3ZS9A

S. cerevisiae get3-adp-alf4- complex with a cytosolic get2 fragment
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
348
structure length
293
Chain Sequence
VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPASE GET3
publication title The Mechanism of Membrane-Associated Steps in Tail-Anchored Protein Insertion.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transport protein
total genus 108
structure length 293
sequence length 348
chains with identical sequence B
ec nomenclature ec 3.6.3.16: Arsenite-transporting ATPase.
pdb deposition date 2011-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3zs9A00
1AIPA 4MKHA 3RS5A 4B3XA 2FN4A 1F2UA 5UKDA 1MV5A 1EXMA 1N5KA 2QSYA 2W6IA 5FPSA 3U2QA 4BLSA 4IKEA 3ZYCA 3P27A 3U4QB 3QPWA 2ERXA 5K8IA 4B2PA 3LBIA 4XIGS 2KE5A 3A36A 4LOAA 5FBWB 1E9DA 4NZYA 2O0KA 2QM7A 5KSZA 3ZZUA 3C4JA 3K0SA 4TTQA 1RZ3A 1U8YA 1T0JB 5AUQA 2Q9AA 2ZRBA 3IO5A 5KUTA 3WMEA 4P4TA 1JPJA 2YJTD 1NF3A 1OXVA 1TUIA 5HZKA 2JLZA 4D0LB 4B3FX 2QMEA 1UADA 5FR1A 2J7PD 2CCJA 2RGBA 1E2FA 1Q22A 1HT1E 1CU1A 1R8QA 1RKBA 1ZC3A 2JAQA 3P1JA 4OI1A 1KK2A 2ZM5A 2G77B 2KBFA 1JAHA 2ZUCA 4DCVA 4ZIRA 5AJXA 2CDNA 4FWTA 1NY5A 5FI1B 1YE8A 2OBLA 4TLDA 4CF7A 1MKYA 3QXCA 4HEJA 1E9BA 4Q4JA 4X8OA 3GLFA 2ODNA 4W5HA 5DSZA 2V8OA 2WWIA 3I3SR 3UK6A 2WKQA 3DMNA 5FUWA 4UQOA 4BFTA 2MMCA 4S2EA 2GKSA 3CZQA 2Q0HA 2UZIR 2O8FB 3EZFA 4DDVA 4V03A 3ZDQA 2ZI9A 3OIYA 3MG9A 5FL7D 1IY0A 4LRWA 4EDHA 2OUKA 3E1SA 4JBYA 4KAXA 4A92A 3TRFA 1GIAA 3FKSA 2PMKA 2MMGA 1JI0A 4M1MA 3HPRA 2J45A 1BOFA 1ZW6A 3LBNA 2VLIA 3AV0B 1FP6A 3T1TA 3K70C 4AKIA 4DEXA 1KK0A 2RH5A 5J4LA 1I4TD 1Z6YA 1E9RA 2REXB 4RFSB 3NWJA 3BBPA 2WIAA 2FEOA 1KZGB 3U3RA 2L0XA 3OEED 3U4QA 3I5XA 3AVTA 1NVUQ 3REGA 4B2IA 1S1MA 5FOXA 3DPUA 4HB0A 4QGHA 1AS3A 4LJ8A 3WRXC 1BMFD 3F5FA 2WAYA 5A0FA 1GKIA 4CEJB 1KO4A 2PEYA 1Z6XA 1UDWA 1M1YE 1EFRD 4PAQA 2IC5A 1GL6A 3SFZA 3BRWD 2JDID 4GZMA 5AJVB 2QENA 2V7QA 2YZ2A 3GFTA 3LW8A 1IXSB 4TMTA 2WWXA 4W7SA 1S9DA 4B6FA 4F92B 1G7SA 1KHTA 3O8DA 4CGZA 5KSOA 3UATA 1SXJA 4JLMA 4KSCA 1P2TA 2BEKA 3CZPA 5DHAA 4L9WA 2QPOA 2VRWA 1GNQA 5E7IA 4GBMA 4CZ2A 1XCGB 3ZIAA 3W3AA 1EWRA 3MD0A 3GMTA 4RD2A 4JLPA 2QROA 3TSZA 3WNBA 4PPGA 1N6HA 3KJHA 3T5GA 1SVLA 3LLUA 3MFYA 1L8QA 4Q1CA 1NN3A 4C0QC 1E96A 1AQYA 221PA 4Q1DA 4TYQA 2OILA 4X8MA 1XEWY 1GL9B 3BB4A 1XMJA 4OKSA 1E9AA 4RD4A 1B23P 3K0EA 5F3WB 2G88A 2ZRGA 1Z0JA 4F4JA 2OSBA 1QHYA 1R0XA 4D6PA 2QTHA 1W1WA 1CR2A 3UWKA 1GRRA 4LHVA 1HH4A 4OHXA 3QF4B 3OE7A 3BXZA 1N6NA 4HAXA 1GM5A 2J0UA 1AGRA 1YR8A 2Z6VA 4HAVA 2AFIE 1T3LA 2ZI7A 3BD9A 5JHGB 2G1JA 1K5GA 1EGAA 2A5GA 3KUDA 4PQFA 2HXYA 4CEJA 3U5ZB 4A9AA 5CB6A 3OHMA 5FUYA 1WDTA 1YKSA 5FTKA 1B0UA 1DVRA 4IOJA 4Q47A 1RVDA 3SJBA 1PV4A 2YWFA 2Q9CA 3LX8A 2EU8A 3VHXA 1G19A 3E2IA 3VR6A 2QAGB 2ZRPA 4LCBA 4MYTA 4UNPA 1BS1A 4EJSA 3KXLA 1UDXA 2BHRA 2Q21A 4HZUB 3JVUA 3MAAC 2I1VB 1N25A 3V00A 1XJQA 3BFVA 3H86A 4AYTA 1OHHD 2ZAMA 4JVNA 3UIEA 1LS6A 1RIFA 1LNZA 1TF5A 2YV5A 4UNQA 2ZI3A 2PCJA 4Z1MA 3S1AB 4F38A 3W6OA 4BUJA 3VNUA 3BE4A 2QY9A 1CR1A 2A9KA 1WMSA 3KXKA 4O2LA 2QT0A 4LI0A 3GJXC 4RJLA 4CDGA 4DLXA 4ERNA 1CTQA 5EXPA 2VHCA 4PC1A 2QMHA 4R9UC 2LKDA 2NO6A 2ODEA 3IEVA 1JJ7A 4G5RA 4PQRA 1LFDB 2IL1A 1X1SA 1P2VA 5JRZA 2BOVA 4RD3A 1G8FA 1BO6A 1S8FA 2A5FA 2C77A 1P60A 2ZRFA 4IEEA 4KYIB 2JLWA 1VG9B 2CHGA 2ZJ8A 5H1YA 3ZD6A 1EX7A 3LXRA 2W2XA 5KNBA 4IDNA 4EPYA 2I1QA 1M74A 2F9LA 1RYHA 5L3SA 3GFOA 3QF4A 2WIBA 3C7KA 2O0JA 5KOYA 5AR1A 2GK7A 4BRWA 3FHCB 3A37A 3KKNA 1GOTA 1M7HA 2AD5A 3FPAA 4KHZA 4Q1EA 3SNHA 3Q7QA 4LJ5A 4O25A 4BRUA 3UPUA 4BLOA 3MWKA 3HPQA 3I73A 2QAJA 4P32A 1WQ1R 2FH5B 1KI9A 3OAAA 2XNSA 3JZAA 4NYMQ 4QGFA 1G7TA 4TLAA 4RY2A 5TV2A 4J0QA 1NVVR 1OT3A 4JLVA 4Q9IA 4EPVA 3FOZA 1IN4A 1AN0A 4HATA 2RB4A 1K6MA 1US8B 3PG5A 2WWYA 1W36B 1YQTA 2TMKA 2E1RA 5C46F 5BYJA 5TXGA 3H2YA 3CRVA 3CRQA 1NN5A 2JJ1D 3VMFA 3PEYA 2HYDA 3ZGXA 3QPVA 4RCYA 3SR0A 3L43A 4BZXA 4M53A 4GL2A 5SZJA 3CLVA 4L8GA 5GJCA 1JR6A 2DY1A 4PTLA 2C99A 3GEHA 2ZPTX 1A2KC 5J4VA 2CNWA 1X3SA 3PITA 2WWFA 4V0KA 1KI3A 3RRNA 3T1VA 1WP9A 3TSWA 1W2HA 4DT1B 4MDEA 3AF1A 5JFGA 3FWYA 2W0SA 1U2RA 3V9PA 2DPXA 2JLSA 1S0UA 3L82B 3QXSA 4BECA 3KDSE 4PPQA 4KU4A 3HU2A 1VDZA 1AKYA 1Q1EA 1Z2AA 3T12A 3T61A 4F91B 3TUZC 4RZ3A 1VG8A 2ZE7A 4QXAA 4TZ0A 1AQUA 2Z83A 3SC3A 5JI2E 4LJ6A 2ZRIA 2IF0A 4WW0A 5L3RA 1YZTA 5DISB 4TTPA 4QKQA 5J4YA 1OPXA 4NYJR 4C0KA 4HSEA 1TU4A 4DDUA 2ZYVX 3AP1A 1XXHE 3GEEA 5SZIA 3W8NA 1NN0A 2C03A 2HDNB 4B3GA 3MCAA 4TSFD 3CB4A 2OCAA 1R7RA 2NZ8A 2XITA 2YNMA 3FMIA 4HUQB 4ARZA 5CITA 3DL0A 4N0EA 1LS1A 1W0JD 2QZ4A 4HAYA 5AJYA 1M34E 3L8YA 3R8CA 1D2MA 1YZLA 2IYXA 1JEDA 2GZAA 3LX5A 1VHTA 1E1RA 1G3QA 1QBKC 2V1XA 5KDDA 4RZXA 2IS1A 1YRBA 4Z51A 3AF2A 5JCZA 3BGWA 1DOAA 4C3ZA 4G01B 3MJRA 3PEWA 1US8A 4Y0VA 5HTKA 3PXGA 3GJ3A 2GHIA 2IYVA 1J7KA 5FBLB 1OFIA 2IS4A 1T5LA 5JLJA 2ZE5A 3D7MA 5CDFE 3W34A 1Z06A 3EC2A 3GLIA 3AKEA 1Z0FA 3THWA 4TL8A 3UG6A 3AVXA 1BKDR 3K0CC 2ZYTX 4M9ZA 1ZINA 2JLQA 2ONJA 3TW4A 1GNRA 2W83A 1WE2A 5EXTA 1F2TA 2ZSAA 3B1XA 4ZPXA 5DN6A 1VPLA 4OI2A 1NLZA 2P3SA 3VNVA 4M2LA 2IYUA 5EP1A 1NVVQ 2XZPA 3CR7A 4KJZA 