1I4DD

Crystal structure analysis of rac1-gdp complexed with arfaptin (p21)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
177
structure length
177
Chain Sequence
QAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARFAPTIN 2
publication title The structural basis of Arfaptin-mediated cross-talk between Rac and Arf signalling pathways.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 60
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2001-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1i4dD00
4LGMA 2B92A 4DLYA 3U60B 4QGHA 1UBCA 2PZFA 2YWFA 3ONWA 4ASUD 3R20A 2WWFA 2ZSBA 2IHBA 4RD2A 2OAP1 1YE8A 5KU1A 2YNMA 3SC3A 2YKGA 1JPNA 2J7PD 3DO6A 5AUNB 4FCTA 2PEYA 2VP0A 2B6HA 4PAMA 3GLFE 3AVVA 3VNUA 2REBA 1HV8A 5LD2C 4KODA 1KY2A 4QJ5A 4ZIRA 4RVCA 2NOAA 4CZ2A 5B57C 2WMNB 2GK6A 4NH0A 1GDDA 2EYUA 5DH9A 4GMXA 1TUEA 3U44B 1XXHA 4OHYA 3K9NA 3Q7PA 1KZ7B 3B82A 4DDWA 1AJEA 4HDOB 2BEJA 2K5UA 2QENA 2X8AA 4BFYA 1EESA 1CRQA 1G20E 1M7BA 4DLZA 2J87A 2JEOA 2QP3A 1VIYA 4A0GA 5TDHA 4GOJA 2FFQA 3KKPA 3ZGXA 1CR4A 3CZPA 2VTKA 4BZPA 3D6TB 3TRFA 5KDDA 4YDSA 3C4JA 1GILA 4A82A 5CIQA 1AIPA 1N6KA 1YZLA 1ZCBA 4AYXA 3U5ZB 3RLFA 1G8GA 3CUEF 3ZD6A 3QPWA 3BS4A 1E94E 4NCIA 5DE3A 1U8ZA 2C77A 4LJ6A 4JLVA 2QU8A 2RH5A 4GT1A 4ASUA 1W44A 4BEJA 3RRNA 2D4HA 2L0XA 3BFKA 2JLRA 4II7A 1DEKA 4KVGA 1OH8A 3TMKA 1HEIA 3ZIAD 1Z0KA 2ONJA 3GLIA 3D31A 2W6IA 4ITRC 4FMDF 2ZU6A 3KFVA 2ZI5A 1E9SA 3WNCA 2R2AA 4BZXA 1HQCA 4BGDA 4JBWA 2QP4A 4B3DA 3PUXA 3LWNA 1FNNA 1QHYA 5JI3E 5EXTA 5CB6A 2IXEA 1GRRA 2QM8A 3B78A 2BDTA 1EG7A 4MGYR 4KLNA 4C4PA 3LX8A 3THYA 4IXNA 1NJFA 3KTAB 3TAUA 4RKFA 1R4AA 1NJGA 1XRJA 2WPDD 4HUQA 4B32A 3PJRA 3VR6A 4BQSA 4TLCA 1Z0DA 4MDFA 4GNKA 2O8BB 2IWRA 2WKQA 1S1CA 4OK5A 3RANA 2F43A 1JR3E 1SVWA 5KUTA 3MWLA 1RJ9A 3THWA 3BB1A 4EAQA 2O8EA 1QDEA 4DSTA 1NLFA 1JPJA 2BJWA 3UWKA 3WMFA 2H8KA 2J7KA 4PO9A 3NC1C 5FI1B 2QRZA 4RKEA 3NXSA 3K0AB 4P33A 3GJ3A 2ZRBA 1CLUA 5IK2D 4AURA 2ORVA 5FTKA 3GLGA 1OB2A 4TL7A 3QEJA 2X19A 4PC3A 4CEHB 3IEVA 3NC0C 5EZ5A 4TTPA 3ZIAA 1ZNXA 4DLUA 3X2SA 4B74A 4KYIB 1GVNB 2BC9A 3FKQA 3T1QA 1DAIA 2MSCB 1HUQA 1AQUA 3LQQA 2Q21A 2ZS8A 2QT0A 2QGZA 3EA0A 4QGGA 1KI4A 2J0SA 4RD1A 1Z06A 3RAPR 1E79D 4D82A 3L0OA 2UVQA 1GP2A 2CL7X 2VP4A 4JLPA 4OI0A 2NZ8A 1NMYA 1WXQA 3SYNA 1VG9B 1GKUB 1NVUQ 4US2R 1CEEA 1VCMA 3CKLA 4GL2A 5KO2A 2FNAA 1JALA 5BQ5A 1J70A 3MJRA 4LHVA 1G5RA 3JZAA 1OFIA 2VEDA 4N0EA 4ESHA 4URUR 1YZKA 1JB1A 4QG7A 3LV8A 4JL6A 4GZLA 4Z54A 3TR5A 1DAKA 4A6PA 3L0PA 2JJ2D 3P4XA 5F2EA 2X77A 2PMKA 1TAGA 1SXJE 1XPOA 1V5WA 2F1HA 1DVRA 3CNOA 2QSYA 2P3SA 2XNSA 4M2LA 4C0QC 5H8WA 2DHRA 2R6AA 1WBBA 3BGWA 2WJVA 2YC2C 3C5HA 3B9QA 1JECA 2IA5A 1CR2A 3NBXX 2MSDB 5FL3A 3TSOA 4LSGA 1YZQA 1U94A 1EFUA 1US8B 5GJVC 1XMJA 4PXAA 2FG5A 4W5JA 2ZYVX 1MO3A 4IDQA 1EK0A 3JZMA 2V8OA 1LF5A 2B7BA 5CDFA 3UANA 2ZRDA 1HQYE 4OHXA 4ZCMA 5LD2B 2CCJA 2JAQA 4BWYA 4X8HA 5FOSA 4MRNA 3VQTA 3L8ZA 1Z47A 1FUUA 1TQDA 2WWWA 4LJ5A 4QHSA 2IW3A 2OFOA 3I3SR 2VBCA 4MQBA 421PA 2BMJA 3A1VA 1XD2A 2CJWB 1P9RA 1FL9A 4DB2A 1E2JA 1P2SA 3SE0A 1LS1A 4KFTA 2NPFA 3WY9A 4L4UA 2JJ2A 2GK7A 2BV3A 1IONA 5AR1A 1IY2A 2DWOA 2ZJ2A 3P20A 1BH2A 4M1SA 1KO1A 1Z8FA 5B64A 4Q18A 3K53A 2XAUA 2ZUBA 2ZUCA 2EFCB 3QBVA 1F2UA 1YVDA 2JLUA 2HYIC 1R2QA 4YDHB 5KOYA 2QTHA 2RAPA 1OKKD 1E2QA 1Z08A 1C4OA 5JEDA 1GFIA 3QVUA 4DLWA 3U4QA 1I4TD 2YC4C 4CYMA 1OH5A 1NRJB 4NMMA 1R10A 2ZJZA 2JDID 3W34A 3CPEA 1K8RA 4UNRA 3M6AA 2BBWA 3UMSA 4F93B 2WICA 3AVPA 3SFZA 5HTKA 1MT0A 1W4RA 3F0TA 3AF0A 2AD1A 5JFGA 1RPZA 1IY0A 2KSQA 4I1VA 2JLZA 3IQXA 1JJVA 1S8FA 2ZS9A 3QF7A 4DLXA 1JBKA 3BB3A 1OF1A 3K9LA 4TYWA 5GADl 2ZYUX 1L4UA 2N1BA 4F92B 1ZMXA 3I62A 4Q5IA 3QG5A 2XNDD 3V4FA 3GPLA 2ZI7A 1ETUA 1YRBA 3I8XA 1DS6A 4E03A 4AG6A 2ZAMA 2F1RA 1M8PA 4W5WA 1SVMA 1CJMA 2I1VB 2ZYTX 3B7GA 1WA5A 1H8ED 3AVOA 2O8DA 3TE6A 3BXZA 1U81A 1OKKA 3BWDD 1Q57A 3B13B 4J0QA 1TF7A 1H8HD 2DFKB 2ZE6A 3W5JA 1E0SA 4LJ9A 3V9PA 1QHSA 2JDIA 5BN3A 2IF0A 4BFXA 2VP5A 3EWSA 4DBLC 3T34A 5AK0A 5E3HA 4W9MC 3ZJYA 4JVMA 2ZVPX 4A8JB 2I4IA 1TEXA 3EPHA 3TR0A 2PH1A 3GFOA 5KPDA 1Q22A 2VSXA 3QKRB 1Z63A 2RGBA 4C0JA 5JWRA 3GLHA 1HT1E 2P5TB 2A3RA 4UNPA 4PZYA 3A4NA 2OG2A 4TSFD 1G3RA 2EFEB 3PV0A 2HT1A 3ZDQA 1E9EA 3KB1A 2YWGA 3EPKA 1CJTC 1NP6A 4C7OB 3K70D 2AR7A 1EX7A 1QG4A 3EZFA 1FQJA 1SGWA 3MGCA 1XD9A 4LV6A 2J0QA 2HLDD 1KJZA 2CLSA 2J59A 4HB4A 4WOPA 4PPQA 4Q1AA 1H8EA 5FOUA 2UKDA 1M1YE 3HR7A 4URXR 1VG0B 1XP8A 1XEFA 3A6PC 2VYFA 1K5GA 1H8HA 5FPKA 3GLFB 5DYGA 1P2UA 1DO2A 2GHIA 3HJNA 1W46A 1T3SA 4DDUA 1S2MA 3PUYA 3HR8A 1NL3A 3RSOA 3Q5EA 2XTMA 1P6XA 4JZKA 5CLLA 1XTRA 2GCOA 1FX0A 1Z28A 2AN9A 2ZI3A 4KXFB 3W8NA 5EE1A 1GG2A 2NO1A 3MUFA 1R8SA 3RS0A 2J0UB 1UBFA 3FE2A 1D2EA 1F2TB 5DO9A 3RS3A 3CIOA 