3ZS9A

S. cerevisiae get3-adp-alf4- complex with a cytosolic get2 fragment
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
348
structure length
293
Chain Sequence
VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPASE GET3
publication title The Mechanism of Membrane-Associated Steps in Tail-Anchored Protein Insertion.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transport protein
total genus 108
structure length 293
sequence length 348
chains with identical sequence B
ec nomenclature ec 3.6.3.16: Arsenite-transporting ATPase.
pdb deposition date 2011-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3zs9A00
3RSOA 3H2YA 5JBQA 1IXZA 2GXAA 1FZQA 1OKKD 3MCAA 2W83A 5E3HA 1QHHA 4BFSA 4FMCF 4LY6A 3N5CA 2W0SA 2IXFA 3GJ5A 4PC2A 1GKYA 1DTSA 4OI0A 1G21E 3THYB 1Z0DA 1G7CA 3GLHB 4Z8XA 3GLHE 2GBLA 3X1ZA 1D9XA 1NG1A 1NVXQ 1ZRHA 1EFCA 4R9UC 1AJEA 3AGQA 5KHOC 2B92A 2R2AA 2RGCA 3KX2A 1R5NA 5AJYA 4F38A 4DLYA 2QAJA 3U2QA 2XB2A 1S1MA 1G7SA 5CIWA 5KNBA 4JSTA 5DE3A 1Z29A 1NLFA 2QT1A 5FPKA 4LI0A 4NPHA 2JA1A 2IXEA 2QT0A 2E87A 4GDFA 2XX3A 4P31A 1UADA 1W2HA 4G3XA 2RAPA 2QTFA 1BMFA 2Q21A 1EXMA 2GA8A 4M9XA 4Q48A 4QBGB 3KQLA 5GVRA 3T61A 5SZHB 4IVQA 3UMRA 1OSNA 2F7SA 2ZUDA 3AVUA 2KBFA 1YR8A 1KI3A 2BWJA 3FMIA 1T3HA 1RRFA 4LHWA 2ZU6A 4A0RA 4WOPA 3AVPA 3EIQA 4AG6A 4C0LA 1CEEA 4PO1A 4I99A 1T3SA 5JJLA 2FEOA 1KI9A 1Q0UA 2JLYA 4TT3D 4TZ0A 1XNJA 4PQYA 2ZR7A 1J90A 4L15A 2WAYA 2OCBA 2QSZA 5B57C 5HKKA 2D2EA 4Q9JA 1Z22A 4BLRA 1W49A 2IYXA 4A8JC 3VTKA 2RGNC 1XD9A 3CPJB 1Z0AA 5AJZA 1JI0A 1G41A 2GILA 1P61B 3L0PA 1VIAA 3U7EB 4DJTA 4LJ4A 3AF1A 1DAHA 2G6BA 4C2TA 4R2HA 3BERA 3PUVA 2QRZA 3UKDA 4V0ME 2DHRA 1NBMD 5FL7A 4C0KA 3RHFA 4BLOA 2EFGA 4TWZA 2YINC 3W8RA 3I32A 2ORIA 2V1XA 2BMDA 1US8A 4D0LB 1HUQA 2NO1A 2O8BA 4PHTA 2AK2A 5CJPA 5EQTA 2IEZA 1MR3F 3WYGA 4M1SA 2CCGA 1U2RA 5L8VA 2GWHA 2H1LA 4HZIA 1CULC 4JKIA 821PA 1IN5A 4A36A 4IHQA 1GWNA 1JR3A 4LHXA 3IKJA 2IYLD 2MSEB 4WXRA 5H68A 3AVWA 1T0HB 4DCUA 2WHXA 2YWHA 2IX3A 4QM6A 4F4JA 1HH4A 1ZW6A 4Q4AB 2ZI6A 4GSYA 3E5HA 3RVBA 1OXTA 3IBYA 2D7DA 2BMEA 5BN4A 2JATA 2NZ8A 4Z1MA 2R9VA 4N1AA 1VYVA 2SHKA 3K0AB 3U44A 2AXNA 5IRCD 2LCFA 4DDVA 3CF2A 3GJXC 1Z08A 3W3AA 4M1YA 3D6TB 1IXSB 1UM8A 1H8HA 5C46F 1N6KA 2GZHA 2BM1A 1D5CA 3Q5DA 5JI2E 1TF5A 2N1BA 3NC0C 3C5HA 3QF4A 4NCNA 1GNRA 2C95A 4X8HA 2I1QA 3B6EA 4TL7A 3AVOA 1KI8A 3OIYA 1KI2A 4G5GA 2ZTSA 1XTJA 4BLSA 2YWEA 4LYFA 3JZMA 3VAAA 3CF0A 1G1MA 4JLAA 4JT4A 4TQ9A 2IYTA 4KHZA 4C3ZA 1M2OB 3MAAC 2ZI7A 4LOAA 4AKEA 4I1UA 1LW7A 1S4QA 1E0AA 4CYMA 2HYDA 2OFOA 2QENA 2W6IA 2WPDD 4TMWA 2A9KA 3A37A 1E2PA 4JLKA 5DYGA 3IEUA 4LGMA 1FQJA 3RC3A 1GG2A 1PLJA 4XSHA 1VCIA 4V0OA 1G5TA 4B3GA 1D2EA 3FPAA 5HE9A 2D74A 2FX3A 1P6XA 3CB4A 4FINA 4YMSA 4FN5A 4C4PA 3PEYA 3W6PA 4MYTA 3U61B 4V0MA 2HJVA 1N6OA 2IHYA 4LC0A 3ZD7A 4Q9KA 2C5LA 1KY2A 4Q01A 4AYTA 2VHJA 1CRPA 4DIEA 4RKFA 2FH5B 2O0HA 5JEDA 3AF4A 2J0QA 2AD5A 4C9BA 3GFOA 3KUDA 4N0EA 5FFMA 4QJ3A 4Q5IA 1W1WA 4MDFA 1A5TA 4D4LA 4LBYA 1HT2E 4NL4H 5FPHA 1QDEA 5B30A 4KAXA 3A4NA 2CNWA 3FTQA 4Q1BA 3HYTA 4HLUA 1N5IA 2C78A 2C2HA 2WJGA 3CX8A 1EFHA 3VHLB 4L9SA 3LA6A 4GBMA 1NN3A 2B7CA 2AR7A 3P20A 2QORA 4KFSA 2CE2X 1KI4A 1WP9A 2MMCA 4LZZA 5EJEA 2JGNA 2GJSA 4ZKDA 3K0AA 3FYHA 2OUKA 2WVJA 1I4DD 1KI1A 2CHGA 4GP7A 2IYSA 1XEFA 1VYUA 4H1VA 1E2KA 3U7HB 2CJWB 4ZV4A 2G1KA 1Z6GA 2ZANA 4NCJA 4A92A 2PCJA 3CM0A 4ESVA 1G4UR 4PHGA 1U90A 1MO6A 2WZQA 1R8QA 5FTMA 2CL6X 2XZOA 5DI3B 2J7KA 2KE5A 4TSFD 4LSGA 3SYLA 2QL6A 1XJCA 1TU3A 2UKDA 4GT1A 4WZ6A 2F55A 3ZVLA 1NSFA 2F43B 2IF2A 2QU8A 2A5GA 3EWSA 3OFNA 1F60A 4DDWA 5EZ5A 5HTKA 1E2JA 1PLKA 2R6CA 3RWMB 1KMHA 4Z51A 3QY0A 4MGIR 5FBLB 2I1VB 2OBNA 2QEQA 4TLDA 3H86A 3AVVA 2PL3A 5K8TA 1XCGB 5CM9C 1C4OA 1VG8A 2IUUA 1GZSA 1XMSA 4A0HA 2QM7A 5FTLA 4OKSA 2IEYA 1KK1A 1X3SA 4P4UA 5EE0A 1LS6A 2JJ2D 1SXJD 1LY1A 2OT3B 3CPEA 4A2WA 4PPNA 5HZHA 1E99A 1JJVA 2CCJA 2HLDA 2PCLA 2XTZA 5L3QB 1RRGA 1L8QA 2F3TA 5B58C 4RZ3A 3PG5A 4KYUA 2JCSA 1M34E 2YVUA 4DCNA 2ZRLA 1XEWX 1KZGB 3LVQE 3W90A 2J0SA 4PHFA 4Q18A 3ZD6A 4LV5B 5JZVA 3QNUA 2RGBA 2ZUBA 4XSGA 1FUUA 4YDSA 2X8AA 3WNDA 2J9RA 3B5JA 5TV2A 3TE6A 4YMVA 4OI2A 4KV9A 1S3SA 3CZQA 1UJ2A 4PZYA 3I3SR 3BFVA 5KO2A 1NN5A 1R0ZA 1E1RA 1SKQA 2Z4RA 3LXRA 2BBSA 1GFIA 2CMKA 1E2NA 1GM5A 4BFXA 4B43A 5HKKD 1V43A 3IHWA 4RKEA 2JLSA 1GDDA 4DSUA 4PSKA 1NRJB 4RFVA 3K9NA 4JVNA 3X2SA 4A1FA 1CU1A 2X19A 4QL3A 5JSZB 4IFBA 1GOTA 2A7QA 2WWFA 2QAGC 4DEXA 3L43A 2PT7A 5FL7D 3WBJA 1WA5A 1CBUA 1E9SA 3IO5A 1CP2A 1G3QA 1W0KA 2HXYA 1YRBA 1ZM2A 2FE4A 2IS6A 1NVWQ 1HA3A 2XNDD 1EWRA 3EA0A 1A2KC 2IBMA 3THWB 1VMAA 1PVOA 2QQEA 2CJWA 1X1SA 5F2EA 4BFWA 4AI6A 2VF8A 3W5IA 1SHZA 1D9ZA 3TQFA 5DI3A 1JR3D 3TVDA 1Q3TA 2ZU0C 4JYCA 3QPVA 2VP4A 5TXGA 2F43A 4CEJB 1Z6YA 3CH5A 3MSXA 3QI2A 4U02A 4PPQA 3UMSA 4JT2A 5KDLA 5FR2A 3SBEA 1NI3A 1NG9A 3I73A 1FX0A 1L2TA 5EP4A 421PA 3KUCA 4NYJQ 1U9IC 1CR2A 2FPLA 4HAYA 1KAOA 2HV8A 4Z1MD 2XZLA 4AKGA 3QE0A 1L7VC 4UXJA 1DBSA 1OFIA 1QHIA 2KBEA 2AD1A 3U6BA 4NE2A 3OEHD 2Z43A 5L3QA 4Q4LA 1AGRA 4O3MA 2ZIAA 5HZKA 1X6VA 1I2DA 4HB4A 1XZPA 2ZS7A 5AJXA 3ZH9B 1Z0JA 4WZBE 4LJ6A 1F6BA 