3ZS9A

S. cerevisiae get3-adp-alf4- complex with a cytosolic get2 fragment
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
348
structure length
293
Chain Sequence
VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords ATPASE GET3
publication title The Mechanism of Membrane-Associated Steps in Tail-Anchored Protein Insertion.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 108
structure length 293
sequence length 348
chains with identical sequence B
ec nomenclature ec 3.6.3.16: Arsenite-transporting ATPase.
pdb deposition date 2011-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3zs9A00
2JIZA 4F7WA 3UG6A 2BBSA 1QHNA 5IF9A 4B74A 3O47A 3ZZ0A 4DCSA 3QE0A 4TTQA 5K8LA 3X1WA 5AUNB 4M1TA 3AF1A 3ZS8A 2E87A 3RS4A 1G8PA 3GJ5A 5HCNA 3QEOA 3B1ZA 2CHGA 4MRSA 4PHFA 4NHOA 3PR1A 5DN6A 3K0AB 2RGBA 4XSHA 1HE1C 2EFDB 4MYHA 3AV0B 3ZQJA 4DCVA 3DM9B 3DEFA 5G41A 1BMFD 4OK6A 1GL6A 2D4HA 3UK6A 2D74A 3QG1A 3SYNA 3ZZUA 2FSFA 2JIZD 3KXIA 4Q00A 3LH5A 3VTKA 1VHTA 4DLTA 2V55B 1OXSC 1GKYA 2RCNA 1F6BA 3SI7A 3AB3A 2VP6A 1DO0A 4PPQA 4QKQA 5M04A 2GCOA 4DT1B 1GFIA 1E2DA 1JR3A 1EX7A 1ZCBA 3N70A 4BLRA 2WAXA 1ZYUA 2R8RA 1LFDB 1YR7A 5DN6D 2RB4A 5JFGA 3BB3A 2QE7D 4F92B 3W9YA 3BH7A 4TL8A 2F43B 1T4GA 2O8DA 2LKDA 2QROA 3R9WA 1DAMA 3IO5A 3Q8XB 4F91B 4HZUA 2WSSD 2ZSAA 2IYYA 2ZRFA 4LBYA 3W6OA 1D9ZA 2W2TA 4G5GA 3WYGA 3O8CA 2IYXA 1UKEA 1Z6YA 2NPFA 3F5FA 2IK8A 1ZINA 1NMZA 1JR3D 1CS4C 2A78A 5DYIA 2WJJA 3TGPA 2D62A 1E9FA 1EXMA 2YYZA 4IEIA 3SJBA 4MGIR 2L0XA 4XD7A 1NRJB 1JPNA 4X8OA 2Q0HA 2ASEA 4C7OA 1MH1A 4KFSA 4JKIA 3CX6A 5AK0A 2ZRAA 3GLHA 3KX2A 5BWMA 3IPXA 2J0SA 4F4JA 2ZRPA 1QG2A 3RWOA 3L8YA 4HAXA 4DKXA 3OFNA 4QHTA 3TRFA 2IUUA 1OLOA 4AI6A 1S3GA 2P5TB 1QBKC 4TQAA 4DZZA 4YONB 4C0QC 3T35A 3AF0A 2Q3MA 1XPOA 4CRWB 4LHVA 4HLQB 4I1UA 3R20A 2ZR0A 3V00A 1Z29A 4BLQA 2FZ4A 3RS2A 4XD7D 4D0GA 3AVTA 4X8MA 3GJ6A 2OLKA 1XDBA 2QT1A 5FBWB 5BN3A 2CE2X 4HAUA 4MA4A 4RD0A 1W44A 3QXSA 4DCUA 3LXXA 3ZJYA 3CRMA 1ZRHA 2NMVA 2PZGA 5JWHA 3SZRA 4FWTA 2VL7A 3OFND 3DMDA 4A6PA 4ZCMA 1Q44A 1TNDA 1KK3A 1OFIA 2O0HA 1Q21A 4GZMA 3TJZA 1DVRA 1UBFA 2A3RA 3CBQA 2VH5R 1IJFA 3A1UA 5KNBA 1YZKA 2GEVA 3CLVA 3PIRA 4ZI2A 4NCHA 1BO6A 1E1RA 1GSIA 4EFLA 5AJWA 2VHJA 3KFXA 4HB3A 3GJ7A 2VRWA 2D2FA 4ASUA 3U3OA 4E03A 1YR8A 1X86B 3KXKA 4MDFA 1UEIA 5BN4A 4C0AC 2AWNA 3EZ2A 1FUUA 3JVUA 4RY2A 1Z6GA 3ECCA 4DT1A 2D7DA 1SKYE 1W46A 4FN5A 4CZ2A 2JLYA 1UF9A 1OB2A 4HYYA 4TL7A 2RGGA 2IWRA 1COWD 2BKEA 1KK0A 1Q22A 3KJIA 1GNPA 2FFBA 1P9RA 2VHUA 4PZLA 1W4BA 4JJZA 3NDBB 2CHVA 4B3XA 4TL9A 4LSGA 5C1BA 5K8UA 1KI8A 3CRVA 1E1RD 2CXXA 1ZUHA 5TVKA 5DLQC 5JS7A 2X2EA 3C16C 1F2UB 2A5DA 3ZDQA 2FFQA 2ZI6A 5JS8A 4ASUD 2X77A 1E2MA 3GLFB 1XPUA 3VR3A 3IBGA 3EPHA 5EE0A 4R7ZA 1G21E 4BZQA 2J46A 4OQXA 1VMAA 4PPFA 1XXHE 3H0KA 5CITA 5LPNA 1F5NA 4G5QA 3IQXA 4B47A 3CWQA 1EFRA 1JEDA 2R62A 1ZD1A 2V8OA 4GOXA 2QAGC 4RD4A 4W7SA 3X1YA 4QJ3A 3T15A 4XVRA 5B64A 3DMNA 3IQWA 1ZC4A 2MSDB 1S9DA 2QBYB 4DVGA 1ZD9A 1F2TB 1RJ9B 2RGEA 4QRHA 3RVBA 3X1DA 1GOTA 2C2HA 3PUZA 2BIFA 3K9GA 1E9SA 1SGWA 2RGCA 1CBUA 1NKSA 1RIFA 2J59A 2EU8A 4DHEA 3B6EA 2IS6A 4V0LA 1KDOA 1Z0DA 2OCPA 2YJTD 3VR4A 3CR8A 5EQTA 4V03A 5AJZA 3A6PC 1Z22A 2PBRA 1YHNA 4JVNA 4RD2A 3S1AB 1A1VA 1L4YA 1QHIA 5GVSA 2BJWA 4B33A 4KJZA 3VU9B 3NG1A 4US2R 5TB5A 1B0UA 2C5LA 4NMMA 2LCFA 3QBVA 2ZRGA 2MMCA 1T3LA 1KHTA 1M74A 2ZUBA 3OEHA 2NO6A 2AKYA 2PT5A 3WBJA 1M7BA 2VIIA 3TQFA 1G18A 4QXAA 2ZRMA 1KOFA 1LNZA 3BWDD 1FZQA 2IL1A 4YQFA 4QGAA 3WYAA 4QM6A 4PQRA 4ILEA 2XTNA 4ZKEA 4M9XA 2OV2A 3RNLA 1MABA 2OEPA 3IIKA 4M1OA 5CIWA 3U7FB 2UZ3A 1E2HA 3VMFA 3A4NA 4EKDA 3O8RA 1NKTA 2Q6TA 1NIJA 2PZFA 2AXPA 1JALA 3ZZTA 5J47A 3ADCA 4URXR 2ERYA 2H5EA 1WXQA 1T9HA 1OSNA 3K0FA 1CEEA 5FPHA 4EFMA 5HZHA 5BYJA 4D6PA 2QPTA 2ZI7A 3OEHD 4KVGA 4EPYA 4JLJA 5JRZA 3B9PA 2PX0A 3REFA 4BZXA 1P9WA 2F1IA 2GJKA 1G6OA 2ZRIA 3UMRA 5F9FA 3THOA 3NH6A 3IBYA 3B60A 2NO1A 4LBVA 4MRNA 5B2ZA 1H8EA 5FBVB 5FUXA 2NG1A 4K8OA 1KAGA 1N6LA 2R6AA 1U94A 2QEQA 1FTSA 2GF9A 1XTJA 4D25A 3B1WA 1O87A 2QNRA 4QBIA 3H1TA 3Q72A 2V3CC 3KDSE 3D31A 3EG5A 2ORVA 2RH5A 1YU9A 2QTFA 3O8BA 3AGPA 4OQMA 4P32A 4U00A 3TK1A 2QN6A 2VSXA 3C7KA 4H9GA 4DSNA 2C77A 2OILA 3BH0A 5EXPA 4BFYA 5JWOA 2A9KA 4XVUA 1F2UA 4PZYA 3ZS9A 1VYUA 2P65A 2Q9BA 1R4AA 1FQKA 4UNPA 1FNNA 1D9XA 3QPWA 4LHWA 4OKSA 2VPPA 1F60A 3B2EA 3GLFA 3A4LA 3EIQA 3NEJA 3U3KA 1TU3A 1VG8A 3ZVLA 1KGDA 5HE9A 1H8ED 3K8YA 1KK2A 1E0KA 3K0CC 1NBME 3QKTA 2ZR9A 1DAEA 5KHOC 2WKPA 2WJIA 3K9NA 3SJCA 4DRZA 1RW4A 2X1VA 1DOAA 4DJTA 4I4LA 4QHSA 1DAIA 1N5IA 5FL7A 1X1SA 4ZIRB 1AKEA 5FPSA 2I4IA 5KDOA 2QAJA 1F2TA 1P2VA 3SQXA 1G3QA 3TR5A 3TAHA 4GDFA 1XTQA 1EK0A 2CLDX 1AS3A 1I4TD 4IEEA 1T6NA 2QA5A 5EUQB 5EUMA 2IEZA 4TMZA 1PVOA 2QSZA 4MYTA 1R0XA 2CCJA 1XMVA 3NKVA 3R7WB 3S1AA 4X8HA 1FQJA 4B73A 3FHTA 1EESA 4OJQA 1Z6XA 2RGAA 5DGXA 4IXNA 3NBZC 4QBHA 3IIMA 5ELXA 4LHYA 4LV5B 4F4IA 2ZJ8A 4W5JA 1JJ7A 3E2IA 4XIGS 2ZVQX 1U0JA 1T3SA 2YVUA 3HYRA 4WW0A 3QUSA 2PT7A 1SXJE 3TIFA 2FFHA 1VHLA 2HXSA 1U81A 4B3DA 5FPKA 4DSUA 4JT4A 2DFLA 1W7AA 4Y0AA 5FOSA 1N6NA 2Z4SA 3HDTA 3WRYC 2BKUA 4M9QA 3F8TA 2QENA 4QM7A 