1P75A 2GXQA 2P0EA 4DDVA 3BBPA 4QBGB 4XJXA 3IBGA 2ZUDA 4D2IA 5KHOC 3EA5A 2AXNA 5D3MA 4B75A 3QQ5A 3RC3A 3V4RA 4M1WA 3TVTA 1X8LA 3B8HA 4M9QA 2ORIA 5EP1A 5FFMA 2PZGA 2ATXA 3L0SA 2ZJYA 3WRXC 1N5IA 1QBKC 4FINA 3QJYA 1GOTA 2TMKA 3RRZA 2D2FA 2ZRJA 1PV4A 1X1RA 4UXIA 2C8VA 2IUTA 1LS6A 1W4AA 1E1RD 2QQEA 5CYOA 1E6CA 2HXSA 4Q03A 4UXHA 1G9XA 1IXZA 1ZBDA 1YZTA 4ABYA 1W36D 2OAQ1 2Z0MA 3QPUA 5KSOA 4DEYA 5J4VA 1U9IC 2G9NA 4KSCA 1ZINA 1TUIA 2ATVA 2F9LA 2IL1A 2QM7A 2WJGA 4D0LB 1CKEA 3EASA 1Q44A 2QMHA 4G5SA 3GFPA 3I8SA 1WQ1R 1CR0A 1E2KA 2ZAOA 4PANA 4ACAA 3GD7A 4OK3A 2PBRA 2V6JA 3E5HA 1N6IA 1OJLA 1U99A 4A92A 4TLBA 4S35A 4LOAA 2E9SA 1DG3A 2QAGC 4QXAA 4NYMQ 2ZXUA 2F6RA 3DZ8A 4B44A 4ZCLA 1UKVY 2ERYA 1KO4A 2VF8A 2R9VA 121PA 3ECCA 3FFBA 3A4LA 4PO8A 1WBDA 2LKDA 3U3OA 2XEXA 2V3CC 4BFUA 3ZS9A 1U98A 2CHQA 2P6NA 3SU8A 4MKIA 5L3QB 2WTUA 1C1YA 3B85A 3LQRA 4FW9A 4DRZA 3LVQE 2QP9X 3NWJA 4QHTA 4TT3D 1KDRA 3T1OA 2X1VA 4Z8YA 4ZV4A 1JR6A 5L3SA 1DTSA 1KAOA 4CRWB 1W48A 2GZDA 3A1SA 4LYHA 2V9PA 4GMDA 4TTQA 3FKSD 3OZXA 1TMKA 4C9BA 3PITA 2WZQA 2KE5A 1XXHE 4KHZA 3EIQA 3GFTA 3RABA 2JLVA 4QC2A 1S1MA 4OQXA 3P4YA 2GKSA 2O52A 5G41A 3ADCA 1RC8A 2G0NA 4NU0A 2ODBA 1IM2A 1P61B 5G3ZA 1MO5A 3UPUA 5FBQB 3QY0A 1ZAKA 4OK6A 2GF9A 2P5SA 3RSLA 3NIBA 1A7JA 2R6GA 4PC7A 2DCUA 3E1SA 1KK1A 5B58C 1I4LD 3DMNA 4PHHA 2G0TA 4KYUA 4MUAA 4QBFA 1P5ZB 3W9YA 1E4VA 5AJZA 3QF4B 2WM9B 1G291 2EWVA 2D74A 4TZ6A 3B1VA 2BCJQ 1KKMA 4X8LA 4Z1MD 4QOSA 4OJKA 3D8BA 5FTNA 3TGPA 4Q48A 3AVXA 2DFTA 3VMFA 4XVUA 3BD9A 2EU8A 4JBXA 4TL9A 2GCPA 2XZPA 5BW8A 4LCBA 3U7EB 3GLIE 1NVVR 2NG1A 3SQWA 4KFUA 4FMDB 3FKSA 3QUSA 3QXCA 4L15A 2H92A 3Q85A 5AJXA 5DI3B 1EFRD 2V7QD 1XTSA 1CTQA 2ODNA 1KTVA 4HI0E 4JJZA 2VRWA 1CRPA 2ZSFA 2OLJA 1EFTA 3RRMA 3M1IA 2WOOA 1NLZA 1XEXB 1CXZA 1KMHB 4GFDA 2RGNC 2CNWA 4YXWA 2LWIA 1G6HA 4Q4AA 4NP6A 1IQPA 1QRAA 3BORA 1PLKA 3FB4A 1OIXA 3K0CA 5JSZB 1S9HA 3KQNA 4PR0A 4PFSA 1E1QD 3RVBA 4TZ0A 1WCV1 3IHWA 4LJ7A 1KK0A 2NZJA 1ZUNB 4P4UA 2ZRNA 4A15A 1RE0A 4HZUB 2VIIA 2NIPA 1NMZA 4EJSB 3BJIC 3GLGE 2GF0A 2HF8A 5H68A 3B1ZA 2VA8A 3QOFA 2FSIA 1UJ2A 4RJLA 1IY1A 4FN5A 4YQFA 1R8QA 1RRGA 2ZI9A 2QMOA 2XOKA 3ZQ6A 2IF2A 3QXHA 4LJ4A 4A4DA 4DIDA 5E7IA 1Z6YA 3MD0A 1IJEA 4IOMA 5DGXA 4NONA 1R0ZA 2FV8A 3LBNA 1L8QA 1ZNWA 2PCLA 4P4SB 1GUAA 2MSEB 4TMVA 4TLDA 1EFRA 4FMBB 1W2HA 2V7QA 4CT5A 1N25A 3H0KA 4IKEA 5AUOB 4OKSA 4YMUA 1NSTA 1ODFA 4JLMA 2A30A 4OQLA 1F60A 2VSOA 1W4CA 4A2QA 4BUJA 3KJIA 2IYTA 3MG9A 4B48A 1MOZA 3P32A 3BAFA 1KJYA 4LJAA 2EQBA 1UDWA 2A5DA 1DPFA 2DBYA 3M4YA 1E1QA 1CU1A 3N70A 4PC2A 2FSGA 3A1WA 1J90A 3AP2A 1D5CA 1ZIPA 1XMVA 4XH9B 4HLUC 3KTAA 5LDDC 4EPVA 2GZAA 2OESA 3W90A 4TYNA 3LAWA 3F5FA 4LV8B 4MYUA 3VX4A 3VR4A 5F9HA 2O8BA 1MKYA 3K9GA 4DEXA 3ZLJA 4O3MA 3KXLA 4UNNA 1XBTA 3VAAA 2D7CA 3TBKA 4CT4B 2QAGB 2QN6A 1B0UA 2FN4A 4LI0A 2J5XA 3AKCA 2ANBA 2VHJA 2WKPA 1GZSA 4NYJQ 1R0XA 4F4JA 1EFHA 1S96A 1ZM7A 2QPAA 2AD5A 1UM8A 1J8YF 4JLKA 3HDTA 2W00A 4CEJA 1FW6A 2Z4SA 3HP1A 5B30A 3NVAA 1UEIA 1Q1QA 1Z6AA 2LKCA 5SZHB 5CDFE 3AVTA 3T15A 1XTJA 2RGEA 1H65A 1ZIOA 2YYZA 4QL3A 5BYJA 4Z51A 1PLLA 1CJVC 1JNYA 3QKSA 4UJ3A 5HR5A 1Z0AA 2AK3A 2I3BA 2Q6TA 4TLEA 3I5YA 4G3XA 3ZVRA 2WSMA 3TVDA 5JS7A 1PLJA 3AGPA 4LYJA 4Q4LA 2AX4A 4LYFA 3WNBA 1U90A 5CLQA 2P6RA 4B2LA 3ADBA 5JWHA 4GDFA 2H57A 1G41A 4MKGA 1X8KA 4M22A 3T5DA 4TWZA 3CPJB 5M04A 3ZZTA 4TLAA 1XFAA 3OIYA 3QI2A 1I2DA 3KL4A 2YVUA 1OE0A 3UG7A 1N3BA 2QG6A 4QKQA 5L3RA 1Q3HA 4I4LA 3VU9B 1QZXA 2GBLC 1SVIA 1XCMA 2FZ4A 1TF2A 1G7RA 2G77B 3BERA 3BFVA 4CW7A 1W4BA 2GJAA 1P60A 1G1MA 2KJQA 3OEHA 3CB4A 1OT3A 5KDOA 2A5JA 4QGFA 2ZIAA 2OXCA 1KK3A 1W47A 3NEJA 3AUXA 1U8AA 3N5CA 4DIEA 4DSUA 1UF9A 4RFSB 2IS1A 2CE7A 2IYUA 2ZI4A 2XZLA 4P4TA 2BM1A 3NEYA 1SHKA 1V43A 3CF0A 5DHFA 5JRZA 3DL0A 2J7PA 3CH4B 1KJWA 1NN5A 2D7DA 3KDSE 1KIMA 1KI3A 3DKPA 4C30A 3FYHA 4AKGA 3L2OB 1NKTA 2A5GA 2MMGA 2HV8A 2OCYC 1UKZA 1Z0FA 2O8FA 5EZ6B 3CNLA 2BWJA 3EIHA 1W1WA 4GPTA 4JJKA 5CJ2A 1D9XA 2C9OA 4KJZA 1GNQA 4LBVA 4WXPA 4KBFA 4W7SA 1SULA 5FTMA 2DYKA 3HYRA 5J47A 2BMFA 1OHHD 1X1SA 1TQ4A 1GKIA 1QVAA 3IKJA 4C0SA 5EP4A 1W5TA 3CH5A 2QL6A 5JCPA 4Q7MB 4AKIA 2QAJA 4C3ZA 3FHCB 2C5LA 3AVYA 3ICEA 2GEUA 3IPXA 1QHHB 3TIFA 4TQUS 2VP2A 3VR1A 1Q0UA 2FU5C 4LDJA 3U3MA 4I1SA 4U02A 1BYIA 1M7HA 1YZNA 1NN0A 2V54A 3ETLA 2OT3B 4XVQA 1GNPA 3JVUA 3LBHA 4Q4HA 4HAWA 4A8JC 2IYRA 1TU3A 3R7WB 2O8CA 1KO8A 5E95A 3T61A 4C0HA 3E70C 3GLHE 3CRMA 1KI6B 4DJTA 3I5XA 4XWKA 3C16C 4EUNA 3SBEA 1UBEA 4MRVA 5CYPA 1CJUC 4QNMA 1N0VC 1NSFA 1XPUA 2PJRA 5CJPA 1XTIA 2BEKA 1K6MA 3WMEA 3H84A 1Z0IA 2VSFA 5EUQB 1NIJA 4LPKA 1ESMA 4KFSA 4ZI3A 1TX4B 1Z3IX 4B43A 5C46F 5CK5A 3V00A 2WPDA 3SEAA 5AUPB 4BRWA 3ZVNA 3NKVA 1OHHA 3CRW1 4M9XA 2IYYA 4WA7A 2GRJA 4B2PA 5P21A 2AKYA 5EXXA 