3AP1A 1RE0A 1AKEA 1M7HA 2BOVA 1E4YA 3CRQA 2IS1A 1Z6XA 4IJMA 2QQ0A 3TAUA 1W5TA 2HT1A 1TPZA 2AN9A 2PEYA 3PJRA 5LB2A 2IYZA 2LWIA 1SVKA 3K1JA 4OK5A 1T3LA 2IS4A 1OW3B 5JWRA 3TIFA 4IOJA 4MKFA 4QBIA 3SJAA 4ERNA 1OB5A 2H16A 1FP7A 1T6NA 3HP1A 1W36D 1G6HA 2VO1A 3CRRA 3ZS9A 3QXJA 1UPTA 2VHCA 2WWWA 2PBRA 4V03A 2X77A 4C0QC 2KSQA 2OEPA 4RVCA 1FFHA 1ZM4A 3BAFA 1XTQA 5FL3A 1VYTA 2DCUA 5E95A 2FGJA 4M22A 3Q7QA 4D4MA 1N0UA 1Q1BA 4HDQB 1KJWA 1I2MA 4LDJA 1R5BA 5AUOB 5FBWB 1O3YA 2GF9A 4M1MA 5J47A 3PFIA 2YWGA 1MO4A 2BEKA 1E3MA 1IBRA 121PA 2WWXA 4RD6A 2QBYB 2OCAA 1OYWA 2WOJA 4ARZB 3T15A 4ABYA 5G40A 2DB3A 2GEDA 1X8KA 3M4YA 1PUJA 1X8LA 1XCMA 2B8WA 2JLUA 1KOFA 3ADDA 4IOKA 1GILA 2O8DB 4H9GA 4DSNA 1N0WA 4FWTA 4ZDIA 4ZIRA 4CEJA 3AB3A 1YJ5A 3EPLA 1JR6A 3AVXA 3BK7A 3P1JA 1NVVR 3E70C 2ZR9A 1AQUA 5EE9A 5G41A 4EQ6B 2IHBA 2ZRDA 3EZ7A 2ZM5A 1ODFA 1T8TA 5FUVA 4D82A 4QJ5A 2FSFA 3PEWA 1II8B 2ODNA 2R62A 4EJSB 5BN3A 2N42A 3EC2A 2ZI3A 3ZLJA 2BBWA 1U99A 3PXGA 2ATVA 3CX6A 3KQNA 2WJVA 1XPOA 3ONWA 3SBDA 3V9PA 1Q57A 4MYUA 3ADBA 4QGHA 1NY6A 3CWQA 1NBMA 3QIAA 1P5ZB 1G8PA 1ZYUA 5JJKA 1E94E 2VRWA 2OCPA 4NCIA 4JS0A 2NPIA 2PX3A 4NYIR 4U7DA 1KY3A 3GLFE 2J87A 3KB2A 2VSXA 4CGZA 3OFND 5FBVB 4C7OA 3MD0A 5H1YA 2FDCA 1ZU4A 3CR7A 2GZAA 4P4SB 4NYMQ 5EXPA 2ECKA 3OF5A 2XTNA 1IN8A 5SZIA 3W6NA 1S3GA 2P6UA 4P32A 4QM7A 2V1UA 5FOSA 1MKYA 2JIZA 2W0MA 4DCTA 2FZLA 2XSZA 5J4LA 3B1ZA 2RGDA 1YZNA 4LUCA 1YR6A 2NTYC 2RGGA 3H0KA 5FOWA 2OM2A 2GBLC 5JS7A 4J0QA 5J4VA 1M6NA 2W2XA 4KLZA 4Q1EA 1ESMA 2H92A 2ZRAA 3WMEA 4DCSA 3TGPA 1RIFA 2UZ3A 4IEIA 3IQWA 4V02A 4DDTA 1HYQA 3IBGA 1YKSA 4F91B 3X1XA 5EZ6B 4G0NA 3RSLA 1F5NA 2NZJA 4I1VA 1NIJA 1UDXA 1IXRC 4BFZA 1E2MA 3BIFA 5ANRB 1K6MA 3M0EA 2IK8A 3SI7A 3R9WA 1T4GA 1BS1A 1SVWA 1E2DA 3IO3A 5L3SB 2ZE7A 1E1RD 2EFHB 1J7KA 2XOKA 4OQFA 2ZE8A 5EP3A 5SZKB 2FSHA 1S0UA 5TVKA 1KNXA 1L4UA 2WJJA 5LBIA 5KPJA 1PUIA 2V4ZA 4TYNA 4D4JA 1BYUA 3UMFA 1YE8A 3LW7A 4RCYA 3NKVA 2QSYA 4B47A 4E07A 1E69A 3VKGA 2RHMA 1VG1A 4RZXA 4R98A 2RGAA 3BH0A 2WPDA 4JLJA 4PO8A 4PO9A 4JJKA 4QGFA 4URZR 3K70C 5IDVA 3EX7C 3D8BA 3IILA 4US1R 3B82A 1FNNA 2GESA 3CZPA 2BM0A 1SXJB 3GFPA 1W0KD 4GPTA 4OK3A 4QNRA 4UQOA 4JVMA 3THXB 2ZYTX 4A6XA 4B74A 4L4UA 5JRZA 4JLBA 1YZKA 2QUZA 1SVSA 2ORWA 4AWXA 3SJZA 4WW0A 1QG4A 5LDDC 3ZZTA 3LWNA 4GNKA 1U8ZA 3A1VA 1SVIA 1MV5A 2ZAMA 2ATXA 3WYFA 4DLSA 3W34A 2A2ZA 1KIMA 3TUIC 4KITB 1ONBA 3KKNA 4P4SA 4QHTA 1TUIA 3Q9LA 1G20E 3AM1A 1BOFA 1DAMA 4H1UA 2GJKA 1Q20A 1U8AA 2EVWX 3FHCB 4MYHA 3PEVA 1P73A 2FV8A 3VX4A 4LWZA 5F98A 4JL6A 1IN7A 2WBLC 2O5VA 2TMKA 2FFQA 4S35A 2YNMA 5JEEA 2W2VA 1IM2A 5HCIA 3ICEA 1Q3HA 5HE8A 1Z2AA 4Q9HA 2ZYWX 2IF0A 3F3YA 3QXSA 2VHUA 2RH5A 4WVFA 3VR1A 4BRUA 1S8FA 3IIMA 1P75A 1Z0IA 2BV3A 2CDNA 2DYKA 4RD1A 1WDTA 5J5CA 3ZVNA 2OZEA 1E0SA 2QPOA 1N6LA 2IYRA 3JZAA 3L8YA 4MUAA 2F1HA 1Z47A 1IONA 1II9A 4Y0VA 2O8BB 1OH6A 4LBVA 2G83A 2C9CA 2FJUA 3OE7D 4QHYA 1XD2B 2P67A 5L3SA 3LQQA 1FTSA 3QUSA 2J46A 3VKWA 4FD2A 1M8PA 5FOVA 3UK6A 1E2FA 1JR3E 4DXAA 1GNPA 4TSFA 3C16C 1YZGA 1G9XA 2LKCA 4OQXA 4EFNA 8OHMA 4EPYA 5KYKA 2MMGA 1CR0A 3NVAA 3MJHA 5J4HA 4F4CA 2V7QD 1JALA 4W5WA 1A7JA 2REBA 4OI1A 3CF6R 5E7JA 2NG1A 2IUTA 1QVAA 4QGGA 3ETLA 2P5TB 1N6HA 4OJKA 5FPSA 4URWR 1ELOA 3QEOA 4F92B 1ZAKA 1N25A 2JJ2A 1SXJA 1G8HA 2D62A 2X2FA 3U44B 2YYZA 2ZR0A 3THXA 4V0LA 3AKYA 2IT1A 2Z4SA 2JEOA 3OIWA 3SU8A 1N6RA 2H17A 2EFDB 1QF9A 2YZ2A 2FFBA 2WICA 3VNUA 2QN6A 1G6OA 3MWJA 3QF4B 4LK2A 4O2RA 1GNQA 5FUWA 4ITRC 2AKYA 4Q47A 3VMFA 1VHTA 2W2TA 1E2LA 1TF7A 2QPTA 2CCKA 3KL4A 1E9FA 3QKTA 3FVQA 1E9RA 3REGA 4BZPA 1TEXA 4ESHA 2ZJZA 3LBHA 4JBWA 3U3RA 2G0NA 4A6PA 2UZIR 1NMYA 3GJ4A 1LTQA 4MUBA 1U0JA 2ZJ8A 1W36B 3GLGB 4JJZA 5E7IA 4LJ9A 4B71A 5FPTA 4U5XA 3SQXA 1OXVA 2BC9A 4MA4A 4XH9B 3X1WA 4HUTA 1KSHA 4QC2A 4FCTA 4U00A 1E4VA 4B33A 2JJ8A 1ZM9A 1E2QA 2F6RA 4A15A 3KTAB 4M9ZA 4M1KA 1KI6B 4QNMA 1XJ0A 2VP9A 2P6NA 4JIMA 3U3OA 4IDNA 3T1OA 1ZUHA 4B34A 2VSFA 3ZVMA 4Q21A 1E79A 1GUAA 2BBOA 2CLCX 1Q12A 1Z83A 1I4TD 1MRNA 2EYUA 3A36A 4ZDWA 2X2EA 1GL6A 5GADl 4B44A 2DFLA 3KKOA 5FOTA 4PC1A 1XXHB 2XNDA 3NWJA 4FIDA 3KB1A 1EWQA 1FPMA 1XP8A 3W6OA 4Q66C 5HPYB 3T5GA 2DWOA 2PLFA 4JKYA 5EE5B 3BXZA 2VYFA 1JJ7A 4IVPA 1XD2A 1EFUA 4IXNA 1AN0A 4B3FX 1OLOA 4M53A 1LF5A 2ZSFA 2J0UB 2W6JA 3WHLA 2JIZD 1ZVQA 1MO3A 2XSZD 4XTCS 6Q21A 1E9AA 3TKLA 1G8FA 2HUPA 1W7AA 3ZIAA 4TYPA 2J7PA 3DMNA 3DZDA 3KKQA 3N2IA 4DB4A 4MGKR 3LFUA 3CONA 3D31A 1XD8A 2C04A 3FKSA 1KJYA 1YZTA 2FFAA 4OJQA 2EU8A 3LX5A 2A30A 4B3BA 2BJVA 2GK7A 3CRMA 4TL8A 3ZS8A 1XU4A 3HDTA 3OEHA 1W0JD 3TNFA 4NKRA 2R6GA 5JECA 1ETUA 4G5RA 3RLFA 1MABA 1UEIA 4B6EA 3QXXA 3EW9A 4US0R 3SS8A 1EESA 1F2UA 2ZUCA 1ZD8A 2WKQA 2XOKD 5CLLA 3TBKA 1HT1E 2EW1A 2LKDA 2FA9A 2GNOA 3DVLA 3BBPA 4L16A 4TTRA 1AS2A 1DO2A 3I62A 2Q3FA 1L4YA 4PZLA 5KUTA 2NIPA 4N0DA 2YOHA 3WP1B 1OIVA 4NTZA 1KSFX 1XTIA 2GDJA 1OXUA 3OIUA 5DISB 2ZI4A 1KMHB 1KO7A 3A8TA 3VR2A 2Q0HA 4ZDKA 3HU3A 1KKMA 3GLGA 2ZSEA 3UATA 3LAWA 3PR1A 3KJGA 1XTKA 4PX9A 4ZI2A 5BXQC 4Q7MB 5EXXA 1ZINA 2PMDA 1U0HC 3NHBA 5DNYB 1FP6A 3IUYA 4FW9A 2CVHA 1M7GA 3TRFA 4OQLA 1OIXA 2GXQA 1LS1A 2ERYA 2Q9AA 3DPUA 2BDTA 3KTAA 