1E3MA 2J41A 4DB2A 2AWNA 1JB1A 2HT1A 4LBYA 1PUIA 4LHYA 2R6AA 2RGEA 5JEDA 4ZCLA 1KJWA 4PPNA 5F9FA 1QHIA 2F7SA 2BM0A 5JHHB 5JWRA 2XZLA 1P2UA 3B2EA 3QE0A 4GZLA 3SZRA 2GEVA 2B21A 4PSAA 2R65A 3U3KA 3ZVMA 1UBCA 2QGNA 1KSJA 3WNCA 4Q03A 4FMCF 1DARA 1NRJB 5KNDA 3CRMA 5B2ZA 3F0TA 4DUGD 2FU5C 2OE2A 2ZVQX 1XTRA 2O5VA 3AB3A 1ZCBA 1V5WA 4JYCA 1KI6B 3BB3A 3N2EA 3O8RA 4DLYA 5CYPA 2FX3A 1N0UA 3LLMA 2JIZA 4K46A 3R9WA 4BZPA 5IF9A 2ZJBA 1LVGA 2ECKA 1IXZA 1G7CA 3AVPA 3KTAB 3OEHA 3EC1A 4QC2A 1KMHB 4O2RA 1XD2B 3KXIA 1E1QD 1R0ZA 3Q72A 1U94A 4H1VA 4NYJQ 5GADl 4AYXA 1TEXA 2J9RA 3CONA 4KVGA 3FB4A 3R9IA 5E95A 2IYTA 3RSOA 1LW7A 4JL8A 3I62A 3TQCA 4A0RA 1ZD1A 4OQNA 4HLQB 2F3RA 2GETA 3A1VA 3WBJA 1W36D 2BCGY 2D2FA 1ONBA 3I32A 2A2ZA 5EP4A 4U7DA 1AM4D 4DSUA 3GLFE 3I8SA 2A30A 3LY5A 4HLDA 1ZMXA 2ZU0C 3QEJA 3OFND 1FX0B 2AD1A 3EA5A 5E7MA 2GZDA 1UBGA 1KKLA 2G1KA 3RWMB 3WHKA 1XMVA 4LGMA 3WNDA 1I4DD 1CIPA 2AX4A 2IS2A 2GCOB 2NO7A 2GF0A 4ZKEA 3ZJYA 1AJEA 3QVUA 4PZLA 3IIMA 2R2AA 4HDOB 3QG1A 3FKQA 5CM9C 4XWKA 5HE9A 1ZM4A 3QQ5A 5FPHA 2OCYC 1KK1A 3KJGA 2WVJA 2HCJB 5AWFC 5L3QB 3BH0A 5D3QA 2J0VA 5FPTA 2I3BA 4QJ3A 3L0SA 3K09A 1KI6A 4ASUA 2OFWA 1BYUA 4BEJA 3H4MA 1RRPA 1S4QA 1G17A 1IN7A 3IBGA 4M9SA 4C0JA 4DHEA 3T15A 1QHSA 4K81B 1FQJA 3VR1A 4PO9A 2Z0MA 1DPFA 3RS3A 3TUJC 3KFVA 2V55B 2BKUA 1Y63A 2ZRNA 3SYNA 1WRBA 2BBTA 1XNJA 1SXJE 3IUYA 2DFLA 5HCNA 4TL6A 3UG7A 2W58A 3LQQA 3U7HB 2ZRMA 4I1SA 3QKSB 2VO1A 1XXHB 1FPMA 1ZAKA 3B13B 3QNUA 2QP9X 1UAAA 2NMVA 2RGNA 1OJLA 4MYUA 2Q3HA 5TB5A 1ZVQA 4CVNA 4E07A 4OQFA 4H1UA 2QQ0A 4GMXA 3EWAA 3IPXA 4EFLA 4FCVA 1QZXA 1KSHA 4E03A 1Z5ZA 2ANBA 2H7VA 5CLQA 3RRMA 4Z54A 4JJZA 2WKRA 1UKYA 1YRAA 4D82A 4URZR 3BH7A 1XJ0A 1E2KA 2JJ8A 4LV8B 3TSOA 2EFDB 4M4SA 3CBQA 2QMOA 2G9NA 1KGDA 2BV3A 2HJGA 2FA9A 1QDEA 2LKCA 2ZS7A 4WZBE 2CJWB 2GCOA 2ZROA 3WMGA 2O52A 1JEEA 4B48A 4IFEA 2QAGC 1C1YA 5KSPA 1E6CA 1R8SA 4DLSA 2VTKA 2O8EB 2UZ3A 1ZNXA 4D4KA 3DDCA 2VSXA 1TNDA 3BERA 3VU9A 1TL7C 1U99A 3DEFA 1EFUA 2XB2A 1OSNA 4R98A 4HLUC 4LV5B 4NCKA 3GLHA 3O8BA 1G1MA 4FXPA 1XCMA 5JMTA 2FGKA 3IQWA 3VKHA 2ZI5A 2UKDA 3GJ6A 3CW2A 4CYMA 4KITB 3ADCA 1X8LA 4ZCMA 4V0LA 1MR3F 1DEKA 2FSHA 3U7FB 1Q20A 2PCLA 3TAHA 2FFBA 2BEJA 2P6UA 1AZSC 1KJYA 1Q0UA 2GJKA 3D6TB 3J81k 5TARA 2AK3A 4KFSA 4I1OA 1N0WA 4Q48A 3CPHA 4DRZA 3QKSA 4R7ZA 4Q9KA 4YONB 2Z43A 3SDZA 3P32A 1KO8A 2VP6A 2DYKA 5CK4A 4YLGA 5AUOB 1DAIA 3VAAA 4AK9A 2HV8A 2AR7A 3UWOA 3SS8A 1T0HB 4EIWA 4EPRA 4U02A 5C4GB 1W0KD 5HKKA 1WB9A 4IDOA 1UEIA 2UVQA 5HPYB 2RCNA 3MWYW 3TBKA 2EFHB 2W0MA 3A4MA 1JALA 3GJ0A 4B3BA 2GCNA 5CIWA 1BH2A 2QU8A 5DI3B 4WXRA 4BLRA 4DLZA 5JS8A 4F93B 3BS4A 1G8YA 1IJEA 4C0AC 2IEZA 1JECA 3HJNA 3PEUA 4XSGA 3W5JA 4LSGA 3TAUA 1SVMA 2IK8A 4A15A 2YWHA 2EFEB 4A0FA 2P65A 1H8ED 4DIEA 5JSZA 3TNFA 2JLXA 4OYHA 4BFSA 1Z0IA 4FMBB 3DZ8A 5JEEA 1OE0A 2IWHA 1XDBA 2W6JA 4TLEA 5BN3A 3HP1A 2P67A 2AKYA 2LCFA 2IHYA 5FOWA 4DKXA 4EQ6B 1FQKA 1VG1A 5JI3E 4BWYA 4X8LA 1J2JA 2VP0A 4PSKA 4Q4JB 5J5CA 3GLFB 4B47A 4PHTA 1NJFA 3EW9A 1EG7A 2X2FA 3FHTA 2WJIA 1ZNZA 3CIOA 3SN6A 1U0LA 1X6VA 4TL7A 4A2QA 3SHFA 3QY0A 4CEIB 5KHOC 4WBSA 1PJRA 4ACAA 5E3HA 1XD8A 1FNMA 1O3YA 4CT5A 1OH8A 1M7BA 1EX6A 1P62B 2PEZA 4D25A 2YC2C 2WHXA 3NG1A 4EPWA 521PA 1SVWA 3QIAA 1XEXA 2FOLA 3B5JA 3QEOA 4MRSA 1CR4A 1Q1ZA 4KXFB 4EFNA 2IXFA 2ZRJA 4NHOA 5BQ5A 1OV4A 2DBYA 1NP6A 2J0SA 1KZ7B 4AY2A 4Q7KA 4MRVA 5TVKA 4Q7MB 2FMXA 5GVRA 3RSLA 1E98A 1SZPA 4PQYA 1YJ5A 3QKTA 5DI3A 4FMDB 4CIDA 3WMFA 2GTPA 2OBNA 2JASA 5A5GA 2ATXA 2QP4A 3TK1A 2BBSA 3PJRA 2ZUBA 2ASEA 1FFHA 3MGCA 4TYNA 1E2JA 2VF7A 1MO3A 3IBYA 4M0LA 2NPIA 5HE8A 1NI3A 2QL6A 3EWSA 4X8HA 2IYQA 1R0WA 1SXJB 2XTZA 3DM5A 2V9PA 1MH1A 5F98A 2IUUA 2IYRA 3EARA 2F1JA 4HUTA 3N2IA 3WXMA 4PXAA 4KSBA 4EQ6A 3B82A 4PHFA 5F2EA 1Z6GA 2ZRKA 1AGPA 4QG7A 1JR3A 1GRNA 1A5TA 1IY1A 4OQMA 3U6BA 3PIRA 1D8TA 1SVKA 3QKUA 5KPJA 2JLYA 621PA 1XMSA 2QNRA 3GLIE 4CEIA 3QPUA 4BEBA 4TTRA 4B35A 1Z3IX 2D62A 3U44A 2RGDA 2ZYWX 1P2SA 2YHSA 2AL7A 4OK5A 3T5DA 2W6JD 1N5LA 2DFTA 2RHMA 3TH5A 4JSTA 4NE2A 4UXJA 4NKRA 4DIDA 2FFAA 2XB4A 1P9WA 2XOKD 2J0UB 2EQBA 1XB2A 3CX8A 4KVAA 2B8WA 3GCGA 4D26A 3AF0A 3VR3A 3UXMA 4BLPA 4PZZA 4RD6A 4RCZA 1XPRA 2KB0A 2P5SA 4A8JB 4CRWB 4IVQA 3ZZTA 2HCBA 3KKPA 1M8PA 3DOEA 4ESHA 1KSGA 1H8HA 1QHHA 3EG5A 1Z0KA 4Z8YA 2C9YA 121PA 3CF2A 4I1UA 4OHYA 3B1YA 3KQKA 4S35A 4BFWA 1R10A 3R20A 4EJSB 1D2NA 4LUCA 1NKTA 4TT3A 4UNSA 5SZHB 3BIFA 3H1TA 2ZYUX 2W6ID 3KFXA 3EASA 2O8BB 3G0HA 4URUR 1GG2A 5EZ5A 2BCJQ 2WOOA 3RAPR 2Z4SA 1RJ9A 1WBDA 4JLOA 821PA 4H9GA 3LVRE 1DG3A 4URYR 3V4RA 5BN5A 1T6NA 4NYMR 1ZU5A 3DVLA 1AK2A 3ETLA 2E87A 3ZS8A 1SGWA 1M7GA 1HUQA 3AVQA 4OHWA 1LB1B 3GEIA 4BE7B 1ZM7A 1LF0A 4PAOA 5FR2A 5P21A 3GPLA 1ESMA 3MWJA 3T06B 4M1WA 4POAA 1KAGA 5DIFA 3CWQA 3O47A 2WV9A 4A2PA 4A6XA 1U8ZA 1NN1A 1T8TA 2FF7A 4BLTA 2JLRA 1QHNA 4I81A 5C2JB 5L3SB 1XX6A 1KTVA 3B1WA 3KB2A 2A78A 5C18A 2J46A 2XEXA 4HB2A 3AQ4A 1E79A 4Q7JB 3AVUA 2REOA 2C9OA 4E22A 4C9BA 3PFIA 1SVIA 4A8JA 3U3OA 1MT0A 4YDHB 2WOJA 3PV0A 2Z4RA 4DCTA 4XVQA 1XTQA 3W8RA 2XXAB 1TAGA 3FKSD 1F60A 3LNCA 1C9KA 3F8TA 3QXXA 4LHWA 4NTZA 2JJ2A 4G5SA 2F55A 4US2R 1HQCA 