP3A 3SXUA 3KKPA 3IVGA 4KQWA 1ABBA 4E21A 1OHHA 3DMFA 4ESOA 1M0TA 3AJDA 1SIBE 5LCXA 4RS4A 3ME5A 1LDMA 4B84A 4PQYA 5I5EA 3ETLA 3ZDYB 4C7BA 3ZVMA 1OU4A 2XTJA 4YCSA 2CYAA 5HGJA 5IJ0A 1T6YA 5TVKA 1ND5A 3DO8A 1KJWA 4YRQA 2JCXA 2AK2A 3O1JC 1GZVA 3ZJUA 1HDCA 1XKXA 2QU8A 3R20A 1A4XA 3ZGNA 1RZ3A 3AILA 3HCFA 2MCFA 1D0IA 3GEGA 4ZZIA 1KETA 2PWPA 1VG0B 1U2QA 3K0CA 4YJFA 1ZN7A 3FOBA 1GAEO 1Q1BA 4DDTA 4HB2A 1CUXA 5HKKD 2BDTA 4IZHA 4IIFA 5KOIA 4HVAA 4JXZA 1NBAA 1SPBS 2X23A 3BMCB 1BWQA 1FFHA 1HYHA 3E2PA 3PSAA 4ARZB 5AD1A 1S4MA 3NC0C 3OO1A 1QQBA 1VSUA 4ND4A 4UUQA 4J7XA 3QQPA 3OE7A 3ZWCA 4ITVA 3GFTA 3BSSA 3AVYA 4Q4LA 2VXYA 3AI7A 1LTKA 4N39A 1K8QA 3PUKA 3IAM1 1DL5A 5FQOA 1W44A 2ZYSA 4CQMD 4KR9A 1L7QA 3SQWA 2IXAA 2FV8A 2XF2A 3SGLA 3LDGA 3O47A 1RLIA 1YKFA 3HVJA 3D5EA 1KHHA 4GP6A 2W22A 4KMMA 2NYRA 1I4EB 1CQZA 3N59A 1Y8CA 1K86A 3GD7A 2YR0A 3WZMA 3PNPA 4ZI7A 2BEWB 3V7WA 5JI3E 1PJBA 1THTA 2XB6A 3A6ZA 3UANA 1JL3A 3L1JA 2EZUA 5F98A 3BE4A 2PDAA 3VSEA 3WB1A 1WMSA 2BFBA 2RG1A 4IDHA 2RH8A 4MV9A 3QW4B 3L4BA 4JN6B 3VYRB 2JLXA 3BX1A 1SVMA 4M1WA 1KZ4A 5L40A 1WBDA 2W93A 1P6QA 4B44A 3F5FA 4O2RA 4AJ1A 1FFBA 5J2UF 4TV9B 4CT4B 2WUWE 1EFPA 2GK6A 3ZNOA 2FPXA 2HCBA 2CK3A 1WQ3A 3KYCA 1J70A 3WGLA 4CT0A 2QVGA 3LLMA 4TTQA 4DBVO 1MRZA 1YZHA 2GN8A 2WSBA 3AV0B 1K08A 4I5DA 5G3ZA 2ZUTA 5BUZA 5CT9A 3WL8A 4R7TA 1OYWA 3GGPA 5EUCA 2HSZA 4IZ6A 4BLOA 1RWBA 3FMPB 2DQZA 1JU9A 1WF3A 1J33A 2ZI9A 2PAAA 3D3NA 4GMFA 2ERXA 4U7WA 4XVHA 5PNTA 5KYXA 4NJOA 1DS6A 4DSAA 1H4QA 4OI0A 2Y92A 4PO8A 3ZKWB 3CZ5A 3G0GA 1P2BA 5CLHA 5LMUB 4WH0A 3UAGA 2ZXEA 5B12A 4M1QA 3ONVA 4KIGA 4WW0A 5ETJA 4BO4A 4EHLA 4OXQA 4LYGA 3EC2A 1ZD8A 3IQIX 3I30X 2JFXA 1EVQA 1E6LA 3LM8A 4PYKA 3T4UA 5CBKA 1SC4A 3T99A 1WVMA 1CRLA 2Q1YA 3LJKA 3M70A 4JJEA 1MIOB 4OFZA 3T9AA 1OZ0A 1CEEA 3JD3A 4FFVA 4JL5A 5HFNA 4NS1A 2XUGA 2QW1A 2Z8YM 4YAGA 1PV1A 1NYTA 2A67A 2JW5A 4JEHA 1XHLA 4JOCA 1HXHA 4HWSA 1XZAA 1H2FA 1XMIA 1SMKA 4GMXA 4A16A 1T3SA 1HT2E 1KE1A 3I9V1 3ROMA 5CIYA 1CHDA 3AKZA 4Q1CA 4GEKA 1IUKA 3ANSA 3QITA 4RELA 1XMXA 2VTVA 2YRXA 3BJMA 4Y6OA 5DHRA 3GRUA 4WXEA 3P71T 1L5MA 3MWEB 4HQRA 4BRUA 4XVCA 1PBNA 4GO1A 2OVFA 1BMFA 3UW3A 1Y4AE 4CJXA 3H99A 3E58A 1J0AA 3EQZA 4DTIA 3K70D 2R0QC 5SY6A 4WBNA 3RC8A 5GV8A 2R47A 5KTNA 3WOVA 1LU9A 1Q16A 1YJBA 2IBTA 2AB0A 4WZAE 3RJZA 4WCVA 3PQFA 2ZIVB 4Y2YA 5HKLA 2H2HA 4LV5B 1Z4OA 1QIKA 2ZJBA 5IVDA 4EFNA 2DU8A 1HLPA 3DG9A 1SUFA 3G9TA 1T9KA 3DGEC 1T8SA 4N41A 1AZLA 1BX0A 3GY0A 4RA6B 3JD4A 3PXCX 4H4CA 5EFOA 2JATA 2J59A 1G2PA 2HCRA 3S2SA 1BX1A 4ZVSA 2GRJA 2QE6A 3RABA 4EG8A 3F5MA 4PRKA 2O1XA 3VTFA 1YQXA 4AIIA 3MLEA 2F9MA 2P2LA 1NI5A 1TTQB 1AQ6A 3LXRA 3R4CA 1UBSB 4IXMA 4Z0NA 5H7XA 1I3CA 1U7XA 2J87A 4GVPA 3SDBA 1I5EA 2HQSA 4D9GA 1QYDA 1DC7A 4KGDA 4J91A 2NT4A 4WK4B 4ZA2A 3ZJ4A 3L7AA 2ZUVA 3QUAA 2G4VA 5INTA 4RZ2A 5BWMA 4ZI3A 1QYIA 4F5YA 3IIIA 4P6VF 2JB9A 2CHVA 4OSEA 2PE5A 2BUCA 2QW8A 5YASA 4XASA 1VSQA 2J5KA 3IEPA 4CNBA 3LVQE 3Q9UA 1YZUA 