3T0IA

Crystal structure of complex of bt_2972 and adohcy, a methyltransferase from bacteroides thetaiotaomicron
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
245
structure length
245
Chain Sequence
FSFICNYFKLLKRQGPGSPEATRKAVSFINELTDDAKIADIGCGTGGQTLFLADYVKGQITGIDLFPDFIEIFNENAVKANCADRVKGITGSMDNLPFQNEELDLIWSEGAIYNIGFERGMNEWSKYLKKGGFIAVSEASWFTSERPAEIEDFWMDAYPEISVIPTCIDKMERAGYTPTAHFILPENCWTEHYFAPQDEVRETFMKEHAGNKTAMDFMKGQQYERSLYSKYKDYYGYVFYIGQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of complex of BT_2972 and AdoHcy,a methyltransferase from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase
molecule keywords Putative methyltransferase
total genus 86
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3t0iA00
4HTFA 2OY0A 1HMYA 1KR5A 2ZIFA 3DR5A 3PX3A 4QVKA 4WVLA 2PX5A 3DXYA 5GINE 1IY9A 4KDCA 1ZHFA 4QVGA 3P8ZA 4GQBA 3OZRA 5K8VA 2XYQA 4QTTB 5K0FA 2NP6A 2PGXA 3HCDA 3MAGA 4HGZA 5EHGA 1JQEA 4OQDA 2JHAA 5LQCA 4Y2HA 3SX0A 2R6ZA 5MHTA 1XJ5A 1NBIA 1X1DA 3KU1A 3CCFA 4UOEA 4YV0A 3DLCA 3P71T 3M33A 5EVJA 1F38A 1NT2A 5HIIA 5DTMA 3NWBA 2GH1A 3ERCA 5DXAA 3C6KA 2YTZA 2C7QA 4H0NA 5E1MA 5E9QA 1RJEA 2P40A 4AX8A 4B17A 3NW9A 1G55A 5ICGA 3I5UA 3KQQA 4X61A 3FTDA 3BUSA 1P91A 3O31A 1XDUA 5E9JA 3EVBA 4RWZA 4C05A 3T7TA 3A7EA 2IBTA 3ID6C 4ER5A 3CJTA 2BH2A 1FJXA 3AXSA 2EX4A 5HIMA 2C7RA 1QAOA 2I9KA 1R74A 2XYVA 2LD4A 2CMGA 2G70A 3EVFA 3EVZA 3M6UA 2NXEA 4RV9A 2KW5A 3WSTA 5BP7A 3REOA 1I1NA 3KPYA 5M5BA 4E2WA 3B3GA 2AVNA 5ICCA 3HA7A 3DXXA 2PJDA 5EPEA 3T7RA 3BWCA 2UYQA 2G72A 3PVCA 4CKBA 5FA8A 3LDGA 4GC5A 4AZWA 1FP2A 2OZVA 2ZCJA 1AQIA 2EJUA 1XTPA 3AXTA 3HVHA 4BY9E 4EK9A 5KQSA 4RVFA 3LPMA 4U7TB 3ME5A 5JUWA 1JSXA 4X1OA 3KR9A 1QANA 1MJFA 3BGVA 5E1BA 3DMFA 3GDHA 2FPOA 3BZBA 3HCCA 2AOUB 3P97A 2UZ4A 1RI5A 3SR4A 4A6EA 3B3JA 3GCZA 2VDWA 5K01A 4XCXA 1NW3A 5EKXA 1L1EA 2CL5A 1QYRA 2Z6UA 4MHTA 4EVIA 3M6WA 2BM8A 2WA1A 5EGSA 2H11A 3DXZA 3GIWA 5EZQA 4E2ZA 2CKDA 3PX2A 2AS0A 4OX9Y 4F86A 4GC9A 2QRVA 1P1BA 3O7WA 1JR4A 4GUAA 3C3PA 3LDUA 1EJ0A 1XVAA 3JWGA 4BLWA 4ER6A 1PJZA 5DWQA 5E1OA 5K03A 3UJCA 2AOTA 3TPZA 1EAMA 4C07A 4LG1A 3HEMA 1NW8A 5EKUA 4RTJA 2XYRA 2VDVE 3NWEA 3PB3A 4YMGA 3B5IA 1G60A 5LR6A 3H2BA 3LHDA 1UIRA 4HSGA 5E2AA 2EG5A 5CCXA 1WG8A 3B89A 1I4WA 3NVMB 4FGZA 2PXCA 4M36A 2OBFA 2PT9A 5FA5A 1TW3A 4E70A 3Q7EA 1RI4A 3HNRA 1Z3CA 3MTEA 3SSNA 1UFKA 2PBFA 4EMSA 3I9FA 3U81A 2IFTA 3JWHA 1KIAA 2ZBQA 3C6MA 3SSMA 3P2IA 3P9IA 4PONA 5E8RA 3G5TA 2PKWA 1EIZA 3HCFA 4PYJA 5FCDA 1L3BA 3G2OA 4PIMA 1I9GA 4HRAA 3SM3A 3UWPA 2C7OA 4QQKA 4RVDA 4C03A 4DQ0A 3JWIA 2PY6A 5FTWA 4PIPA 2OYRA 3E8SA 4JXJA 5FWAA 1WXWA 3KKZA 4CKCA 2BR4A 2PWYA 2ESRA 3CGGA 3HP7A 3QOWA 4RX1A 4DZRA 4CXMA 5HFJA 4CTJA 3CJQA 5CUQA 4FZVA 2GPYA 5B1SA 4YV2A 5HEKA 1F3LA 4PYQA 4M37A 1KHHA 3KQYA 3BWYA 4FR0A 3HCAA 3OZTA 3KPUA 4RTLA 3GJYA 3G2QA 4PGHA 5HIKA 5CIYA 5GWXA 2AOVA 5KQRA 5P8WA 3HVKA 5FADA 3DLIA 3A25A 2ONYA 4X41A 1HNNA 1NBHA 1N7JA 3QOXA 2ZBPA 5CVJA 3UBTA 4YMHA 2Q41A 4RYLA 2QY6A 4Z2YA 4KDRA 1YF3A 2HTEA 1L3CA 3SMQA 5C9ZA 3PFGA 2YUIA 4OBWA 3UZUA 3T7SA 4RTQA 4P7KA 2UYHA 3ORHA 3VSEA 3M6VA 4BP1A 4EQZA 4RTPA 4PNEA 2JH8A 4XUCA 5EC8A 4IV8A 2AN5A 3OU6A 1NW5A 3FPGA 2IP2A 3LCVB 4ATNA 2OKCA 4E33A 1YUBA 4PYNA 5EG5A 1SQGA 2QM3A 3OPNA 5K0EA 1X1BA 2P7IA 3B3FA 3LGAA 4LWOA 1AV6A 1NW6A 5DX0A 5HOQA 4Y30A 3KQWA 7MHTA 3FRIA 3P2EA 1XDSA 5DSTA 2AZTA 3BWBA 2OB2A 4FT2A 4KW7A 2V7EA 5LQJA 1FPQA 3BGIA 4GBED 4MIKA 5KVAA 1R8YA 1SUSA 4YUXA 2PVCA 3PLAE 3UJ8A 1XDZA 1U2ZA 4E30A 2K4MA 2FK8A 4PYIA 4C4AA 3MCTA 3EEOA 3KQSA 3EVEA 2OO3A 2HNKA 3FYDA 4OA8A 3O4FA 4DMGA 2ZWAA 5K0CA 3FPJA 3K0BA 3TKYA 5GP1A 5EZSA 3UA3A 5GM2A 3E05A 3SXJA 5EIFA 4ZTBA 1G6Q1 2PT6A 3LDFA 4LWPA 4RVHA 2AOUA 3G5LA 2OXTA 3UJAA 4AUKA 1RI3A 3K6RA 3RW9A 4RTMA 5GIOE 3FRHA 3G7UA 8MHTA 1OR8A 4YUZA 3AJDA 2VDUE 3CVOA 4HC4A 4X60A 5LSAA 2B78A 4DA4A 3MHTA 3DOUA 5HZMA 1VE3A 3V97A 3R24A 2ZW9A 5E9WA 2EFJA 3EGEA 3FUVA 3R6TA 4KVZA 1RI2A 3I64A 2CWWA 3A7DA 3OCJA 4HTFB 3HA5A 3VC2A 2O06A 1YB2A 2P8JA 1VLMA 2QRVB 1TPYA 3BWMA 4PYOA 5EMMA 5FHQA 3KQOA 1H1DA 5DM4A 3NDJA 1O9GA 5FQNA 2EJTA 2ZWVA 5DLYA 3TR6A 1P39A 3V8VA 1IXKA 1KXZA 4P7JA 3HCBA 4XUDA 5FUBA 4BLVA 3R9XB 3NJRA 2FYTA 4FT4A 2V74B 3G88A 3LKZA 4NECA 1JG1A 5LQKA 4M7RA 2VZ9A 4C06A 3MTIA 4IKPA 5CVUA 3CKKA 2CMHA 5DPMA 3LX6A 1R18A 3GRZA 3FPHA 2AN4A 1N2XA 1DCTA 2G71A 4DCGA 2JH9A 2B3TA 3NVKI 2ERCA 3KR0A 3LKDA 2NYUA 4P7GA 1XXLA 3EMDA 3HCEA 2I6GA 3AY0A 2AOWA 2YQZA 2VS1A 3OU7A 4P7FA 5IH3A 4RTKA 3BT7A 4PWYA 2AR0A 3HA3A 3GU3A 2A14A 1M6YA 1WY7A 3CBGA 2NXJA 3PS9A 4FSDA 5EMKA 1QAMA 3MCZA 2ZULA 4ER0A 3SVZA 5K05A 5EMLA 3OE4A 2FK7A 5T67A 4YV1A 10MHA 2YR0A 3KPVA 3MGGA 4C04A 4EKIA 1JTEA 5DTRA 1V39A 1Q0SA 2ORED 3FUTA 1SUIA 3GRRA 2IBSA 1EG2A 2NNWB 3ELUA 3DH0A 2UYOA 5G02A 2P7HA 2GAFA 4QPNA 5EEGA 2P3OA 5FHRA 3BGDA 3FUXA 1YFJA 2WK1A 1INLA 2DULA 3DTNA 3G8AA 3LSTA 3TMAA 1JQ3A 4BP3A 1JSZA 5H02A 4PGGA 1B42A 3OZSA 5F2KA 4AZVA 1RJFA 3G8BA 1WS6A 3A27A 3IEIA 4WXHA 4QDKA 1VL5A 4E31A 5KYGA 5CCBA 1KPGA 1O54A 3LCUA 3ELYA 4YUWA 4DKJA 2BR3A 2NXCA 2JHCA 2H1RA 3A4TA 2G8NA 3TFWA 5K09A 4P58A 3FPFA 2O07A 1BKYA 1G38A 2XVMA 4RTRA 