3UXMA 1RW4A 1KI6A 1AK2A 4DZZA 4JVSB 4BRWA 2AL7A 1EFRD 3LY5A 1F3OA 4II7A 5JLJA 2DFNA 4AY2A 4B6FA 3SHFA 4QHSA 1DAEA 1XXHA 4HLDA 2JAQA 4I81A 621PA 1Z0FA 1MO5A 1JPJA 3GEEA 5EP1A 4HAVA 5D3MB 1OB2A 3NIBA 4BZXA 2OHFA 2PZFA 3SZRA 3WNBA 2CEAA 2ZETA 3OIVA 3R9IA 2FNAA 2J0UA 4TQAA 4B3DA 3A1SA 1ESNA 1E9BA 1ZMXA 1OPXA 2HCBA 2FU5C 3AEZA 1HE1C 3SDZA 4L5BA 1UFQA 3KKPA 1RKBA 3T1QA 4Q7JB 1JXOA 4A82A 1VDZA 1LF0A 1KK2A 3TW4A 4NHOA 3KQKA 3NG1A 4MDEA 5DI9A 2AFHE 3I8SA 4ZI3A 3EPJA 3CRW1 1J2JA 2WOOA 4C0SA 2IYWA 3WMGA 4EIWA 2HDNB 1R10A 4D6PA 5BYKA 4OHVA 4F4IA 4KVAA 4PTLA 4DC9A 5FOUA 3P4YA 2X1VA 1SZPA 2GZDA 2ZS8A 3EZ6A 1R0YA 4EFLA 1YRAA 5G3YA 2WMNB 2FPKA 3J81k 4GZMA 2CLDX 3QKSA 2VQSA 4M8NE 2OO7A 4EDHA 1NLYA 3FE2A 4DUGD 1IY1A 1S9HA 1ZM7A 1X1RA 3B7GA 2AX4A 3NH9A 4JLDA 3BB3A 4JVLA 2QGNA 4AURA 3WXMA 2GAOA 1WF3A 3A1TA 2REOA 4RD2A 1WRBA 1FX0B 1CLUA 1P2VA 1KI7A 1ZIOA 1IOZA 1G3MA 1AZTA 2BCJQ 5H70A 1SULA 3F8TA 3EG5A 3Q85A 4XWKA 4YDHB 2XXAB 4NP6A 2ZJ2A 3I72A 5G3ZA 4DLRA 1QZXA 4M21A 4HZUA 3W3ZB 1WE2A 3D3QA 4M1OA 3AVTA 4M9SA 2QGZA 2FOLA 5KDDA 2A5JA 1J70A 4G1UC 3CW2A 5TARA 2GRJA 2ZJBA 3ADKA 4PZZA 2I4IA 2Z5FA 4BASA 1YZLA 3ZGXA 1JB1A 5CJ2A 2OBLA 4G5SA 2GHIA 2VBCA 3R9XA 4DSOA 1QHGA 1KMQA 3W5JA 4LHZA 5D3MA 4TL6A 2PLRA 3X1YA 1XTSA 1Z6TA 3KXIA 4B35A 4TZ6A 1E1QD 1QHYA 1ZNWA 2QM8A 3T34A 2WIBA 5K8IA 2J1LA 2JDIA 4FCVA 2J41A 1NN1A 1E9EA 2AK3A 3RS7A 2ZVPX 2F9LA 4IDPA 1RJ9A 5EE3A 3B60A 4XOIA 4EPXA 5BWMA 3L8ZA 2XZPA 3KXLA 1A4RA 4UNSA 3CNLA 3AP3A 4Q4JB 5TB5A 2C8VA 3DM5A 4YONB 3EPHA 2IWRA 1E2IA 1HURA 4M1TA 1KO8A 3SC3A 1E79D 1XEXB 4YMWA 1O87A 1YQTA 2R8RA 4YQFA 1NVUQ 2GEUA 5UKDA 3O47A 1XF9A 2P65A 2YOGA 3LW8A 3ZZUA 2DPXA 5EUQB 1XWIA 3IHLA 2IYYA 4LYHA 3FDIA 2GETA 1P9NA 3UWKA 5K8LA 4NBSA 3N70A 3KDSE 1P2UA 3PITA 1W48A 2ZJOA 2RKOA 4A2PA 1R8SA 2ZRBA 3JVVA 4PR0A 3HPRA 5DIFA 1R0XA 3A4LA 3RRZA 1U0LA 2W6JD 2HF9A 4G5QA 4ZIRB 2JLXA 1IJFA 1OYYA 4UNNA 4AC9A 2WWIA 2QMEA 1XCPA 4WAUA 3PUXA 3BB1A 2Q3MA 4TLBA 4OL0A 3WMFA 3ZIAD 4XWOA 1TF2A 2J7PD 1W46A 1Z0KA 2GTPA 1TAGA 1TQ2A 2GVDC 2ZYVX 4KBGA 2AWNA 2PJRA 2F9MA 1N3BA 2ZXUA 2YJTD 2QMOA 1ZM3A 1ZC3A 3FKSD 4O0MA 3BC1A 4DCVA 721PA 5F3WB 3NBYC 3U60B 1JQJC 3NH6A 4URXR 2XXAA 1E0JA 3P32A 2KB0A 3EARA 3ZZ0A 3VNVA 1ZC4A 1YVDA 3C4JA 1H8ED 3GLIA 1Z6AA 5C4GB 1P72A 1XTRA 2ONJA 1JBKA 4PC7A 3T12A 4ZCIA 5CITA 2WKRA 4FCWA 4IDOA 5ELXA 3DDCA 1NBME 1IN6A 2YKGA 4UXIA 1ZNXA 3PQCA 1UBCA 3IPYA 2ZRGA 2QP4A 3CH4B 4W5HA 2PMKA 4C7OB 3BFKA 1J99A 3K09C 1MT0A 3OE7A 4AD8A 1B23P 2GXSA 4JLVA 2PX0A 2FSIA 4AIIA 5C18A 4MGYR 4EPWA 4JL5A 2W58A 3K0CC 5FPYA 5IHPA 4HUQB 4NYJR 1MOZA 4TMXA 2D4HA 2J59A 2VP0A 2V9PA 4C0JA 3NXSA 4PXAA 4JZKA 2WM9B 2BEJA 4M4SA 2ZJAA 3T06B 2V7QA 1UBEA 1G16A 1ZUNB 5G53C 3ZQ6A 2WAXA 4URVR 1JAIA 1LB1B 2YHSA 4Q4JA 4Q1FA 1HE8B 1TX4B 4K8OA 4EJSC 1KYIA 4L8GA 1AA9A 5A5GA 4Q4HB 1XEXA 1DOAA 4B3XA 2YOFA 1M74A 1TQ4A 4MRNA 3EPKA 4I1SA 1N5LA 2QTHA 1GKUB 3AQ4A 1T8UA 3PCRB 1B0UA 2VP6A 5KSPA 3SNHA 521PA 2XNSA 2GAAA 4RFSA 5JWHA 3A1WA 3FWYA 3TW8B 3RWOA 1NVVQ 4B32A 1VCNA 1EG7A 5CB6A 1W47A 3K9LA 3MJRA 3CR8A 1GRQA 2G0TA 3E2IA 2ZRFA 1JXMA 3EZFA 2AWOA 5M04A 5AK0A 2IYUA 2RHDA 1IJEA 4WIAA 3RYTC 2JASA 1FTNA 4M2LA 3VFDA 1AQYA 5LD2B 2IW3A 4E03A 1P62B 3B1VA 3FHOA 1UDWA 3ND8A 4C0HA 1R5OA 2WSMA 2CL0X 1KNQA 3H1TA 4IDQA 4NH0A 4TYYA 1DAIA 4QRHA 1W4RA 4ZDJA 5JMTA 2R6AA 1JAHA 1QG2A 3CPHA 2IL1A 1GL9B 1G5RA 4LX0A 1Z3IX 3WRXC 4TTQA 2P6RA 1GTVA 4TYWA 4MRRA 4NYIQ 1FNMA 4NDZA 1A82A 2VTKA 3GD7A 3ZDQA 2L0XA 4ON9A 1G8GA 4TQUS 4WA7A 1AGPA 2ODEA 3CO5A 5DGXA 3LBNA 5FI0B 1Z5ZA 2PJZA 1Z07A 1CTQA 1H65A 5BYJA 2OESA 4HEJA 3GJ7A 2ZSDA 1XDBA 3P27A 2IS2A 3KFXA 4OBEA 1KSGA 1J8MF 3FFAA 3D7MA 1J8YF 4MITA 3VU9A 4OI4A 2QAGA 3QVUA 2QMHA 4BQSA 1DAFA 4JLPA 4LJ7A 4ZCLA 3MWKA 2FMXA 2ZRNA 1GKIA 5CLQA 5EXTA 1XRJA 3SOPA 1OJLA 1KHTA 3T5DA 1RVDA 4HUQA 3GEHA 3TSWA 2ZROA 4D0GA 2QG6A 1R2QA 1QRAA 2C9OA 5DHFA 4X8MA 3AGPA 4DB2A 1YHNA 3DOFA 3CKLA 5FOXA 3NBZC 3KKMA 5EP2A 3QXHA 1OHHD 3RDPA 1KO5A 1VCOA 1C1YA 2BIFA 2G77B 2ZE5A 4Q1AA 5FH9A 2CVFA 4FMBB 2E9SA 5KNDA 3O8CA 1SXJC 2CXXA 2IA5A 4Q4HA 3DL0A 1NY5A 2REXB 4P3YA 3U6KA 2ZPTX 4MH0R 2ORVA 4HAZA 3OZXA 4BEJA 4DBLC 5BQ5A 2H7VA 2FPMA 1W0JA 1U9IA 3O8DA 1XEWY 3DO6A 1I4LD 2XGJA 3CBQA 3BS4A 1DAGA 4LBWA 3MLEA 4FMCB 4FWIB 2IYVA 4JSYA 3B9QA 2ZI9A 2O8FB 2HCJB 4LYJA 2R44A 1VECA 1OFTA 2JLQA 3SN6A 2N46A 2CK3D 2QP9X 4D0NA 1G18A 5IK2D 1AS3A 1FQKA 5DO9A 2JDID 3AH8A 1DVRA 4IW3B 2YV5A 1S1CA 4MKGA 3K0FB 1PJRA 3SEAA 3CRVA 1LV7A 2IXGA 1CR1A 1BH2A 1P9WA 4HI0E 5EUMA 3NTUA 1LNZA 2EWVA 4KSCA 1DELA 4MKHA 4DT1A 2XJ9A 1Z8FA 2VHTA 1ZUIA 1F2TA 1TQDA 1SXJE 2Z0MA 3S1AA 2KWIA 4DHEA 5EXSA 2ZRPA 1W2GA 4ZO4A 1RZ3A 2XITA 1EFRA 1QVRA 1Z06A 2RB4A 3Q3JB 3KJIA 3QQ5A 1UKYA 4GI7A 1OH8A 3KZ1E 2V55B 3BOSA 1XFAA 3SFZA 4LJAA 1ZJ6A 3NDPA 1NSTA 4OHYA 4OHZA 4NONA 3NHAA 4QJ4A 2ERXA 4BEBA 2HXSA 5JFGA 2VLIA 2GEVA 4IXMA 4W9MC 1TUEA 2FFHA 2QNRA 1R0WA 3P4XA 4JLOA 4QG7A 1NMXA 1CRQA 2ZSBA 4E09A 3AVYA 3ZVRA 5CYOA 4V0KA 3IDQA 1XMVA 1UKVY 3THOA 4QBFA 3RNLA 4I1OA 4LPSA 1Q1QA 3OHMA 5FUXA 3DMDA 5CDFA 1GIAA 1N6PA 1AZSC 4OQMA 4DLZA 3RS3A 1DADA 4HYYA 3Q72A 4QFMA 1COWD 2OV2A 5CB8A 2NO6A 