4RD0A 1E69A 3PUVA 4C0KA 2IS6A 5L3VA 1TL7C 1T6NA 3SYLA 1E2NA 3U6KA 2DWQA 2GCNA 1COWD 4P31A 2ZRLA 4Q1EA 1W5SA 5FI0B 5TARA 5LB4A 1YU9A 3M0EA 3RS2A 3W3ZB 4N1AA 1QHIA 4G1UC 4GP7A 3MMPA 2B8WA 3DKVA 4A9AA 4QFMA 5EP3A 4XWOA 2Q9BA 2QNRA 2OM2A 2O0HA 1LY1A 2JA1A 4V0LA 1AA9A 1XXHB 3BH7A 4U7DA 2AL7A 1DBSA 1G8FA 2YINC 4FXPA 5A4JA 3BB4A 5FBRB 1GTVA 2H1LA 4IDPA 5IK2A 1J7KA 2XXAB 4KAXA 4IW3B 1N6PA 1DADA 1W2GA 4D4JA 2A9KA 4DSOA 1JXMA 5J4HA 1UBGA 1ZUIA 3MLEA 4OBEA 4Q7KA 5TXGA 1CR1A 4K81B 3RS4A 3CWZA 2IYQA 5BN4A 4G0NA 1VYUA 3LNCA 3FGNA 1E99A 1CJKC 1P62B 1E9CA 2FZLA 3L8YA 4R2IA 3THXA 3B5JA 1P72A 4M4SA 3PUZA 3BFXA 3IILA 1M2OB 3LW8A 3VR2A 4YLGA 4PO1A 2ODEA 2XTNA 3QKRA 3PXGA 3O8DA 1XCGB 1YQTA 1T4GA 2B8TA 1E79A 3SOPA 3K09C 5JWOA 1GL6A 3MAAC 3VNVA 2UZIR 2IUSA 4ACBA 1N5JA 3OE7D 3K0SA 1E9FA 3DVLA 2IEYA 4PX9A 1MABB 3SJZA 1COWA 4Q9HA 3GLIB 5IT5A 3CR8A 4G5RA 1T5LA 4PZZA 1GM5A 2CHGA 2WSSD 2GNOA 3EWAA 3D3QA 1D2MA 1SKYB 4E5UA 4IXMA 3O8CA 1B23P 4HAXA 4C2TA 2WV9A 1U0JA 2CE2X 2HXYA 3B1WA 3TUJC 1U0HC 2F55A 3Q8XB 4RZ2A 5K8LA 3GP8A 2EWWA 1T3HA 4LPSA 4EPWA 4HLDA 4N3NA 3THYB 3SJBA 1OB5A 3NHBA 1KGDA 4HUQB 5JHHB 4MYCA 2BBOA 2YOFA 1XF9A 4HZIA 4TQ9A 4YMWA 5SZIA 3CWQA 3AF3A 2EFGA 3LD9A 1RJ9B 3THWB 2KBEA 1IN7A 4EPYA 3LY5A 4Q1BA 3DOFA 5JI2E 2FPKA 2Z6VA 3KB2A 2J46A 5G40A 1Z07A 1F5NA 4ARZA 2Q3HA 1II0A 4DLSA 1IN6A 2IYZA 3I72A 4QGAA 2C9YA 2J45A 4MRPA 4PPFA 4RD3A 1XTKA 1AKYA 2NO9A 1T5IA 2JJ1D 5J40A 5KSPA 4JT4A 3QKUA 3GLGB 4LBWA 4TQAA 1R5NA 2J0UA 1OIVA 2KBFA 2QQ0A 3OE7A 3ADKA 3BH6A 1JR3D 4JLJA 3NDBB 1ZM3A 1KNXA 2FEMA 3CF6R 4JKYA 1NY5A 5H70A 4B35A 3C8UA 4EIWA 4JL5A 2C03A 1G5TA 5LPNA 4V0MA 2DPXA 2ZE8A 3FMIA 1BMFD 3UMRA 3B6EA 4YONB 1KK2A 4B6FA 1YR8A 5IHPA 4MITA 4HB2A 4JKIA 4FMCF 4NYMR 1XJQA 2AKAB 4RZ3A 4MKFA 4WZBE 3CX8A 5CK4A 3GJ6A 3D7MA 3LO5A 4QM7A 4NYIR 2ZJ8A 5BN5A 4LV5B 5AJWA 3VKWA 1EGAA 1NLYA 4URVR 3NBYC 4OHWA 3REGA 2HUPA 3U3JA 5KNBA 1FPMA 1J8MF 4RD6A 4F91B 2OBLA 1GRQA 1LFDB 2KWIA 1DOAA 1ZM4A 2ZRIA 3TKLA 4M1TA 4YC7A 1HY3A 2Q3FA 4CGZA 3LXRA 3CRRA 2GVDC 2JLWA 2GXUA 2GA8A 4DCTA 4MYTA 2WWGA 2YOHA 1FUKA 221PA 4S2EA 5A5GA 1R6BX 2JJ1A 3C15C 1EFCA 1VYVA 4GOXA 2GAOA 4QHYA 4O25A 1SXJC 3AH8A 2XSZD 3IEUA 2DWPA 4JIMA 2ZJ5A 1AGPA 3R9IA 2MMCA 2GDJA 3CRQA 1KHTA 2WOJA 5FUVA 4CEIA 3Q72A 4AKEA 2W58A 1BMFA 2CVFA 3IO5A 5J5CA 3WP0A 5JECA 5GJCA 1LB1B 2XNDA 4L5BA 4AY2A 3VR5A 4NTZA 1RW4A 1M7GA 2D62A 3PENA 2RCNA 2AFIE 2ZQ5A 4Q7JB 4IFEA 2QUZA 4P0TA 4Q7LA 2ZETA 3QG1A 2H18A 1NG1A 2QPOA 5C4GB 2CCGA 3WYGA 1MO4A 3WYFA 4AI6A 2PEZA 4OI2A 2E1RA 4LX0A 4KSBA 4RY2A 1NN1A 2RGCA 4EPRA 3OFND 4PZLA 1NN3A 5JLJA 3EC1A 1MRSA 2Y8EA 3PEUA 1ZNYA 4IEIA 1II9A 4MRSA 3X1XA 4MKHA 3KUCA 4DCSA 2W6JD 2RMKA 2QROA 3UIEA 1RYHA 4R98A 5B2ZA 4BFTA 1XD2B 2QRNA 2OCAA 4A2WA 3I61A 2X2FA 5DNYB 2W83A 1Z6GA 3N2IA 4G5GA 4IVRA 4WXRA 5FOTA 3K0EA 5GJBA 5E4FA 1MR3F 1KI8A 4PHTA 4A1FA 4D80A 2WWYA 4URYR 5FPSA 3KUDA 2BKEA 4P32A 5FPYA 3WNDA 3VKHA 2IS4A 1F2UB 1IXSB 1KYIA 4MRRA 3RS7A 1N5LA 1T8TA 2WVJA 1KO7A 3B9PA 4TSFA 4EJSC 4ZPXA 2P6UA 3I4LA 3CRVA 1KMQA 3DM5A 3R9XA 1Q20A 1WP9A 2EW1A 2IWHA 2RHDA 1E9DA 2VHQA 4JLDA 1J99A 4RZXA 4DB4A 1T8UA 4TMTA 3TSWA 5JRJA 2HLDA 2ZTSA 3U6BA 3FDIA 1VG1A 4AYTA 4R71A 2ASEA 2QE7D 1L4YA 3OFNA 2ZRGA 3HWSA 4JLOA 4GOKA 3BIFA 4M0LA 5G53C 4E09A 2PCJA 2A5FA 2C2HA 3KKQA 4NE2A 4EFNA 1PZNA 5DN6D 4NHOA 1I2MA 2PLRA 2QI9C 1OFUX 3A37A 4Q4JA 2PL3A 3RWMB 4LBYA 3SBDA 3EPJA 1OYWA 1AK2A 1YJ5A 5FBWB 3ZD7A 2ZREA 2IHYA 4OI1A 3OIUA 1OXSC 1XZQA 2IYXA 3DEFA 1II8A 1M74A 1VPLA 4BFZA 4BLSA 2BM0A 1N6LA 2IT1A 3SFVA 2GJKA 3OEED 2OBMA 4NCKA 2O8DB 3SI7A 5EUMA 5CITA 4C0BA 3U7HB 3REFA 1Z2CA 4JSYA 1AS3A 4G01B 4PSKA 4MH0R 3CBQA 4HUTA 4OHZA 1NI3A 1ZM2A 2ZRFA 1XCPA 1PJRA 3CLVA 2XX3A 5JSZA 4AWXA 1WRBA 1JQJC 1NIPA 1P73A 4HLQB 2QTVB 5KTYA 1E2PA 1UAAA 1R0WA 4HZUA 2QY9A 4H1VA 3X1WA 3ND9A 1U2RA 3SQXA 2BIFA 2H5EA 2QE7A 2WMOB 2C95A 4JVLA 5FL7D 2GESA 3UK6A 1NG9A 2F1IA 1E2HA 2W2XA 3GLHB 1T0JB 3PVSA 1E1RA 3K1JA 5DN6A 5FBVB 4C2UA 2QSZA 1TEVA 2RGAA 1ESNA 3TNFA 5HE9A 1U8YA 3ZS8A 1N6HA 4JBYA 1N0UA 1S0UA 4M8NE 3BC1A 1G7CA 2WWXA 1OH7A 3TQCA 3RDPA 3UWOA 3GJ7A 5CB8A 3K9HA 1AZSC 1BIFA 1W0JD 5FOXA 4ZKDA 4LHZA 2GXSA 5KNCA 4R9UC 1ZVQA 2G88A 2ZYWX 4TN1A 3WXMA 1NVWQ 2OFXA 4OHVA 3U2QA 4D4LA 2WHXA 1XWIA 4K8OA 3PIRA 1N6NA 1P4SA 1U0LA 5DSZA 4BEBA 1QVRA 4KI0A 4EQ6A 2R8RA 3HU1A 3QXSA 4I1OA 3WP1B 1TNDA 2QBYB 3IPYA 1JJ7A 4IHQA 2W2VA 621PA 2CL0X 4IJMA 1KZGB 3AGQA 3LFUA 4D26A 3RC8A 3LX5A 1HE1C 1P3JA 3AF2A 2GCOB 1D9ZA 4F38A 8OHMA 1SXJB 3SJAA 4PSVA 3THOA 1NKSA 1Z0JA 4HAZA 5FL7A 2IYLD 4FWIB 5GVSA 1HURA 1WE2A 3PQCA 1R7RA 2IYSA 1HA3A 3W6NA 4HEJA 4Q02A 4TT3A 4EFMA 3KJHA 3WHLA 3AVQA 1TPZA 3S1AB 4BE7B 2JLSA 3R8CA 2O5VA 4CF7A 2PX3A 3GJ5A 3K70B 3AUYA 1XB2A 4B34A 