4XA8A 3TUZC 4TXMA 1JN0A 4H6PA 3S2UA 4AS3A 3ETEA 1HORA 1P7PA 4CF4A 3TJRA 4GLBA 4LDAA 2GHTA 3PXUA 3BMNA 3RJTA 4MDEA 3WSTA 1IATA 2HTFA 4HXFB 4UNRA 4HWKA 3JVEA 4UFPA 2X3UA 2CT8A 2CMFA 5CLIA 1QJ4A 1H2BA 1O94D 3NM6B 4M55A 5CLLA 5LP6C 1FMCA 3Q40A 1Y33E 4MVYA 3JAKB 3WRYC 1A5SB 1YQUA 2BM8A 5G4KB 3LWNA 3SR3A 4QJIA 3ZS9A 1VE5A 4ZEOA 5HUQA 3QUSA 1PWXA 4WESB 4R9RA 4DUYB 4CEJB 5LVAA 3MAGA 4RHCA 2GASA 4YRIA 3WTBA 4A8HA 4DADA 2YJ4A 2VDPB 3A31A 4B8ZA 4Q34A 2VJYA 1SXJD 2V98A 2H4WA 1YBAA 2B8NA 4L0QA 1F0PA 4O25A 3FOAA 1BKDR 4X44A 5DLDA 2QBYA 1E9BA 5CK4A 4YP9A 1E5XA 4GBJA 3HJFA 3T52A 2O50A 4OHCA 3QKUA 1A1SA 3PX3A 4FIDA 3R3SA 2CMHA 4JKYA 2GEUA 3KJXA 5LNK6 4ENUA 3PQDA 1XZQA 2WVGA 2YYZA 1E4EB 1DZ3A 4IEIA 4LNHA 1E2QA 3AZQA 4OQPA 1QLJA 1XEXB 1E0KA 2WJ6A 2PUDA 1USKA 4M60A 1F2VA 1FU8A 2J9FA 3HUEA 4HX2A 4MDHA 1E2FA 2QV0A 2VPIA 1KH3A 4GEGA 3H8SA 1R50A 4D25A 2XCUA 3ADOA 2ZSJA 5TT0A 4PSVA 1E6WA 3LCUA 4TRJA 1RMTA 1XEAA 5FIUA 5KYGA 2AFRA 2IHJA 3IKMB 3K72B 2R62A 5J5AA 3WMXA 4BAUA 5K20A 4IDEA 1SOWA 3EFHA 4D0RA 1OV6A 1E1YA 2I4MA 4K3VA 2Z2JA 2RAPA 4K9MA 3ED1A 3VBCA 4HG2A 5CDHA 3K70C 1NQ5A 4XVQA 3OESA 2QV7A 3QPUA 1DRUA 3SOPA 2IF0A 2C2HA 2CWDA 1Q3HA 1U9IC 3FKSA 4I3HA 4YIHA 4Y2QA 3B3GA 4O1MA 2BFWA 1OR8A 4R0VA 4NBNA 4UHFA 1RYEA 4BGIA 3OQMA 1ONPA 1H6BA 4B3CA 1M8PA 3EFEA 1BN6A 1OILA 4IGAA 1V26A 2PLWA 4JVMA 1O7JA 1BHQ1 2OHJA 1JKMA 1Z0SA 2VYQA 1PR3A 2EJBA 3A3PA 3AKDA 3F6YA 5FOUA 3J80A 1FXWA 1T0UA 2V7QD 4NV1A 4WWHA 4ER6A 2P9TA 5IPFA 3AHGA 3MUEA 4RD4A 5HIJA 3K6SB 1ANKA 1JHQA 4LEIA 2VIIA 3O8RA 2N42A 3PXAA 4DEYA 2CVPA 2AMFA 4L9WA 3CYFA 4FE4A 1VHJA 1XA4A 4WECA 3TKAA 4JQSA 4DXDA 3C8MA 1U1IA 4L5AA 3KVOA 2OSBA 3UO8B 3UUEA 4EL0A 5CA0F 4UTZA 4J0IA 1N5RA 4XYMA 3VR6D 2Z8XA 2WG2A 4JLKA 3T7RA 4XDYA 1WHTA 5FB3A 5COQA 4JX9A 1EXMA 1KP9A 1YQGA 2BHTA 2HDHA 1POXA 5EZSA 5A4JA 1N34B 1KEUA 4FNMA 3EXHB 3IBCA 1V7PC 1RWPA 2QX8A 1EGHA 2V7GA 3A4IA 1RQLA 3V4OA 5KMGB 3G5MA 1V9SA 1K63A 4PFQA 2H7VA 1NI4A 4O2AB 4JI1B 1PUIA 3IMEA 3OUZA 3UAZA 2B9EA 1X9IA 3C97A 1F2UA 4LSGA 3TSYA 2QM3A 1AK1A 3ZJYA 2DKNA 1O94C 3LC7O 4AFNA 4Z3OA 1PTJA 3NNDA 3IBGA 1N2CB 2PMKA 4ZYXA 3P9RA 3VZSA 4PBSA 4U7FA 3O94A 3NEYA 5JMOA 3U17A 2DQYA 3QTBA 1CZLA 2CXRA 4ONEA 4M9SA 4OJKA 3Q8KA 1N3LA 4A2WA 3D6AA 1RXEA 2JJ1A 3T5DA 1ISJA 3R9KA 5GJVC 5ALOA 5CAEB 4IOMA 1DOZA 3HI4A 3OZDA 1W5BA 2BFDB 1I30A 1VPLA 2CVZA 3NTRA 3BK1A 2G5CA 1M2OB 4MQ5A 5A3SA 4JQCA 3VA7A 4D99A 5BSGA 4B81A 1KARA 4RF4A 4IV8A 2IK8A 3K0SA 3K09C 2XDQB 8ADHA 2G83A 4UDYX 1PJSA 2Q07A 4QTYA 1U2GA 1UBOS 3R4VA 2RI0A 5B3LA 5JT1A 1MG5A 1QTNA 1NQVA 5J2UA 4WZ6A 2HJSA 5JJKA 5HQJA 4E5PA 2WHPA 3Q8XB 3P8ZA 4BLVA 2NO0A 3CISA 3H2SA 2XWBF 3VR6H 5LBIA 2FN7A 2K5UA 1XCBA 1ZNQO 3HWWA 3I23A 2IZ1A 3CZCA 2KJQA 4HEHA 4MGYR 3G8CA 4U7TB 3BHMA 1N0UA 1MC8A 1Y8RB 3D7RA 1NNEA 1LJ8A 3I2JA 4FSHA 2PX5A 3RVQA 2G0AA 1WZCA 4UU0A 4BE7B 5HP4A 2MSNA 1WV1A 4OJQA 3AO0B 1N25A 1XGKA 1COZA 2Z6VA 5CPFA 2QG6A 2WF7A 4OU4A 3SHQA 1SKUA 4N5HX 