3KKPA 1M1YE 3VKGA 1JQLB 1MR3F 1WP9A 2JEOA 4HAWA 4ZDIA 2XX3A 2CCKA 1NF3A 4JBXA 4Q4LA 3OEEA 1U9IC 4DEYA 1W4CA 1QDEA 4TTPA 3QXHA 3QVVA 1WA5A 3L0SA 2WJGA 4XWOA 5FTJA 1N0VC 3VNUA 1Z6TA 3LY5A 4NU0A 3DPUA 4KVAA 3B82A 2Z4RA 4JZKA 1T3HA 4PQFA 2HDNB 4Z54A 1R10A 3B5JA 5L3QB 1GITA 2FNAA 3EIHA 4IDQA 4O0MA 3GJ0A 1CJVC 1G3IA 1L4UA 1XX6A 3CX7A 1BOFA 4NL4H 4XSGA 5A0FA 4KBFA 1CLUA 3BE4A 4TYPA 1ZM3A 3GLIB 4PAQA 3LVRE 4AG5A 2XGJA 5L3VA 1Z2CA 4X8LA 1ZIPA 2GHIA 2ORIA 3GD7A 1W47A 2F1HA 1SVMA 2G0NA 3D3QA 1W2HA 1E2GA 2VHTA 4CYMA 3GFPA 3IILA 3OEED 3M6AA 3U4QA 2AXNA 1W2GA 2N46A 4XWAA 4NYMQ 2ODWA 4ERNA 1NP6A 1GWNA 2ZSEA 3LXRA 3RC8A 1OIVA 4HZIA 4PC6A 1UAAA 1OXTA 1P5ZB 3ETLA 3QG5A 1TUEA 4LYHA 4R71A 2XZLA 2BDTA 2IW3A 5JCPA 1IN8A 5IRCD 2OT3B 4MUAA 2AX4A 3DL0A 4OYHA 4HI0E 4IOLA 2C96A 2AD1A 4TSFD 4Q01A 3C5CA 2FGKA 1YE8A 3A1VA 2G3YA 1KI3A 2YOGA 2QMEA 2W00A 5E4FA 2RMKA 4MGKR 1BH2A 3FTQA 1XEFA 1XTIA 2CVFA 3I5XA 2CL6X 1SVKA 2H57A 1U2RA 1OH8A 2ZJ5A 3AKEA 4P4TA 4ZIRA 1WCV1 4TTRA 2YKGA 1P2TA 1IY0A 1U8AA 1YR9A 2QGNA 3MCAA 5FI1B 5L8VA 5EE1A 3N5CA 1UKYA 1KI4A 2WV9A 5JRJA 3TUIC 2R6CA 3A8TA 2FV8A 3B1XA 5FTNA 1OH5A 1Q1BA 1IXSB 4BEJA 4RCYA 3HPQA 1RFLA 1I4LD 3ZVRA 4ACAA 3BRWD 1KI2A 3R7WA 4DXAA 3TSWA 2GWHA 3MGCA 2QZ4A 4KO8A 4A6XA 2Q21A 2BBWA 5DNYB 2AWOA 4NCIA 5FI0B 4FMBB 4MRVA 1LVGA 3B9QA 4O2RA 4WXRA 3OESA 5KOYA 4OK3A 1W1WA 1D6JA 2XSZA 1DELA 3I32A 3X2SA 3T34A 1CKEA 4IHQA 4QNMA 3Q85A 3BBPA 4NBSA 1JXOA 3RAPR 2IXGA 3BORA 4NZYA 2J7PA 2SHKA 5FH9A 2GF0A 3BFXA 4ZV4A 2PL3A 3HYTA 4OHWA 1HT1E 2X8AA 5FOUA 4PTLA 2OG2A 2WZQA 3Q5DA 4MITA 3HWSA 4GP7A 1XD8A 1GRQA 3LDAA 1ZNZA 1R0YA 2GKSA 2DR3A 1N0UA 1VYTA 4PC2A 4QC2A 4AYTA 2B92A 1K6MA 4R2IA 1XB2A 4A8JC 3K09A 3LQRA 4OHZA 3TNFA 3ND9A 2ODEA 1YR6A 2ZJBA 3V9PA 4LGMA 1K5GA 1AIPA 2Q3HA 5L3QA 1OHHA 3FE2A 2XSZD 3NDPA 5TV2A 3NHBA 1N25A 4NONA 1VIAA 1OH7A 1XMIA 2C04A 1VDZA 2DHRA 4AG6A 3TSZA 4V0NA 4KU4A 1ZVQA 3GLIA 2HEIA 2J7PD 4DSTA 4GBMA 1EWRA 4Q1FA 4RKEA 5A5GA 4Q9JA 2W2XA 3AUYA 3AVPA 2ZYTX 2GCOB 3U61B 1DAHA 2V7QA 4GOKA 1LS1A 1A2BA 4PANA 3VFDA 1DAGA 2C98A 2IA5A 4C0HA 1ZNWA 1TQ4A 2CVHA 2FDCA 1FP6A 4JIMA 1X8KA 4KSBA 4EPXA 1P3JA 1OHHD 2F6RA 3EZ7A 3TR0A 2O8DB 3REGA 1TADA 3EPLA 2JAQA 5J4YA 3G82C 4HZUB 1VECA 4BPBA 1CF4A 4URYR 2A5GA 3K9LA 1C9KA 3KL4A 2ZI5A 2C9YA 1X6VA 2OM2A 2DWQA 2XNDD 3LX8A 4RD3A 3SYLA 5KNDA 4GZLA 1NMYA 1QF9A 2YWHA 2ZI9A 4ZKDA 4TN1A 4PQYA 4Q1BA 3CWZA 1AKYA 1J2JA 3ZD6A 2W6JA 1JBKA 2WWWA 1RKBA 2WJYA 1TQ6A 2P6NA 5C4MA 2P6UA 1W48A 1UBCA 1CTQA 4DCNA 4FWIB 3L0PA 4LJ6A 3T1VA 3SNHA 2GVZC 5SZJA 2JA1A 3AH8A 3CUEF 4YMTA 1MO5A 2YNMA 2BJVA 3AVUA 1G291 1M8PA 3KZ1E 4BFZA 4ITRC 2F9LA 2RGNC 3W5IA 5JECA 1R2QA 3NBYC 1OFTA 1P73A 4IW3B 1X8LA 3SFZA 3QKRA 3VKWA 2VEDA 4L9SA 4HDQB 4A9AA 1YZLA 4M22A 3AVXA 2GZAA 3PENA 1S9HA 5K8TA 2R6DA 3CPHA 4C0SA 2GCPA 1Z3IX 2W6JD 4IDHA 2JASA 1SULA 2J5XA 4CF7A 5JEEA 2ZE7A 1E9CA 1V5WA 2O5VA 3TQCA 3OIYA 4US1R 4Q66C 3LA6A 4PO1A 4ZDWA 2MSCB 2ODBA 2MSEB 3BB1A 1RYFA 4GFDA 2O0KA 2ANCA 3IGFA 3TBKA 4M1WA 4Q03A 1OXXK 5B57C 4G5OA 2GXUA 1TF2A 4Q02A 2OZEA 4B75A 3EWSA 1T5LA 2FPMA 5E7JA 5HTKA 5J40A 2XAUA 3OE7A 4OQNA 5UKDA 1AQYA 5FBLB 3N2IA 1G5TA 1JR3E 1W4AA 4TMXA 1AQUA 3THXA 1G8HA 2B21A 2ECKA 2HJVA 4KAXA 4B2LA 4URUR 1KO1A 1WE2A 2DB3A 2YV5A 3CPEA 2IYSA 3HJNA 2GA8A 2REOA 2VYFA 3GLGA 4TYYA 5EZ6B 5BXQC 3UANA 3VR6A 1N6KA 3AUXA 1AS0A 2VO1A 1D2EA 1IN7A 1AZSC 2QSYA 3LO5A 3P4YA 4LYJA 721PA 4HLUC 2BM0A 2GBLC 2FPKA 2PCLA 2W83A 2ZSDA 5J4LA 1P2SA 3OZXA 2ZRHA 5F98A 3N2EA 3OE7D 1S96A 4DLWA 4QG7A 4JLPA 3OAAA 3WP1B 1S1MA 2J0UA 2J87A 2YOFA 3O8DA 3ZIAA 4L8GA 4B6FA 4PXAA 4PHGA 1YJ5A 4HB4A 2ZAOA 3NBFA 4B76A 4CEJA 3VHXA 3MFYA 3ZD7A 2C95A 4LJ5A 4JBYA 3WNDA 1OXUA 1N5KA 3GLHE 1TPZA 1KMHA 2V9PA 4O25A 1HY3A 1NVVQ 2V54A 2OAQ1 5JSZB 3FOZA 2E9SA 3I92A 3VHLB 2JLWA 3K53A 4IJMA 4LV8B 2N42A 2J7KA 2KWIA 4YDHB 2F7SA 3RDPA 3RWMB 1S1CA 2ZROA 3KJHA 2O8FB 1NLYA 3TUZC 2V1UA 2BWJA 4MRPA 4B35A 2O52A 5C46F 3ZIAD 3CX8A 4G0NA 4HSEA 3TSOA 5CLLA 3UXMA 5C18A 5GJCA 1Q20A 4U02A 1TEXA 4Q4HB 1OPXA 2ZJZA 5FTLA 3ADDA 3GFOA 1D5CA 1VCOA 4NCNA 4WA7A 4OQLA 1ONBA 4PR0A 4B2PA 3NIBA 3MMPA 2IYZA 3WRXC 2WKRA 2JLUA 2C78A 3UMFA 3HPRA 5TY0A 5LD2C 1IN6A 1HUQA 3TH5A 3FHCB 1GVNB 1XEXB 2AD5A 1S8FA 2ZXUA 1FW6A 1XTKA 3LX5A 2DCUA 3CZQA 1NVXQ 2WIAA 4QOSA 1JB1A 1KK1A 4EJSC 3T1QA 4D82A 3U5ZB 2BHRA 2P6RA 2ZSFA 4JLDA 1KNXA 3HU3A 4C30A 1OE0A 1DE0A 1ZCAA 2VSFA 2ZPTX 1ZM2A 3EPJA 1TQDA 4CEIB 4RCZA 3T61A 3LVQE 3VR5A 3QENA 1QHSA 1E94E 1AGPA 1MABB 4NE2A 3U3RA 4H1UA 1W36B 3FKSA 3PUWA 1J7KA 1G5RA 2XOKA 4S35A 3W8NA 4K46A 2DPXA 3W3AA 1R8SA 5AWFC 1E9BA 1TAGA 4PPGA 5E7MA 3K0FB 4URZR 2RKOA 4QHYA 1E69A 4A4DA 4DWJA 2TMKA 1CRPA 3FPAA 4U5XA 4E5UA 5EP4A 3KFVA 3GEEA 4GP6A 4E09A 1U98A 2AL7A 3EXAA 1NN1A 2FSGA 3RYTC 4Y0VA 1OH6A 2R6GA 1XFAA 3LLMA 2WAYA 1GZSA 2VQSA 2ZI3A 1OT3A 2WWGA 1R6BX 3PCRB 4LI0A 1Z47A 3GEHA 4DLSA 2PLRA 1O3YA 5AR1A 4BGDA 4JLVA 2ZRJA 4UKDA 4DCTA 1N3BA 4A2QA 2BMDA 2JLRA 2QP4A 3FKSD 3P26A 2XOKD 4LJ9A 2ZTSA 4TLDA 3RANA 3I72A 2QPAA 3L43A 4GL2A 1E2QA 1YZGA 3LWNA 2ZE8A 2WKQA 3TMKA 4MYCA 3W3ZB 2QM7A 2GZHA 4A0FA 2XITA 1GKUB 1II0A 2DFKB 2G1JA 5KNCA 