3T0IA

Crystal structure of complex of bt_2972 and adohcy, a methyltransferase from bacteroides thetaiotaomicron
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
245
structure length
245
Chain Sequence
FSFICNYFKLLKRQGPGSPEATRKAVSFINELTDDAKIADIGCGTGGQTLFLADYVKGQITGIDLFPDFIEIFNENAVKANCADRVKGITGSMDNLPFQNEELDLIWSEGAIYNIGFERGMNEWSKYLKKGGFIAVSEASWFTSERPAEIEDFWMDAYPEISVIPTCIDKMERAGYTPTAHFILPENCWTEHYFAPQDEVRETFMKEHAGNKTAMDFMKGQQYERSLYSKYKDYYGYVFYIGQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative methyltransferase
publication title Crystal structure of complex of BT_2972 and AdoHcy,a methyltransferase from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
total genus 86
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3t0iA00
5EC8A 3SSMA 2YR0A 4GBED 2AVNA 2HWKA 4XCXA 5CD1A 5G02A 2C7PA 3NVMB 4F86A 3QOXA 2B25A 3UJCA 3C0KA 2GA9A 3BWCA 4RTNA 3FZGA 4A6DA 3GXOA 1QANA 2G70A 3LKDA 1P91A 1RI5A 3SGLA 5C9ZA 3ER8A 2WA1A 4AZWA 1G8AA 5E9WA 3LCUA 2PSSA 1M6EX 4V0QA 3UBTA 1YUBA 3L8DA 1IY9A 3RW9A 2P7IA 2XVAA 1NBIA 5DX8A 1X19A 5EHIA 3G89A 2ZZKA 2YX1A 4FT2A 4GUAA 2V74B 3P9NA 3G2QA 2ZBPA 2PXCA 3TFWA 1UWVA 3HCFA 4ER3A 4FT4A 5GM2A 1Q0TA 1R00A 5K0EA 3MTEA 1KR5A 4POOA 1H1DA 3ELDA 3FPJA 1ZKDA 2E5WA 3I53A 1KIAA 3BKXA 3LDFA 4GF5A 1UFKA 4GOOD 4P7KA 1NBHA 3MGGA 4X60A 4YUZA 1EJ0A 2P35A 3PT9A 2YTZA 2IDJA 3O4FA 4HC4A 4JXJA 5EKUA 3V8VA 5DSTA 3EGIA 5BP7A 4C06A 3SR4A 2B9EA 2OBFA 1IM8A 5HEKA 1N7IA 3K0BA 3R24A 4RTJA 4E2ZA 1N2XA 4AZTA 2C7OA 3KQQA 3CVOA 1QAQA 3LSTA 2O06A 2QE6A 3FRHA 5CM2Z 1WS6A 3GCZA 4E32A 4LWOA 4GQBA 4MTLA 4E70A 2PX4A 2CMGA 4DKJA 4M7RA 3S68A 1JSXA 4ER6A 1D2CA 3EVAA 1EAMA 4XUDA 5DM0A 3T7SA 4YV0A 5HIIA 1VE3A 2OZVA 1SVUA 3PB3A 4QDKA 1SUIA 2IP2A 3BUSA 4X63A 3TQSA 1ZGAA 5K0BA 2NXNA 2GLUA 4YUXA 5FQOA 1L9KA 2FHPA 1NW5A 5DLYA 5E8RA 4IKPA 1I4WA 2P7HA 3E23A 5JUWA 1UIRA 4RTKA 1VL5A 3BT7A 4CXMA 3G8BA 3IHTA 3HVKA 5KVAA 3B3GA 2NXCA 3UJ9A 2PJDA 3EGEA 4KIGA 2XBMA 2JHPA 2YXEA 2FYTA 2NXJA 2OKCA 3A26A 3GWZA 4E31A 3MQ2A 4FSDA 2ZBQA 5K0LA 3R9XB 1EQAA 2AOUA 2HNKA 3OE5A 4H0NA 4HGYA 5E9QA 3HA5A 2AOVA 3SVZA 1JQDA 1ORIA 2H11A 1RI3A 2ERCA 3KQSA 4DCMA 1DCTA 3LHDA 2PV0A 2HR1A 4OX9Y 1U2ZA 5K01A 4RTRA 3HTXA 4RSRA 3CJQA 1R18A 2VDVE 5E1OA 2JHCA 4PINA 5DWQA 4PYQA 3GDHA 3HM2A 4KWCA 1JTFA 5D1NA 1KPIA 2PX5A 4EVIA 1R8YA 4DMGA 2IH5A 4LWPA 3OU7A 4R8SA 3UFBA 3MB5A 1VP9A 2AS0A 3BGVA 2EX4A 4FP9A 4E33A 4GOLD 2IBTA 1D2HA 1MJFA 5ICEA 2VP3A 3FYCA 3KQOA 5GOZA 5LQCA 1SKMA 4LG1A 4OBXA 5C1IA 3A4TA 3M33A 2IFTA 1BC5A 2AOXA 1JR4A 5T64A 3HCBA 3T7TA 4QQNA 2P41A 4OBWA 2VS1A 4KIFA 5BW4A 5ICFA 2NNWB 1ZHFA 4DQ0A 4C07A 4R05A 4PGGA 2H1RA 5H02A 2BR4A 5IH3A 2JG3A 3D2LA 2PGXA 2IBSA 3TMAA 4XUCA 3SSNA 3E05A 1DL5A 4PONA 3JWIA 4ER5A 2PY6A 4FR0A 1NW7A 4HGZA 2IH4A 1KPGA 1RI2A 2YXLA 3B89A 1N7JA 3FPGA 5DPMA 5DTRA 5E2BA 2XYQA 3SSOA 4RTLA 1JG4A 4P58A 2BH2A 1SUSA 2CL5A 3FUUA 3BWMA 1TW2A 5FADA 3UJ6A 1O9HA 5DM2A 3SX0A 5LQNA 5CVEA 2ZZNA 3MCTA 5DM1A 3OFJA 1X1CA 2JHAA 3OZRA 3B5IA 1R8XA 3BXOA 3GO4A 3PX3A 4KDRA 5DM4A 3TRKA 2BM9A 2YXDA 3FYDA 3GRVA 4GC5A 4OQDA 1VBFA 1ZGJA 2BM8A 3EGVA 3IEIA 3M6WA 5FA5A 1XDUA 3P8ZA 4PYIA 3HVHA 3OZSA 3OZTA 4PYMA 3B3JA 3GGDA 1RJEA 2GB4A 4KVZA 4RVFA 1PRYA 4PYJA 1AV6A 2UZ4A 1ZG3A 3DXXA 2ZIGA 3KHKA 3P9KA 1D2GA 2ZIEA 3P9CA 5FHRA 3F4KA 4PWYA 4PIPA 3I5UA 5EHGA 1HNNA 3A7DA 4X1OA 3BKWA 2B3TA 4HTFA 3G2MA 5EGSA 1FJXA 1B42A 3FUWA 4GC9A 2FK7A 4ISCA 4P7JA 1Y8CA 2ADMA 9MHTA 2DULA 2ZFUA 5EIFA 4RTPA 2OXTA 4BLUA 4PYNA 1RJGA 3ORHA 5E1MA 3WSTA 2ZWAA 2ZVJA 5K05A 2WK1A 3Q87B 5F2NA 1HMYA 2Y1XA 2YQZA 4YV1A 3EVFA 2HV9A 1L3CA 5F2KA 3H2BA 3OCJA 4YMGA 5E9JA 3CKKA 2PXAA 4LECA 4HRAA 2O57A 3LDUA 2JH8A 4PCLA 3KQVA 5K0GA 2AOWA 5CIYA 2I9KA 4X61A 3LCVB 2P40A 3JWJA 4E30A 2BR3A 4AX8A 4G56A 4RYLA 4GOND 5E1DA 5GIOE 5CVDA 3EPPA 3KQMA 5K0JA 3HEMA 1RJFA 2VZ9A 3B3FA 2IH2A 3P2IA 3C3YA 5E2AA 3E7PA 1FBNA 5FULA 4BP3A 4C03A 3FUVA 3TLJA 2ZCJA 2BR5A 3KQPA 2FPOA 4RVDA 2HTEA 3FTFA 4MHTA 4FSXA 2IGTA 3KPUA 4HTFB 1NW3A 5DTQA 5BXYA 2AN3A 3EVCA 3K6RA 1R6AA 5DXJA 4QPNA 4CKCA 3TKYA 1O54A 2PXXA 1O9GA 3GRUA 5DSXA 1YZHA 2PBFA 3EEYA 1TW3A 4EQZA 5LQUA 1X1BA 1KYZA 1IXKA 1Z3CA 2K4MA 2ZW9A 3BWBA 4PIMA 4Y2HA 2VDUE 5LQRA 5MHTA 3CGGA 3E8SA 4BLVA 3NVKI 1SQGA 3EVZA 4M36A 2VDWA 4P7FA 2FRXA 5GWXA 4RTSA 3FPEA 4PCAA 2P8JA 2ZTHA 2Q41A 3PX2A 4EKGA 1G60A 4MQ4A 2A14A 3A27A 4IV8A 4MIKA 3SM3A 2QRVB 3THRA 3HA3A 2R3SA 3SMQA 1YZ3A 2IPXA 1NE2A 2PKWA 2UYOA 4KW7A 4FGZA 2WA2A 5EMLA 3UJ8A 1YF3A 3M70A 3TM5A 3DXZA 1WG8A 2ZIFA 2AN4A 2AOTB 3CC8A 4C4AA 3FTDA 2G72A 3AWIA 3GRRA 3NJRA 3LL7A 4EMSA 5DXAA 4RTQA 5LQAA 1VLMA 2N47A 3LCCA 4IWNA 4QTUB 4DM3A 1F38A 4X41A 4ER7A 3KPJA 3DP7A 3GJYA 3GNLA 3AXSA 3BGIA 3PLAE 2CKDA 3VC2A 3DLCA 1EIZA 4NECA 1RI1A 5K0NA 5K03A 2Z6AA 5KQRA 1WZNA 2ONYA 3NMUF 3GU3A 3QOWA 3TKAA 4C04A 3AY0A 1FP2A 1RJDA 4E2YA 4DA4A 1P1CA 3ELWA 4OA8A 4C08A 5K09A 8MHTA 4ER0A 2OB1A 3DLIA 3DMHA 1JQ3A 3G2PA 3KQTA 3P2EA 3V97A 4CTKA 4CKBA 5HIKA 5GIPE 3R0QA 4FZVA 2EJUA 3Q7EA 4U7PB 4ATNA 5FWAA 2ONZA 3DOUA 5F2OA 4FS8A 2UYCA 4IV0A 2O05A 3KU1A 1BOOA 3IV6A 1JG1A 1XDZA 3NTVA 5T6BA 1VP3A 2OO3A 1OR8A 4RWZA 2OY0A 5HIJA 1QAOA 