1YZ3A 3O9ZA 4TT3D 4U2BA 1G2QA 1VJRA 5EIOA 3N2EA 1Q91A 2YX1A 4BNHA 2VJKA 4YPOA 3BXGA 3GJ3A 4K88A 1EE1A 3DM9B 4UTVA 2QMEA 4Y30A 4EGQA 1NU6A 3L0SA 1I01A 1LI7A 1RHUA 1P7WA 1TUIA 4XX0B 5F73A 4ALNA 1UBGA 4AQ7A 1D2AA 1W7AA 2I3GA 3DFFA 2RG7A 1WUYA 2IYRA 5BRNA 2BZSA 2EX0A 1VPWA 4B6JA 4KLZA 3GQVA 2XV1A 3E53A 4LY3A 1IQPA 4MLZA 1CVIA 1STOA 2PLAA 2YKGA 4XFJA 5AM3A 2ADOA 4FMBB 5KVQA 3ASVA 3OZAA 3UMCA 2EBFX 4YXFA 2XVXA 1B6GA 1RKBA 4EF5A 3RT7A 2D8AA 2FPRA 1F14A 3OCCA 3AWIA 2F17A 2EEZA 5F2NA 4Y8VA 5BSRA 4DUPA 3DEKA 5DEIA 2C5FA 1N5JA 1GGJA 3FDZA 3OZFA 3CRW1 3KOWA 5TV2A 2X6RA 3KUUA 4PW0A 1L5QA 4CM6A 4W1QA 2AN1A 3DOEA 3IE2A 1NPYA 1HYBA 3FOCA 1JIQA 3OPVA 3R8FA 3RYIB 3VR4H 4M49A 3DCNA 3HSYA 4JR0A 4AJPA 2O3TA 3PGLA 5DZSA 1G9XA 5IARA 5AVVA 1S96A 1CULC 1ZK4A 3EJWA 3OCYA 3Q8WA 4KO2S 3SKYA 3PD0A 4F72A 2NXJA 1QVVA 4FX5A 1Z8FA 1TU0A 3OC6A 2ODWA 4FDAA 3KTAA 4YRDA 3RWOA 1F0KA 2LDBA 3LQRA 2NTVA 4LFCB 3BJRA 4MP3A 1HDIA 1U0OC 1WU7A 2EGHA 4EA6A 2IODA 5BSMA 4C78A 1R64A 3H5LA 2RH4A 5DHTA 2H1SA 2NO4A 3KR2A 4EFDA 3GX1A 2YXEA 5AXAA 4D8XA 5JXWA 3EQ6A 2MR6A 4QTZA 4W7HA 4ZU6X 2F1IA 5IT0A 3WKAA 1K3FA 4M0LA 4CKYA 3H6KA 2CZQA 4L15A 4UXJA 3WIDA 4AJ4A 2MJLA 1KOJA 1MPXA 3G6WA 1JIUA 2XUZA 2DFPA 3P4YA 2O0HA 5FYDA 1Z4QA 2WTUA 2W6OA 2YNMC 1Q20A 2VTKA 3JSXA 2G25A 2XCTB 2NW6A 1VJTA 2HNBA 3OJEA 3DHVA 4P0TA 2H4FA 4GECA 3L0PA 4UVHA 4R98A 2Q3LA 1B14A 2WWIA 3RV3A 3QU2A 2DAPA 5JZMA 4CIVA 1XMOB 2C59A 1TTPB 1USUA 2JI6A 3Q3HA 4XQ9A 1V7QA 4Y2XA 3B78A 2WU1A 5ALIA 5F2KA 5LJLA 1W8IA 2IXBA 2DCMA 3H6HA 1U0SY 2EP7A 4W5JA 3LRTA 3K5IA 2B36A 1X42A 4YMIA 5JAHA 1ISFA 2AW5A 3OBBA 1YMVA 4HZUB 2ZIWB 4BNNA 2GK4A 3F2VA 5E8JA 3WLKX 4O4LB 1JAIA 2P35A 5IH7A 1NXVA 2A0UA 2NZYA 5JSUA 5TVGA 3IAAA 3RUHA 1EWQA 4QO8A 3SVLA 5CXXA 2CNLA 1SVIA 3WMGA 3CVVA 1OV4A 1CQWA 5EIXA 3CXRA 3QKWA 4E3ZA 3L8HA 1U3WA 4MR7B 3DWGA 4KXUA 4YDSA 5JCOC 1JGTA 1A4RA 2OR3A 2X5KO 4IXTA 1TYCA 4YIKA 3FTDA 5CB4F 2FW1A 2QS9A 5AQ1A 2OKGA 1R0LA 3JWPA 5EHQA 4GKKB 3DL7A 2WUFA 2O20A 5JC8A 5ERXA 2I7XA 1ZCBA 2AUMA 1YB5A 3K9CA 1MVOA 3JYQA 2OV3A 4YCDA 5F35A 3HKEA 1COWD 2ALJA 3FZQA 2GBFA 4CEHA 3ZW8A 3HCCA 5L51A 1GV0A 2WICA 1GPJA 4E88A 1ZICA 5HS4A 4K9DA 4DSZA 1LDGA 1C80A 1YB1A 4UZSA 5CCBA 3IMFA 3I01A 3KSDO 5FWXB 5GADl 1B8NA 2R8OA 4POAA 1OWMA 1X70A 3AGQA 3BGDA 3DONA 4HNGA 4OK6A 3SF8A 4DA8A 1HNWB 1Z7BA 4AZ0B 4LOJA 2I2AA 3PVSA 4RTPA 3RF6A 1XHEA 2FEMA 4MULA 4EZBA 3DBRB 5TQ2A 1AQJA 4OBEA 3NVKI 5CBPB 3U56A 3I2HA 3D7LA 2GMWA 3ISVA 1WB4A 4NJMB 3WXMA 3VH1A 2QZ9A 2QN1A 2FPMA 3THXA 1Z82A 4M0FA 4MLDA 1NQXA 1MAVA 1TA4A 1YASA 2N1BA 3I2YX 4GM0A 5KB3A 3CS3A 1H3NA 1NKVA 3UHAA 4B6PA 5FNZA 5AJTA 1R12A 5B6PA 1QRTA 2XNJA 2A7QA 5SZJA 1AKYA 1HRDA 4CG0A 4NQZA 3USCS 3ZGLA 4WXMA 4ZVTA 5BMVA 1Q95A 3BC1A 3QU7A 1TGYA 2O3RA 2GJAA 4PGFA 5HW0A 5ICCA 4KVAA 2V03A 3AV3A 2OQVA 1EBUA 2OCKA 4OCZA 1ETUA 1C9JA 1XAGA 2YNMA 1C1XA 1WHSB 2EDCA 2I7CA 1BRMA 2Z30A 4QOSA 4AP9A 1T9BA 4B9AA 2WB2A 1EUZA 1ETHA 4R3WA 4WKGA 