2BMDA 2FFBA 2HCBA 1VYTA 1W0JA 2LCFA 5D3MB 4Q47A 3ZYCA 2N46A 2JLXA 2FGKA 5JBQA 1G18A 4DLVA 2AK2A 2DFNA 4Q00A 2CLCX 4IOLA 4OJQA 1E98A 4TMKA 3O8RA 2X2EA 1PVOA 1TADA 2GJ9A 5TY0A 2J41A 1Q1ZA 2E87A 2HEIA 3L0IB 3QPVA 4E07A 2HYDA 2VO1A 2A7QA 2FPLA 4JSTA 2KB0A 3EG5A 3FMFA 4NBSA 2QEQA 3I32A 2ZRKA 3Q3JB 3BOSA 3AKDA 1KSGA 3U44A 3TW8B 3AVWA 4HAVA 4XOIA 5KPJA 4R7ZA 3LDAA 2ZR7A 4PAQA 5E7JA 2GJSA 3TAHA 3AEZA 3SYKA 1F48A 4Z1MA 2RGXA 3AVUA 2NGRA 2GAAA 2ZRCA 4L9SA 5FBLB 1XJ0A 3DMDA 3VU9A 4PQYA 5HKKD 2FJUA 2A2ZA 1NVXQ 1ZW6A 5EE9A 1XU4A 1W0KD 3W8RA 5BYKA 1VCOA 3H4MA 5DLQC 5FH9A 3KX2A 1OFTA 2YWEA 3EX7C 2ZI6A 1N6RA 1XDBA 3MWKA 1M34E 4YMSA 4TL8A 1JEDA 2SHKA 4Q9JA 2CLDX 1DO0A 4Z8XA 4RFSA 1FTSA 4L9WA 1XX6A 4RCYA 3PFIA 2IEZA 1FP7A 3KJGA 2Z83A 1KDTA 2IYVA 3GJXC 2YHSA 4WZAE 2G6BA 5EXPA 1CF4A 1MV5A 3W6PA 3NH9A 1E3MA 2PZEA 1S9DA 2PLFA 4QNRA 1VG8A 4LWZA 5FTLA 2BKUA 3DPUA 1P7CA 2ZJOA 1Q3TA 2ZJBA 2GEDA 2YJTD 1RKBA 1TU4A 5JMTA 2D06A 2QA5A 1A5TA 1KOFA 3IBYA 1FMJA 4KBGA 3OIVA 1VDZA 4PHFA 2JASA 3PUWA 4NPHA 5KNDA 2ZE5A 3PR1A 5DYIA 1XZPA 3VR3A 3HU2A 5KSZA 4WZ6A 1XNJA 4BECA 2NO7A 4PTLA 2GWHA 4OQFA 4LYAA 1WMSA 3KXKA 2OZEA 3QENA 2C9CA 1E2DA 5K8UA 2OCPA 4I81A 1D8TA 3K0AA 3TLXA 3EZ7A 1P2VA 3X1YA 4FD2A 3SJCA 2A78A 3ZZUA 3GEIA 1L2TA 1QHXA 2XGJA 4CEHA 3FPAA 4FI3C 1KI6A 3C41J 3VX3A 1LTQA 3KKNA 1K5DA 1X3SA 1WF3A 1E9AA 4KO8A 4N0DA 4YMTA 2HF9A 4PQRA 3LBIA 1IN5A 4UNSA 2WAYA 4LJYA 3ZH9B 3IGFA 2CHVA 2ZU0C 1A1VA 2G1JA 2ZJAA 4C0AC 3LLUA 4A0HA 3SR0A 1RYFA 2VPPA 4RD4A 2OFWA 5G3YA 3NBZC 1VHTA 4GP6A 5DHAA 1DAFA 3KXIA 4Q1DA 2OO7A 2P65A 5FTJA 3HU3A 3L43A 3G82C 1VIAA 3AP1A 4DWJA 3P27A 1QG2A 4ERNA 2W6ID 4JLNA 1G21E 1G19A 2AHOA 2ZR9A 3B1YA 4IEEA 4LJ8A 4XSHA 5C18A 1W7AA 4Q4AB 3GCGA 5FPTA 4HLUA 1TTTA 4ZCIA 2QMUA 4EKDA 4B3BA 3QKTA 2VHTA 3Q7QA 1GIAA 4B3FX 4BLOA 4DT1B 5IF9A 5K8TA 4NCHA 5L8VA 1Z2AA 2XXAA 2IX3A 4ESVA 4I99A 1KDOA 1T9HA 4BLTA 3G5UA 2G3YA 2GEVA 4QBHA 1ZM9A 2ZRAA 1SVLA 2VF7A 4QRHA 4EPXA 3EZ9A 4LBZA 1VCIA 4KFRA 1NVVQ 2JATA 1M6NA 3K0FB 1E9BA 1X8JA 5CM8B 2DR3A 1KI2A 1US8A 4V0ME 2BVNA 1ZU4A 3GJ4A 3IHLA 3RHFA 2NO6A 4FMCB 4PHGA 2BJVA 521PA 3AQ4A 2VHCA 4LC1A 2VP9A 1KI1A 4LK2A 5HZKA 3C7KA 4GRAA 1HT2E 3ASYA 2VP6A 4H9GA 5K8IA 1YZUA 3A36A 1J2JA 1FFHA 1G5PA 5EE5B 4EDHA 5JHGB 2N42A 2HDNB 3TH5A 2OBNA 4JT2A 1UPTA 4FWTA 1DAEA 1MABA 1OPXA 5H1YA 1ANKA 1GSIA 4GI7A 5AUQA 1S3SA 2C96A 3AKEA 5HZHA 4MGKR 1E0AA 4EPTA 3T1TA 1FOEB 3K8YA 3L82B 2CJWA 4AD8A 1G3QA 1L7VC 3W6OA 4FCVA 2OLKA 5FOWA 3SS8A 1Z5ZA 1UEJA 1NBMD 1BYUA 2G83A 1JAIA 1KSHA 2AWOA 4JYBA 5EE3A 2V6IA 2GBLA 2F9MA 1Q12A 2OSBA 3LVRE 2EYQA 3HYTA 3I1FA 1ZD9A 3LA6A 4A6XA 5FUYA 4DCVA 3EC2A 5FR2A 3VHXA 2R6CA 1XPRA 2CVHA 3GMTA 3WBJA 1SKQA 4OYHA 4Q21A 1T91A 2I1QA 2WWHA 4MA4A 1N5KA 1C9KA 1G16A 4MDEA 4LHYA 3TK1A 2FH5B 1KKLA 1LNZA 2BMEA 2WBLC 5J4YA 4XD7D 4IVQA 4LHXA 4HB3A 3N2EA 5JCZA 3KQLA 2GILA 4IRUB 1GNRA 1OXXK 4BRUA 1KSFX 4CEJB 4WIAA 2WKRA 2FGJA 3O47A 1X6VA 2C98A 4Q1CA 2F3TA 4IOKA 4LRWA 3B2EA 3C14C 4F7WA 3QKSB 1E96A 4POAA 5KDLA 4DZZA 4Q66C 4ZKEA 1LF0A 1E2IA 1P9WA 1S3GA 4LC0A 3GJ8A 4JYCA 4UKDA 3B60A 3O8BA 4ZIRB 4US1R 2WAXA 3NDPA 1ELOA 5TB5A 4PSAA 1G64A 4TYQA 1NBMA 2FFHA 2ZVQX 3LH5A 5D3QA 1GAJA 3CR7A 2RGDA 3IO3A 3OHMA 2W0MA 3NBFA 1F3OA 4NCJA 3ZQJA 2IXGA 4GSYA 4KCGA 3PEVA 4NDZA 5EE0A 5JJLA 1GRNA 2YWHA 1G4UR 2D2EA 3VKGA 5ELXA 3CX6A 4V0OA 4MGIR 3KQUA 1TQ2A 4XD7A 1DARA 1RFLA 1ZYUA 3U3RA 6Q21A 3AF4A 4A8JA 4B3GA 2FWRA 1OIWA 2ZRHA 4W5HA 3A1TA 1OXVA 3PCRB 4BLPA 5EJEA 2GTPA 2R65A 5TV2A 2CCKA 4ZO4A 1Y3AA 1HE8B 1I4DD 1RZ3A 2IK8A 2NTYC 5HCNA 1RIFA 5UKDA 3BK7A 4D81A 4O0MA 4JLAA 2YZ2A 3WYAA 3RS5A 4KVAA 1GL9B 3FFAA 1AS2A 1X86B 4M21A 3WHKA 4QJ4A 1T3LA 2WJHA 1PUJA 4X8OA 4QM6A 3PEYA 4C7OA 4GZMA 3RYTC 1DAGA 5C1BA 3OF5A 4V0KA 4D0NA 2O8FB 3T1VA 2HT6A 2OV2A 3KKOA 1ZU5A 3MWYW 4B3XA 1IN8A 2IS2A 2ZR0A 4M9ZA 4A2PA 4V02A 4BLQA 3MCAA 3IIMA 4PC1A 1E9RA 3TUZC 1E2MA 3H1TA 2ZSAA 2HJGA 1QHGA 3EW9A 1BKDR 1ZJ6A 3HPRA 5EXSA 4V03A 2ODWA 2F43B 3DHWC 1IN4A 4RSGA 3OIWA 1VECA 1O3YA 4HAYA 4UJ5A 5IDVA 3GLFA 2PX0A 2XZOA 1CULC 3TSZA 4P3YA 2O8EB 2ORWA 1LVGA 2CEAA 3KFXA 1KI7A 1MH1A 3OAAD 1SVSA 2JJ8A 3CONA 3LW7A 4B3CA 5TVKA 4KLZA 4ZDIA 2QGNA 3A4MA 3LXXA 4PPGA 1D2NA 3U61B 3QIAA 3DZDA 4Q4HB 1UKYA 3U7FB 2F3RA 1Z22A 4M1YA 2O8CB 2IC5A 1R0YA 2JLYA 3EAQA 4B2IA 2ZM5A 3T12A 3DOEA 3LLMA 2BOVA 1F2TA 3GEHA 5FUXA 2ZSEA 1VKJA 3UMFA 4M53A 2EVWX 2WSSA 2P2LA 5C4MA 1RRCA 1QHNA 4U00A 2F7SA 1JEEA 2PT7A 4AKHA 4XTRA 5AJVB 3K09A 4M1MA 2ZRPA 1CIPA 4D4KA 4IDOA 4PPNA 3R8FA 4IFBA 2FDCA 3WBKA 3FVQA 2BBSA 1Y63A 2R62A 1IOZA 4TYPA 3CNNA 3PEWA 2FMXA 1DELA 1E2GA 4URWR 2VQSA 3EZ2A 1R5BA 1E0JA 3OAAA 1SZPA 4B6EA 4R2HA 1DE0A 3A1UA 4H1UA 2EFHB 2WJJA 4L8GA 4L16A 1XJCA 2C04A 3EARA 4BLRA 3E2IA 3KZ1E 2ZRMA 