3T0IA

Crystal structure of complex of bt_2972 and adohcy, a methyltransferase from bacteroides thetaiotaomicron
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
245
structure length
245
Chain Sequence
FSFICNYFKLLKRQGPGSPEATRKAVSFINELTDDAKIADIGCGTGGQTLFLADYVKGQITGIDLFPDFIEIFNENAVKANCADRVKGITGSMDNLPFQNEELDLIWSEGAIYNIGFERGMNEWSKYLKKGGFIAVSEASWFTSERPAEIEDFWMDAYPEISVIPTCIDKMERAGYTPTAHFILPENCWTEHYFAPQDEVRETFMKEHAGNKTAMDFMKGQQYERSLYSKYKDYYGYVFYIGQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative methyltransferase
publication title Crystal structure of complex of BT_2972 and AdoHcy,a methyltransferase from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase
total genus 86
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3t0iA00
1U2ZA 1IXKA 2ZZKA 1NW3A 4WVLA 2ZVJA 5T67A 3SSMA 2G71A 4R6WA 1QAQA 5EGSA 3A26A 3AY0A 1QYRA 2FK8A 1UIRA 2PVCA 5CM2Z 5DXAA 3RIEA 2C7OA 1G38A 2PX5A 3UJ6A 2R3SA 3GXOA 1WG8A 4PWYA 5BXYA 3NWEA 3O31A 4LG1A 2AOVA 3GJYA 1XDSA 2WA1A 3ORHA 3UWPA 4B17A 3VYWA 1O9HA 3DMFA 4EKGA 4IWNA 2FHPA 3AJDA 3V8VA 1EJ6A 3LDFA 4OX9Y 1V39A 3PVCA 3HVIA 1Y8CA 2HNKA 4K6MA 2GB4A 4X41A 5EIWA 3FUVA 3P9IA 3UJ8A 3PTAA 2VDVE 1H1DA 3P9KA 4BY9E 3MTEA 4EK9A 5IKMA 5E1DA 4AZTA 2PGXA 4Z2YA 5C9ZA 2O57A 3JWJA 1HNNA 5K0BA 3HCEA 5FCDA 1RJGA 1NE2A 1RI4A 3TFWA 2ZBQA 5DM1A 4E2XA 4KDCA 4Y2HA 4C06A 2H00A 3KQVA 3GWZA 1P1BA 2CL5A 1YB2A 4DA4A 4RVDA 5FHQA 2GH1A 5K0NA 1R00A 2B2CA 2LD4A 4P7KA 3GNLA 5FA5A 5HILA 1VQ1A 4RTLA 4GF5A 2I6GA 4RTJA 2P35A 4YMHA 1KHHA 1PJZA 2R6ZA 4PGHA 1EQAA 1NBIA 2C7RA 3HCAA 4KRGA 2ZFUA 4YUYA 2UYQA 4KVZA 4PINA 1M0EA 1EG2A 2N47A 3B3FA 3EMBA 3SVZA 4YUWA 1WXXA 1QANA 3C6MA 3K6RA 2AOXA 4AX8A 5FADA 3EVBA 5KS2A 4ATNA 2AOTA 4HSGA 5MHTA 3DMHA 3SXJA 4JXJA 4BLWA 4O29A 5DWQA 3EGIA 3L8DA 3GO4A 3MHTA 2NXCA 4DCGA 3BWBA 1BHJA 1P91A 2XYQA 3TMAA 4A6DA 3A27A 3D2LA 3GRZA 3P2IA 1JTFA 3DUWA 3EVFA 3FUXA 3KU1A 3LPMA 3LBYA 1KIAA 2QE6A 3FPHA 4FS8A 4PYQA 5LR6A 5LQNA 3OU6A 4M7RA 1MHTA 2DULA 3EVAA 2IH4A 4X61A 2GS9A 2BM9A 5BW5A 2AVDA 3UA3A 3KR9A 4FZVA 2CMGA 4HH4A 3T7RA 1ZG3A 4H0NA 1X1AA 3KR2A 2P7HA 3B3GA 1B42A 2AVNA 5EQJB 3TRKA 1ZGJA 3ER9A 1SKMA 3SM3A 1G55A 4YUVA 1NT2A 2AZTA 5K0EA 2VS1A 4G56A 5P8WA 3HCDA 1D2HA 5EHGA 3HP7A 3UJBA 1AV6A 1AF7A 2H1RA 2YVLA 5E9WA 3BWMA 1TW2A 4V0RA 1L1EA 4RVFA 2JH9A 5DTRA 2PWYA 3TM5A 1KPHA 2ZW9A 2OBFA 5HZMA 3GRVA 1BC5A 3SR4A 1NBHA 2A14A 3DULA 5HIMA 3FZGA 4DKJA 2ZULA 1SUSA 3RW9A 2Z6AA 1ORHA 5B1SA 5CVVA 5E8RA 2ZSUA 5DTQA 5CVDA 3NDJA 4C05A 4F84A 4C04A 4RTNA 5EEHA 2IBSA 1KXZA 4Y30A 5ICCA 5IH3A 3PFHA 5DTMA 4ER0A 1WY7A 3A7DA 4E70A 3SX0A 3PX2A 2F8LA 2YTZA 4RSRA 5FTWA 5K03A 4DMGA 3LL7A 5E1OA 1DCTA 1YZHA 2ZIEA 5CD1A 2IFTA 4R6XA 10MHA 3DOUA 4PYLA 2P3LA 3HVKA 3HA3A 2UYHA 2ZWAA 2P8JA 5DX0A 3Q7EA 2AOUB 3LBFA 2AN3A 3EEOA 2P7IA 2OXTA 1AQIA 2PX8A 4PYNA 5EOVA 1X1DA 2PKWA 1KYZA 2OKCA 4YV2A 3FPEA 1JG4A 1M6YA 1P1CA 2IIPA 3G5LA 3G7UA 3GRUA 3ID6C 3FPFA 3HA7A 1JR4A 3A25A 4YMGA 1R6AA 4C08A 3EVDA 3EGEA 2JHCA 2ZBRA 3LGAA 4FR0A 5DLYA 5DT2A 5EPEA 3UJAA 3WSTA 4BLVA 2OZVA 2V7EA 4EVIA 3OFKA 1I4WA 4E31A 2BR3A 4YV0A 4PGGA 2YUIA 3F4KA 4X63A 2EG5A 3PT9A 4P58A 2OY0A 3G8AA 5ERGB 2PXCA 3T0IA 3FTEA 2BR5A 4GQBA 2G70A 5E8JA 3GGDA 3CVOA 2P40A 5GIPE 2NXEA 3R3HA 3BUSA 3JWGA 1QZZA 3FRIA 3FTCA 4FSDA 1T43A 2IGTA 4POOA 5DX1A 2I7CA 2OPBA 3KQPA 3M6UA 3B89A 3OZSA 4PYIA 4RX1A 5KVAA 3ER8A 2ZIGA 2GLUA 5CCXA 1TPYA 3IHTA 2CWWA 4CWAA 4MHTA 3MTIA 1VBFA 1XCLA 4OQDA 1O9GA 2YXLA 2K4MA 3GRRA 3KPYA 4IV0A 4QPPA 1JQDA 4XCXA 4RTRA 4PYKA 2GPYA 4CKBA 3HCBA 4MTLA 3LHDA 4PNEA 2ZIFA 4M37A 4GOOD 3DLIA 5FHRA 5GP1A 1JSXA 3BGVA 1ZQ9A 4U7TB 4YUZA 4AZWA 3HEMA 3ELUA 4RV9A 4RWZA 3GRYA 3PLAE 4GC9A 1EIZA 3AXSA 4FP9A 3ERCA 2OYRA 4GBED 4CTJA 3P2EA 5EMKA 3CC8A 4LWPA 2NXJA 1Q0TA 2QYOA 2BR4A 3NMUF 5FQNA 3JWHA 3CGGA 5EZSA 4R8RA 1UFKA 5JR3A 3KQTA 4RTSA 1EJ0A 4XUDA 4BP3A 3FPGA 1XCJA 1L3IA 3LDUA 5GINE 5EG5A 3FPJA 2Z6UA 2PX4A 3EVGA 4HGZA 1AQJA 3KPWA 3P97A 1N7IA 3NJRA 4KWCA 5DM4A 3DP7A 2B78A 3C0KA 3IEIA 2PJDA 5ICEA 5KQSA 4RYLA 3ANXA 1Q0SA 3H2BA 4FSXA 3UZUA 1JG1A 1Z3CA 4E32A 5ICGA 5LQRA 3B5IA 3PFGA 4PIPA 3IYLW 3MCTA 1YZ3A 1DL5A 1SQGA 5EKUA 3VC1A 5T64A 5HIKA 3HM2A 1YF3A 4FGZA 3CJQA 4ER6A 5K05A 3BGIA 1NV9A 3U81A 3BT7A 1WZNA 2ONZA 4X1OA 3QOWA 5GM2A 3TPZA 5K8VA 3TQSA 1KP9A 5LQJA 3TKAA 3QOXA 4A6EA 1KR5A 5DRTA 4OA8A 1QAOA 3KR1A 4R8SA 1ZKDA 5DSXA 5FUBA 2IDJA 2O0LA 3MB5A 3MGGA 3BKXA 5E9QA 4DZRA 1VPTA 1VP3A 2P3OA 2YXEA 9MHTA 4BP1A 4YUXA 5GWXA 1I1NA 2PT9A 2P1DA 2GAFA 5K0CA 2UYOA 1R18A 3I58A 4DQ0A 4QQNA 3R9XB 2GA9A 2ZCJA 3NW9A 5FQOA 2PY6A 2WA2A 5K0JA 4XUCA 3JWIA 3LDGA 3M6WA 1INLA 1G8SA 2VP3A 1G6Q1 2B3TA 2CKDA 3X0DA 1D2CA 3G2QA 2ZWVA 2PT6A 3LCVB 5DX8A 3SGLA 3BZBA 2AN4A 3P9NA 3NVKI 3LSTA 2AR0A 3KPVA 2O06A 3QV2A 4IV8A 1IY9A 5K09A 4EMSA 2O05A 1WXWA 3G8BA 4QQKA 5EEGA 4RTKA 2AS0A 3CCFA 5DRYA 3MERA 3DH0A 2UYCA 3OU7A 5F2NA 4C07A 4HG2A 2Z6QA 2CMHA 1RJDA 3BGDA 1SUIA 4QDJA 4YV1A 1JTEA 1IM8A 4MQ4A 5E9JA 3NTVA 3ELYA 5K0GA 3LCCA 5H02A 3P2KA 3SSOA 3PX3A 3FTFA 3OE5A 2B25A 2NP7A 3ELWA 5LQAA 2YR0A 3G2MA 3GDHA 4CKCA 2AOUA 2FCAA 3PB3A 4OBXA 4PCAA 3TR6A 3UJ9A 4RVHA 4ER3A 3PS9A 