2HYDA 4WIAA 1KAOA 1GNQA 1NL3A 2GNOA 2HYIC 4BLSA 2ZJ2A 3SJZA 5JSZA 5EE5B 1NY6A 4JL8A 2G9NA 4DDTA 3RS0A 1UM8A 3SEAA 5CM9C 1CJTC 4JL6A 3WY9A 1KO4A 2O8FA 4RD6A 2Z5FA 2PCJA 1P6XA 1Q3HA 3KB1A 4HB0A 1GAJA 2NPIA 3L0IB 1G16A 3MSXA 4C3ZA 1X8JA 4QL3A 3AVWA 2GJ8A 1G3MA 4A2WA 1Z0JA 4Q4HA 1CP2A 4G5SA 3I61A 1BIFA 1G3RA 3EX7C 2BC9A 4AK9A 3NEYA 1T8UA 5L3RA 1TUIA 521PA 4Q7LA 3AKDA 4KFRA 3D8BA 4LOAA 2OBMA 4Q1AA 1E4YA 1GP2A 4HUQB 1NMXA 1OIXA 3CH4B 1MT0A 2OFXA 1ZM7A 4JYCA 1OYWA 4DLRA 4EPVA 5B30A 1Y63A 1VG1A 2C03A 3MG9A 3ICQB 2D06A 3QEJA 1KI7A 1XEXA 3L0OA 1AJEA 1XWIA 1EFRD 2GAAA 2WWXA 3QSYA 1BYUA 2VTKA 3C14C 1TEVA 3U7GA 3GMTA 2KBEA 4AKEA 4DDUA 1E98A 4V0KA 1E9AA 3WXMA 2JLZA 4C0JA 1M7HA 1XJQA 2IX3A 4TMTA 2JDIA 1Z63A 4CEIA 5F3WB 1T0JB 1G64A 1XU4A 1XNJA 1ZC3A 2QTHA 3BIFA 2V6IA 4IFEA 4DC9A 5FTMA 4IDOA 3K0CA 4JJKA 4DUGA 1VTKA 2WVJA 4NYJQ 4QGGA 2G1KA 1WBDA 3VX4A 1KDTA 4QNRA 3I5YA 5CLQA 2IC5A 1H8HA 2WPDA 4AYWA 1WMSA 3EARA 2WMNB 1ZP6A 3HR8A 1SVLA 1UADA 1F3OA 2PH1A 4NYMR 1EGAA 2PJZA 621PA 4Q4AB 3JVVA 2PMDA 1EFTA 1R8QA 2J1LA 3KQKA 1E96A 1HQCA 4UNQA 4RJLA 2OO7A 3LFUA 4N0EA 2DYKA 2HXYA 2WWHA 1CJKC 2YZ2A 4ZPXA 1NVWQ 4HLCA 2IYQA 4MUBA 1IXRC 3PXGA 5CDFA 2ZU0C 1JAIA 1E32A 1T91A 3GLFE 3V4RA 2JDID 3WP0A 3GPLA 1WB9A 3QY0A 3AGQA 4R9UC 4IDNA 5DYGA 4DUGD 2J3EA 4LK2A 2KB0A 4LCBA 5L3SB 1W36D 1JJVA 3CB4A 5KPDA 1DPFA 1DS6A 2K5UA 3U4QB 1P7CA 3HU1A 2JJ8A 1H8HD 1I2MA 2H18A 2WIBA 2WPDD 1M2OB 2YWGA 3PEUA 2FZLA 3KKQA 5BW8A 2RHDA 1KI1A 3PQCA 2OFWA 2GXAA 2YWFA 2J45A 2W58A 2IS4A 5J5CA 5JJLA 3W34A 4LC0A 3W5JA 2NO7A 2FX3A 1FTNA 4WZBE 1ZUIA 4FMDF 1N0WA 2GEUA 2XEXA 5JBQA 4OBEA 5HPYB 1U9IA 1MRNA 1NSTA 5KDLA 2QG6A 2NOAA 4A8JB 3M0EA 3QBTA 3HP1A 1SVOA 1FPMA 1KSFX 1CU1A 4EPWA 1E99A 2QY9A 2J41A 1K5DA 5LB4A 3ADKA 2IT1A 3AF3A 3CH5A 2QMOA 1UDWA 2ZRBA 4ZCIA 3WBKA 4C0KA 3THYB 2ZYUX 3GP8A 2JLSA 2GK6A 3W90A 1J8YF 3GJ8A 3FVQA 4HUQA 3MAAC 3ADBA 3FHOA 3UATA 2QPOA 4EUNA 2ZIAA 3GJ3A 4RZ2A 2V4ZA 4M0LA 2ZI4A 3PITA 1G7RA 2ANBA 2ZRDA 3ICEA 4UXHA 1RPZA 1JI0A 2GAOA 1T0HB 2EFHB 4OHVA 5G3ZA 1CULC 4M21A 2OXRA 1SHZA 5GJVC 3LNCA 3C8UA 1IN4A 1Z07A 4NKRA 2QT0A 1IJEA 3KJGA 5FL7D 1S2MA 4BEBA 1ZM4A 2EWWA 4Q19A 1ZIOA 1ESMA 1QHYA 4BLPA 4LHXA 1KSGA 2H1LA 1CR2A 1TQ2A 4KLZA 4YMWA 4BFUA 4YMVA 1FMJA 1YRBA 2HT6A 4TL6A 2WWYA 5DH9A 2O8BB 2EVWX 1NSFA 1FOEB 3AEZA 1A7JA 1AK2A 1M7GA 1XCMA 2OCBA 1E2JA 4M4SA 4POAA 4BRWA 4A92A 4FMDB 1D8TA 1L7VC 2AK3A 3KKOA 3LQQA 4IRUB 1JPJA 3ZGXA 2CLSA 1GTVA 3BH6A 2F9MA 3D7MA 4Q4AA 4AURA 2GJSA 1KO8A 2PJRA 4Q21A 4L5BA 4TT3A 5EP1A 1LV7A 3B8HA 2IXFA 1IN5A 5SZIA 4QGHA 1D2MA 4TQUS 5FOXA 3ASYA 4Z1MA 421PA 5JMTA 4A15A 1PLJA 1VIYA 2Z43A 5KUTA 1GKIA 2VF8A 4BFTA 3CW2A 1KSJA 3ASZA 2GCNA 2IYRA 4LPKA 4M8NE 4ZO4A 4C4PA 2OUKA 4F38A 2YINC 3G0HA 3L82B 4EAQA 2RHMA 1R5OA 1IY2A 221PA 3C41J 3W8RA 2A5JA 5L3SA 1X3SA 1G7CA 3P32A 1NLFA 2ZANA 4XTCS 4JS0A 5D3QA 3OF5A 2QMHA 1Q1EA 3NVAA 5TARA 5FR1A 4EDHA 2JLVA 3BK7A 1OFUX 1Q3TA 2I3BA 2QGZA 4LJ7A 4V02A 4TT3D 4A36A 2FU5C 4Q18A 4QFMA 3U60B 4Z1MD 5JI2E 3AP2A 2VP4A 4JLOA 4M9ZA 1M34E 4M9SA 4GT1A 2KJQA 2R2AA 1SVIA 1RRFA 4B44A 2FF7A 3DOFA 4D4JA 4A8JA 1DADA 1CJUC 1FMLA 1JECA 5HE8A 2ZRLA 1QRAA 4E07A 2FWRA 1G17A 1JAHA 4BWYA 6Q21A 2Q9CA 2VP5A 1V43A 1N6RA 4UQOA 1HQYE 4IKEA 5KSOA 1WDTA 5DE3A 1UFQA 2WM9B 4HATA 2R9VA 5DI3B 2QQ0A 3PJRA 1CR1A 1JQJC 1R7RA 1ZBDA 2CEAA 3THYA 1N2CE 2A5YB 2UVQA 1WQ1R 2F1RA 2WICA 4EQ6B 1KY3A 3CM0A 8OHMA 3R9IA 3F3YA 5FOTA 1OB5A 3QJYA 3QKRB 1CJMA 5FUVA 1E2IA 2YOHA 4LHZA 1NN5A 2QM8A 4IOMA 4C2UA 4C0LA 2JLXA 2BBTA 4BLOA 1E4VA 4W5WA 1I4DD 4TQ9A 4FXPA 1SXJC 4DBLC 3EPKA 1J70A 3A1TA 3ND8A 5KTYA 5KYKA 4A82A 3MD0A 1YZQA 5FR2A 3QXCA 3H4MA 3QXXA 3WMGA 1UBEA 1RZ3A 2DFNA 3GJXC 4UXIA 1SKQA 1XCPA 3GLIE 1KJWA 3B85A 3FFBA 2QP9X 4PSAA 2O8BA 2B7CA 3NHAA 2V1XA 5EXXA 2CNWA 4PAMA 4HAZA 1YKSA 4JL5A 2JJ2A 3LBNA 5EP3A 2D3WA 1PJRA 2J0VA 1IXZA 1MO4A 1M6NA 5FBRB 3THXB 4V0MA 1ZM9A 4IXMA 1PLKA 1NG1A 1P72A 2CCGA 4RZUA 2G77B 1S3SA 2O8EB 4KV9A 4B3FX 2ZUDA 3NBXX 821PA 5CB6A 1NNEA 3GLGB 3UWOA 3BERA 4HDCA 2CL7X 2AR7A 1OF1A 1SZPA 1XJCA 1NY5A 2FH5B 1W0KA 1KNQA 2RGNA 4BUJA 4Q5IA 5FUYA 3VKHA 4JLKA 3AVYA 4TLBA 2CNWD 5HCIA 2NQ2C 1GIAA 1Z8FA 3QI2A 2ZRCA 4YDSA 4XWKA 3PEYA 3MJRA 5DO9A 2J0UB 1BYIA 2QQEA 2N1BA 3E5HA 2B7BA 2NTYC 1J99A 3CF6R 3F0TA 3X1XA 2HLDA 5G40A 3K70C 4CEJB 1EG7A 2GZDA 1YZUA 2IYUA 4GRAA 3CRW1 5CIQA 2RAPA 1KZ7B 3BAFA 4XTRA 1A82A 2BEJA 2HJGA 3PG5A 5DHFA 5GJWC 3RHFA 3SJAA 1KMHB 1NJGA 3MWKA 4TLCA 1W0KD 4LJYA 3WHLA 4B3CA 1WRBA 1XP8A 2QP3A 2GEDA 3BB4A 3QXJA 4Q47A 4V0OA 4PC1A 3AVOA 4AYXA 3RC3A 1MV5A 3U2QA 3I62A 3P27A 2EYUA 4QJ5A 2V7QD 3SHWA 1XBTA 2GETA 3CIOA 3U6BA 2AKAB 5AJVB 5FTKA 2EFGA 3H84A 4A0GA 2BCGY 1G5PA 2IHBA 2IYWA 2V6JA 5BN5A 4M1SA 4TLEA 2ZE6A 1EFUA 4ZDJA 3B78A 5FOVA 4RZ3A 2C8VA 2QORA 2HLDD 2NGRA 2FFAA 4FCTA 4AWXA 1QVRA 5DI3A 5H68A 3BJIC 3IHWA 1N6PA 1XZPA 3MLEA 4C2TA 3AQ4A 5TMPA 2F3RA 4II7A 1P61B 4HLUA 4D4KA 3PEWA 1UJ2A 3ZYCA 3K0SA 4EQ6A 3AVQA 4DLUA 4CT4B 2JJ1A 4AKIA 4LPSA 1KDPA 2KI5A 4D81A 4DLYA 5ANRB 4MKGA 4Q9KA 3JZMA 4D2IA 3FDIA 1Z6AA 4PFSA 4FINA 3AF2A 2F55A 3K09C 3CZPA 1LF0A 3M4YA 2VHQA 3D6TB 1FX0B 1S4QA 