1F48A 5KPDA 1D8TA 2DBYA 4ASUD 1NN0A 3B9PA 1Q1ZA 3I61A 3MRSA 1DAKA 3U3KA 4BWYA 1RYHA 4XVRA 5GJCA 4JMPA 3EZ9A 3K70B 5CM8B 4CT4B 3VR6A 2K5UA 3IQXA 4JLNA 3BRWD 3IEVA 3LVRE 2DWQA 2O8FA 5FTJA 2RCNA 2EYQA 1EK0A 3V4FA 2O8CA 1NJFA 2VHQA 4MRSA 5B64A 1WBDA 4BFTA 1UKZA 3CNOA 3F0TA 4DEYA 4UNPA 4DUGA 2Q9BA 3FGNA 4PC6A 3WRYC 1OE0A 2GXUA 4P4TA 2EQBA 1W36C 3K0FA 1KDOA 1BIFA 2OG2A 2XTMA 3QJYA 2V6IA 3B78A 1ZNYA 2GF0A 3QEJA 3QOFA 4LRWA 1LVGA 3E1SA 3NDBB 2ZS9A 3I1FA 4GP6A 3EAQA 3L0SA 1DARA 3K9HA 5IT5A 2R6DA 4HB2A 5L3RA 3NEYA 3TVTA 3DOEA 2A5FA 4IOMA 5HCNA 1KTVA 2CLSA 4QOSA 3HYRA 2YC4C 2QMUA 3UIEA 4PANA 1MABB 1P4SA 4MRPA 3IIKA 1F2UB 1XPRA 1NKTA 1E98A 1OFHA 1FOEB 221PA 3WP0A 3SYNA 3MMPA 4TN1A 4KFTA 3ADCA 4B75A 3C5CA 3GCGA 1G4AE 5JRJA 3I5YA 2VEDA 1SKYB 1XPUA 1SKYE 3SJCA 2VL7A 5DLQC 2VA8A 5J40A 5FTNA 4BLPA 2GCOA 1E9CA 4B3CA 3GPLA 4IDHA 2IYQA 4DSTA 3GLGE 4AYXA 1KO1A 2GJ8A 4D26A 1E1QA 3NBFA 3ZJYA 4TTPA 3I4LA 2A5DA 3CIOA 3ECCA 3HR8A 4HLUC 3CLVA 2XEXA 2GJ9A 1YZUA 3MFYA 2QE7A 1TADA 1V5WA 3REFA 3UPUA 2AHOA 2VF7A 4G5OA 4KODA 1E2GA 2BJWA 2ZE6A 4ZPXA 3UANA 1DO0A 1QHSA 3G82C 4ILEA 1RFLA 1XJQA 3T1TA 1DS6A 3X1DA 2ZI5A 3FB4A 4OHXA 5C4MA 1EX7A 2J45A 1XXHE 4M1WA 3WHKA 4AYWA 4KYIB 1S9DA 4OQNA 4B48A 2R65A 2ZRHA 4RJLA 2PZEA 4PFSA 4PAOA 5JHGB 1LFDB 1TNDA 4B2PA 1K5DA 1GP2A 2EWWA 4V0NA 4D2IA 1KDTA 4GOXA 3LBIA 3RS4A 1TU4A 2QY9A 4CDGA 1GRRA 4B2IA 1G3RA 1G5PA 1Q21A 4AK9A 1CXZA 4JBXA 2QP3A 2O8EB 1UF9A 4LC1A 2BHRA 2G3YA 1K8RA 3LXXA 5DN6D 2BKUA 3DM9B 2ZRIA 3AUXA 4UNQA 3R7WB 4NU0A 5AJWA 4NCHA 2A5YB 4FI3C 3AVQA 4AG5A 4RSGA 4JBYA 2WWYA 1EGAA 4CVNA 2G1JA 4QXAA 5C2JB 1G19A 1W4AA 4EFMA 3HWSA 5LB4A 4FXPA 5DH9A 2I3BA 1EX6A 3O8RA 3G5UA 1Z2CA 1NNEA 1H8EA 5HR5A 5FTKA 4W7SA 4A8JB 4TYQA 4KXFB 3THYA 1CKEA 4BLTA 4A4DA 1AKYA 2BCGY 3GLHA 1WXQA 4DVGA 2PEZA 1AM4D 5A4JA 4PAMA 2YC2C 4GZLA 1IY0A 1YZQA 4TMVA 3QKSB 5FBRB 2JLRA 3K8YA 1T9HA 2PH1A 4G01B 3SYKA 3EC1A 5GJVC 3QPWA 3ZQJA 1BO6A 2IWHA 1VCMA 4HB0A 3RANA 4IOLA 4RZUA 4I4LA 4X8OA 4L9WA 4QGAA 4JYBA 3PUYA 4XD7D 3Q8XB 1YU9A 2ZVQX 2OLJA 1GRNA 3WY9A 3DHWC 4WXPA 2KJQA 2GKSA 3KJHA 1SVLA 3OEEA 2OSBA 1IHUA 4HZUB 4GRAA 4IVRA 2GVZC 5KOYA 3R8FA 1E32A 4P33A 4BLQA 1OH5A 4GL2A 4GMDA 1X86B 2AKAB 3N2EA 4B76A 3QSYA 3IGFA 3TSZA 5KTYA 4KBFA 2UVQA 3T35A 5KSYA 5DHAA 3SQWA 4DLWA 4LCBA 1M7BA 1N6NA 1DG3A 2V8OA 3U3MA 2F1IA 4BECA 2JLVA 1G64A 1UBFA 1GAJA 1SVMA 4Q1DA 4C2UA 1GL7A 1SGWA 2WSSA 2ZJ5A 3LH5A 1T5LA 2FWRA 3I8XA 4Q9IA 1RYFA 4MYCA 5E4FA 1R4AA 4DLTA 1CJUC 3ASZA 3SR0A 3KXKA 2BBTA 4US2R 2O8EA 3DKPA 1ZD1A 2CHQA 2E1RA 2CBZA 2WJHA 4ZKEA 2B6HA 2PZGA 3BH7A 5E7MA 1RJ9B 3R7WA 1G291 2P3SA 5B2ZA 3PUWA 2ZEJA 3KQUA 2FG5A 1JNYA 1Y63A 3NC1C 4TLAA 4KFRA 3VR5A 3KFVA 2A3RA 2ODBA 4N3NA 3BFXA 1CS4C 4C0BA 4D4KA 2V6JA 4KLNA 5TY0A 4HDOB 4A8JA 4DLXA 2P2LA 4O25A 2RGNA 3EASA 4EPTA 3QG1A 1CIPA 4LJYA 1OH7A 2OILA 4Q4AA 2D7CA 2Q6TA 4NZYA 2C9YA 2WJYA 2ANBA 1G7RA 3QKUA 3LQRA 1D6JA 2C77A 2BMFA 1JPNA 3A1UA 3AUYA 5LPNA 1WQ1R 3ASYA 3U4QB 1NLZA 4YXWA 1A2BA 3EZ2A 1G7TA 2OAP1 2NGRA 3B1WA 2HYIC 1R7RA 4IFEA 3L0IB 2OFWA 1KDRA 1KSJA 2CL7X 2H18A 4PPGA 3C7KA 1VG9B 1UEJA 2QTVB 3EIEA 2W00A 3EIHA 3TQCA 2G88A 3TUJC 3F5FA 1ZP6A 3GLIB 4PQRA 3FKQA 3VX3A 1PV4A 1OHHA 3TR0A 3GLIE 1U94A 2OXCA 3LRPA 3VQTA 2H5EA 3L82B 2WTUA 4OYHA 2Q3HA 1YR7A 2ZRCA 2RGEA 4LV8B 3QENA 4MQBA 1A1VA 2OCYC 5BN5A 2ZYUX 1KK0A 1P2SA 1BKDR 5P21A 4Q19A 4MRVA 1M1YE 1VTKA 2JJ1A 2RMKA 1E2EA 3O8BA 1CJTC 2B7BA 1Q1EA 1Q44A 1TQ6A 3EXAA 3B1YA 3BWDD 3HU2A 2NPFA 5JCPA 4KFUA 3NBXX 1BMFD 2DFKB 2CK3A 4P0TA 2D06A 3FFBA 5IK2A 1VIYA 4A0FA 3B85A 1AIPA 4XTRA 1HEIA 3U7GA 1TTTA 4XVQA 2GCNA 4RD4A 1TL7C 2J5XA 2QE7D 3KJEA 3BH6A 5FUYA 5JI3E 3OAAA 1PZNA 4KCGA 3K53A 4AKIA 4HAWA 2NO7A 5C1BA 3IIJA 4LJ8A 2NO0A 1NMZA 2NO9A 2WJIA 3L2OB 4KO8A 1WCV1 4URYR 3GFTA 2MSDB 3FMFA 4TMZA 3I92A 5TDHA 3LDAA 4UNRA 5TMPA 3LLMA 1XMJA 1ZIPA 3K70D 4KSBA 4BUJA 1QHNA 4LHYA 3A4MA 4RFSB 5K8UA 2ZRJA 1JECA 3FOZA 1HY3A 3VR3A 4BZQA 2VP5A 5AUQA 4D80A 2QA5A 3AP2A 2F1JA 2ZSAA 4B73A 3RS5A 3R8CA 2R6FA 4KU4A 1HTWA 1KAGA 3FMOB 5AUNB 1P3JA 1IAQA 2FGKA 2WMOB 1FL9A 3U4QA 5DSZA 1ZCBA 4R7ZA 1NP6A 1ANKA 1W4CA 2B21A 1K5GA 2GJAA 2QROA 1UAAA 4NCKA 1IY2A 1GSIA 5AUPB 5F9HA 1JQLB 4YMUA 2ZITA 1CJVC 2NQ2C 1G17A 3BD9A 3OESA 2QI9C 4Q9LA 5L3VA 5FI1B 3B8HA 4CZ2A 1E0KA 2G9NA 4UXHA 1COWA 4XWAA 4EKDA 4MGZR 3CWZA 3M1IA 1IN4A 4E5UA 4ASUA 4CEHB 3VR4A 3M6AA 4M9QA 4DLVA 2AXPA 3QVVA 2CE7A 4HDCA 1S2MA 3HR7A 2OBMA 1JEDA 3GJ0A 3VU9B 3C41J 5JJIA 4UJ5A 2QAGB 3DZ8A 2MSCB 2VIIA 3A6PC 4BGDA 5KNCA 5JHHB 3BJIC 2ZREA 2XJ4A 3PENA 3QKRB 5AJVB 1UKEA 1S96A 5AWFC 4ACBA 1H8HD 4IRUB 5JS8A 4GOJA 4K46A 3ZYCA 5LD2C 3TAHA 3QF7A 3V00A 5AR1A 4WBSA 2EFEB 2V54A 2OAQ1 1SHKA 3W9YA 4FMDB 3FHTA 2J0VA 3OEED 2WWGA 2NMVA 5KSOA 4KJZA 2PT5A 2Y8EA 4OK6A 4DKXA 4D25A 2F1RA 1NKSA 4A2QA 4HB3A 2DFTA 2P5SA 4RD0A 1OKKA 3GEIA 2Z6VA 3ICQB 2YWFA 1HQCA 4C30A 2W6ID 1ZCAA 2H57A 4LBZA 3WBKA 1N0VC 3MG9A 3LX8A 4TMTA 3C14C 4JLMA 2J3EA 1E9DA 1GITA 2DR3A 5GVSA 2VSOA 4IKEA 3BGWA 4EPVA 5JSZA 1G3IA 2WSSD 4LHVA 4NMMA 4A0GA 1BYIA 2ZRMA 5IF9A 1R6BX 2WIAA 3TMKA 5H8WA 2ASEA 1TMKA 1XZQA 4BPBA 3CUEF 5SZJA 3K0SA 3RRMA 