4AUKA 2NP6A 2IH2A 2OB1A 1HMYA 3B3JA 4FT2A 4V0QA 3K0BA 1F3LA 3KQWA 3R24A 1XXLA 3I9FA 4HC4A 4EQZA 2NXNA 5U4XA 1X1CA 4F86A 1YUBA 3O4FA 3V97A 5EHIA 4RTOA 1NW5A 2G72A 1YFLA 3A4TA 3G2OA 2ZTHA 3C3YA 3FUWA 4PYOA 4OBWA 4C4AA 1FPQA 3FRHA 3UJCA 1JG2A 2EJTA 4QVKA 5E2BA 2WK1A 3NVMB 3UFBA 5HFJA 4AZSA 3DMGA 5CIYA 1WS6A 5DM0A 4F85A 3DXZA 5G02A 2FRXA 5GOZA 2PBFA 4E33A 4C03A 5KQRA 1SQFA 3HCFA 3BWYA 1G8AA 5DSTA 2PXAA 3M6XA 5BW4A 1ORIA 3LCUA 1VLMA 5HEKA 4KIGA 2G8NA 2HWKA 5EKXA 1NW7A 5LQKA 4RTPA 3SMQA 3FUTA 5BP7A 1L3CA 2ORED 4PIMA 4GOLD 3T7SA 4HTFB 3UJDA 5GIOE 3KQMA 1VIDA 3KQOA 5F2OA 2ESRA 3M4XA 4CKEA 2YQZA 3OU2A 3KQSA 4GOMD 4PCLA 4AZVA 3OPNA 1NV8A 3I64A 4DF3A 2XVAA 3AXTA 2P41A 3I53A 4UOEA 3THRA 1G60A 2FPOA 3E23A 3FUUA 5E2AA 1VL5A 1SVUA 3G89A 5EMLA 1X1BA 3S68A 1MJFA 3TM4A 3HA5A 1JQEA 1KPIA 3KPJA 1R8XA 1I9GA 1TW3A 5KYGA 1X19A 3GCZA 2VDWA 1XVAA 2XVMA 1RI5A 3T7TA 2AOWA 3AWIA 2I9KA 3G5TA 4OQEA 2HR1A 1L9KA 1OR8A 3CJTA 3P8ZA 4KDRA 4MWZA 3DR5A 2VDUE 3MCZA 4PONA 2Y1WA 3RODA 1UWVA 2BH2A 3B7PA 3EVZA 2OB2A 3UJ7A 1F38A 2P3QA 3MQ2A 4P7JA 4RVGA 1N7JA 2QM3A 1P39A 2OO3A 5EMMA 1BOOA 3KQYA 1NKVA 5HIIA 2FK7A 2NYUA 2ZZNA 2KW5A 4P7FA 1VP9A 5C1IA 1M6EX 5FWAA 3G88A 4CXMA 4KW7A 2QY6A 1NW8A 3KQQA 1N2XA 5LQUA 1FBNA 3HVHA 3LKZA 1KPGA 5GM1A 1PRYA 3BKWA 1SG9A 2H11A 3M6VA 4HGYA 3KKZA 3NDIA 1JG3A 3HTXA 3ME5A 4R05A 4ZTBA 5K0LA 4EKIA 1XDUA 3G2PA 2JHPA 2ZBPA 4XUEA 5EIFA 2JH8A 8MHTA 3KPUA 4PYJA 4E2WA 1QAMA 2G1PA 5LSAA 1FJXA 1RJEA 1RI1A 3SSNA 5CUQA 5F2KA 3ELDA 4RTMA 2AN5A 4P7GA 3C3PA 5CVJA 4CTKA 2EFJA 2YXDA 3OZTA 4DM3A 2PSSA 3DXYA 2I62A 3P9CA 4PYMA 2XBMA 2AOTB 3MAGA 3LX6A 5EZQA 4ER5A 2PX2A 2JHAA 2ADMA 4OA5A 5FA8A 3REOA 3BWCA 4WXHA 3BXOA 2BZGA 2DPMA 4LECA 4LWOA 4MIKA 2UZ4A 5CVUA 1FP2A 3R0QA 2O07A 2PWPA 2Y1XA 2YX1A 3OE4A 5DPMA 2XYVA 5EMJA 5LQCA 2IH5A 3FYDA 4E2ZA 3HVJA 4L7VA 5E1MA 3THSA 2ONYA 5DXJA 5HIJA 1JSZA 3DXXA 3M70A 4ER7A 2IBTA 4KIFA 3OCJA 5JUWA 3HNRA 5T6BA 2HTEA 3NWBA 4GUAA 3TKYA 1L3BA 4QTTB 3VSEA 3DLCA 1XDZA 1ZHFA 4E30A 3Q87B 5HOQA 2EJUA 3EEYA 5EC8A 3GIWA 4E2YA 5CCBA 3HCCA 2HV9A 4BLUA 5EVJA 2PLWA 3DTNA 1YFJA 1JQ3A 5K0FA 4DCMA 2VZ9A 3EVCA 2XYRA 5FWDA 2JG3A 3EPPA 3P71T 1RI2A 2V74B 3EMDA 4FT4A 2E5WA 2HMYB 3KR0A 2FYTA 5FULA 3TLJA 3VC2A 4X60A 2ZLBA 5ICFA 3UA4A 4QPNA 1XJ5A 3I5UA 5D1NA 1BKYA 2QRVA 3GU3A 5C0OE 2PXXA 3EVEA 4GEKA 1ZGAA 1EAMA 2ERCA 3CJRA 4IKPA 1VE3A 3FTDA 3OFJA 5CVEA 2C7PA 1O54A 2QRVB 3TOSA 4RTQA 7MHTA 3E05A 4HRAA 1DUSA 1XTPA 3OZRA 4QTUB 4GC5A 1NW6A 3UBTA 4QVGA 1RJFA 2ZZMA 1FP1D 2IPXA 3C6KA 1RI3A 3KHKA 3FYCA 4M36A 1KYWA 3LECA 5E1BA 3IV6A 3LKDA 5M5BA 2PV0A 3O7WA 4M38A 3E7PA 2B9EA 2NNWB 4U7PB 3R6TA 5DM2A 2BM8A 2C7QA 4GOND 4HTFA 1R74A 3EGVA 2JJQA 2IP2A 5K01A 1D2GA 3E8SA 2EX4A 1R8YA 3A7EA 3CBGA 3CKKA 4ISCA 4QDKA 5D1HA 4NECA 2IDKA 3M33A 2Q41A
chains in the Genus database with same CATH superfamily
1UCFA 4WVLA 4ZPXA 3SWWA 2HWWA 2JIDA 2GZ1A 3QY0A 2GJ4A 4ZCSA 4AKTA 2ZJYA 3BF8A 4A0HA 4OXKA 3W2FA 4J03A 1RQLA 2VHTA 4KWTA 2EERA 2A58A 1CY6A 2X22A 2B83A 4RGBA 2C0CA 3UJNA 1AO3A 2QL6A 2IHKA 3R6GA 4L2IA 5NULA 3TE6A 1PG5A 1G17A 1COWA 2H7VA 3QRWA 1G16A 2F8SA 4AJ2A 3ASZA 4RPGA 3NHZA 1GL3A 2PZ8A 4RGYA 2FP4B 4XIYA 1W44A 4E1VA 1PJLA 1AQNA 3I2KA 4BMXA 1UT8A 1SA0A 2GM3A 3U4QB 2IS1A 1G98A 1OXUA 5B55A 1SBQA 2J1LA 1BDBA 4I0WB 2J7PA 1K86A 1QYCA 1S1CA 3MCAA 4HN2A 3AVWA 2XUGA 4QYWA 3RFVA 1NX6A 1QGYA 3C5WP 3GD7A 1XZBA 4OATA 2I3DA 4E46A 5IYZB 1B16A 3MTEA 4YMTA 2VPIA 3ANMA 1O8CA 2IOQA 5FKJA 5T5QA 2GVDC 3EQ7A 2PGXA 4X3CA 2OQIA 2YHIA 1VJ1A 1LLQA 1Y6ZA 2PZEA 5INTA 5KSZA 1KEEA 4EUSA 5KINB 4AMUA 3ZHVA 4D26A 5IZCA 2XZLA 1RJGA 1FXSA 3C4QA 3OOJA 3KU4A 4YRTA 5ISMA 4RZIA 2HSWA 1PR0A 1QLHA 1QOZA 1RLOA 4UC0A 4YI3A 2YZ7A 2QN6A 2YH2A 1ZI8A 3AJEA 3M3HA 1FVFA 1ABFA 3GF4A 4NCNA 2QTHA 3R8CA 4DEYA 3T3GA 1VQ1A 2G07A 4GF5A 5EXTA 2J4DA 2GNAA 5TSDA 4TYMA 1QHFA 1WQ3A 3GC6A 3AP2A 1AK2A 2UYQA 4LZOA 3P2YA 2E6UX 3AX6A 4DRZA 4E5VA 3B3FA 4YCLA 4WX2B 4UM9D 1QBKC 4L8FA 4X71A 1HOXA 2O2JA 2XMZA 2BFBB 4WN3A 4RF4A 4F72A 3VPSA 1GZ7A 3IURA 1ZCJA 3TW0A 3F0TA 3NTQA 1HYGA 1COWD 4K8OA 5HSGA 3GO4A 4B4DA 5B57C 3IOYA 3AILA 2J5RA 2YXPX 4JB0A 4V38A 3AUAA 1BHJA 1P91A 5FPSA 5KYXA 1UXIA 4W8HA 4UFNA 1C9DB 4BX8A 4MNTA 2J7PD 3ZBPA 3THWA 4HWPA 3H11A 4KXNA 2OORA 5NLLA 1L5HB 4M6WB 1M1YE 4RMIA 1UBFA 3TNFA 3TBHA 4XLZA 4JI4B 3RT9A 4IJQA 4U2GA 1I3LA 4QYMA 1M73E 1WUHS 4WQMA 2CMDA 1X1SA 3T0FA 1GVNB 1F0NA 4NE7A 3UQZA 2WYUA 4BGUA 3SYLA 3PE6A 4I2NA 4I5FA 5ESRA 1KFBB 2GBCA 3IGFA 2OFOA 4TV8F 4KLAA 4EX7A 4OUDB 4N18A 1L7PA 5J43A 1SKMA 4U39A 2CL6X 4LNUA 1U1DA 2DCMA 1X15A 2VQSA 5CHYA 4PRLA 4X5OA 2YRXA 3DT8A 3OQMA 3ZWYA 4HAXA 3MWGA 4LSMA 3SE7A 2ENWA 1AK9A 4Q7KA 4BE7B 1D4FA 4Z7JA 1TL7C 1YL6A 3OESA 4V0RA 1QB8A 2JH9A 3IERA 4LE1A 4BFXA 5HZMA 5TNXA 4EFNA 1PZXA 1ZD3A 4AF7A 4FGUA 4H7FA 5HM8A 1RKQA 4XQ0A 3Q8XB 1T29A 5DB4A 1E1KA 3VKUA 4RK0A 5DYIA 2EJVA 3C43A 3OF2A 1SC1A 4C05A 1HNXB 1MNAA 4UBKA 3VOTA 1AM4D 1VLQA 3F9RA 3ZUGA 1L5NA 2QT0A 2VCEA 3LBNA 1WY7A 2BFFB 2F8LA 2I3GA 2ATEA 3G7NA 3QE3A 2C88A 1CY8A 1VXRA 4RSRA 1ZU4A 1UANA 3QUBA 4CL0A 3BG5A 3AL2A 1BVHA 1PL7A 10MHA 1TJ4A 1QCYA 2Q4RA 3HVKA 3I04M 3KT3A 3PL1A 4LN1A 