2J59A 5FUXA 1KNXA 3PUYA 1NY6A 3ECCA 5LDDC 1COWA 2NQ2C 4WIAA 1VIAA 3VHLB 2QUZA 1G3RA 1L4YA 2FE4A 3QXHA 3I4LA 4LJAA 1W4RA 3C41J 3CRRA 2O8BA 5DYIA 1IM2A 4JL5A 1S3SA 1XMIA 5K8TA 1G21E 4URXR 3GJ4A 4QHSA 1II9A 3MUFA 5F9HA 2PLFA 1HE1C 3BC1A 2GJ8A 3QSYA 2FSIA 4PO8A 5IHPA 2R6GA 1T3HA 3QG5A 2QE7A 2V7QD 4Q9HA 1XEFA 2ZR7A 1IHUA 3CNLA 3PQCA 2XAUA 4MRRA 1SXJD 1CEEA 1R5OA 1FMLA 2NG1A 4HAUA 2CHQA 1NMYA 2P6NA 1IAQA 2BMFA 1Q12A 1AZTA 2OFOA 4MA4A 4Q9JA 2ZS9A 3ZIAD 3IQXA 1Z47A 2XTMA 4IJMA 5C1BA 4XD7A 5KDLA 3CPJB 3A58B 4Q9LA 5D3MA 2QSZA 3RDPA 3TUIC 3C16C 1PLLA 3W3ZB 5J4KA 4ARZB 2AXPA 3A8TA 2BBWA 5DNYB 4TMWA 4N3NA 4IVPA 2AWOA 1KI2A 3B6EA 4MUAA 3PCRB 2BMJA 3RS7A 2VQSA 3AVOA 3FDIA 2IA5A 5FBQB 1VCOA 1D6JA 2PH1A 1BIFA 1U9IC 4DCSA 2XXAA 3TKLA 4FCTA 1I2MA 5E4FA 5EE1A 4F4IA 3ND9A 4EKDA 2OBMA 2PX3A 4NCIA 1M2OB 2ZI4A 3EZ2A 3NC1C 3AM1A 2GDJA 3OE7D 3K8YA 3GLIB 2BDTA 1E0KA 2ORIA 2XSZA 3THWB 4JIMA 3NC0C 5FUVA 3SI7A 1D9ZA 4A82A 5FBRB 1VYVA 1IY2A 1N6IA 4DCUA 1R0YA 1OH6A 4BLQA 3EPJA 1XZPA 1P9NA 3CF6R 2PZEA 1F2TB 3GLHE 4QGGA 2R8RA 4LJ9A 1U0JA 3THOA 5TMPA 5JWHA 1MOZA 3REFA 4NMMA 3VR2A 5CJ2A 4CEHA 2WSSA 4CW7A 4DVGA 1Z29A 3WY9A 3X1YA 3QBVA 2H5EA 2BJWA 3IKJA 2Q6TA 3KJIA 3Q85A 4JT4A 2PL3A 2MSCB 4Z1MD 4F4CA 4HLUA 2A5YB 4PX9A 4I4LA 4URWR 1FZQA 2J1LA 1ZD8A 3Q3JB 4JLAA 3QENA 2DCUA 2CK3A 3GJ5A 4Q5IA 5G40A 4LX0A 1D9XA 1KI7A 5G41A 5FTLA 1IOZA 1NSTA 2WM9B 3NH6A 5KNCA 4DSOA 2FPKA 4DWJA 1ZM3A 4N1AA 2CLDX 4P4UA 1J70A 2EYQA 2AFHE 3T1QA 3SQXA 2ZAOA 2OAQ1 3U61B 4XJXA 3W6NA 3SBDA 1A82A 4IRUB 1TQDA 4OK3A 4LPKA 4Q4HA 3UKDA 4IW3B 4JYBA 1PLJA 1CRPA 2HLDA 5JJLA 1J8YF 3DOFA 3PUZA 4TQ9A 4NBSA 2OLKA 5BWMA 1P73A 1ZNWA 2RGXA 3WHLA 4V0OA 3SEAA 1NMZA 1DADA 2G0NA 4JT2A 1EFTA 2WMNB 1G4UR 5GVSA 1E2HA 3VX4A 3KX2A 2YKGA 2IW3A 1MO6A 4N0DA 2ZR0A 4TQUS 4LBVA 4A1FA 2KWIA 5IRCD 3N5CA 1DAHA 2J0QA 3OAAD 4XVRA 1DAKA 4I99A 2WZQA 4M21A 4PPFA 1OFTA 2N42A 2Z5FA 4ZDIA 5BYKA 3RANA 4ZDJA 2D4HA 1GSIA 1NLFA 3H84A 3JVVA 3SYKA 2PT5A 1G5TA 2DWPA 4Q66C 1NSFA 1OXTA 4M8NE 4AG5A 2ZI6A 5ANRB 1HY3A 3FGNA 1Y3AA 2DFNA 4FIDA 3EIQA 4MDFA 1NVWQ 4UXIA 2OV2A 1XTSA 4RD0A 2WPDA 2P2LA 3K0AB 3PUVA 2GF9A 5DLQC 1OIXA 3CX7A 1XTJA 2ZE8A 2XGJA 1XP8A 2FG5A 1M6NA 3R9XA 5EZ6B 3LD9A 3EZ7A 2CNWD 3AVVA 3AP2A 4GNKA 1HE8B 4Q4AB 3KJEA 1FNNA 1E9EA 2CLSA 3FVQA 3LDAA 3WYAA 4RVCA 1X86B 3U3MA 3ZH9B 1VMAA 5JJIA 3SJAA 1IQPA 2GEUA 3QXJA 5FH9A 4ACBA 2GXUA 3ADKA 4XVUA 1YZUA 3B7GA 3BAFA 4BFYA 2G3YA 2VPPA 1D5CA 1F5NA 4IFBA 4NCJA 2NZJA 3AGQA 3QBTA 5EE5B 5IDVA 2CCGA 2C78A 3WYFA 4EFMA 2O8DA 3NIBA 2WSMA 4GFDA 3RWOA 4C30A 2CK3D 1W7AA 1T5IA 3NDBB 1LF5A 3MWLA 3Q5DA 4JLJA 2REBA 3Q8XB 1R2QA 1SVOA 1GTVA 1E94E 2IUSA 2XJ9A 3EZ6A 1GILA 3M1IA 1LY1A 1G3IA 1E1RD 1N5IA 1P7CA 1P4SA 4TL9A 4ZI2A 5JWOA 5K8LA 2QORA 3KB1A 3FMOB 4NONA 4Q1AA 1LTQA 4DLWA 4ABYA 1G291 5EXSA 1DO2A 1UBEA 4B3CA 4MYCA 4JKIA 5FTNA 1NL3A 4PHGA 4MYHA 3DMDA 4OQLA 4NDZA 2BMDA 1ESNA 2VHUA 2KBEA 1JR3E 5CLLA 1F3OA 1Z28A 4AI6A 4NCNA 4Q02A 3NEJA 3V4FA 1OKKA 4EPTA 1E4VA 2V6JA 3QOFA 3K0AA 2C96A 3OIVA 4TQAA 2C2HA 2GRJA 2ZEJA 5BXQC 6Q21A 1KDPA 3ZVLA 2ZRLA 5FTMA 2VF8A 3THXA 4Q1BA 4F7WA 2D74A 5G3ZA 1CXZA 3IDQA 1GDDA 1XF9A 3D8BA 4Q4AA 5DN6D 1A7JA 1TF7A 3L0OA 1UBFA 4C0LA 1PUJA 2ZETA 4LZZA 1ZM2A 1G3UA 4K8OA 4HB3A 4OBEA 1KSFX 2VIIA 4QHTA 3LO5A 2QBYA 5DI9A 1QRAA 3VU9B 4A4DA 3AKCA 3L0PA 3KKQA 2CE7A 2CL6X 3B85A 4PHHA 3EA0A 3FHOA 3MRSA 1RE0A 1S2MA 1VYTA 3GLHB 3C5CA 4GOXA 2DB3A 3N70A 1DO0A 4UNNA 1YHNA 3B9PA 2HT6A 3A1TA 4QJ5A 1RW4A 4BFVA 4LDJA 3EPLA 1AA9A 5AUPB 1ETUA 4I1VA 4LHXA 3ZQ6A 4KFUA 1YR7A 1X8JA 2QN6A 2RKOA 5E7JA 2F1HA 3HYRA 4R2HA 2OCBA 2IHBA 5JZVA 4Q01A 2DFKB 2ZREA 1XWIA 1ZUIA 3UMSA 1NMXA 4QBHA 2JGNA 3L8ZA 5EP3A 5KTYA 1J8MF 2F9MA 4IDQA 4M22A 2GXSA 2HXSA 1GAJA 5FOVA 2JIZD 4QBIA 2EWVA 5GJVC 4GPTA 2PLRA 1CR0A 5AJZA 4B32A 2RGGA 3IIJA 1KKMA 3NBFA 3OEHD 3RS0A 2YINC 1E0SA 1KI8A 4DSNA 2ZJAA 1E2QA 5LB2A 3KQNA 1NG9A 4ZV4A 2NO0A 3AH8A 1N6RA 1CJTC 4QBGB 4C2UA 3ZLJA 2QEQA 4JZKA 5BW8A 3DO6A 4TMXA 5KDOA 1OFUX 1XPUA 1TPZA 3CRW1 4II7A 4ZI3A 3THYA 1G16A 1W44A 3A1UA 1R6BX 4RKEA 3ZQJA 2VHQA 4OJKA 1W4CA 2H92A 4YXWA 4AKEA 3NBYC 4B34A 1ZYUA 4WA7A 1OKKD 5JSZB 2KSQA 1ZU4A 4ZO4A 3UMRA 3LVQE 1NLYA 3VFDA 1HYQA 4B74A 4ZCIA 1I2DA 3C8UA 4A6PA 2P0EA 1II8B 1HT2E 2PX0A 4D0NA 3D3QA 4UJ3A 2F43A 2ZE6A 1WA5A 2JA1A 2EFCB 5JCPA 2ZSEA 2ZIAA 3P4XA 3C14C 1H65A 1NBMA 1VCNA 1G6OA 1YVDA 2CVFA 1ZRHA 2BIFA 4YMWA 4FI3C 4ZDKA 3JZMA 2LWIA 1W46A 2QQEA 3PUWA 1VTKA 3TR5A 2QTVB 3OESA 4LYAA 5K8UA 3Q5EA 4YDSA 1E9SA 1G18A 1KOFA 3TVTA 2RGCA 2IXGA 4NU0A 4UKDA 4ASUD 1UJ2A 2YC4C 3BFKA 4JLKA 2EYUA 1AKEA 3DKPA 4QNRA 3LXXA 4TMVA 1EFHA 1XEXB 4B76A 2H8KA 1E69A 2DWOA 4B75A 4WVFA 4B43A 2JATA 4D2IA 1N6OA 2PMDA 4XH9B 4BASA 2EVWX 1OXXK 3ADBA 1U8AA 2FGJA 2IYZA 2ODBA 1GITA 4XTCS 1WXQA 4FMDF 1ODFA 3HU3A 2IXEA 2HEIA 4JKYA 2VH5R 3CH4B 3U7GA 1E4YA 4LC1A 1W36C 5CIQA 1S96A 4YMUA 1GFIA 3NVAA 2CLCX 3NXSA 1W47A 2KI5A 1NIJA 4TLCA 4Q18A 2YOHA 4QFMA 1KO1A 3WRYC 5LD2B 1DELA 2J7PA 2E9SA 3M0EA 4TMKA 1W2GA 3ADDA 1Z22A 1VKJA 1TEVA 4Z8XA 1VECA 1II0A 3NH9A 1GL7A 4XOIA 4TYWA 1II8A 1VIYA 2RMKA 5JRJA 4LHZA 3IPYA 4M1KA 2ANCA 3LFUA 3CO5A 