2VBCA 2ZUCA 3OIWA 1DG1G 3RS7A 5EJEA 4UJ3A 2HT1A 2VA8A 3DKVA 5HZKA 3CF2A 3GLGE 2PEYA 2RGXA 5D3MB 4BFXA 4GMXA 4NYIQ 1XTSA 2P2LA 1TU4A 3KTAA 3FWYA 2GDJA 4A0RA 2ZRKA 1G8GA 3SYKA 5AUPB 3BGWA 1E79A 4LBZA 1QG4A 4JBWA 1UKZA 3R8CA 3WYFA 4ZDKA 4L9WA 4F4CA 4EFNA 1VCNA 1GUAA 2QUZA 3BFVA 3VR1A 1DO2A 2QAGB 3BS4A 1ZU5A 4MGYR 1PUIA 5GADl 3SS8A 1QHHA 2DBYA 3U44B 1ZU4A 1BMFA 3BXZA 1H65A 4W5HA 3EIEA 4PPNA 1XZQA 2O8EA 1NJFA 3FMOB 4B3GA 2FGJA 1PLLA 4CT5A 2B6HA 4AIIA 3BD9A 2R6FA 1Q0UA 4NPHA 3WNCA 2WSMA 3CKLA 4OL0A 1UEJA 2C9OA 1SVSA 2OHFA 1E79D 4RD1A 4TYWA 4GSYA 1HA3A 4G1UC 2QE7A 1W49A 1P2UA 4Q4JB 4ARZB 1U0LA 4O3MA 3EWAA 4EJSA 2BM1A 3T1OA 5FUWA 1FL9A 4I1SA 4LJ8A 4PZZA 2WSSA 4O2LA 1LTQA 4PSVA 2YHSA 2H17A 3NC1C 1IQPA 1AA9A 4TWZA 2MMGA 1N6OA 4FD2A 1TF7A 4YC7A 3TVDA 3SN6A 4B6EA 1NI3A 1DTSA 3FGNA 4DB2A 2ZVPX 5JJKA 4AKGA 2I1VB 2OLJA 2XB2A 3KQNA 1KTVA 1TMKA 1Z0AA 1KKLA 1ZNYA 1ZUNB 1TTTA 3CNOA 3OAAD 1OJLA 1KDRA 3B1VA 1YZNA 4MQBA 1SHKA 5G3YA 2EFCB 1KO5A 2EFEB 3MWLA 2XTZA 1BS1A 3CR7A 2QTVB 4NTZA 1XD9A 2FPLA 2ZITA 4ON9A 1EFCA 1IHUA 3RRYA 1GDDA 1AGRA 3PEVA 4JSTA 4RKFA 2DWOA 4OI0A 5KPJA 4GOJA 2CJWB 1SKYB 1HEIA 4M53A 3ZH9B 4LYAA 3HU2A 3IKJA 4I1VA 4NYJR 1ZNXA 2P0EA 1OV4A 4LYFA 4AKHA 1XF9A 4Z8YA 3RSLA 4RVCA 2J9RA 5KU1A 2EWVA 1OFHA 4WZAE 2EW1A 5C4GB 5IK2A 1LB1B 2A30A 4KI0A 4TYQA 4N0DA 3AKCA 3RRNA 4BZPA 4JVMA 1FX0A 1N6IA 4M1KA 4KSCA 2OBLA 3UG7A 4AC9A 5H1YA 2JCSA 3RS3A 2EQBA 2GJAA 5CM8B 1ETUA 1W5SA 5D3MA 4ZCLA 3ZVMA 1E6CA 1SQ5A 3P1JA 3RRMA 1G8FA 3SE0A 4BRUA 4GMDA 3KQHA 1C4OA 1P75A 5EP2A 1RYHA 1XXHB 1UDXA 3CNNA 4NH0A 4OQFA 4A0HA 5EE3A 2WWIA 3GCGA 3LBIA 4DEXA 1WF3A 1GL9B 2Q9AA 1RE0A 1HE8B 5K8IA 4LRWA 2PZEA 2PLFA 4C9BA 2IWHA 2QAGA 2ZREA 3U44A 1IBRA 2BMEA 3SQWA 3OIVA 1LS6A 1XMJA 2P5SA 4ACBA 4OK5A 2ODNA 2WOOA 3QF7A 5IK2D 3DM5A 2YC2C 4DLZA 3GJ4A 3FMFA 2UKDA 3I8XA 2H92A 3K1JA 1L8QA 1KYIA 3LV8A 2A2ZA 3AM1A 2G6BA 2C9CA 4Q1EA 3B7GA 3MWYW 3VX3A 4B43A 4ESVA 1DARA 4HB2A 1COWA 2IYVA 2XNSA 3K0AA 5TXGA 3RLFA 2AN9A 1VCMA 2W0MA 2VP2A 4Q4JA 1E2FA 4ARZA 1J90A 2CDNA 2OCYC 1KIMA 2BBOA 1CXZA 2ZYWX 2B8TA 2BV3A 3B1YA 2IXEA 3I1FA 2REXB 2D7CA 1U8ZA 1Z06A 4CVNA 2NIPA 1VG9B 2FSIA 1GM5A 1E2EA 2G83A 3X1ZA 1A4RA 3NTUA 5HR5A 4AY2A 4G01B 3T06B 1XCGB 2WJVA 3CRRA 5CYPA 3DDCA 3T5GA 2NO9A 1XRJA 1PV4A 1PZNA 2ATVA 1E3MA 4FMCF 4IFBA 3RRZA 1P4SA 4PC7A 2OBNA 1G9XA 4JKYA 3CRQA 4WAUA 3SU8A 1PUJA 2JGNA 4JLBA 4PHTA 3KQLA 3LD9A 1HV8A 4D4MA 3RS5A 2F43A 1VG0B 3NXSA 1Z2AA 2ZE5A 1R5BA 3K9HA 4M1MA 4P3YA 4MKFA 3Q7PA 4A2PA 4P4UA 4DIDA 1ZD8A 3EZ6A 3E1SA 2X19A 4D0LB 2Y8EA 5JHHB 1ZAKA 1E9EA 1NVUQ 2CJWA 2XJ9A 3RABA 2Q3FA 4FIDA 2OSBA 2CK3A 3EZFA 2ZS9A 4BFSA 1DEKA 1T8TA 2F1JA 1HTWA 3I73A 2GILA 4Q7MB 2LKCA 1C1YA 4P33A 4YMSA 2R65A 4TLAA 1VPLA 2VP0A 1YQTA 3HR7A 2WJHA 1G7SA 1NLZA 3U6KA 1II8B 3KXLA 3UMSA 1NG9A 1A2KC 4HAVA 1TL7C 4TZ0A 2QI9C 2FN4A 2XJ4A 1HT2E 1G6HA 4PHHA 1AN0A 4YLGA 4CIDA 2ZAMA 4QBFA 1U90A 3EASA 3A37A 2FE4A 4RZXA 1ANKA 1XXHA 5CDFE 5SZHB 3CNLA 4DB4A 2IUTA 4EPTA 1E1QA 2YC4C 2EYQA 2VP9A 1FNMA 2CK3D 4NCKA 1Z28A 4WXPA 3DO6A 4FMCB 3CO5A 3QVUA 4HDOB 2F3TA 5IDVA 1II9A 5G53C 2IF2A 3DVLA 5SZKB 4FCWA 1Z08A 2O0JA 4HUTA 1B23P 3AP3A 3C4JA 4G5RA 4US0R 2ZETA 4KHZA 1GL7A 1ELOA 4B32A 4Q9IA 1W0JA 2CMKA 2QRZA 1G1MA 3KQUA 1CR4A 3G5UA 3CF0A 5IT5A 3OIUA 5JWRA 1DAKA 1E2KA 1MO3A 2FMXA 2KSQA 5AUQA 3THWB 2AFHE 2WMOB 1IM2A 1E1QD 1FFHA 4CEHB 3TVTA 2BEKA 3LW7A 3PV0A 4RFVA 1GRNA 4XJXA 3MJHA 1F48A 2IEYA 1SXJB 4LUCA 4DIEA 4URVR 4UXJA 1G3UA 3BOSA 1YZTA 1DG3A 2E1RA 1CRQA 2HCBA 4JVSB 5CJ2A 1AS2A 2ZS7A 3Q7QA 4HEJA 5DISB 5P21A 1QHXA 2BOVA 2D2EA 3A36A 3NH9A 3R8FA 1W0JD 3FB4A 4J0QA 4KCGA 2XTMA 4L16A 3UKDA 1UPTA 3QIAA 4JLNA 1IAQA 2P67A 1XD2B 2B8WA 3UIEA 1KI6B 1R0WA 2HF8A 3QPVA 3U7HB 3TW4A 1Z0FA 2FG5A 4LDJA 4B2IA 3EA0A 5GVRA 1KO7A 1KMQA 4P31A 2GXSA 4DSOA 1YVDA 4OI4A 4ABYA 5F9HA 2HCJB 2ZSBA 2CLCX 4EPRA 1MO6A 4IVRA 1N5LA 1OW3B 3FMIA 3OHMA 3IO3A 3H86A 1KI9A 2KBFA 5B58C 3L2OB 2AHOA 4Q1DA 3TW8B 2IUSA 2IS2A 4YMUA 2O8CB 4IDPA 1I2DA 4JMPA 4ZI3A 1BKDR 4S2EA 4LJAA 4BFVA 2KE5A 3FYHA 5DI9A 3GQBA 1RRGA 1GNRA 3PUVA 3GEIA 1HURA 5A4JA 1DAFA 2P3SA 4URWR 4CGZA 2AK2A 1E2PA 1W36C 3PUYA 1Z0IA 3AKYA 3SOPA 4DDWA 4Z8XA 3PVSA 2UZIR 3FKQA 4BQSA 4U7DA 3SC3A 2ATXA 1II8A 2QBYA 3K70B 4P4SB 1RJ9A 1Y3AA 4E22A 4XVQA 3M1IA 3SHFA 3MUFA 4QJ4A 2IYLD 4LBWA 4JLAA 2ZJYA 4LJ4A 3WMFA 1JR6A 2GVDC 3ZVNA 1IOZA 2H7VA 3JZAA 5FOWA 1MKYA 3QNUA 4JYBA 4ESHA 1TX4B 4IOKA 1RC8A 2HV8A 3BFKA 4XH9B 3FMPB 1XJ0A 3VU9A 1NBMA 4QBGB 5CK4A 3W6PA 2ZJAA 3T5DA 5CJPA 1E0JA 2I1QA 3EAQA 4TMWA 2ERXA 5LBIA 4KODA 4MGZR 4XOIA 4WZ6A 5BQ5A 1XEWY 4A1FA 5JI3E 3TE6A 5E7IA 1OIWA 5FBQB 3TKLA 1Q57A 4PAOA 5F2EA 4D4LA 1ZJ6A 3KKMA 2XZOA 3C15C 5H8WA 5LDDC 1E2LA 2CE7A 1RRCA 3SBDA 4LV6A 4KBGA 2PMKA 1NN3A 2JLQA 3FFAA 3U3JA 1XPRA 3THWA 4JVLA 5KSPA 4MKHA 1GG2A 1US8B 1OKKA 1G4UR 4CEHA 1NBMD 1AZTA 4UJ5A 3SR0A 3A1WA 1QZXA 1JNYA 3E70C 5EXSA 3IEVA 4LC1A 4LZZA 2ZYVX 4R98A 3DHWC 1U8YA 5E3HA 2G0TA 3P20A 1SXJA 1Q1QA 4UNRA 5JLJA 2OXCA 3EC1A 3J81k 5FFMA 3LAWA 1P9NA 4BECA 3A58B 2ZM5A 5JHGB 4LX0A 2QU8A 4GPTA 5KSZA 1MOZA 1JEEA 5IHPA 1J8MF 4TSFA 4FW9A 5FPYA 4HLDA 1XD2A 