1M34A 4BEWA 4IIJF 2E85A 4JQCA 5IN4A 1MH1A 3GFPA 3PI6A 2W2NA 1WCYA 3K05A 3QFHA 4R8VA 4ZEMA 2XKJE 4TUYB 1HKUA 2WR8A 3IKLA 4NYJQ 3EA0A 4L16A 2P75A 3G5LA 3GRUA 3OCUA 4GX0A 4B3MB 4HPWA 5I45A 3CF4A 3ZXXA 2XYGA 4FD3A 3PUJA 3DM9B 4EA8A 5GJBA 4YMGA 4CEJB 4R2LA 4NFYA 4QUDA 3BVPA 3WK8A 4J91A 5KYWA 3KDSE 3E0XA 3MWEA 5JSFA 4RJ2A 2JHCA 1BX3A 4BV8A 4UOQA 2H59A 3E7DA 4PZZA 4MCJA 5L3ZA 3WYEA 4KAXA 4B3XA 4CW7A 1DT5A 3TTUA 2OGTA 5CT6A 5DCWA 1N0IA 4EUFA 4D97A 4Y0AA 3U7FB 4X44A 3UGJA 4X63A 2NUAB 4XQEA 1E32A 2PXCA 1BCRB 3JASB 1Q19A 3O6VA 4QOIA 2CT8A 2IPOA 1IB0A 2P5YA 4UMEA 3GGDA 1S1MA 2V7TA 4I81A 4CMJA 3UMGA 5IG2A 3O95A 3PX7A 3MT9A 4QJ3A 2O2CA 3CQ9A 3W04A 3FTCA 4BX3A 4POOA 1E4EB 3UF0A 1E3WA 1VJRA 1EWYA 1AKTA 1KI2A 5FO0A 2GHQA 2O6HA 1KTVA 4BOYA 5C18A 1RAIA 3IHTA 3QKWA 2DQSA 2VHYA 2V1UA 1CLEA 4FOSA 3RC9A 4C4XA 2QUZA 4M1YA 2YXLA 4PGMA 3ZCPA 4RTRA 1N2BA 3RANA 3LQFA 3UHOA 4ALKA 1RQNA 1W1IA 4NU8X 1ZGHA 1NJSA 3DD1A 3HYSA 1OXXK 5DWVA 2MSNA 3P2MA 5EQFA 4CLOB 2IV7A 3EQ9A 1AXEA 1PVDA 3F9CA 3GRPA 3F73A 2QNBA 1JSXA 2VWPA 3EHEA 4ZVLA 4IEIA 3MN1A 1KI3A 1QG4A 4RV9A 2OQ2A 4L4ZA 4CMIA 3OIUA 1QM5A 1NVEA 3L06A 3MGBA 4LY6A 5JTTA 2O7SA 2QP4A 1LV7A 2NX2A 2ORIA 2VNHA 4ILEA 3D8NA 3AEKA 1Q1EA 3JYNA 4UE2A 2WUFA 4I3HA 3SJAA 1Y1RA 3UUWA 3W06A 2O3UA 3EYAA 4XX0A 1D3AA 1WXFA 2DR0A 4ZU6X 3C1TA 2A0YA 2QYHA 3N2GB 3MMZA 1YR6A 2ZRKA 2ZWMA 1DJNA 3I5AA 4ZVSA 4LJSA 4Y2TA 4DR6B 1XMVA 4BO0A 1FIUA 4M1MA 4F6RB 1F9AA 4P53A 3BTVA 3F3MA 4LMBA 5BV2P 1Z3CA 1RQPA 2JGAA 3MJTA 5A4IS 2YZGA 2V6IA 3IFSA 1KY4A 3OPYA 1NVKA 3JRWA 2ALJA 2F6RA 1ZGBA 3HXTA 5AVWA 1I13A 1LLCA 1YF3A 2D06A 2QT9A 3K94A 3LV8A 2GN1A 1QFXA 4P4GA 1YE8A 2Q6TA 3LOQA 4AZ0B 3BT7A 1Z0UA 4UBIA 2IV3A 3IIMA 3MMNA 1ZIDA 5JBIA 1A9ZA 1KR5A 3K6SB 1UOQA 2BF7A 3KR1A 3KYDB 2PKEA 2WQ7A 1JBQA 1JIUA 1ANKA 1MP0A 4GO1A 3C3BA 3R6WA 1R64A 1RT9A 3USZA 1V5WA 1Z74A 2WKSA 4BZWA 4D4IA 5L3SB 3HL0A 3RF6A 3MINA 3PRJA 3T7CA 3ZLTA 3FDIA 4HCJA 3WYFA 3WKBA 4DCPA 2JJ1A 3OQOA 4G85A 4BGVA 3T9DA 3OT1A 3E1SA 1U4OA 2VDLB 3ICOA 1TC2A 5IT0A 1M8PA 3LCVB 3HKCA 1O6FA 4ZCRA 2PGLA 4CLRA 3BJEA 3AHDA 3ZOKA 1M2JA 1KTIA 4CEHB 1NMEA 3QENA 5G53C 2TYSB 4RZQA 5F2NA 4JCOA 1J8MF 2G8LA 4DR7B 3BGDA 3HO8A 4CM3A 1JTEA 4YH1A 2VJAA 1MO4A 1NRIA 1MN6A 2C4VA 3OQIB 5FFNA 3BDIA 3HNOA 1YJBA 3P4UA 4P38A 2CD9A 1SOUA 3ELWA 3IVRA 2GCNA 3ANYB 4G0VA 1JHDA 2GBIA 4RHCA 5B6JA 1UBMS 4AP6A 2IH2A 1EDOA 5ENVA 2V3VA 4TL6A 4DDUA 1J9ZA 2IDMA 4CLXA 3IBFA 4YT2A 1K1EA 2GK3A 2NXNA 3MSXA 1I10A 1PYOA 1YUBA 3EUAA 2G72A 4RL4A 3ZZ0A 3UW1A 4AG3A 3OIDA 1AUPA 3G2OA 2O0JA 2W2OA 1C4WA 4ED9A 1GUZA 1JR6A 1G4UR 5CIWA 1SHJA 3P0IA 3FVQA 2Q5OA 3UH0A 2Z1NA 3F5FA 2YWFA 4LXHA 4OB8A 3EPLA 1JWAB 2VLBA 3HO1A 3BJZA 1V96A 1WDLA 4Q24A 3LCJA 1B3BA 4YYEA 4DUPA 5BWNA 2X5XA 1U2GA 1UC9A 1ND5A 2EIXA 1IM5A 1WMAA 2JJ1D 2YIVX 3U3KA 3EFHA 5CFRA 1YTUA 4GXNA 1KI7A 2CB0A 4B3RB 1FB5A 3MFQA 4HGRA 3ZKWB 3QA9A 1ABBA 2FMIA 2FPIB 2KLBA 4LQ4A 2VQ6A 3HDYA 2HYIC 3H16A 3GI1A 3GT0A 4OHBA 3R3JA 4KR7A 1JDJA 1JGTA 3TJRA 1PJSA 3ND9A 3ROTA 4E4TA 2XCLA 4G24A 3DDHA 4N3BA 2EQ5A 2VTKA 4S05A 2OFPA 2O8BA 3EFBA 1CF9A 3E9NA 1RWNA 3ZWPA 1TOAA 2CLCX 2XX3A 1H3NA 1QWSA 4LUCA 2CLHB 2YFQA 2YQZA 3KQSA 3L7AA 2YBDA 2VCHA 1QIGA 2MCFA 3RFFA 2BM0A 1U6IA 3RC3A 2IUUA 2J9ZB 3HLTA 3L5KA 2OCXA 4LYDA 5EMLA 1BS2A 2ZJFA 3HJTA 3BH0A 2VC2B 3F6CA 3RSOA 2ANBA 2ZRDA 4D9MA 1G8HA 5LP6F 1LBEA 3L7YA 3G5TA 1P2VA 3GV0A 4LISA 2R68A 2VZ8A 3NHYA 3PIDA 4MWZA 4CR8A 5I7VA 4CF6A 4PSAA 1BW9A 3PGVA 4GE0A 4BPRA 3PZBA 2LVBA 2R1TA 2YJ5A 5HK9A 2G25A 4DS3A 4M1TA 1W0CA 1NR1A 1JHZA 2DWQA 3O9VA 2NW6A 5KU7A 1TTQB 3WZ2A 5LMNB 2J3DA 4WL0A 1C81A 4RGQA 5HJ2A 5CDFE 4P7FA 4Q0MA 5H3HA 4CE6A 5C1IA 5TY0A 1W34A 1T0JB 2EYUA 5EXSA 2BGLA 4I2VA 2A5JA 2NUBA 4KPEC 3DE6X 4GMGA 4MK4A 3I0ZA 3K72B 5EYPB 4UDXX 3U9TA 1AZWA 5HKKA 5KJFA 3UH1A 1SVKA 5GM1A 2I4LA 3M6VA 3O8DA 4XM1A 1UEJA 3U1TA 2V9CA 4UE3S 2R1UA 1FP4A 1POXA 1HE8B 1FRZA 1CQWA 1JG3A 2ZI7A 2J5QA 3H1GA 4N47A 4HVTA 3NTRA 3V2HA 3PD1A 4URXR 1L7NA 3FX2A 3I9V1 8MHTA 2JH8A 4AY3A 3E81A 3UOAB 1Y8RB 1GNLA 1C9JA 2ZUBA 3IALA 2C95A 4GNKA 1KJYA 2BSAA 4DLRA 4EYGA 5JW6A 4YMUA 1K5HA 1JHOA 1NLUA 1NNSA 2J6IA 3FWNA 2YZNA 2EBWA 2G9UA 1QP7A 1K5PA 1A5AB 4JL5A 1KOGA 1YVEI 4C76A 3PYLA 4PZYA 2RHHA 5H81A 1W7AA 3KLBA 3AETA 5EP3A 2QTMA 5LU9A 1EGMB 3TVDA 2W2QA 4LKRA 1K08A 3IMFA 4ZAGA 1NFFA 1UMBB 1RW4A 1UFQA 3HO6A 1U2TA 3O4JA 4Y2PA 4BCBA 1ORWA 1U9JA 5CVUA 1N6NA 1CVLA 1F8XA 3R0QA 4M9CA 4OXNA 4MMYB 1QYIA 4UCFA 3EW9A 2EFHB 4LE2A 3THOA 4E2ZA 1W5BA 1DO8A 1G0OA 1J8FA 3LXMA 4ER7A 1E66A 4XIGS 5ARCA 3FTEA 5B7PA 2XQIA 1NQWA 4AWBA 1I7PA 3VSEA 1NVAA 2XNDA 3RVOA 3DLCA 5B3KA 5HKKD 2B2XA 5GMOA 3HUFA 1AK1A 2GKGA 4LHXA 4AICA 3OEED 3F6YA 1V43A 3W6PA 1IXSB 2PLWA 3UMMA 2J9FB 2RE8A 1TYDE 2DJIA 2HOQA 2MMCA 4C4TA 5JASA 3G8DA 1PI3A 2DLNA 1S3SA 2Q6IA 3NAZA 1E0AA 2J3HA 3SEQA 1OXMA 1F6DA 2VJBA 1E5TA 3O84A 4C4PA 4RHXA 3RVRA 4NOJA 4BFWA 3ZNNA 1JDVA 2OAQ1 2B0JA 4B3HA 2G5TA 3HJHA 4XXHA 3FTDA 4R0VA 4AF8A 3FZEA 4RTQA 2QRVB 3SS7X 2OC4A 2G5CA 3ZE9A 3WFIA 2Y99A 1VI2A 4X97A 2ZIVB 1NC3A 2F90A 5ES4B 3DPSA 2C82A 1MC1A 2QTBA 4G0NA 5F98A 2R8XA 1T9DA 1GU7A 2ZRPA 4M88A 4DT1A 4Z49A 2XECA 1V7QA 1PGOA 