4QPPA 4YUVA 4DCGA 3PFHA 3MTIA 3EVBA 2QM3A 1M0EA 3AJDA 2ZSUA 1XVAA 3P2KA 1FP1D 4KRGA 4QVGA 3HCEA 1RI4A 5FTWA 3NWBA 3THSA 5K8VA 2C7RA 5LQKA 3HP7A 3FRIA 2Y1WA 3LECA 3MCZA 3PS9A 4HG2A 4RX1A 5CVUA 5EMJA 2OB2A 4RVGA 2GH1A 4QVKA 5DRYA 5EOVA 2NP6A 1BKYA 4RTOA 3ER9A 3KPVA 4PYLA 1JTEA 3P71T 4BP1A 2HMYB 2Z6UA 3VYWA 2GPYA 5EPEA 4U7TB 3P97A 2BZGA 4OQEA 4R6WA 3VC1A 5P8WA 3UA4A 4CTJA 2C7QA 3G5LA 5IKMA 10MHA 5DX1A 2PWYA 1XCLA 1I9GA 5BW5A 5LR6A 1NW6A 3G2OA 3NW9A 3HNRA 5U4XA 4V0RA 3UA3A 5EQJB 2PX2A 1KHHA 3C6KA 4CWAA 1KPHA 4F85A 3KPWA 5KYGA 3TR6A 4BLWA 5HOQA 3ERCA 7MHTA 5EZSA 1QAMA 1G6Q1 2G8NA 3ELUA 2ZZMA 2OYRA 2ZBRA 1KP9A 2KW5A 5M5BA 3HCCA 4QQKA 1V39A 3G7UA 1X1DA 2YVLA 5FA8A 4XUEA 1XTPA 2I6GA 2PT9A 4MWZA 1G55A 2H00A 2AVDA 3KPYA 4M37A 5FHQA 5EMKA 2XYVA 5ICGA 4BY9E 3DTNA 2ZLBA 4PGHA 3M6UA 4WVLA 1R74A 2EJTA 1NV9A 2NYUA 1WXXA 3BZBA 3EVEA 5DRTA 4B17A 5KQSA 2Z6QA 2LD4A 2EFJA 3I9FA 2QRVA 4KDCA 5JR3A 3LBYA 1L3BA 2IIPA 2OPBA 3HVIA 2ORED 3O7WA 1WXWA 2R6ZA 2YUIA 3BWYA 2FK8A 3ELYA 3HCAA 3HCDA 4WXHA 5T67A 2AOTA 2XVMA 3JWGA 4PYOA 3UJBA 4P7GA 1XJ5A 3FPHA 4R6XA 2PX8A 4GOMD 4AZVA 2G71A 1DUSA 4QTTB 1JQEA 2O07A 4O29A 4PYKA 2ESRA 2O0LA 5EG5A 3MHTA 5KS2A 4YUWA 3M4XA 3CJRA 1Q0SA 1QZZA 2QYOA 4RVHA 5GINE 1INLA 1NKVA 3HVJA 1MHTA 4PNEA 1ORHA 1TPYA 3IYLW 3NDIA 3CCFA 3PTAA 3DUWA 3I58A 3REOA 1XDSA 2EG5A 3ID6C 4A6EA 4YUYA 2ZULA 1KXZA 4DF3A 2QY6A 2GS9A 1SQFA 2PVCA 5CVVA 2GAFA 3A7EA 5EKXA 5HILA 3DXYA 3EEOA 3R6TA 1L3IA 3RIEA 2AR0A 5ERGB 3DH0A 3UWPA 4F84A 4RTMA 2P3LA 1P39A 2NP7A 5K0FA 1T43A 3P9IA 3LPMA 3LKZA 5CCBA 5GP1A 4E2WA 1YFJA 2B78A 5GM1A 3UZUA 5CVJA 3DMGA 3X0DA 4RV9A 3NDJA 1JSZA 1WY7A 3M6XA 1M6YA 3GIWA 4AUKA 1YB2A 5EVJA 3HA7A 2JJQA 3KR9A 5E8JA 1NW8A 1AF7A 1EG2A 3EMBA 4OA5A 2UYQA 3C3PA 4AZSA 3DR5A 2B2CA 3PFGA 4UOEA 3OPNA 1QYRA 3CJTA 3TM4A 3TOSA 3R3HA 1L1EA 2AZTA 4CKEA 3DMFA 2PWPA 3LGAA 5HZMA 4R8RA 1FPQA 5FUBA 1G8SA 3PVCA 4Y30A 1PJZA 2PT6A 3AXTA 3ME5A 3UJAA 2ZWVA 3JWHA 4L7VA 5DTMA 4HH4A 2G1PA 5EZQA 2CMHA 3NWEA 2V7EA 3MERA 2F8LA 4M38A 5K0CA 2IDKA 2CWWA 2AN5A 3B7PA 2I62A 5HFJA 1SG9A 4ZTBA 3C6MA 3KQYA 3CBGA 3FPFA 5ICCA 1VQ1A 2P1DA 3G5TA 3I64A 1VPTA 3KKZA 1I1NA 3EVDA 4DZRA 3T0IA 1AQJA 2UYHA 5D1HA 3FTCA 5CCXA 1VIDA 5DT2A 1EJ6A 2PLWA 1XXLA 3SXJA 1P1BA 2NXEA 3MAGA 3OU6A 5E1BA 1YFLA 2I7CA 1AQIA 3GRYA 3U81A 1F3LA 5HIMA 3M6VA 2AOUB 5LQJA 4EKIA 3TPZA 1JG2A 5C0OE 1KYWA 1G38A 3FTEA 2JH9A 3OU2A 3G8AA 3KR0A 1X1AA 3QV2A 1XCJA 4HSGA 4E2XA 5EEGA 1ZQ9A 3KQWA 3T7RA 3KR2A 3KR1A 5CUQA 4YV2A 5DX0A 3FUXA 3DULA 3LX6A 5B1SA 5FCDA 3VSEA 3UJ7A 1NV8A 4K6MA 5EIWA 3O31A 4YMHA 3LDGA 1BHJA 4C05A 5EMMA 4Z2YA 4EK9A 3LBFA 2P3OA 3A25A 3BGDA 3FUTA 3OFKA 3EMDA 3EVGA 3GRZA 2P3QA 4GEKA 5FQNA 5LSAA 2FCAA 3ANXA 1JG3A 3RODA 2XYRA 4QDJA 3UJDA 3G88A 5FWDA 2DPMA 3OE4A 1NT2A 5EEHA
chains in the Genus database with same CATH superfamily
3V46A 4HVLA 2XE8A 3BEDA 4Q6BA 2QP4A 4A10A 1D7OA 3RFFA 3K20A 4KMOA 1O95D 3RF6A 1JSLA 3ROEA 2IOFA 2C9YA 1WNTA 1WUJS 1YUNA 1BQ3A 2VAMA 2XQIA 4MUGA 1Z75A 1R4ZA 4YALA 4A6DA 3GXOA 3IPYA 1REQA 2P11A 3EWIA 3LKDA 2AJCA 3ORFA 4UHHA 3T9FA 4BJHB 5KU7A 1OMOA 3RHTA 1NRJB 4KBYA 4BO3A 1L5MA 2PO5A 3LCUA 3DFIA 3IXMA 4WESB 1MG5A 3HYLA 2P4UA 1AZSC 1E6CA 3RW9A 1JJVA 5I6DA 1AE1A 1OWLA 2F9FA 4GMFA 4O5OA 2VJCA 4MW9A 5EE9A 1EUZA 2IZ6A 5JZVA 1YRBA 4TTSA 3VNRA 3WGKA 2ZBPA 5LKRA 3CEPB 4IX9A 4KU4A 1HDOA 1Q0LA 3HDQA 3U7JA 1ZR4A 4BGIA 5IYZA 4URZR 4MW2A 3Q7IA 1YRHA 4Y3UA 5EXDA 4E0BA 3ZZMA 5KB3A 2XY4A 4RH1A 1FTSA 3I61A 2E5WA 1THZA 5LA6A 4Q9KA 1J1ZA 2O52A 2C5LA 3MGGA 1YOVA 2QRGA 3GGOA 4YUZA 3HFSA 3PCTA 3O4FA 4AM8A 3Q7PA 3U9LA 2P30A 3W2FA 3HXMA 4B3CA 2O1XA 2B9EA 3HCPA 3GMTA 3PNOA 221PA 2GNOA 3IP5A 2BF4A 1E7MA 1YUMA 3JAWB 2GPNA 3CVOA 3NT4A 4FLEA 4BO6A 2JFNA 4Y1GA 5CM2Z 5DYIA 3UK1A 5DNAA 3U3ZA 1FNBA 1KJWA 5A3JA 1U4NA 1H22A 1WCXA 2YJGA 1QV6A 4UTXA 3DOOA 4RE6A 4BKQA 5JZSA 1T8TA 2YINC 1ECPA 1BEZA 4M7RA 3W6ZA 1PQ4A 2Q3HA 3PDHA 2IPOA 4XUDA 1KE1A 1UOQA 4Z7NB 4DUZB 1GTVA 1ZU4A 2IU6A 2OE2A 1FDOA 2OT3B 3ESAA 2BI4A 2EYUA 4ZOLF 2WJWA 4IDDA 4YRQA 4YUXA 1H0SA 1L7QA 3A1SA 5J47A 4D4IA 1ADYA 1Z74A 4RZ2A 1H4TA 1WUKS 2C2BA 2C58A 2XQGA 3IPLA 1QOPB 1W87A 3O26A 3O1JC 3T8YA 3LQ2A 4KKVA 4ZP1A 2D0DA 1PJ8A 4FFMA 4KIGA 3DEFA 4JP2A 4F4UA 5CA0B 3QEMB 3C5WP 4JJAA 2ATXA 3GZ4A 2WILA 2HNKA 1WHSB 4HGYA 4Q9LA 3GK3A 3JZDA 4EUKA 1ONSA 1ZD8A 1ZWKA 3N2NA 3MCVA 4FNGA 3KQSA 4TKUA 4DTCA 3DMTA 4BX0A 1VZ2A 2A7XA 2HLNA 4TT3D 3RUEA 3HTXA 4I5GA 2GZDA 4I36A 4IQ8A 3ZH9B 3I8SA 3IAEA 2JGDA 1HXHA 1NYQA 5DOVA 1PG2A 2CNWD 3IUMA 1PNTA 1KPIA 3D8TA 4Y8VA 3IEUA 1LF0A 3HUUA 2IH5A 2EP5A 1RYZA 3WRVA 1UBFA 1ECJA 1UPFA 4J29A 4J91A 2PFKA 4GG1A 3OT5A 3QU9A 3GZJA 4JGBA 4PY2A 4E33A 5L4NA 2W00A 5ICEA 2VP3A 4BZWA 1RE1A 1JVSA 2KWIA 5GOZA 2OFOA 1MGPA 1P0QA 3EB9A 4PAWA 3SMVA 1CUAA 2CHFA 1KDRA 3HO8A 5BY2A 3IKTA 4HYYA 3D5EA 4Q3AA 2YIDA 1SRRA 4GGPA 4ZDIA 3MRTA 1USVA 3PWKA 4MRMB 1DKQA 1U9ZA 4GPBA 2AJTA 5IVDA 3AVXA 2JBWA 3V6LA 1CEEA 3GG9A 1CZKA 4ZGWA 4R05A 4PZDA 3PKJA 4KPEC 2JW5A 2OSBA 1E9FA 2LCQA 3TCXB 1IDN1 1VFPA 2FLKA 3VI4B 4HKTA 3LX8A 1EI9A 1JKFA 2X40A 2ASEA 4FR0A 2OXEA 3VV2A 5KIAA 2BEJA 1NXPA 1ZC3A 1XEXA 2WFLA 2BDEA 3B89A 