4N3NA 3V4FA 1OYYA 2WHXA 1KI6A 3TUJC 4Q1CA 5J4KA 3LBHA 1N5JA 3K0EA 1OKKD 3SBEA 1ESNA 3QPUA 2Z0MA 4B48A 3DZ8A 5KDDA 1U0HC 4CW7A 3A1SA 4I1OA 1ODFA 1YRAA 1XEWX 1SXJD 1Z83A 4MRRA 2WOJA 1VKJA 2IHYA 3MRSA 2DWPA 2XXAB 4KLNA 4OHXA 4IVQA 3ZLJA 1Q12A 1D2NA 1KSHA 4KFTA 2ONJA 2VHCA 2O8CA 3AVVA 4NYIR 3MWJA 3QF4B 2GRJA 1G20E 2FEOA 2DFTA 2FSHA 3W6NA 1DBSA 4FI3C 1P60A 1N6HA 2GESA 2RGDA 2FA9A 4H1VA 1XMSA 2CL0X 2JATA 1K8RA 3CONA 3IPYA 4BASA 4C0BA 2OESA 1E0SA 2VF7A 4Q7JB 1E9DA 1U99A 4LWZA 1P62B 4P4SA 4K81B 4W9MC 5EZ5A 1RRPA 4V0ME 4GNKA 1IY1A 2GK7A 2WTUA 4F93B 3QKSB 3KJEA 1FUKA 3T12A 3AP1A 3KKNA 3LLUA 1MRSA 4KYIB 5J4VA 3B13B 4MH0R 4M2LA 5DIFA 5JZVA 2PEZA 2BMJA 4TZ6A 3U7EB 3WNBA 2FJUA 3RSOA 3KTAB 3I8SA 2J0QA 5C2JB 1XTRA 4RFSB 4N1AA 2OE2A 4MYUA 3A4MA 1NIPA 1T5IA 3CPJB 1HH4A 1KKMA 3LRPA 4YXWA 2NZ8A 1E2NA 3WMEA 2BMFA 2R44A 2ZJOA 4PC3A 2IBMA 4QGFA 2NZJA 2X2FA 3IIJA 2HUPA 4PO9A 4TMVA 1QHHB 3UWKA 2CBZA 3DKPA 4P0TA 5GJBA 5HKKA 2Z6VA 4B34A 1VCIA 3K70D 1EWQA 3QQ5A 3PFIA 1FP7A 4HAYA 3EZ9A 1Q1ZA 3VQTA 2REBA 4PO8A 4OHYA 4BE7B 2QL6A 1WBBA 1LF5A 3EW9A 4TMKA 4CDGA 4UNSA 1NVVR 1R0ZA 3I4LA 2ZS8A 1CR0A 2GXQA 4IOJA 3VAAA 4KITB 2IS1A 3UPUA 3IUYA 5CYOA 1G8YA 1US8A 5LD2B 4FCVA 2DY1A 4BFWA 3ONWA 2WBLC 4JSYA 4WOPA 3DZDA 4D0NA 5JEDA 1UKVY 1R5NA 4PSKA 3EA5A 2JJ2D 2A5FA 3U3MA 4YXWD 2AFIE 4TYNA 2OCAA 4KYUA 3KB2A 3C5HA 3P4XA 2ZQ5A 1OXVA 2QMUA 4EJSB 2QRNA 5HKKD 3TAUA 5J4HA 1VYVA 3DOEA 3PUXA 4OI1A 1GRRA 4Z51A 5FL3A 4DLVA 1KJZA 3KUDA 4Q9HA 4Q7KA 4D80A 1S0UA 1Z5ZA 2XNDA 4LY6A 2BCJQ 3IDQA 3QKUA 5E95A 4MDEA 1A5TA 2FEMA 2XZPA 2ZEJA 1IONA 5JJIA 4IVPA 5CB8A 4NP6A 1E9RA 4KXFB 1LY1A 3NWJA 2C99A 4UNNA 4OJKA 5KO2A 1G19A 4NCJA 3Q9LA 4G3XA 1CIPA 3TLXA 3VNVA 1LW7A 1UBGA 1G4AE 3ZQ6A 2VLIA 3LW8A 3GFTA 1QVAA 3H2YA 2IYTA 3EC2A 1KZGB 4I99A 5KSYA 2XXAA 1KY2A 3IEUA 5EE9A 2GTPA 1EFHA 2ZRNA 5DHAA 1W4RA 1JXMA 1G7TA 2ZU6A 1X1RA 4KFUA 3BC1A 2H16A 5AJYA 4L15A 2W2VA 4JT2A 3QF4A 2GBLA 3I3SR 3QOFA 4M1YA 3SFVA 1AM4D 3L8ZA 4BLTA 4L4UA 4WBSA 5H70A 2CHQA 4B71A 1G41A 5FPTA 1RVDA 5BYKA 4NDZA 4OI2A 4MKIA 2W6IA 2LWIA 3Q5EA 3NC0C 2YWEA 3T1TA 2OAP1 1E0AA 5LB2A 1GILA 3IHLA 1HYQA 1ZMXA 3WHKA 5TDHA 2FOLA 2PX3A 1W5TA 4C7OB 4B3BA 4RSGA 1Z0KA 1QHGA 2HF9A 4R2HA 5DSZA 4WVFA 1NN0A 3GLHB 3Q3JB 3QKSA 4Q9LA 5AJXA 1L2TA 121PA 3KUCA 5JCZA 2A7QA 2Z83A 1ZW6A 1KJYA 2NO0A 3SDZA 4Q48A 2XB4A 5AUOB 2H8KA 4DDVA 1TF5A 2VSOA 2JJ1D 4RFSA 2ORWA 4DLXA 4JLMA 2BVNA 2G88A 4PX9A 3VR2A 2W6ID 2GJ9A 4AD8A 3R9XA 4I81A 5EXTA 2ONKA 4D26A 2IF0A 4EIWA 5CK5A 4GI7A 3AF4A 2ZR7A 2WWFA 2OFOA 1EX6A 1SVWA 2W0SA
chains in the Genus database with same CATH superfamily
3LFHA 3W3AH 5JYBA 5BR4A 2R47A 4F7WA 3UG6A 5GP1A 4TSRA 2BBSA 3SEFA 3HCOA 1T8YA 5K8LA 1ZN7A 4JQYA 4OB6A 1U0BB 2GX6A 3X1WA 1CZKA 5I7RA 1PT9A 4CKEB 4IIJA 5JAOA 4CF5A 3F98A 1Y9JA 1LFAA 1G8PA 1XMXA 2PH3A 2NTJA 3ETNA 3CTPA 2HJRA 3QEOA 3A6LA 1QRDA 3SY8A 5I48A 1EXVA 3LT1A 1HF3A 2IKQA 1NZDA 3K0AB 4ROTA 2CKMA 4LWOA 4EO9A 1JAZA 2EFDB 1IL0A 1QWOA 3T41A 4GUAA 4RKWA 1UBOS 3V4VB 2OXIA 4QVKA 4WLUA 1PR3A 1T2CA 4F72A 3VBCA 4ZI7B 1BMFD 5JZMA 4DMMA 2X1MA 3HGTA 3AEUA 4WXEA 1QO7A 3UFXB 5IVPA 2D4HA 3IUNA 3SF8B 1CDOA 3QG1A 5D00A 3G5AA 5GMOA 4YBZA 4JYPA 3SYNA 3TS1A 5ADVA 5KVAA 2JIZD 4CF6A 4WI1A 2UYCA 2GCGA 5JOQA 5FJJA 2P6MA 5EJGA 1U7WA 1OXSC 1WY5A 1YIOA 5ICCA 1IQUA 3NIFB 2BEVB 5A7HA 3TJMA 2GO7A 1H0RA 2C2MA 4R1SA 4G09A 4QKQA 1AMUA 2TSYB 2OWEA 5DM1A 3EDYA 3AY7A 1E2DA 4DT1B 4ZMRA 2W42A 1XRSB 1ZCBA 3R0JA 3ZE7A 1QK4A 2YHIA 4KHPB 2WAXA 1ZYUA 4IMRA 2R8RA 4IHJF 2IV2X 1XR3A 2JK1A 5DN6D 3HA7A 2XKAA 4N7JA 4RORA 1NVKA 2Y4OA 3BB3A 3V7FA 1C9JA 2IIPA 2OORA 2QE7D 1Z2NX 3RSZA 4PYJA 2FRDA 4HTFA 4X45A 5FYQA 4XRGA 1XMQB 3AV3A 2F43B 5E6SB 7AT1A 2VPYA 2QROA 2FVXA 3R9WA 2VJBA 3IO5A 3Q8XB 3IRUA 2PWYA 5IARA 1SUBA 3KP1A 5KYUB 5WRFA 1DIRA 1KRHA 1MEJA 4IIXA 1JSRA 4DANA 2BHLA 2IYYA 1LBTA 3WYGA 2WPNA 1ZQ1A 1QE0A 3I8OA 2IYXA 4Y9RA 4W5NA 5C8YA 1I3NA 1UKEA 1YCDA 1X1DA 4ZJPA 3PYMA 2IK8A 4I6GA 3L02A 1ZH8A 2O3UA 1QO9A 2WJJA 5A06A 3Q7SA 3FSEA 2WJ4A 4EJFA 1EXMA 6AT1A 4RHUA 1CV2A 1J5PA 1QE5A 3QP9A 1T5OA 1NRJB 4J4HA 4JDUA 3VPDA 3VSBA 2Q0HA 4QPJC 4C7OA 5B6JA 1MH1A 3NOVA 3OZSA 1RXWA 1NVDA 5AVUA 1KS2A 3K94A 1LPNA 2JGDA 2A1TS 3FOWA 4MULA 1B42A 2WR8A 1J0BA 5BWMA 2CVOA 1DDOA 3IPXA 4AJPA 4CXMA 4MQ4A 1NVGA 1I7NA 4GPZA 3X1JA 4HAXA 3W2HA 5DYNA 3LOPA 4FT2A 2IUUA 1PDWA 1S3GA 1XVTA 3NM4A 1Z4IA 2L18A 2P5TB 3EVAA 1T2EA 5DTIA 3T35A 3TCXB 2Q3MA 1XPOA 3IT1A 2QD2A 3OFSA 2DKOA 3OMWA 2CXSA 1WW2A 2EDAA 3R20A 4YHBA 3V8BA 1Z29A 3UAZA 1Z2DA 2D1SA 1OILA 1SN7A 3D81A 1B41A 2VQ3A 3PYXA 4R2JA 4D0GA 5KYTA 5EGSA 5AW1A 1XDBA 5DNAA 3CN9A 4ZYXA 1R3DA 2CE2X 3DOJA 4HAUA 2ZCVA 1T9BA 5GZ3A 1YDEA 1QOPB 1L7XA 3QVGB 1NVAA 1X80B 1XZGA 4BQEA 1JLRA 4DCUA 1FLVA 2JBWA 5EZSA 1ZRHA 4D9CA 1ECJA 2FW8A 3C39A 3LRTA 5BQXA 5KB3A 4CKEA 4A3SA 3GAZA 5JWHA 1RC1A 2FK8A 3SZRA 1M1ZA 1KVRA 3V4SA 3FROA 3OFND 4BYMA 4F45A 4OB7A 4ZCMA 3M6IA 5AVZA 1Z7WA 5FV4A 4R6WA 1N2IA 3R24A 5D3KA 1Q21A 1HE5A 4GZMA 5CB4F 5BXYA 1DVRA 1UBFA 2A3RA 3AETA 2VH5R 3CBQA 3RU3A 3A1UA 3UC5A 4YTEA 1SC4A 5AICA 3AY0A 3W78A 4EMTA 1Y6ZA 2GEVA 5KNBA 1ZHHA 1H6BA 4U2DA 1S8OA 