2RGAA 3D3WA 3NHFA 3Q7QA 5K8JB 5IAOA 4YCAA 3E70C 2PUTA 4KMMA 3TGPA 4TKUA 3B3AA 2W70A 1MRZA 1IQRA 3H99A 3OUUA 1LV8A 3BB1A 5J2TF 3UHJA 4OLFA 2JJQA 2D1SA 5AW9A 3TBFA 3V33A 1RWKA 2IDKA 1S9HA 3U5ZB 1PWYE 4L6AA 4Q4JB 3F97A 5T67A 1NW3A 1XKLA 3NHSA 3R8XA 3OQNA 3VU8A 5CEJA 3I4CA 2XNDD 3WMEA 1AKNA 1WXIA 2FK8A 4L95C 2EP7A 5U9CA 1RRKA 2A1TS 2R3SA 3H8SA 4GX2A 5JD6A 5FOWA 4M1ZA 5TQ0B 4BHTA 4X8MA 3NWEA 3T54A 3QUTA 4GPAA 2ZTUA 3ORHA 4LG1A 4CEIB 2QN1A 1O9HA 4MVJA 2PK3A 2QX6A 3D2AA 4D98A 4O2BB 2KJQA 3LDFA 1UC8A 3RJ9A 2C2GA 3W8DA 2ADOA 2YYSA 3JQBC 4LKOA 3ZGYA 1U2QA 2B9VA 2FPKA 2ZJBA 3PENA 2W7TA 1RAGA 4BCDA 4DR1B 3FYHA 4UNSA 1AS0A 2GB4A 3U39A 5J4KA 3FUVA 1AB6A 3FCXA 4LXQA 3G0CA 4HDSB 2JFNA 3IR6A 4EK9A 2QY9A 4TL7A 5IVIA 1CUEA 2OOSA 4IVQA 4IYRA 1TIBA 2EX0A 5T3UA 4BZQA 1D8AA 1UZUA 1WF6A 5BMOA 4QATA 1FUUA 5BSHA 5K0BA 2PR7A 3RC2A 3BQ9A 2BN4A 2WZDA 4K05A 4C0AC 4CFSA 1AUQA 3WXBA 1S0UA 3U7IA 4KR6A 1TKBA 2AD1A 3VMMA 4P2BA 2QPOA 3AJ8A 3EZ9A 4DXDA 1WQ4A 4ZI2A 4OHRA 4CJXA 1N9GB 1CUGA 2H5JA 3WBKA 4KFTA 4JR1A 2CJYA 2H2DA 2FGKA 4L50A 2C7RA 1VYTA 3U31A 3FYUC 3RVMA 1R3DA 1V37A 4PINA 4XPIB 3U3OA 4YDRA 1TEVA 2FLVA 2O5RA 4WNAB 5ENZA 1NJ5A 3O82A 4AO8A 1JEYA 4CG0A 2Q1SA 5E7JA 3N1UA 4AY5A 3BMOB 5IM5A 2ZT7A 4AJPA 1D1PA 3ED1A 4KPYA 4MVJD 3VJMA 1JDBB 2Y77A 2HK7A 4GP7A 1XQ9A 3NOOA 2R4TA 3A27A 3L0BA 5CX4A 1IPHA 2Y1FA 5EUMA 2G9ZA 2VQ3A 5AKLA 3LPMA 4FYVA 1ESDA 1VL0A 3NT2A 4A0RA 1U04A 3L92A 3RASA 4DJEC 1VKHA 4ESHA 1XMPA 1JT9A 1O3YA 2AEJA 3U44B 5EESA 2D4AA 1XPRA 5CYOA 1EINA 1E5DA 2XGSA 4OUDA 2QNIA 1JR3E 3LIPA 1KJQA 1LRKA 1R2QA 2X7XA 3I42A 3KKEA 2XB9A 3R3VA 2GWHA 4KI7A 1CU1A 1M7HA 2JLBA 5LWHA 4X1KA 1DO0A 2H2AA 1N5OX 2AW3A 2ZWOA 3KYBA 4YUVA 3T06B 4BFTA 4GMHA 1Q3KA 3MUFA 4B80A 1TJYA 3DL2A 1T5DX 1QTIA 2FN7A 2H85A 4GR5A 4HQ6A 5CPBA 3UJBA 2DTDA 2M98A 2YVLA 4B44A 2XOXA 4TSRA 2GTIA 4FX2A 1Q1QA 4MIOA 5CLGA 1JR2A 1YS7A 2XVYA 4PW0A 1J70A 2L17A 3OLCX 3N05A 3I4FA 1H2RS 2HZ7A 3K6KA 1I4TD 4MS1A 1O0CA 1SFRA 4KUGA 1KP3A 3IC5A 1KYQA 1RXUA 3A10A 5CVDA 3ZU3A 4OSPA 1TFUA 4IGEA 4RTNA 2REQB 5KTRA 1V4NA 4U7JA 1FXWA 1KXZA 3DYVA 2ZU6A 1QQ6A 3DE3X 2GCOA 3NTXA 4J4HA 4W82A 4M86A 1XZKA 5GONB 3AF6A 3M4JA 2PZGA 1U1FA 4PZLA 4MQFB 4F1WA 2IOHA 1OGYA 3DOUA 4TUYA 2XMRA 2PYDA 3HA3A 1V4VA 2P8JA 2WAOA 2DT5A 1VE7A 3GZNA 4M0FA 4DXAA 2J67A 3L4BC 1NUQA 5BQFA 2UZIR 1K6JA 2ERXA 2YV1A 2JIMA 2VHXA 2BMEA 3FPFA 3FR7A 3BZWA 4GDMA 2BT4A 4UMFA 3VPGA 2GJ9A 4DQKA 1G21B 2GM5A 1E2IA 4BMCA 3UUEA 2WSMA 4C4SA 2Z08A 5JV5A 3ZVNA 4IIYA 4V02A 3BXPA 4QGAA 3GFTA 4Y1EA 4IRXA 1PFWA 4CMBA 2DSNA 4Z6KA 2J08A 1N9KA 1VHQA 3JASA 3ZLUA 3VTFA 2PVPA 3SEZA 4Q1AA 2I2AA 2YIDA 2YY6A 1Q21A 1R6BX 3I1IA 4KDEA 2FDCA 3LOPA 1LNZA 3IOEA 1QGDA 3TYXA 1UZLA 3WHPA 3HJAA 4O4IB 3IKTA 5E8JA 2X3FA 3CTMA 3MS2A 3OWOA 4XYGA 1ZYUA 4B73A 2GASA 3QHAA 2H1WA 2OPBA 3OZSA 3MELA 3O74A 3B9PA 1JKFA 4ZAXA 4YREA 4WCFC 1LF5A 1VKOA 5FNZA 4EUEA 4YY3B 4O4JA 2GEUA 5JCOA 3RG2A 1VBFA 4F8YA 4RAOA 5F7XA 2PLNA 2WC1A 5FPYA 1GRCA 2K4MA 3KPYA 1QOQB 5L7YA 4CM5A 1R5OA 2GSWA 2VSYA 1F4LA 3JVDA 4IX1A 1N2CA 2GARA 3KWLA 1GYRA 3CW8X 3PQ5A 1QX3A 2IU6A 4KVGA 4MV0A 1J0CA 4C9BA 1NM5C 5GOTA 2Z58A 1N33B 1CQJB 1ZMXA 3HLYA 1P31A 1ULHA 16PKA 3D6MA 4U7TB 4CKBB 3GRYA 1GAWA 1R9JA 3AXSA 3BH6A 4D8WA 2NV2B 2CHQA 1L4LA 3BJIC 5A05A 3IEVA 3DLPX 5H82A 4N5DA 1QDLB 3TI9A 4FFWA 4JBWA 4EPXA 1XALA 1I2ZA 3KKMA 5ARBA 3EQZA 5IABA 1OC4A 5LMZA 5EHQA 1L5ZA 5HRUA 2HBQA 2W6JA 3KT6A 2H5EA 3VPCA 2GSDA 4UJ3A 4C78A 1E1DA 1U0HC 2PU7A 3IOMA 4BUZA 5ENDA 3FBTA 4DM7A 2BWJA 2PJDA 5IKPA 5HZKA 1XJCA 5IF9A 2E4YA 1U8AA 2V4UA 1Z6XA 3DMRA 3NBZC 3JSAA 1A71A 1TD1A 4MV1A 2X77A 5E6RB 4E11A 5HIKA 2PUBA 3K6SA 3BRSA 4FGZA 4ER6A 1W2GA 4ZQBA 3T35A 4X1OA 5FTKA 2MSWA 2WG0A 3CSSA 3H5RA 3DWGA 3MFYA 3PDCA 4MQEA 4ZO9A 3W5AA 1EBBA 1PKEA 2CNBA 3F4BA 4TMYA 5I7WA 1PUXA 2BRUA 1NYRA 3S2YA 3SVTA 3ZZMA 3T3MB 2V7BA 2Y0DA 4LHWA 2EZ4A 3I1YA 1K2WA 3Q0IA 1NVBA 1WXEA 2JLWA 1OWMA 3DDZX 3EBPA 8ADHA 1NUSA 3AIMA 3D7LA 3RVBA 1JJAA 3VKHA 3N0RA 2GA9A 2AR9A 2YIJA 4D9EA 4XYEA 4G25A 4LRYA 3P0RA 5CHEA 2VP3A 2WI8A 3I37X 4P36A 5EMHA 3TQQA 1ZESA 3OC6A 4YMIA 2A92A 1X8XA 1U0LA 3RC7A 1II8B 3IS3A 3SQNA 1XRQA 2AR0A 1GPUA 2B1QA 3BL5A 4RS4A 5E4JA 1K4MA 2YICA 4HTAA 3WGGA 1LI7A 2W90A 1J8VA 1O57A 1VJGA 2W6JD 3TRIA 4DMMA 4TLMB 3VVMA 5CB8A 2ZR0A 5KTKA 2Z6QA 1OX6A 4QDJA 3HB5X 3MVEA 3RCBA 1SVSA 2QRPA 3TZEA 3UMVA 4GE3A 4GYYA 1YAJA 2OECA 1QH9A 2Q8QA 1YZGA 3L7KA 1EDBA 3OOSA 4G26A 4KQEA 3U7JA 4D2IA 5KQGA 2AOUA 1NKTA 2HA2A 4PCAA 3PRYA 1QHYA 4NEQA 1XTVA 4MS3B 2OB1A 1S2OA 2J0EA 4V0QA 3KZMA 3R9KA 5C4IA 3KJHA 1ENYA 2F62A 3HFSA 3WGOA 3SKXA 4DIDA 4R0NA 3EG5A 4J6EA 3N2YA 3NTUA 1U28A 3A1EA 4Q01A 3QLVA 2O14A 4H0FA 5BN3A 3LA6A 4CGZA 3GPDG 3NXKA 4N0MA 2P27A 3AB8A 3MZ0A 2OHHA 3PHLA 3RWOA 3PWKA 2RBEA 4FYPA 5I7HA 3M7IA 1JG2A 1Y1TA 1Q3HA 3JQAB 2E6KA 1XLUA 2FQWA 1K06A 3KO8A 4OM7A 4WPGA 3B3QA 1T2VA 2HMVA 1CQIA 4BNJA 1DPGA 5B2FA 5K8TA 4QDOA 1ESMA 5KQRA 1G2PA 3WS7A 1UPAA 1NVDA 2FPXA 2HA5A 4WSOA 1RHQA 5DSTA 5A3RA 3LYLA 2C2OA 4CMEA 1ORIA 1MB3A 2BGIA 2BKVA 4M7WA 5KZMB 2NVOA 2P4HX 2GBFA 2CDCA 2YQ5A 5EP4A 4BWYA 3LXUX 4X0EA 4I99A 5DWDA 1WSWA 1GILA 3ZIAA 4CIYA 1DJPA 