1TX4B 3I8XA 1Q1QA 2ZR9A 1U90A 3Q7PA 4D4JA 1E2EA 4D0GA 2QT1A 4GOJA 4Q21A 1SVSA 2QMUA 3B9QA 3GQBA 2BM1A 2ERYA 3CF0A 1UEJA 1G5RA 4IDPA 2P6RA 2W2TA 1Q21A 4O0MA 4IXMA 3OIUA 2R6FA 3U44B 5FL7A 1N2CE 3TJZA 1IONA 2WJJA 3LA6A 1FMJA 4UXHA 1E2IA 1RRFA 5LPNA 3QKRB 1YZKA 5DGXA 4Q4LA 4KFTA 4IOMA 4KBGA 1RC8A 4ON9A 1KY2A 2WBLC 4RFVA 2WKPA 3L2OB 5G3YA 2F1RA 1MABA 1Z07A 3OEEA 1D2EA 3AF4A 3NTUA 4WXPA 2HF8A 4MGKR 1BMFA 4L4UA 3AF3A 1Z8FA 2EWWA 1QHHB 4D81A 2QP3A 1EFRA 4QNMA 4GDFA 1EESA 3R7WA 2JDIA 1RRGA 2GEDA 2VA8A 4KCGA 2WWHA 3ASZA 3RC3A 2GXAA 1OXSC 4FCWA 4L9SA 4LY6A 1OIWA 4UJ5A 4DEYA 2BBOA 2GA8A 2ZRDA 2VYFA 1FUKA 3P20A 4OQXA 2Q3MA 3I61A 5HKKD 3TQFA 1ZUHA 1G8PA 1KYIA 2QI9C 4MKFA 1ZNYA 3SOPA 3M4YA 2C04A 4PC3A 4BPBA 1OB2A 2H57A 4LBWA 8OHMA 1TADA 1RJ9B 3K0FA 3RC8A 1XJCA 1AS0A 2EFGA 1IXRC 3CPEA 3IILA 4LYFA 2GJ9A 4PSVA 2GJAA 4Q19A 5FPYA 2DHRA 2C8VA 2VBCA 4ESVA 2PT7A 4XWAA 4A36A 4G0NA 5JECA 2ZRHA 3I1FA 5IT5A 2OEPA 5L8VA 3UANA 4BQSA 1F48A 4ZDWA 2CVHA 2V54A 3TW8B 1LV7A 2YWGA 4JL6A 4C0HA 4DDTA 3QJYA 4HLCA 4LYJA 3ICQB 1HA3A 3FFAA 3QKRA 2C5LA 1QHXA 1VG0B 1BYIA 2QRNA 3RHFA 4B71A 3GLGB 1VYUA 1OFHA 2OT3B 2VEDA 1Z08A 2HJVA 3BK7A 4IEIA 4PO1A 5B30A 3BH6A 4KBFA 1V43A 2NO1A 2JLUA 3A4NA 4NYIQ 1W48A 3AKDA 1JAIA 3K0CA 1Z83A 2GBLC 1ZC4A 1CP2A 2OLJA 5GJBA 1XEWX 3K09C 1XD9A 3TE6A 1DS6A 3ZD7A 1T4GA 2ORVA 5AK0A 4L5BA 2NGRA 2A5JA 1XRJA 2CXXA 1JBKA 4UNRA 3LWNA 4JLNA 3U6KA 5CB8A 1ANKA 1JJVA 2F3TA 4W5JA 1E2MA 1N6PA 4QM7A 3OIWA 5LB4A 3KQUA 1Q3TA 4D80A 1OHHA 3C15C 1WBBA 3ICEA 3KL4A 4TZ6A 1Q3HA 1YZGA 1X1RA 3H0KA 1KJZA 1KO7A 2AHOA 2H17A 3VQTA 3B8HA 2RAPA 5KSYA 1HV8A 2F1IA 2RGNC 3MLEA 2I4IA 1S9HA 3EXAA 5EQTA 5DHFA 1DAGA 1KNQA 4IOKA 4D4MA 1ZIPA 1KDTA 3EX7C 1L2TA 4C7OB 1QF9A 4C0BA 2RGAA 4RD1A 1P72A 3MJHA 3FE2A 5CJPA 4TN1A 3KQHA 2OESA 4YC7A 3OZXA 1SKQA 5CM8B 3FMPB 3K53A 4M1YA 5H68A 4DC9A 5JJKA 4IDHA 1OYYA 5B58C 3HR7A 2H16A 2XX3A 3VR5A 4QM6A 4MRPA 2B6HA 2FWRA 2QA5A 3T35A 4P0TA 2F6RA 1G4AE 2FJUA 2BKEA 5D3MB 2C95A 3ZZ0A 4BZQA 4KO8A 1A1VA 1JR3D 1KY3A 3GLGA 1Z63A 2GWHA 4V02A 1ZBDA 2JLVA 3KKOA 2O8FA 4KFRA 1E2PA 1G3MA 2ZANA 1E0AA 4R2IA 4GI7A 3GJ8A 4G5GA 2QTFA 4NCHA 1E99A 3T1OA 3RABA 2IT1A 4B44A 2AKAB 3I5YA 2X1VA 3EPKA 4JS0A 2NIPA 5G53C 3CUEF 2IBMA 1AS2A 1CLUA 4V0MA 5EE9A 1EFCA 2OXRA 4JBXA 2VP2A 4ILEA 4PR0A 4DLUA 2J87A 4RZUA 2MSDB 3LAWA 2B7BA 1UKEA 3DM9B 4RFSA 4Q1FA 1YU9A 1W4AA 1ZD9A 3ZS9A 4E5UA 5H8WA 2JJ1A 4XSHA 4B73A 3DHWC 3EAQA 1MO5A 1TQ2A 1TF2A 3A1SA 2HUPA 2AXNA 1NG1A 1HTWA 3AEZA 1H8HD 5B57C 3R8FA 2JCSA 2OZEA 5KYKA 1KIMA 2ZJOA 1CULC 1X8KA 2O0HA 2V4ZA 2CHVA 2WAXA 3K9LA 4M1OA 3VR4A 4C7OA 4V0NA 4NPHA 4YQFA 5KO2A 4CEHB 4TT3D 4DSTA 4Y0AA 3B1VA 1OF1A 3IO3A 1WF3A 4M1TA 4P31A 3TVDA 1NNEA 1N3BA 1P3JA 3AP3A 3AVWA 3HYTA 3X2SA 2PJRA 4JMPA 1IN5A 1QG2A 2FSFA 2IYSA 3FTQA 3LRPA 2OFXA 4MUBA 4TSFA 1Q44A 1TUEA 2YOFA 2VP9A 1W0JA 1XBTA 5L3VA 3VKWA 1E2NA 2VSFA 3IGFA 3K9NA 1G41A 1JPNA 4FINA 4AIIA 4AD8A 2AK2A 4B6EA 4Q4HB 2ZJ5A 1OYWA 2P5TB 2PZFA 3GJ7A 4LK2A 4Q7LA 4TYPA 2VL7A 2ZVPX 3NDPA 5FOSA 1CF4A 1YR6A 4MITA 1W4BA 5FBVB 1E0JA 1CKEA 3L0IB 5C4MA 2FZLA 1UKZA 3MMPA 2IYLD 1E79D 2XJ4A 5AUNB 1F6BA 2ZU6A 2ZJ2A 2DR3A 1JXOA 4AC9A 3SU8A 4WZ6A 1QG4A 2ZJZA 1FTSA 3FFBA 3Q9LA 1WCV1 4MGZR 2WWGA 1HEIA 2HYIC 1NVXQ 3ND8A 2OAP1 5HZHA 4BFZA 4L15A 4O3MA 1T9HA 2WTUA 5FL3A 1T3SA 2JJ2D 2QAGA 1E9FA 4MGIR 3RYTC 3CR8A 1COWD 1SKYE 4HZUA 5DE3A 1KO5A 1NBME 4LV6A 5EE0A 2EW1A 4DLRA 2IX3A 2X2EA 4QRHA 3K1JA 4LJ7A 3W6PA 5EUQB 1J99A 2ORWA 3IEUA 1RRCA 3S1AA 1FOEB 3WYGA 4HYYA 4C0SA 1R5NA 5J4HA 3SQWA 2QGZA 3LBHA 1E9CA 1KDRA 1GNPA 4HAZA 5CYOA 4OHZA 2VHJA 2OM2A 2B7CA 2G83A 4GSYA 2B92A 1GWNA 4D4LA 2QE7D 2WJHA 4AG6A 4TLBA 3PUXA 2CL7X 5LD2C 2WJYA 4DUGA 1XZQA 1OLOA 4LJ4A 2A7QA 1DAMA 2CBZA 3NBZC 1XTKA 4HB4A 4MKGA 2D06A 2W2VA 1PZNA 1SHZA 1G9XA 2R6CA 3I72A 2O8DB 3PVSA 4XD7D 1Q1BA 3EIEA 4TMZA 1NJGA 5IK2A 2R9VA 2H1LA 2WWWA 1E1QA 1KMQA 1YR9A 4PC2A 3B78A 5HCIA 1TQ4A 3LH5A 2CE2X 2X19A 5EE3A 1C4OA 3TMKA 2D2EA 5KPDA 5J40A 3PENA 2ZSBA 3FMFA 3O8CA 1NKSA 1P61B 5LBIA 3AVYA 4U00A 2V1UA 1SQ5A 2ZUDA 1XCPA 2BJVA 3SYLA 1GKUB 3TIFA 1VCMA 1GP2A 3DKVA 3HR8A 3QI2A 2RHDA 2ZXUA 1P5ZB 2OCPA 3RNLA 1A4RA 4RSGA 4FWIB 4G5QA 3OFNA 2XSZD 1MRSA 1U98A 1IN8A 4JLBA 5FPKA 1S3GA 1CJMA 4XWOA 4LC0A 2C9CA 1N0VC 5FFMA 2XZOA 2Q3FA 4QJ4A 3SHWA 3THXB 3IHLA 3T34A 4W9MC 1E2GA 1TTTA 4JVSB 4M9XA 5EUMA 3A4LA 4C2TA 5BN4A 3RLFA 4DT1A 3GD7A 3TGPA 4JSYA 2GAAA 2QRZA 2D7DA 2WSSD 2QBYB 4MQBA 1SXJC 2NTYC 3BORA 3E5HA 1UF9A 5EP2A 4LJYA 3B60A 4GP6A 4GP7A 5FOUA 2IS6A 2A5DA 1SULA 3PR1A 1GVNB 2FV8A 2J5XA 5CK5A 3QVVA 4WAUA 721PA 5JS7A 3KKMA 2WJGA 3WP0A 4AWXA 4ZKDA 2X77A 1OH5A 2FNAA 3K70B 2K5UA 2OHFA 3HDTA 2GJSA 4BFUA 1E2LA 2BVNA 3MSXA 2X8AA 5H70A 4HUQA 4KODA 4TYYA 4P33A 1A2BA 2ZRCA 1ZCAA 4KLNA 1CRQA 4QBFA 4MRNA 1W5SA 4OI4A 2V6IA 2NPFA 3U7EB 1G64A 1UFQA 4NH0A 2GCPA 4U5XA 4YMVA 1UKVY 2HLDD 4LBZA 4OK6A 1TMKA 4DDWA 2R6DA 3ASYA 2JEOA 1CJUC 4IHQA 4KLZA 3NBXX 5IK2D 5DH9A 1CJKC 3BWDD 3DZDA 1VCIA 2XNDA 1P6XA 2CL0X 3VKGA 2BWJA 5EJEA 4BGDA 3HU1A 4GOKA 4B3DA 4G1UC 5GJWC 4A8JC 3M6AA 1U0HC 4OHVA 1HURA 1XFAA 3F3YA 3RVBA 1E32A 3AUXA 1FL9A 2CCKA 