4FSXA 5BW4A 3FTCA 4F84A 1JQDA 3TM4A 3CJRA 3EGVA 5C1IA 3GRUA 2FCAA 4DF3A 5HILA 3LBFA 4A6DA 1M0EA 4IV0A 3VYWA 2HWKA 3Q87B 4OBXA 4POOA 3B7PA 3RIEA 4GF5A 1T43A 1M6EX 4GOMD 1EJ6A 5DT2A 5CD1A 2I7CA 1MHTA 4R6WA 5LQRA 4YUYA 1ZGAA 4ISCA 1SG9A 1BC5A 2BR5A 2AOTB 2AN3A 3SGLA 4M38A 2BZGA 1R00A 5DX8A 5BW5A 4GOLD 3ER9A 2C7PA 2JG3A 1PRYA 2AVDA 4AZSA 5DM2A 3ANXA 3EPPA 1ORIA 3F4KA 2ADMA 3SSOA 2ZZNA 3D2LA 3LECA 3I53A 4RVGA 3UJ7A 1AQJA 3A26A 5ERGB 5JR3A 2R3SA 4HGYA 1BOOA 2Y1WA 3KQMA 3KR1A 3TKAA 1G8AA 1N7IA 2XBMA 4KIFA 3G2PA 3FYCA 4PYMA 1KYWA 4MWZA 1IM8A 5DSXA 3EVDA 3RODA 1FBNA 1SKMA 2ZVJA 2P3LA 2WA2A 4PCAA 4V0QA 2YX1A 4XUEA 5CVVA 9MHTA 2ZBRA 1VPTA 3ELWA 2GA9A 3EMBA 1JG3A 3UJ9A 1D2CA 1VIDA 4L7VA 5HIJA 3GXOA 3LL7A 3S68A 2O05A 2IH4A 4CWAA 3OFKA 4FP9A 4GEKA 2UYCA 3HM2A 2E5WA 3LBYA 4DM3A 2GS9A 5DRYA 3IHTA 3MQ2A 3NTVA 4HG2A 2PV0A 2NXNA 5DM0A 5ICEA 4QQNA 1VBFA 1AF7A 3MB5A 4FS8A 1UWVA 2OB1A 2IH5A 2PX8A 3KPJA 3C3YA 4E2XA 4KRGA 3T0IA 3EVGA 5T64A 3EVCA 3G2MA 1O9HA 2VP3A 3P9KA 3OU2A 1TW2A 4GOOD 4MQ4A 1YFLA 5K0NA 2B25A 1RI1A 2H00A 2OPBA 3GWZA 3MERA 3E23A 3UJ6A 3KHKA 1SQFA 1D2HA 3UFBA 4PYKA 1JG2A 2YXEA 4QTUB 4V0RA 1KPIA 3IV6A 1G8SA 5D1HA 3DUWA 3C0KA 4AZTA 1R8XA 5IKMA 1X1AA 5F2NA 2ZIEA 5K0GA 3TRKA 3E7PA 4RTOA 5D1NA 1NV9A 1XCJA 1L9KA 2IPXA 3R3HA 5F2OA 2P41A 3OFJA 2B9EA 1KYZA 5ICFA 2HR1A 2FHPA 3EGIA 5GIPE 3HVJA 3L8DA 3P9NA 1ZGJA 1EQAA 2P35A 3CC8A 5CM2Z 4CKEA 1YZHA 4G56A 3FTEA 3BXOA 3GO4A 1JTFA 4IWNA 2Z6AA 2HV9A 3DULA 1RJDA 2ZZMA 1ZKDA 2JHPA 5E1DA 4KIGA 5EOVA 5DRTA 4QPPA 3TM5A 1FP1D 1NW7A 2O0LA 3ELDA 3NDIA 3THRA 1QAQA 3P2KA 5C0OE 1NV8A 4K6MA 1QZZA 2P1DA 5LQUA 4E2YA 2PX4A 2G1PA 3BKWA 3QV2A 3M70A 1KPHA 2ONZA 2ZTHA 1X19A 3GGDA 3PTAA 3FTFA 5EEHA 4DCMA 1XCLA 2ZFUA 3KR2A 4F85A 3M6XA 3UJDA 4OA5A 3VC1A 5U4XA 4RTSA 4YUVA 2IGTA 4KWCA 1Y8CA 4MTLA 2B2CA 5CVEA 3THSA 3X0DA 5EIWA 2PLWA 2GB4A 3GNLA 3AWIA 3GRVA 3UA4A 1D2GA 3JWJA 5KS2A 4RTNA 3ER8A 3TOSA 4X63A 5FULA 4ER3A 3R0QA 4QDJA 5EMJA 5K0LA 3NMUF 3HTXA 2FRXA 3I58A 3KPWA 3KQTA 4HH4A 2AOXA 2QE6A 2GLUA 2YXDA 4CTKA 2ZIGA 3P9CA 2N47A 3FUWA 1BHJA 4R8SA 3FPEA 2NP7A 1WXXA 4C08A 3PFHA 2ZSUA 4R6XA 2PXAA 1JG4A 5GM1A 2P3QA 1Q0TA 2IH2A 2PXXA 5FQOA 1DUSA 2IDKA 3DMHA 3KQVA 3GRYA 1R6AA 1VP9A 4PCLA 1KP9A 3G89A 3IYLW 3TLJA 1RJGA 3LCCA 2ZZKA 5LQAA 2Y1XA 1L3IA 3FZGA 5E8JA 5LQNA 4GOND 4RSRA 5K0BA 4U7PB 2DPMA 2Z6QA 3FUUA 4E32A 5BXYA 3M4XA 2IDJA 4O29A 5DTQA 5DXJA 2O57A 1NE2A 3EEYA 4R8RA 1ZG3A 4EKGA 1X1CA 1VQ1A 2JJQA 2YXLA 3TQSA 2PX2A 2I62A 5GOZA 3DP7A 4OQEA 3EVAA 5EQJB 3KQPA 4LECA 5EHIA 5DM1A 4PYLA 1WZNA 1VP3A 2PWPA 3HVIA 2QYOA 2PSSA 2YVLA 2IIPA 4BLUA 1ZQ9A 1SVUA 5DX1A 4PINA 3DMGA 2F8LA 5E2BA 3PT9A 3UJBA 1ORHA 3BKXA 2XVAA 1YZ3A 5K0JA 5CVDA 5FWDA 1NKVA 1P1CA 1DL5A 2ZLBA 4ER7A 3OE5A 2HMYB 2BM9A 5T6BA 4R05A
chains in the Genus database with same CATH superfamily
3L18A 1UAGA 4ARBA 4C14A 4F5WA 5DHAA 3BE5A 1AGPA 2P77A 3HJNA 4OHVA 5IBCA 2AC7A 4MV0A 1KSHA 8ATCA 1Z6AA 3VJRA 4DJ5X 1ODTC 2A0UA 3D4IA 1TM1E 3H75A 1Y5MA 1YQTA 4OXNA 2QD4A 3W79A 2AN9A 2VHQA 4BRZA 3STVA 5DHQA 1SFRA 1O3YA 2PZBA 4KRFA 2B61A 4QOHA 3CCFA 3U6BA 2COUA 5HG0A 5B4UA 4BO8A 2FOLA 3DLCA 2HX1A 4HDNB 4CEIA 1S2OA 3F5MA 4OSOA 4X1IB 3WY9A 5C46F 4HDNA 4K6GA 1ACJA 4P3KA 1R27A 2OHXA 3OUZA 4WZBE 1SC4A 4RETA 1IUKA 3D3JA 4W7SA 5AD1A 1SBNE 3JQPA 2R2AA 3SZMA 2V8OA 5HP4A 5KI6A 1NYLA 2JDID 4D9GA 3OX2A 1C0PA 3TI7A 4E5MA 1R37A 4F21A 2I3GA 1KE1A 4TV9A 4B83A 3EDQA 1Z0FA 1QFMA 4ER5A 1U1EA 3CJTA 3NBAA 4PN7A 5IM4A 1PNOA 4YCJA 1LSJA 3FDZB 2Z98A 1CJMA 2YNMC 1EX6A 4WK4B 2ZG6A 1DGQA 2ODQA 1G3UA 3O0TA 4U7DA 3KXPA 2C8KA 2LD4A 3PC8C 2HIMA 3QLVC 4I1SA 4TLCA 1Z08A 1RAHA 2KW5A 1CBUA 3KSAC 3RJZA 3SZLA 4LVOA 3EGXA 2QTHA 1PGQA 4UUQA 2XNSA 3BMNA 5KJ1A 3HBNA 3PCRB 4AZWA 4BO1A 4UTNA 4RS4A 1N8TA 3AXTA 2JZCA 4BY9E 3OJ0A 4D56A 1RW4A 2ZIZA 4RVFA 2CN1A 1VHTA 2VDNB 4K6CA 4TWJA 4CM5A 4EZBA 1FJGB 1DEXA 1TECE 2O20A 4YP6A 1R0CA 3RM3A 3C7TA 1F8XA 3ZJVA 2NVUB 1DCMA 3AOEC 4RPKA 1E2IA 2UZ0A 4HS9A 4HL6A 3OT5A 3R1IA 2NPFA 4ZDKA 2C58A 3FCAA 5TQ2B 4HNAA 3BX1A 4G4SP 5AW9A 2WFZA 3ECCA 2VPZA 4RF5A 1SZPA 1XQWA 2NQTA 2O5VA 3CU5A 4NU0A 2G67A 2WD7B 3LDAA 5EGSA 3WA6A 1DKOA 3GIWA 3ZWNA 1KIMA 1LBTA 1XAJA 3EZFA 1YV9A 3PX2A 4NG5A 4PG4A 1PHRA 3NUQA 1UPAA 3QLJA 1XXHA 2P27A 1JR4A 2VLBA 3WAKA 1AA9A 4C1BA 5FBRB 1PJZA 1V6SA 3FGZA 1DC6A 2F1RA 2B83A 4X0EA 5ENZA 2AMVA 1CWUA 2F43B 1CQPA 1ECPA 3RI3A 5EXTA 4EG7A 4B73A 5HXAA 1UZNA 3JD3A 4JGGA 1YRBA 3V4VB 4K87A 3LC0A 1I4EB 3EGDA 3H2BA 3FCXA 1BE6A 2BAGA 4YHHB 3IC5A 5JJ5A 3B89A 3BEOA 5EIBD 3ND5A 3SQDA 4OHOA 5KMGA 3D3QA 5EMNA 1D5CA 2RI0A 2VJQA 2WVJA 9ATCA 3KSBC 3V46A 4ZOLB 2INGX 1H2RS 1VCOA 2Q2VA 3K92A 3GDWA 3NHWA 4X3CA 3GZNB 3JWHA 2LWIA 1R16A 2I0FA 4LNAA 1N7HA 5GZ3A 1ZCAA 5K99A 3UHFA 2XWBF 3G5TA 4TWZA 1C3XA 4OHXA 3RBAA 4XD7D 4EHLA 1L3BA 3I0MA 5IN4A 4HRAA 2A9KA 2P4QA 3MOIA 3QUCA 1YS7A 3GLKA 4NE9A 1EBBA 4I3GA 2Q3HA 4MITA 1SB9A 4X24A 3SX4A 1HTWA 1T5TA 2ZAGA 3E8SA 2IEDA 4IR7A 2N3ZA 3CPSA 4GM4A 4O08A 5GJWC 1RRPA 2VSXA 3ZLBA 1KI8A 1SIOA 1WUHS 2H06A 3CF4G 4DZRA 2NZUG 1VXRA 2J30A 2UVDA 3D4OA 1UPBA 1HT0A 2GUWA 3L49A 3EIQA 2QP9X 1P6XA 4K1LA 3G5MA 3O4GA 4UXJA 4ZRMA 