2DUNA 1JPVA 5KWSA 3UJDA 3R7NA 2OCIA 1OI4A 3CF0A 3RM3A 1E64A 2MINA 4OBEA 3IDFA 1W0JA 1N3BA 1Q3TA 1KFJB 3VZCA 3FKSA 1U1EA 3WYDA 4DF3A 2YV3A 5E6UA 3PWZA 3EJWA 1SXJC 2P41A 3ILSA 5IJ0B 5BR8B 1L8AA 3E23A 2H0RA 2JW5A 2ZYAA 3FUUA 3TIIA 2PRZA 4G89A 2MU1A 5JNUA 2JK0A 2LIVA 1N2OA 3LVBA 4HADA 2X8LA 2G1JA 3I5MA 2VJLA 2WM3A 2H2FA 3HA5A 3IQIX 4JLDA 4OPMA 5JAQA 5CJJA 2C8VA 3QU5A 1J49A 2PO7A 3LA8A 4NZMA 2DWCA 3UV7A 4J7CA 4F04A 3AWIA 5I9IA 2FX2A 2HWUA 1BHSA 1WVGA 1G5IA 1W52X 2VRWA 4JP3A 2WAXA 4JUDX 2HR1A 1JYFA 1Y8AA 2VDUE 5D6NA 5CPFA 2OV1A 2O19A 3B7PA 4KL8S 2YZKA 3FAZA 3MIZA 3RYFA 3PNMA 3JYOA 2VNIA 2I03A 5FUQA 5JQWA 2B21A 2ID8A 4JN6B 1IU9A 3D2BA 1LVHA 3V5NA 2DKFA 5B58C 4NQZA 5ALZA 4CIWA 4BX2A 4D96A 2WYHA 4LV5B 1G19A 2G28A 2DUMA 3H1TA 4YP0A 3S99A 3ZNQA 2D2FA 5F51A 1GOTA 4D9JA 1OAAA 5EIBD 4FM9A 1KAMA 1D2MA 4NMMA 3KEFA 2YHAA 5KMGB 4DABA 2YWHA 4AZ3B 1Z5NA 4UBNA 1S89A 5AKIA 2HTFA 5CXQA 1GXSB 3DFMA 3SZOA 1UUFA 4RO0A 1OTYA 1PZHA 1E2DA 1KS9A 1YVPA 4PSVA 1G59A 1QPBA 1A95A 1RIIA 4R7TA 2FPUA 4HX5A 4JC4A 1NYLA 1DBPA 3LYAA 1W0JD 3I1FA 4H7EA 1N0VC 1H5UA 2WFAA 1AO0A 3FKSD 1VG8A 4F97A 1P7WA 1OYYA 4UMVA 3FDXA 3EASA 4YT8A 4P7GA 5IJ9B 1NF2A 3R5HA 3IKVA 1CY4A 1E2KA 2LCIA 2AGVA 3QP9A 2XMSA 4JR0A 4RA9B 1G8FA 4XD2A 2JI9A 4R98A 4ZXPA 4ZKDA 1ZH8A 1J2UA 1UMBA 4JWTA 4DMLA 3PP8A 5C4MA 1Q6YA 3VC7A 4OLJA 1MIOB 4S12A 5CVTA 5CAEA 3K7EA 1J0XO 1E8NA 3FWHA 1U0JA 3BXOA 3HP4A 4DLAA 2FVXA 5I9NA 1OB5A 1Y1KE 3DDWA 4XZ3A 3S2SA 2I55A 2POQX 2AT1A 1D9ZA 2PE5A 4Q9DA 4TQGA 1NI4A 3FYDA 5EPOA 4C29A 5I3ZA 2JLAA 2ASEA 5ARDA 1TQ8A 1X1QA 1JSZA 5CLHA 1YCDA 4CR7A 4E7OA 4ZO4A 3RTAA 2RGXA 1H2BA 2XZDA 3I73A 2YFKA 2BKEA 4KIFA 1NE7A 2IW1A 3P96A 4QNRA 3SZ3A 4BFYA 2XBLA 5EJEA 3A06A 3IQHX 3TKYA 4XFKA 3WY9A 4RJJA 3WLAA 1EJ2A 3LWDA 3DL7A 3EAGA 2XEDA 1QV7A 4G5XA 5LBUA 4DC1A 3P5SA 1MAHA 5ALKA 3DVSX 1GPAA 3JRNA 1WOYA 1JDSA 2DFKB 2X76A 3DZBA 4BYMA 1AMUA 4NK5A 1OFGA 4B4UA 3KNZA 2CXOA 1F20A 2HB6A 3LPCA 2WQZA 3SFVA 3EPPA 3FFTA 3ENWA 3UCFA 3SHOA 1E6MA 1KO8A 2QRVA 4I1YA 1L5MA 3ZTYA 1L5LA 2P5SA 5F76A 2C0PA 5E0KB 2PYZA 1JNYA 1NUAA 2Z3ZA 1JL3A 3OT4A 3PBKA 2W6QA 4FI3F 4ND5A 4LHYA 1SM4A 5CB4B 4QBIA 3E5MA 3IQGX 4U02A 1B15A 2RAUA 4V1CB 1KSHA 4ZO8A 3U3JA 5LNK6 3MHPA 4U7GA 2KHZA 1ZS9A 1T2NA 4FYKA 1UJCA 3P9ZA 4EYSA 5AICA 2ZRGA 2HUPA 2XAUA 1BCSB 3BD8A 2EFEB 1LPBB 5B1DA 1KE1A 4EM6A 2BDUA 1HT0A 2E1RA 4R84A 4YUZA 5M5BA 1CZKA 2RHBA 2NNWB 1R6XA 2QXUA 2P0YA 3QBTA 5BXQC 1DELA 3G0GA 3H0CA 3EGVA 3VNAA 2QUAA 2XJ4A 5JAMA 2EX4A 3O83A 4QDKA 5AO9A 5IMBA 1NNI1 3VU1A 4B33A 3IA7A 1RM3A 2JCSA 3H9JA 3REGA 3OJ0A 2CHEA 4Q4AB 5L3VA 3ZI7A 4R6WA 1XMIA 2JDIA 5FWYB 2DPGA 3EGXB 5KNLA 3QXCA 3HUTA 3U4CA 5L4NA 1N5RA 3D6NB 2VH5R 4BBAA 2F43A 2PX5A 3IPLA 2QZZA 2WHYA 1WG8A 4FE4A 2QX9A 4X7BA 3R3ZA 5EJ4A 1YK1A 2FUCA 4EG3A 1T0BA 1MBZA 3ONDA 2AOVA 3CVVA 1OB2A 2BI4A 1JA0A 3R4CA 4H3KB 2ID4A 1TX4B 4O4HF 2OLKA 5AI9A 4LW8A 2I87A 5BORA 4TZ6A 3E3OA 2X7JA 4CHTA 3IO3A 1O6CA 1SCDA 1YC5A 4WESB 2LCFA 4JLMA 2UKDA 2PMBA 5HDBB 3U0BA 4IXNA 1Q1NA 5EIWA 4LQCA 3GOQA 5BNTA 1IZ9A 1SBNE 5H5JA 3ZE7A 2ATIA 1USWA 3I8XA 4PQEA 3SKVA 3ZJYA 5C9ZA 3GNQA 1Y3FE 3NH6A 4TWAA 4DV0B 2I3AA 3C98A 4R3UC 1JEAA 2H4XA 2VHUA 1H23A 1RI4A 1S2IA 2ZBQA 4B83A 2APJA 2ECQA 3KALA 2GPJA 2CL5A 5JISA 5TGZA 1CJBA 2IPAB 3N7UA 4JD5A 5KNDH 4H3SA 4M0LA 3DXFA 3R40A 3EXEA 2LD4A 4D9IA 2HK8A 3QU2A 2GLXA 3NT5A 4LS3A 2VSNA 4XPIA 3ZH2A 1XZ8A 1XQWA 4ZALA 2AX3A 3X2SA 3HCAA 3KELA 2GBLA 3PDUA 2JDID 2WSLA 3MT8A 3LHIA 3FDZB 1A7KA 3OQJA 4MUXA 1KOJA 4EJFA 4YUWA 4WK2B 2ODTX 1XU7A 4O63O 4TMVA 3AI2A 3IUEA 4V0KA 3NUQA 2PKXA 2Q5HA 4C1NA 3EXFA 3HB7A 1M2NA 4BFVA 3EAQA 2NV0A 2OCKA 4IRUB 2C42A 3EY4A 1UBSB 2Q5LA 1XZIA 1U02A 3V7UA 4F3YA 2O7VA 3LMKA 5CURA 1AJEA 1DWOA 2B0CA 2J87A 2IYLD 4NCHA 5EJ8A 5K0SA 1M72A 3T34A 1J20A 3UG7A 4TV9F 2ZB8A 2QTWB 1GNPA 3U44A 1W5SA 2QTRA 3K16A 5GZ1A 4M7RA 2PEYA 5JNSA 1KL7A 4DIBA 1TNDA 1QHNA 2H8KA 5BR7A 5BV1A 4DV2B 2V7GA 2JZCA 1QDEA 1ZA1A 2Q3BA 4C22A 3UA3A 4NVRA 4J2TA 1EGAA 3CGWA 4NATA 2D54A 3WGMA 2O1SA 1JG7A 4HH4A 1P6XA 4KWHA 3MEQA 4Y6LA 1S02A 4TL8A 5TQJA 3G0DA 4AYWA 4EUHA 4MQUA 1IM2A 3EFOB 4FFVA 5FJJA 1QK5A 3L79A 5CW1A 2VTDA 3SM3A 1NT2A 4WEOA 2ZQZA 4Y6QA 1JU4A 1TYBE 5IJXA 4G56A 4DJFC 1B2RA 3GFFA 1K92A 2PQ2A 3HP7A 4O4LF 3MCVA 5LYJF 3N2IA 3FPCA 2XSZA 2IZOA 2R2AA 4LK2A 5IDVA 1AZSC 1TVEA 1YFZA 2GZ3A 4IJKA 4RVFA 2PWYA 1SVLA 4GLJA 1GADO 4FFLA 4YP5A 2W2PA 2ZAGA 3LX5A 3OZWA 4R68A 3RYTC 4IZHA 4DAOA 721PA 5HKAA 5HTOA 3O8QB 2GN4A 3B1FA 1WMSA 5J40A 3BTOA 4Q03A 3NOQA 3KAQA 5FNVA 1JJBA 1P75A 4Y30A 2AKYA 4V3CA 5IH3A 4F2WA 4ER0A 3COJA 4JP1A 1K0UA 2BOVA 1MO5A 1V16A 4EATA 3B53X 4BBJA 4DNFA 3QPAA 3B6KA 1HDYA 1DCMA 4Q47A 2C7BA 1OWPA 4UAGA 3TJZA 3W77A 4BDSA 2UYHA 4YCBA 1ORTA 1XUOA 3IVGA 1EA5A 5FFMA 4M53A 1U0GA 2XMDA 4EW2A 2O54A 1L5VA 1BGXT 1QOPB 2WTNA 1R0WA 3KB6A 3NEAA 2O3TA 1QTQA 3FJOA 3KKQA 2NO7A 2VK8A 2GF2A 1NRWA 1I14A 2FF7A 3P2OA 4BZPA 1C4XA 4MAMA 1SXJB 4KO3S 4MUFA 3AGPA 4YJGA 1SD2A 3BBPA 2XODA 5BW8A 4EL0A 2C5FA 2G1KA 1F0PA 1GG2A 2ILTA 4LTDA 3GHHA 3HK2A 3N0TA 2QMQA 1U3TA 1FYWA 2ZR9A 3CRRA 4IF6A 4RY9A 3BWDD 1GR1A 1KJ9A 2XSZD 5JVDB 1WO8A 1S8FA 2XMGA 1XD8A 3VU9A 4QHSA 