2JCSA 4DSNA 1IBRA 1XEWY 2CL6X 4DLRA 4TL6A 2O0KA 4AIIA 1IHUA 4NCNA 1YZGA 2GJ8A 1JR3A 4BASA 2HJVA 2B21A 4IDHA 4AG5A 5TMPA 3FHOA 1AKEA 1N6OA 1GWNA 1DG1G 1XMSA 4TMXA 4UQOA 3THXB 4FIDA 4A36A 1SQ5A 1VTKA 2P67A 1MO6A 2FEOA 3QEOA 5HCIA 1EWRA 3ZVLA 3QSYA 3JVVA 3K70C 1KI9A 1EWQA 2GVZC 3ICQB 4NL4H 1KAGA 2VH5R 4XIGS 1SXJD 2XJ4A 1E2LA 4YMVA 3SDZA 5L3QA 1LW7A 3H2YA 3FHTA 4F4IA 2J0VA 821PA 4RFVA 3AM1A 3QXXA 3ZZ0A 3BH0A 2QPTA 5FOVA 3KQKA 2Q9AA 2R6DA 1DAHA 2VHUA 3T35A 3CF2A 1AGRA 3W3AA 4JLBA 4UNQA 1G7SA 3P1JA 5JJIA 3IIKA 2JGNA 1OH6A 3Q9LA 3R9WA 2FSFA 3KKMA 1JQLB 1E2EA 4TYYA 1XTQA 3F8TA 4C0LA 4DHEA 3T06B 1NMXA 3DM9B 5EP2A 3Q5DA 1N0WA 4JVNA 2Z43A 2V1XA 4ZDKA 3ZVMA 2HCJB 4OQNA 4KITB 4D0GA 2XSZA 4HLCA 1WDTA 3MJHA 5SZKB 4WVFA 5AWFC 3A8TA 1F6BA 2H16A 2QORA 2Z4RA 3U4QB 1FP6A 2RKOA 4Q01A 2PJZA 1EXMA 4Q9KA 1Z6TA 2QBYA 3QNUA 4A0RA 1IJFA 4B33A 4HYYA 4LHWA 2Q3MA 2GXAA 2ZANA 5J4LA 1ZD8A 4ARZB 4BFVA 2GETA 1YR7A 2REOA 3AF1A 3QF4A 4DDTA 4CDGA 1SXJA 2VLIA 3FWYA 4Q19A 4HSEA 4U5XA 4AYWA 1HH4A 3B1XA 2ZITA 5JEEA 4Q1FA 4QBIA 4TMZA 1P9NA 2NO0A 2XITA 4HB0A 2OCBA 3TUIC 4RZUA 1OLOA 1OXUA 4MGZR 4B71A 1E4YA 4IDNA 3IUYA 3CZQA 3W5IA 3S1AA 2W6JA 4MUBA 5GJWC 4ZDJA 4NZYA 4B73A 2WJYA 1G6OA 4KU4A 1HYQA 3FMOB 5JZVA 3X1DA 1G3IA 4JMPA 3UXMA 1W36C 2OHFA 1G8YA 4LUCA 3ND8A 4WAUA 3EPLA 5DI3A 3FOZA 3NG1A 3ASZA 1SVOA 2D3WA 1A4RA 2XTZA 3WRYC 4XTCS 2ONKA 1IAQA 2RGGA 4Q9IA 4B76A 1XEWX 3X1ZA 1XEXA 1KMHA 1VCNA 2O0JA 4HAUA 1AS0A 2G1KA 2WIAA 1JAHA 3CW2A 4CVNA 5C2JB 2ERXA 2Q0HA 3VTKA 5FUWA 2JIZD 3NH6A 1AZTA 1QF9A 3CO5A 3BRWD 4TTRA 2F1JA 3AKYA 4OL0A 1IXRC 3MFYA 5DISB 2R44A 3EIEA 3TQFA 1ZCAA 4PC6A 4EJSA 3U3KA 1CS4C 4TMWA 3IDQA 1EX6A 4F4CA 1KNQA 4OQMA 3MWJA 3SHWA 2FF7A 1A82A 1ZNZA 5F98A 1WB9A 1GKYA 1T0HB 4D4MA 4CEIB 4V0NA 3CX7A 2RHMA 2FX3A 1XMIA 3CM0A 4QJ3A 4FCWA 5DI9A 2CK3D 1ONBA 1KSJA 1FMLA 5KYKA 1TF5A 2BHRA 4JS0A 4NYJR 4Q9LA 4A0FA 4P4SA 5IRCD 3AV0B 3TJZA 4NYIQ 4PQFA 5EQTA 2NPIA 4EFLA 1O87A 2W0SA 2V55B 3OEEA 2J9RA 1E0KA 2XJ9A 2REXB 2QZ4A 3UG6A 3C5CA 2DFLA 3GQBA 2QMEA 5FPHA 1UDXA 3FMPB 1GITA 1AM4D 2R6FA 1UKEA 2WWIA 3NTUA 1CP2A 3KJEA 4DKXA 1OSNA 4XSGA 3I92A 1W49A 2FA9A 1N2CE 1U9IA 2GZHA 4G5OA 1KO5A 3ADDA 1GL7A 5KSYA 5AJYA 2H17A 1MRNA 2JIZA 1A2BA 2A5YB 4Y0VA 3GEEA 4DVGA 3NHAA 5E7MA 1Z83A 4AC9A 5BWMA 4Y0AA 2AXPA 4ZDWA 3K0CC 4JVSB 4B47A 4BFWA 5DIFA 2IBMA 1NNEA 2AWNA 5BXQC 4IVPA 1TQ6A 3I73A 3A58B 1FX0B 5GVRA 4ZI2A 2ZSDA 3RRYA 4LY6A 1FTNA 3H86A 1SHZA 4MYHA 4BZQA 3G0HA 1G4AE 2FOLA 4HDCA 1OYYA 1A2KC 1UADA 3UKDA 4CIDA 1S4QA 4IOJA 1YR6A 5FR1A 4DC9A 2QAGA 2B7CA 2CNWD 5LB2A 4YXWD 1ZUHA 3LRPA 1Z29A 2CK3A 2FFAA 5JJKA 2FSHA 1OFHA 1E32A 1YR9A 4XVRA 1HTWA 3IQWA 4ILEA 1G8HA 2NQ2C 4M1KA 3J81k 2Q9CA 2Z5FA 4O2LA 4AK9A 1FZQA 1P2TA 3CPHA 3HPQA 3P26A 3BE4A 4HATA 4DCNA 3DDCA 2DB3A 2XOKD 4Q4JB 5JS8A 721PA 1SKYE 2ECKA 4US0R 3GJ0A 1BO6A 2IYWA 2KI5A 3SZRA 4JL8A 3MSXA 1Q1EA 1R5OA 4WBSA 2DY1A 3U7GA 2AFHE 2BCGY 1SVKA 2ZS7A 1E2FA 1BOFA 1II8B 1PUIA 3EZ6A 2J3EA 4D6PA 4HDQB 4M9SA 3RWOA 1VMAA 2EFDB 2FE4A 2ZE7A 1VHLA 2IXFA 3SN6A 1G3MA 1Z6XA 5J4KA 2XB4A 1NF3A 3IIJA 2BBTA 3RNLA 3VHLB 3QVVA 1ZC3A 3AP3A 1JXOA 4DUGD 1G8PA 4BPBA 2C78A 4LZZA 4E22A 4URZR 2J1LA 4DLTA 3FTQA 2OEPA 4XWAA 4DT1A 2H7VA 4UXJA 5CM9C 2CXXA 3F3YA 2VL7A 2YV5A 4DXAA 1NY6A 2V4ZA 4OI4A 3QBTA 5LBIA 2RB4A 2WJIA 2PMDA 2W2TA 4KV9A 4RCZA 3VFDA 2IUUA 1OW3B 2OILA 5A0FA 4NKRA 3EXAA 3K0FA 3AB3A 2ZEJA 2YOGA 1YKSA 4GBMA 5L3SB 1G7TA 1YHNA 1D6JA 1G3UA 2C99A 1W36B 3UATA 1BS1A 3T5GA 1FNMA 1Q21A 1OXTA 3OESA 3WMGA 1NBME 4X8MA 3QE0A 2WIBA 1OV4A 2PT5A 1ZC4A 4I1UA 2ZROA 3QXJA 1RRFA 4PAOA 2OXRA 2CBZA 2RGNA 5HE8A 5HKKA 2CMKA 1Q1BA 5CIWA 1JI0A 1W0KA 1XD8A 4K46A 4EQ6B 3KQHA 2CDNA 4DUGA 1G17A 5ANRB 2FPMA 1QHHA 2QTFA 5SZJA 4ON9A 3SNHA 1ZP6A 5F9FA 2QT1A 1CBUA 1UFQA 1YRAA 2ZPTX 4O2RA 3SHFA 1LV7A 1RRPA 2OE2A 4BFSA 5F3WB 2V1UA 4D25A 3R7WA 1ZRHA 1DAMA 4G5QA 4DCUA 2XB2A 1AQYA 1RVDA 5HPYB 2NMVA 3PG5A 4WW0A 1FQKA 1AN0A 3TW4A 1ZD1A 4M1OA 2OUKA 2ANCA 1KDPA 1KY3A 3OEHD 2UZ3A 2JLQA 3MRSA
chains in the Genus database with same CATH superfamily