4IOLA 1CBUA 1G20E 1ZUNB 2GVZC 3U3JA 3THYB 1Q57A 3CNOA 5AJWA 2GESA 1Z6TA 1ZP6A 1MRNA 2FZ4A 4EJSC 4PZYA 4IXNA 3K9GA 2IYYA 3UMFA 4GT1A 2G6BA 1R4AA 3FYHA 4OJQA 4KI0A 5JBQA 2WPDD 4MH0R 1OW3B 1OB5A 1W49A 1KI4A 3WBKA 1XTIA 4M9QA 4PC6A 1S1CA 1RFLA 4OL0A 2IF2A 2IUTA 2F43B 3W9YA 2OXCA 1K5DA 4LYHA 3TLXA 4YMSA 1CS4C 1JXMA 1K8RA 1IJFA 3PEVA 1SKYB 1XU4A 3X1WA 1G8HA 1QHGA 1G5PA 3P26A 4FMCB 2FEMA 5FI0B 4PC7A 4BFXA 4URVR 4G5OA 1L7VC 4PANA 1OXUA 2GBLA 3QUSA 5TDHA 2GAOA 1DAEA 3AGPA 2J3EA 3BB1A 4FW9A 4W5WA 1N5JA 3CM0A 1QVAA 5FOTA 1KDOA 2QPTA 4ITRC 4DZZA 3KUCA 4KYUA 3KTAA 1KMHA 2B8TA 1XD2A 4HAWA 3NEYA 3AUYA 4AYWA 1GKYA 1W0KA 1FTNA 3VX3A 4P4SB 1DE0A 1YZQA 1ZJ6A 1JQJC 1DTSA 4EPXA 4XTRA 1RPZA 2V3CC 4RKFA 4LWZA 1Z0AA 3A6PC 1JQLB 2D3WA 2IYWA 3X1DA 2YYZA 1P75A 3LW7A 3P4YA 3SFVA 2HF9A 4QL3A 1G6HA 1R5BA 1UM8A 3EPHA 2QG6A 3ZVNA 2Q9BA 3EZ9A 2ZTSA 1NIPA 2OG2A 2ZSFA 4R71A 3KZ1E 1E2DA 3ONWA 2O8CB 4EUNA 4HZIA 4DBLC 1KI1A 3GFPA 2XNDD 3GLGE 1PVOA 1H8EA 2VSOA 1FX0A 1IN6A 4QGAA 2WMOB 4US1R 5M04A 4DLTA 3U60B 1KAOA 2OO7A 1FUUA 4QHYA 421PA 3CH5A 4P3YA 1Z6AA 2GZHA 2YOGA 4V0ME 1T8UA 2KJQA 2NO9A 3SJCA 3RS2A 2IWRA 4A0GA 2AN9A 3G82C 3SE0A 2FPLA 2ZITA 2CEAA 2G0TA 3RRZA 1VHLA 1ELOA 3D31A 1XPOA 1SHKA 2ZRAA 5HR5A 1N6LA 3CKLA 3IIKA 5L3QA 1EK0A 3TR0A 4WOPA 4B2LA 3RRYA 3LQRA 1P9RA 4DXAA 1Z2CA 4C4PA 2NOAA 1GZSA 2ZQ5A 4JLDA 4KV9A 4US0R 1U81A 3C5HA 2Y8EA 1N6KA 3IHWA 3RS4A 3X1ZA 1DG1G 4JVMA 4QOSA 5DO9A 3NHAA 5SZKB 3K70D 5FTJA 2ZS8A 4RZ2A 3EIHA 4FD2A 4YMTA 2SHKA 1HQYE 3VTKA 2MSEB 3NHBA 2IEYA 1MABB 2C98A 3A1WA 4IVRA 4P4SA 1G7RA 1QVRA 2GXQA 2WJVA 4DLVA 1PLKA 3KQLA 5ELXA 2N1BA 3BJIC 2J7KA 3X1XA 2BMEA 3BFXA 4JBWA 3CNNA 2H18A 2WICA 4JVLA 4HDQB 1UPTA 1XXHA 2BC9A 2D7CA 2R62A 4G3XA 1DAFA 2PJZA 4E09A 2ZSDA 1FP7A 3R7WB 4A2WA 5TY0A 1O87A 1IBRA 1TQ6A 3SJZA 2R44A 2O8CA 3ZVRA 2FSGA 2YWEA 4M1SA 5B64A 1F2UB 1J90A 1ZIOA 3AKYA 4DJTA 1TU3A 1DBSA 3LV8A 3OF5A 3CWZA 2CMKA 1G8GA 3QF7A 2PBRA 2ZJYA 2GK6A 2ATVA 4LPSA 3I92A 1CJVC 2ODWA 2PZGA 2CJWA 3K0FB 2A3RA 1MO4A 1T91A 2ONKA 3NKVA 4AURA 4HDCA 3BOSA 4GRAA 4EAQA 4NYIR 3SBEA 2FFHA 5CDFA 2FFQA 4AKGA 3K9HA 2O8EA 2FPMA 4L16A 4YXWD 5A4JA 4WZAE 1FW6A 2VP4A 5DYGA 4DB4A 2QM8A 4PFSA 2N46A 5J47A 4A0HA 5EXXA 1W5TA 2QPAA 4NL4H 1EWQA 2VHTA 4ZIRB 1L4UA 1ZM9A 3W5IA 1U9IA 4JJKA 2GILA 1I4LD 1YZNA 2DWQA 3CX6A 3E70C 2VP5A 4OI0A 3B1ZA 2XOKA 3HWSA 4DCNA 1NBMD 2YVUA 5KU1A 2GNOA 2GVDC 4CT4B 3G5UA 2W00A 3GP8A 4FN5A 3W90A 4MGYR 4PAMA 4MKIA 2FDCA 1JNYA 1GUAA 4AKHA 1Z0DA 4Q00A 1RYFA 4GMDA 1OH7A 1KK3A 4TWZA 4B33A 4HI0E 1OIVA 4NP6A 3WP1B 1GRQA 2XTNA
chains in the Genus database with same CATH superfamily
5JUWA 1AIPA 1O9GA 3LLSA 4MSUA 5EIBC 5ETJA 1SWWA 4RW0A 3RS5A 3ZKWB 3ZWVA 3A6LA 3USES 1MV5A 3V4ZA 2ZAIA 2UYQA 1CS0A 2W6IA 4S2UA 3U2QA 1HOXA 1F1JA 4DJEC 2QQ5A 3SNKA 1EM8A 2ERXA 3EVFA 5B58T 1CUWA 1ECFA 2EKLA 3LBIA 4XIGS 2NV6A 3A36A 3H17A 2F17A 1E9DA 4LOAA 5FBWB 3REQB 5ADWA 1C5KA 3OI7A 5KSZA 4ZOQI 1K0FA 3OLCX 3CZRA 5K05A 4LVUA 1IIRA 2R60A 1U8YA 4BQRA 1VI6A 3FPFA 2Q9AA 5KUTA 3IO5A 1Y5LA 3TNJA 1Z33A 2DHEA 1NF3A 3HCCA 1X74A 3I5UA 4GI1A 3HGTA 3ZLVA 1GTJ1 3LXMA 3FDXA 4CGYA 1A77A 2HK9A 3F3MA 3LZ6A 5H9WA 1CIVA 1NVMB 4B3FX 2QD4A 4WOJA 4OIFA 3DPSA 1LJUA 3WS7A 1T8PA 1E2FA 1YBVA 3AEQA 3UMRA 1RKBA 2JAQA 1U2TA 1ZC3A 4DG9A 4N76A 4V24A 1L5SA 5D3ZA 1D0SA 2IIQA 4YGYA 1WCIA 4Z51A 2CDNA 2NTEA 1YE8A 2KM1A 2OBLA 4TLDA 4CF7A 4EHKA 3QXCA 4Z0HO 4RVUA 1PQ4A 3CLUC 1GEGA 2VUUA 1SNYA 2Q1SA 3K1AA 4C1BA 2WKQA 2XVYA 3QTLA 1FQOA 5FUWA 1GU1A 3DL4A 4BFTA 4S2EA 4NEGA 4YV0A 1GQRA 2GKSA 3CZQA 4QAJA 4RZIA 1T5TA 4GH5A 4V03A 2ZI9A 4B6GA 4Z6KA 2HSJA 2BD0A 3EISA 1A5SB 2VDJA 1IY0A 2IP4A 5AJHA 3IXMA 3QEBZ 1FJ2A 3B6KA 4KAXA 1PZMA 1I0LA 3OM8A 1TYAE 1F0NA 2Q3JA 5DHQA 2LDXA 2PUAA 2PMKA 2IX9A 3NGLA 1EZ4A 1XCOA 2J45A 3HPRA 3LBNA 4AIIA 3T1TA 3K70C 2RH9B 4DEXA 1OLUB 1S7GA 3CXRA 5JR3A 2UXBB 2GNPA 2ZDHA 5IJWA 1E1CB 2ZCVA 1I4TD 2J6HA 4IFTA 1E9RA 4EEKA 4MWZA 4B3TB 4QBTA 1QH0A 1ORHA 1PCXA 2E5WA 1PQWA 2FEOA 1JPVA 3EGVA 5FA6A 3T1NA 3U3RA 5LQUA 4MRMA 1VLHA 4MDHA 4RLQA 1K9SA 3IODA 1E77A 1T0PA 1U2DA 1ENYA 3GFVA 1S1MA 1U3DA 2GH1A 1PFUA 4CCSA 4EI2A 3WRXC 1KYYA 1K0UA 4F2DA 4GRDA 4MYDA 3SR3A 1X38A 2B8NA 2V6MA 3TX6A 1B8PA 2PEYA 1Z6XA 4CQLB 3DEZA 5J2UA 4DLBA 3LTEA 1XWFA 3CPSA 4FZRA 2JDID 4MVWA 1ND5A 1LC3A 3GXBA 3HWRA 3K2EA 3RVNA 1JDSA 1OCEA 4TROA 3V34A 1PR0A 4OJNA 4Q12A 1UQRA 5KSOA 3OEWA 4DLPA 1P2TA 2FPPB 4HDSA 1XZCA 1EB8A 1ZMBA 2VP3A 2YCBA 1ACLA 4GM1A 2J9FA 2GM9A 4YLYA 1B8OA 2EW8A 5C8YB 4GEGA 1R8JA 3BILA 1SA0B 4M9CA 1I10A 4EEZA 3ZIAA 3W3AA 4XQ9A 5JQWA 3OHSX 1N5DA 3H83A 4WNYA 2RB5A 3I45A 4JLPA 2QROA 5FLEX 1ADYA 3TSZA 1BCSA 3GT7A 3WLOA 5IABA 2EKPA 2IHUA 2DBVO 5T41A 4RXMA 3WNBA 4PPGA 4D43A 3FVVA 5F9MA 2VA9A 1EX9A 1MFZA 5A3RA 2AVDA 1K3UB 2H63A 4ZA2A 5FFNA 1BXZA 1GZ5A 1QQ7A 1AQYA 4FDUA 4MLZA 4TYQA 2O1EA 2WYOA 3A2KA 4MQUA 1GL9B 3E9DA 1E9AA 3IKLA 4O2BA 1O0SA 4AX8A 3OJCA 1B23P 1XQ9A 2G88A 2ZRGA 4D6PA 3FYTA 5I4IA 1LRLA 3L6DA 5BNIA 2G7MC 3ANLA 1T8RA 1HH4A 1EDEA 2IITA 1GSAA 3DTVD 3S81A 3DTNA 3SPXA 1QV6A 4HAXA 1AGRA 1YR8A 4EB0A 2G08A 5JSYA 4EUKA 4TN5A 5A7FA 5CA1F 2I6GA 4OHCA 5KTMA 