2XXAB 2BGJA 3W8DA 1T0JB 1QTRA 4NZOA 3G0GA 1M34B 3EEQA 3EW9A 3HBMA 4GU5A 3MT9A 3NQ41 3WP0A 4H7HA 1K7YA 1T9BA 3EYWA 1O5IA 3PEFA 1NBHA 2FP4B 3AJ8A 3KKLA 3ADKA 3BDAA 3Q5DA 2QY6A 2W4QA 3NRBA 2X23A 3RVNA 4D3ZA 1SUWA 4ARZB 1JSRA 4DREA 3QBDA 4A15A 2YN4A 5B7QA 2O8BB 2H85A 4IO0A 2L2QA 3K1YA 2Z1NA 1OB5A 1TT5B 1CUZA 2Z4SA 1JDZA 1FU7A 1QG4A 3HXKA 5DE3A 3D3WB 4IDCA 4F6RA 5K7SA 4Z7JA 1HTBA 4BP1A 5E3HA 2ZR0A 4OXYA 4R9VA 3HJGA 4XUCA 4YLEA 1OX6A 1CUDA 1ZLYA 2AN5A 2GVNA 2O2JA 3IMFA 5LPNA 4P0PB 4DIEA 2PKRA 1NI5A 1U2GA 4DV2B 5IH7A 3F6PA 4KCGA 2ZIUB 2FSVC 4L9WA 1Z68A 5A6SA 2I29A 1ADCA 3V3KA 3RJ5A 1YZQA 1HE5A 3UHOA 2ICAA 3STHA 4EY4A 1K9SA 2C59A 3OQPA 4A2PA 1JH8A 3W6NA 3E6AA 2QORA 1XFDA 1BJTA 2H5IA 3E5RA 1ZIYA 4ZFNA 2ZS9A 1YL7A 3EUFA 3I1IA 4F3CA 2ZWIA 3SIWA 1JHVA 3HPRA 2Q4RA 3AG6A 3PDJA 4GVPA 3VPAA 3FPJA 1GILA 3TKYA 5EZSA 3P20A 2B0CA 3W6UA 4RAQA 5KNBH 1X80A 5AMXA 5EIFA 3LP6A 5K45A 2JFBA 3FVTA 1GZSA 1YZGA 1ZI9A 2AI2A 2DTXA 2VTEA 3LYAA 2Y0CA 3C8HA 1N2EA 1V8BA 4REQA 4F3YA 5TQ0B 4MV4A 1OUMA 4B3GA 2YBEA 1NRJB 1VCHA 1J7KA 1M2HA 2XCQA 4GE3A 1NN3A 5LSAA 1E2UA 1Z2NX 5KWEA 1K8XB 1MAVA 2ZW9A 3QJGA 5E9WA 4YWHA 5IVDA 4EELA 4MP8A 2BFCA 2X1VA 2QYTA 1R12A 1JA1A 3BFXA 3ZQ4A 3IERA 5DN9A 4I55A 1GUYA 1PSZA 4TMFA 4WI1A 2HI0A 3CH4B 1TX4B 2XWJI 3TNJA 2F62A 3WHPA 3FMOB 4EWLA 4MPRA 5I7VA 5FH9A 4QRIA 2CDCA 1L5VA 3BFVA 5COBA 4FBGA 5DK4A 5TF4A 3MTJA 2WUVA 3R9XB 1ETHA 4MVCA 4N7MA 1IHDA 3TZKA 4YLGA 1ZVMA 1G3MA 1K1EA 1NFRA 3MJCA 4OUDA 2LNDA 4G4GA 5IARA 3OKPA 3KLNA 1IPEA 3OZEA 4XWWA 3W9YA 1AY0A 2EFCB 3K0FB 1YC2A 2HRQA 2BHSA 2W2KB 3HZZA 1OXSC 4AZ0A 1FFXA 1E69A 2J48A 4EJ2A 3IGFA 1OW3B 1LV7A 1U9CA 4ZVUA 1OASA 3S2FA 4E5DA 2B3DA 2QR3A 5JWRA 2B37A 2IXGA 5AVVA 4XVQA 2WFLB 1UINA 3HRIA 3SIXA 4D97A 2UXDB 3U9SA 2QV0A 1PK8A 3LZ6A 1BN7A 2IOHA 2E5LB 3HJFA 2VP0A 1JZQA 3SLGA 3N2GB 4RQUA 3PBKA 2VH5R 2N9UA 1IC6A 4OJQA 1NXPA 1KVTA 2Q3LA 3R0IA 4K9OA 1B14A 5D7BA 3ZXUB 1IDOA 3FUXA 4KLNA 1TM3E 5ES4B 2A5LA 3CYFA 4Z3DA 3K7EA 3RFVA 2HK8A 3V6MA 5HVNA 1QHHA 5E4JA 4D26A 5C5DA 1AOXA 3NXSA 1F60A 3FKJA 3GLHA 1T34A 3PLRA 2IEGA 1BG6A 3OZSA 1OHHD 2D54A 4M8NE 3H5AA 1MORA 3W5SA 5JOQA 1QGZA 1LDGA 1RRGA 1W5SA 3WA7A 3SQXA 3C97A 1GCIA 5EJ4A 1JIJA 4MVJF 1C9MA 3FF4A 2R6HA 9LDBA 2NQ2C 4C0QC 1FRQA 1RBZA 3B36A 3DGFC 4KXWA 5HQ3A 4GLOA 4DKJA 4YRJA 1DBIA 5B3AA 4JLUA 2DHRA 1GZDA 4LC1A 4MVYA 1KBQA 4OB8A 2OBNA 1NI4B 3LM8A 4FSXA 4KUGA 1O4WA 2X6QA 3LPAA 3ZD9A 4C4PA 5B5SA 5BV1A 2H17A 1M2OA 2QQFA 1TM2A 4MQEA 3GRUA 5LZ4A 2R97A 1SRRA 5KOYA 2V7UA 3GVIA 1J8MF 3R09A 2WTEA 3L02A 2M9MA 4GOMD 2YKGA 2GZDA 4O25A 1UXOA 3NYQA 2MYNA 1HSZA 1EK5A 2VDRB 221PA 2F48A 3AWDA 3HBFA 3R20A 2BIFA 2MMCA 4NBRA 1DBRA 3MS4A 2D0IA 2HF7A 4Q05A 3DMTC 4P08A 3U9TA 2IHJA 5BW5A 3F2IA 3MWEB 4GOLD 4ZPJA 5FAKA 1BN6A 4LX0A 1BJKA 1XTIA 1YA4A 1XVLA 2NUAB 4GYWA 3GVPA 2VTBB 2ZCJA 1H1LB 1C7QA 5AVOA 1AQJA 2C4VA 3AEKB 4OYRA 2B6HA 2NTVA 3QUBA 2JC3A 4LRXA 4P4SA 1C3OB 3Q0IA 4M87A 1XLVA 4F93B 4K03A 4B8YA 3IR7A 2XBMA 2BGGA 4X1IA 1Y6JA 2HADA 3C7AA 1TQDA 4U02A 2EERA 3HDVA 5KVCA 2CLEB 5KYYA 3QF4B 4II7A 1E5QA 1BKDR 3WL7A 1MJGA 2AQIA 3ELWA 2BD0A 2YRFA 3EMBA 2R60A 3OPYI 4M53A 1KMMA 3GFRA 4MSUA 1VIDA 2OE2A 4AD8A 2H57A 3INTA 3AIKA 3LL7A 1A82A 3DD1A 3MTQA 4QICA 4V24A 2IV3A 4E5KA 3L6EA 1DC7A 1PR0A 3GJ3A 1YB7A 3KDAA 1ZGHA 2EWVA 1WLYA 5BQFA 3RRNA 2QGNA 5K8UA 1GLGA 4CR6A 1WV1A 1U5BB 4CIAA 4J3NA 5BMOA 2Q1XA 3DM9B 3HFGA 1DCFA 4FEGA 4KAJA 4E4YA 1BKSB 5KX5B 2Y66A 1I94B 3WB2A 3G2MA 3N0VA 4QJ3A 1CR0A 2DZDA 2DVMA 4B84A 4RWEA 4LX8A 4DEVA 1PGPA 2W2MA 2EYUA 4PPGA 4KZPA 1SCKA 1UBEA 2OPBA 3GWZA 3NETA 1AUVA 2LBPA 1M1NB 1OBCA 3VR6A 4G9GA 5EQDA 5JNLA 1BW9B 4OK3A 3Q0EA 4B9AA 4Q3NA 2DQSA 2P2YA 4L0QA 4EA9A 5CYGA 4NMXB 4M9UA 4AZTA 3C3WA 3CZ5A 4JC8A 121PA 4LF4B 4JU9A 4MV1A 2QRNA 3E7PA 5C8ZA 1NV9A 2WSSA 1L5GB 4B09A 2VQFB 2Z8ZA 3WRYA 2PUEA 3HADA 1KYZA 2GNPA 4EY7A 4Y6PA 3L8DA 4RH1A 1ORVA 3K9QO 1NNSA 1UJNA 1EDBA 2DT8A 1PJRA 2GBFA 4S1OA 3KD2A 3URKA 3QW4B 1IEVA 3D7SA 1PVDA 3VU1A 1YKGA 2NUTB 2XMQA 4YAEA 1FSPA 4IOKA 2FFHA 5AT1A 5KDLA 4JZKA 3HVRA 1BS1A 3T52A 1MH1A 1GLNA 2IDMA 3NDIA 4YT2A 1EB9A 1QJ4A 4YI3A 5EWLA 1QU2A 2CLFB 3KDPA 2BTQB 1V4BA 1FMJA 2ZDQA 3ZE1B 3SXUA 3QMMA 1JXMA 2IIVA 5G2OA 4YRKA 1P9LA 3DWEX 1GNPA 2J3IA 2ONZA 3GMIA 4I4NA 3SX2A 3TZQA 3UO8B 3IQFA 4YRIA 6LDHA 2PLFA 1YZVA 2AD1A 2JAXA 4GPBA 3FSJX 3S1SA 1Y8RA 3PHHA 3GRVA 4ARIA 3PGVA 2H48A 2AEEA 5EA2A 2ADFA 3ZGZA 3GLGE 1DAMA 2FLKA 4G0OA 3DEJA 4KGZA 4OK5A 1UC9A 3D6VA 2ZJOA 1JKFA 2YFYA 3HCRA 3IBFA 4RMJA 2FRXA 4U3JA 4C7JA 1E6MA 3HUEA 3D6JA 4L15A 4NOKA 1CVLA 3KQKA 3QSYA 1EZ4A 2WMYA 2HUNA 4D7AA 1Q95A 1RYNA 3IAUA 1GG8A 2VPQA 5LUAA 3L6CA 1YMQA 3D59A 3UMYA 1EZ1A 4XX0B 2FW9A 1DUSA 5IANA 1J9EA 2AXEA 4ZVTA 3A1SA 2QROA 4F1JA 2XUZA 5BW8A 1T2EA 5L3QA 4KR7A 1A88A 2GASA 2NO7A 3MWFA 1ABBA 1ZN9A 4HAVA 4LXHA 2QENA 3JRXA 1JHYA 4MJXA 5E8JA 4FHGA 4XM1A 2C4HA 4Y18A 5LMUB 2CFTA 3U3MA 3IKJA 5GOTA 2PRYA 2OG2A 4IIDA 1W5BA 3HYNA 3KTFA 2HJVA 1BEEA 2GKSA 1VHJA 3QVXA 1SR8A 4ENTA 3L41A 1CYEA 4RV5A 2V58A 2I62A 3PPIA 4PR3A 1PI3A 1T4CB 1TT7A 5BWBA 1T1RA 2JF0A 2D5LA 4JWTA 5EHIA 4Z0NA 2PL1A 1KAHA 2XBUA 4B1FA 3RS8A 4BLUA 2YVLA 1NFQA 