2NSDA 2D59A 3FPGA 4YRFA 5CM9C 1MB2A 5A9SA 4FK8A 3MSCA 3BB1A 7YASA 2XZTA 3WG9A 3SX0A 4L4YA 1TA4A 4A8TA 2AN1A 1UOOA 3FNBA 5CB8A 1J97A 4N12A 1SJ9A 2VPIA 5AP9A 5HGJA 4ZRDA 2FWRA 1AU9A 2RGWA 3OUTA 5H3HA 5C1OA 2B5OA 2B8WA 3EGVA 2Q2QA 4IZIA 3IJPA 4PYIA 1N9ZA 3HVHA 2OYSA 5C80A 5HM6A 1I7DA 4D8UA 1YDEA 3TCNA 4EHJA 1CUHA 1K75A 2M6SA 1T9AA 2Y2VA 3AV0B 4P3YA 4GRIA 1LSJA 3AJAA 1ZG3A 1CVIA 2ZBDA 3NKFA 4J1NA 4JQSA 3BCRA 1HZJA 2P5TB 4B81A 1AUQA 1QGUA 3KT8A 1B0PA 1Y1TA 2X4DA 4QYTA 3JPWA 4X1OA 2B3TA 1XTQA 3TGPA 1RRCA 2HJWA 2OBXA 3ENNA 1NWCA 3EXEB 1W96A 1Y5NA 3SS9X 2CDNA 1EFPB 4KQ2A 2XUOA 2AQHA 2ZFUA 1NLUA 2WKPA 3O1IC 3N7AA 3HWWA 5JAZA 2DPXA 1JWBB 1XF1A 2QG4A 3AG5A 1XFDA 3EYWA 3KYBA 4QXAA 3RS0A 4BNYA 1Z2EA 4N49A 2VJBA 4ZEVA 2AJ8A 5F2EA 4MGZR 2PPVA 4DV2B 2GZMA 1S01A 4TTIA 2JA2A 2PZFA 2CXOA 2JLAA 3UOWA 2ODBA 3L49A 5JIBA 1GKYA 4LECA 1E20A 1WWKA 4QYIA 1TE2A 2B6NA 2XUGA 3ADOA 2YZKA 4N5MA 2RGNC 2Q3EA 2P9JA 4ACAA 4TL9A 5FD8A 4B0PA 1N5KA 1T1RA 5K0JA 2YVUA 5I8ZA 4B45A 3RS7A 4RPKA 5KKNB 1LRLA 4P4SB 3RFTA 1TEZA 2XBUA 3MS7A 4MV4A 5GONF 4RVDA 2NU8B 1MC8A 2A30A 3R41A 1PTJA 2ZI3A 2RHRA 2X0FA 3W05A 4I7EA 4DBLE 3LFTA 3KLPX 3MCUA 2DFVA 4F6CA 2DKFA 1QE5A 5LZ9A 3FLBA 1SOVA 2JCXA 1N2GA 5DHAA 2QJOA 1C9DB 2JJ1D 3EGCA 1F12A 1FLAA 2GESA 5BV7A 5LQRA 4JEUA 5EJMA 3KJNA 1BXGA 2M1XA 4QPZA 1TJ4A 3S81A 4GZ3A 4HEA6 1IZ0A 2EZ8A 2LNDA 1L5FA 3JQ7A 2FPWA 1YA8A 2NQ8A 3DNFA 3HCWA 3T7JA 3UYKA 3UH0A 1WJGA 3NBMA 3TAUA 4E4TA 4LYFA 2ZJ4A 3QXGA 1WUIS 2VDRB 4F4DA 1JKIA 1RC8A 4D3SA 3ONFA 1P1IA 1M7BA 2D7CA 5D3QA 1ZEJA 3LMKA 1O0CA 1VLHA 3T9BA 4CYMA 2QD1A 1ADJA 3L0IB 4DB4A 1NMYA 4PZ9A 3NTUA 1CR0A 1Y48E 2IU3A 2A5GA 3M9XA 3TEMA 2CFSA 4EMSA 5BN5B 3OMLA 3W9UA 2ZDQA 4IWNA 1JECA 1V5GA 1ZJ4A 2EKZA 3CNOA 1AM4D 4QTUB 1RBQA 2G1KA 3LC2O 1HFJA 4YJKA 1SKYE 2JA1A 3MJVA 3M5CA 4KHPB 4B75A 3OQ6A 3HUDA 2XQVA 3BFKA 1E3JA 2YKGA 1Z2PX 2Q6IA 4R4JA 2N0SA 2WYHA 1YJQA 1YZQA 1XRMA 1E2LA 2O7VA 4MLZA 5K09A 4PNZA 5AQ1A 3L4KA 1MD9A 3EIUA 3I04A 3NAGA 2XTZA 5IJ0A 4JI0B 2FA9A 2P2ZA 3VU9A 1SVOA 2R7NA 3QG5A 4U7PB 3R7WB 1D9XA 1I7QB 2B99A 3LVRE 3ND8A 4Q3LA 4ZOAA 5DGIA 1E7WA 1Y89A 2EX1A 4DLKA 4YDQA 1TVKB 4KB5A 2UYCA 1QVAA 2YIVX 3H0KA 4EA7A 5ITZB 3A6LA 1SHZA 4LCBA 2VEDA 1GPWB 1ZDMA 4RPHA 2G76A 3NH9A 1U2RA 4FINA 4Q4DA 4B7ZA 1U9CA 3FAKA 2JKZA 1QG2A 3DTVD 3MT0A 1QNFA 2DECA 3V33A 1CDEA 4NEGA 1NJ5A 2GBLC 2HPHA 4LKRA 3PS9A 1Q95A 4HG2A 2FX3A 5F5XA 4DMMA 2HM7A 2RKWA 3RQSA 2SECE 1PBTA 3AB8A 3SR3A 2CYCA 1JVBA 3HI6A 3RRJA 1G16A 1UDBA 4QELA 3NOQA 1T25A 1XCGB 2X4GA 1CYEA 3OHSX 3O9MA 3KEOA 3R0XA 4DA8A 2ZIXB 1JEOA 1WRBA 3A1FA 1SCKA 5HTKA 4HVAA 5I9SA 1T9GR 3CMMA 3WMEA 3WA7A 2X9LA 3QLUC 2O5CA 4J2OA 2FSUA 1I9GA 3HZRA 1TC1A 3K5PA 4LRSB 3J80A 4AJOA 1NW6A 1IWBB 2DT5A 3K0FB 5HRUA 3O4VA 5F98A 1ZFNA 1BA3A 2GCOB 2I80A 3GT0A 3JYNA 3SBXA 4C87A 4U3JB 1VG0B 3QU5A 3V3KA 2M32A 3A1DA 3AETB 2SKCA 4MVJA 2VCEA 1FUKA 5B3JC 5B6IA 4I8XA 4IIGA 4H15A 3R3YA 1OW3B 1QHGA 1SRQA 1NN3A 2IHTA 3NC0C 3B1JA 4TWAA 2F3QA 4RIFA 1YCDA 5AIBA 2O8VA 2YMPA 2VCHA 6PFKA 2GFHA 3EOAI 3LYHA 4IVPA 5IVIA 3TD6A 3KPYA 2AVDA 1SIBE 3C3AA 5THKA 2F8MA 5JS2A 1FW8A 1U3VA 1XD2B 3PNLA 5A9RA 1L1FA 4E7PA 1Y3HA 1OBHA 3O1HB 5BW8A 1SC4A 3FJOA 3KVVA 3TL6A 4E4RA 1DC3A 4QFMA 3RARA 1W35A 3BRCA 1CRWG 1ZR2A 5HRCA 4EI8A 4FCVA 4Y0VA 4KDCA 1DC6A 1GOTA 4CQMD 3TCKA 4KWIA 3IVMA 4NAHA 2P6PA 4E13A 5L7WA 3VPGA 1IEQA 5G0UA 4EA8A 3O7WA 3JQ6A 2EV9A 3G0DA 4XIJA 2FK8A 3ELYA 3ZZUA 3AVTA 1EFLA 3HJCA 2VAPA 2G07A 3DT9A 3UV3A 3PHLA 4HUQA 4LF4B 4M9RA 4QBGB 2H1HA 3TZLA 1RXWA 2KE5A 2G71A 3OQJA 5EHZA 4JP1A 5CK5A 3MLAA 1SU8A 3REGA 3PPWA 5KS2A 1VHJA 4ARCA 4U7HA 4QUEA 1TKBA 1MHTA 3EARA 2DQ4A 2COKA 3MUEA 5C5EA 1NJ6A 1EFTA 2CBXA 1B73A 2VRNA 3NRCA 2GYUA 4L8VA 1AMUA 1N5MA 2LIPA 2EWVA 5HR5A 1HTTA 3A9UA 1T2UA 5IF9A 3QKWA 3U7QA 3ZNPA 1Q15A 1JLHA 4LMPA 3DWFA 1DRUA 1UEIA 3NEPX 2C5HA 2GS9A 4FYWA 3BTOA 4GVLA 1IG0A 3VZSA 4TZ0A 1ZK0A 2RBGA 3AGQA 3OOHA 4P4LA 4R98A 1V25A 3IBCA 1ZONA 5CD9A 3OCXA 1M2EA 4QFCA 2A1TS 4MQEA 1E1CB 3S1SA 4BFCA 3HKEB 2P9HA 3L8EA 2OMEA 1DIBA 2GPSA 2Q4RA 3IV7A 3N2ZB 2VBFA 3ETDA 1F14A 2C2XA 4HB3A 5JXHA 2V7VA 4BNNA 1F4VA 5JYEA 4IDNA 4JP8A 1JXMA 1U63A 1CZOA 3QVVA 4LJYA 3EZ2A 3BRWD 3HJBA 1HH4A 5A4JA 1ZSNA 2JLUA 1D3AA 5FPKA 2H8GA 1I2ZA 2JIZA 3HRIA 2WKRA 3TM4A 2WNIA 2F1RA 3A10A 5A4MS 1L1EA 1RXUA 2AEJA 3C48A 2AUTA 3QENA 3IEVA 1SFRA 3AHEA 2VTKA 1XC7A 1CXZA 1LLQA 3ADKA 2PM8A 3LUBA 5TE9A 4Y30A 4FGSA 4DC9A 4D9JA 1R6XA 2H1LA 5DCYA 1TZJA 5JJCA 1ZICA 2F8LA 5CT5A 2UUPA 4J0FA 4UTOA 5LLSA 2QRHA 2JBHA 5D85A 4IFTA 3LV8A 1DCFA 1C3VA 2IDZA 3CU5A 1JFVA 4HJXA 4KPGA 4LDRA 5EWMB 3SSAA 1VOTA 3ZY5A 2Q8QA 5IM5A 2O8CA 4ZK2A 4HX2A 1ZP6A 2PZMA 3RVOA 3SZMA 1SVKA 3N86A 1VDZA 2ZRKA 3ZCQA 1U2PA 2VK8A 3RSZA 4DLNA 4LZNA 5AW4A 1AC5A 1TF2A 1Y7PA 3JQDA 3OY7A 4PG4A 4TXNA 2XF2A 4DGQA 1ZL0A 3IAS1 3ZV6A 1DQNA 1KYWA 3DL2A 2OSVA 1F0NA 3KL4A 2JH9A 2BTQA 3EDYA 3FNGA 1OOEA 2ZANA 4EY6A 3BOSA 1OPRA 1FB5A 1D5WA 3OFVA 4HXGA 4QXRA 3VH1A 2FW8A 3MJSA 2BUAA 2E89A 3G2LA 5EEGA 4IPTA 1PJRA 4ZT2A 6YASA 1NJGA 2I3BA 2C54A 1I9CA 1I36A 3FUXA 4XGQA 3L9WA 4RD6A 5B1SA 4AQDA 3O8NA 1NV8A 5HHTA 3ZJVA 2PYIA 5BQPA 3G7NA 4C05A 4L57A 