1T3LA 1AO0A 3K1YA 4L4SA 2ZI7A 1H2WA 3BD9A 5E6RB 3R7SA 1ZIXA 3UHFA 2K7ZA 4YRIA 1U3UA 1FUEA 1HM5A 2NXWA 4KN8A 1JWAB 2H08A 3PNYA 4EG0A 3PNOA 2PT6A 4MW6A 4EI7A 1IYZA 1C0KA 2GRAA 2X8LA 1WZUA 4PQFA 2XBUA 5A2GA 3LWZA 4XM0A 3ZNPA 4P7JA 1Y34E 3CR3C 1PV4A 4ARCA 3JD2A 2L82A 2QM3A 2Q9CA 3LX8A 4HDKA 2OQIA 4J0KA 4S0XA 3VHXA 1L3BA 3A70A 4LKRA 4MYTA 2W48A 4EJSA 1E8MA 2RHJA 4UVIA 1UDXA 3VH3A 2BHRA 1JIIA 1FRZA 1M1NA 3DV0B 2CNOA 2FCAA 2GFIA 2I1VB 3GFRA 3FLAA 2I4LA 3JVUA 3V00A 4DCPA 4S05A 4F84A 3K4HA 2ZAMA 4JVNA 3OTGA 4HFNA 1T29A 1LS6A 1NVTA 1XMXA 3PWZA 5EWMB 5KKCA 1EE9A 1LNZA 1ZHFA 2QVXX 2HWWA 2QZPA 2ZI3A 1U9CA 1DIHA 2BH9A 2GD6A 4Z1MA 3W6OA 2BSAA 2XV1A 4I9UA 3FHJA 2FLVA 3MQFA 5IBRA 1GPBA 3H4IA 4H60A 1W8DA 3ET5A 1CR1A 4O2LA 5BWMA 2X0KA 4LGCA 5FBHA 2E21A 1D4OA 3GJXC 4GIBA 1A8UA 1CTQA 4NG4A 4MR7B 2FR1A 4GWLA 3T9FA 1YR1A 1TC1A 3O75A 5TE9A 2NXEA 4G5RA 1MNAA 4PQRA 2ZT5A 5C52B 1LBQA 3IQHX 1YQUA 3C45A 3GVCA 2E2WA 3K4PA 2V58A 1A97A 1P2VA 2XADA 4I55F 2RI1A 5AVZA 5IUNC 1Z5UA 3CVWA 1RXWA 4RNDB 1EB9A 2JEYA 1GN8A 5A9RA 2CHGA 3KJNA 5KNBA 1FDWA 4DXDA 2TMGA 1M74A 3KTFA 2Y0CA 1JQAA 3FTFA 3GFOA 1YDMA 1Q5PA 4G09A 2FP3A 2O0JA 4IUCS 4LAFA 2B1IA 4FYPA 1V16A 1WB6A 3WRVA 3F67A 5I7UA 2BYTA 3KKNA 5EXEA 3HEAA 3SNHA 5AK5A 2MINA 5AKGA 4EW2A 3BDVA 3I73A 5H0IA 5KB3A 3S6JA 4QE3A 3BE6A 1KI9A 3W3AH 3ZJ5A 2C5EA 4RY2A 1FXSA 4NYMQ 4QGFA 1VSBA 4PYMA 2CXOA 4F2PA 1RQ7A 3HUDA 3KOYA 5GZ1A 4Q9IA 1EFPB 5DM60 2BW0A 3FOZA 1OX4B 2OC9A 1IN4A 1P2DA 2RB4A 4L0MA 2WWYA 3V6MA 2IP2A 2TMKA 3PTLA 1LBIA 3G13A 4M0DA 5DM0A 5C46F 5BYJA 1B8NA 4YAGA 4EHJA 1E3WB 2WMYA 3DFMA 4XQGA 2LPMA 2LCIA 2OTCA 3JQEA 4N0MA 4UTVA 3QPVA 4TS1A 1Z56C 1J5EB 4RCYA 1I7LA 3II6X 4JKOA 5M34A 3SR0A 4L76A 4M53A 3KXDA 4L8GA 5GJCA 4CFZA 1JR6A 1BA3A 3T7AA 3R2JA 1E1MA 1JIQA 5EY5B 2RJNA 5HOEA 2ZPTX 5ITVA 4RK4A 2BFMA 1A2KC 4LW8A 4GVPA 2CNWA 1X3SA 4FR5A 4ZT2A 4AJHA 1CZOA 1Y6JA 5ESRA 5TPWB 5AWFC 4D3YA 4S3MA 1J2UA 4RVGA 5BN4B 4BWVA 1W2HA 5NLLA 4EYQA 4MDEA 3AF1A 4YYZA 5LDGA 2W0SA 2VEOA 4MJ7A 1KEPA 4QGSA 4YP5A 4KU4A 4KGDA 3HC7A 1EI9A 2VXBA 5B37A 2WWTA 5B3KA 1MT3A 2ZE7A 4QXAA 4F0JA 4TZ0A 1Z0ZA 1ZESA 2XLBA 2Z83A 3EPPA 1ENPA 2IF0A 1ORVA 2WU8A 4WASA 5DISB 5ES3A 4C2AA 4QKQA 1OPXA 4NYJR 4HSEA 2ZT8A 3GEEA 3L7LA 1TMYA 1U1CA 2EKQA 1KOGA 1YZHA 3KT6A 2C03A 2HDNB 2A4KA 2PKYX 2G80A 3RBAA 5AI8A 1M0WA 2ZB3A 1R7RA 3EZLA 4NBRA 3SE7A 3ZD9A 4AJKA 5AD1A 2F3UA 4JJ4A 4P34A 5CT6A 4E2WA 3I6IA 1LS1A 1QAQA 1RJEA 2QZ4A 2WSYB 1KZ4A 4ED9A 4DVJA 3ILXA 3NRBA 1E1RA 3NYRA 3PKZA 5ALDA 2RHRA 2IS1A 4FYKA 5JZ9A 3G89A 1V48A 1GN9A 3ELWA 4JODA 4YB8A 4RIIA 4YV1A 4KQ2A 3TQTA 1JHQA 1NVGA 1XCLA 3I9NA 5HFJA 2I7TA 3PEWA 4UCWA 1P4GA 4C29A 1YRWA 1J7KA 1L5RA 1MC5A 4JH0A 8LDHA 4F9GA 4W1PA 2C4VA 2RHLA 1A88A 1G5HA 4R16A 4XPIB 5CDFE 1Z06A 3GLIA 1N0HA 3DOOA 4LMRA 1S89A 1Z0FA 4ER6A 3THWA 3UG6A 3GRUA 3NDIA 4I9NA 4LA4A 1BKDR 3WSTA 2ZYTX 3L8DA 1FS5A 4M9ZA 3SEQA 2JLQA 3KD2A 4AB1A 1U3TA 3AG6A 2ONJA 1NXWA 1GNRA 3VC7A 1QJCA 4Y2YA 4EECA 2UUBB 1WX1A 3HO8A 1KEWA 3KPWA 3IUBA 4AUKA 1F2TA 2VAPA 5M7EA 1TM2A 1VPLA 1E3QA 3EWNA 4KX5A 4IJKA 1ORRA 1BD4A 1G5QA 1LPAB 2IYUA 2OP0A 3HDJA 5EP1A 1EDZA 3ZTWA 2AWNA 1FFAA 3N1UA 2AQKA 2AEFA 1QRRA 2R6AA 1E5LA 2RGEA 3JQQA 4ZP1A 5JXJA 2PSHA 4W7HA 5F9FA 5HF6A 1BZYA 4NJEA 4Y6RA 1XAHA 2DECA 3OZ7A 1IVNA 3HN6A 2IZ1A 5WRFA 3SZRA 4Y30A 4O4IF 1AKNA 4PSAA 1EPUA 2NO4A 2TRSB 3WYBA 4TXLA 1BE6A 2CW5A 2IIVA 2QGNA 3WNCA 5AYVA 4AF6A 2IZZA 1YVUA 1M2GA 5KNDA 5SY4A 2ADMA 2HPVA 3GV0A 2LD4A 3EFOA 4GHWA 3FHLA 4RKYA 1D2HA 1Z4OA 2BDEA 2CV0A 1H4QA 4YJGA 2CFCA 3OMLA 4HH4A 4TSRA 3WZLA 3AB3A 2PWBA 3PRJA 1ZCBA 4JYCA 4LYGA 4MA0A 4PTZA 1KYXA 1RJGA 1W8IA 5IC6A 3T5PA 2ZIUB 3K9WA 3D4LA 4M98A 3ZHYA 1RDFA 4BPRA 4BZPA 4CKXA 1G7CA 3V1MA 4L3WA 5HBGA 3VISA 4CIBA 3Q72A 1PR3A 2YBEA 4NYJQ 1NC3A 3GJSA 2G06A 1WVGA 5E9QA 3CONA 3GGJA 3D4PA 1AC5A 1G5FA 1JVSA 2NT3A 2ZB7A 4HG2A 4OA8A 1R64A 3HB5X 3RSOA 1HOTA 3JZFA 4OB7A 2WSLA 4UD2A 2XQGA 4ANFA 4G86A 4OQNA 1P3Y1 2TMYA 2VDUE 5KNCH 3L9XA 4LVNA 5ALWA 3SHQA 1L7NA 2F3RA 5LXTA 1QH9A 1QO0D 2HFJA 4IDEA 3L0ZA 4KG7A 1MQAA 3LPDA 2OK8A 4OHUA 4QO8A 3V7NA 1JT2A 1ONBA 3HJBA 3OU2A 3TI9A 4FOPA 2ZYAA 4DSUA 3PYMA 3A31A 3S2IA 3LY5A 4HLDA 3HCRA 2ZU0C 3DV2A 1IUKA 1JFFB 1E1KA 4JI0B 5E7MA 2G1KA 2GM3A 4R8SA 3IPLA 3Q2KA 3STTA 3HKBA 3DAFA 3INYA 1QPGA 3JAKA 1I4DD 3WNDA 5KOJB 3EIOA 3NOOA 1TJNA 1EE1A 2KX7A 2GF0A 3E61A 3U9SA 4FGSA 1N0IA 1OBVA 5BXYA 3QVUA 3ZHUA 4FSHA 2BL4A 1JPUA 1ONNA 2HCFA 3DVRX 5CFNA 3QG1A 1XZKA 3FKQA 5HE9A 5KJ1A 2R4QA 4U6SA 3KJGA 1AQNA 2WB2A 1CUYA 5CDUA 4C89A 1YI1A 3TPCA 2FSVA 1SD2A 3FZQA 3P2JA 5ALUA 2GLXA 4Y2XA 1C9EA 1G21A 2W70A 4QJ3A 4R0NA 4RHEA 1YACA 4B82A 2XMQA 3AJRA 3H4MA 5GM2A 2W42A 2JCVA 3KUKA 4M9SA 3U56A 3GHHA 1D2AA 2L2QA 3H6GA 3VC3A 5F5LA 3MUOA 1GZVA 4K81B 2QGFA 5DM2A 4PO9A 2PRYA 3EF3A 3RS3A 3TUJC 4CTMA 5AW2A 2NWQA 3CUKA 3KFVA 1TEHA 2P35A 4I5EA 4GRIA 4KNWA 1Y63A 3W05A 3SYNA 1WRBA 2H9AA 2XWSA 3NTVA 3E9ZA 2VK4A 4ZQFA 1S7CA 5IVIA 1JEAA 5HCNA 2FOIA 4TL6A 3UG7A 3JQDA 1X77A 3LQQA 4JB2A 5IBPA 3U7HB 4KMOA 3VZQA 2FMTA 3OP1A 1XXHB 3B13B 3KVVA 3A6DA 2NMVA 4L2IB 1DJOA 1OJLA 4L8YA 4MYUA 1IDOA 4QOGA 2W2LA 4E07A 