4ZDWA 5ICFA 4LYYA 4DA0A 1PQWA 2WAOA 4GE0A 1G20E 5JJ5A 1PSDA 1S5PA 3VZQA 4LGCA 1CR2A 2ZS8A 4D81A 4J7UA 1SRRA 4NFLA 1JW9B 3U5TA 1TX4B 1M8FA 4OXRA 4RV4A 3VM6A 3P0FA 4P7FA 4Q03A 2NZVG 1NXSA 3VR4A 4DG9A 4PX9A 4LFBB 1Z47A 4TKLA 1FUEA 4TVSA 1ZH2A 1T13A 2VWPA 3N05A 3L40A 4UAJA 2G7ZA 3N5CA 4IIHA 1ZVJA 4WKCA 1ISIA 3BPSA 1IB0A 4B33A 1GPH1 4CLEA 3RF7A 1F8YA 3CE6A 4RIHA 2V1UA 3B38A 4QKQA 2C2OA 1C3VA 1EM8B 2QTZA 2DE0X 3OKAA 4GZ6A 4A6EA 2JDID 2OM6A 1IUNA 4ZVNA 1K6IA 1CJCA 1XN4A 3UA3A 4PGGA 3B1VA 5JMWA 4EPRA 3U9LA 1RLOA 3G0BA 1ESNA 2FMHA 2NXNA 2OECA 1CUUA 3LDHA 3NP9A 3NANA 4L5YA 4CM8B 2B35A 5JWOA 1DKPA 3OT1A 2ZRGA 3HCNA 2IA5A 1JQLB 3UJHA 4K9RA 3HUFA 4ENVA 5F3RA 5B4UA 3TD9A 1V9CA 1QH8A 4JXJA 1BX3A 2XCSB 2IHTA 4KIJA 2IP1A 1BD4A 5EJFA 2W43A 2NAPA 3AW9A 1NSTA 1E4YA 4NYIQ 4B3IA 3IOBA 1HURA 2YQ4A 1HK7A 3UQZA 3VYWA 3N0XA 2XRYA 2GYUA 3RBAA 3IB6A 1QCYA 1H2WA 1WSWA 1WSAA 1WAMA 4MEJA 2CXSA 5UKDA 4AUKA 1ZW6A 1T0IA 3TW8A 2PRJA 1BA3A 5JNWA 3IAFA 4EWLA 4B0OA 2H00A 2RK3A 6YASA 4S35A 3U4HA 1JS1X 3PB3A 1TMGE 3EUWA 4QYWA 3ZI0A 4ZHQB 1KK1A 4EYOA 3PRHA 4L16A 1RE0A 4ERNA 5DTIA 2XUDA 4RFSB 1XCPA 4D44A 1KPIA 5GQSA 2NXWA 4CFSA 1CRQA 2IYVA 4MIKA 2D1QA 2EG5A 5E0OA 4YAEA 3H9BA 2GKSA 4BX2A 4ZCMA 3MVEA 2GEFA 4XW2A 2Q8NA 3OLVA 4UAUA 2H4YA 1MB9A 2FG5A 5HZGA 2VJDA 4AUEA 7MDHA 4FHFA 1J0BA 1J8YF 2VQ6A 3ZHOA 5IAAA 3SBOA 4ZVVA 4V1CI 1EDDA 5CDFE 5HPYB 3BERA 1Z18A 1MXHA 1N0WA 2D2IA 2Z83A 1LKZA 2Y1GA 4ZYVA 4PZLA 1CU1A 4GPEA 3RFUA 5G4LA 1E9AA 1X38A 2JGJA 4DLYA 1OVGA 3D4IA 4UPEA 1DV2A 2JGRA 2AEEA 1FSZA 3EYAA 5DNYB 4DV0B 2F6RA 4GKBA 1B93A 1YBMA 3OQ6A 3SR4A 3WLOA 1QHHB 2CDCA 4MZDA 4CL8A 4J16A 1E3LA 4M3NA 5J58A 2RHWA 1BIFA 1SO8A 2FPSA 3BTVA 3ZHSA 1J49A 2GAJA 3DBHA 4PS0A 4W8GA 4PNHA 5GONF 2JIOA 2G9QA 4LPKA 1BNCA 2REQA 2J0EA 1M6YA 3KYDA 1DJNA 1ZM2A 3IODA 3OI7A 3Q6MA 1NF8A 2K2QB 1BH2A 4FXOA 4KUHA 4EO7A 3RROA 1NF9A 2CLDX 2W2TA 1L9XA 4HNVA 3IRUA 3OX2A 1VKOA 1XOIA 1QDUA 1T9AA 1IWBB 5HZKA 2Q7OE 3TNLA 4M99A 2NQ8A 4L0MA 2H2IA 4NCAA 2JASA 5KPJA 1RJ9A 2NUTB 3B9PA 4LXIA 1RLUA 2QMZA 3ACCA 4NOJA 4BX0A 4DPMA 5K0EA 4Q15A 1KNXA 3KETA 1CX9B 3ONDA 4S1PA 2UKDA 3HLYA 1GT6A 1IXRC 3MS2A 4LF5B 3IILA 3K0AB 1U11A 2JLAA 3WAKA 4TTPA 2P2SA 3ED5A 3AJ8A 3IXQA 4FBMA 1OKKA 1BFDA 4RKWA 1Z2DA 4P4LA 4U6SA 1UBNA 4Y2HA 4L74A 5BOSB 1B2LA 4UUPA 3EGIA 4BO1A 4FU0A 2AZMA 3O21A 2Q3DA 4PAGA 4EAAA 4I4NA 4G25A 1U9CA 4ITUA 4MQLA 2P68A 4ZPXA 1PZFA 3EZXA 4B3SB 3DWEX 3FZEA 5FOWA 2VQFB 5ELXA 4UUNA 4OH7A 1RYFA 5GZ6A 5K8UA 3GFBA 1UJ2A 2H2WA 3IIKA 4LC9A 4CM1A 2YHAA 3ZU3A 3VNSA 4EMSA 5B5SA 5IYZB 2ZIZA 3PDIB 4GP9A 3W06A 3FJOA 4X20A 2CV0A 4J9UE 1RQXA 3ZY2A 3WYFA 4LJRA 1Y63A 4GC5A 1NVVR 2I3BA 4GWGA 5ICEA 2G1JA 5IBQA 1I5OA 3OICA 4RSGA 3QFTA 5TSDA 1JHOA 3AVQA 3NDJA 3QLJA 3VX4A 4ZK6A 5I4IA 4R41A 2CUTA 2YJ5A 3C3WA 3A1CA 3OG9A 1PJ4A 3DDUA 2YWCA 2HC9A 2UZ1A 4QQ8A 2DLNA 4NHEA 3NAMA 4U9UA 2ZUEA 4UXHA 4CMAA 1ZQ1A 4B3RB 3OMWA 2WJ3A 3QUQA 1BHSA 1W2GA 4LZLA 1K06A 2QD3A 