4KVGA 4B2LA 1XB2A 3MWLA 2O0KA 2OXRA 3DKVA 2FF7A 2ZJYA 3QPUA 1CJKC 3B13B 3RS0A 1CR4A 4Z8YA 4EAQA 4XVUA 5JCZA 5J4YA 3THWA 3PEUA 1NL3A 5A0FA 4Q1CA 5CK4A 4DT1B 1FUKA 2VH5R 2NOAA 3PV0A 1F2TB 1EFTA 1FMJA 5FBQB 4C0AC 3AKCA 1N5JA 3S1AB 3GJ8A 1DG1G 4GMXA 3UWOA 5FR1A 3MWYW 4HAXA 3H4MA 1ZU5A 3K0EA 3EA5A 1E2HA 1QHXA 3VHXA 3TLXA 4CF7A 2CNWD 4TT3A 3QG5A 4CEHA 5D3QA 1U98A 3MGCA 2KI5A 2C98A 2DY1A 2RGXA 1CJMA 4Q7KA 3H84A 5CIQA 4PPFA 4RY2A 1PLLA 3LD9A 4MKIA 1TEVA 1KDPA 3BORA 4AKHA 3B1XA 1XBTA 1W4BA 4POAA 2QZ4A 3TSOA 1IQPA 1FMLA 3LV8A 4YXWD 1XMIA 3QKRA 2ODWA 3RAPR 4HATA 4BFYA 2ZAOA 4CT5A 4X8LA 4O2LA 2IUSA 3I5XA 1HQYE 4BFVA 4DDUA 3GLFB 1WBBA 2D2FA 5DN6A 1T0JB 3HU1A 3K9GA 2C03A 4URUR 5CDFE 3LO5A 2CHVA 2WKPA 3CX7A 3BB4A 3EWAA 4OHWA 1C9KA 3PVSA 3RS2A 4EUNA 1E6CA 1G3UA 2GCPA 3AF2A 4CIDA 2AFIE 3AKEA 1UBGA 1OIWA 1ZD9A 3QBVA 3TK1A 3GMTA 2FSGA 2FZ4A 1D2MA 4PC3A 4QBHA 5GJWC 3QXCA 4RZ2A 5BW8A 1ZNZA 2JJ1D 1OV4A 4NYMR 5F9FA 4TMKA 4UKDA 1KKLA 2HLDD 1RRPA 1X8JA 1Q22A 3SFVA 2WWHA 3AF0A 1OFUX 1P7CA 3CNNA 3T1VA 3TR5A 1G8YA 4RD3A 2O8CB 1U81A 2HJGA 4FMDF 3RRYA 1RC8A 1OF1A 2H8KA 2C99A 3Q7PA 1RRCA 5KSZA 1HV8A 1II0A 2OE2A 3P26A 3KQHA 2JLZA 1FW6A 3C15C 4YC7A 4R2IA 4CEIB 3RC8A 4QKQA 3A58B 4ZCMA 2Q9CA 4Q02A 2O0JA 2DWPA 5KU1A 1N5KA 2QRNA 2QBYA 1U8YA 3OAAD 4IEEA 3G0HA 4ARZA 4BFUA 4PAQA 1AS0A 2JLWA 4XD7A 1KGDA 1GVNB 4TL9A 3K09A 3C8UA 1VG0B 3WNCA 1RPZA 1D2NA 1QHHB 2FN4A 2XB4A 4K81B 4XIGS 2ANCA 5DYIA 3RABA 1VPLA 4YMTA 3U7FB 1W44A 2VP2A 2O8DA 3TUZC 4D81A 4LYAA 1DE0A 1ZBDA 2B8TA 3AV0B 3K0CA 3Q5EA 3SJBA 4DLUA 4LPKA 1KO4A 2ZQ5A 2BVNA 3LLUA 4PHHA 3IPXA 3LNCA 3TH5A 4EQ6A 5EE1A 1N2CE 1NF3A 4EPRA 2D3WA 2ZRKA 4W5JA 1KZ7B 2VPPA 1NIPA 1II8A 3VKHA 4EJSA 3GJ3A 1P9RA 3SHWA 4DWJA 4DRZA 3RRNA 2FEMA 2Z83A 1T5IA 1P2TA 2GCOB 4E22A 2GK6A 3AKDA 4Q7LA 4DIDA 2HT6A 5CYPA 1WMSA 3HJNA 3U3JA 4LJ5A 4PSAA 2P0EA 3V4RA 1W5SA 4PSVA 4F7WA 3GLFA 2IC5A 1QBKC 3GQBA 2V3CC 4TLEA 4HSEA 4LV6A 4Q03A 3W8NA 1YR9A 4BE7B 3WYAA 1KJZA 2O52A 3SE0A 1Z63A 4Z54A 3GP8A 4Y0AA 4KI0A 2BMJA 4M0LA 4HLQB 5JWOA 2BKEA 1VHLA 1OT3A 1XX6A 1MRSA 3R20A 3PUZA 3UG6A 2QPAA 4S2EA 4HAUA 3TJZA 2OLKA 4Q00A 4R71A 5GJBA 3HPQA 2OFXA 3U5ZB 2ONKA 1WB9A 3UG7A 1P60A 1E96A 1VKJA 1Y3AA 2EFCB 1SQ5A 4WZAE 1KK3A 1N6IA 3DEFA 3PIRA 4GOKA 3MUFA 1NJGA 5CK5A 4ACAA 4YLGA 1DEKA 4F93B 4JL8A 1MH1A 4XJXA 1OXXK 2A78A 1DPFA 1Z28A 3GJ6A 3B2EA 4HLCA 3BE4A 3FMPB 3JVUA 4CW7A 3ND9A 2XAUA 3QBTA 1SVOA 2F3RA 2C96A 3NEJA 4CEIA 4CRWB 4RCZA 4A9AA 3L0OA 2HEIA 1OXSC 1T91A 1US8B 1CF4A 4PQFA 2WV9A 2HF8A 4TLCA 4UJ3A 5KDOA 5J4KA 1JEEA 4GFDA 3AF3A
chains in the Genus database with same CATH superfamily
2WYWA 1KBOA 4D74A 5JSFA 3HUDA 3ZDYB 1JRLA 2GXAA 4WDRA 1OKKD 2W83A 1B2RA 2FK7A 3MSCA 4QARA 3T3IA 5HSGA 1V7ZA 3N5CA 1HZZC 1HNWB 3GJ5A 5TS3A 1QGAA 3WL5A 3E9DA 2COUA 5IULC 1G21B 1DTSA 2JRLA 4ZOAA 3THYB 2B5WA 1B16A 1URPA 5CD1A 3M6IA 3LI2A 1F06A 5PNTA 4JEHA 1AJEA 1ZJYA 5KHOC 4PBSA 2EJBA 2R2AA 3NV7A 3VBEA 1R5NA 4OQ4A 3EGXA 4QPZA 4N03A 5K8JB 3JQAA 4JSTA 1Z29A 2BW0A 1L5HA 2COKA 2MHCA 2QT1A 5FPKA 4LI0A 1A8HA 2QT0A 5FV7A 4BNXA 1RVV1 4FOPA 3M5DA 4X0EA 2H51A 1VLQA 5AM5A 1DKUA 4I36A 1W2HA 3RYFA 2QVBA 3GJSA 3V4PB 3W2FA 4UTRA 2Q21A 2D2XA 1EXMA 3KQLA 4QBGB 1E3WB 1R4MB 2CV0A 4OUDA 2WA1A 5AOCA 1IMOA 4LYDA 1HORA 4F6RB 2FQ1A 1DPGA 2PRSA 2AVDA 3RJTA 1VJGA 1JKFA 3T9BA 1B0AA 4TVKA 5J1TB 1NLUA 3ROEA 3HRKA 1IUKA 1M1NA 1RRFA 3FMIA 4IWYA 1M6EX 4A0RA 4OG2A 3OLVA 1V37A 4WOPA 3EIQA 4I99A 5BQPA 1FTQA 2JLYA 1G20A 1M8FA 1R6UA 3NHRA 1XNJA 4H08A 4IQ4A 5EIEA 2WAYA 1R9GA 2QSZA 1EVYA 1ONOA 1GN8A 2O20A 3VPSA 5DSXA 2YWDA 5LXTF 1CETA 4A8JC 4EK9A 1YA8A 2RGNC 3PC2A 3R0QA 3CPJB 4QSMA 3VTKA 4GL4A 5AJZA 2WD8A 1GGMA 5EKUA 2JCGA 1JI0A 1C4XA 1QE5A 1SBQA 1TVEA 3TX6A 1P61B 2RGUA 1IIRA 1DAHA 1J8FA 5LVAA 2H85A 4R2HA 3PUVA 1BVYF 1I7SB 3MIIA 2G5CA 3OMLA 2F48A 4D9EA 4TWZA 2M2IA 4L5IA 3WLKX 2V1XA 4D0LB 1B15A 1FUYB 2PMCA 4NBRA 3KEQA 3CT4A 2AK2A 3KD3A 1EHYA 1MR3F 2HM7A 2A4KA 4M1SA 1RKXA 5AJHA 2Z2ZA 3TX2A 2H1LA 4JKIA 4M55A 1QF7A 1IN5A 3LA8A 5DBEX 1GWNA 3RC9A 4LHXA 4HJXA 4O2AB 2P9YA 3IVCA 3OPVA 4DSZA 5MGNA 5ESXA 2MSEB 4S24A 2GRUA 5A2GA 2EBUA 1AG9A 1T0HB 3NT2A 2WHXA 4FOOA 5CIYA 5AM0A 4Z0NA 4IH1A 1O2DA 3NV9A 1T24A 2WDPA 1WKVA 5TE9A 4K3UA 4UHHA 3ZZNA 1RPNA 1U9YA 4HXYA 4Q4AB 1EZ1A 1TJPB 3H5NA 1JKIA 1CDEA 3K94A 3EB9A 3GVIA 5FNVA 3C24A 3TD2A 3BJEA 4OLBA 3C6MA 2FW6A 2Q2QA 3U80A 1USWA 1HI9A 2JIMA 3FCEA 3IBYA 5KEIA 4L1KA 4V24A 3TQQA 3IXMA 5A9TA 2W2PA 2HRDA 3IJEB 3VKUA 4RPIA 2AR0A 4JXZA 1VYVA 2W93A 3K0AB 3OQVA 4I9NA 4BMCA 2WTBA 3GNSA 2C20A 3GCZA 4DWVA 3WLOA 3UBTA 3CCBA 4DNXA 2AC7A 3D6TB 4OO3A 1EP1B 3ZCPA 2H2FA 3BMNB 2E4AA 1TYCA 3U56A 3F74A 4XLZA 3O2JA 2P91A 2FSUA 1UJ6A 3PEEA 3NUQA 3E18A 3EVEA 2CV1A 2NW6A 5IUJC 3K2IA 4G5GA 2ZTSA 4CLOA 5IVKA 4LYFA 3JZMA 1ISSA 3GGGA 3CF0A 1TYZA 4TKVB 3WAGA 4H7HA 1RP1A 2V98A 3OZVA 4KHZA 4C3ZA 4QELA 4LOAA 5B7NA 5KWSA 2BE9A 3WRYA 4B3MB 1LW7A 13PKA 1N5MA 3WL3A 1GCOA 3D1JA 2CDCA 2OFOA 3PNOA 3IYLW 4FILA 3ZE6A 2QENA 1NDHA 4EW3A 2W6IA 1ISHA 4JQZA 4H7JA 3HLTA 3NHKA 4WESB 3SZLA 2DC1A 1IK4A 2LW7A 2X1LA 3A37A 2UVDA 3IC5A 5JZ9A 1DIGA 2HA0A 1K8YB 3A2LA 