3R6WA 3TW6A 4ZI2A 1J9GA 4XJSA 1GSIA 3CVOA 4V0SA 4EFLA 4ZI7A 4AAYA 1VBMA 5AW3A 2VHJA 4HB3A 1BDHA 4MW0A 3GUHA 3SF8A 3CQ9A 1K8XB 2D2FA 4M8KA 2W22A 5ERXA 3TPFA 4ASUA 3C3CA 1ZDMA 2C3YA 1YZFA 3EBPA 4XUGB 3OPXA 5EKTA 3RYIB 2H1OA 3M9LA 1QZZA 5FBKA 1NPDA 1P7PA 4XCQA 1K5HA 2AWNA 2BEVA 5ALDA 4C0AC 3PI6A 5DB4A 5BYAA 1Z6GA 4DT1A 3DUFB 5E9WA 4FN5A 3D5TA 7REQB 3WKCA 1UF9A 4K9OA 4H1TA 1YR3A 4TL7A 1P9OA 2DAPA 4A26A 4EABA 5JNVA 3R3HA 1COWD 2BKEA 1KK0A 1Q22A 1SBTA 4AQDA 2BGUA 1GNPA 3JD2A 2Z8ZA 5JAIA 1W4BA 3ZWOA 2PBFA 4LZWA 2VDVE 2QTAA 3VNAA 2HDHA 3CRVA 4JSRA 2GYYA 5AKKA 4CCYB 1YBMA 2YJ4A 1G5IA 3K6JA 4OXNA 5TVKA 3ZGVA 3C16C 2DECA 2O2JA 5ALLA 3NETA 5C32A 3QNMA 2FFQA 3T7DA 5J5VA 5KYUA 5CBPB 1TYBE 1I6WA 2DHDA 4H60A 1XPUA 4ZALA 3FYTA 3EPHA 2Q4TA 3AUTA 3RKUA 1P5FA 1XXLA 1G21E 2AJTA 2J46A 1N2JA 4JB8A 1R8YA 1UQRA 2HMYB 1RYEA 3H0KA 1F5NA 2P9YA 2PL5A 4G5QA 1OVGA 1PR6A 1R8XA 4L02A 3WZ2A 2MU1A 4BV3A 1ZD1A 1GY8A 4HFNA 3OURA 2C88A 4ZD6A 3RC2A 3D7LA 3MUEA 2PM8A 3DMNA 1UJ5A 3LQKA 4CM5A 1V9CA 1S9DA 4PN3A 4CUZA 4FOPA 1TTTA 3IVCA 5FTWA 1GOTA 3PUZA 3X1DA 3K9GA 5CFZA 1E9SA 2QYSA 3SX2A 1TO2E 4WZBB 4P5PA 2J59A 1Q6ZA 4H1WA 1KDOA 1Z0DA 3VR4A 4EKIA 4LTMA 1GR1A 1SOVA 3VR3D 3QX8A 3IE2A 4V03A 5AJZA 2UUBB 2PBRA 2P75A 5MN6A 2H8GA 1UAYA 2CUTA 3RUDA 5GVSA 1DTWB 3L49A 1YDHA 5K0GA 4FDMA 3V1MA 3IR7A 1ZMRA 2ZYRA 3FRIA 2LCFA 2F64A 3HB4X 4PLPA 1SXHA 3ROQA 5BPHA 1AKTA 3QOYA 4N5IX 4I7EA 3VYRB 1DPGA 2XNHA 2VCEA 2ZUBA 3EXG1 2NO6A 2QY6A 1R00A 2DBVO 3FOCA 4RXTA 3TQFA 3VC7A 4QXAA 1KYQA 3BKWA 1DHRA 3O7WA 4I36A 1E92A 4YGXB 3GZTB 1LNZA 2VUIB 3LPMA 3MJSA 1HSZA 1NNSA 2IL1A 2P27A 1ZMTA 2VYCA 2R66A 3H2HA 1X80A 3OX3A 3QVGA 3KR0A 1RHRA 3ZBPA 5IWAB 1O0BA 4LG1A 3GAAA 1ONNA 1R66A 3K9WA 4RWZA 1Y1TA 1BC5A 3BIJA 3IP7A 4ND1A 3NOXA 3VSDA 3U7FB 4P38A 1NXWA 2E1PA 2UUPA 3KLPX 3ZWVA 4EKDA 3ZE0B 3O8RA 1NKTA 2OV4A 1NIJA 2Q6TA 3NFYA 4N6NA 1D09A 3OU2A 4R5MA 6CHYA 4OU5A 3X2FA 3P9CA 2H1IA 2H5EA 1OSNA 1M8GA 3HG7A 4KR3A 1B6GA 5I4KA 5BYJA 1O8BA 2QPTA 1JF8A 2BY4A 1ISMA 3PFBA 2JRCA 1S8AA 3C7AA 5BR7A 1EVLA 2YL2A 3N0RA 3M89A 2PX0A 1AG9A 1DCMA 2O7RA 4RL4A 4L8WB 3RYIA 3T9CA 1L4GA 3LCUA 3T5MA 5A4IS 2FUG6 2VZ0A 2ZRIA 3KLOA 4HQOA 3THOA 2O54A 5AVXA 4OH1A 1GU0A 2NO1A 3B60A 4LBVA 2DY0A 1L8AA 2LIVA 3DUFA 7REQA 2ZSKA 2F3PA 2R6AA 2PKYX 4JI1B 5IS2A 1E5QA 1H3EA 1XTJA 3D2CA 3UAOA 3ESCA 4L74A 3O9ZA 3CNBA 3H1TA 5JXGA 3GJYA 4B6RA 3TVYA 3RTGA 4HDMB 4UUPA 4ZRDA 3AGPA 4UBKA 4P32A 4E3ZA 5B37A 3C7KA 2VSXA 3D6JA 2IU0A 4CCYA 5KIAA 3BH0A 1GA6A 3KRTA 3LIIA 3A6GA 4PE5B 4D3FA 1VYUA 4DDMA 5CBPA 2UZAA 3D64A 4V0QA 2V7GA 1D9XA 3QPWA 5E9JA 1F60A 3B2EA 2DVMA 3B52X 4BPRA 3IR5A 2Z30A 5I7UA 2IEIA 1XVLA 1HDYA 2IOHA 3PNQA 3R3YA 1WZCA 1YMUA 1VG8A 3U3KA 4D99A 3ZVLA 3DTVA 5HE9A 4HD8A 1H8ED 4O02B 3IEVA 4F6LA 1M76A 1Z4OA 4EENA 2JGIA 1QP4A 4MI6A 7ADHA 2WKPA 2WJIA 5DLYA 3SJCA 4DRZA 2J9XB 1YKGA 3CA8A 4BO6A 3SM3A 3QEKA 3HA2A 2DX7A 3PPXA 4QDTA 5FB3A 3PTAA 2LVBA 2W2LA 4ZIRB 1AKEA 5KDOA 1P2VA 3LT0A 3MJFA 2VHVA 4JOSA 5K6AC 3GPCA 4R1UA 1WY7A 4XR9A 3TAHA 1RVV1 2FR8A 4P80A 4WZBA 4NZZA 5JH7A 2CLDX 1M34B 2HI0A 4RO0A 4XYBA 5G2OA 1B3RA 1XTBA 3WGJA 3M82A 1EXDA 1IB6A 2QSZA 1PVOA 1R0XA 4R0MA 2CCJA 1XMVA 4GEGA 1CW2B 1SJ9A 4RTSA 1C9NA 4DR6B 3QW4B 3C8HA 4NECA 2ZT6A 2FN9A 2BUCA 1EGHA 5DGXA 2QTZA 4IXNA 4L50A 5KS2A 1H6DA 3NATA 4NJEB 4F4IA 1RXUA 3CBGA 1KXJA 4ZXPA 1JJ7A 4DR1B 4H35A 4ENVA 4PV7A 3R7FA 3HYRA 3V42A 1ZUD1 3NR2A 2VRBA 4N18A 2PX4A 2X7HA 2GHTA 2FKAA 2PT7A 3TIFA 1ZCZA 4LA4A 5DWVA 1BMDA 5FPKA 3WKEA 3PHIA 1YGPA 1U11A 1W7AA 4HGOA 4Y0AA 1O54A 1N2CB 3ZJVA 3IC5A 1N6NA 4S1VA 4TXNA 1OC2A 2GD0A 3FZGA 3JD4A 3OZIA 5LXTA 2R1ZA 4M9QA 3F8TA 2QENA 3VO1A 3KKPA 3UBTA 4YRBA 4MIOA 3DB2A 3KD3A 3SAJA 5C5CA 1ISIA 2XX3A 1TVKB 2B4TO 2DCMA 2CXUA 2JB9A 5AKHA 1Z0ZA 3IMGA 4CFZA 2HO4A 2NAPA 4L4SA 1U9IC 2GBPA 4B4KA 3N0TA 1XNRB 3DLTA 4OLJA 3O82A 1QPGA 3NQ41 4UVIA 2GD6A 1Z6TA 2WHRA 3LY5A 5U9CA 2Q6LA 4GGPA 3B82A 5ED0A 2GNAA 4NE9A 3ZYZA 1T3HA 1X14A 4Z54A 1E4EA 1GAEO 2G07A 1HLFA 3S7ZA 2J31A 3EIHA 4IDQA 3H1GA 5K1ZA 1POWA 2I78A 3DGFC 4LJKA 3U3MA 1QQAA 3QYPA 1QO0A 2DU8A 1GKKA 3N7AA 1NRXA 1ZM3A 3VZPA 1EUYA 1LQ2A 1U4OA 3OPVA 1MU0A 2PAFA 4ENTA 3ZBUA 3L0CA 4UDOA 3DL7A 3R41A 4QQRA 1HLGA 1STOA 5L45A 3H8JA 3F73A 4JYAB 2X8JB 3K8ZA 3V48A 3PFFA 4WXYB 4RTNA 3LC1O 1E2GA 5CNKA 1Y5MA 3C85A 3ZWKA 4EY8A 3EWNA 1A8IA 1ECLA 2VUSA 4RU1A 5MHTA 1KORA 1E6WA 4MO2A 5JQGB 2OY0A 4NYMQ 5MFPA 2PQMA 1PTJC 4BKUA 1NP6A 2RHWA 3O2QB 3LY7A 2A9QA 1KY4A 1DCFA 3KOYA 1UXJA 5L7TA 3G49A 1OIVA 2DQKA 4YMGA 2V98A 4NAVA 1Z6ZA 3MCZA 1P5ZB 4QUDA 2G1AA 4S1TA 4ZOCA 3KR1A 1L7AA 2FQQA 1WSAA 3JQ9C 2IQ5A 4LC9A 3CO0S 2XUHA 3NB0A 4MDHA 3SXPA 1GO2A 2OT3B 3H16A 4LOLA 1CUYA 4CPDA 4OY3A 2AX4A 3RTDA 3BRWA 4OYHA 5AXBA 2HOQA 3E5MA 3BQMB 1NXQA 3HLTA 4IOLA 4KQEA 4MVXA 3DW3X 2AD1A 2DBQA 3S29A 2FGKA 4JELA 1JQAA 3IEPA 2HMTA 2QMEA 2W00A 4MLPA 4YV7A 2Z09A 1ODKA 1B2RA 1YJXA 5I45A 1V1JA 1DBPA 1XZAA 3FTQA 4M1QA 2LRHA 5EJ2A 1ZVMA 4RHCA 3L79A 3ZU2A 3BN3A 3O8LA 4ZVOA 2FWPA 2B8JA 4EGAA 4ZIRA 3K1YA 1WCV1 1FQWA 2YKGA 1P2TA 5FQNA 2NV2B 4DG9A 3MCAA 1V26A 5MGBA 1F8FA 1M34A 4KPUB 3TUIC 3B7WA 5FTNA 3ZWBA 2VDMB 