2DY0A 1ZGZA 4N9QA 4P0QB 1G66A 1U9IA 4REQB 5CFNA 5TX7A 2W43A 3DKVA 3WX0A 5T57A 2PRJA 5C53B 3B1XA 4NNJA 1JLHA 3IAM6 3NH9A 1YZ3A 4JOBA 4I99A 3ZHZA 4O33A 3KC2A 4U0JA 2HMYB 2BEKA 3H4TA 3GJZA 3KR0A 3EG9B 4WH0A 3FNHA 2HOQA 1PR9A 3ZH9B 1TUGA 2AI1A 2CXHA 4M9QA 4YV7A 4PCUA 3SJAA 3WWZA 3BD7A 5FWXB 2VHTA 5DK6A 1YGYA 4D9FA 4CM9D 1WKCA 2VJPA 3AVQA 1ODCA 3IIEA 2R8OA 1JQEA 2QIOA 2YFHA 3V7UA 4QGAA 3L8GA 1DDGA 1K0FA 2R6ZA 1UP4A 1B76A 2XE8A 4ZO6A 3BXFA 3WYGA 4BMVA 1W36B 2QN6A 3I5MA 4G23A 2P2NA 1D8TA 1SD5A 4QOIA 3IQXA 4YJ3A 2D2FA 2VH1A 2ZR8A 3ZE6A 4E46A 3N2ZB 5C8XA 3V3TA 1K3TA 5H7XA 1IQRA 4KQHA 2BMDA 3DNPA 1T91A 4YRSA 4MB6A 3VSBA 3OQ6A 4FGUA 5DXAA 1GTZA 3U40A 1TZJA 3ASZA 3ORFA 1U7HA 5THKA 4B17A 1P3Y1 4V0MA 5C35A 1K63A 3GEBA 2A30A 4L28A 2JL1A 2YHIB 4HNHA 3RH0A 2FR0A 4KQWA 4RWZA 1L7VC 2FPGB 3O8BA 2WFLA 2GN0A 3PXDA 4ZV9A 5G1OA 1CE8A 4RELA 5ABPA 1TJ4A 1GVHA 4KK3A 2C4WA 3EXIA 2FPGA 3RS2A 4ARZA 1QYXA 1T9AA 5JYCA 1GIAA 1Z83A 2RI1A 3AETB 3D1JA 3LSYA 3G9XA 4X9XA 4BO4A 1Z7GA 1LLQA 4ALNA 4IYJA 4B35A 1HT2E 1MPXA 1T1SA 5TPZD 1HEYA 3P19A 2QTRA 4P80A 5AM3A 1X9HA 4MRRA 3NIGB 1UBMS 3P9XA 3R4VA 5J59A 3FOEC 3U4CA 1P45A 3EH1A 1O8BA 1A98A 4L16A 2C4TA 5EPEA 1MGOA 3BWCA 3SY8A 4GDFA 4XQEA 3WLQA 5FA8A 3PQ5A 4I55B 2BKAA 4LRUA 1FP2A 3RAEC 1V3TA 5B4TA 2FUNB 2CE2X 2RGGA 4ENQA 2F1KA 1O2DA 3GUYA 3R3XA 5HMLA 1PTJA 1EVKA 1YI0A 4KQIA 4LVCA 3EQ8A 3OP4A 1W8IA 2EZUA 3A6HA 4RZHA 5E1BA 1QANA 1MJFA 2OCYC 4HB3A 3K0HA 4PZ9A 1E0JA 1D1PA 1JJBA 2VJYA 3AHGA 2ZETA 3OIFA 1KJZA 4EJSC 4LF9B 2PR2A 3RIYA 4BRUA 3KQUA 2LV8A 3GCZA 5K01A 2ZR9A 3WYEA 1E8MA 4K2HA 5A0TA 1QYRA 4ZEOA 1TAGA 3TJRA 1DKRA 4MHTA 2R6FA 4HMPA 4GLJA 5ERXA 4TZTA 1DEAA 3RIHA 5HM8A 1ZVJA 3ADPA 1Q7TA 5FR1A 1ORWA 2QRVA 2HF8A 1G5HA 4YRBA 3P2YA 4KNYA 4B80A 4BEJA 1IB0A 4DHEA 3Q41A 2AWOA 5LU8A 2AOTA 4IEEA 4L4XA 5FWNA 4K9MA 3CNBA 3R7FA 5HJ7A 2PS0A 3ET4A 1ODKA 1Y7LA 1DKPA 2ZWPA 4H6XA 4JC4A 4BWYA 2XH8A 2XJ4A 3RRFA 4BB9A 1DXOA 1BYIA 5CHEA 4YMGA 4C30A 2X22A 1YHNA 4IH9A 4MR8A 3RFXA 3G0DA 2VTBA 5AVJA 1TQ8A 1XRJA 2JFXA 2NT3A 3NVMB 4FJ1A 3PUIA 1ZSVA 4Y0NA 4UM7A 1E1CB 1XRMA 4N1AA 1M72A 4R5MA 2ODWA 3VGPA 2XA9A 4QO8A 1TKCA 2NMVA 3PFCA 3UWMA 5E8RA 3OQVA 5JXHA 5LKRA 1EIZA 1PJLA 4G36A 1VIMA 4O4LA 5EHZA 2WYHA 1Q1QA 2C7OA 5JLAA 1C0IA 4S35A 5D7NA 4P4LA 4XJSA 3WFJA 3OKCA 4WZZA 4WLNA 2D06A 1GA4A 4MYUA 4Z9BA 1NGSA 5AJXA 1U0GA 4GR5A 1WXWA 1GTRA 1QZ3A 4UD2A 4CKCA 2CV2A 5ALIA 1EFHA 2PWYA 4B46A 1F8UA 1OAKA 4CMIA 1TUEA 2A0XA 4JFRA 5CUQA 1P2FA 4HXYA 1M2VB 3VHRA 4LF8B 3W8RA 2NO9A 3CISA 3IVAA 3LQYA 3NIDB 4MNTA 2FUEA 1Q1GA 4NPAA 4Q9KA 2VPXA 4B6RA 3GVHA 4F2DA 1FQJA 3R6DA 3HJTA 2W2NA 1OAOC 2FETA 3RO7A 3ZU6A 3VBCA 1CNMA 1S02A 2EL7A 2X9QA 4L5CA 5C81A 1UZLA 3PWKA 3L0SA 1WA5A 2Q5QA 3Q8WA 2QUBA 4ZTUB 4Q16A 2Q7DA 3WKAA 4RH0A 4IYRA 4I19A 2UYGA 1W5EA 4GMDA 3HLKA 3K70D 4M99A 1WJGA 1Z2OX 3UUEA 1ISJA 2BFNA 3CIFA 2CE7A 3Q10A 2EU8A 2CV0A 3RVPA 1P74A 1QC5B 1RHQA 1RP7A 4A3SA 2CB0A 1UFRA 5F5XA 5TVKA 1OWPA 5B1HA 2X4DA 2CZGA 3RK0A 2IX9A 3MLAA 2ENUA 4XX1A 4BJ3A 2CT8A 4NF2A 1CSEE 2IZ5A 2ZU6A 3PYLA 1CUEA 3H2ZA 4OY3A 2WHPA 2WAXA 1K97A 3LCVB 3P94A 1HDGO 3DPUA 1VL2A 1E3QA 3CX7A 4URYR 1X2BA 4Q4DA 3BSWA 1U9IC 4FFBB 1WMEA 5FUXA 1KORA 2PTGA 1EUZA 2J67A 2PYIA 1RYBA 3KAPA 3LT4A 3PI6A 1JBEA 2WAMA 4R1NA 1XDSA 2HF2A 2QRJA 4HUTA 2V98A 5H81A 3EPKA 3QVGA 1H2HA 1FJ2A 2CMFA 1TTPB 1FFGA 2FZ5A 2QTTA 3AEXA 4FKZA 1B4DA 4E30A 4MS3A 3CG0A 3S2GA 2HPVA 4GZ5A 5COAA 2OMEA 2OV1A 2PEYA 2QHXA 1WQ1R 3FYDA 3LT2A 4QYTA 3F97A 4TRJA 2IYRA 4CQMD 3NJ4A 2N0SA 4F2PA 1TU4A 1IXZA 4P4SB 5AVWA 3L4JA 1GCGA 4BIIA 4EOGA 1ZK2A 3F5DA 5D3QA 1UBCA 3S3TA 3VNUA 3OD5A 1D6MA 2EW1A 2KLBA 2PT6A 3GLIE 3DMPA 1MA3A 4Z7QB 2HD4A 4QGBA 1BXGB 3D1LA 3LA6A 3MHTA 1XJCA 1XTQA 4RIEA 4DQLA 5CD9A 1A72A 4DA7A 5BRAA 3BB3A 1R6BX 1GSOA 3LF1A 4MXDA 2Z09A 1DHRA 1JEQA 1TMKA 2CXXA 2CWWA 5DLQC 521PA 3I30X 1VLMA 1LSOA 1I6MA 4F7DA 1FFSA 1VYHA 3MVEA 1V8OA 4RZ2A 5EMMA 2QUIA 2MDTA 4Q6WA 1RMQA 4KSYA 3VR4A 4BMXA 4XUDA 3KNZA 2CUZA 4X84A 1V0JA 4FT4A 2X58A 2F17A 1RYMA 4UHJA 4B3XA 3VVBA 5AXDA 5JCJA 2I76A 4HBZA 5AM0A 2QYHA 4UTOA 5LQKA 2C2BA 2GAOA 5GGXA 2HW8A 3CY6A 1Z8NA 4B3FX 4UTPA 3A31A 1W0KD 2CMHA 2DBRA 5KMGB 4G1VA 3GRZA 3HSYA 2GA8A 3GFBA 4LJ5A 4Y6GB 3S2YA 1W36D 2VF4X 2ZT7A 2OD7A 3N8IA 2WD8A 2H3HA 4XH9B 3UEOA 3R0VA 1H3FA 1XPOA 1SXJA 3IVRA 3MUOA 5EWJB 4RANA 1XG5A 4IHKA 4MWGA 2P9QA 4ONEA 3CBGA 4PX2A 3IEPA 3G1TA 2JAOA 1F8GA 2IP4A 2ZULA 4ER0A 2CJFA 1RS0A 4URXR 4UCXA 5K05A 3I1FA 4PAQA 1YRHA 3GLFA 1MC8A 2RIPA 1JTEA 1UAAA 3FUTA 5FTMA 2C03A 2CBXA 4ZWNA 2QQ5A 4F72A 2V0GA 4XCQA 4R81A 5A6VA 3G8AA 4HZIA 1MB0A 2JGJA 4RPHA 2V3CC 4KB5A 4G63A 1G9XA 1V8ZA 4CHTA 4F0JA 2QUZA 1GRVA 4M9XA 2H8GA 4Q9HA 2XZPA 1PYOA 2QGFA 2HWXA 4RY2A 1EZZA 4WOKA 3AC0A 3FKQA 4PNEA 2D62A 1VL5A 4PQYA 1JSLA 1LVHA 4GPAA 4UBLA 5KYGA 1AS2A 3ELYA 1PK9A 3IDSA 4G8CA 1RHRA 1EBUA 1VJRA 3MEQA 3R4CA 4M76B 3TFWA 4EUKA 3U7GA 4CM1A 2JGKA 3OJEA 3C48A 3A6FA 3HB7A 4D0SA 1YCHA 2RG1A 4RTRA 1C1XB 1T3HA 4F84A 1JQDA 1N5JA 4U6SA 2OQVA 1XE3A 2RGUA 4WN3A 4GZLA 1IN1A 4BNDA 1UDRA 5C18A 1T2CA 4OBEA 4HYQA 1GGHA 2XE6A 3R7WA 2F1JA 2P3SA 4LMPA 3O4RA 4U3JB 3EZNA 1OVGA 1OWNA 1QYWA 4WDQA 