3Q72A 4L74A 5CLJA 4OYLA 5J5CA 4FZJA 1ELOA 2G70A 4MJ7A 5T41A 2GPTA 4IIVA 2NXEA 1BMFA 4GKAA 2WF9A 3L1HA 3TZ6A 4KSYA 2PFSA 4E12A 4D0SA 4J94A 4H7PA 1LVGA 1YUNA 1C3LA 4UHEA 4V0LA 1SMKA 2QIPA 3P4YA 4DIFA 1YIDA 2ODEA 2WT8A 3QTLA 4XE5A 1H2YA 1XCLA 3I2JA 5CRIA 3EIUA 5J4HA 1T13A 2TMYA 2VKTA 3FVWA 2R7AA 4Q3LA 3CLRD 4CKBA 5KQMA 2IYXA 4PNEA 3GBSA 2OBNA 4C3VA 2FPMA 2YCLA 2HK6A 4KODA 3VOAA 4I9FA 3PPWA 4DEVA 3KEQA 3DNFA 3OO1A 4FQ8A 4QICA 4A10A 1QP8A 2EJCA 2Y1OA 3OEHA 4K03A 5JXGA 4J0CA 5IAKA 3P2EA 4IS3A 4R71A 1KORA 2FW6A 3SQXA 1S96A 4CKWA 3RS7A 4ZODA 2VNSA 1HBJA 3D6TB 4FSHA 3LUJA 1NQTA 4M55A 1L7DA 1RYEA 1XCJA 2FFJA 2XT0A 4JELA 2XIQA 4M98A 4YO8A 3VM6A 4LFAB 3PICA 1QYWA 4EGJA 2DEUA 1ENZA 4OP2A 3E35A 3C5CA 1P9WA 4YT5A 5AW8A 2UZ0A 4J16A 3S8EA 4PE5B 4ZVUA 1ECLA 3DP7A 3OKCA 2W2KB 2HHHB 5BY2A 3UGKA 2ZETA 4Q3DA 5KPDA 1Z5WA 5TT1A 4HMQA 1R4MB 2X6RA 1LPSA 2XJ9A 4RKYA 3LLMA 2H18A 5LA6A 5AW5A 5MDHA 4Q4CA 4HAUA 2J0QA 1SCNE 4FN4A 3BRCA 1SQGA 5LUAA 1GGHA 1ZN8A 1W75A 2FX5A 2JL1A 1DKOA 3CLTC 3HBAA 4IHJA 5FLKA 3F6SA 2XWSA 1A4UA 3TPZA 4WZBE 3HEAA 5AI4A 3TQSA 3WIBA 4TPKA 3TAXA 1VPEA 3I52A 5JD5A 3CWZA 4DLSA 1QG0A 1IWOA 4F0JA 1TA4A 3T5GA 3V1KA 3U19A 2R8YA 1IHPA 1ZJWA 3K9LA 4X1YB 4IJUA 3UK6A 5BNWA 4PZAA 5I8WA 4QGGA 2HMUA 4Q9NA 1OH7A 2EBHX 1Q7RA 1OX5A 2B8TA 2V6BA 1C14A 3TR0A 4BUCA 4YROA 2Y1CA 2RHCA 4QQNA 3R9XB 2XUZA 4S04A 3B9QA 4YLEA 3TCNA 3ZW8A 5FQOA 4B87A 1XLWA 3LX8A 2XNHA 2P2SA 3PGXA 5EJ2A 4PBSA 5HCUA 4BEJA 3OEHD 3CMMA 1QR2A 3RYIB 4D41A 3FE2A 4QBFA 1T9GR 4O08A 1M5UA 2JGDB 3AEUA 3HC7A 3OHPA 4MGYR 4MW5A 4NE9A 5DX8A 3W6NA 1GPBA 1P73A 3VPFA 3DBIA 3PT5A 4IV8A 1BS9A 4MCHA 4K6HA 1NG9A 3WRVA 1E5QA 3G8BA 3HN6A 4C43A 4U9IS 1LQTA 3GLGB 3VUFA 2D5LA 2YDYA 4TWZA 3Q3JB 3KOYA 4EVSA 4ZI5A 4U2EA 1N78A 4MQ4A 4AJ4A 1M6NA 4ZMRA 1L7BA 1DQSA 1G18A 3CSDA 2YHSA 4NCIA 3SSOA 5DM70 3T3DA 4LXYA 4DEXA 1EDZA 1C3VA 1XELA 2G3YA 2P9TA 4KXMA 2OBYA 1J9EA 2PNFA 4GH5A 5SY6A 4NYJR 3PB3A 1K2VN 1RE0A 2G36A 3U3DA 3JQQA 3SLKA 5ILOA 2BEJA 5IKXA 3DE5X 3KVOA 4C89A 4CYMA 1F3LA 1JFFA 2JAXA 2JCYA 5FORA 1GQFA 1I32A 1MJHA 4QYIB 3EWAA 4QLOA 3ZBQA 1Z39A 1MABA 4ID3A 5T4FA 3V97A 1MX3A 2O8DB 2VBFA 3A4TA 4Q4DA 1AQ6A 2F4NA 3C3YA 3VR3A 13PKA 2QL7A 1R7RA 1F3OA 1ZSNA 3JQAA 1KVQA 4I36A 4PXSA 1BYIA 3U5TA 2FG7C 4NDZA 1KNXA 3AVQA 2VDMB 3L0PA 5IKEA 3PG5A 4HQNA 1C1XA 5CFQA 4DADA 2ZM6B 2ZU0C 4V0NA 5IRCD 2GXQA 2J6HA 5CIYA 1RHKA 3CUUA 5DM0A 2OAP1 1SELA 4LWQA 3E22A 4NZNA 3TW4A 4I5GA 3RVLA 3QPVA 1JU3A 4UE6A 1WVMA 2JIBA 1JYSA 3JTMA 1KZGB 3O4VA 4KEAA 2QX7A 2QUKA 1XNGA 1SZJG 3PFFA 1XTBA 4MB0A 1V71A 4N01A 2Y66A 2HWKA 1VTKA 2QX4A 5LQKA 3FBWA 3B1XA 3KZNA 3D6VA 3DNMA 2ECFA 3M6FA 4PV7A 1L6RA 1VMIA 4JFRA 5DO9A 1A04A 3V4FA 4BAZA 3L1UA 4CT5A 3QLUA 5K8IA 4ABTA 1BKSB 3C7TA 1GCUA 3L6BA 3O8OA 2WJPA 3JRXA 1TC1A 3HYNA 3OZFA 2HF2A 1UEXC 4CKEA 1D4AA 1Y6QA 2VPYA 3DHEA 4JGIA 1YR7A 3KV1A 1QHIA 2ZYTX 4ZCQA 2WFLA 3ZHZA 5A2GA 2FPRA 4J2OA 3EUEA 1HE1C 4PLGA 5AXAA 4BFLA 4W63A 1PD1A 1MT3A 3IDQA 3BGOS 4FCCA 3LP8A 1US8B 2B69A 4FC7A 1J0AA 1KAOA 4K9DA 4MJ3A 1VLJA 5FV7A 3M9WA 1C2TA 4DCVA 3TZLA 4O2AB 3IPCA 5L3QB 2C92A 4GQAA 2YNMC 3I01A 2C0QA 3LTEA 1GT6A 3OLVA 3TEFA 2WPDA 2VUUA 4JIMA 2FB9A 2LWIA 4LYYA 3RS9A 1I7LA 4DWVA 4UHJA 1V3TA 3JQAD 2RK6A 2HQSA 2PBRA 4BNFA 4JVLA 2Q8NA 3CG4A 3O90A 2EZTA 3TZCA 5F3WB 1C9KA 1N7JA 2G17A 4C3OB 4BKMA 3PD7A 1NHGA 1ZD8A 2BSQA 4QLAA 3BL6A 2W4IA 4QXRA 4P80A 4EGAA 3QYPA 1F2VA 4IOMA 2LDXA 3GZTB 2O1XA 2F7SA 2V0GA 3GQBA 1FBNA 5D85A 2AC7A 3MXOA 3ZWCA 1DO2A 2PAAA 1ADBA 1Y63A 1B3RA 1S3IA 1TCUA 1VFNA 2O4UX 2PJZA 1MW9X 2ZIWB 3AKYA 4RAQA 3DUFA 1NW4A 3AFNA 3DAGA 3IP7A 3MM4A 3PU6A 5EIFA 1F9EA 1XEWY 3H6KA 1R6DA 4KSBA 1OWOA 3CFYA 3K73O 4HUQB 1U7XA 2WAMA 5FLEX 4HH3C 4DSTA 2O8CA 4AS3A 2NUTA 1T6YA 5JLJA 5E4TA 3HMKA 3NV7A 5CVJA 1UJ6A 1UBGA 2W2XA 3NKLA 5E2IA 2AMFA 3DXYA 4IL5A 3O4IA 5SYAA 4CFYA 5LOVF 1H66A 1RPTA 4Q93A 2AOTB 4TS3A 1B2LA 3JAWB 2C5EA 4JKIA 1NNEA 4QUJA 2JHAA 4OEHA 4GP6A 3QEMB 1G8YA 2YMMA 5IDXA 2IRWA 5BVHB 1JVBA 3UMRA 1W88B 2XAAA 4BKUA 1FLVA 2DPMA 2WPDD 1J7JA 1RYZA 4JLWA 2OWEA 4XUGB 5JI2E 1I6WA 1WDKA 1Y4SA 3SEAA 4Z4IA 3LCMA 3CZRA 1DIRA 4IO0A 3KVNA 4G01B 2SKDA 5T8KA 4NJOA 4HL6A 3THSA 2QA5A 1A5BB 3M70A 7ABPA 1LSOA 1NT4A 2ZI3A 4GIBA 1IHXA 4RULA 1X8KA 5B7QA 4P3YA 4TVKA 1IHDA 4TTPA 2WILA 3TH5A 4KHPB 4Z4QA 3T1VA 1T1EA 3X43A 1T3LA 1WJGA 4GUAA 4CIVA 1ODTC 2PZMA 3FHTA 1VKZA 2QJOA 2H7CA 4AN1A 5AI6A 3ZDYB 3P9SA 5I3CA 1F14A 4BE9A 1IY0A 1L4MA 1JKXA 2YN4A 4N65A 5BMVB 4O3MA 1T3TA 1YWGO 2JJYA 2PFGA 2QM7A 2VYFA 3Q3IA 4P54A 4H31A 1BEUB 1YDEA 5DT9A 5FOVA 4UEKA 2GZDA 4EHLA 1OTXA 2VO1A 3HHPA 3ON5A 3WGYA 5LNK1 1D2NA 1P6QA 3LRPA 2Q0HA 3T1HB 4DZZA 2PLFA 2ODNA 4QPNA 1FNCA 1TT5B 2Z5GA 1R0ZA 1Q77A 3JZIA 4MP6A 1CIPA 1RLMA 4PZUA 5CXXA 3IJ5A 1DAPA 4G09A 4NZOA 4DNOA 3GCDA 2GM4A 4V1CA 1EM8A 2R11A 2VT3A 1EP3B 4BTEA 3T95A 4F38A 3BMNA 2OV3A 4M83A 1Q95A 5T4EA 1OQAA 2VCYA 3EF0A 1LDEA 1MPXA 1NC1A 1NF9A 3FB1A 3MAAC 1DAGA 1LBIA 4HRAA 5IW8A 2VT7A 5ICSA 4M9RA 1NW6A 4DM4A 3IILA 4BLPA 1N2JA 2H07A 1GKUB 2G77B 1JWLA 1YU9A 1EK6A 1VA5A 2P2DA 2P62A 3ZLBA 2FQXA 4DIKA 4FZRA 2OAGA 3CRW1 4FTWA 1MA0A 2JZOA 3GUHA 3E7PA 1THGA 1XYYA 1IJFA 