1CCWA 7AT1A 3EWAA 1NUTA 3BFPA 4EFLA 5KHAA 4KOAA 4AZVA 4MP6A 4B6RA 3HY3A 5LZ7A 1M34B 1GTL1 2ANBA 2NNWB 5CLQA 4B4KA 2IFTA 4D9BA 4G81A 4M0MA 4QDJA 3FFXA 3ML1A 4D82A 4HNSA 3BH7A 3IAM6 4NDNE 5KS2A 1E2KA 2GX6A 2PYZA 5KQMA 3L4BA 5JAQA 2ZS7A 1B6SA 4WZBE 2ZROA 2XQVA 5AVUA 1VJCA 2O3RA 1SD5A 2QD3A 3IDZA 4XFDA 2PL1A 3SIWA 4BQIA 3G8BA 3ENWA 2O8NA 1C1YA 1NTRA 2Z9CA 5BR4A 1R8SA 2CXUA 3EDOA 1JGTA 3GRVA 1NBAA 1FFCA 5B3AA 3U0VA 4RTJA 1ZNXA 2O8EB 1YVEI 4ALNA 5JZMA 2ZCJA 4OGWA 2Y0EA 1K88A 3UJ7A 1TNDA 5CBPB 1CY4A 5F5NA 2VSYA 1TL7C 3CEMA 2JFBA 3EOAI 2YIMA 4NZ9A 1C1HA 3OU7A 4CTJA 4EHDA 2ZUEA 4M55A 1M0EA 4QX6A 2XCSB 3C6YA 1RZRA 4NJMA 2VJBA 4LV5B 3DW1X 2AOTB 3L1JA 4IIEA 3GLHA 1G1MA 2H4JA 5JMTA 4CL3A 2ZT6A 2X58A 2EQAA 3GJ6A 4CYMA 1TIPA 4FB4A 3C87A 3OPQA 3R4VA 4KITB 1X8LA 3FM9A 3MTAA 4MHTA 1MR3F 5C9ZA 3QBJA 1DEKA 3ZDXB 4AZ3B 1RADA 2M6SA 4TWRA 3TAHA 3KVNA 1HDGO 1UC5B 4YUYA 1FMFA 5C0OE 4W6QA 3D6TB 3QLUA 4ZVQA 1BKSB 5ADHA 4P36A 3J81k 2AK3A 1UT8A 4KFSA 4I1OA 3TLJA 2BGWA 3DUFB 1WDLA 3VZCA 2Z2KA 3CPHA 4R7ZA 4Q9KA 1JSCA 2K2QB 3P32A 2JRCA 3ZHCA 2PUWA 1WU8A 5CK4A 4YLGA 5CXQA 4RTSA 4C04A 2BFFA 2VJOA 1X1AA 1W6RA 2XGMA 4P3OA 3RIXA 3VAAA 2OYSA 4AK9A 2BGGA 1NW3A 1P1HA 3IAM1 4GYJA 3OZTA 1TT5B 2O23A 3UMBA 1T0HB 2BR5A 2HHLA 1JKJA 1JYEA 1W0KD 4UTOA 4UQLA 1NR7A 2B4AA 5IZCA 4X1KA 1UEIA 3PSAA 4CI0B 1VQ1A 1ECCA 1JIXA 1K08A 1VSVA 1LK0A 1WXDA 2RCNA 1QXSA 4K26A 1WHSA 2QTAA 3GJ0A 1V5GA 2GCNA 4PLGA 1RYMA 3E7FA 3V46A 4WXRA 2Q4EA 4BLRA 5IWAB 4RJ2A 1TUBA 3PZBA 4DV3B 2I9KA 3BS4A 3B52X 1IJEA 2NNLD 1JECA 2QL7A 3U3XA 1H9AA 4PLCA 5JJCA 1CPYA 4ZC8A 2AOUB 2R7LA 3BUSA 1LBEA 5GY7A 3EXIB 1XDUA 2R751 1V7ZA 3I5XA 4A15A 1X9HA 2ATEA 4KAAA 3H5LA 4R9NA 1I6MA 3EEBA 3UMGA 2I7XA 4OYHA 4PG6A 1RXSA 1Z0IA 1UZUA 1OFUA 1IN1A 1RLIA 3O21A 3RPEA 5I7RA 1T36B 1S2DA 5DK4A 5FOWA 1QR2A 1J06A 4MW2A 4EQ6B 5JI3E 2HW8A 1J2JA 2JIPA 2HLHA 1HC7A 2NUTB 2WJPA 4FLEA 4ALMA 4B9EA 5I7OA 3GLFB 1VE3A 3EW9A 5IDWA 1EG7A 3NM4A 2X2FA 3H9JA 4TRNA 1X14A 1EYZA 4TL7A 4NARA 1I2AA 3SHFA 3A6GA 4K88A 2QXUA 3FI0A 3C3DA 1ICIA 4ETMA 3HBLA 3VSBA 5K0BA 5CH5A 4X24A 1UOOA 4Y9UA 5TF0A 5A4IS 4X44A 1XD8A 3GRAA 4IRXA 1NJ1A 1O3YA 2JBAA 2VPIA 2PL9A 1P62B 1PJQA 2PEZA 4WTOA 4BNLA 5JXHA 4ND4A 3T8YA 4Y6LA 4UCXA 4EPWA 2QX6A 3ANNA 4NOJA 3WOVA 3B5JA 3ECSA 3S5JA 1J56A 3MTEA 5LA6B 2C5HA 1OV4A 4MO2A 4EKNB 1WCXA 3IDAA 1A8SA 3GUYA 1OAOC 4LRYA 5DWQA 4YUVA 3VPCA 5H4GA 1WZIA 1YASA 4ZYXA 2YVLA 1ETHA 1OYVA 2BFDA 2QTTA 2A57A 2WTAA 3BG5A 4JJ8A 4OLHA 4QAQA 3RSLA 4MLPA 5C8VA 1V8BA 3PC7A 2UZ1B 4PQYA 1KERA 2PXAA 4ZT3A 1UBNA 2BN4A 4P38A 4CIDA 4IWYA 2GTPA 2OBNA 1AMNA 1MJGA 1TM7E 1V7CA 2HTFA 1ATIA 4BAUA 2VQDA 2OOSA 3I34X 3M6WA 3OMWA 3TK1A 5A5GA 4KREA 4EMSA 2ZUBA 1HMPA 4CKBA 5I9NA 2BONA 2C5AA 2O2DA 4TYNA 4FFVA 3TJRA 1GUYA 1HKUA 4M0LA 2I2CA 5HE8A 3ZWCA 1R0WA 1SXJB 1TXGA 2XTZA 5C8YF 1OVMA 2JHFA 1MH1A 3IBTA 2OAGA 4M1QA 3UJHA 1GV0A 3MF4A 4D7AA 4EVSA 1O95D 1CEYA 1XPJA 4E13A 2JGKA 2PBFA 4KIUA 4BL5A 1CFZA 4BKUA 1JLMA 4O4HA 4BRZA 3AR4A 1B8VA 1MV8A 2GPJA 4KSBA 2BHNA 4GL4A 4NV0A 4OU4A 5BSMA 4HAOA 4WK4B 5BN5B 4TSKA 1AGPA 3PQEA 4QG7A 1GRNA 2X86A 4L6IA 2ZFUA 3HYLA 4R2KA 3ESRA 1TKRA 1SVKA 1MRZA 1RTKA 3LIPA 3MERA 3NIGB 5AVOA 5JLJA 5BUZA 3LL7A 3D0RA 3SC2A 2H0RA 5IARA 2CJYA 4TTRA 4BEBA 4F6CA 2BEUB 3TOXA 4NOKA 2QRVB 2XNJA 2ZYWX 3OOSA 3T5DA 4DJDC 4O4LB 1N5LA 1B42A 1QG6A 3RG2A 2E7ZA 4DIDA 2PFGA 4QWMA 4RGYA 1VI5A 3I6BA 3UJ9A 5IAEA 3DVSX 1WCWA 1E7RA 2XA1A 3PGJA 2GUGA 2NSDA 2YICA 4KDRA 2CZCA 4D26A 1P6QA 4H27A 3SD7A 1N4DA 4UUMA 4YK7A 2HHCA 2ODPA 2XGSA 3I01A 1CNMA 4K3VA 5H7XA 1DIRA 4RIEA 1N2BA 3H9GA 1T10A 3AFNA 2YHAA 3KHTA 1ODIA 1NGSA 1IXKA 1RCFA 2FWJA 2RONA 1KSGA 2R11A 3K30A 4TXNA 4Z8YA 4P4LA 4QARA 1H0RA 4BTEA 4FEAA 4FM9A 2A4MA 4O2AA 3Q7IA 2GEFA 4EJ0A 3KQKA 3UUWA 3LT1A 5EWJA 3W5HA 2FXIA 1WSDA 4Q24A 4KSYA 2OK7A 5F1PA 1D2NA 1OBFO 4KQ6A 4J1TA 4UNSA 1E18A 3AQIA 3FJ1A 4UNIA 3C7DB 5SZHB 3WC4A 3QVOA 5BT8A 4XDHA 1QCZA 5BPHA 5KKNB 1FP4B 4P3PA 3OWHA 1BHQ1 3KFXA 4LZNA 2BGNA 3G0HA 1GG2A 5BWLA 3I1IA 4WKNA 5EZ5A 1QLWA 2M6LA 3HCWA 3P9SA 3MJTA 1JEQB 3M1LA 1OR8A 5MDHA 5A5VA 3TLAA 4F86A 1FNDA 3DE6X 4ME6A 821PA 3CUWA 4URYR 3QITA 2OYCA 1THGA 1U2ZA 3E15A 4IQ4A 4OF4A 4RBNA 1L5HA 1T5DX 2OCXA 3ENNA 3L7NA 1AK1A 4E7OA 3ETLA 5CNKA 3ZS8A 1SGWA 3BRCA 1TKAA 2FZWA 2P62A 5JS6A 4CU5A 1WEKA 3PL1A 1ZM7A 5JQGB 4JJAA 3TW8A 5FR2A 3FR7A 2YRXA 3IOEA 1UBSB 3T06B 4L6AA 4MJXA 4EK9A 1V1JA 4POAA 2K7FA 3ZGOA 2WUGA 3P2IA 5DIFA 5AM3A 3DL7A 1WKCA 3HB1A 1CUDA 4WK6A 5GOZA 4ENVA 3LYHA 2PKXA 2NAPA 1U8ZA 1T3GA 1F2VA 2FF7A 1QHNA 2JLRA 4I81A 4DLAA 3GWZA 2HOQA 4FB5A 7ADHA 3LMKA 1UZAA 2A78A 3DC7A 3KB2A 3ZCSA 4DANA 1THZA 5C18A 4C21A 1NFFA 3AVUA 4U63A 4X3CA 1XQ6A 3L7BA 4G1MB 1WNTA 3A28A 4C9BA 1U2GA 1JMYA 4E15A 3WWYA 5JAOA 1N1MA 1V4VA 1YE3A 1ZOIA 2FMFA 2FRDC 4YDHB 2F1OA 4RGQA 2JHPA 5B7NA 1D1TA 3WGJA 2JGIA 2Z4RA 2XXAB 1XN4A 1YJ8A 1TAGA 1DTWB 4EO4A 3BIOA 5DGDA 4IPTA 4TS4A 4H3SA 4LJSA 4NTZA 5ALMA 3ESDA 4G5SA 1ZVVA 4DCCA 2BELA 1KBZA 4PYLA 1KNXA 1N5MA 5CD1A 1T1RA 1NY6A 3PP8A 1FFYA 2QUHA 1WMDA 2A58A 3IP6A 1Z4NA 2ZYSA 3CMCO 2QUZA 4MIEA 1GO2A 2FE4A 2XNCA 5B5SA 4U9IS 4I5DA 4LJAA 