4LGMA 3U60B 1Z5GA 2BR5A 3KT3A 3I9FA 4OA5A 3COPA 1PFUA 4XUCA 1UBHS 1WX1A 2PZFA 2YWFA 5BRAA 1L1EA 4RHUA 3BXOA 2OAP1 1E5XA 5KU1A 2VWQA 4MP3A 3HUEA 3Q6MA 4KO4S 3SC3A 4F5EA 3DO6A 4LE2A 5FAKA 1RKVA 1T24A 2H0AA 3EWIA 3KTFA 3L92A 3AVVA 1DTWA 2IZ0A 4GDMA 4R5HA 1BU5A 1HV8A 1FJGB 5EMLA 3R3JA 2LPMA 4KODA 3UA3A 2DHQA 3IPAA 3WX0A 5JAZA 4HF7A 2BLNA 3SVTA 3IMFA 1V16A 1UZNA 3EUWA 2GK6A 2D7JA 4RQAA 2EYUA 4MR8B 4N6GA 1GVHA 1BJRE 1TUEA 1Z8NA 2IS6A 8ABPA 4OHYA 2VJQA 3ZHXA 1OROA 5B3JC 1F6DA 4UVEA 1FFXA 4G0UA 1W73A 2W2LA 1QRRA 4Z4QA 4DXDA 3MTGA 4HDOB 1WZNA 1P44A 2BEJA 2Q50A 2X8AA 4OBXA 4QDZA 2XTAA 1AOXA 1XAHA 1XKLA 3LO8A 1AHNA 4HRVA 4WLFA 5TDHA 2PUBA 1A9OA 2ZPAA 3ZGXA 3ZY3A 4I9HA 3ZJUA 3DMRA 2IH4A 3FJYA 2PIAA 3ESAA 1Z4KA 5KDDA 3DBRA 1GILA 1EE2A 4H6PA 1AIPA 2YHIA 3G6WA 1ZCBA 3QUTA 5JMOA 5BR4A 4DJAA 1JEYB 5EIAA 3F2IA 3OCYA 2O5CA 3ZD6A 1M2OA 3CXUA 2PKWA 4GPBA 1PN3A 1DRVA 5F3RA 1U8ZA 2WUFA 4KGZA 1U7OA 1W5EA 4BEJA 2XH8A 1FW8A 2BW0A 2GDZA 3KYIB 4ZYWA 2D4HA 4AICA 2L0XA 1F8XA 4II7A 4B9EA 1O94D 2X3FA 2QZSA 3TMKA 5JNLA 3NM5A 5B7QA 3GLIA 3D31A 5F33A 1FVHA 1T36A 3E9QA 4PR3A 3GMIA 1SPBS 2VQFB 2BP7A 2ZJ3A 2J5BA 3DP7A 1IHOA 3TNJA 2P2CA 4BZXA 3Q3VA 5FQOA 4BGDA 2QP4A 3IEMA 2JJMA 4Q3DA 3WB2A 4KDCA 5JI3E 2EDAA 2PMWB 2PMFA 2QM8A 5ALHA 1PJTA 2I7VA 2HU2A 1FCJA 3ZWXA 4R16A 2NZUG 2YV2A 4KLNA 2I8AA 1YJAA 3E4DA 1U5CA 3KTAB 2Q9UA 3AT1A 4XX0A 1XRJA 4XIFA 2V3VA 3OOJA 4TLCA 2B9VA 3F2VA 3DP9A 4BYMA 3IDAA 3VPGA 1UMKA 2J6HA 3TNLA 1S1CA 3AR9A 3EVZA 3QMVA 1CHDA 2HR1A 1XQYA 1M0WA 2K87A 5DSTA 4XM2A 3NHWA 3BSWA 1RJ9A 4CL2A 1EWKA 5LZ9A 1HE3A 1AV7A 3T4UA 1A3CA 1G5QA 4MTLA 4ROSA 3I37X 1EM8A 2AQHA 4GL4A 3RJTA 1NAIA 1BGVA 1SXQA 3E5NA 1ZBQA 2HDOA 3TBHA 2FLVA 3QK7A 4B80A 2HN9A 3GB9A 5DRTA 4EGJA 1WQ3A 5A1TA 1AG9A 3PEEA 2R3SA 2X2OA 4IBOA 3VZQA 4EI9A 4BVJA 4E33A 4EB8A 1MW9X 1NQTA 1T3GA 2Q5FA 4CFSA 3L1JA 4P33A 1PYOA 4R69A 3PC7A 3DHVA 2AG0A 2D2IA 5DOZA 4CM9D 1R4ZA 1X8XA 5FTKA 1OB2A 3G9TA 1TTTA 3CW8X 4X7BA 3WBBA 1CUSA 2X19A 1O94A 3OPNA 4PC3A 5A4DA 4FCCA 3OU7A 4L9AA 4M98A 3KEQA 1ZNXA 2HLHA 1T5TA 1WCXA 2ZSJA 3GT4A 3IQHX 3JARB 4I9FA 3N75A 4KYIB 3MTBA 3FKQA 1DAIA 3LUBA 3RBVA 5WRFA 3STUA 5C81A 3VV3A 4EHHA 1JYSA 2XTJA 3JQRA 4TTJA 7MHTA 4UASA 3NRJA 1P4GA 3CF4G 3UFXA 2QGZA 4HAOA 3R7BA 1MC5A 1YCFA 2J0SA 1DPGA 1FU4A 1Z06A 1NV8A 4G65A 4X41A 5LP1A 1L6RA 5JS7A 2J33A 3HKDB 3RRBA 4FGUA 4YI5A 1W19A 2A86A 4KXLA 1RLOA 1HKUA 2CL7X 2P11A 2VP4A 4WEOA 3TCNA 4US2R 5EN4A 3ZOZA 3DKIA 3LP8A 1N2CB 3JAWA 1L7PA 4MI6A 1A96A 3QVLA 4D96A 4BCDA 4IJKA 5KO2A 4LHVA 3NT5A 3P5SA 4Q3OA 3DBHA 5E8JA 4ESHA 1C9YA 4DPKA 3K1ZA 3GBSA 1RLJA 1ZOPA 2AOTA 2INGX 3LV8A 1JHRA 4EJFA 1DAKA 1Z6PA 3MCVA 4CM8A 2JJ2D 1X2BA 4GC9A 4ZYXA 1JZQA 3DR5A 1TAGA 1RLTA 4RV5A 4CLRA 4N48A 1U8EA 1XNHA 1WXIA 1I7LA 2F1HA 3N53A 1IWPB 2BHNA 2NSLA 4YJGB 2CB9A 1PJCA 3Q1LA 1WULS 2XNSA 4M2LA 5J59A 3U31A 4OX9B 5CEJA 1WBBA 1YR1A 2WJVA 3L7CA 4IDEA 4BKUA 1CJCA 2PRZA 4RHYA 3NTOA 1C9DB 1ISRA 4BDSA 4HTFB 1EPUA 3V4LA 1YZQA 2AN4A 2PRIA 7REQA 1EFUA 5GJVC 5IANA 2ACEA 1T4CA 4RS3A 4NWIA 1XMJA 4LGCA 5ALWA 1XNRB 1LV8A 3MLBA 3EPRA 3OKFA 3O4GA 4RIIA 3P8ZA 1MZPA 1Y4UA 1MO3A 4YI3A 1A77A 1OFGA 1SUFA 4IDQA 1QPBA 3JZMA 4DNFA 3MMNA 4WV3A 4A27A 2R0QC 5CH5A 3QE2A 2QVBA 4ZCMA 2VSNA 4YGXB 1VPTA 4BMZA 2PUTA 3QLUC 5FOSA 1Q14A 1Z47A 1FUUA 4ZTBA 4OY3A 1BXRA 3AK4A 2F3QA 4QHSA 4UD6A 1OVMA 1A7AA 2VBCA 5LQNA 1I7PA 3VVMA 2BFEB 2BMJA 1SCDA 5M2QA 5DMHA 4CFYA 2CJWB 3DE4X 5FI3A 1FL9A 2Q4EA 2AJLI 2OD2A 3L7DA 5JSFA 2JCGA 5LOVA 1LS1A 2W2OA 4KFTA 3TEFA 4EH1A 4L4UA 1YZ3A 1YCGA 1PD1A 2JJ2A 3HXLA 1FA9A 2WTAA 4X24A 3ROXA 2AQ8A 5AR1A 1TB4A 1IY2A 2DWOA 2ZJ2A 3A4YA 3P20A 1RAIA 1KO1A 1KXZA 4M1SA 5K0BA 1DFGA 3IXLA 3O75A 3URMA 3K53A 2VJAA 4XJTA 4WNAA 2YQ5A 4I08A 1TVCA 1NU6A 3SIPA 1CRZA 1CR6A 2QTHA 1OKKD 4OG2A 1V8PA 5TQJA 3QVUA 1RMTA 1E5VA 1MG5A 3CINA 4II3A 4ZOLB 1HT3A 4KIWA 3AJEA 3OCUA 1QE0A 3RIEA 2VDMB 4HO1X 1R10A 2X9VA 2J4FA 3GPIA 4N65A 2ZJZA 5BSGA 2JDID 1P1KA 4K03A 4UNRA 3FNHA 4HQOA 2BBWA 3GY0A 3UMSA 1KC3A 5LXTB 3PHJA 4S1VA 4YT4A 4U2FA 2I87A 3N2ZB 1W4RA 2G8LA 3BHJA 4N8DA 1IK6A 3RODA 4LY9A 5I7SA 1J00A 4RA9A 1Y9AA 4C7KA 4JI8B 2OBFA 4I1VA 5CFNA 4JXZA 2BI7A 1JJVA 1WNFA 3BMNB 1S8FA 4ID3A 3EZYA 1VCHA 3F3MA 2O6LA 5GONB 2QLMA 2D5CA 3BB3A 4FJ0A 4U63A 4BC1A 4OUDB 5IUKC 1O08A 2ZYUX 2A9QA 3DE5X 1PR1A 4MUFA 4N7JA 3OA2A 2EQAA 1W59A 4NK4A 1J5EB 2J0EA 1XZIA 2VLBA 3PEFA 3KYJB 5D1HA 4IRMA 4IZHA 4D9GA 4ZXPA 3UOGA 4GRDA 5ESWA 1LPSA 2FETA 4MLDA 1N2EA 4AG6A 2QUKA 1QMGA 5KX5A 1M8PA 1QC5B 1VLZA 4X9XA 5EWLB 2GD6A 2BUBA 3D5TA 2VRCD 2W48A 1F2DA 4CMAA 4UTRA 3RAJA 5JVDA 1H8ED 1BWSA 3BEDA 3IUQA 5A03A 3OZTA 4CM7A 3FGPA 3KQSA 2XVYA 1OKKA 3LRTA 1Q57A 1N3YA 3B13B 1TD9A 4MQ4A 4RA6A 4LZWA 2BRUA 4H7PA 1VGVA 2ZE6A 1E0SA 4JUCA 3OC6A 3NWPA 2WG0A 4R2LA 4ZVRA 2JDIA 2QV7A 5LN1A 3MB8A 1Q1GA 5BN3A 2C2WA 4LOJA 3ZWWA 1E3WA 4Q4DA 4DBLC 3A6HA 3Q7RA 2FSUA 3O0DA 4W9MC 2UZ1B 2ZVPX 4A8JB 1Q77A 3OT1A 4XPIA 4C3UA 1RZRA 1TRHA 3TR0A 2FG6C 2EKLA 1DQSA 2OV4A 2PH1A 3AZPA 3QKRB 1Z63A 2OM6A 5IYZB 1T8PA 1Y34E 1ILWA 3GLHA 1HT1E 2FZVA 3BRQA 3RU2A 1E3JA 2IV3A 3A4NA 5JH7A 2OG2A 4E2WA 1UBSB 4N39A 2ZBQA 1G3RA 2BT4A 2EFEB 2OWEA 3KLPX 4GZ6A 3ZDQA 1E9EA 2YWGA 3BXHA 1GCUA 2P4SA 3GRFA 1T34A 1NP6A 4GECA 2UVDA 3CGGA 2AR7A 3SM3A 3EZFA 4J0KA 1ZJWA 1SGWA 4LV6A 4LZAA 1V3VA 1MB2A 2PKQP 2PXAA 2CLSA 3HYNA 3Q0IA 4HB4A 5E2BA 4PPQA 1U0FA 1SBYA 4Q1AA 3Q8MA 1X80B 2R6ZA 1H8EA 4UM9B 1U4NA 