4YUYA 1G5QA 2YOHA 3HXLA 4D8TA 2CK3A 4U63A 3KUUA 1A0OA 5HZKA 2V8BA 5DX8A 2JG3A 2FUG1 2BFEB 2BI4A 1T9CA 1YJXA 3MSCA 3PJDA 2XHEA 3CB2A 3I53A 2JGNA 3UJ7A 2Q4BA 5DASA 3WOVA 4NMMA 3QK7A 1Q1EA 4V1CB 1IOVA 1NLFA 4P36A 1RM5A 2G5CA 5AW4A 2VEDA 3L7IA 1HE4A 1WU7A 4RNDB 5A9SA 2LCIA 4V1CA 1GTL1 1KYWA 1NL3A 3E82A 5H59A 3IEVA 1TD1A 3RUFA 4IVRA 1R0RE 2Q5HA 3R0JA 4B81A 9MHTA 1Z0ZA 1JWAB 2OYCA 4C4TA 4MW2A 1S3IA 2O8NA 1FF9A 2CDAA 5HIJA 2ONJA 2HJGA 4CTMA 5JFGA 5JCJD 5K20A 2EKPA 3EYAA 1DQZA 4MKXA 5BYBA 3GP3A 4B7CA 3B60A 3AY6A 4YQZA 3ZCSA 3O95A 2AKYA 2BKLA 3PD0A 1QNLA 4UHBA 2QRUA 1JKJB 4LNUA 4IL5A 1P7YA 3MYYA 2TYSB 2VUUA 4KL8S 2DOKA 1AF7A 3RT1A 5LU9A 3SZUA 4QOJA 2IH5A 1DQSA 2R6JA 1P7VA 2DSNA 5KC8A 1RFGE 1U63A 4JCOA 1R8JA 4Z2AA 3D6FA 5K9ZA 5K6AC 3KLBA 4ZCRA 5FWXA 3PVZA 2XMPA 5FFFA 4AFNA 4B0PA 2VP3A 3LVBA 1HQDA 1XZBA 4MLZA 1M10A 3QYPA 1D1QA 3KB6A 1JV2B 4QXOA 1T4MA 3WMEA 3FR7A 1QH1B 5REQB 3MERA 3B48A 1GYQA 1TC2A 3MQ4A 4HLDA 4Q66C 3K70B 2AJDA 4MR9A 4Q9LA 3X2EA 3NS7A 4FU0A 4LJ9A 4QTUB 1P4SA 1EVYA 4WRRA 5DGHA 3HBLA 5D1HA 3C0KA 3TH5A 2WIGA 4IDDA 4KQ9A 3TQOA 1ZS9A 3C4VA 3FB1A 4RTOA 2QTNA 5B1YA 1HF3A 2C3PA 3JD4A 1I3MA 2IPXA 4Z86A 1CZUA 4OSEA 1R4MA 3ROMA 2YCBA 1T8WA 5ED0A 3VNSA 2CVHA 5BURA 2FHPA 1GCAA 3P9NA 1L7AA 3LC2O 2B5VA 2H4YA 3ER6A 4G5YA 4WLFA 4QLBA 4DV5B 1E9EA 4RPJA 2ZS8A 1PJCA 3LG2A 3U56A 4LSMA 1RADA 1M0SA 1KH3A 5F7ZA 2Z6AA 2W2XA 1A8UA 1RJDA 2R1VA 3A1CA 1DUIA 4MQUA 2RGRA 4CEHB 3FROA 1G5PA 2FU5C 4I8IA 1U3WA 3ZDRA 3KJGA 2GVDC 1USWA 1SIWA 3LRXA 4LZOA 3CRQA 2OHGA 1FMLA 2DLNA 3ECSA 3LP5A 2WHQA 4IJMA 5DHFA 2UUAB 2RGDA 5KDOA 4Q9AA 5F5NA 4D0GA 2Q3EA 1Z6PA 3DKPA 4UU7A 3VPCA 5D3MB 3KOMA 3MMSA 1N0WA 2DLDA 3NHPA 1RQ2A 4JBGA 5BVGA 1FDIA 2GEFA 1U7TA 4FHFA 1AU9A 1P7PA 2DBVO 4IIBA 2XCRB 1ICEA 3BRCA 4G2TA 1RXCA 4R51A 2DR3A 5E0KB 5FRDA 5JEEA 3FTNA 5JAZA 4TV8B 2X8LA 4IJ6A 3EZ2A 4X63A 3RVDA 1VYVA 3ZV5A 3U60B 1V2GA 3DF7A 3RTBA 3KUDA 5L6MB 5JDIA 2JKVA 5J3JA 3ESQA 4PX9A 2BLNA 4QO7A 2GJKA 3L4KA 3JQCA 3ONEA 2GRJA 4DE5A 4N5MA 4X6XA 4CTOA 2LDBA 2XRZA 5CA1A 2PO7A 1WXXA 2A59A 4WZ6A 3C1TA 1IDN1 2OV3A 3CLHA 4EARA 5CAEB 4BBPA 1S3FA 1MGPA 3FGPA 3IJ5A 2XWPA 3O90A 3G59A 2WINI 3TUZC 3NM5A 1YDWA 4JSRA 2NNLD 3R41A 5CYFA 4HGRA 2FEAA 4NYMQ 4AJ1A 5LQNA 1PJSA 4FSHA 5IXYA 1T5SA 2KSQA 3C3JA 4LUCA 5F98A 3IJPA 4JP2A 5DTQA 3R3JA 2Q5JA 3VNBA 4KITB 1U2RA 2FA9A 1U9YA 3IFSA 1Z6YA 3HCPA 1NUQA 4N12A 2EL9A 2QPLA 4NFHA 4BZXA 4D4MA 4LOAA 4EI8A 4MMZB 1O4VA 3FHLA 2H63A 1JHXA 2E21A 2JFVA 5AKXA 4EAAA 2MYTA 4PXSA 4Z0TA 1XCBA 3MJHA 3AI7A 4JLSA 4R1PA 4UMEA 4XD7A 2V3WA 2WDPA 1KKUA 1ZUWA 2OUIA 3S81A 1ZM4A 3UMMA 5C1OA 2ORWA 2WJ3A 2HWUA 4R2KA 1BMQA 1XCGB 4CV3A 3UM9A 2P2ZA 2AG1A 4OHMA 3ZXSA 1TE2A 3K5PA 3U7EB 4OGGA 1UK7A 3QQ5A 2ECFA 3WLPA 1KR5A 1U0NA 3H16A 2DM6A 1B8PA 3DE0X 4YCBA 2O3JA 1JT9A 2QAIA 5KYUA 4KVGA 1M5RA 1SGWA 4W5RA 3LWZA 1PT5A 1E8NA 1REQA 4QULA 3MAGA 4MUEA 4MIEA 4JI6B 2BY4A 1Q14A 1NOIA 2KQUA 3CLSC 4Y2HA 1K5PA 5JISA 1CVRA 2WVGA 1LDYA 4NCXA 1QE5A 4IS2A 1YVDA 4O2AB 2Q2QA 5IXSA 4K9DA 2GERA 2RH9B 4IY1A 1NVWQ 2PSEA 2VYQA 2WU3A 3ACCA 1A7JA 3K2EA 3NTLA 5LM3A 2PRZA 1T1GA 1Z06A 4JITA 4Q4JA 1HDZA 1BE0A 3F6BX 5K2MA 4ZJZA 4IEFB 3CNNA 1K5GA 1FZTA 1IBRA 1V6AA 4GXNA 4JEUA 5H82A 1UBLS 3UH0A 1ZDMA 2BWJA 5TMPA 3C4JA 1KVSA 4KO3S 5KTYA 1FJXA 2AE2A 5T4BA 3ZV6A 5I9TA 4Q47A 4AW9A 4MWOA 1JEJA 4D0LB 2VHJA 1ISGA 3AZOA 1ZLXA 1U5AA 1ZMXA 3I05A 4I4CA 1A9YA 3NAQA 4G8JA 4PIVA 1UPUA 2IPOA 1LBQA 2DE0X 2ATCA 2ERXA 2JANA 3GPIA 4WESA 3U49A 4E09A 4KGXA 5ICCA 5IT0A 2JD0A 3PGLA 2DJ5A 3ROGA 1NBMA 2H54A 3T7RA 1S3SA 2CHQA 2IUSA 2PT5A 4N3GA 5IJ0A 4PGMA 3M4YA 3QVKA 1EM8B 1NNUA 1RBQA 4MW6A 4JAVC 1XMIA 3PPXA 1AQIA 1GGEA 4NDZA 4IG4A 1R0WA 4MAFA 4DCUA 2B7LA 4EX7A 4KN8A 2ZRBA 2ID4A 3QKWA 3FLEA 4YEDA 3IKMB 4CE6A 3HWRA 4ID9A 2NT4A 4IH1A 3RG2A 4YJHB 1ULSA 5EE5B 1M5UA 2OGZA 4LOJA 4DS3A 1KYIA 5DBOA 4ZQGA 5HKBA 3TD2A 1GGKA 3BZBA 5DYGA 1CK4A 1U7PA 2OLJA 4P53A 4BLPA 1RKQA 3IL2A 1BO6A 1RKVA 4ZA2A 5LYYA 1PX2A 5EFOA 1ZZEA 3STUA 1OZGA 1P4JA 2DWOA 4A4DA 2BM8A 4MRPA 1VKNA 5EZQA 1OC4A 1TVKB 2AS0A 4DMMA 5CM8B 1Y8ZA 3E9ZA 4YBRA 1C50A 3CRVA 4E51A 1W25A 1TKRA 4DV7B 4ER6A 3H11B 3V1KA 2VNSA 3SAJA 1G8KA 4NBUA 1H2ZA 1QQ6A 5F21A 1E2DA 1ABFA 3HCNA 1JEEA 2OO7A 3OJOA 1L2TA 4IJ5A 2YOFA 3B5IA 3TK1A 2ISCA 1QH8B 3OAAD 1Q6ZA 1XD2B 2PT9A 3WS7A 1Y8QB 3TPCA 1KYTA 2WWTA 1YR3A 1PJTA 3HNRA 1XWWA 1HFWA 4NFLA 1XEFA 3SSNA 6AT1A 4WTOA 4DLPA 1DI0A 1RWMA 1UMCA 3SQMA 3PJRA 1YUNA 3OHMA 2J9GA 3UGKA 1J2TA 3C7DB 1ILEA 3WLAA 4Q4CA 1BRTA 1MT3A 3BICA 5D87A 1V1JA 1JIQA 2GYUA 5EI5A 4AYTA 1WW3A 1N6NA 1OI3A 3C1OA 5HTKA 4DCSA 5JD3A 1L4KA 3HR7A 4RVOA 1PF7E 1TMYA 4TVSA 3QLVA 4RVDA 4F4CA 4CLDA 1NW4A 5L95A 2OAGA 4YIKA 5BUQA 3HLYA 3EF1A 3E9NA 4EFNA 1NSYA 1C0EA 2YHBA 3UATA 3BQ9A 1J1ZA 3QU5A 3H9JA 2YIDA 4LWZA 1RZUA 4RD2A 4OGWA 1V5FA 5E7IA 3DBLB 5SV2A 1LPSA 1PT8A 4NV0A 2GPYA 4C2AA 4R2IA 4L9AA 2O2DA 3VR6H 1H2AS 5SZHB 2VPIA 2XYHA 2C83A 3CUSA 4CDRA 4D9NA 5MDHA 3JD1A 2QZ9A 4H3KB 1NULA 4OHKA 4P34A 1MW8X 4L0DA 4NYMR 4RD6A 1CEYA 1NUTA 3T4EA 4C9BA 4KE9A 1JQKA 2VJDA 4JBHA 3ZBQA 2NM0A 3FCCA 3Q85A 4QBFA 2X8WA 2QF7A 1MJNA 1KKMA 2CNDA 2C54A 2HLHA 3D64A 2FFBA 