2RE8A 2CNKA 4PLWA 3UH1A 3D3NA 3E7DA 1L5SA 3CUUA 3F5DA 3D7NA 2D5LA 2EKLA 3F1LA 3K73O 5DP1A 4BJ5A 2V7GA 4CUZA 3FYHA 3EVGA 3PUYA 2P3QA 2NUAB 4DRYA 4EYQA 5CEJA 1YNSA 2Z83A 5JH7A 1TVMA 1J2YA 2GF0A 2JGRA 1NM5A 3CUVA 2E87A 1AXEA 1E2BA 4RTQA 4QOIA 4GI2A 4FX5A 2C8JA 3MNFA 1M2VB 3HN7A 3QPAA 1DSSG 3R20A 1M7GA 1W30A 3NTRA 4TM7A 3NVMB 4I4TF 4TZKA 5A03A 5CIWA 3SG0A 5D01A 3C0KA 3WGTA 5IPFA 3FZGA 5FBQB 4RKEA 1FXWF 3F98A 3IESA 4KIUA 4PLGA 5DHUA 1BMDA 3Q40A 3OZAA 2PQ6A 1RPZA 1C1DB 1E63A 1P91A 1M8PA 4HUJA 4LJ6A 4X84A 1MA3A 3TW8B 4AZWA 1JB1A 4DJDC 4LBVA 4PICA 5K6RA 1LLCA 5AUPB 3IEKA 3K0HA 5T4BA 4XX0A 3RV3A 5DX8A 3ROFA 5FUWA 3KZXA 2R1ZA 4DOMA 2ZZKA 3MG9A 3B8EA 3CH5A 3B13B 4DCOA 2DKNA 2FSGA 5CM8B 3OLWA 4F96A 4RMHA 4XYEA 1O94D 5C4IA 1ACLA 2ZTMA 3F67A 3NWJA 1ORVA 4G0XA 3TLBA 1GGKA 1Z39A 1XZKA 3CNQS 3WGVA 4EJSA 4F9TA 2HQ1A 1MPTA 5CLIA 1I01A 1APBA 4POOA 4K05A 5EE5B 3T0FA 4GOOD 1S0UA 2VA9A 3MIZA 4ND8B 3R3ZA 3GP8A 2C03A 1W93A 2C4WA 5B1EA 1Q0QA 1IULA 1QQ5A 2IYNA 2R2GA 3PLRA 3PD1A 4QGFA 4MRNA 3TTVA 1PWYE 1EFRD 3PD0A 4OBEA 1T35A 2F9MA 4PE5B 2O8BA 1NYTA 3DT8A 4XCVA 3BS4A 3QA3E 1DINA 3SBOA 2IELA 2Y1CA 1WMDA 1LDBA 2HCJB 2JI7A 3LT0A 1ZXBA 4HDAA 4CVNA 2ENUA 3IE2A 1G18A 4MDEA 1H2AS 3JQBA 4B3TB 3QHQA 1XVIA 1VYHA 2PDAA 2CCGA 4D7AA 3O9ZA 3UWDA 2A1UA 4D99A 1M34B 1K1EA 1Z35A 3O4HA 2VDOB 4RC9A 1NA5A 3FPLA 4XDGA 3PG5A 5AJVB 5AHKA 5B53A 1EK1A 4IDQA 3U60B 4PX5A 3DLBA 1B23P 4EA9A 4JBIA 3EIWA 3KFVA 1M2GA 2YQ4A 3X1XA 5C8DA 1F9AA 3H5IA 3JR3A 1L9KA 3H6KA 1TJYA 2F64A 4U5QA 3FI9A 5E8RA 4DC0A 1O58A 1UMDA 5DHQA 1KYXA 2AK2A 2FPIA 2PKYX 4Z6KA 1SCUA 1YS1X 4QARA 3QNMA 4RK0A 3AP3A 4YACA 1QHXA 3BN3A 5FBVB 5AVTA 1NYLA 2YXEA 3OFND 3W2TA 1KAEA 1LPAB 1EQAA 1TNDA 3I4CA 3KAJA 3T06B 1C2TA 3HA5A 4WD3A 3TZKA 5HZKA 4L8LA 1JAHA 3SVZA 2FFQA 4YBRA 5I9BA 3WKBA 3DZHA 4G1VA 4OQZA 4BLSA 3UWMA 5AKZA 2PYZA 3F6PA 1X39A 3KVOA 3QELB 5C8ZA 2XQJA 1V0JA 1GPAA 3DFZA 3ND9A 1H1LA 4MWDA 4PINA 5DWQA 4CE6A 4DWWA 5JS7A 3PDIA 1TU3A 1XU9A 2XRMA 4UEKA 1EP9A 4L0DA 5AK0A 2Z5GA 3ROXA 5A1JA 5E4FA 4EYEA 3DQPA 3AVPA 4DMGA 3B60A 2IEYA 4YMSA 5DNYB 2AZDA 1C1XA 2R5NA 1P2TA 2UZIR 3KJHA 1ZA2A 3MMNA 5DU2A 3WA6A 3H2GA 1W46A 1C8LA 4OM7A 4Q1CA 5I7FA 2GYVA 3E9CA 7ABPA 2GAIA 4MOWA 1TCVA 3GCXA 1E0JA 1JLKA 4ZWNA 3M33A 4TQ9A 3ESRA 4QQNA 1ZMOA 2BEUB 2MR5A 5KCMA 4UUOA 5AVWA 4BDSA 3Q88A 1WLSA 4FZ5A 2ZQ5A 4UAUA 1D1PA 5AJWA 4U0JA 3LIPA 5I8PA 4PLVA 3DNMA 3RWMB 3RUFA 2DWUA 2H1RA 2PQ0A 2ZSHA 3F96A 3GPCA 1W8IA 4DCNA 4JZKA 4BLQA 4KK3A 2VXCA 1ZC4A 1F2TB 1QIJA 3B38A 3LVBA 1WP4A 4DIOA 5JNWA 1ODLA 2EFEB 3E05A 4K9NA 4U2BA 3TL2A 5LZ4A 4RHYA 5AKEA 1Y1SA 4X1KB 1Z12A 4OP3A 2YXLA 4ZAWA 3MJTA 4ZCRA 1J5XA 2JJ2D 3SM9A 1W88B 3O73A 2CL5A 4IQ4A 4X94A 1DOZA 1ZJWA 1L1RA 1ZHOA 3HP4A 2BVNA 1VCIA 2V7TA 4DVJA 3ESYA 2LWIA 2OO5C 1YRWA 3WP0A 1QU2A 4WGGA 8MHTA 1LK0A 1XU7A 4DNFA 3H5TA 2CZGA 1Y3CE 4GP6A 1XHEA 1KSGA 2HHJA 1RRFA 1T9BA 1E79D 1XTIA 3EZ7A 1WQ1R 4LEIA 4IDPA 3ZNNA 1EUCB 1NP7A 5DYWA 5K99A 5BN3B 3PPVA 4OKSA 1IZ8A 2Q1TA 2ZOSA 4XWWA 1FTNA 1KYIA 2J67A 2MINA 3BIOA 3F7TA 4RESA 4BEVA 1GGVA 3KV3O 1LQUA 2A8YA 1AHIA 2E48A 3C24A 3SZ3A 3JAWA 1YB6A 2DF8A 3TUZC 5TV2A 3I4LA 1A69A 2QRZA 1T9CA 3E7WA 3K16A 2HA0A 2WD9A 4QJBA 3SEAA 2WJPA 2WHRA 3L1JA 3IAFA 1MRNA 4Y2PA 1EXNA 4JL6A 4CL8A 3AOGA 3DBLA 5BQOA 4JYMA 4WRRA 1JJFA 4R1UA 1DMRA 5ALMA 1E2JA 2A84A 4R5HA 2OZKA 2R7AA 4CR7A 3WLNA 1O89A 4D9KA 2CUKA 2QTRA 3RSLA 1SOMA 1WIWA 3OCJA 3CEJA 1HV8A 2YFQA 5J5CA 3UXYA 1S4MA 2GARA 1P9NA 1H5UA 1YJ5A 2C1XA 3CZRA 5KNCD 4HDKB 1TL7C 2QP3A 1DIGA 4OI2A 4BNDB 4ZOLA 4FXOA 5CT4A 1YMVA 2GEUA 4QJ5A 5EIBD 3ZTTA 3QEMA 4A1FA 1SBQA 1MCZA 2IP4A 3JQFA 5HCUA 2OQIA 4DZTA 1WHSA 2QL7A 4DJEC 3NHWA 1B6GA 1N4DA 2AN9A 1CUJA 1M6VB 3B3FA 3C3YA 3GW8A 3P9PA 3AP1A 5AKHA 1II8B 1OSNA 2WSLA 3PQ5A 4MJLA 4CI9A 2ZCJA 3GFSA 3A6PC 4U63A 4BX2A 1XTTA 1H94A 4PTZA 1Y7LA 5AD1A 3HHPA 5KCZA 3UVEA 2H2DA 4ZI7F 3WNQA 1RFGE 5IKEA 3R3SA 4I19A 1JU4A 1P2SA 2DBYA 4DARA 2ZVDA 4N03A 1BHQ1 1O9GA 3WVNA 4KR6A 1S02A 3H04A 2ZW9A 1J09A 1P6UA 1W1WA 1YBMA 1Z0IA 1ZVMA 3IO5A 2VDUE 4I81A 1XK6A 4AL4A 3Q11A 5ALYA 4EHFA 4ZI7B 3U0VA 5EJ7A 1CF4A 5U4QA 2RGRA 3EVZA 2VDWA 2W4IA 1V8OA 1VJ1A 2QLJA 1PG5A 2CE7A 5CYFA 5JHGB 1YDHA 4D3DA 2QW0X 2F8TA 2XUAA 4HJRA 4KTTE 5G0VA 1H2BA 1C3LA 3A3KA 4N54A 4RFVA 4MRMA 3TVTA 2ECFA 3I6MA 4YP6A 2ZRGA 2VTEA 3QU4A 3BE6A 5E7QA 1SCBA 3I5MA 2IJGX 1AY0A 2NZUG 4XPZA 3E7XA 4YK7A 4EYGA 4C14A 1GPBA 2OCLA 1NE2A 4MNTA 5C2JB 1N2SA 5HE9A 4HMQA 1RW4A 2OQ2A 3RTDA 2F48A 3DTVB 5K51A 3F6EX 2FPRA 2FWPA 4G4GA 1RDFA 3PEWA 2WIGA 3P9SA 4D4MA 1NX6A 2OAQ1 4LRUA 4BB0A 3MPOA 4QUHA 4HLUC 3TBHA 4DQDA 1R0ZA 2DB3A 1F38A 2JFGA 3LHFA 1EGMB 1F3OA 3DP7A 1LDGA 4Q9DA 4H7KA 2Y3IA 2D7DA 4JV5B 3G3EA 4RGYA 3L1HA 1TZKA 1Z16A 3UAVA 1IHPA 2J0SA 2H5IA 5IJWA 2N3ZA 5GTDA 1H8EA 3OZGA 3IS3A 2XUDA 4L8GA 1FP2A 2XE6A 3M6IA 3ELWA 5DXFA 3OX4A 1JEQA 3R5XA 3IMCA 5E0KB 4Y0AA 3AHDA 1XVVA 2WQ6A 3DMHA 2VDMB 5G0SA 2B8NA 2NO6A 2QVLA 4GXNA 3KQNA 4UBLA 3DM5A 4WY2A 1KMHB 2ATEA 4KN6A 4UDXX 1VPLA 3AR6A 4B6JA 4V0SA 1Q3TA 1QM5A 1XVUA 2FPPB 3EF0A 4E11A 3ACDA 5A3RA 4RIEA 3O6VA 3G0OA 4M8NE 5ETJA 5M7EA 1MEOA 3IE0A 2AC7A 3EXEA 1XG5A 3LP5A 3H5LA 4PX3A 