5HCUA 5TPWA 3V7NA 4DILA 2UKDA 3HR7A 3UJPA 2V8BA 5AVTA 1XP8A 2EG9A 2ISSD 3K4PA 4HDKB 4O0LA 4OIMA 2VYFA 3DOOA 3GWGA 3LXUX 3HCAA 2B98A 2WTNA 3GLFB 2QJRA 2CVZA 3GFFA 3HJNA 3M6FA 2CC2A 3I28A 4KRGA 4F1JA 3L01A 1CJSA 3PUYA 4TXLA 4DDUA 1NBWB 1YJBA 1X92A 5F7JA 1OX6A 3IVMA 2O23A 2YQZA 1XDUA 2IOFA 3S1SA 2MDTA 1SBQA 3GAFA 3JWEA 3K92A 2GASA 3Q5EA 3QA3E 3VC2A 1BE6A 4IR7A 4L0QA 3N07A 1XTRA 1CZHA 1JSLA 3CUVA 5REQB 5LYJA 3TVYA 3W4KA 3M6UA 3S70A 1NPDA 2AYYA 2D1SA 1GG2A 4PFJA 2NO1A 1VIDA 4INJA 5C32A 2Y9MB 3FE2A 3TSYA 1RNLA 3NWOA 2CNOA 5DO9A 4AJNA 1H6AA 3RS3A 4JCOA 3NWEA 2XCTB 1TYDE 3SQNA 1YACA 1D1PA 4ZJPA 3Q8LA 3MXOA 2IQ5A 4DDVA 3WFIA 4DBZA 3C3WA 3EIFA 4D9NA 3QFRA 2AXNA 2DP4E 4KIJA 5AW7A 3RC3A 3TVTA 5DTIA 1X8LA 4M9QA 4CKZA 4Q05A 4UBKA 2ATXA 1X19A 3WRXC 1BU8A 1PJZA 5DHRA 4BJ5A 2AGVA 3KT6A 5LIPA 4ZRDA 4I5GA 3RRZA 4E4TA 1U0TA 2DERA 2BFCB 2D2FA 1PV4A 1X1RA 4F6CA 2C8VA 2CYBA 2NXEA 3OX4A 5BORA 1L5WA 1ZCFA 2VPYA 3DZCA 4BAZA 2OXTA 1NU8A 3R23A 1FUEA 1JUDA 4DGQA 4Q03A 2F8TA 4E0BA 2OA0A 1G9XA 4CKYA 1YZTA 2BGRA 1GYRA 5CLFA 4N7BA 2EAUA 3W2GA 3GEBA 4DR6B 2KX7A 2Z0MA 3QELA 1NJ2A 4GPZA 5KSOA 5IKPA 1U9IC 2BEWB 5AI4A 1HMPA 2BMAA 2G9NA 3ZXXA 5CDGA 1PQ4A 1Z34A 3VPBA 2V7VA 1JKXA 3R41A 3K6SA 2ATVA 4B4DA 5IJ9A 2GWRA 2F9LA 2VYQA 1EGVB 2NZYA 2CLHB 1MXHA 2LE0A 1CKEA 5C7LO 2DVMA 1ISPA 1PGNA 4E6PA 4G5SA 2FJ0A 1AKWA 3GFPA 3JZIA 3UJ8A 1Z5VA 4WY8A 3SNKA 3UJHA 1CR0A 4EJ0A 1ST3A 3DMTC 5D86A 2AZXA 4BEWA 3E5HA 4HFJA 5B2EA 1N6IA 1OJLA 3I52A 4AZ0A 5B7PA 4PBTA 3H17A 2GKOA 1WOYA 2QAGC 4EGCB 3M4JA 1K5PA 4WLVA 4B44A 4BMCA 2XMZA 3K72B 1ZGGA 4PYLA 2VQ6A 4ETNA 5TS2A 1GL3A 1UJMA 3I76A 1UKVY 3PFNA 3H2IA 1WTAA 3FFBA 2LKDA 2A14A 3U3OA 1I5OA 2V3CC 3S1LA 3ZHYA 3ZS9A 4BFUA 1ZRSA 2WTUA 4YR7A 5L3QB 4HGQA 1F1JA 1GU7A 3ZCXA 4HXFB 4ZOQI 3UHOA 5C7IO 1AO0A 3T1OA 2VDUE 3DOCA 3QPDA 2YCBA 5KYGA 4IIHA 3KJZA 2GZDA 2V9PA 4GRIA 1P1RA 3BF8A 2QOEA 3FKSD 4WFQA 1ZD4A 4I50B 1TMKA 2VAMA 4C9BA 1E2UA 3PITA 5F5XA 4OQEA 3HDYA 4KQFA 1T9KA 3ZC3A 4QC2A 4MIOA 1XR3A 3P4YA 1PJAA 1E3QA 3FA2A 4FGWA 4HPXB 1ZHHA 5G41A 4OVKA 3WFZA 2G0NA 4XKJA 3JQFA 3MWEB 1P0IA 4TZKA 4XA8A 1P61B 3BXPA 2HMTA 1AE1A 2QNBA 3UPUA 5FULA 2YVAA 3QY0A 4BN4A 1TJ3A 3DVRX 1B8NA 4PZAA 2GF9A 1D1TA 1YFZA 2NM0A 5HDQA 2DCUA 3TQOA 5BNWA 2CMDA 3E1SA 5DGCA 1KK1A 1M6YA 3ZDEA 1VM6A 3PNMA 1I4LD 3DMNA 4PHHA 3QE9Y 3ZE6A 4BRSA 3O1LA 2XUPA 4MJLA 5A71A 2V3WA 5CVVA 4MKZA 5DNWA 2ST1A 3CLHA 4MUAA 1BQEA 3U37A 2DZDA 1NMSA 2HHCA 3L8DA 2WM9B 2EWVA 2ETXA 2B3TA 2D74A 3ZJTA 1L3BA 5CIYA 3V4PB 1KKMA 4DA6A 1NHGA 1UCFA 4EYQA 1OLUA 5FA6A 2PSJA 5HOEA 2EU8A 2HA6A 1YOBA 3UUGA 3DLIA 2G76A 2R97A 3V8MA 1AK1A 2BL4A 5I9TA 3GLIE 4OGKA 3SQWA 3SR4A 4KFUA 2XY4A 4FMDB 4F2DA 5AM3A 1TAUA 3O90A 1QOPB 1JS1X 3FKSA 1ABEA 2FSSA 3MJVA 3M6LA 1VIMA 3O3CA 3R4VA 5TNXA 2DBVO 4MV0A 3U7QA 2OQIA 1FLDA 3ZWNA 4D3DA 4MMYB 2COEA 3H19A 1PDWA 3G0GA 1YK1A 1PHRA 2FWAA 3IBTA 4ND7A 4MIYA 2I1WA 4NFLA 2V7QD 3IVGA 2EOAA 5E9WA 3O82A 4GPIB 2ODNA 2YY5A 4S04A 1KFKB 4DR3B 3PP8A 1P2FA 5IT9A 1P39A 2FFRA 2ZSFA 4WK6A 2WFLB 5DEOA 4HNGA 5L3ZA 3CVUA 4II2A 3UM9A 4PQGA 4KPFC 1KMHB 2WQZA 2I29A 4WNIA 4ZMRA 2ZJ1A 4OMDA 4B82A 4GFDA 2V7XA 3KSBC 3M5PA 4J1TA 3DHEA 3FMGA 5JAPA 4JBHA 1U6KA 3W06A 1SZCA 1G6HA 5ALFA 4NP6A 3BORA 4QREA 5KVCA 4PR0A 1B0PA 3QM1A 4PFSA 3IHWA 1J23A 1MA3A 1SBHA 2HWYA 3NANA 2HQBA 3ESXA 4I5IA 1S01A 2WIJA 4OHUA 4UPVA 5EQDA 5TGDA 3TGWA 1Y5MA 3EODA 3TZQA 1BGXT 4PLWA 3GVPA 3SBXA 2NIPA 1BA3A 1MEOA 4EJSB 3BJIC 3GMDA 3B1ZA 3QOFA 1RAGA 4MB2A 4HFNA 4U6NA 1UJ2A 1DCTA 1IY1A 4MCAA 3DXYA 1A0OA 2XOKA 1XRPA 3L04A 3QXHA 4GR5A 3ICWA 4LJ4A 3RIMA 1FJHA 4B8YA 5E7IA 4B87A 4NQRA 1V6CA 4LVCA 5AO9A 4H7EA 2EFYA 3G89A 4WK0B 2FV8A 5AMXA 3WKEA 3U81A 2X41A 3RYFA 4DRXB 3BREA 4G0MA 3TRDA 5CFZA 2F48A 5HRAA 5LJLA 1FFCA 4FMBB 1W2HA 2V7QA 1FMTA 3GPBA 4YWHA 3H0KA 3DWFA 3IEKA 3OD5A 5AUOB 1ZN7A 3B6MA 4OKSA 2XB9A 3AUJB 3F6SA 1QJCA 2IOHA 2KYRA 1S8NA 2A30A 1SKUA 1RXYA 1W4CA 5KYUA 4A2QA 2AMJA 4RE5A 4BUJA 3HN2A 1XUOA 2R68A 10MHA 4GQBA 2H4ZA 3B7PA 3SS7X 1MOZA 3TZEA 2HM7A 1C30A 4I3HA 4BNJA 3DFZA 4DREA 4LJAA 2EQBA 4RMGA 1U2DA 4ZT4A 1CB7A 1CU1A 1M8JA 3N70A 1H94A 1MENA 2CMGA 2FSGA 1O9BA 3CEAA 1JSXA 3DONA 5HSGA 1XMVA 4A8HA 4ALKA 3DJFA 5KX5F 5LDDC 4EPVA 3QX3A 3R4CA 2GZAA 4XFJA 2OESA 5T67A 3WLAA 2FVYA 1P9OA 3W90A 3N7AA 5JVDF 1N5DA 2M6SA 5TT1A 3VX4A 2WABA 1QZTA 1EVQA 1QH8A 1L4BA 3KWLA 4AJJA 5EWJB 4XGIA 1P1JA 1QK5A 1MFPA 1CETA 1RHQA 3G2LA 5F7XA 3ZLJA 2Y0CA 2ZBEA 2IU0A 1GYPA 3K94A 3CXRA 4AUEA 2J48A 2D7CA 4FMPA 2JGMA 3DE2X 4L02A 3I23A 4XDYA 3TBKA 2QN6A 4YP1A 3GX1A 3I2JA 4OF4A 2FN4A 5AVRA 1GEEA 3UT6A 3TZHA 1J1IA 2J5XA 3E5MA 2QRKA 5K3OA 1XA3A 1G38A 2WKPA 4NYJQ 1R0XA 1S96A 3CTMA 4N4AA 2AD5A 2SKDA 4JUAA 3QX7A 1Q6YA 1K0FA 3HDTA 5L7YA 3HP1A 2ZWOA 