2HFJA 4ZCLA 4M7RA 3HDYA 3EMKA 3VC7A 4C22A 4BIMA 1IQUA 1M10A 1M7BA 2PX2A 2W37A 1MX9A 2C3UA 3U7QB 4RVFA 4DY6A 1WBBA 3W79A 2R6CA 5JR3A 1P8JA 1EVIA 3C3AA 2F1JA 1BS9A 2IY9A 5AKKA 5BR4A 1Z8DA 1E3EA 2GLXA 3HN6A 2VBIA 3HWX1 2IHZA 3K4PA 3M3PA 3NHJA 5DDIP 2DULA 4OX9Y 2BKXA 4ZO6A 5KNBD 3TEFA 4RIEA 1JHXA 1JVNA 3V46A 5FWYA 3N6VA 3ZJ5A 2ZU6A 3MJFA 5CB4A 1FDWA 3QEAZ 1L5ZA 2XA2A 2NPOA 2QN9A 2V4MA 4YJHA 5JRJA 2FWIA 2Y1OA 1L7DA 3TW6A 4P5PA 2CEKA 4OI2A 2FW7A 2FK7A 3TBFA 5JZBA 1E8MA 5JS2A 3BK2A 4ZRMA 1Z36A 3RVPA 3DVSX 2CL7X 2QP3A 1KIMA 1CY1A 4JQOA 2AQHA 1LZKA 4OFWA 2YWGA 4F4HA 2H4XA 2W6JA 5HS6A 3IESA 5IKPA 2GCOA 3PQ4A 4LN1A 1PFYA 2W11A 3UXMA 1E9RA 1OQAA 3ZY4A 1WZUA 3EA0A 3I8XA 2WTBA 3E05A 1UOEA 2REOA 3LPCA 2ZM5A 3OCXA 1ZX1A 3B2EA 1JR4A 2AK3A 3UY4A 5C1PA 1E3IA 3ZTYA 1E6KA 3BA1A 3BDAA 4G0VA 2D00A 3L4KA 2ZUCA 4FYXA 4G0NA 1O4WA 4TL8A 1TE2A 1DJMA 3P4UA 2DHDA 1RR6A 2GDZA 4PV7A 4AZ3A 3D1VA 3GNSA 4JBYA 1G291 2YQ5A 4G67A 4EKIA 4IIEA 5HIMA 1QVAA 1D6JA 2WTAA 3FMOB 3GFSA 4R51A 5EHNA 2RGUA 2H31A 1D4ZA 4F11A 1WB5A 1PJ8A 1PV2A 1RCTE 3MMPA 5B3JA 4FUQA 2B3DA 3AOEC 3AVUA 1SCUA 1JHRA 1G5RA 4B73A 5K6AC 1BROA 2B9VA 2G77B 2KI5A 3GJ5A 3PRKE 1DT5A 2F43B 1R66A 4NI5A 4BV3A 4F5ZA 1JIJA 1U3FA 2WPNA 1BD3A 2XY4A 4LV6A 4MUKA 5IAOA 5MGNA 1TCBA 1NE2A 2ZSAA 3TTWA 3V7YA 2GCGA 3OQNA 4QTUB 4E5KA 2BMFA 3OX1A 1CK4A 3UHPA 4EFKA 4AKGA 5DBFA 2YRWA 4HSGA 3EBLA 2PJDA 3KU4A 3ZJTA 5AIBA 2J33A 5EZ5A 3VX3A 4FEYA 4QDXA 4A8TA 1TKCA 1B73A 2WIJA 2Y4OA 4HNAB 3UT0A 4EKDA 4ZOEA 3ZQJA 3L0IB 2N75A 3LY5A 3ZE1B 3A1VA 1REQA 2H06A 3AHDA 1U0NA 4F4JA 1AKUA 3UV7A 4ZQCB 3P9ZA 3RBVA 3TI9A 2JIDA 3OZEA 2Q9BA 2WB4A 4ND8A 4HOYA 2FEAA 1UMCB 4PQRA 1FMTA 5DTQA 2Y9PB 1QGYA 5CX4A 1MT3A 4ENRA 4CVNA 4ZDIA 2QYTA 3GAZA 3D3QA 5JAUA 3KSBC 4G0UA 3KVVA 2X77A 1XYYA 4WFJA 5AI0A 4AJ2A 3RVMA 2XUFA 3SX4A 2EHJA 3QKRB 4C6TB 2QL7A 1Q5PA 1Z5PA 2R8ZA 1RRCA 4QM6A 1HO3A 2HA6A 4TN5A 1Z6XA 3GR6A 1N2BA 1DOHA 4Q4AA 4X7RA 1U7HA 1VMAA 3KT3A 2W98A 2NVWA 4GPIB 4EF4A 1PX2A 1LFDB 2R44A 3BBLA 3G0CA 4DLAA 5HWSA 4J7AA 3RS8A 2LBPA 3N76A 5J3JA 1E3WB 2W4QA 3TH5A 3KV3O 1NT2A 3LHIA 3OA0A 2ZVDA 4X62B 2H2AA 2REXB 3EVAA 2A9KA 1R2QA 1ODJA 2N9UA 4MOWA 421PA 1E0AA 4F21A 1UK6A 4DCNA 5EIEA 5KVAA 4R3NA 4PAQA 4P3NA 1RAIA 5CXQA 2CHEA 4QNNA 2YV1A 4E2YA 2AHRA 4XOIA 1X80B 4BLTA 3ZV7A 1EZ4A 1GRQA 3B8EA 4PLZA 3X2SA 5JD6A 3LTNC 1EVYA 4G41A 5IVPA 4YQYA 3AFMA 4R1SA 2Z2IA 3DFMA 2C5GA 5IJ9B 2C2XA 5DNAA 2FW8A 1JKJB 3MGBA 1KJ8A 3VU9B 3DE4X 2WJYA 4JJ7A 3LH5A 1E2HA 4M1KA 4C7XA 5I8WA 2DRIA 2GVDC 2JFWA 4JBLA 4LRUA 4PGMA 5DOVA 4AZTA 4LJLA 1W93A 2VPWA 1FXSA 5FTNA 2A4MA 1NPTO 2O7SA 4KO1S 4CKXA 4RESA 3QYPA 5A9SB 4HPJB 4UVDA 4MUYA 1NUHA 5BO5A 1U28C 2WM9B 1TF2A 3DKKA 4BXOB 3IKLA 2IPNA 4A5OA 4O5AA 2AN4A 2QIPA 2Y67A 3EIUA 1I3LA 3JRWA 4FFRA 4NU0A 3RJMA 3T1NA 2PRIA 1WXEA 3EG9A 2Q0XA 3JPYA 2WYOA 3KJNA 4TXJA 1DUVG 4UU1A 3ZVLA 1QKIA 1R3UA 3WRWA 3PJEA 4FHZA 5K6TA 2BGJA 3V4PB 2XECA 1JJBA 4YGYA 4NKRA 1DO8A 2JGAA 