1EFPA 2B92A 1J2UA 1M1XB 3K7EA 1N9GA 3QY0A 2FJUA 2VWHA 1JDVA 4ZI5A 4AXBA 3GFRA 1XVAA 16PKA 1T9KA 4J2TA 4D3XA 3AUKA 5L4SA 3K72B 2VVTA 4C2BA 4E2ZA 4Y98A 4UPVA 2PLFA 4RVGA 2KLHA 4L28A 3MM4A 2FDXA 3KOYA 4RFSB 1CQIB 5CXXA 1U7PA 3H5AA 4RNDB 3IT0A 3L43A 4HWRA 2NZWA 4OFXA 3K2QA 1OIWA 2HSGA 2P0EA 1LRKA 1YONA 2Z6UA 5ILOA 1V6AA 4U7TB 4CQMB 3MUOA 5DM70 4I9UA 2FZLA 4FBMA 1VL2A 1XZFA 4LJKA 1VJCA 1MFZA 1QGOA 1SWVA 2XIJA 4G5OA 4ZAFA 1A98A 2A59A 4G2NA 4E5YA 4PO3X 4P4SA 5BW5A 1FTQA 1S5PA 2J7PD 4IRXA 4TMVA 1CVRA 1V5IA 1WCWA 3R6LA 5FWNA 4A0FA 2IXGA 1P74A 2GR9A 3HBLA 3M8KA 4IJQA 3W6NA 2WVGA 1B0ZA 1P8AA 4IW3B 3IODA 3M2PA 3AVYA 3VR0A 4LGCA 1C3EA 1W0KD 3KZKA 3DE4X 2X3YA 3RNOA 5B5SA 2OYRA 2JRCA 2KW5A 3GPDG 4AIIA 1RKXA 2Q6VA 1V39A 1WDWB 2QN7A 3G7UA 1TJ5A 3W5AA 4YJ3F 5FI5A 3V8EA 2I6GA 4JWTA 3V3TA 1K7FB 1NURA 3WWYA 4YHBA 4G5HA 3HV2A 2YOHA 3U7HB 4PGHA 1VGQA 4HFNA 4TVKA 1HT0A 3L7OA 3M6UA 4QULA 2FFHA 4X20B 1CG6A 1KOLA 4AF6A 1VG8A 2AR9A 2Y0BA 3PFWO 1U7OA 2VHXA 3I01A 1QORA 4YJ3B 3RVRA 3PXCX 4LFAB 1TX4B 3PGMA 1Z38A 3I6QA 5C4GB 1S2IA 4OXIA 4Z4EA 1H5QA 1O8CA 2GN6A 4M6WA 3MBKA 1CEQA 4OF4A 2JIPA 2BMVA 5C8YF 1ZINA 2UKDA 2CXRA 1I7LA 1VMKA 2OPBA 2Y0CA 5SYMA 4A0SA 4Q7KA 4Y6PA 5TF4A 2FOLA 1H2RS 1IG3A 1F48A 3BHJA 3GYBA 1MJGA 3H9CA 4P86A 5FRDA 1XDBA 2ZYRA 5LJIA 1C1YA 1EEHA 1G5HA 4IZ6A 5C8VA 2A58A 4LF5B 5A62A 2VPWA 4KH1A 2QUBA 3DDWA 5D6OA 1CDZA 1GAJA 2B0JA 3A9TA 2FRDC 1Q0SA 2JS7A 2HCTA 3CJRA 4JX8A 3AEZA 4JJ8A 3CUEF 4A3SA 2BKVA 2I7TA 4OOEA 1WV1A 1A9PA 3LT1A 3ESXA 1P1KA 1EFHA 3WL5A 2V7PA 5HDQA 1V45E 3HH8A 5BW6B 2J9YB 2VJOA 3AEKB 4ND3A 1YR3A 3STTA 3S27A 4B3IA 4J6EA 4E1BA 2G80A 4BLPA 1OILA 3WWDA 4XYLA 4LGYA 3OZEA 3WTBA 1B8UA 2WKWA 2QVXX 1KEZA 4QJ3A 3FBGA 2Y1FA 2WAXA 3EEOA 1TVKA 2NTEA 4F84A 6AT1A 5ITZA 5CH3A 3BERA 1V95A 1C9KA 1EB9A 3QFTA 4TLAA 3VAZA 5IAOA 1IHDA 1HDCA 3DEAA 4E6PA 2P9TA 3GJ4A 1TZBA 3CZ9A 4W9MC 5HFNA 3PNKA 1WSAA 5CVJA 3WZ2A 2DCMA 5DCLA 4DLVA 2GKSA 1X7YA 2X7HA 3LUDA 3OCVA 2I8LA 3OTWA 3G2HA 4RVSA 4NZYA 1N6HA 3AIOA 2OXRA 1T2NA 4GBMA 2ENWA 3K0KA 4TSFA 2J30A 3PC8C 4UM9B 5A6VA 4CHTA 4C5BA 2FFRA 1BRMA 4UOEA 3NNSA 4B44A 3TOSA 3E35A 3EEIA 2BFWA 3ZN2A 4ABYA 1JF8A 1ZJJA 2EW1A 3MCAA 3HPRA 2C3YA 3MOIA 3GEEA 1LX6A 3DV0B 1KYYA 3OEEA 4V39A 4W9RA 4EFKA 5LLDA 1JJAA 4R54A 5F21A 3ME5A 4LJ4A 9ATCA 1GCOA 3K0FA 4N6NA 5A0FA 3VNVA 1MC5A 1OWMA 4BNWA 2EP7A 2GCOA 2V7EA 3B51X 4H3SA 4M38A 4U3JA 2QRPA 4UU8A 2VTBA 3OZVA 3AETA 1JMVA 4RJIA 4YXWD 1ECGA 3NHAA 1F17A 1GL7A 1N1MA 2C42A 4RGQA 2B0CA 2ZJZA 2IITA 1DCMA 2YJ5A 2LCFA 4FCWA 4L9SA 2RI6A 3CX8A 4ON9A 3SXPA 3T0IA 1Z63A 1D7AA 2HWXA 2G9VA 4MGEA 2D0IA 1LUAA 3SQMA 3BBLA 3QU2A 1NQVA 4H7FA 3M4NA 3P52A 2BIFA 3C3JA 2YN0A 4Z49A 1G98A 1JI3A 1ZMXA 1XD2A 5F5LA 5G3ZA 4EGSA 3GLIA 4TV8B 1JDZA 1RT9A 4BDTA 4EB6B 1G38A 3RC3A 1J20A 1H6DA 5C4MA 1EB8A 3SC2A 3I73A 3FWPA 3GBVA 2VXBA 2ZTLA 5JECA 4BLRA 4LYAA 5CUQA 1J2RA 2WB4A 3OWXA 4JOQA 1AK9A 1CUUA 5D87A 4HLCA 2JLYA 1J06A 2QG6A 2VJAA 3IIKA 2C31A 4WTOA 4Y1RA 2FWBA 3LDGA 3VYTB 1VCMA 4JJKA 1CLEA 1ZMBA 3AUSA 3DHWC 2WVAA 3L40A 4TLBA 5E6SB 5EJ8A 1G0NA 3EAGA 2O6HA 3BGDA 3TIGA 4F2PA 3FW1A 4NZZA 2Y93A 3K15A 1FL9A 1XA3A 2CVHA 1S1CA 2X3UA 4GEKA 3BJIC 4O0LA 4OCZA 5NULA 4EG7A 2VYVA 2WUGA 2B34A 4D42A 3OJXA 3KBOA 3ACBA 5FWDA 2G04A 3OE4A 3SXUB 1EYZA 5EEHA 4BEJA 3C4JA 1NJ1A 1YDFA 3HK2A 1EA7A 1QWOA 4D5GA 4RK5A 2F00A 2P2CA 3TNDA 2XTAA 3BWCA 4EHAA 1MX1A 4LV6A 1NMXA 1ZRMA 2BRUA 4UDYX 1ESMA 4UKDA 1AZTA 1MDFA 1CNFA 2CNDA 1Z6QA 1GUFA 4JJ7A 3QTLA 1U65A 3NALA 4ZXFA 2GJ9A 1PR1A 1R4NB 2XCUA 3D2BA 4MYUA 2VT7A 1QVZA 3FUCA 1HOXA 4F5WA 4HDCA 3X2SA 2HD4A 4IUYA 5CITA 5J4KA 5AM2A 4UTZA 1C3OB 4A0QA 1UWVA 3EQ9A 2HJ9A 1DJQA 1IOZA 1E1CA 1GQSA 2QNIA 2QORA 3FFWA 3R77A 3TTTA 3HKEA 1I1OA 3W77A 1VKOA 1KR5A 3EXG1 2PV7A 2XDWA 4QYXA 5IK2D 2WV7A 1P9OA 1GPNA 2DLCX 1QQ6A 1TYCA 2XTJA 4GLOA 3K9NA 1QHIA 3CLSC 3QRWA 3SZGA 3N3BC 4ENUA 4LF8B 2Z08A 1BX1A 1PW7A 4KXVA 3R24A 4QGBA 4Y6OA 3E9QA 3OCYA 3QWIA 4PFKA 5BUQA 3L7KA 1PNRA 2FWAA 2PX0A 3L02A 1TRHA 4PLHA 1JP7A 1JR2A 4MVJE 1L5LA 4Z4GA 4IAOA 3A32A 2AEEA 1Z82A 1Y8RB 4FYIA 1D07A 1W5EA 121PA 1U02A 1W5TA 3Q7QA 3TXXA 4ASUA 3NAZA 1CLUA 2AG1A 2E4UA 3FOWA 3T7SA 1AMNA 3EIHA 4LCEA 2QGFA 3PWZA 3CLSD 3E27A 1YQDA 4K9LA 4RKYA 5EWMA 4QL3A 1P2FA 2AMYA 1U3GA 3IR6A 5JSUA 2VTVA 4OLHA 2NTJA 1A4IA 4UNIA 4W8OA 4IKPA 2JZNA 4EJ0A 1OX4A 5KOIA 3ASVA 2A88A 3I9V1 5HBGA 1VDMA 3E1GA 4BB5A 3B3GA 2NXCA 5DBIA 1RRMA 2PJDA 3TI7A 4HADA 3RIMA 3JVUA 4LHXA 1E4VA 2C4MA 2ECQA 4RLSA 4CI0B 2JJ8A 3HXPA 4BMCA 2B1QA 3FVWA 3C2QA 5LDGA 1PF7E 2JLCA 1QCZA 1B26A 4J7UA 1RADA 1U2ZA 1U7TA 4TRJA 3KLNA 2KBEA 5AW9A 4RSRA 4ENSA 5FA6A 1U0FA 3ZQKA 1IIBA 1V8BA 2H9AA 1T4DA 2CVPA 2E1PA 4KPYA 2DM6A 2PXHA 4PYQA 4U1RA 5H80A 4LBZA 1JTFA 3G49A 5CT8A 5B2ZA 1JIVA 1IN5A 3U4HA 4WCFC 1P3JA 4RV5A 3Q3VA 1KL7A 3PUJA 3MRXA 1EDOA 2GEFA 2VAVA 2ZAMA 4FUQA 4ONEA 4IJUA 1IXZA 4RYDA 3BPSA 3X43A 3ETGA 4YRKA 8OHMA 5EKSA 3VQTA 3C1AA 2C3PA 1F5SA 1USIA 2XI4A 3I9OA 3RTEA 4YEDA 5AM0A 5HZHA 1BC5A 2VRCA 3FJYA 1ZQ1A 4MV5A 1Q12A 1BTOA 5LM3A 3PA6A 4KIFA 2F55A 4F11A 4QICA 2C5AA 2X7XA 4C07A 4JBYA 4CMIB 2JIOA 4NOLA 3UK0A 1IEVA 2CL7X 2BGJA 1C1DA 2QTMA 