4KXYA 4U7PB 3SBDA 4MUNA 2X4GA 2WWHA 2W8BA 1ZA2A 3AEQB 4Y9UA 2H7XA 4WOCA 5T6MA 4R3NA 4XM0A 3AY3A 4LMRA 1R8YA 3QVGB 1SQ5A 2W2VA 4ISCA 4IUYA 3QG5A 3HDQA 4KQ6A 1YZLA 2NN3C 4YP6A 4DY6A 1GJRA 3HKDB 5A4DA 2OBMA 2QN9A 2FWPA 4LWZA 3SSMA 2AH5A 1QRSA 3STUA 4A16A 3L3BA 4MKXA 5G4KB 5IC6A 1VHJA 2O2EA 1H94A 3QLEA 4KXLA 1SKAA 5K6TA 1U0EA 4ASUA 2JB9A 1GSIA 1UIRA 5DXAA 4JMLA 4CQJA 1KQGA 4RLQA 1KU0A 1MO6A 4PWYA 4JLKA 1MD9A 5E3JA 1T9HA 1LK7A 4K81B 4C2UA 3CH4B 3Q9UA 4B17A 4E1AA 3CF2A 3VTAA 2O8EA 3TW6A 4EGFA 4FWTA 1IN7A 1CZUA 1G20E 4QIHA 3UKDA 2WWXA 3EDRA 5K01A 4BL5A 5CD9A 1BVYF 2FPPB 4GM1A 1Y8CA 2HNKA 2VL7A 1B0ZA 1LDMA 4U00A 4QHTA 2PJRA 1YNSA 3N53A 4X41A 3L82B 3TNJA 4U5QA 1ZSVA 4AWAA 2VDVE 3RJZA 3CRNA 4TXLA 4MUMA 1G2QA 1GPLA 2HHLA 2Z9DA 1N4AA 4DYVA 4BJ5A 1YQDA 4TMTA 2FDRA 2FKAA 2JCGA 1RACA 1DXOA 5I9BA 4P86A 3V8MA 1V95A 3F3KA 4YCMA 2G7ZA 4G5OA 4FFDA 1H1LA 3TFWA 1H9CA 3GR6A 3PQ4A 5DIZA 3MPOA 1ZUNB 1JNXX 3CINA 3IODA 3CONA 4N8DA 2AI1A 1VG0B 2DY0A 4AF6A 1I94B 4UASA 4MB2A 2FZGA 2ZRBA 4UUBA 4RTLA 1E3TA 3QMPA 4P4SA 1SQ6A 3EXAA 5DYTA 4QBHA 3T6KA 3AFGA 5REQB 1JZQA 4UEQA 1CYDA 1A72A 3WKEA 2VJYA 5CT5A 2OENG 1DWUA 1F8UA 5JQGB 1M0EA 1D7OA 1M66A 2NIPA 4ASUD 4DV3B 5HQ3A 5ERXA 2R1VA 5IWAB 2AJBA 2E1PA 2FJ0A 3LFTA 2H7YA 4HSGA 4YRBA 3EGOA 3CSUA 1PGJA 4HWSA 1L8OA 2Q2QA 2QMUA 2EX1A 3EGIA 3L8DA 3AU8A 4KHZA 2NZ2A 1UBHS 2ZJ6A 4A6DA 1M5TA 1XRSB 3RYHB 3FWKA 1LB1B 1LS1A 3VHXA 3G23A 4L3OA 1V9SA 3ES9A 4BLRA 7YASA 1S8NA 4R5HA 2YJ4A 1WD5A 3E1GA 1V25A 2BFMA 3DQZA 1S2LA 3OU6A 4FDAA 3U09A 1TCCA 1O89A 1J90A 1GPJA 1SXIA 2DULA 3EVAA 3U1BA 1SXPA 2GS9A 4EHAA 5DNYB 4EMTA 2NMVA 1QE5A 5BW5A 4CCWA 3EFOA 2ZQYA 5JH7B 1WULS 4MVJF 4Y67A 3SJZA 2ZANA 1A2BA 1BKDR 3GEDA 3NBXX 4DCSA 1UKCA 1GFZA 1JKJA 5DLPA 1K68A 2NO1A 2X19A 5EQJB 3KLNA 2RHRA 3KKLA 1YKSA 2GPSA 3H2ZA 3P9RA 5IYZF 3Q10A 1Q74A 3D1JA 3BRWA 2PLRA 4RK7A 3H7AA 3EDYA 2FFRA 1LY1A 4PSDA 1AF7A 3H2SA 4D8XA 3VAAA 2BD0A 1AKYA 2HBYA 3ICVA 3EN0A 1HOTA 2YIMA 2B4RO 4S2UA 1REQB 521PA 3LVFO 3CA8A 3QW2A 2YOFA 1ISJA 2G09A 2Z4TA 1X13A 3ZV6A 3BB3A 1U2PA 3DTVA 3ONVA 4NRDA 5ITZA 5B1SA 1HWYA 1CEYA 4LBWA 3OH8A 2R65A 3NPAA 4OQ4A 3VHLB 1A88A 4B82A 1K0FA 1QFYA 1KO7A 2C4WA 2DX7A 2E48A 3KP1A 4XVCA 3GLFB 3V1NA 3NBYC 3HV2A 3WGLA 4L72A 2CUZA 1P2DA 3PFHA 4S1OA 4Z1MA 5HX7A 3MBIA 4C7OA 4DLUA 4LF4B 4MW2A 3W1EA 1N6IA 2P9ZA 1QTRA 2BSXA 4JLSA 3OZGA 4M22A 4WEQA 4B3CA 1X7WA 5DNEA 3RBAA 1AHPA 1LH0A 1BN6A 1VMDA 2R1ZA 5TJHA 4DCCA 2JI7A 3G1UA 4KLZA 4Q7MB 3U1VA 4PYNA 3GJ6A 2YZMA 1UADA 3DV9A 1I51A 3JWEA 4H9GA 4RABA 1GRRA 5JCZA 1WP4A 4BRSA 5DLEA 1GAJA 2X40A 4PHTA 2V9PA 1HI9A 2XITA 1VDMA 1JR4A 4JEUA 1Y4ZA 1JJVA 1PT5A 5AI8A 4Z4FA 3K30A 5JY6A 3A0RB 2E18A 3S70A 1HYBA 2FNAA 3EZ6A 2XKAA 1UBNA 1B76A 4B6FA 4FE7A 5KUTA 4QSMA 2FSVC 3BRWD 4RM3A 1EHYA 4L78A 3T5BA 4TMXA 2RJ3A 5JTUA 5DHFA 5KC9A 2ZYVX 1RRMA 1UKVY 1N2IA 4P3PA 3ZQUA 5WRFA 5A2QA 4ZT3A 3T0IA 4MV3A 1E2FA 4PO3X 4CQLB 1V7ZA 2CLEB 1B43A 3JSXA 3DBOB 4A8JC 5F5NA 3B12A 4R0MA 1VHLA 1FJ2A 3Q11A 4FNMA 4X1IB 4WBNA 3S81A 4EPWA 3DTVD 3QKUA 3V1TC 5D51S 3WWCA 3CN9A 3KC2A 1SUWA 4LMPA 3OLYA 4QA9A 5I5GA 3U61B 5DFAA 3EC2A 1UM9B 1JB1A 2VT6A 4W8GA 4D3FA 4Z1MD 5H0IA 4ZZ0A 4MHTA 3DHYA 2ROQA 3B85A 1IDN1 4LYHA 1USGA 4YV2A 3PDIB 1YO6A 3TIFA 4U8GA 1KZ9A 1XXHE 4ZT7A 5C7IO 1E59A 4IFEA 1N0HA 3QITA 4U7DA 1EHIA 1C9MA 1BDJA 1XNJA 2C7VA 3D1LA 4G0XA 2NM0A 2R5NA 2WTAA 3U80A 4DSNA 1G9XA 4LC9A 4QARA 5AVKA 4WOPA 5JJKA 1T15A 2B99A 4CTJA 3HYRA 4J0DA 1A76A 1MAVA 3L0SA 2R4UA 3E61A 5B3JC 1JQJC 4H3HB 4TLCA 4WKGA 2VDRB 2AYXA 4RPHA 1AGPA 3DFFA 4B76A 4C7XA 4ETWA 4XIIA 2W2KA 5CDUA 1MB4A 8GPBA 4TUYF 4KXWA 3W0LB 1QE3A 4X91A 5LDHA 5GINE 3SYTA 1VJDA 1DOHA 2VHZA 1DBWA 1UAYA 3N8KA 2VKQA 3O8BA 4HGZA 2OMEA 3QELB 3CLUC 2G5GX 4M7PA 3WJ1A 1P5JA 1ZK3A 3K96A 4BQRA 2I99A 1L5QA 4GI5A 4W5JA 5DGXA 3GLIB 4LBVA 2WKRA 1TIPA 1Y37A 4BFZA 1NBME 5DN9A 3OLXA 4RFSA 5IJAA 4L4UA 5B7NA 3FPKA 4MRSA 4PTLA 1VPDA 3ZHTA 2E4VA 1HE3A 3LRXA 3CRVA 3CEPB 4OXIA 3S8YA 3KTAB 1B00A 3VI4B 3EJ6A 3QOWA 1SOAA 1VM6A 3BIFA 3OZXA 3RJMA 5KOJB 5LZ4A 2X42A 1L4UA 5DP2A 1ZM9A 4L5AA 1EFPB 2IP1A 4OA8A 5DRTA 1OH8A 3O8NA 1K7XB 3AVUA 2IDZA 5TVKA 3CUYA 1TM4E 1X7XA 3MGGA 5E9QA 3SS8A 3FYTA 1C0EA 2O50A 3D0OA 3E3AA 1NY5A 1U9IA 3F7TA 4R40A 3ENVA 3HU5A 2YDXA 4G4GA 4GPBA 1HMPA 2CXHA 3DC2A 4ENRA 3I4LA 1ECPA 2FG5A 1XVLA 1E7WA 1KQPA 2JGDA 2IXFA 4N12A 4IIDA 1EVIA 1ML3A 4ZOLA 3SC3A 2H5LA 1IE3A 3DVQX 1YAHA 2BGUA 1WXDA 2FEKA 2J5XA 3AR8A 5EE3A 1SCUA 2QUBA 3ND6A 4B4WA 5BYKA 4EG6A 3WR5A 4NKRA 1OXSC 1ATIA 1R16A 2R6GA 1ECCA 2VUHB 3KKZA 3CYFA 3QYFA 4GGMX 4O0LA 5HXAA 2YWEA 5K09A 3R44A 3R0JA 2Q99A 4LZNA 2FPGB 4NHEA 5HQJA 2JFWA 2J33A 3CISA 3DH0A 4K6FA 5IBPA 3TO5A 1DBSA 1NULA 1SHZA 3X2FA 1A9XA 1GD1O 3NYQA 4IDOA 1W2HA 2PKQO 4ZD6A 3ZS9A 4TXNA 3NTVA 4RJKA 4YP1A 3D31A 1UWCA 4TS9A 4F91B 1KI9A 1CD5A 1FU8A 3BJRA 3UY4A 5LQAA 3N0WA 3LKVA 1VHWA 1JIIA 2F17A 2CFCA 2YOHA 3QVVA 3PS9A 2FA9A 4MWGA 5E6SB 1GAQA 4FFBB 4FT2A 2HH9A 1Z62A 3KQWA 3T0GA 3T99A 1EMDA 2IIQA 4HC4A 3SQOA 4D43A 2BUAA 3Q6MA 2BGNA 2XTMA 4ZYXA 3DCYA 3O4FA 1CHNA 2VUTA 4IQFA 5AK0A 3VVLA 5ESDA 3K3PA 1K89A 1RADA 1YCHA 3IQDB 2MYUA 3WLPA 4A9AA 4R2WA 