4DWWA 4BEJA 5C80A 1RFLA 2PQ2A 3UHAA 4XWYA 4ACAA 2AG0A 2XT9A 4DXAA 2COUA 3KPUA 3JYQA 1I9GA 2PS1A 5BSUA 1GG9A 4G5HA 3TBHA 3KR9A 5DNYB 1AF7A 2O7VA 1N33B 4NJEA 1O77A 5BSGA 4YRLA 3VISA 1U4NA 2HIAA 3OESA 4O2RA 2F62A 1W1WA 1ZXLA 3IBSA 4OK3A 1RACA 1D6JA 2IHZA 3ZCSA 3PRKE 1P1KA 2G9RA 1YA6A 3T34A 1CQXA 2YZMA 3OZAA 1I80A 2OTCA 3NVKI 5KQRA 1YNOA 4I4NA 3C6YA 2WT4A 4HUJA 3BBPA 4NBSA 4V24A 4FK8A 1SBYA 1N2CA 1UJCA 2QX8A 3GF4A 2KMLA 4W6ZA 2YBDA 4KK3A 3TIVA 1S2NA 2PL3A 1J7JA 1HT1E 3ILHA 3T3DA 2WZQA 1TVKA 4MITA 5DZSA 2BONA 5T7BA 3FPBA 1RPTA 1EZ1A 1ZNZA 5SYNA 4D9FA 4I9FA 5H02A 2DR3A 4LY9A 4AMGA 4KGVA 2WABA 2JGAA 3CN7A 4QC2A 1EWTA 2B92A 2WE7A 5CVJA 1JT2A 4R2IA 5ESXA 4C2BA 3JWEA 3DF7A 4OHZA 3ND9A 3DB1A 4UPVA 1EIWA 3V9PA 2I6SA 4LGMA 1K5GA 1KH3A 2Q3HA 5TV2A 3A9WA 3NHBA 3LQFA 1F7UA 3TNLA 2HN9A 3GRFA 1ZK3A 4UZFA 1FTQA 4QDZA 1XMIA 4K6KA 3I1JA 4QG3A 1LPMA 1N1DA 2WU8A 4YFVA 3TSZA 4BY9E 4MWTA 1ORVA 5EZYF 2GNPA 1VP3A 2J7PD 5FO0A 3K15A 2H4YA 3HCBA 4DSTA 4POOA 1HZJA 2ADOA 4MUIA 4UTNA 2OGTA 1EWRA 2CJXA 1P74A 2X8JA 3IFSA 5A5GA 2AZTA 4I55F 4W82A 3AUYA 4M0KA 4Q05A 4EKNB 2PFSA 4U7JA 4IJKA 4EFKA 4GPD1 5IXSA 4KH1A 4DG8A 2RIPA 4N3CA 4RPCA 3VFDA 3FFXA 2B82A 2PFKA 4EI9A 5JQGA 4YQZA 2C58A 2HPHA 3FCXA 3OLCX 3OM0A 4WCVA 3VI4B 3C3MA 4WPGA 5C34B 1FFXA 4DF3A 4IIUA 3VHXB 1WXHA 1OHHD 2A88A 3KZNA 4BNNA 2PT6A 1UMDB 1TADA 4S0XA 4BNUA 2PMBA 5J4YA 4NU8X 3LG2A 1T6BY 2NU8A 4L75A 2MYTA 3G82C 4BPBA 2A5GA 3LUKA 3JX9A 4R41A 3R2JA 1QNFA 3O8NA 2DWQA 4R83A 1PNRA 3SYLA 2JD0A 3HNRA 4YP0A 4GZLA 3O1JC 1E6LA 4RDXA 3IBTA 4RGQA 3U4IA 5TQJA 5COBA 3PZBA 1WNFA 1YI8A 2WU1A 3BZBA 4G1BA 4Q1BA 5F9MA 3ZD6A 2R7KA 4RXUA 1RLMA 1PJ8A 3DAOA 4BMCA 4HFJA 2DWUA 4B40A 4CMBA 1JS1X 1W48A 1KERA 2A3NA 1EQAA 1UBCA 2NQ8A 4PLTA 2G17A 4OM8A 4RW0A 4HVCA 5AVWA 3DO5A 2HDOA 1U2DC 3HCPA 3T1VA 3IJ5A 4ADSG 1WIWA 5CAEB 4ED9A 3D6NB 3CUEF 3KQMA 4M9CA 5E3IA 1IMOA 2QIPA 1UJNA 3N8GA 4KPUA 2BJVA 4NPCA 3KAKA 4BP9A 3HWWA 1L4HA 4O3FA 1MW9X 2VAPA 4RY8A 2IHTA 1Q7RA 2D00A 4IEFB 4NQRA 4JHLA 4BFZA 1JJAA 5JTTA 3ZI7A 3KT3A 2Y68A 4WUVA 5LJIA 5CT5A 4RXMA 4IW3B 3ANNA 2ZLBA 1PSWA 3HP7A 3HJCA 3LKZA 3QKRA 3F6PA 5KNDD 3LHDA 5LNK6 1YZLA 4M22A 3AVXA 3N2YA 3ZXIA 2ZVJA 3PENA 3AW8A 5FUMA 4IDHA 1U3CA 2JASA 4Z0PA 4C4XA 2ZE7A 3W2IA 4IUDS 4R1QA 3ELYA 1NQ5A 1WM1A 5IT0A 1B4DA 4PO1A 2H1FA 3LHKA 1IPFA 4KIWA 2R60A 2MSEB 3BB1A 3UNXA 1FY2A 1RYFA 1AHIA 1WTCA 2BD0A 1G5HA 3LIPA 4GVLA 3HDHA 4JX8A 1WQ3A 5FLEX 5HFNA 3WL6A 2JZCA 4M1WA 5H83A 3FUUA 5SICE 4Q03A 1OXXK 3ZLVA 1RBZA 1L5YA 1TF2A 4NK4A 4B75A 1IOLA 1A8UA 3EWSA 1T5LA 2VWQA 2WFZA 3JV7A 5E7JA 4BFLA 2XAUA 1Q92A 3OE7A 2RG1A 5FBLB 5DNVA 1ZH6A 4R8LA 3G0GA 3BMNB 1KTIA 3THXA 3BIXA 4PYNA 3QQPA 4YROA 3WLKX 4B2LA 4EARA 4RTPA 4URUR 1U5AA 4BFCA 1OAKA 4KGDA 4NAUA 5AQ1A 4KIGA 5CD9A 2SICE 3I5UA 4U63A 5IKPA 2YV5A 5AVVA 4F2GA 2VYFA 4PBRA 1SBIA 2HQSA 3UANA 2OR3A 5ESDA 3UYLA 3OI7A 1N6KA 2ZJ7A 4FE4A 3M3DA 4MKRA 2WYHA 2X86A 4W8OA 4LJLA 2QSYA 3VH3A 3F90A 4LYJA 4P82A 3ZHRA 3NTXA 3DMHA 5KNCH 1P1RA 3GT3A 2PCLA 3M6MD 5HRCA 4DXDA 1AK9A 2FPGA 3GAFA 1I2BA 1C9MA 3FGZA 2PIDA 5A4KA 2GMWA 1D4AA 2N0SA 1NE2A 4QG7A 4ETNA 3KYIB 5EHIA 1Y8ZA 3WP1B 1V0JA 3WSWA 2RJOA 1XCBA 3AI3A 2YOFA 4RHEA 4PXAA 2VJOA 3G23A 4PHGA 1O0SA 1QJCA 1D7AA 4NF2A 4X85A 1AXEA 4DR4B 4B76A 3VHXA 4NARA 2VH1A 1Z4LA 1Y81A 1B93A 3EBOA 3R0VA 4N7BA 3ZD7A 4L5IA 3A2LA 3KWJA 4LSMA 1E59A 3T4UA 1N5KA 1RFGE 1WLYA 1TPZA 3B6ZA 3HUDA 2OOKA 1QGOA 1NAHA 5AVOA 4BNKA 5ITVA 2HWXA 1EBUA 2XLBA 3ESXA 4U2FA 3T9AA 3A7DA 3E9QA 5B1SA 4TWAA 3R5JA 5AI9A 2F3UA 2E9SA 2KW5A 5JPIA 5ITWA 2YMLA 3K53A 3P2YA 3QV1A 5KAPA 4F5DA 1SIOA 4PIMA 2JLWA 3KEGA 1QC5B 2KWIA 2FX5A 2W4QA 4IFIA 1QZ3A 4MLCA 1HL3A 4O63O 3RWMB 1PR4A 4ZCSA 4F2HA 5JNTA 2I22A 2V1UA 4IILA 3NMUF 2O8FB 1W52X 2HBYA 2QV0A 5LDGA 1KVTA 4FT4A 4MRPA 4WESB 3D2BA 4BUCA 2DM6A 2Z9BA 3MRXA 3CZRA 5EHNA 3OOYA 4G0NA 3JQ8A 5ICFA 4D0RA 1PT5A 5CLLA 1AA6A 5GJCA 3ABRB 1TEXA 5CAEA 1F4VA 1ZR2A 3K2IA 3DE6X 4BQIA 1UM9B 4OQLA 2FHPA 4KQXA 1GTL1 1ONPA 3KSDO 4C07A 4PR0A 4R54A 4B2PA 2C4WA 3MMPA 1P4RA 4Q39A 3I3OA 2WKRA 1Z6PA 4WUTA 2C78A 1ONSA 2J08A 3T7JA 5TY0A 2KLBA 2J3HA 3G89A 1IN6A 1YGYA 4HP8A 1G66A 4KH0A 2R6JA 3O9MA 4JT9A 3PXCX 1HUQA 2P4SA 2PTHA 3A70A 3FHCB 3LHSA 4J07A 3TH5A 2AJ8A 3WX0A 1XEXB 4F5EA 4LNUB 4PRZA 2AD5A 3NIGB 4INAA 4W5QA 1NVXQ 3EPRA 4L6AA 5F1YA 4EGFA 3STUA 5EIXA 3FPFA 1QNLA 1UZAA 1E58A 5EQFA 3T1QA 2E18A 2PLNA 2BHRA 2AIRA 1USWA 2YQ4A 3FBTA 4G0OA 4GLOA 5AD1A 4JLDA 3TFWA 4R6XA 4D0SA 4IO0A 3IOBA 3KEQA 1DE0A 4RSHA 4HNAA 1EG2A 1IEVA 1IPHA 1RWKA 1W4LA 2ZPTX 2VJCA 3OFJA 4CEIB 4RCZA 1CZLA 3VR5A 1U1GA 3QENA 3SVZA 1QHSA 3LI2A 4DNPA 4HZGA 2H07A 5I7EA 5K3EA 2JEZA 3HZRA 3OECA 4NE2A 1GTRA 4UPDA 4H1UA 1W36B 3FKSA 1MIOB 4DSZA 2HHHB 1NW7A 3F96A 5CVVA 1KE2A 1UFKA 2H31A 2Q6VA 2J67A 4YRTA 1UDAA 1WMFA 2DPXA 3HE3A 3DGEC 3W3AA 4HQNA 1QRTA 4QRIA 4TV8B 4QXMA 3ZX4A 2RKOA 4F5YA 5BR8B 4DWJA 5KTPA 3BDAA 5DTEA 1MZPA 3I1YA 3PKZA 3O9VA 3KFVA 4NFYA 5FV7A 4E5UA 3EXAA 2FSGA 3A26A 3ODPA 1PS9A 1J2EA 3RYTC 1OH6A 3L5KA 4YJHB 3JQ6A 4FHDA 2JFBA 1LSUA 1FSPA 2XMCA 4HS4A 2VQSA 3TTWA 1IFXA 1R6BX 3PCRB 4UASA 1Y7PA 4JP3A 4DLSA 1VC2A 