2RCYA 3OIYA 1QLJA 1VPVA 1X0VA 2F90A 3TMAA 3TW8A 1KOFA 2V8OA 4KVAA 1NFRA 5EJEA 2F1OA 5I01A 2RARA 3ICEA 1X86B 4LY0A 3L1KA 1QQAA 1DL5A 1UPXA 3GLHB 3QUBA 3DKKA 4ER5A 2PY6A 1O6BA 2GVZC 4YNBA 3HBFA 4BNIA 1DBWA 3ZVRA 2KBFA 2QTAA 2HWUA 3PDWA 3QMPA 4QLAA 4CW7A 2BH2A 2X9NA 4DPMA 1ODSA 5AW8A 4CEJB 3TQHA 4EG3A 5LQNA 4JKIA 3JS5A 5BSUA 3V8PA 4MVJP 4U2EA 2AI3A 1R8XA 3GO4A 3H2ZA 3DTTA 1Q20A 5TNXA 3TRKA 4TZTA 4DUGA 2RGDA 5E6RA 1YI0A 2B83A 3NVAA 3CRMA 4ND8A 4WHMA 5GVRA 1CP3A 3GUYA 1EX9A 4TL7A 4CMHA 3AC0A 1L7PA 3H2IA 1JA1A 4H7PA 2XUZA 4PYMA 4IQ0A 2ZVQX 4QFDA 5TQVA 1RJEA 1Z0UA 5FR1A 3CF6R 1US8B 5JS8A 1UJCA 3NQ41 3ZCXA 5AJUA 2WUEA 3G0CA 1P4AA 2ZIEA 1MVNA 2GBCA 1G6OA 2KJQA 2E5LB 3ZWXA 3A7DA 3LP6A 3QWFA 4HTFA 4DLXA 4AKHA 1YDGA 3AONB 1H2ZA 2QD2A 721PA 4ENVA 4JGIA 2BGKA 2ZWOA 3QPCA 1JJ7A 3R8FA 4H3VA 1M34A 3A6JA 1JEYB 4AYTA 3H5NA 3LWDA 3V1LA 2CB0A 3EMKA 5FOSA 1U28C 3Q87B 5ERYA 3LF2A 3HDVA 2DUMA 4Q1EA 1ZJYA 2CUTA 1L3CA 4B85A 3ZLJA 4JJ6A 4GDFA 3HC7A 1XJWA 1T91A 5KU1A 1PGJA 1K9VF 3TOZA 3DW3X 4K3VA 2WAMA 2AOWA 5K0ZA 2SCUA 2O8DB 1XLVA 3CXUA 2ZS8A 3MAAC 1NKSA 1BSVA 3EAQA 5TGDA 4FE7A 3M83A 1Z8FA 2GF9A 3UTCA 3OIVA 4AUMA 1ZOOA 1Q1QA 3ENVA 3N6VA 5BR7A 3CZ4A 3KOOA 2CBGA 3EDQA 3TLJA 2BR5A 1WXIA 5JTTA 1QK3A 4N0PA 3QELA 4HDRB 4HF7A 4D44A 3VPSA 4TVSA 4UBJA 5BXYA 4DZRA 5JDIA 5BUZA 3JD1A 3JYLA 3D6UA 3TLYA 2O2SA 3ISJA 1GPLA 2ZCVA 5J2TF 3WRWA 1FP7A 4Z1OA 1O54A 3HSYA 4O5AA 3EXG2 3LJKA 3VU8A 1TOAA 3BSWA 5G1OA 3IFSA 4OHYA 4K6CA 3NDBB 2JGMA 4TMTA 4U6NA 4X5OA 3LAWA 5A6SB 2JC3A 1T4MA 2DLDA 4LE1A 5GWXA 5LIPA 5J2TB 1OREA 4B82A 2GPWA 4RKWA 4JLDA 2IWRA 4FFLA 2BEUA 2ZRAA 3R3WA 4EI9A 1N6RA 3PU6A 1CJSA 5ADUS 2ZJ0A 4JC0A 3VR6A 1KVTA 1QR6A 3LSYA 2R3SA 4B3HA 4CCSA 2RBEA 1NVVR 3L1IA 4WXPA 5JJKA 1LS1A 4WY8A 3E1SA 1JKJA 2RAPA 1CVLA 2WIBA 3LO8A 4KHZA 4R3WA 4IS2A 1F2TA 5LVAA 2FEAA 4KDEA 1TAQA 3BH7A 2ZAIA 4GOXA 3ITDA 3HS3A 1OI7A 3MWLA 3W04A 5HBRA 3IOMA 2YCLA 3V7WA 3LY9A 1V43A 5DN6A 3B1XA 5LQAA 1HR0B 3TGWA 1KJ9A 1YL7A 2C57A 2Q3MA 2OG1A 1W88A 3FVRA 2OL4A 4BVAA 1R4MB 1ZITA 1U4SA 4HNSA 4OFWA 4DDMA 5AVKA 1X8JA 4ALKA 4O6VA 1S2DA 1SB8A 2MJLA 2GZHA 1Q5PA 3IHLA 5J63A 5MN4A 4M9QA 2FH5B 2IXEA 2CFCA 5HZGA 4KR0A 5J5AA 3Q1LA 4H7JA 4ZPXA 2RHDA 2BHNA 1B41A 4M89A 4R1NA 1ORWA 5BN3A 1JFSA 5IBPA 4WOCA 3VOBA 2PK3A 3ONEA 1PGQA 5JAMA 1T2FA 4PNPA 1RD4A 4WLFA 1JHZA 4YWHA 3WE7A 2C7VA 3ZYZA 3QJGA 4CM4A 2ETVA 1NOJA 3ZE7A 3UHOA 2EHDA 1UWLA 3CCBA 4XDZA 5F51A 1SZCA 2Z30A 3LW8A 4JUBA 4TOIA 4CDGA 1M0EA 2DUNA 5GVSA 4JI5B 3W1VA 1MU0A 1RI4A 1Y98A 4HLDA 2GXQA 4HWGA 4YA6A 3TGLA 4OMFG 3FRIA 3LECA 1Z8DA 2WTEA 1ABBA 3QQPA 1OQAA 2EW8A 4UUBA 1L7RA 3I2JA 3WJ2A 3PQEA 1GDHA 1JTEA 2BJWA 4RUKA 3SFVA 4HDKA 2QTHA 3AJ9A 2JH3A 1HDRA 3I37X 3P97A 3Q9NA 3HACA 4FHZA 1Z18A 4BNDA 4CF3A 2BYTA 2CZQA 3CB4A 3C6XA 4BGUA 2HH9A 2Z6VA 3D3JA 3IAUA 4UHDA 1PU2A 1G17A 4ZJPA 3RU2A 3KTFA 5JSQA 5K8LA 3UWSA 4GE0A 3OTGA 1M6VA 3IMGA 4MZDA 2NIPA 1G5IA 1RM3A 2X4IA 3E9EA 5KNDD 1ONNA 4FFRA 1KH2A 4V0RA 2L42A 4ZYUA 3JVIA 3VU1A 5IAGA 3U26A 4OHBA 4Y2GA 2R1UA 4HAZA 4NYIR 3ITEA 2FQQA 1ZW6A 4DCVA 2H0RA 2ZE8A 1G8KA 3PKIA 4QEKA 1URPA 5BVGA 1TMGE 2X13A 2FNAA 4D9EA 5CDGA 3FTNA 3P4YA 2CMDA 2JCVA 1DAHA 4DCCA 2VH1A 3MWDB 5JAUA 4ZAZA 2WZDA 2D62A 1VSBA 3LFHA 3NZEA 3KAPA 1YZTA 4ZI7A 3BJRA 3N2KA 5CB4B 2RC6A 4S1VA 4HNTA 3B6MA 3A6HA 2C84A 3H4MA 2BSQA 2V55B 1EK6A 4UCWA 5EUCA 8ADHA 1KJNA 3FSRA 2ZI7A 1NRWA 1JR3A 2V58A 5EHQA 1JAZA 1FBTA 2C5EA 1K6EA 4XGRA 3OQNA 2BMAA 1EP1B 2LD4A 2JLQA 4WFJA 3CKMA 2W0MA 1Z06A 4J0QA 5JSYA 5IT5A 1UBUS 3I9LA 1TA9A 2FEOA 4Q39A 3FYUA 1OTXA 2ZPUA 4NYMR 2ORED 4B87A 3GLFB 4B73A 2Z2ZA 4WK2B 3SLGA 3ZEIA 1VL0A 2XVMA 4YAKA 1W76A 3L01A 3WHPA 1XJ5A 2ZBGA 2V96A 1N3IA 2BH9A 4LOLA 2OZEA 2DQKA 1O97C 3PK0A 2W6IA 4P93A 1QRRA 5EGNA 4HWOA 3GVCA 2EF0A 1NBMD 4OXRA 1OAOC 1QZZA 3DD1A 1NKVA 1P2DA 2QVGA 4ZODA 1KQFA 2JEZA 1PS8A 3IYLW 3O47A 3VBEA 1PIWA 4CG0A 5CEEA 2HJVA 3RAFC 1DT5A 5K8UA 1MQ8B 3PR1A 5ISMA 2WPDA 4X45A 4K8RB 3O93A 4ZRMA 4ZVLA 4JR2A 3ZVNA 4BTLA 3IERA 3CUWA 1NPDA 2GBLA 13PKA 1ADGA 2XR1A 3MS2A 2QX4A 5JNRA 2GM9A 3Q0TA 5B1IA 3A7EA 1O97D 4HQFA 3AILA 3E03A 1KMHA 1YHNA 4KWHA 1OHHD 3MYRA 1BIFA 3TB6A 2FPPA 4KE6A 1R0LA 3EA4A 3LHIA 1WDMA 3DDUA 4XEHA 2HO4A 3ABRB 4POAA 1XD8A 3R5KA 3LKZA 3OPXA 1JUDA 3ZC3A 3GUUA 3NYRA 3L7LA 3PTLA 3QLUA 1ZI8A 5D3KA 3DVSX 5LL6P 2BGIA 2VHVA 5GM1A 1UOEA 2IHKA 3HB5X 1YZKA 1OAAA 3KKQA 5L3RA 3ZS8A 1COWA 1QUFA 2QN9A 2PPLA 3OD1A 3GD7A 4DADA 4PAMA 3QEOA 4BZPA 3PJRA 4RFSA 1LA2A 2YWXA 3KVNA 1CQIA 1J9EA 1LV7A 3ZGNA 2UU9B 1IL0A 4OXYA 2UYQA 4WN9A 1KJ8A 1IHOA 3OPNA 4FR5A 3AH8A 4HPJB 4AWAA 1VYVA 4FYMA 5INTA 3DMFA 1DG9A 3JRWA 3QF4A 4HT3B 2Z58A 1R6VA 5LYJF 5CR9A 3SDZA 1Z34A 4TWBA 5FUBA 2CXHA 3PVCA 7GPBA 4RJ2A 1M2JA 2QAGC 3BMQB 3VR3D 4G5SA 2GM4A 1YBFA 4H4DA 2FW9A 3D6AA 4MA0A 3DBOB 5ECDA 2B8EA 5BSVA 3NPAA 2PUAA 4XTRA 5LYJB 1FYXA 2A3NA 2I7XA 3ANTA 3FCUB 2DOKA 2FZCA 2FP4B 3LDAA 5GJCA 3ZWPA 3T5DA 4WJLA 3JX9A 2N75A 1VQ1A 3L7JA 3FZQA 3PGVA 4LZPA 4AUEA 1I1NA 1LSSA 2VBGA 1WMAA 4HGPA 4I3FA 2AFHB 3D6NB 1FNSA 3GOQA 4MV7A 5H82A 3FNRA 3AR8A 1NNI1 5D5PA 4IH4A 1CZUA 4OQPA 3FIUA 3PFCA 1DV1A 1GILA 2OR3A 2AOUB 5ERXA 2W2PA 1BU8A 