2XE8A 1GCOA 1MAWA 4PYOA 3UT0A 3VKVA 4EDFA 1Y8QA 1FRNA 3DBRB 1YVRA 1U9CA 1Z13A 2ADFA 2NQTA 5HFJA 1RYDA 4DBLC 3Q41A 1V3UA 1RP1A 1ZIPA 2C2HA 3QPDA 3HRKA 4G1MB 4OMCA 3DC7A 3CF4G 4QQ8A 5LP6C 4DQUA 5BSGA 1M2VB 1MT0A 2BTQB 4NP6A 5ALJA 4E33A 3DZFA 2G9RA 1XTTA 1OC2A 2IXTA 3NCTA 2Q7OE 3RSSA 4BO4A 4EJSB 2HT1A 2BCJQ 2AZ4A 1RU3A 1XA0A 1E3IA 2O2HA 4L6CA 3HDJA 3IP6A 5TARA 3OC0A 4NYIQ 4RTPA 2E4WA 2DFDA 1UODA 4HLNA 3PGKA 2EL7A 5E2BA 1RKVA 3DVAB 3GLHE 3H17A 4HTFB 5JC8A 1RLJA 3KQMA 1ZN9A 2F55A 5KSOA 1TA0A 2IJGX 3EEFA 1CS0A 5FOUA 3T7AA 1UKEA 2P1ZA 1US8A 1VE6A 1Q16A 2Q3FA 4NDAA 1V9CA 4NF2A 4HFMA 4MWOA 5JSQA 2GEBA 3O75A 5JEEA 4IEEA 1MCZA 1EFHA 2AG8A 2CJFA 1NJGA 4MW6A 4RD0A 3S68A 4HDMA 2OGSA 5JSKA 1I9GA 1TW3A 1WMDA 4AECA 1PK8A 2I29A 2B6NA 2H1IA 2SECE 2SCUA 3PC8C 4RKQA 2RI6A 4BQPA 3ISVA 4LPSA 3UWOA 2NNLD 4BLSA 3G9ZA 4BV9A 2BYTA 1FJHA 1PS9A 2C9ZA 2RONA 2Y1WA 4HP8A 9ABPA 1YXMA 4GPEA 1M6WA 4OGLA 3BHIA 1SC4A 3CIFA 3UJ7A 2J32A 2OGZA 4AJ9A 1FFAA 3GELA 3A36A 3H75A 3LTNC 4QUIA 2VR1A 1R6UA 4XR9A 2PGAA 1ICEA 2VH1A 1GSAA 2A94A 1O97C 1FTYA 1BU5A 2Q3HA 1I4OA 2H65A 2HMWA 5FWAA 4ENVA 3KOOA 2AI3A 2QY6A 1A9RA 1KVSA 4R2XA 2O23A 3AF5A 2F9LA 1DJQA 1JZTA 4Z8XA 2RGCA 5FOQA 1J42A 2QQFA 4ZT6A 1PUIA 5EL0A 3VPHA 1NUTA 1CG6A 3NETA 2JVIA 1QAMA 4AXBA 1VI6A 4KX3A 1CS4C 1FJXA 5TQVA 4IJ6A 4QULA 5TV2A 1ZC3A 3WL3A 3K9CA 5CUQA 3ZS8A 5BSEA 1LBQA 3IQFA 3UAVA 3HMQA 2RGWA 5MN6A 3GJ0A 1PEYA 1RC1A 1SZDA 2Q6KA 1PR9A 4J6FA 3PHGA 3ZHXA 3VYVA 5CDGA 3ICEA 2CEKA 5SZJA 5F1PA 2B6HA 2QORA 2ACVA 3K0CA 4Y0VA 1FQJA 5GV8A 4LGMA 5KSYA 1ZEMA 3G1TA 3QVXA 4G4IA 4GSLA 4H7DA 4NR0A 3GP3A 1HA3A 3OE4A 3UJPA 1WZUA 3TPCA 5LQCA 9ATCA 4BGDA 3DQQA 4RYDA 4X84A 3B9RA 3NALA 2WU4A 4AC9A 1XKTA 2XT6A 5AMXA 3K1AB 2IBTA 3BX1A 2CVFA 2WAAA 3LPAA 3CNLA 1B0AA 4P93A 5JPCA 1AQUA 1USIA 1DEAA 1DMSA 1L3BA 1PQYA 2V03A 5EXEA 1LRJA 1GA4A 4AYXA 3NXSA 1YONA 5SY9A 5TRTA 4CM8A 1XKXA 4F2GA 1ST3A 3KOXA 1VPVA 5HBRA 4OQZA 1N77A 3M5DA 1E58A 3HE3A 3ZU4A 4YV7A 1Z4JA 2ZS9A 2ZE6A 4B6EA 4YMLA 5I7FA 2VP4A 4ZGWA 5JC1A 4KU4A 3IP5A 4M0DA 1YOVA 2B7LA 2P67A 3AR2A 4QJIA 4IHQA 3VC2A 2ZJ4A 2XCQA 3QHQA 3NJ4A 1M83A 1XJ5A 3H04A 1SKUA 4HD8A 2GAIA 5A9TA 2HCJB 4GEKA 1TZKA 3JQ9C 5KYUA 2P1RA 5DNDA 4CF4A 3CEAA 4KO8A 3HZRA 4DJDC 1O54A 1APBA 2WIGA 4HYTA 4OQXA 1ESNA 3INRA 1E77A 3ONFA 2ODQA 3D6FA 1YC2A 3QIVA 4LBYA 4C6HA 1XSEA 3KKNA 4PG4A 2ZZMA 1MVOA 3L77A 2JLZA 3OM9A 1SIBE 4QGHA 3AZQA 2AXQA 1J21A 1GTL1 2ZBEA 4G8BA 4MOWA 4WZAA 4G0PA 5IAEA 5TS3A 3TRJA 4A8JB 5HJ7A 4H6WA 4K28A 3HXPA 5CX1B 3RRMA 2NQ2C 5EJGA 3QWFA 5JYEA 1R74A 1D7AA 5G4KA 2I4OA 3E8SA 2XMQA 3DAPA 3WHKA 5BV7A 5JDIA 3M33A 3QKRB 2I78A 4MQBA 4HH0A 1ZPDA 2YWGA 3CRZA 3ILYA 2PH7A 2OCPA 3A26A 4FLEA 3SYRA 2QRZA 3UMYA 1C3OB 2X5JO 3CIOA 3PUKA 2RGRA 1YZTA 1C1YA 3KJZA 4LIPD 4I4CA 3FMIA 5IU6A 3JAMA 2MYPA 3SXUB 4CGYA 1QIDA 1TIKA 2QPAA 1MQ8B 1ZH2A 3GYGA 1D5CA 4LCBA 4KE7A 2IHYA 3PVSA 4CR6A 4G3XA 1Z82A 2I6UA 1TFRA 5KX5A 5GZ3A 4B7UA 4WNCA 2XNJA 1V39A 1C7ZA 4II3A 3HVIA 5ALQA 2PRIA 1NPTO 4YYZA 1AKUA 3REQB 4QUHA 4PBTA 1R1DA 2A4MA 4NABA 1Q17A 2QGZA 4P3NA 3MGKA 4WRRA 3UJ8A 2GGSA 1MJGM 3Q7RA 4YBZA 5J47A 2GYYA 5KYNA 5LC1A 4P0PB 3BK1A 3RI3A 2D62A 1DZ3A 3EGCA 3FSGA 3KLPX 5AHWA 5DEOA 3FCOA 3TB4A 4EY5A 3AVXA 3D8HA 3HPRA 1KNQA 3MTDA 2NAPA 3QG1A 2HJRA 2GPBA 3M9LA 1Z08A 3E6AA 2QRLA 3WL4A 5HOEA 1ZHOA 4ROSA 1UPCA 3ACDA 3DVRX 3BHMA 3TG8A 3W7BA 1AS3A 4CI0B 1ZITA 3LWNA 4DLXA 3V1YA 3LOUA 2OO5A 3BZUA 4DWJA 1SUEA 2P2LA 4J0QA 2A35A 2O2DA 3O93A 1JJIA 2EWMA 2PJUA 3GNLA 3WQBA 2NZWA 5K3FA 5JQGA 1Q0PA 3WK7A 4F5EA 3I2YX 1U7WA 2A1TR 4QWMA 5ALHA 2O2IA 3HDVA 4EG8A 1ZKMA 3IBYA 3RDPA 4MEBA 2A67A 2O8VA 2GN2A 2JFBA 2XZPA 1YMVA 1OFTA 3D4BA 3K4PA 3SN6A 2FN8A 2V3CC 2X8JA 3AVTA 1EFDN 2BEWB 4PXAA 3VZSA 2NTVA 3EVBA 5CLFA 4RK5A 4WVFA 4E5YA 5MHTA 2QRNA 1VLHA 1QIFA 1S3FA 1VMAA 3FB4A 3VA7A 1O1YA 1P4HA 4HHEA 2NXCA 4JOQA 3S3TA 2J4CA 1RQRA 3RNOA 4CDMA 2DHQA 4I4TA 4QXOA 3CVXA 5ANRB 4BEVA 3GRZA 1ZW6A 3ZXUB 3PEVA 3Q98A 4BVFA 2ZVDA 4ENUA 1KEKA 2QE6A 4KMSA 4EHDA 4PYQA 4QDTA 5ESXA 5LR6A 1Z68A 1T8TA 5LQNA 5C51B 2X8WA 4KBGA 3NRCA 3K4QA 5JH7A 1SBCA 2H0AA 4OJYA 1OAOA 2QRJA 3EZGA 2BM9A 4JNKA 4O2BF 3FSGD 5F3DA 3TNDA 1U5CA 1IC6A 1SVIA 3KR9A 2FEAA 1NASA 3JQ8B 3GJQA 2QTZA 3WFZA 3KG2A 3KEGA 2Y9PB 5H9WA 2D2VA 3WZLA 4G0ZA 3K5HA 5GPBA 3EW7A 4E3WA 5IM4F 2VRCA 3E5HA 4TKVA 1DKQA 2VXBA 4BAUA 1WUTA 3H1AA 4U7HA 1KSFX 4Y1FA 1FSPA 1EI9A 1DCFA 4WOJA 3HCDA 1L6IA 1OVMA 5EHGA 1JAHA 2CYBA 1DKNA 3I12A 4BMSA 2H1RA 4HQFA 1G7TA 1LCIA 3WB9A 3W2HA 3MAJA 3D3JA 3H2YA 1DIGA 3WIEA 1LUAA 2NOAA 5F5LA 5DTRA 1GLNA 2A9RA 4QXPA 3EG9A 2XDWA 1BC5A 2X2PA 3R5FA 5DYNA 2XB4A 2CN1A 2ZSIA 3TL2A 3GLFA 4M76B 4YTEA 1RKXA 1L5SA 4KK4A 3NDJA 3KSUA 3EARA 5CDYA 3ZZNA 4DVJA 2NZ8A 3NP9A 4WIAA 5T7BA 3CR3C 3FF4A 5H4GA 2QG4A 4NK4A 3NIBA 3SX0A 3WRYC 3H86A 5DTEA 3LWBA 4A5SA 3C70A 2A1UB 3FETA 2XCIA 1BE6A 3UFXB 2IFTA 4TVSA 3LJKA 1EWQA 1GHTA 3OPXA 2XD4A 1NXQA 4HSEA 5TGDA 4DZTA 4RH3A 1ZMTA 2P7IA 3ONNA 2OXTA 2VJOA 3NTLA 2AK2A 3FMGA 3LL4A 4LRXA 1CIVA 2IC5A 4I9NA 2C9CA 2G1AA 3HQ4O 5F9MA 3HA7A 4FK8A 4NEHB 3FJ1A 4B9AA 4J07A 4MWEA 4YNBA 3UENA 5L8VA 3FJYA 3OETA 5IHPA 1QGZA 5EPEA 1Z0JA 2W6CX