3C5HA 1Q0HA 4QEKA 4C0BA 4OLHA 4R69A 1GV0A 2OCKA 1BRMA 4HH1A 1JE0A 3LUHA 3MRVA 5GY7A 3A9SA 4YCMA 2XEDA 4OKSA 2R65A 3JVEA 3T99A 3ZHOA 3D2CA 1OI2A 2H9IA 5BYJA 2G5PA 3UZUA 3D1VA 1DXHA 1SBIA 3NXKA 5MN6A 5KDDA 2EDAA 3VSEA 3FOBA 1GXSB 4FN5A 1KZYC 3AV0B 4EHAA 2I4IA 1ISIA 1O96B 5EC8A 4EG4A 1QO9A 3JQ7A 3FPGA 4M1KA 3OAAA 2IP2A 3ZLTA 3VKUA 1LC0A 4HDKA 2CDBA 1OILA 1EWRA 1ECJA 2O5EA 2CD9A 1Z38A 2Q4OA 5IULC 1CVIA 2GF2A 1NW6A 2C4KA 1AGNA 2AL7A 1KY2A 3CMCO 3FRIA 3P2EA 1EMDA 1SO8A 5DSTA 4X64B 4OM8A 1VSBA 3LHKA 5F23A 4JGIA 5DCYA 3PFFA 2D1YA 4CJXA 1C3OA 1ZVKA 3AP1A 1KZ9A 1U2QA 1YCFA 3PKIA 4FZ5A 4MIKA 2FW1A 4RLFA 5CLIA 1GDDA 4IRUB 3ZK7A 1NUUA 4HY3A 1P5HA 1XDZA 2YN2A 3BD8A 3T7AA 4HQKA 1KQNA 4BKOA 4F38A 5ICSA 2QYSA 3G2LA 3TR5A 4GSYA 1UK6A 3ZV4A 4ERXA 5B57C 3EEOA 4E88A 2HMUA 1BROA 3AR8A 1AQYA 2BJHA 2NYRA 3RQSA 1X7WB 3H2YA 4NEGA 4BU1A 4D9IA 1SM4A 2JEOA 3BIWA 5LP6B 3G2HA 3OHSX 2JBHA 4X6LA 5FFNA 2JI7A 2JH3A 3F6YA 4L3WA 1KS2A 3OM8A 5DLEA 3RSFA 4CQLB 2PEZA 2EATA 3G5LA 1EP1B 3HI4A 3K6RA 3MINB 4QVIA 3FRHA 2X40A 2F1OA 2ZT8A 2X0EA 3VZCA 2G7MC 4D6YA 4C7XA 4HFNA 1KQOA 4TXHA 1G9TA 2REBA 4LTNA 3OQMA 1Y0BA 3I3SR 2PKQP 2WW8A 1QQTA 4JEHA 3CUEF 4KVZA 4AP6A 1C4OA 5FEUA 1SAYA 4M1EA 5IZCC 3JVVA 4J3JA 1RFLA 1WUTA 3QG1A 4YO8A 4ZQEA 3W90A 4BFUA 4CQMB 1PS8A 1L5FA 1E6KA 1JHQA 5JSZA 5C7IO 2AZXA 3EIOA 2RG7A 1FXWF 2RARA 3E9EA 3HJBA 1IIBA 3OQIA 1WMAA 2QL9A 3PSAA 4P7JA 1Z39A 2FEPA 2BF7A 3Q6NA 4CFYA 1RC0A 3B9QA 1NP6A 3QTLA 5BN1A 1NN0A 3NR2A 2YS7A 4LMBA 1RQPA 3P0HA 3U3DA 1W4ZA 3UMVA 3COVA 4XPIA 4K3UA 2G28A 3A6JA 3EFOB 4B5KA 2GUGA 5ESXA 4GG1A 4NMLA 1WW2A 5LMNB 3SHTA 1Z13A 3T06B 2X13A 3LWDA 2I6GA 4RTKA 4DMFA 1Z0KA 3CLTC 5EP2A 2OUKA 1PT6A 3FYHA 1I14A 1T4GA 1W4CA 3U1VA 1DO8A 3CF0A 2L0XA 3JQFC 3QG5A 1MQ8B 3TW0A 3RYHA 3ZG6A 2V1XA 5LFAA 2XVXA 3RBZA 4L5AA 4CQJA 4DFDA 2WNHA 3ESCA 4FHEA 4N0QA 1T3ZA 3B78A 1X13A 3KT6A 1DZ3A 5EEGA 1U28A 4LYDA 1D09A 4AURA 2FZEA 2XYGA 3MFQA 4FNGA 2IYTA 4KIJA 4A23A 4G6ZA 3PYMA 4BO5A 3NDRA 4BNVA 4YJ2B 5JMWA 3ONNA 5DIFA 4PGGA 1HDYA 4RIGA 1RJFA 4RIHA 1SMKA 3L05A 3TTUA 1PHPA 3SYNA 3QEKA 3R77A 3RIGA 3TZLA 1U3VA 2Y0DA 1NQUA 2CLKB 4ZVOA 4ZIRA 1GNVA 3A4TA 4CCYA 7ABPA 4LZPA 3P52A 4OQXA 4NY1A 3C8ZA 5HQTA 2XQVA 3QFFA 3NANA 1WZUA 1AT1A 4FPXA 4TMYA 1R6XA 1PZHA 3HB9A 4K9NA 3AG5A 5C1IA 2PCJA 2QSJA 1KH2A 1PBTA 1EDOA 2J1LA 1PT9A 3Q6MA 1U7OA 4PLFA 2C9OA 2CLIB 3U3XA 1C4KA 3VR5A 1M6EX 3NHFA 3L1UA 4YAJA 1NNLA 2ZUDA 2AE1A 2AR9A 3ONFA 1CERA 3R6GA 1Y81A 2NAFA 4FFPA 3BH7A 4ZO9A 2RH5A 4C5CA 3K8OE 2VT6A 3GEEA 2DETA 2IT1A 3OC0A 3X1KA 2AN3A 4PZEA 1HRDA 4NZYA 2R1TB 4QSHA 4ZICA 1XEWX 2FOXA 1OLXA 2JGMA 4L85A 2GPAA 4KNVA 4MJLA 3EGDB 1P1KA 2HBYA 2YINC 3DYVA 4V2IA 3JWPA 4QM6A 1EFLA 3JQ9C 4M8KA 2R3SA 2P9EA 2QAJA 2CL6X 5CJ2A 4BNFA 4OX9B 2X9VA 5FJJA 5AQ1A 4NOMA 3NPAA 5DGXA 2GLTA 1ZK0A 3LLVA 4M0DA 1MXFA 2XKAA 5EP1A 3V4FA 1P80A 3FZEA 1RM0A 3QKUA 5HW0A 2BT4A 3UVEA 2BFBA 4QM7A 4IIXA 4C4SA 3IAXA 5KYXA 4LYFA 2ZBRA 3W5AA 1Q7EA 3AHCA 2YJZA 5KYXB 1LFDB 2V7BA 2VHXA 3PZBA 1NF8A 4JUFA 2RGNC 2JLYA 1YQEA 1O97C 2AH5A 3UW3A 1QYCA 1KZHA 3RD5A 1PQPA 3FPSA 3T3PB 1JHUA 3VZRA 2UYCA 4YAOA 2BEUB 1ADFA 4IXMA 4LHSA 3C3MA 4D98A 4YMVA 1IAVA 2B1QA 1D1TA 2GLXA 2X2PA 2ZVDA 1DRWA 1SOUA 2RHMA 1DKLA 4WK0B 4DAEA 3MOSA 2CXTA 2XCIA 2C5FA 2PZJA 3DZ8A 1TCAA 2J9YB 4G86A 4RHCA 1RKUA 5IAKA 5I7EA 1EHYA 2I80A 4EF5A 2AFVA 2IU4A 2J87A 4P4UA 2PAFA 3UYLA 5C5CA 2QVBA 4I1UA 1RWKA 1XA3A 1YNSA 2GM3A 2ORIA 4PF1A 5CCDA 2J0UA 3ZE9A 4DXDA 4Q34A 2RHWA 3CVJA 3PL5A 4UCFA 1D2HA 1T9KA 4BNZA 4NARA 2W58A 2YHIA 5CB4A 4DEYA 4EG3A 2WQZA 2FPXA 3N74A 4LZNA 1Z75A 4BAGA 3W78A 5JAOA 3SFVA 3VR5D 1K6JA 5K6AA 3RSOA 1J23A 3A1EA 4BQQA 1BGVA 2C2MA 3R9IA 2GCNA 2FJUA 1JX6A 3VISA 2B9EA 4BNGA 4PQGA 3BQNB 3DV2A 4KBGA 2V5UA 2Z3ZA 4RZIA 1OFHA 5KQSA 2QT9A 3SYRA 4ZZ0A 2P2DA 2IWHA 1UXGA 4G56A 4EG1A 1CXZA 5FTNA 1QS0B 2PGLA 1J2YA 1V5WA 1TPZA 2UZ3A 3TQQA 2DFDA 2IXTA 4LYGA 3MQFA 4UVGA 3AM3A 2I3AA 3CW9A 2VNJA 4WOBA 5E1DA 3BWEA 2XB2A 1BDMA 5CJJA 2X3FA 2O0LA 1NJ1A 5F1KA 4CTNA 5LWQA 2BC9A 3PTLA 4WUTA 2JAPA 3GELA 3OD1A 4K6KA 4MWEA 5AOVA 3V9AA 5JJIA 3QXGA 1W6UA 1TKBA 4GICA 1DEKA 3W8NA 3QV2A 4MWCA 1WZ2A 1E2HA 5TMDA 1X19A 4FC7A 4WFKA 4UUOA 2HQOA 3M6XA 3ED1A 1W9HA 4QBIA 2PUTA 3VC1A 4XDGA 3VXKA 4Q93A 4EJMA 2W6JA 1TLFA 4KWCA 1Y8CA 2B2CA 3RVJA 4D3SA 1WMFA 1Z6GA 2GB4A 2IS2A 1D2GA 2O2EA 3Q72A 4UBNA 4YQFA 3QE9Y 1BHO1 4FGKA 1Y7PA 4N5LA 4QU0A 3U48A 4ADSG 2XD9A 2ZIVB 5T4HA 3GI1A 3DE3X 3K9HA 2D5AA 1UJ2A 3IUBA 1QHXA 4ZAYA 2CDNA 4JH0A 5JS6A 3PGMA 1ZK1A 5I7WA 3KQTA 4S05A 4BATA 4ZDIA 1YS4A 3I5YA 2BRUA 4URUR 3AF6A 2ZJYA 2WJJA 1J24A 1OA1A 1KI2A 4ZYWA 3OFNA 4BC0A 3D3WA 3DLPX 1A4IA 2QTZA 1GJRA 4WLVA 1C7JA 1MFZA 1P2VA 3EWSA 3PFHA 2OOKA 3CM0A 2HT1A 4E13A 3VHXB 3W5JA 1QHHB 3CCBA 3A37A 3GFSA 4YMWA 5F73A 2IPLA 1GZHB 3BERA 4PV7A 3H2HA 3VBEA 4YCLA 4RK6A 4BJ6A 2QSUA 1XOIA 1JHOA 4WADA 2F9FA 2FWIA 5DXFA 3D4BA 3MMXA 1NDUA 2YHAA 2IYWA 2ZSJA 3I73A 4OAPA 3DBHB 1NBMD 2G3YA 2Q28A 3EEYA 3K16A 1PJ3A 5D5HA 4YMIA 1TADA 3ZCXA 1VTKA 1XD2A 1U04A 2FWBA 3BCSA 4PTLA 4L3OA 2Q5FA 1PR6A 3HCOA 1QF7A 4K3VA 4WLOA 3ZEIA 1W19A 4EHFA 4K46A 4EYSA 2O5CA 2A0FA 4KR9A 1OXVA 3MINA 