5C0OE 3ZE2B 4EB3A 1YXMA 4BKOA 1S2OA 2FMIA 2K2QB 4HNHA 4YJ3A 1CQWA 4DEYA 1IOLA 1Z5OA 2XZDA 1IUOA 1U0GA 2P9BA 2O5RA 1U8AA 3DUFA 3KQWA 4UBOA 1GU1A 1QS0B 1SM4A 3G9TA 4QRDA 4ZU1X 3LX6A 5EHNA 2QV0A 3OG9A 1QIDA 3SYTA 1Q44A 1ECBA 2O23A 1RHMA 3DAFA 2C2OA 3EZLA 4IGEA 4JB3A 3RHZA 2CVOA 2DBQA 2QY9A 4NWIA 2C59A 2I6SA 3K8QA 4ZKEA 4DDVA 5IVKA 4BN5A 5BWOA 1BROA 2WJ3A 3CX3A 1G7CA 1XCBA 2Q4TA 1NATA 1NXWA 1GLVA 2R66A 5C8YA 1KI2A 3U31A 5KAMA 1XAJA 1SCQA 2Q3FA 3C7AA 3G88A 2HV8A 3PUVA 4GRAA 4MUIA 5CW1A 4GKJB 4Q4LA 4UATA 4E5KA 1F9EA 1R27A 3L6BA 7AT1A 5FBZA 5J4LA 1JX6A 1JYEA 4CM6A 3KWMA 4ZAVA 1C2YA 1X80A 2GA9A 4ZPJA 1IN8A 2CXSA 3SP1A 3AF5A 2P1RA 3THYB 2VDJA 3FNEA 5A7GA 7MDHA 5KYUB 4LOAA 2HAEA 2BBWA 1XYYA 1M6EX 3G0BA 5JS1A 2ZVPX 2XOKA 2EIXA 1OXTA 3RIXA 2B4QA 3QK7A 5ENVA 1Z88A 4IMJB 4JMLA 4KQEA 4ZQEA 1QKKA 4XI9A 4BX3A 5K3EA 1ZH4A 4W7IA 2PXCA 2Q7OE 1SA0B 3RQIA 3ZY4A 5L3QB 1PW5A 2RH4A 1JDJA 2FQYA 2YMLA 1Z5ZA 1Q0TA 2R65A 2VPZA 3ND5A 1R00A 3CPJB 3ABSB 2PT5A 3BWEA 1E18A 3T12A 4TTAA 3WGMA 1UQUA 5DBOA 4UNSA 2HNAA 2VK4A 4GF5A 2QGZA 1XWFA 3QEJA 2FETA 4DM7A 4IEIA 4FXPA 1M1YE 4YCLA 4CDMA 1XPRA 3FOCA 2XT9A 3D5TA 3ETCA 1FS4A 4N7RA 5IEBA 1GM5A 1UBLS 1LZLA 2NQ2C 3V2UA 3B1VA 1BX3A 1NW9B 4B7CA 3B9QA 1UMBA 4LJ8A 4QXOA 1PV2A 4EM6A 3U6BA 4CM9D 1EBBA 4MVJI 2H4HA 3OPVA 4V2IA 4E32A 1SXIA 2VHQA 3SIWA 4E70A 5AKKA 1LBEA 1WDKA 4NDAA 2HRRA 4XB2A 2K7FA 5TEWA 4JR1A 4YI3A 3FGOA 1TU0A 4MMXB 4AN1A 4JXZA 1L9XA 2O3QA 1QO7A 1EINA 1FXSA 2YFYA 2IP2A 3JQGB 4X63A 3TQSA 1L2TA 3DZJA 1OD6A 4LF6B 4RQBA 2VPQA 4TVOA 4H1TA 5LCXA 3DLHA 1I4WA 5AI0A 5HUHA 3OJ0A 4K1XA 1AKMA 4DT1B 4FTWA 3TW4A 3G2IA 4ARZA 5F7XA 3EGEA 4WCFB 2LDXA 3B12A 1QP0A 4ZDWA 4OJMX 2H16A 1L4YA 4TV8A 3RSFA 4OGGA 1N2JA 1KRXA 1KMQA 1ABFA 4OOFA 5EE0A 5ILQA 1JQDA 5JDCC 2ERCA 4BVLA 4KI7A 2WU1A 1XMXA 1POWA 5AOVA 1Q17A 2R7KA 1LI5A 2HXSA 5F1YA 1P81A 4ETNA 1QB8A 4S35A 2J5BA 3HQ4O 3ZLBA 2BMWA 1SELA 3K53A 4RHXA 3GDHA 2W2LA 3DYIA 5E6SA 1G9TA 3KQLA 1B1CA 1E1QD 1WD7A 1NN5A 4RWEA 1Z2OX 4KQ1A 3NTOA 3PXEA 4CKYA 5B4TA 3L8MA 1JDPA 2W2NA 1IN7A 1W0CA 3NPMA 2QTVB 4QBIA 1KZ7B 1O3YA 2BGWA 2OMKA 2XNHA 3SXUA 3CF2A 5HUQA 3NANA 4MUFA 2L17A 1HQKA 1OGYA 2EC5A 3DCYA 2PH1A 5KYXA 2H54A 3A4LA 4DIFA 4OBWA 2XGSA 5FX2A 1CSEE 1H2WA 3ADDA 3E15A 4Y2YA 5FXMA 3B1KA 4XARA 1B0UA 2JL1A 3H3FA 5BVHB 1PJSA 3HWSA 1PT5A 3QSGA 4TWJA 5AVOA 1V1RB 5H02A 3KSBC 3MLEA 5IUNC 2MMGA 1MJHA 1N3YA 1BS9A 1W48A 3IP7A 1JQJC 2A3RA 3DZBA 1EFUA 4L2IA 4XUCA 3VFDA 4JXXA 4DQLA 2NAFA 1R4NA 1VJ5A 1R9GA 2WC1A 1P1RA 4WFIA 3QBVA 5IN4A 1D8AA 4YRBA 1V8FA 3KM0A 4HYEA 2NWQA 4UNPA 3DCIA 1EDBA 4HXFB 2QLLA 5DWDA 1C3OA 1LBSA 2XYQA 1QZUA 1AUVA 3FUUA 4WLOA 4XB6B 1PT7A 4PG8A 3N8IA 3F7MA 2YZMA 3MAJA 4FQ5A 3TLMA 4MR7B 4F8YA 2QRLA 3B5IA 5BN1A 4EB8A 2G5CA 3VPBA 2EATA 5DI9A 2YXDA 3C1TA 3HY3A 3DEKA 5FUQA 5LLTA 2MHCA 4D0GA 5I51A 1EKXA 1RYNA 3V4SA 1EE1A 4G86A 5KHLB 1QQBA 4E3ZA 1TYEB 3EISA 3GUCA 2XXBA 3IE1A 4J3JA 4BMPB 4KVZA 3W7AA 2AKAB 3P0HA 4OM8A 5DT9A 1CS0B 2HT6A 4IJWA 1DTEA 5K8CA 4DYDA 1LPSA 1XZLA 3L8YA 3NHBA 5I9TA 2QROA 3QBJA 1LDNA 3K1YA 2DSTA 4MS4B 1MNQA 5EGSA 1NZJA 3D3QA 1K8QA 4D4JA 2J3EA 1Y8RA 2H2GA 9MHTA 1S8OA 1OTHA 1H6CA 3KT6A 3QVXA 5EIFA 3JAKB 4DMRA 5JW6A 1FFYA 1T2AA 2QYHA 1E9SA 2QW1A 3G9ZA 3DE6X 4MKXA 4UMDA 3EFEA 3H42B 4LHWA 2DUJA 3V32A 4NBRA 3BDIA 5ECGC 3GLIE 1P9RA 4A03A 1DOAA 1DO2A 1QF6A 3LC1O 3P9XA 1Y1RA 2HCBA 2ZB2A 3DVQX 2DWOA 3SK0A 4E30A 1F8GA 5KPJA 3I0ZA 4I99A 5GIOE 1A9RA 5F7JA 3I6ZA 3QY9A 1FNDA 1C29B 2MTBA 2D5IA 4G0QA 4Q1AA 5AHRA 5EWJB 4X7PA 5TB5A 4UAJA 5JMTA 1EXDA 1Z0DA 3O1LA 4C03A 3QX8A 5LBIA 1KY2A 2XYPA 2NQTA 2XECA 3RROA 4JASB 4DDUA 5J58A 2Y1KA 1UJ6A 3E6AA 4OUDB 2AV6A 4IHJF 1OLSB 1CT9A 1HDGO 1JSRA 1MAWA 1HG1A 2PXXA 4PPNA 4Y9DA 2XUPA 3I5AA 2MSEB 4EQZA 4KOAA 2Q6LA 4W6ZA 5LQUA 2UXBB 1Z3CA 2BKEA 4UTNA 1E94E 2O7QA 5TQ0B 3AUAA 4J7AA 3ECSA 3O94A 5FI1B 3T3EA 4NU0A 2NYVA 4D0RA 4FI3F 5KYNA 1TDJA 4HVTA 4Q9JA 4QGSA 1U3DA 3RAJA 3GDWA 4DLAA 1V4VA 3L05A 4I5EA 3ZZ1A 5LOVF 2WM3A 3RFXA 1DLIA 1TUBA 2FLVA 4QDZA 4C7MA 1V1MB 4EJ6A 5F5NA 5LZ5A 4BMDA 1OJ7A 3D4NA 5DCWA 2QL5A 3BE4A 3CF0A 2XEDA 4MKGA 4YJHB 4CMIA 3FB1A 2GXAA 3QVWA 5AIAA 2PKWA 2ZXUA 3UJ8A 4ZEMA 2WA2A 4LV8B 3U7EB 5LOVB 1SU4A 2OHHA 3WMXA 4Y2QA 2SHKA 5AUOB 3LY8A 4G89A 4LZLA 4MYDA 1DJLA 3GRRA 3HUFA 2QU8A 5AR1A 3NU1A 4CKCB 5BURA 2V4UA 1I4TD 1N4AA 3GT7A 3QBEA 4ER7A 2ILVA 2OCPA 3GNLA 4F3YA 4GKVA 1YVPA 4EHDA 4CEJA 5LN1A 3WMRA 5BSFA 1B7GO 1C50A 3E4CA 5B30A 4MCJA 3ZX5A 1H4VB 3L8ZA 1LGYA 2EQAA 3KT0A 2R8PA 2X2EA 4UU7A 5G41A 3KOUA 1CC1S 1Y6GA 4QO8A 1RJDA 3B20A 3UKOA 1E1LA 3Q3IA 1UJMA 4NHOA 3RJ5A 4R1LA 3H8SA 5IASA 5H59A 1J7JA 3V4ZA 4K2AA 4NZOA 4BHTA 1GDTA 5DNVA 1NNEA 2EAUA 4Y2TA 1US8A 5A3VA 3SHOA 2O1EA 1JIQA 1P75A 3DQQA 4NJMB 4K1LA 3IP9A 2W37A 5IMSA 4O3MA 2VIIA 4D79A 1HDIA 2J4CA 5JI3E 4GM1A 2OFWA 2UUOA 4EWLA 2XD4A 4OTZA 1IBKB 3ZY6A 5JFTA 4CTMA 1BS1A 1NSFA 2QSYA 1UWCA 3P96A 4EEZA 5BV1A 3ZDAA 2Y92A 3FRJA 4TQUS 2XAAA 1DIRA 1E2PA 3ZXUB 2ZSUA 5TR9A 1J5EB 1JEYA 4R31A 4EEKA 4AP9A 3G85A 3LA6A 1Z5NA 4NPHA 5FTWA 2CMKA 2C7RA 4OD0A 2VF5X 3MCZA 4MJ3A 2Y0EA 5EMJA 4C0AC 4C0QC 3ASUA 1BWQA 2RC5A 1KXJA 4COOA 1ZRSA 3ER9A 1RHKA 