2RHTA 1Z26A 4KJZA 4OMUA 1G21E 4R31A 5F2OA 3VR0A 4JI6B 4HAYA 4CKEB 2I87A 4Q9AA 4DRXA 3OIGA 2X1LA 3DZHA 4DFDA 4ZJYA 1VG9B 4YP7A 3QLEA 4CLHA 3R3ZA 1A9XB 3DXYA 4NMHA 2IV2X 4Y6QA 4PYMA 2VDOB 2E85A 4PICA 3U40A 1PGJA 2BFPA 2VJNA 4IJ5A 3DDCA 2BWJA 4PLPA 5DK4A 4G4JA 5LMNB 1LX6A 1JU4A 3VDQA 1QV6A 2AS0A 3V4RA 2ZIXA 1JHAA 4URWR 2RH5A 5GONA 1ZU4A 1A82A 1WRBA 2AQ8A 2PEYA 4H18A 2Q0HA 5A0VA 1JIVA 1T25A 1QNLA 4I1PA 1R3DA 1R9MA 2VHYA 2Z4SA 4INJA 3RWBA 1TW3A 1DCFA 2WKWA 3ICEA 1NG1A 3MLBA 1RJDA 4HB0A 5CA1B 3J7TA 2XGMA 1X2BA 4F3YA 1QHFA 4M7PA 4PRZA 4C29A 1WP9A 2QD4A 2Q5QA 2YBDA 4LISA 3T94A 2QVBA 4EPVA 5JADA 2IW1A 4G1FA 1H8HA 4QJ4A 4MS4A 3BUSA 3LE8A 3DCYA 2D1FA 4GT1A 3RS5A 2EATA 3SYNA 3D0KA 2X41A 1SJ9A 3GAMA 4BCDA 4KMOA 2H4HA 2MR5A 1WXGA 1ZL2A 3K8YA 3ESRA 4QG7A 2B20A 1M2KA 3B36A 4MYDA 4XARA 3L49A 3I12A 3MTQA 3JWGA 4CZ2A 2XCIA 3V33A 3R0XA 2XCRB 1GILA 1KI2A 3NO4A 3U4MA 2WR8A 1HYEA 3PC3A 3QHPA 3V42A 2JGKA 3FRHA 3NOOA 2ISCA 5M5BA 2G0TA 5E9QA 2YCLA 4MQFA 5BR8B 1VL2A 1K0UA 2XDAA 4UNPA 5D3ZA 2VA9A 2UVPB 4QHTA 3Q7IA 4O2BF 4MGIR 4FJ0A 2ZAIA 5FYQA 1H9CA 3W5CA 4ZOLF 2WA2A 3DUFB 3A8TA 2G9VA 4MS3B 1DV1A 1R27A 4X60A 5EESA 1N33B 4BCBA 4CV3A 5IABA 2R1VB 2ZBEA 4H15A 5BWLA 5I4KA 2IS6A 5JPIA 1QS0B 4MRMB 1PT8A 2DERA 4NBWA 3UFXB 1D09A 1NW6A 2ZJYA 1ZH4A 5FJIA 5GINE 4FFPA 3URMA 1RXCA 1XQYA 1G6KA 1H8ED 2W2KB 3BAZA 5G02A 4PYNA 1RRGA 1TUGA 3ENKA 2B5VA 3HEBA 4R9UC 3T7CA 1AM4D 5AUOB 1KSJA 1RLTA 2WVHA 2XT6A 4HQNA 4MWGA 5IKOA 1YJQA 2PUBA 2NP7A 3UAXA 4OYLA 3CE9A 2ACEA 4IJKA 3R9WA 1D2RA 3C7CB 4KFUA 5IDVA 1BS2A 1UADA 2X5XA 4YTEA 3M33A 1XCGB 1YDHA 3T3EA 4RHFA 3WK4A 3TSAA 4TLCA 3I9FA 4K9NA 4OAOA 1U3CA 2ZE8A 5AVSA 3HUDA 3MWFA 3RIXA 1A8QA 3AGPA 2CZGA 3AJRA 3I28A 1O8CA 4KSBA 3DL2A 4DBLC 4EITA 5BSEA 1K7XB 5K0ZA 4DJEC 1QP0A 2CZCA 3NV7A 1GKIA 4BP1A 3ZIDA 4EB6A 1O58A 2LE0A 2G6BA 221PA 3JQ9A 1OSNA 3F97A 1VI5A 3HR8A 1Q21A 1W0JA 1N1EA 2WU4A 2YL2A 2I2BA 4K9QA 3A1FA 3IELA 4A0QA 3G7SA 1WPQA 5AKEA 1GY8A 1YHZA 2AD1A 1ZO8A 1H6DA 2XWSA 2G9RA 3G5AA 1OB2A 2OZEA 4I9NA 1UKBA 4YRRA 3HUUA 4K9KA 3GRAA 3T3MB 3B2NA 3L77A 5THXA 3HCAA 3T12A 2MOKA 4DNFA 3WYNA 4F7DA 4WZAB 5CEEA 3G9UA 1EK2A 4IUBS 2QRKA 5A4AA 1Q2UA 2P9FA 3N58A 1GZ4A 3DMNA 2ZRHA 2FWBA 1NT4A 3LUPA 2R65A 4IUCS 1IQRA 4Z0PA 3OHMA 1BDHA 1YAJA 1VLMA 1U3UA 1T3HA 1YZQA 2P2DA 1UOOA 3QG1A 2E4YA 3G85A 4MB2A 4WRRA 2IV3A 2ZR9A 1G3MA 1JT2A 1KDZA 3REQA 2HXYA 4CLOA 5K0SA 2P90A 5KSZA 2EKQA 3O9MA 1L7VC 1P5ZB 3IEUA 4JD5A 5EP1A 4TSFD 5EXTA 1IEWA 1CF9A 2RARA 1PR9A 2VTDA 4BY9E 1IN8A 2M9MA 4HDOB 2GZSA 4EPTA 4GBED 5CNIA 1ZR2A 4QL3A 3RYFA 2BR3A 2GM5A 4XYLA 2O06A 4K6CA 3QFCA 3VVCA 1QZUA 2C54A 3NI2A 3UICA 1HEIA 1GADO 4R54A 1WP4A 2NUPA 1KEVA 5HDBB 5JMTA 4XE5A 1QV7A 4BO7A 1SU4A 2OV6A 2J3LA 3GC6A 3K8QA 1YE3A 2BUBA 4A6XA 2Z9CA 5EHXA 2QE7D 2H7YA 4WJKB 1RPAA 4NYMQ 3R3WA 4DAOA 4CMIA 4RMIA 1GTZA 2ASEA 1QP4A 3LLVA 3ER8A 3KKKA 1I3KA 3WLTA 1NJSA 2AFIB 4CMCA 1E96A 2JGLA 3AJEA 2D7JA 2QAGA 4GMHA 3VO2A 