3HFJA 2Q2QA 5CDTA 1E3SA 5BNWA 2ZRJA 3FCEA 4KWTA 2JAPA 3PNMA 3NORA 2ZBEA 2BMDA 2QP4A 4TLDA 3UWDA 4B3MB 3D1VA 4MKXA 5JDCA 2FCRA 2WIDA 1H66A 3I2YX 3L43A 4GL2A 4F9TA 2FETA 3PJFA 4RCVA 2PUHA 2GZHA 1CVLA 5LMNB 4YASA 3TOCA 4LVOA 3OFVA 4Q7QA 1TYZA 1NL3A 3HI6A 3L8CA 4MUGA 1BA2A 2RC6A 2HYIC 5FWYA 2DXIA 1W6UA 1DO8A 1WG8A 2ZJ2A 1GUZA 3G0CA 4J0FA 1YVUA 2AFHB 2XB6A 1NY6A 3WDSA 2B4AA 3RHTA 3ZGOA 4KWEA 4JL8A 2BRUC 3F6EX 3OJFA 3HDJA 4K6FA 3PF8A 4DDTA 4Z2AA 2HHAA 1QC5A 2OHJA 5CM9C 3FH0A 4PSUA 5BT8A 1JU3A 2O8FA 1JH8A 3R5TA 2X2PA 4IXWA 1G9SA 2FZGA 1ISHA 2Z5FA 2WSIA 3GGSA 4RENA 4WESA 5DASA 3S2FA 1PJ2A 2BLLA 2CB9A 1G16A 5BVHB 4BGIA 3DZFA 3SEZA 1PJ3A 4D92A 3COVA 3H99A 4G5SA 1BIFA 4L27A 3EX7C 1FXWA 2I4NA 4QECA 2JIPA 4IDEA 4OHOA 3Q3VA 4AK9A 2GZMA 2IOYA 1UM9A 2R11A 3IBFA 1Y5RA 3P52A 3QPBA 3AKDA 2PL1A 4JXZA 3DEHA 3D8BA 3D5EA 5T4FA 1Q5PA 3HABA 4B3IA 2AUNA 4UW9A 1J8QA 4G1EB 4EY3A 1OIXA 2OGUA 2AYXA 4JYCA 1GNSA 4BN5A 4HRVA 1VG1A 4WV3A 4K0KB 2C03A 1FNBA 1Y37A 3VOSA 1V8OA 2YN2A 1LNQA 3O4JA 4KR6A 1OAAA 1U65A 2BZ1A 1XEXA 4Q1VA 2EJVA 4LNUA 1XWIA 4RH0A 3ZGLA 1AJEA 1CQJB 4FVTA 2I8CA 3C2QA 3IAUA 4Y2GA 2JHPA 3TOZA 4V1CB 3H9UA 2IJGX 2Q41A 4QU5A 1GU7A 4QQ8A 5AP9A 4AJ2A 4DGQA 4QTYA 4D3XA 1TEVA 3HXPA 3K4HA 3GMTA 2KBEA 1G6KA 3MGGA 2QR3A 4C4OA 1Q0LA 1FUYB 4LGVA 5LLTA 4D4IA 1E98A 3A4VA 1VPEA 3M4ZA 4JQZA 2JLZA 1D6NA 1OI3A 2PRJA 3H5NA 4C0JA 1GGNA 2FW7A 1M7HA 1XJQA 3DE7X 2EIHA 4CEIA 5KQLA 3SPXA 5F3WB 1G64A 1XNJA 1JEYB 3I04M 4IFEA 2QLFA 2JFQA 1HNNA 3SC4A 5JUWA 2WVJA 1QMGA 2HDWA 2O2CA 3JTEA 2G1KA 5GGYA 1MIOA 3FUWA 4AO6A 1GT6A 1KDTA 1Y34E 2ZIUB 5CLQA 1JT9A 5IYZF 1PNTA 3HR8A 3ZXUB 3GRCA 2G5PA 2PH1A 5MF6A 2Q5LA 2DG2A 4NYMR 3JAWA 5KKNB 621PA 1TE2A 1LX7A 1EFTA 3IKMB 1CK4A 1R16A 1WUJS 5K6AA 4IUCS 4RJLA 3LFUA 3KPJA 4N0EA 4OMDA 4C5CA 1E7RA 2WV7A 5E1DA 3RKRA 3NU1A 1RXVA 2OYCA 3Q9NA 2GD2A 4FQ7A 5B2FA 2IYQA 4RVUA 1IXRC 4YJHA 1Y48E 4C20A 5FDFA 2ZUTA 1I10A 1EDDA 2GK4A 4JJ4A 1A2OA 1Q19A 5AIAA 3V4RA 4WCFC 3WP0A 5DULA 4N12A 4R9UC 4WK6A 5CDUA 2AF3C 1KMIY 2J3EA 2Z9CA 4WK0B 3RKSA 4DR3B 4RDCA 2HM7A 4RTLA 3CB4A 4YPFA 1QRSA 1DS6A 5ETJA 3U4QB 4RFLA 4C3UA 4ESEA 1GLVA 5L40A 3A28A 3B3JA 2YWGA 1Q11A 4OAQA 3DEIA 2RHDA 5EHZA 4F8YA 3PQCA 3ESYA 5BSFA 3CZ4A 2HRCA 1ZVJA 2VJPA 1VGVA 2J45A 2FLWA 5J5CA 1DC3A 3BXXA 4PPYA 1S3FA 4B3TB 3L7YA 2RI0A 1K7EB 2IOQA 3DV0B 4LCJA 4X5OA 2AN5A 2J3IA 1VIMA 1JDVA 1TLLA 3EULA 4WZBE 3FPLA 4OOEA 4I2VA 1KFBB 4RS4A 2RH4A 5J59A 2AFHA 3F7OA 4ER6A 5CGZA 1WSBA 3AG5A 3KQVA 4UBNA 1Z3CA 1TTHA 4MUHA 1U9IA 4OBEA 1NSTA 5DN9A 5KDLA 4LXXA 1T2FA 3DQZA 4Y2YA 3ZV6A 3L7CA 2RGUA 1ZJ4A 4F5WA 3PCXA 4BNWA 4ZTZB 1U8XX 5EHXA 4HDRB 1C3VA 1Z5NA 2HJHA 2VDWB 3HP1A 4EYSA 1SVOA 1E7QA 1J1UA 1FPMA 1KSFX 3NUGA 3FG9A 3FSJX 3PDJA 3F7TA 1T43A 2XWQA 3PTLA 5BVHA 3L7KA 2J41A 5LB4A 3ADKA 3AF3A 2QMOA 3ENZA 3TSAA 1NAIA 3LTEA 3C7DB 1ZOIA 1O4WA 4ZCIA 2PT9A 2CDBA 2IY8A 2LR0A 2X5OA 4ND7A 1YQXA 3WWOA 3HUUA 4BTVA 2KX7A 4UCFA 3RVQA 4B82A 2ZYUX 2JLSA 4B45A 9LDTA 1ZR4A 3W90A 4DM3A 2WP0A 4M1ZA 1H0SA 3JQPA 1HE3A 1WAMA 3IOYA 2YRFA 2YJZA 3L1UA 3MAAC 3O90A 4QUBA 1MB9A 3F5QA 5EERA 4EVQA 2Y1CA 2Q4EA 1NC1A 5D1NA 3E9EA 2EX1A 4WFIA 1U0EA 1RPZA 1JI0A 2GAOA 1GHTA 2I4OA 1IY8A 4EG3A 5A05A 4UBJA 3IP1A 4DA9A 4FPXA 3ZJ4A 5BOSB 3V46A 4PHCA 4DBLE 4BEBA 1S2MA 4K1LA 5CW1A 2I4MA 2EWWA 4R84A 3A27A 3CZCA 4MS4B 1RRVA 5E7QA 5I7OA 4E1AA 4L4ZA 8ADHA 2Y1OA 1TQ2A 1RYZA 3EEQA 1GTG1 4BFUA 1YRBA 1GPUA 2HT6A 2XODA 2IFTA 2QN3A 3WB0A 4C5AA 2WWYA 2EVWX 1G42A 3AEZA 3CMMA 2C3UA 3GLKA 1A7JA 2FUG1 2OCBA 4M4SA 1E2JA 4POAA 1UK8A 4GOND 4A92A 4AKSA 1VKRA 2AQKA 4BRWA 1D8TA 2R8BA 4RK0A 3KKOA 1MB2A 1PZFA 2V96A 3LQQA 4IRUB 2FDRA 1V3VA 2VN8A 3OZWA 4CQMD 4KGZA 4NCXA 1FFEA 1RXIA 1U28C 1YACA 3WYDA 4B6SA 4BDSA 4DQXA 1E3WA 3QTLA 3PNOA 2GJSA 4OGKA 5I9NA 2PJRA 1WPQA 4OLBA 4CWAA 5F3DA 4CDMA 3CEMA 5SZIA 2IXFA 4O4LB 5FOXA 1PYGA 3KLBA 3LL4A 3C3PA 1WZUA 2AOWA 2Q8PA 2B4KA 1NBWB 4AZ0A 4YRNA 3L4JA 1GKIA 3P9QA 3KQPA 2BR5A 2GCNA 3H5IA 1QU2A 4M8NE 3U40A 2OUKA 5K4HA 3E48A 2Y4NA 3UCEA 4E21A 2GVNA 4IRMA 1MRZA 1N9KA 3SLKA 1Y4DE 4BO7A 3DFFA 2RHMA 4REQB 5ESWA 4A6PA 4UHDA 16PKA 5AM4A 1R0SA 3HQ4O 2BISA 2PTGA 2Q7OE 4EZEA 2PH5A 1IXKA 3ZGYA 4N0QA 4B2YA 1E1CA 1FA9A 4DILA 4ZZ3A 5TPZD 1RRKA 3IOCA 3KDAA 4XTCS 5G0SA 4JS0A 1GEEA 1C8VB 1SXQA 1RTTA 3DP9A 2XWBF 4BV2A 1Q1EA 5TARA 3OQBA 1XF1A 5FR1A 5JCOC 3IQDB 4JI0B 4H7FA 3GK3A 2OL4A 5M34A 4H3HB 2C2GA 4HH3C 4TT3D 2BEUB 2VLBA 4A36A 3CNHA 4QFMA 4ZODA 3U60B 2E4XA 4DV1B 3DV0A 3AY6A 1EGQA 1M2HA 2VP4A 4IWXA 4L2IB 4WCDA 1Y1LA 1M34E 2RHTA 1CEXA 1SU4A 1ZFNA 5B53A 4CF4A 3WGQA 3T94A 1OVMA 2E55A 3VSCA 1SVIA 5FHQA 5KC8A 3V32A 3VV2A 3AESB 4HVTA 4XZ3A 4D4JA 2IUYA 3AFGA 3IVMA 1Q2UA 1GT91 4E5MA 2H0AA 3S2EA 1C9YA 3DV2A 3GWGA 1QSGA 2QKYA 3JAKB 4PEVA 2Q2OA 3FWNA 3AB7A 4JLWA 1QRAA 5HE8A 4U6QA 3OQNA 4HKTA 1XVUA 3T4EA 4BWYA 4J1TC 2BTOA 2YH2A 5ALYA 2VK4A 1TUBB 4E7PA 4B7UA 2YYSA 4MO9A 4IKEA 4B7ZA 3HFRA 4R1NA 2I6FA 4W6QA 3AHIA 1IEWA 4NOKA 3EXFA 1R7RA 5EI5A 2JAXA 3E82A 1N2CE 4HEA6 2A5YB 2HA6A 5JE8A 4YAIA 2HNBA 5AJUA 3I6IA 4I5IA 5LWQA 1C29B 2C0QA 3QV2A 1KY3A 4FYYA 1HFWA 3R9IA 2NVUB 1Y7LA 1OB5A 3BJZA 3QJYA