4B6GA 2PUBA 4N39A 2D3WA 2HRBA 4A6PA 3INNA 3CR8A 1U99A 4NBVA 2J5QA 3UA4A 2WSBA 3K9FC 2ZKLA 2G4CA 2R62A 2RHOA 5T8KA 1GPMA 3HZZA 3MJCA 2Y9MB 4YHHB 1RYDA 2ONJA 1G5RA 3K70D 3OQ1A 2FU5C 2JKVA 3E0QA 4NV1A 1FSFA 3DCJA 4HDRA 3IPRA 3KPWA 4UEQA 3F6BX 4WIAA 4X1YB 1IMJA 5H9VA 3ERCA 4XQCA 3GFOA 2V65A 4MI9A 1RHJA 4EARA 2W6MA 1SBYA 3DBHA 4OHRA 2ZZMA 4DSUA 4DA9A 2H5JA 1QO9A 1XRQA 4NOMA 4D8TA 4NRDA 2EKQA 1GNTA 4KPUA 4OH1A 3GCGA 3BXGA 5HF6A 1RXCA 2Y67A 3KJGA 4J49A 5FHQA 5A6SA 2EZTA 4OQ4A 1QKJA 5J2TA 4EI7A 3EDOA 1BU5A 3LPDA 3KIPA 4MCAA 3OY2A 4U9UA 1SHJA 2O2JA 3S2YA 3SE7A 4HLUA 1NFFA 3L77A 1Q92A 5DGXA 1R74A 3K5HA 2WUFA 6CHYA 4URHA 3L6OO 5JNLA 3G0GA 1W4RA 5FFNA 4Z8XA 4HUTA 2VATA 5KQSA 2LUOA 4BNZA 1G21B 1V9SA 5JR3A 2QAJA 4KODA 3PEYA 1PE0A 1T1IA 3L0YA 2JIMA 4Z4CA 5BSHA 2JLZA 2GPBA 3IBYA 2JVIA 2P6UA 3QJYA 3BIXA 4DS3A 1KY4A 4YRSA 2YUIA 4IM7A 5JAOA 2ISCA 3UJBA 1TQHA 1T4CB 1JLSA 4P7GA 4DNPA 4KC0A 4R6XA 4Z7JA 5CBKA 1WCV1 1M3SA 4YWJA 4ACBA 3NEJA 1TCBA 1GSOA 4UE3S 2OLKA 2FQ1A 2WTAA 1T8SA 2BE7A 2Z2XA 3NHUA 2AK3A 3G5AA 3LKBA 2PH5A 2OV1A 3AR7A 1R4MA 2XAUA 3I1YA 2WSMA 3BF7A 4MPDA 4WEOA 3D64A 4RVHA 1UDWA 4OHWA 3UV7A 1INLA 3INYA 4PR0A 3OIGA 3WDMA 1R6DA 5KTNA 4HLNA 4KKXB 3ZDRA 3C74A 4G24A 2ZTSA 1QRAA 1T3GA 3QE2A 4MICA 1LTHR 1DUIA 1KIMA 2FWJA 3VXKA 2GZAA 1C3XA 1BJKA 1N3BA 1RWWA 2W2KB 1QOQB 2WJIA 3D31A 4J0IA 4PVCA 1WDLA 3U40A 3UAWA 3DXYA 3TXAA 3NG1A 4MWEA 3J81k 2FSPA 5ABPA 1I80A 1L3IA 3TSZA 2NSHA 2BFNA 1RWXA 5LD2C 3K6JA 5TEVA 3ZZ0A 4BRUA 2R87A 1NVAA 3OT4A 1MQ9A 1IOWA 1NTOA 2PZKA 5L40A 3BCSA 1DWPA 2J3MA 3DE5X 2HF9A 1ZW1A 2EFHB 1U9YA 2PMKA 2C88A 1M1UA 2QAGB 2XJ4A 2XTMA 4JR0A 1XQWA 2C95A 3D0KA 3DMGA 5D5QA 3VTKA 5BR8B 3QKRA 4LVOA 2G0TA 5K3AA 1N2EA 2XYGA 3FNHA 4IXTA 3KR9A 2CYBA 2NGRA 3AX6A 4AWBA 1P9LA 1JIJA 1VA4A 1Z2CA 2HHLA 1AGPA 5T57A 5JY6A 4RV4A 3PFGA 2P9ZA 4M46A 1IAQA 3B53X 4R3UC 3VJKA 1YE8A 4YCAA 2Z98A 4EO7A 2WMNB 4GUDA 5CLHA 3CUTA 3OO1A 4W4TA 3RPEA 1V8ZA 2A9VA 2CLLB 2Q9UA 3EA0A 2ZWVA 1N6PA 1PUXA 3JV7A 3JWHA 4V0NA 1R9NA 3FR8A 1T36A 2W71A 2Z2JA 4Q00A 4HS9A 1YDMA 4N7JA 1ODTC 2G17A 2E21A 3JASB 3SI7A 2CGEA 1Z37A 2C82A 1CERA 2HWWA 1IHUA 2J59A 1OVGA 1KSHA 3I1FA 3C6MA 4IIHA 2DHQA 3D1LA 5AUQA 3V2IA 1R6UA 3VH3A 1CQPA 1N1EA 3G5TA 4Y7CA 4MQLA 4EGQA 4OP2A 2NNLD 3LLMA 2ZUCA 1FMJA 4H08A 4ZZ0A 1I0IA 5AQEA 1E60A 1NRXA 1IJBA 1PEYA 1XX6A 1FFWA 1XYVA 2C4NA 4M2LA 2JJMA 4P22A 3ABOB 3SXJA 4JI4B 1VCHA 2NVBA 3CRQA 3MELA 1XMVA 1GQRA 1XZHA 3PQFA 4J9UE 4NYIQ 3SPXA 5CB4A 4N5LA 1Q14A 2FG5A 3GQVA 1E89A 1T2DA 3BB3A 4OAOA 1Z0AA 5M2QA 1Y3AA 3DL7A 4N47A 5DGCA 1PJ4A 3OUZA 1FJHA 4GL4A 1CRLA 1YJBA 2AFVA 3ACCA 3EC7A 3GZNA 3G5UA 5LFAA 4U8GA 1SOWA 1U3TA 3QVUA 3UT5A 2B21A 2FRDA 2X22A 1G7SA 1PG0A 5KJCA 1TUIA 2A0UA 1Q2UA 1FSSA 4NZMA 4N01A 4ZV9A 4RDXA 1TB4A 3HMKA 1BHJA 4X97A 3GLFA 4D4KA 1GNQA 3AESB 3BTUA 1M9NA 1V16B 2DXIA 1ZM2A 4D81A 2C9BA 3F71A 2B1IA 5FQNA 3WKDA 2I29A 3ZTYA 5J4VA 1KFCB 3ZU4A 5I4CA 3PUIA 2O48X 3UJDA 1IUPA 4WOBA 2FJPA 5I8WA 4WZ6A 5BN4A 1ZGCA 4L8WB 2Z8ZA 4TTPA 3E1KA 3QVMA 3UY4A 3LC7O 4NYMQ 3CINA 1XF9A 5DNWA 1I94B 3MF4A 1DQYA 1TM3E 1U2GA 3QOXA 5EKTA 1P3DA 3PHGA 4GPEA 2ZWPA 4D46A 2O54A 1EBFA 1RMTA 1ONBA 2XMGA 3H3XA 4QUBA 3RE1A 3RUAA 1YIAA 1U1CA 4R8VA 2RHJA 4AG5A 5LB2A 5HJ7A 5E9WA 1F4LA 4AKTA 3NKLA 2XCLA 4X8MA 2BCJQ 4CDRA 3RUIA 1E1DA 5EA2A 3HCNA 4C20A 3VKHA 3PC8A 3G89A 4O2AB 2C9DA 4FT2A 4F2HA 4S0XA 1P5JA 1GU7A 4DLWA 1DIOB 3L0CA 3OA2A 3KTAB 3MOGA 1ZIXA 3SF0A 3L7DA 4H0FA 2V7QD 3IELA 3OZFA 2FPKA 3OM0A 1E92A 1CJVC 3H5OA 1C4XA 3SHVA 3OTIA 4IDFA 1Z68A 2YHBA 3VHLB 1XJ0A 3FSJX 4GR4A 1JTVA 1V96A 2R8RA 3DV2A 2UAGA 3BGSA 4RK7A 2AF3C 3SYNA 5BP7A 2FE1A 4J7XA 1E5VA 4RH0A 3WB1A 2OBFA 4LJLA 3EIXA 3FSEA 3UPDA 2C7OA 3DLAA 4OMUA 2R00C 2YASA 4EVRA 2F9LA 1RLJA 3VMMA 3WDKA 1KE2A 2HY7A 2XRZA 5AFSA 1YS4A 1CIJA 1UBJS 1FYFA 1DAFA 3HPQA 1WQ3A 4BASA 1XHFA 2JFWA 1YE5A 2PKQP 2KQUA 3JALA 1HTWA 4O3FA 2VSYA 4E2FA 1VIYA 4MKHA 1FQOA 5LYJA 2D06A 2UXDB 2FP4A 3BUSA 1NNLA 2Q50A 5D84A 2HW8A 5L4LA 3WYCA 2FHPA 3EG9A 5JUWA 4RTKA 1VKZA 3GUHA 4EZIA 4DJ5X 1X1QA 3FZYA 5KUTA 1VL5A 1P2VA 1W36C 1JR3E 1BKDR 1M2HA 1QH9A 1YT5A 2AFHA 1OXVA 4WKPA 4ARVA 3RKRA 4BNHA 2VSFA 1LFAA 1WB5A 3D6HA 3NBKA 4ITRC 2H4ZA 5T6MA 4ITVA 1YZLA 2AOUA 3C14C 3KYCA 5AM4A 4PS1A 1SHTX 4HVCA 2O3RA 4V1CI 1PK8A 3V48A 1Y9JA 2H06A 1UXHA 3LQRA 5H70A 3WSVA 2IBMA 5B3AA 4DCMA 1KR2A 3IH5A 3OOSA 4CL2A 1YKSA 3W2HA 1QS0A 2XCOA 3B78A 3AR9A 3OUUA 1JH9A 3RADC 1NVDA 3EQ8A 3EWAA 3DO8A 1AXGA 3ANMA 4JVNA 2H31A 3AU9A 2VC2B 3MHPA 2PX5A 4LKOA 2L0XA 2QIOA 3G2JA 1DJPA 4O33A 2O0KA 4BV8A 3PQ8A 4DMFA 3QE9Y 2B8JA 2B4TO 2ZDGA 3T54A 1P7WA 3EEBA 3SYLA 4TYWA 3RC8A 3FWHA 2DUUA 1MIOB 3AUFA 3E58A 1HI9A 3IQHX 3P9RA 2IRWA 4G81A 4GI1A 1A2QA 2AQIA 2ZYUX 2X6RA 3C70A 3TXYA 5DNUA 3HCBA 3W2IA 3H19A 3H97A 5B4VA 1OX6A 1ESCA 2P41A 5EQTA 3SHWA 2YYAA 3FETA 4HQKA 3COJA 3P32A 4OSOA 4DQ0A 4HAYA 3GMSA 2IZ0A 2R6CA 3PGKA 3NCHA 3THYA 2XT6A 3AHFA 4BLTA 3OJOA 2UUAB 3VPXA 1QV7A 3CW2A 3EJ6A 4CG2A 1FQKA 4XLZA 1S9HA 1U0HC 5KYUA 3UKDA 4HHEA 2RAVA 2BGLA 4FOLA 3OESA 4EX7A 2QX8A 2POCA 4ZCPA 4E51A 2VWGA 3N0VA 3N3AC 3Q8MA 1KZ9A 2NAPA 3KCQA 1NZFA 1QP8A 3N0RA 4KWEA 3TW0A 5L3QA