3KLBA 4AKSA 4L7VA 1M2EA 4JLNA 1UXHA 3ITEA 4IWXA 5JY6A 1D6SA 1KO5A 3P9KA 1EI9A 1FJGB 3WB2A 2JBAB 3OEHA 5EYPB 5GJWC 1YK1A 2Y27A 3FUWA 4FX2A 4QBIA 5LYJF 3IRVA 3MWDA 2Q5EA 2PH1A 3M3HA 2C7BA 3EXG2 3KKOA 5GGYA 4LHEA 3KJGA 5CNJA 2XXAB 1KEPA 3ICQB 3UAWA 2Q5CA 2IKSA 5BT8A 3G89A 2D1SA 2PUJA 4ZVQA 2AF3C 4B9EA 3U4GA 4QYTA 2P8SA 4DOMA 4E22A 4S2EA 1WD5A 2F3PA 1V47A 3L6RA 2HYDA 3B13B 1BA2A 3PTAA 3PFIA 1SZJG 4GGMX 3L8GA 3TIFA 3TZCA 2OBBA 3GL9A 4II2A 2XI4A 1QC5B 5EIHA 1S4QA 1Y3CE 3QXCA 2UZ0A 5JXGA 3GLIB 2W48A 5CH3A 1IUOA 1EIZA 1WW8A 2CJWB 3AESB 3EEQA 3P0HA 2OBNA 3PHHA 3VYUB 4UREA 2O1EA 3PHGA 1E9CA 1UEXC 1VJDA 3PFFA 3TFWA 2WIDA 4Z2AA 5LQSA 2JKVA 2V54A 5AI4A 1SUBA 4P0PB 3UXYA 5HQ3B 2FI1A 3NTLA 4J76A 1NAHA 1XJQA 1DCTA 1WBJB 4UQPA 1LQUA 2F3QA 2OXRA 1GTL1 3AETB 1PP4A 1X2EA 1OLSA 2KM1A 3FVRA 4YAWA 4R69A 4IDCA 2G8LA 1OASA 1VCIA 1M6VB 2WLTA 3PKJA 3ONNA 4GI2A 3HDHA 4DNQA 1J7KA 1ZD9A 1DCMA 3CPSA 1ZNWA 1XQ1A 3R3HA 1OLUB 1NUAA 3UCXA 1XX6A 1FW8A 5AQEA 4BFYA 7REQA 4ED9A 3DUWA 3NAQA 1KYYA 1B76A 1GPAA 2PR7A 4QOJA 3KZKA 3C3MA 4M54A 1I2CA 1J07A 3DXFA 3DF9A 3FIUA 3I83A 3V55A 5A2QA 1Z37A 1GT91 1Y3HA 3GFGA 1DBVO 4BJHB 5AW5A 1UH5A 3A4MA 2EQ5A 2AEFA 3LX8A 3UOGA 3ZK8A 4N5NA 4B79A 4LOAA 4BMPB 4DRZA 4UCFA 1TADA 1B8UA 3GIWA 2CLFB 4JI0B 4E08A 1CUEA 3ROKA 2P6MA 4UBOA 4UUMA 2C20A 1O97D 3KAKA 1I14A 1ZI9A 3DTVB 1NVKA 1TMYA 5EWJA 3H5IA 1KAMA 5DVZA 1G4AE 1HEYA 1JXQA 3HBLA 2ATEA 3OM8A 1HQYE 1ESCA 1HDGO 1YWGO 3EVFA 1S2NA 2ASVA 4L1KA 1CJMA 2XXBA 1YU6A 2Z1MA 2ZETA 3QWBA 5ED4A 1X7YA 1JDJA 2YJTD 2BFOA 3ZBPA 4AJIA 2WFAA 5JYCA 4HQLA 1BVHA 2GUGA 1WXDA 1X0XA 4NH4A 3I53A 1KY3A 1X8LA 3IJPA 1ZGAA 1DIRA 3D43A 2PV0A 4TSRA 1ML4A 1P62B 3PFKA 4YR7A 4U2CA 3BB3A 2PKCA 4MLPA 5EKXA 3K1AA 3AIKA 3E22B 4LCEA 4I19A 4DCGA 4PR0A 3BXFA 3LUGA 5A05A 2QJTA 2YZ7A 3OP4A 4G5OA 3EE6A 2P2YA 3GDWA 4G0XA 4L5JA 4HZGA 5CLGA 5KWEA 4BMCA 3I1YA 4I3FA 4WFKA 1DEXA 1XXHE 4LX0A 3LNCA 4K8RB 1O6GA 4LXUA 3U4AA 5HJ5A 3KUXA 2EJVA 1V1RB 4LY9A 5JIBA 2QUZA 2HY7A 3A04A 1D0SA 3C5HA 1FLAA 4AMUA 4FMPA 3KTDA 3HY3A 5JSKA 1Y8ZA 1JPUA 1VE6A 4C0XA 4KSCA 1EX1A 1B3BA 4R2JA 4D56A 2BBOA 1LS1A 1FQWA 3AP3A 4HAZA 1ZCAA 4FDVA 4H3SA 3HHPA 2AC4A 1J2RA 1CJSA 1Q84A 1ZA1A 2G71A 3BILA 4O3MA 2ATVA 3SM9A 1FMLA 4W9MC 4CCYA 1DJQA 4R7GA 1VIYA 4HEQA 5DLYA 5IJ0B 1NBMD 2XNCA 3FFBA 3DWIA 3IAXA 1IRXA 4XGIA 1WXWA 2H1FA 2ZWPA 5REQA 3LDAA 3X2EA 1QIMA 3HP7A 2Z6AA 5KWJA 2PWBA 2PZFA 3TEJA 1T0HB 4RTLA 4IH4A 5G1NA 2G76A 3M4YA 4JS0A 4BGVA 4FI3C 2SICE 4R8LA 3EVTA 1M1NA 2I3AA 3L8CA 4O2BA 1LSUA 4UE2A 5JNRA 4B5KA 1N92A 3MGCA 2XKBA 4IKOA 2FDXA 2HWWA 4ZOLA 4YJFB 1NVBA 5F7OA 3I6QA 1PNTA 2Y3IA 1NSYA 1RFLA 3CUTA 1JQAA 5AKJA 1W5FA 2E82A 3OFJA 3KSMA 2VP2A 5A2GA 1JI3A 3SJZA 3HQ4O 3A1WA 4PQGA 1CRZA 1GPNA 3BD9A 3QIAA 2ID8A 5ES4B 2AQIA 1FJXA 4DQUA 1W1UA 1A69A 3TE7A 3UT5B 5L4SA 3PICA 3W3AA 2AMJA 4I0WB 1ZHOA 4AROA 4XIIA 1TEVA 5COBA 2ZSKA 4DC0A 2VAMA 3LFUA 4LJ6A 4MEBA 3EULA 1RQGA 3K15A 3OTHA 6ABPA 3QE9Y 