3WWPA 3VH2A 2CLSA 3T5BA 4OJNA 2F67A 4BWVA 4K7JA 4TL9A 4YRGA 1BVYF 2J31A 4NFSA 3QVJA 4PYRA 3CWQA 1U11A 3E7FA 3SI7A 2HRZA 2I2DA 4DIDA 2OCPA 3EQZA 4QVGA 3P8ZA 3CR3C 1D0SA 4M0KA 3HJCA 4ZC8A 3TIXB 4HZUB 3O3CA 2J7KA 4HVAA 1VBKA 2GEBA 2P65A 4F46A 2REXB 1D4FA 1GRQA 5JAQA 1FW8A 2AFHA 1DAHA 3C3BA 2A6PA 3PC6A 3WAGA 4GHWA 1UM9A 2V03A 2XNHA 4H18A 1GD1O 2FEXA 3WGOA 1LX7A 4BIMA 3NWBA 3LMKA 1Y1PA 1RXVA 3C6KA 2COKA 5TJHA 3G79A 2PJZA 4B7ZA 2C7QA 3JYPA 5HQ3B 5JYEA 4Z4HA 2ZRLA 4MLPA 2ZYTX 4AX8A 4MR9B 2D2VA 4NULA 3KQQA 1X0XA 3WHIA 3O26A 3ZQUA 3LTNC 5EXEA 2ENWA 3A7EA 3CVWA 2H2FA 4MRVA 3W3AA 4I1RA 3QY0A 5HNKA 2O59A 4O1MA 3BD9A 3UWOA 4JUBA 3KBBA 4NBVA 2FX2A 2G70A 4AJEA 1DAKA 1T9ZA 4ZVNA 2WU4A 3IMCA 4WJLA 5HJEA 1P8JA 4FS3A 4EBFA 2WJZB 2XCSB 4KN6A 2I6UA 5FLKA 2XNJA 3OPXA 3B6EA 4NC9A 4LW8A 3EXHB 4EL5A 2BCEA 3BF8A 1T2VA 3D0KA 2GO1A 1MIHA 2QUAA 2OAEA 4IQ8A 4B4KA 2QVXX 3PHIA 4WAUA 2GD1O 2Y1CA 4ZRNA 2Q6VA 5EHXA 1R5JA 2XB9A 4J3FA 3ZLJA 1JPNA 1L8XA 5J2TA 3EUEA 2FWRA 2JAQA 1B7GO 4Y98A 1J42A 1XQ6A 2FPOA 4UAJA 1PJ2A 1TJ5A 2NW6A 4EB6A 1T9GR 3WRWA 2C57A 1Z25A 3CZ9A 5TQ2A 3PUVA 3ONDA 1KTVA 3H86A 1OD6A 3B7WA 4M46A 3F6EX 2DFNA 2IQ5A 1ZH2A 5CW2A 4Q7QA 1A9XA 4RJKA 1YKFA 2HCTA 3SYLA 1KE2A 1AN0A 5FPSA 3S1AA 2Q6TA 1I4LD 1PR5A 1QGYA 4I6EA 4V2UA 3DZHA 2XNDD 4DSNA 2JZOA 1CY2A 2DXIA 1E4YA 4A5OA 4IP0A 1EJ0A 1K2WA 4NQZA 1QWOA 1SCAA 3GOQA 4M7WA 4PRLA 1IMJA 1FTNA 2H5JA 2XT9A 3UJCA 3CBQA 3UXHA 1G20B 3FFWA 5AKGA 5EE9A 2YXNA 4IDPA 1EAMA 4C78A 1S8FA 2ZI6A 3MT7A 5EKUA 2GTHA 5AYVA 5IJ9B 1YASA 5B53A 1VJ0A 1GL9B 5TY0A 3HS3A 5JMTA 1Z8HA 1DC5A 3JQEA 4I3FA 4NJOA 5FFMA 2CL7X 4EHKA 3RVSA 3X2FA 1FS4A 5HGJA 2AUMA 3GCXA 1MKYA 4DIMA 3TBFA 4XARA 1J6UA 3WRXC 2PAAA 4QUIA 2XOEA 2FAXA 1N25A 3JQAD 4RA6A 4DIKA 5JC1A 5JU6A 5K3EA 2D6FA 2X0NA 2CNLA 1S1MA 2M1ZA 2WV7A 5I4BA 4F3TA 1TF7A 1J07A 5FCDA 1QLWA 4MTCA 5DF1A 3PUHA 2QVZX 3A3NA 1L4UA 3UPTA 3I2KA 1OSNA 3LK7A 1G2PA 1ZA2A 2A5FA 2PNFA 1E64A 3LUAA 3W4JA 4BASA 1ZO8A 4D9CA 1TAQA 4ROTA 1H4VB 2R00A 3IQWA 1BWRA 2HRBA 1ULBA 3H1PA 3HP7A 2ESRA 1VJDA 1SIUA 1SXJC 4IMPA 3KP1A 1PK7A 4KJXA 4Y3UA 3T5GA 1QQ7A 1B41A 2D0OB 1BCRA 4MPDA 4XVHA 2IPAB 1X7ZA 3W06A 3DQQA 2UXBB 1WSWA 4M37A 1NAHA 4C4ZA 1B1CA 4RPCA 3RGGA 5E38A 1H6BA 1QGED 2FMHA 3HU1A 4QKQA 3IH5A 5JCOA 2GJ8A 3CEJA 3OZTA 4H7PA 2IOYA 4OLFA 2I71A 3BMNB 3PQ2A 1YT5A 4FFVA 5G0UA 2I2AA 2I3BA 2Y27A 4GI1A 4HNGA 5E9AA 1IRXA 3Q5EA 1RBMA 1FS6A 1DKNA 3IAM1 1E5VA 4UOZA 3ZI7A 3B82A 1ZINA 3EZ6A 4YMHA 4FQ5A 3U09A 5LIRA 4PNPA 3PKZA 1FSGA 2BRUC 2FR1A 1N8SA 4LISA 4Z4CA 1YIOA 4IDHA 2PUDA 5A03A 5JS7A 2QNBA 2H51A 3WBKA 4JENA 3LLMA 5C3UA 3L8MA 1HFEL 4WOCA 5GADl 1T0BA 2ECKA 3E1GA 3O8NA 2TMDA 4RTPA 1XMQB 4R0NA 1CF9A 4D96A 3LYUA 4OF4A 1DAIA 1PGNA 1VPDA 2YV3A 5CFLA 4O3MA 4YRNA 2VT2A 3OTHA 1S89A 4M9SA 4PLWA 5JHHB 2QP4A 1SQGA 4MZXA 1F1BA 2GARA 2NU7B 2VUHB 4QARA 1TO6A 4R1LA 2JJ2A 2WJIA 3D6NB 5CLFA 1Z0DA 2RHOA 5L3SA 3H0KA 3HK2A 4FWTA 2VR1A 1YKSA 1DKUA 2ACEA 3TLXA 5I7UA 5CLQA 1EA7A 2FSGA 3U44B 3TEJA 1FL9A 5ALTA 5HWSA 2O5RA 1B26A 5SY4A 3PLAE 5IUJC 4LHWA 4KAAA 5H4GA 4MO9A 1MBZA 1RE1A 2XDYA 4R1UA 3EVEA 3LT1A 2OO3A 1NQ5A 2ZM6B 3M49A 3QLUC 4CNQA 2ZWAA 3AJRA 5L9AA 2QXTA 4QNNA 1ZHHA 2XIQA 4O2BA 2VRCA 1N6OA 5DV9A 1P3DA 3UA3A 3ICQB 3E05A 3WYBA 2NTEA 4H08A 1WLSA 2GPBA 3UJAA 1QQAA 1Y3AA 3EOZA 3A6LA 2W0SA 2WE7A 3UKOA 2JLAA 3U39A 1II8B 1YUMA 4AECA 1XZNA 1B3RA 3ZI4A 5CBPA 3DOOA 1SCBA 2R96A 1F8FA 3O8OB 3R6TA 4K26A 2C2WA 1U3DA 3VHQA 3WMWA 2OWEA 3ZCTA 5BV7A 1LQUA 3K4PA 3S44A 3KQOA 1H1DA 1QKKA 2MYPA 1Y34E 2E89A 2PL3A 4QGGA 1CZHA 3TUJC 2CXOA 2HY7A 3VPDA 3QOFA 2HMWA 4LYEA 3ITDA 3OE1A 3GLUA 4QRDA 3IALA 4P3PA 4DUGD 5CLJA 1JFSA 2NQ8A 3M81A 1FUYB 2GX6A 3LKZA 4RESA 3VM6A 3L07A 4W5WA 2B5WA 1YH3A 3B6ZA 3REFA 4DADA 4MQMA 1OZAA 3X2SA 1SCIA 2WJAA 3L7NA 5DNVA 3AHIA 5G53C 4EZIA 1R18A 3H6KA 4FI3C 4WT7A 3DMYA 4LRTB 4RCVA 2ZRPA 2CY0A 3NTUA 4D3FA 2FN9A 3LKDA 1ZNWA 5JJBA 4FX2A 2CLMB 1JZTA 2AOWA 1UDBA 2PQ2A 2QM8A 3B3QA 3KJNA 4O4IA 1DT5A 1A5BB 4M55A 4MYCA 5ALQA 1CRLA 2RSLA 3IOEA 3GJSA 2PVPA 3PUZA 3ZWKA 1TJPB 2Q4EA 2V0NA 3DEIA 1Q1BA 2VJMA 3LZCA 3P4UA 3KPVA 4EW1A 4F9EA 1H3NA 4QT4A 4CFSA 2YWXA 4R0MA 4N6OA 3HN2A 5AI0A 1JR6A 3K53A 2G04A 2BKVA 1QNFA 4QPNA 4QGSA 4P84A 6CHYA 4C0LA 3AUUA 4E11A 2ZKIA 2E87A 4CF6A 1XO1A 4G89A 2I03A 3GHYA 4LDPA 5AK4A 2GEVA 3L4BA 2JA2A 3KLOA 1V7QA 2JI4A 3BH0A 3DFFA 3MWKA 3OQHA 3PFBA 3IEXA 3ZWMA 4GPEA 5K3CA 1HLPA 1ZUNA 4MB0A 4Y6RA 3I9V1 4D44A 1V5GA 2BR3A 4BFXA 1GTMA 2X1HA 4QHSA 2VQEB 1KEPA 3JTMA 4WZAB 1GKKA 2ZYUX 1VFNA 2ZUWA 1R0ZA 1D2EA 1T6YA 1IHUA 4N3AA 4LJKA 3BL6A 1JU3A 4GOKA 4RADA 4DVJA 5HJ2A 5KAMA 4TYYA 5F76A 1U7DA 1XU4A 3BTOA 4EI9A 2H7XA 5AJTA 4AF8A 4I36A 1RXWA 2QJWA 4KMMA 2R1VB 3LRTA 2YICA 4RK0A 5SZIA 1N6PA 1CEEA 1Y7IA 4P3OA 1RQGA 4O3FA 4DVGA 2PH3A 2EVWX 4ASUD 3OA2A 3IJEB 4KHZA 3GUHA 5AICA 2VJMB 2Q0XA 1H5NA 1WP4A 2Z3VA 2QKYA 4LFCB 3WNBA 1I3LA 1C9JA 1GAJA 5D6NA 3R5KA 1SG9A 4FFMA 1HY3A 2R7NA 1NG9A 5JQWA 3MLEA 2OZEA 4I8DA 4M6WA 5AR1A 1RR6A 5FPQA 3VNAA 4WXPA 4BUJA 4E14A 2R6CA 1U2SA 3LT5A 3AF1A 1A9ZA 1L5HA 3H18A 3TO5A 3CRRA 4C0JA 4DIUA 3DE5X 2YYYA 3EPPA 1HE8B 1NJ5A 2Q6KA 4FWIB 5C5IA 2ZZNA 4DLUA 1U28C 