3CRRA 2O8BA 2ZLBA 2ZKLA 4MWTA 5DN9A 5DYIA 2EX1A 4JL5A 2G70A 1FDSA 1XMIA 5K8TA 4J0GA 4HK4A 1XZIA 1K6IA 1U9ZA 1HDOA 4DCOA 3OE1A 1II9A 3MUFA 3W5AA 3EVBA 1DIAA 3BK2A 4E5SA 4AKTA 3DWEX 5IHPA 1ZXLA 5J23A 3UMJA 3QG5A 2A9QA 4HN4B 1GGKA 3BXXA 3SLRA 3F6CA 5BPFA 1XEFA 2QV7A 3FYUB 1R8YA 1DT3A 1FLDA 4JP5A 2Y27A 4GR9A 5J1SB 1R5OA 1FMLA 3CLHA 4LYDA 2FDXA 1OLXA 3NVMB 4CM8B 1AGNA 4R3NA 1FF9A 2BMFA 3AESB 4J9VA 4MKRA 4XFKA 3HJTA 1U1GA 3QYFA 4MA4A 4KOEC 2PSEA 2ZS9A 1XALA 3IQXA 1MA0A 4JGGA 3IVCA 3TQOA 3TZCA 1YU6A 1J5XA 4QUBA 4C20A 4BFCA 5I45A 1I0ZA 3TUIC 1ORTA 3GT0A 1WHTA 3W3ZB 4G8JA 2AXPA 5JIBA 4TMWA 3AR6A 2A33A 5HIIA 3AEUB 1KI2A 2R6R1 4YAIA 3RS7A 4EAAA 3SEZA 5EJ7A 3JALA 2FMIA 4PLYA 3GLVA 1KMNA 2JGDA 2PZMA 2IA5A 2BP7A 4WOKA 1L8XA 1U9IC 3GVHA 5COBA 3DEJA 2GEJA 2P9FA 1UINA 2R00C 1XCBA 4WKGA 2B0CA 1EDBA 5EFZA 4EY7A 3IQFA 3T5TA 4NCIA 4JOBA 4GKKB 1YMVA 3BMCA 4MV9A 4C3UA 4O3MA 2GCIA 3EXG2 3CX4A 3K8YA 3SMVA 1ZN7A 2O8VA 4IDFA 3DDSA 2BDTA 1ZK1A 2IPNA 2ORIA 1I01A 2HM7A 2QI9F 3OA0A 4F3RA 3AKZA 5ILGA 3ITNA 4AXBA 5AVRA 3IAXA 1ZR4A 1HL7A 5BVHB 5HDBB 4TTAA 4DCUA 1IY2A 3PQ7A 2IYPA 1R0YA 3QVWA 1Y81A 2OG1A 1MHPA 4WFJA 3BGOS 2D1YA 4ZO8A 1PJ3A 2AZ4A 3CF6R 2G67A 1UANA 2B36A 3EEIA 3KSBC 3B38A 3QW4B 4UPDA 5AKEA 1AUOA 3ILVA 4UUOA 3VR6D 5H3HA 3REFA 1WLSA 3I8OA 4KP7A 3JYPA 2FW9A 4Z9AA 3KHUA 4RANA 2R5NA 4RS4A 4DVGA 4LOKA 3O1HB 4FNOA 4JU9A 1L5NA 5U9CA 2RJOA 2C7RA 3QBVA 4X7RA 1ZISA 2H5EA 3GGCA 1VLQA 2HIHA 1JQEA 4FDVA 5DRTA 3RIYA 3LCVB 3NVDA 1WSWA 3HBMA 3KJIA 4FEYA 4JT4A 4F4CA 3R9XB 4RPGA 5BUSA 3MZ0A 2I1LA 3ICVA 3MHTA 2A5YB 3Q12A 4URWR 2LTAA 2J1LA 4RHXA 4PZDA 4F3TA 4B6JA 4KL8S 4PRKA 4R1UA 4ZQCB 3NFYA 5FTLA 5BR8B 3E7WA 4B4UA 4GX5A 1IOZA 1UXKA 3NH6A 1D04A 4DSOA 2FPKA 1FYFA 2V6FA 1Z5PA 4AVYA 2VZEA 3AV3A 2AFHE 3M5CA 2ZAOA 5CB0A 1F20A 2ZIVB 4XJXA 3W6NA 1K4MA 1YH3A 5KVVA 4MCIA 2GSWA 4RORA 1TQDA 1ZD3A 4X60A 4IW3B 3SS7X 2EW2A 1UPUA 3QU9A 4G0QA 3AK4A 1SIOA 1QIFA 4MWOA 5BQOA 5JJLA 1BFDA 1J8YF 3PUZA 3UAWA 3L3BA 4IGKA 4PEVA 1NA5A 2EG5A 1P6UA 1P73A 3F73A 1JKIA 1K4YA 2XE7A 1HLPA 4F4DA 3J7AC 2G0NA 2JIRA 3E3AA 4HNAA 2V97A 1BTOA 2P8JA 4QVGA 4H2DA 3KX2A 5JAIA 1G6KA 1G42A 1ZWKA 2I2BA 2AGVA 1JA9A 2YR0A 1IU9A 1MN6A 1CE8A 2YV3A 1VXOA 3OX4A 4N0DA 4YJ3F 4A1FA 4QLBA 4RTLA 1IZYA 2IE8A 1DAHA 5AHXA 3E6AA 3WV4A 1BQEA 3E5RA 3OWOA 2E1PA 2Z5FA 2N42A 4I4TA 4XGNA 3UM9A 4EX6A 1KVUA 2CFSA 2O2IA 3OPYB 5BYKA 4JUFA 3V7WA 3MMXA 4PNPA 1GSIA 3H84A 3KL2A 2I6XA 5L4LA 5J2TA 2OHIA 1XRNA 1G5TA 2Y1EA 3HBAA 1SO8A 1OXTA 1NMSA 2X6TA 5EHNA 3ROEA 2ZI6A 5DBOA 5ANRB 5FDFA 4WCFC 1KBQA 4DG5A 6LDHA 3UA4A 1W30A 2DFNA 4FIDA 4TTSA 4UPEA 4KK3A 4UULA 1T8YA 5FFFA 4MDFA 3FJOA 3K0AB 4Z7JA 4F46A 4JQZA 1JP7A 2ZE8A 2XGJA 4DR5B 1YBFA 4RAOA 1SXPA 1M6NA 3GIDA 4U2DA 5EZ6B 1ESCA 5DMHA 1XRSB 3LD9A 3DAYA 2PV0A 4W5TA 3OQMA 4MEJA 5JSQA 1FNNA 1E9EA 2WHQA 2WFMA 3FVQA 4FVTA 4FX2A 4JJFA 4Q16A 2QPLA 1YK0A 4QODA 2PO5A 1XZBA 2G9QA 5JJIA 5DBIA 2GBIA 2XCUA 1ZQ1A 1N8NA 4BB9A 2GEUA 3RVLA 3WYDA 1GEEA 2FMUA 2J0EA 4ACBA 5E0OA 5LWQA 5K6AC 5K6RA 1BS2A 1NT2A 1NV9A 2G3YA 2VPPA 3GG2A 4NCJA 3RFXA 5ALNA 5CA0B 5JNVA 3KAPA 1XGKA 3QBTA 1RQ2A 1VSTA 3A6ZA 1FE8A 2BJHA 2BI8A 3H2ZA 3N07A 2PVPA 4EFMA 4G85A 3NIBA 2WSMA 4GFDA 3ASUA 4Y1FA 1RYZA 2VT7A 1QK5A 3NBKA 4YP9A 3TGLA 1T5IA 1W7AA 2ALJA 3EFEA 1NUPA 3IXLA 3MWLA 3HJUA 4JLJA 5E2BA 1P4JA 3HA5A 1E94E 4O4JA 1GILA 5JLAA 3ZDAA 3M1IA 1LY1A 1NF9A 1PQUA 4ZN6A 1N5IA 2WUWE 4Y2RA 2IE0A 3UJCA 1K8ZB 1U65A 4PS1A 4Q1AA 2Q6OA 5DTEA 2VYND 4ZI7A 4B3CA 4XGQA 4MYHA 2XDQB 3DMDA 1G8SA 1L7DA 2TECE 2Y68A 5DSTA 1UK7A 2I34A 3WWZA 2AZXA 1JR3E 2FMHA 3OE4A 1TYCA 1Z28A 4WLFA 1R9MA 4DA4A 5A3QA 4NCNA 3V4FA 1CDZA 1S2OA 2V6JA 1M0SA 4ZMSA 3EEYA 4TQAA 2GRJA 1HFJA 4RV9A 5REQB 3OTOB 2ZEJA 5HF5A 3F3SA 4DLNA 1PV2A 3UY4A 2ZRLA 1PE0A 2V65A 3A0RB 3I0MA 4M0KA 3SX0A 2QR3A 3JQRA 4Q1BA 3H1FA 1SQ6A 3UMMA 1DC8A 4BVHA 3TG2A 3Q8KA 5AP9A 2WUVA 4TKUB 2OGTA 1TF7A 3L0OA 4MQFB 5AH0A 7REQA 5KYGA 1P1JA 2ZETA 2RI6A 3AZOA 3ZBPA 2GN6A 3HEMA 1JJIA 4LMBA 4X91A 3N3AC 4E5KA 2QBYA 4W4TA 3IOMA 3M5WA 1B15A 1K2WA 2HQOA 4MQ5A 4RKRA 4TYMA 5G0TA 4AMBA 4DS3A 4JC0A 4LTNA 5FWXA 2P2NA 1YL6A 4AS3A 2CE7A 3B85A 1QYVA 3FHOA 3MRSA 4CKEB 1RE0A 3GFSA 3C5CA 3UJBA 1MJGM 3PLRA 5FI3A 1L7QA 5CVUA 3N70A 1DO0A 4UNNA 3USCS 2IPLA 3B9PA 1WW3A 1IMJA 4LDJA 2A0XA 2ZIGA 3H1GA 1QYIA 2YCLA 3IA7A 3HDVA 2I4NA 1A1SA 3HYRA 1CUCA 1MDBA 1Q2UA 1VCHA 3QFTA 2ZREA 3QELA 3UMSA 2FPSA 1NURA 4MVJG 4KPGA 4MW4A 4M22A 3H11A 3U7JA 4BOYA 3DL2A 2CXPA 4NRDA 2WKSA 2H54A 3H8JA 2WUFA 2HPZA 1M9NA 2HXSA 3DBRA 3IP9A 5L7YA 3NM6B 4QBIA 4REOA 3BTSA 5CYFA 5GJVC 2QZSA 4FHFA 4F06A 4GPTA 4OLAA 3V55A 5AJZA 1GPMA 4Q3EA 1I94B 5KINB 5LVAA 5HRUA 2R1VB 3G49A 1E0SA 3OCCA 3V33A 1YIAA 2C2GA 3ZZNA 4EG3A 1A9QA 3AHCA 1ESEA 2IZOA 3I39X 1WMFA 4NXMB 1SCDA 3IV6A 2OA0A 3HJGA 1Y1TA 2E0IA 1M6EX 2FPWA 2BAGA 2D4AA 5KDOA 2PJUA 3AY6A 4BGIA 3SBXA 3CRW1 3H87A 1RT9A 1BW9A 4B3IA 4BFLA 1G16A 2AI3A 1Z7YA 1W44A 1R6BX 4DA7A 3L07A 4KE9A 2Q2VA 3GLTA 2HEGA 2ZTVA 2H92A 2FP4A 2I3AA 2Y05A 3FZGA 3GH3A 3KZXA 3L77A 3WA6A 4RDXA 1CD5A 3NBYC 2WIGA 3KQPA 3WLNA 3WR5A 3PDWA 5JSZB 4E5NA 1PZXA 4MPDA 1OLSB 1ZU4A 2OMEA 3LVQE