2FFJA 5A5VA 1HQCA 1W4RA 4TTSA 1UK8A 1D7OA 4R5HA 4MVJE 4A8JC 1U2EA 3F71A 4JLAA 5L7YA 3U3OA 4E7PA 2ZKLA 5DHUA 1YFJA 3WVNA 1SZCA 3CNOA 3B9BA 2OCBA 2AYZA 4EG1A 4JYCA 4IIJF 3OAAD 3IIEA 1O97C 1XVIA 3MCAA 1HYGA 5CJPA 5HSGA 3RAEC 2FZGA 3ENVA 2GZ3A 1RPZA 2ZUUA 4NOLA 4I9HA 3ZIAA 2D5CA 5DOZA 2QVLA 1PQ4A 5FUYA 1E2JA 5FBWB 2OXIA 1I6LA 3F47A 4DQKA 2O5RA 2YZMA 3IEXA 3SK0A 3DKRA 4U39A 2FAXA 4XYGA 3KYCB 4AULA 1DADA 5B58C 6ADHA 3OZ7A 1KGSA 4EMBA 1YACA 3PHBE 1O8BA 4MJLA 1UKCA 1UEIA 3PNBA 1RAGA 4JP5A 3RRXA 3K6KA 1V16B 4HFJA 1YR9A 3WGGA 2O8DB 3IT3A 2H1WA 5KYXB 3NT2A 1ECFA 4X3PA 4RHUA 1ODCA 2Z9BA 3CM0A 4PY2A 5L3ZA 2BBWA 3TPFA 8AT1A 2Q3HA 1KDTA 4P93A 1FTNA 2IV7A 5I7SA 1E6CA 4HNTA 4LDPA 5JFOA 2IP2A 5D3KA 1F5SA 5AM4A 4OQ4A 3GPLA 5TPZD 5I9NA 2WT8A 1PGOA 2C83A 1VLJA 2FDRA 3VU0A 3LF2A 1LPBB 2Y6UA 2IXFA 4N8EA 5EI5A 1G7SA 2WKQA 4QFDA 1LS6A 3L01A 1CDEA 3NUQA 2QL5A 3I39X 1RWVA 5SYNA 3NDBB 2QU7A 2DG2A 4F60A 1IEXA 1NRJB 4YRKA 4Q7JB 1KY5A 4WLNA 5T4EA 5C2JB 4ENPA 3UYLA 4JIGA 5DYGA 4J0EA 4XYBA 1IDOA 3D4OA 4U2DA 5CX1A 4D9IA 5F9FA 3A0RB 4D92A 1PZXA 3ZV6A 2EBUA 1Z28A 3JW8A 1QB8A 2BMWA 2WQ7A 4R3UC 3ZDFA 3ZLJA 3C45A 1I5RA 1DFHA 1NVAA 1XZIA 5PGMA 1QO0D 3U1VA 2OC9A 4HLCA 1QF7A 4U00A 4D98A 3HA2A 2GK7A 3U2QA 3PNQA 4FHCA 4MW7A 4YJ2F 1NQWA 2CEAA 4RACA 2HLPA 3T7EA 1HG0A 4PHFA 4Q1VA 3JQAB 4UOQA 1W52X 4M9RA 4WGGA 1WL8A 2D2FA 4XFKA 3RYCA 3K9BA 1R16A 3GP8A 3BQ9A 1I36A 3KO8A 1SC1A 4RY2A 4AKEA 1Q1EA 2WUEA 4N48A 2V7XA 2B21A 2R6R1 3D8UA 1XTBA 3IAM6 3JAWA 1N1DA 1UZLA 4GRIA 3ZE8A 3LAWA 1VJCA 1W85A 4INZA 2PUEA 3RK0A 3ABRB 3FNQA 1O5TA 1TGVA 5HDQA 4BBAA 1U2SA 2B0JA 2FZVA 3KM0A 3NWOA 5ARBA 1SC3A 3BORA 1D1SA 2AFHA 2G72A 4JT8A 3W2FA 3HSSA 1PT9A 4L02A 1C4KA 4Y6RA 3D3WA 2I9PA 4WCFC 5C34B 1P9RA 3G88A 3UCFA 4FN5A 5FAKA 5KINB 4ZEVA 2WWTA 3AT1A 1ZJ6A 1M0EA 5L9AA 1I6KA 1L7OA 4BFSA 2ECPA 3CBQA 1Z63A 3VNVA 1P2DA 3TRIA 2J08A 3FPFA 1Y37A 3GA7A 4BO8A 3HU3A 3NASA 2MSLA 1KMIY 5EQDA 3FDXA 1UFKA 1Z3IX 3ECCA 1PWEA 2FR1A 1M1UA 4FGLA 5K4HA 2FWRA 4GYYA 2I22A 4HEA1 4JJKA 5ECGC 1EHIA 1KEZA 4IIBA 4B6EA 4ZYZA 1EGAA 2I29A 4C01A 2X3FA 4BYMA 3DP7A 5JSQA 2W4MA 2MINA 2C2MA 4JK3A 5EPUA 2ZSDA 5A62A 1SUIA 1XELA 2ECQA 1KI6B 1JZSA 3ENWA 4NQRA 3TLCA 3FUUA 1R6UA 3UB2A 1PNOA 3NTVA 1V5FA 1NW9B 5HMLA 4B4WA 4BUCA 5E2AA 4L9AA 2PVCA 4K40A 1MAWA 1CIVA 5C4MA 2FR8C 3MTJA 3ZDDA 2JRCA 1E2LA 3Q2OA 1CNMA 2ARKA 5JECA 3AIOA 3GT3A 4YMWA 5T64A 3O3OB 3IV7A 2DC1A 4RH0A 4ETNA 1NSFA 3CR3C 2JFZA 4B2YA 4MWSA 3TW4A 4G9BA 5GIOE 4H6XA 1NJ5A 4WE3A 3FR8A 4KYTA 1KRWA 4DA4A 3ZEIA 4WLFA 4RPKA 4DZTA 3WQBA 1L5SA 4TTJA 3ZNNA 2QLNA 3DM5A 4KB5A 3M49A 3I9V6 1PJTA 1XAIA 2EAUA 1MZVA 2ZBQA 5E9JA 1YCGA 3ZY5A 1VM6A 5CDGA 5HX7A 2JGFA 3U3MA 5LOVB 4ARCA 4MAMA 3FMIA 1PT5A 3TB6A 3ZDAA 3EGXA 2J7KA 4HZIA 3DAYA 1A1VA 4E3WA 3TJZA 3FPJA 4LQCA 3QVKA 4CI0B 4EATA 2AXNA 1QQTA 4TQGA 4AO7A 2EP8A 3GFQA 3NH9A 4F96A 4Z4FA 1G20B 4RM3A 3VUEA 1ITZA 2ZB2A 4N8SA 1M5TA 3V00A 2FWJA 4CV2A 5LKAA 4URZR 5JU6A