1N2JA 1YB1A 3AR7A 1PLJA 4XSHA 4K6HA 4C7VA 4V0OA 1SC1A 1ZWKA 3U40A 4B3GA 3FPAA 3WWEA 3CB4A 1OBCA 1SURA 3ZGLA 2ERCA 2V5VA 3W6PA 4V0MA 2HJVA 1DTEA 1F2DA 1SKMA 4LC0A 5I47A 5JAIA 3JSAA 5BNIA 4ZYUA 4YP1A 4Q9KA 2J3JA 3ESRA 3RJ5A 3LT4A 4AYTA 3DV0B 1ZRMA 3E58A 1QDLB 4BMSA 1CWUA 4DIEA 2FMKA 4RKFA 5JEDA 3AF4A 2R0QC 2HHCA 1Z45A 2ZIUB 3HK2A 2J0QA 5JS2A 2Q4BA 1VA4A 2GA9A 4C9BA 1PU2A 2C61A 3AR9A 4MPRA 1RC8A 1C2YA 1SUCA 3HADA 5D8DA 1E1LA 4F85A 2WUWE 3TRHA 5IF3A 1CB0A 2O1SA 4PYRA 4AQ7A 4BXOA 4HRVA 5KNDH 3F49S 1Y8RB 4ZZIA 1W1WA 4MDFA 4RENA 4BU1A 3JQCA 3S29A 4LBYA 4E2WA 1HT2E 4LG1A 4NL4H 3I5UA 2H06A 2P6MA 5AESA 2HKIA 3Q15C 3A4NA 3QX3A 1KY4A 2WUEA 4UM7A 4GRDA 2QTBA 3RNOA 3AR2A 4MS1B 5C32A 5KZMB 2C2HA 1H2YA 2A84A 4MIYA 1EFHA 3D2BA 1TLLA 4IGIA 4NV1A 5REQB 1ZIXA 5ARDA 3AIIA 2AFHB 4YAIA 3P20A 1Z4LA 3VHRA 5AVVA 4EB3A 1DKPA 1P7VA 3E3NA 3INTA 2GJSA 4LA4A 1M2KA 2OUKA 3H5LA 3QX8A 1EU1A 1KI1A 5BUCA 3H2BA 4IO1A 3F4LA 4JGBA 4GP7A 1H1TA 2IYSA 4PONA 1VJ0A 1VYUA 3PNMA 4Y2XA 3ZH2A 3VC2A 3U7HB 4ZV4A 1JUDA 3D59A 4A92A 1JIIA 4P5PA 4ESVA 1X7XB 1L5WA 1FDIA 1MO6A 1Y42X 3UUWA 5KTPA 1I36A 3N9IA 2UUBB 1D1SA 2VNSA 2A9FA 3QTLA 4NG5A 1RYYA 5CYGA 1U9CA 4TSFD 4ES6A 3LBYA 2P35A 3BMQA 1XJCA 1TU3A 2CKDA 2UKDA 1VKZA 2Q1UA 4WZ6A 3TQHA 3T0GA 2IF2A 3EWSA 2PGIA 2QY6A 5EZ5A 3H9GA 3ODPA 5KOJA 1E2JA 4Q37A 3RWMB 1KMHA 3N1UA 1TRHA 3I76A 5FBLB 5B3JC 2I1VB 2OBNA 3I2KA 1Q7EA 1YKFA 1D4ZA 2CLOB 2GZ3A 3OUZA 3VA7A 3AVVA 3G0DA 3WGUA 3F67A 3HFJA 5ECDA 1XCGB 3CBGA 1C4OA 1RWQA 2LBPA 2IUUA 3EBLA 3IA2A 4A0HA 3RVKA 2RJNA 1WDKA 1KK1A 2GFIA 4P4UA 3JASB 4ENRA 3JQAD 4RKWA 3CPEA 1LY1A 4UEOA 2K2WA 1U9ZA 4B17A 5ESDA 4EMSA 3H8WA 5IARA 2X9VA 5A7FA 5HZHA 1NR1A 2Q4DA 4E3WA 3IESA 4P80A 1NBIA 3RADC 4RPLA 4QOIA 2B4AA 4C87A 5IVPA 3UMJA 3H3JA 2JCSA 2EF0A 1BVRA 1VBNA 5JQGB 1V7PC 3TSAA 1KZGB 4YCBA 3UJPA 4NIMA 4Q3EA 2MSKA 1EDOA 3ZD6A 5IKOA 1SK8A 4LV5B 1YJAA 5JZVA 2ZUBA 1JGTA 1UBSB 3UVEA 1Q3KA 2QOEA 4KR9A 2J3LA 2X8AA 2YMQA 4JR2A 1WR8A 3B5JA 2VT3A 3WQSB 4YMVA 2GPAA 4OI2A 3W4IA 1KDVA 1I0LA 2Y6UA 1UJ2A 2ONZA 5HGXA 3ETJA 3EFOA 3I3SR 2P1ZA 4O4JB 4YLEA 5CXXA 3UT0A 2VF2A 4BNHA 2QJFA 2WHPB 1DKMA 5JVDB 2XRYA 1GM5A 4BFXA 4B43A 4XGRA 2ZIWB 2RG7A 4KQCA 4RKEA 3U5TA 3I6YA 1GTG1 1VJRA 2JLSA 1GDDA 1JEOA 5DBHX 3H17A 4PSKA 1JQBA 1O96B 2Q5EA 3CZMA 4H0CA 4GBED 4RFVA 5JH7A 3VVCA 1IOVA 1JS1X 5ALNA 1W73A 4HWRA 3O73A 4PQEA 5B2EA 1XTPA 2O23A 2A7QA 2V6MA 3CURA 3M4JA 4PGHA 4PQGA 3UJCA 4CQMB 1HQKA 1JT9A 3DL7A 4C4ZA 5B7PA 5IBCA 1CBUA 1E9SA 1CB7A 1CP2A 1WZIA 5AHKA 1YFLA 1MJFA 2HN9A 1YRBA 2Q6OA 5IC4A 4XYMA 2MINB 3C3DA 1KMMA 1HA3A 2ATCA 1EWRA 2XNDD 3GUCA 2XNCA 1A2KC 4LVCA 1PVOA 1VMAA 2M6KA 2O6HA 4MVJI 2VUHB 2Y0DA 2JHFA 3VVLA 1DTWB 2GK4A 4J1TC 4AI6A 4X5OA 5DTQA 1C7ZA 2VF8A 3NJRA 4HX2A 4FHEA 1EWTA 2GTIA 3TVDA 3K71B 1KJJA 2ZU0C 1OWPA 3SKXA 4RMJA 4CIAA 1M6VA 2B4RO 1EGMB 2OTCA 3LYHA 4FQ7A 5D51S 1CD5A 1LBHA 3DVQX 5KQRA 5ALYA 3N0XA 3QI2A 5T8KC 3VHXB 4CMCA 3JCZA 4TGLA 3K0KA 1FBTA 1KZYC 1U9IC 5EJAA 4I1PA 4LF7B 2HIMA 2WIJA 1CR2A 2PJUA 4N3CA 3STWA 1OJ7A 1KAOA 3DB1A 2XYHA 4I1RA 3UMMA 1KFCB 4DABA 3DHNA 2VHWA 2PZKA 1L7VC 5BNWA 1GYQA 3OG9A 5F5XA 5EWJA 4BQFA 4TRRA 5IJXA 4CQNA 1SU4A 5KYVA 1SPBS 5L3QA 5K4AA 2R1VA 1AGRA 5BOSA 4O3MA 4HB4A 5AJXA 5L7WA 4P98A 3FWZA 4WZBE 2QTGA 3TN7A 2GNAA 1F6BA 3R4CA 3AP1A 1RE0A 3NANA 1AKEA 2XMPA 1M7HA 3BHMA 4XDGA 2F3SA 5G1NA 2A6PA 1Z6XA 1E1YA 1MCZA 2XBUA 2I3AA 2QQ0A 1ES9A 1R3DA 2WG2A 1Q19A 5JMOA 4CU2A 4UTPA 3UBMA 8ADHA 2IYZA 4MUEA 5CBKA 3EE6A 3K1JA 4OK5A 9ATCA 1T3LA 4V38A 3VUEA 1A2OA 4UU0A 4RJIA 5AI5A 3JATB 3QFHA 1MTOA 2QVYX 4UOZA 2H16A 3LE8A 4UAGA 1T6NA 4L5YA 1Q7TA 4DGSA 1UC4B 2KQUA 3QVXA 1CV2A 1G6HA 4CJXA 2XYGA 2R25B 3PEWA 1KF0A 2WWWA 1PR3A 3NNSA 2X77A 3GJYA 4V03A 2VQFB 4MDEA 1VPEA 5I9MA 1NNSA 2OEPA 3T9EA 3T9CA 4KLRA 3EAGA 3GRRA 4GU5A 4KGVA 1AZWA 3QLVC 4G0PA 4M0KA 3EEQA 4DQXA 4EARA 5JY6A 2C7VA 5IDXA 2Q46A 3VTAA 4RNDB 5IT4A 1AQJA 4M22A 1MAHA 5DTMA 3RQIA 4D4MA 3D7NA 1QNLA 1N0UA 1VI6A 1RADA 4LDJA 1R5BA 3SSMA 3VBCA 5AUOB 2H3EA 2YUTA 1TD1A 4MQUA 2WG0A 4IIUA 3VPDA 5E0OA 1MO4A 3HJFA 2BEKA 1GUBA 4RVNA 121PA 2WWXA 5AW9A 1U5CA 1XMOB 1QUFA 4Q7QA 1MAVA 4N5NA 5IWCA 3T15A 5G40A 2L19A 3KHSA 1J7JA 5D87A 1K8XB 3M4YA 3QUQA 2WB2A 4ARCA 3LRXA 4AICA 3O8OB 3IOCA 4BVHA 2VDQB 3H97A 4NNOA 4OMCA 4WK4B 4CG0A 3GRPA 3QU9A 3OT1A 5D84A 1HRDA 1IU9A 1K66A 1VL2A 2WSIA 3GZJA 4R9NA 4DR7B 4RFLA 2SCUB 1YJ5A 2O54A 1IN1A 3P1JA 4F71A 2FSVC 1AQUA 5EE9A 5G41A 4TKUA 2IHBA 3EZ7A 2Y1WA 5FUVA 4D82A 3DMHA 2PSEA 2VHEA 2P1RA 4JNKA 4QJ5A 1QLHA 2FSFA 2HSGA 3Q0IA 1II8B 2R62A 3C2QA 1B4DA 5EWLA 3W6ZA 3ZJ4A 2Y4NA 1SQ6A 2XMRA 4XSVA 1Q1AA 2BBWA 3UOWA 4BZWA 5IZCA 1E6KA 2EZUA 4UHCA 3PXGA 3CX6A 4C29A 3KQNA 3E5NA 4HDNA 4WY5A 3SBDA 3PTAA 2OGUA 1Q57A 3EDMA 4RK7A 1JZSA 3F98A 3CWQA 1NBMA 3DBLA 3TCXB 1P5ZB 4DR3B 2QD5A 1Z36A 5J5VA 3ST7A 3ZD9A 1Q0RA 2OCPA 1HYEA 2NPIA 2PX3A 4U7DA 5GMOA 1FFAA 3CQ9A 4QUEA 5BNTA 4O4LF 2GQ0A 3RW9A 5FBVB 1SUIA 2JGLA 3MB5A 3MD0A 1ZU4A 4IRXA 2DWCA 1DDOA 2GZAA 4JITA 3F7NA 3R5XA 5EXPA 2ECKA 3OF5A 2E1PA 4KTTE 3VDRA 5SZIA 3VV3A 1B7GO 1DT3A 2YZMA 3H19A 1S3GA 4PTZA 4L0CA 5A4IS 3A3PA 6ADHA 3HS3A 5FOSA 