3SKXA 4LJ7A 3A26A 3RANA 1E3EA 1RM4A 1V5IA 1HDXA 3C14C 1BOOA 1DAOA 4BNKA 2CXNA 5B7PA 3TKAA 1ZAKA 1D4OA 3GPCA 4IIYA 4N0MA 3QLUA 3S2IA 5BWLA 1ZJJA 1SKMA 2EF0A 4ZPXA 2P3LA 2WT9A 2NZJA 4MUMA 2PNJA 2YX1A 4GI2A 6NULA 1N9ZA 3UOAB 3ANSA 5I7FA 3PWSA 2GA9A 2Q0QA 1QF9A 1QZUA 3DV0B 3G0IA 4L7VA 1E6LA 1P2SA 4MDYA 3R7LA 1CF2O 1IH8A 1JPUA 1RJWA 3OFKA 4NONA 2TMKA 3EQ2A 4FMCB 3ZU5A 1U5BA 3C6QA 3SEQA 4EITA 5IAAA 1NSFA 2NXNA 1D9XA 1E1QD 3I92A 3ZVKA 3BTSA 1GPYA 3H5NA 4G4IA 3U4MA 4M1SA 2UAGA 3MD0A 4BJ1A 4PN3A 3EVGA 2JLUA 2O3RA 3WE7A 4V0KA 4E21A 3AVOA 1OU0A 1Z6QA 3NBKA 3PCXA 4WZAE 3TIIA 4AY4A 5FJIA 2ZRNA 2FZVA 3PD7A 4XFDA 5JAIA 4CGZA 2VOJA 1RI1A 2VQDA 2OG1A 2WU8A 1UBUS 2YV5A 2GRUA 1B23P 4GE0A 3I8XA 4MUIA 2MMGA 1UC5B 1UZUA 4V0RA 2P6UA 3NPMA 2XNCA 2XKJE 3FJOA 2W6PA 4RABA 1EBFA 5IW8A 3WOHA 3O8RA 3R40A 5GONB 1C8LA 1YVRA 4BN4A 1FVOA 4O4JB 1M6HA 5CJPA 4IKOA 4NCKA 2PJUA 2G80A 2OHVA 4PLTA 4U4AA 5ICFA 1JEOA 4RUKA 3GRCA 1O0CA 1VC2A 1FP6A 3FIUA 4REOA 4RY8A 5CFOA 4FC6A 5BNWA 4WGFA 2AYXA 1KYQA 3RKSA 3IOBA 1FSSA 5BSGA 3Q7RA 3JX9A 2JFHA 4K40A 4UTRA 1PFVA 2JLXA 2WI8A 2X1LA 3A0UA 2XWSA 1SQ5A 4BQPA 5T5QA 2QG6A 4CM4A 4EECA 2GCPA 3QMWA 5KNCH 4EQ6A 4PBRA 4Q3KA 3IAS6 2XOKD 3E7WA 5FL7A 4ZCTA 2WWXA 5BUSA 5LZ2A 4M0FA 4XR9A 2EWWA 3FOFC 3H3JA 2QDXA 5LBTA 2G8LA 1RRVA 1QGAA 1Y33E 2P4UA 2ZTHA 5CLHA 5DHTA 4BB0A 4C7BA 2DCUA 4F1WA 4LDJA 4ZOLF 2CEKA 2XGJA 3C1AA 3UJDA 1GUZA 2H4ZA 3QFRA 2NUAA 4ILKA 4TYQA 4ZKDA 5H4HA 3R7DA 1T10A 2GRAA 1R9GA 4LHEA 2JFZA 4WQMA 1M1NA 1VL6A 2CXRA 2DPYA 1KJJA 2B99A 3QHQA 3TLAA 4E4TA 3MWJA 4WACA 5ITZB 3ZY2A 1W73A 2Q6OA 1QV9A 3QELA 3I58A 4NENB 1V45E 3HXQA 4JS0A 4PZDA 4TGLA 4Z8YA 4YP7A 2DPGA 3QIVA 4LAFA 4ZEXA 3ZJTA 1A95A 1VDZA 1NPTO 1X1RA 1Y1RA 3FUWA 1L4EA 3L1JA 4GX2A 4CLRA 4FB5A 4R6XA 5J43A 2DHEA 1T6BY 1YCDA 4Q3BA 4LZWA 2P5YA 3BZUA 4UDNA 3R3UA 1KP9A 1L5QA 1TEVA 2C8JA 5IUNC 5FNVA 2AFIE 1JSCA 1U9JA 2COEA 2Y1XA 3BE8A 3JQQA 1TTHA 4EYGA 4DSUA 4RSRA 3FUUA 3F6CA 4J9VA 5BXYA 1IUOA 3SKVA 3L40A 3VKFA 5C52B 3O8DA 1QCDA 3A1FA 4CKWB 1F3OA 5ETJA 3MMNA 2BHRA 2VF5X 3RHFA 1L5WA 1T5OA 1BGXT 5DO9A 4V0LA 3DEKA 4LJLA 5BO5A 4JHXA 1WZNA 3G49A 3R7NA 3E2PA 4OAOA 4WA8A 3INYA 3U4AA 1IVYA 4YREA 1LPPA 3UK0A 4DLBA 1QDLB 2YMLA 5KTTA 3ZHUA 3HFSA 3UOGA 3ROEA 5K0JA 2QSYA 3VOSA 5L3RA 3T7EA 2ZLBA 4V0SA 4ER7A 2PH1A 4KPUA 2Y0PA 2Q5IA 3EFBA 3NHZA 3OIDA 1FBTA 2ZIFA 1PJBA 1S9DA 1T0HB 1ORTA 1K7CA 2P11A 4RZXA 2O3SA 4IQGA 4EW2A 4DDWA 4MA0A 3LNTA 3UMGA 4AMVA 2BGTA 2NVWA 3V1LA 3DB1A 2WVHA 1WXQA 3SX0A 3O8CA 4E6EA 3EODA 3FFBA 3I72A 1R0SA 3KU1A 2EJWA 2QD2A 1VG9B 3HYRA 1C2YA 2CGEA 2Q1SA 5HS6A 2QUHA 1OX4A 2P75A 5AIBA 4HQLA 3OBBA 3EPJA 2ZSHA 1LJUA 1DIOB 1DV2A 3W05A 3IAHA 3PT5A 5A02A 1O1YA 1PNQA 1QHNA 2ANBA 3F8SA 2DU8A 1F0KA 1B0PA 1ULTA 1GPUA 2H07A 4RFSB 1TM7E 3RHTA 2AGVA 2B6NA 4QQRA 2FPIB 5ICGA 1F14A 2REQB 4JYMA 1Q6YA 3BUSA 4Q0MA 3DZBA 2DFLA 3WHLA 1KSJA 2CJWB 4TTRA 4MWDA 5A3QA 2YYZA 4R0VA 5U9CA 1X7YB 4CFZA 1LTQA 4JC5A 1PDWA 5I3CA 3T38A 4OGFA 5AVQA 4XQGA 3UB4A 4QYXA 1NVMB 4Y2QA 3OEED 4ZHQF 2CSUA 3EVNA 3RNOA 4EYQA 3GV0A 5IDVA 4LC0A 5CBPB 4Z49A 2I6QA 1TK3A 4C87A 4CF3A 3KPYA 4KGDA 3QWBA 5ILOA 4OI0A 2CF6A 2MYUA 3BGWA 3DXXA 4M7PA 4YVFA 2WC1A 4BGIA 2G72A 1T9GS 4GDMA 1KJ9A 1NAIA 1WCIA 2HLDA 4L57A 3PL1A 4GC5A 4ZVVA 3EH2A 4ETMA 5LNK1 1G4UR 1MUUA 1YIDA 4PNHA 3MUEA 2ASVA 3E1SA 2G1KA 4G4JA 5JANA 1Y3IA 3K2BA 1WVGA 5AXCA 1ZIXA 3VKWA 1ZUNB 1H05A 4BUCA 3KJIA 2P9TA 3QUTA 5A05A 2FG7C 1JAHA 3MM4A 1WUYA 2CLHB 3HCCA 3Q88A 2Z5LA 2A0KA 4PS0A 5FBHA 2GD2A 3CH7A 3TVDA 1DJLA 1T15A 1E7WA 1WB5A 1YZUA 1QIMA 3FLMA 4ZI5A 4IIJF 1SBTA 4G1UC 3VDXA 4HWTA 1T1EA 2FMKA 3KZVA 1G2OA 1GFSA 4UAVA 3MPUA 3TXXA 1SU8A 1FVHA 2WA1A 4UVIA 1CHNA 1Z26A 2H6EA 2NN3C 2XQGA 3P96A 4JJGA 1MN6A 1XKXA 2QVCA 4N03A 2SCUA 4A0FA 2JVIA 3RHSA 4ZOAA 2HWWA 1TYAE 3NM6B 3S28A 4ENPA 3C3PA 3TLMA 3I4CA 2B1IA 4QLAA 4XUGB 1ENYA 4LQCA 1IN4A 1QV6A 2H1CA 3HUFA 3LQFA 4DY6A 5A71A 4C6SA 1YJCA 2EX0A 3TMKA 5IC6A 3VHXA 1GGVA 1Z15A 2O2XA 4F4JA 8GPBA 1VLVA 2AFIB 3NP9A 1UIRA 2M6LA 1EEHA 2QLNA 1WMSA 1GEEA 2YZNA 1RRCA 3FFTA 5AJYA 3GD5A 2A5DA 2YC2C 4FDLA 1HNZB 1N2CB 2DWPA 5G0TA 4JB3A 2QJTA 5FL3A 2CCGA 4Q1FA 5FPTA 3DBHA 5MN4A 1V1RB 2IFTA 1KIAA 2J9FA 2WJYA 2ZRJA 1WF6A 3AYXB 3H5TA 3EDCA 4OOEA 4W1RA 4PONA 1N2GA 1OYOA 1X8KA 4QUHA 3ROZA 2FMXA 2XY4A 1KYVA 1I9GA 1M5TA 2AZ4A 2E48A 3A2LA 3HABA 3M5DA 2IEYA 2IF0A 3CINA 3K9WA 5ES3A 5HIAA 4KIWA 2Q2OA 3W9BA 4HWPA 4QRHA 2P0AA 2G9VA 2QRLA 3DXFA 4FBMA 1Z4KA 3GVXA 4DC1A 1USUA 2Z3WA 4W5NA 2Y9MB 2EV9A 1EK1A 4FLFA 4Y0VA 1LS6A 1GPNA 1I2MA 4OI4A 3EQ6A 2DB3A 3GMDA 3H2SA 3OI7A 3VYVA 5EJAA 3ZUGA 4JN6B 3I28A 1ZQ1A 2WF8A 2VKTA 4WJKB 3V7WA 1NA5A 4Y8VA 1EXMA 2E4WA 3H6HA 3N2GA 1L4BA 2R48A 1UXJA 1VECA 2ZSDA 3D4NA 5EHQA 3RROA 4A36A 4FR0A 2LTAA 4W6QA 2ZI5A 4IJWA 1GZ3A 2MU1A 1M2NA 2FZWA 3WB9A 4TM8A 4F7WA 5IPFA 1F2TA 2VJAA 1FFYA 2ZUTA 1ODSA 1UADA 3VZPA 1F7UA 4CKBB 3GJYA 4XRGA 1AIPA 1NXOA 1JBKA 1M0WA 1UT5A 4Z4EA 3TLGB 2GJ4A 4BVLA 4HNUA 2FXVA 3WQBA 3PRHA 3DR3A 1E92A 4HAXA 4RDHA 1E3WB 3M4ZA 5BSFA 1KO4A 1QYDA 1LW6E 4FYYA 4GR4A 4H16A 4ND1A 4QEZA 3DA8A 4AJ4A 4BKUA 3OIUA 4F9GA 5A06A 3O94A 4GKVA 3CO5A 3L7CA 4X5OA 5DCWA