1MKYA 5CCBA 1PCXA 2FZLA 2IP1A 4JROA 3B1ZA 3RG2A 3GMDA 1DNPA 1AKNA 1K7EB 4I3GA 4FS3A 3WIEA 2H2GA 3K0BA 4OCZA 1XXLA 2C1EA 4J0QA 1V1JA 1M6NA 5J4VA 2W2XA 4J49A 1JMYA 1Z6PA 4J1QA 4KLZA 3H65A 2ZRAA 3KOOA 4DMGA 1HL3A 3WMEA 4YP6A 4LAFA 2XMZA 3OKFA 3UWPA 4V02A 4YI5A 1VJ5A 2EJTA 5TPWB 1HDXA 2VXOA 3IBGA 3OQ1A 4UU7A 1Y9DA 1U0NA 1S6YA 3BGSA 4LDQA 5EZ6B 1AMOA 4UPVA 2H4HA 3RSLA 2NZJA 3F5SA 3AK4A 2PWAA 4UVDA 2QVZX 1NIJA 5EJFA 1E2MA 2XUPA 5ANRB 5KOHB 3M0EA 5FKJA 2I2WA 4ZU3A 4UM8B 1EVEA 1XQ9A 4QPJC 5JJCA 3B3FA 3R9WA 2HO4A 5DLYA 1MX3A 4X1YB 2EFHB 1J7KA 2XOKA 2RHGB 1JVNA 4YGYA 3WJAA 5SZKB 2OCLA 4IUBS 3LKBA 3C45A 2C0PA 2FSHA 2VDWA 3U7JA 3TTTA 3QKWA 4BU0A 3CW9A 4PNEA 1ODCA 2POCA 4UUQA 2HTFA 1BYUA 4QQNA 3UMFA 1TM2A 4Z3KA 3LW7A 5A71A 1I13A 2IYNA 4E07A 3V1LA 2FVYA 3G0OA 4CMIA 1PNRA 1T6ZA 2JA2A 2PS0A 5LYJF 1NBEA 3O8LA 3ENQA 5CA1F 5IKXA 1YK1A 3EF1A 3QYJA 5KWIA 4I55A 3U4CA 1ZIDA 1JSZA 2WPDA 4N5HX 3IJPA 1HOTA 4PO8A 4QGFA 3K70C 5IFKA 4ARIA 3BWXA 2EOAA 2HK6A 3D8BA 4P86A 4UMDA 4Q3LA 4RK0A 3L79A 4JVMA 4QTTB 2DHCA 2V7XA 1PJSA 3O6VA 5AKEA 5ALJA 4ALLA 3AJRA 4JLBA 3UV3A 2IPOA 2QUZA 4DWWA 1M67A 4DBLE 4UVEA 3VC1A 3SJZA 4WW0A 4HXFB 1KBZA 3NW9A 3U4DA 4MUJA 5F51A 3LWNA 3Q0EA 4OGGA 5KIAA 1Y37A 4R3NA 1QGZA 4E7PA 3TXAA 1F4VA 1MV5A 4OGFA 3WMRA 5C1OA 4K1LA 3WYFA 4JUBA 3RHTA 3G2LA 4RW0A 1RAAA 4JCOA 2A2ZA 1KYWA 3CEJA 2FEXA 3B9RA 2AUMA 1NU6A 2XDWA 1ONBA 4U2EA 5ER6A 1VPVA 4P4SA 2VXCA 4QUAA 4D97A 1G59A 1TUIA 1G20E 3N39C 1X77A 5JPIA 1Y1RA 5EKXA 4RGQA 4RABA 3LPMA 5LU9A 1SBZA 1ZXBA 2R68A 4P6VF 5DOZA 2R8XA 3L40A 4MULA 5BNFA 3AIKA 4LWZA 1AE1A 4UVIA 2BFEB 1WEHA 1QYIA 2DP4E 3R6TA 3QVJA 4J7AA 1DOHA 3MYRA 3E9QA 4AO8A 2CDAA 2J85A 2FFQA 2PJDA 1LJUA 3OZBA 4MLZA 3T41A 3V7FA 1MT3A 2CC2A 4YA6A 4YUWA 3ICEA 1V9LA 2JIBA 1SIBE 3BULA 5HE8A 1Z38A 3ZLBA 5B4TA 5L4NA 1YGPA 3DOJA 1YHZA 1GUZA 4BRUA 3NIGB 4KXQA 3T38A 3G17A 4RD1A 2DYKA 4AG3A 3WWPA 2FZ5A 5GM1A 1I51A 3L8YA 1WSWA 2WP0A 2F1HA 4MWBA 3VTZA 1Z47A 1IONA 3AETB 1JDPA 1ODLA 4ZYXA 3KLMX 3N8DA 1OH6A 3ZE7A 2XKAA 4I9GA 3JD1A 4QHYA 1PTJC 3HBMA 4Q3NA 1AGXA 5ALIA 1FTSA 4NULA 1ILWA 2J46A 1MXHA 3WTCA 2PUJA 5E3JA 4PCVA 5KYNA 4U2CA 4YJGB 2C42A 2FWAA 3C16C 2HV9A 5KC9A 2O2GA 2LKCA 3BUSA 4RQAA 1TJNA 3H5VA 4D4HA 2MMGA 3IL2A 3FYTA 1CR0A 3C7AA 3MJHA 3OKPA 1XWFA 4F4CA 4ZARA 1GTJ1 3D8TA 4W5WA 1OZGA 1A7JA 2REBA 5TRTA 2NACA 1ECLA 4PRKA 3F71A 3KSRA 3N8NA 4JEMA 2VK4A 3ETLA 1SWWA 2O4UX 4GKAA 1CP3A 3PCXA 1DJPA 4URWR 2HO5A 4YP5A 2VDMB 4Z7OB 4YCJA 1D0VA 2B2CA 2O0LA 4YAOA 4F92B 1ZAKA 1N25A 2JJ2A 3U44B 4B4DA 2HQSA 1NDUA 1HMYA 4MKXA 2Z4SA 4QT4A 1EP2B 2JEOA 2IY7A 4C43A 1PFUA 1N6RA 4GWKA 3KG2A 2BZ0A 2WICA 1JDUA 2ZTMA 4V3BA 4QPNA 2LP4Y 2JD2A 2EDCA 2ZDQA 4FBLA 5E2BA 4EY7A 8MHTA 2CHFA 3KUKA 4Q47A 4PE5B 2VDRB 4QYXA 3LU1A 3HZZA 2COEA 1NAIA 1L4FA 1ORDA 2QPTA 3E0QA 2CCKA 5JC1A 2VAPA 1FFXB 5AW1A 3RODA 1E9RA 1SXGA 1CUGA 1TEXA 1GXSB 2PZBA 2ZJZA 3LBHA 3M1AA 4NENB 4OB7A 2G0NA 1PTKA 3U3RA 4G07A 2P2NA 3WA6A 1VPDA 4BNNA 2JI9A 3T7JA 3M5CA 3SZOA 1U0JA 5ECWA 2Y4OA 4YMGA 5AK5A 1EUQA 4LJ9A 5EJMA 3GDHA 4M8LA 3GGSA 1CZLA 4U5XA 1AKWA 5FPTA 3KZMA 3SQXA 3K9QO 4J9VA 3N2NA 3PEFA 4QEKA 1E6LA 3VR4H 5KCZA 3X1WA 1RZRA 1KZ1A 1NE7A 1H2XA 1KSHA 1AQIA 1XTZA 4GYKA 4QC2A 4BUZA 1E4VA 2OO5C 1XALA 2ZTHA 4LK3A 2O59A 4IEFB 3O1HB 4ZHQB 4RTLA 3H7AA 6PFKA 2HK7A 2VYNA 1KI6B 2H5JA 4G8CA 4KG7A 3W1EA 1GZ7A 4YO7A 5SY9A 1TZ2A 2XCTB 2P6NA 2E0IA 3WGOA 4IDNA 1KQNA 3ITEA 3NNDA 1GUAA 1EEHA 1MRNA 1Q17A 2PRYA 3NCHA 4ZDWA 4C7MA 1E92A 1N1MA 3M4NA 5DBGA 2A0YA 1SVUA 1XTUA 3HJCA 1SFRA 1JLSA 3VYRB 3BDVA 3KB1A 3MCTA 1FPMA 3RO7A 2C82A 5KYWB 4U7HA 2PLFA 1BXZA 1PD1A 1L7OA 1X9IA 2JRCA 5HK9A 1XDUA 5K8LA 2VYFA 2GSDA 1ECGA 2B1JA 3Q8WA 4II3A 1D2CA 1SRRA 2FLVA 3U1TA 5CFZA 1AN0A 4D9GA 4J3FA 3O1JC 1Q0PA 2ZSFA 1ULBA 3ANXA 5KJEA 3HSKA 2G08A 3WHLA 6Q21A 4IH9A 2VKTA 1KBQA 3U39A 1MGOA 4QGSA 3T1YB 3OPXA 2X0RA 3PPWA 4C4XA 1FNDA 4LC9A 4B45A 4YAGA 1XJWA 1VMIA 2E2WA 4I5DA 5TQ0B 4W5QA 3N2IA 4G2NA 4N7MA 4HN9A 3FYSA 1WHTB 4KACA 4OQEA 3RB8A 4KR7A 2VRCA 4YR7A 4ZD6A 1Q0QA 2XB6A 3L93A 1MC1A 3N3AC 4UM9B 4DV0B 2EWMA 5D5QA 1KJYA 3EIUA 1Y3FE 4BCCA 1AK1A 4QNNA 2XGGA 4EO7A 4TL8A 4R3WA 4MAAA 2RD2A 3V33A 2OHVA 3A32A 1QRSA 4NKRA 4PAWA 3WO0A 3AESA 1ETUA 3O8QA 3RT9A 1TC1A 1M6YA 1UDBA 4US0R 2Q2VA 3EW9A 3SS8A 2PVPA 2Q1SA 4IINA 2ZUCA 3H11A 1T43A 2QR2A 1IWOA 2XOKD 4LQLA 1HT1E 3MGBA 3V34A 2LKDA 4IF4A 4RACA 4L16A 4TTRA 4YBRA 5K05A 1DO2A 1L4LA 1CUJA 2VJKA 3VO9A 1FQOA 1QONA 3RVQA 2NIPA 2JEYA 1QMPA 1W9HA 2H1HA 2YOHA 3PYXA 3IT0A 4NTZA 3L77A 4QSHA 3BD8A 2GDJA 1OXUA 3IUEA 3O4RA 5TQVA 3WB1A 2RONA 1ZJWA 3TEFA 1KO7A 2Q2WA 1I8TA 3LL4A 3A8TA 4J0DA 2NUAB 5EZYF 3D4LA 3VR2A 3ZW7A 1R66A 4ZDKA 3O2SB 4CT0A 4CXMA 4LSMA 3GLGA 1LWNA 2ZSEA 3UATA 4MUAA 5J43A 1BE6A 1R00A 1XTKA 1UXKA 5K6RA 4IIVA 5IBRA 4ZGWA 1J97A 3EAFA 1WLYA 2BMAA 3EEFA 4TPKA 4DA4A 4KQIA 4RY0A 3NEAA 4AU1A 1NYRA 4HVCA 2JC3A 3IJ5A 1K1EA 4FW9A 5NULA 3AJEA 3ZWMA 4LF4B 4N41A 4JJGA 1OIXA 2PU5A 2RARA 3DZFA 3GDOA 3KTAA 2HU2A 5E6UB 1DKRA 3UXMA 5LIPA 4G65A 4B1FA 2BDEA 1CUWA 2ID7A 2AL7A 1EFRD 4C6TB 2JCBA 4HQNA 4L2IB 3KT6A 4KXVA 5BYAA 7YASA 5EAIA 1Z0UA 1GYRA 1QV6A 3AY6A 3EMBA 3FF4A 1YUMA 2YV2A 2Y99A 1EIZA 1WMAA 4OGLA 1KVRA 4QTUB 2B99A 5F2OA 2JAQA 4R81A 2JKVA 2Q99A 1BGWA 4G5HA 1WV1A 2PQ6A 1Z0FA 3OZ7A 1BHQ1 1JPJA 2II6A 3GEEA 1K68A 1OB2A 1ZLYA 5SY4A 3N0TA 3VDMA 3TD9A 1EQ2A 2CEAA 2QNIA 3HA5A 5HNKA 4JMLA 3INRA 5G0VA 4BMPB 2X4DA 2XYPA 5GZ1A 4TQAA 2J0UA 4B3DA 5CP8A 4XDYA 3KVRA 1E9BA 4RC9A 1OPXA 1ZGCA 2B83A 1WTAA 1BCRA 4OJMX 4KI7A 1HE1C 5TVGA 3MBKA 2W6MA 1FB5A 2YJ4A 3EMKA 3SYMA 3V8MA 3EFEA 1JXOA 4A82A 8GPBA 2FN3A 1LF0A 3IEIA 5AI8A 5FAXA 4AIRA 1CEYA 2LZ0A 2GAFA 2GAIA 4QYTA 4YN3A 1LQTA 2JBAA 3TW4A 5BP7A 1YA6A 3QEMA 4AXBA 2V59A 2GZ1A 2VQ3A 5LKRA 2G71A 1S7CA 3I8SA 3OC0A 3QUTA 4O2BF 4G0MA 3QQPA 3RFXA 4CKBB 3CRW1 3HCCA 2F8LA 4PGMA 1I0IA 4EEKA 1DBRA 4NESA 2HWUA 2IYWA 3AJDA 4JZYA 5D5PA 2E4WA 2JGJA 2G7ZA 3NQ41 4O2AF 4KVAA 2R5WA 4ZQGA 4F4IA 5FOUA 1UBHS 2FWJA 3S40A 1ULUA 2QYTA 1O4VA 2X1VA 3HJGA 1ZH6A 1OZ0A 2DBRA 2YQZA 5G3YA 3KU4A 4BGIA 2NTEA 1A5SB 5JOQA 5DHUA 1QANA 4GZMA 4RSRA 2VQSA 4M8NE 1J0XO 2OO7A 3SX0A 3I37X 2PHZA 3AEQB 3FE2A 4LMRA 3H2KA 4BMOB 1ZM7A 1S9HA 1UZMA 3JR7A 3NH9A 3DTNA 3BB3A 3H9JA 4N9WA 5IX8A 1MQSA 5KYTA 3ZNQA 5HFAA 1J56A 4AURA 1WW8A 1JKMA 3WXMA 3MRVA 1WF3A 1ZICA 2REOA 3A6JA 1I4OA 4RD2A 5F2KA 5FA5A 4E1BA 2CXTA 2Q5OA 4BTEA 4GPIB 2EFJA 1HE2A 2PH3A 3PUHA 4EHHA 2SNIE 1IZ7A 1KTIA 1QYRA 2AX3A 3NJ8A 2BCJQ 4WOBA 1Z5VA 3WV5A 2AVNA 3FFTA 5A03A 4XWKA 3PR3A 3QWIA 1QSGA 4DLRA 4NFSA 2WSLA 2PKQO 3ZE9A 3A2NA 2NVUB 1NNLA 1O94A 4W9RA 3RF6A 4XX0B 2QGZA 2FOLA 2NVBA 3V46A 1MB2A 4UCXA 4L27A 4BMDA 3D1VA 4FDTA 3P96A 1F0NA 3BE5A 1TRKA 5H3LA 5B2FA 1KVSA 2ZJBA 1YXMA 2HIGA 3ADKA 3H99A 1O6ZA 3PICA 4IDBA 1GCUA 1HG0A 3ZGXA 3P2EA 4Y67A 2OBLA 4YGXB 1NONA 2GHIA 3W77A 1E4EA 5A2QA 5KC8A 5LDHA 3RK1A 5J59A 2HDWA 2P79A 1UQTA 3WLTA 4FI3F 3W5JA 5F2NA 3PE4A 2PLRA 1PJ3A 4FSDA 3TPZA 1PP4A 1YAJA 5EXEA 3A2KA 2HJ9A 4NQZA 1CCWA 4DIMA 4PVCA 4YJHB 1QHYA 4Y2YA 2WIBA 4F9EA 5K8IA 2JDIA 1NN1A 4MTCA 3I5AA 1PI3A 1JW9B 3OOWA 4IDPA 1RJ9A 5EE3A 4XOIA 1FPQA 3RFVA 3ZE8A 1H2BA 1Y4UA 3AP3A 5TB5A 2C8VA 1DQYA 2H4YA 1E1NA 3MC1A 4IJVA 4AF6A 1QFZA 3BMCB 5B1HA 3UH1A 1HURA 4M1TA 4LRYA 1GPAA 4MQ5A 4OMUA 4YMWA 5IH3A 1O87A 3QLTA 4IV8A 5AW4A 1LDYA 2AYYA 4IGAA 5BSHA 2HADA 5BSWA 1WUTA 2GEUA 1LPMA 2VYCA 5UKDA 1XF9A 2WJAA 1JMVA 1XA4A 3LW8A 3Q6NA 4BMNA 5HKLA 1SKBA 2VRNA 3FDIA 4XZ3A 1A9OA 4Y6OA 4DV4B 2A58A 4LWQA 3KDSE 1P2UA 5CM2Z 1W48A 1ID8A 1JNXX 3LX6A 1TO2E 3KV1A 3AI1A 3ANSA 1CY7A 3ELBA 4FDLA 4N7RA 4ETNA 3A4LA 5DP1A 1Y6ZA 4WERA 3UOAB 4G5QA 1JKJA 1ZFNA 4ZIRB 2QUHA 2WVGA 1ENZA 4NS4A 4AJ2A 2WWIA 2C31A 2QMEA 3RARA 1POXA 4WAUA 4QPDA 2AMYA 4R51A 3OLWA 4TLBA 2C07A 4MS4A 3FD8A 1K4MA 1W46A 3CLRD 2ZYVX 1TAGA 3DVAB 4HSGA 2GD0A 3GRVA 2OD7A 3JZFA 2YHIB 2OHIA 1GLNA 2QMOA 2VRCD 4RK5A 2BZ1A 1CERA 4O0MA 3AEUB 5K0EA 1U5BB 3BC1A 1EXDA 1ZGBA 2P9FA 3QLUA 1J2RA 3U60B 1ETHA 4URXR 4TXLA 2FR0A 2QSUA 3ZZ0A 5AHWA 1JSRA 1PFKA 2HSZA 1H8ED 1ULZA 1Z6AA 1KAEA 3MLBA 4LXQA 3V1YA 3VO2A 5I4CA 1EDBA 4UEKA 3ZE1B 4Z7JA 4CLDA 5CITA 4FCWA 4RA9A 3MN1A 3MT9A 1PQWA 2XMSA 3DDCA 1NBME 3K8QA 1IN6A 3VPHA 5K8CA 1WVGA 2VUTA 4YRTA 1ZNXA 2ON6A 5D1HA 3W04A 2DSNA 5H4HA 3GOQA 3AEKA 4NE9A 3T5MA 3CH4B 1I1OA 1YSCA 3JQGB 4C7OB 4UDYX 2W4MA 1P4HA 3K09C 1H6DA 1K9SA 3ZKWB 1Q11A 2CFSA 4EKNB 1UT6A 2O50A 2GXSA 4JLVA 4L8YA 3VR2D 1RPZA 3BRWA 2ZULA 4RAQA 2PUDA 2FSIA 3E8XA 4FGLA 4JL5A 4MRMB 5FEUA 1B42A 1GRCA 3WX0A 1E7WA 4GI1A 3SQMA 4R41A 4WINA 2HPVA 2N75A 5I3CA 1J42A 1QP7A 2J9FA 4M4SA 4L85A 1ZGZA 1WDLA 3T06B 5CA0F 2Q7XA 3DUWA 3K9WA 5G53C 1XLTA 2WAXA 4URVR 1OFVA 2YHSA 2P68A 3VVMA 4Q4JA 1OGJA 2UVPA 2VJMA 3KSMA 5CB4A 3NU1A 1XMQB 3OQMA 2Q6LA 3PXEA 1RYMA 5A5GA 3PPVA 1SB9A 3C7TA 1XEXA 3AU9A 2B6NA 1VP3A 1IB6A 2FDXA 2WSBA 5H16A 3ZHTA 1TQ4A 4B85A 3DE7X 3WIDA 1JVSA 4LF5B 3Q2IA 4O4JF 4MRNA 4X1IA 2IHTA 3I9OA 3AQ4A 1T8UA 4GVLA 2IXBA 3PCRB 2G70A 1Q0LA 2Y05A 2YIVX 3RTCA 1PT6A 2VP6A 5KSPA 2CXNA 3SNHA 4YWJA 1MA3A 2XNSA 3JVEA 4RFSA 3FWYA 2AC2A 4E14A 3RWOA 3TWOA 2DT8A 4B32A 1RQPA 2DUUA 5F5LA 5CB6A 1W47A 2R6R1 1JH8A 3MJRA 4M0DA 1GRQA 1PK9A 3E2IA 3V2HA 3ZCRA 5M04A 3U44A 4ARBA 5AK0A 3S2YA 2G5PA 2IYUA 4N82A 3C3CA 3ZGZA 3IP1A 4JR1A 1ZJ5A 5LD2B 2X76A 1JFFA 3ETGA 3FNEA 3T9AA 5ILOA 4E03A 2WYIA 4IQGA 1QP4A 1CG6A 4ER6A 2Z09A 4C0HA 3JVIA 2O2HA 2ENUA 3OPYA 4DA9A 1D8AA 4YTEA 5IKMA 1C0EA 2AOTB 2IZOA 3H1TA 2JFBA 1I4EB 4NH0A 1C81A 4F1JA 2QVGA 4JA2A 4ZI7F 4Z4GA 1DAIA 3DDZX 3QHQA 5JMTA 1W4RA 4JX8A 1RP7A 1JAHA 1QG2A 2JFHA 2IL1A 3HB7A 1G5RA 3W7VA 1Z3IX 4L95C 1Y3DE 4BVFA 1W85A 1A9PA 3E82A 1DMSA 1PL8A 1VKNA 4MRRA 4DC0A 2XMCA 1RM5A 3U16A 1A82A 1SCJA 3GD7A 3ZDQA 1Z12A 2F2TA 1G8GA 2CSXA 2QN7A 2NZXA 1HO3A 2XB8A 2VNAA 4LQCA 4ZJYA 2CMGA 3DSRA 1TVCA 5COBA 2O3QA 5EJIA 3RR2A 3HO1A 3KZCA 2ZR8A 3W3AH 1RKVA 1XRNA 4BNYA 3O1IC 4BYGA 4HEJA 5DMXA 1OX5A 1XDBA 2LTAA 3P27A 1AOXA 2QN3A 3P9ZA 1DKOA 4FXOA 2BMWA 1JE1A 2GX6A 4FFRA 5CVJA 1EUDA 3FFAA 3P9YA 4G0VA 1J8YF 4MITA 3VU9A 4OI4A 3SZUA 1OI2A 5MDHA 2GAJA 2QMHA 1DBIA 2HGSA 2PUTA 4ZCLA 4ZEMA 1ZH2A 2ZRNA 1GKIA 3JY6A 3NS7A 4QPPA 3TR6A 1V8DA 2I1WA 3SOPA 3E5RA 1OA1A 1WSAA 4QOHA 1KEUA 1Y5MA 2GRAA 2P4SA 4FBGA 5E6SB 5IC5A 1QIMA 1RVDA 2QUKA 1V11A 3QFRA 4K28A 2J08A 2G7MC