2NV6A 4LDAA 1T15A 1JAYA 2LKCA 4MJXA 5SZHB 3AVTA 4GKKB 1CY6A 1XTJA 2RGEA 4GGPA 5FRDA 1ZIOA 5BYJA 4YHHB 1KP2A 5EXEA 2ZXFA 1CZRA 1PLLA 1JNYA 2O1XA 1YV9A 4G84A 3KOOA 4FUTA 3BD8A 2JGEA 2AK3A 2Q6TA 3UJ9A 3UMVA 5HR5A 4G3XA 4NC9A 4JMLA 3I5YA 4F5YA 2WSMA 1GQ2A 1ZMBA 3TVDA 4C5BA 1J97A 1PLJA 5I47A 4LYJA 4P5DA 1WXEA 5TPZD 2AX4A 5TLSA 4RTRA 4KP7A 5JMWA 1DG9A 1DXQA 5CLQA 3WK5A 3D3NA 2P6RA 5K3AA 2H57A 1VL1A 1IJBA 3PD1A 3NT4A 1W9MA 1G41A 1E7MA 2NXCA 1P9LA 3EXHB 1X8KA 3MRVA 3RJ9A 1QRSA 4JJ8A 2HAEA 1DJNA 3CPJB 4TWZA 4EF4A 2FPGA 1I6MA 5JDIC 1ONSA 1KDZA 4KQHA 1M8GA 3VHRA 1VE3A 3NHZA 1Y7HA 2XBUA 3E18A 1OE0A 1CQJB 1X2EA 1N3BA 5L3RA 4TXMA 4KLAA 4YGYA 1B1AA 4JU9A 3PQ5A 1T10A 1SVIA 1PKEA 2GN0A 2NU9A 1NW9B 4BP1A 1NF8A 3FRHA 3LDFA 3BERA 6REQB 3BFVA 2HX1A 5DWDA 4DA4A 3P2YA 2FLWA 3PKJA 3OEHA 1RAFA 1T2DA 3DBOB 1CZUA 1Y3FE 3GK3A 1OT3A 4D8WA 2A5JA 2H0RA 4FOPA 4QGFA 1TMYA 1F0NA 1XCLA 2GPBA 2GS9A 3QWHA 4Z7QB 3AUXA 5TR9A 4DSUA 5LYJF 2ARKA 4GSLA 3RT7A 2IS1A 1LBEA 1CP3A 1PEAA 5CP8A 4P4TA 5GTDA 3O6VA 2PIDA 1SHKA 3CF0A 2P3LA 4RF5A 2XNJA 3T5BA 1UPBA 3NMUF 1S7GA 1Y4AE 3CH4B 4RK6A 1NN5A 2OP1A 1KIMA 1IOWA 2V7EA 4MQMA 3V55A 2DAPA 3MS4A 3WV5A 4DIFA 4CFZA 3L2OB 1GPDG 3MJFA 2MMGA 1QGUB 2HV8A 2OCYC 1VJCA 1WM1A 1N9GB 1S02A 3NOVA 1EYZA 3LT5A 1QANA 4PN3A 1A9XB 4PGAA 3EVCA 3CNLA 1QCZA 5AH0A 1W1WA 2R48A 2XB2A 2JI7A 2VPZA 4KJZA 1GNQA 1OGIA 1CUGA 4WXPA 3TFQA 5FTMA 1S7CA 4JB8A 1M72A 1BCSB 1I1NA 4H1WA 3HYRA 4LN1A 2CEKA 3D54D 3M3HA 3DCNA 3K96A 2YS6A 4O5OA 5HGXA 5IEJA 1W5TA 2BE9A 4ZVUA 1X7XA 2QL6A 2PPLA 3IAM6 1MU0A 2G9ZA 3NAMA 3SZUA 3V1TC 1I4EB 4AKIA 4D02A 1ISJA 3ZI4A 4M0DA 2X6RA 4E94A 2HFKA 3WJAA 1X9IA 3DS8A 2O20A 3BWVA 4M9CA 2YFYA 4ZAWA 1L8AA 5K0NA 4DA0A 3EIWA 4O33A 3X1KA 4LDJA 2WF6A 3U3MA 5IM4F 5L51A 4I1SA 4KB5A 1WPGA 3OEYA 1N4AA 5AW3A 4CHTA 2MINA 1L3IA 3JQCA 5GZ6A 3H04A 2WHYA 4QAJA 2ZBPA 2V54A 4U0JA 1V2GA 4XVQA 3PGXA 4MGEA 5JS2A 3V2UA 3VOTA 1F20A 2IYRA 1KO8A 2AYXA 3IA7A 1TA9A 1ZRNA 4HN4B 4DXHA 4V2UA 1C0EA 3GLHE 1IN1A 3S7TA 4IGAA 1VSBA 2Q5JA 5BMOA 1LRLA 3NASA 4HQ0A 2UUBB 3FZNA 1WNTA 4XWKA 4YA6A 3SBEA 1H1LA 5FO0A 1XQWA 3VSEA 3PWTA 1RPTA 1U02A 1IQRA 3MGKA 4MVJM 4JFAA 3ROGA 1N0VC 3EUFA 3RTBA 1RSZA 2W4MA 5CJPA 3HY4A 2XUDA 2X7HA 3PKZA 1YS1X 2A0YA 3EIUA 1Z0IA 2E82A 3FZGA 1NJ6A 1NIJA 2J9FB 4ZMSA 1ESEA 4KFSA 4BVLA 3OPYA 1Z3IX 3PYMA 3V00A 4V0SA 1YNOA 1BKSB 3SEAA 2GLUA 2OV8A 1W93A 3K2EA 5JYBA 2XUGA 3NFYA 2IYYA 2C58A 2VNJA 4MQUA 1GZ7A 1UC4B 1H2ZA 2AKYA 3MAGA 4NFYA 5EXXA 5P21A 3KR1A 4K9LA 2CHFA 2WP0A 3SYLA 3Q9UA 2C8LA 3ACDA 4RIFA 1P3Y1 2ZRLA 4P31A 5CLGA 3RS2A 1YU9A 4BRZA 4BKOA 1QHIA 1PR9A 2B8WA 2K4MA 3DKVA 4QFMA 1KH1A 1QWOA 4JROA 3GL9A 4JBIA 3KSUA 2OGTA 1LY1A 1AA9A 1B74A 2JEZA 2YVKA 2AL7A 3D1VA 4D99A 4U7DA 1ZVMA 1G2OA 1H1TA 3OWXA 4FXPA 2P4QA 3EDQA 1RAHA 4I4CA 4UAUA 3IAEA 1WMAA 5ER6A 5FBRB 4DABA 1J7KA 2D0OB 2H1HA 4HWTA 1SCKA 2QYSA 4FDTA 3HUFA 4IW3B 3IYLW 2ATEA 2WW8A 3ESDA 2OORA 5J4HA 4Q7KA 5A62A 1CT9A 1JL3A 1X0XA 3FNEA 4K81B 2DWCA 4BN0A 4JJ6A 5ICGA 1VB3A 1E99A 4LXGA 2O5RA 3DF9A 3PK0A 5CFPA 5DHPA 1M8KA 3VR4H 5FPYA 2XWQA 3WFJA 5JPCA 3L1KA 1XCJA 2O57A 4L9RA 4MPTA 1ARZA 2JCVA 2PH3A 3C5EA 3LW8A 1IE3A 3O1HB 1QGZA 1YQTA 1Y8RB 3O8DA 1TT5B 4CV2A 1JFSA 1MC4A 2P4UA 3WGJA 5JIBA 3K09C 3OURA 3WKCA 2WDZA 3QVKA 2DLDA 1M54A 2IIPA 3S68A 4BWGA 4U2EA 5K6AA 3OE7D 4EB3A 1XWFA 2OOSA 5AXCA 1BNCA 3SJZA 4Q9HA 2VCYA 5A02A 1TCAA 2ZK7A 4G5RA 3PHIA 4KJXA 2Q7XA 1IJKA 1D2MA 2MSNA 3D81A 4IXMA 4BKRA 4C2TA 2BAGA 3GNSA 5DMXA 1XROA 3FYUC 4BQFA 2P8JA 1V26A 1XQ6A 2B1JA 3AM5A 2GRUA 3B1WA 3MT9A 3TUJC 1Z62A 2F55A 1RHMA 4EUFA 4JOQA 3TJRA 1HQKA 2J85A 1VSVA 3GHHA 4EPWA 4MQFA 3THYB 4M7PA 4N3NA 1OB5A 4YS6A 3CLUC 1KGDA 4H3KB 3A27A 4BV2A 2FUCA 5JHHB 2D2XA 3GW8A 2X4GA 3CJQA 2BBOA 3O4IA 3H5WA 3WE7A 3ZV4A 5ESDA 1XF9A 1XZKA 4AM8A 3SZ3A 5K8CA 2ZUEA 3C5VA 3SGLA 4AN1A 3LUFA 4JR2A 2PYDA 4YMWA 2R00A 1ECBA 4TWJA 5IM5A 5SZIA 4HFMA 3UCFA 1RR6A 4ZVLA 1ISIA 2JHGA 1IN7A 1P6QA 1R6AA 4MW6A 3LQFA 4G2TA 3PX7A 4Q1BA 5U4XA 3DOFA 4XXHA 1BE8A 1ZRMA 3MHTA 3LVFO 5JI2E 2FPKA 2Z6VA 1COZA 4MCIA 5G40A 3ZUPA 5ETJA 3RVRA 4DUZB 1KVQA 1GAEO 1GNSA 1EFPB 1II0A 3PNSA 4GWGA 5JDCA 2J45A 3L0DA 4PPFA 3S5JA 3TJMA 1XTKA 2V0NA 1MN6A 4XGRA 1AKYA 4BVEA 1DT5A 2JJ1D 5KSPA 1KRXA 4MW4A 5LMUB 3GLVA 4HAIA 3DAGA 4LBWA 3EFOA 2R47A 2DCMA 1R5NA 4MV3A 3OE7A 3H5LA 3QUQA 4JLJA 1ZM3A 1KNXA 1P7PA 2EF0A 5AK3A 4B84A 1G5TA 2CFIA 5LPNA 3CZMA 4CDRA 2MR6A 2V97A 2ZE8A 3FMIA 2RJOA 3HCEA 4QSMA 4REMA 4N6OA 1CUUA 1H6BA 2E4YA 4FMCF 1XJQA 3FI0A 4NYMR 4RWEA 2JGIA 3CX8A 3QWBA 4L6AA 1E1KA 3D7MA 1DV1A 4BP8A 1PUXA 5BN5A 2X8LA 2OXFA 1U5AA 3DOJA 5DHSA 4LE1A 4G1CA 5CNJA 3DUWA 4L8YA 1RC1A 3S81A 1BX3A 1FPMA 4KO2S 4L85A 1GLVA 2WF8A 2OBLA 4EI7A 1Y4ZA 3EVEA 1NXVA 1XDSA 2Y1GA 2ZRIA 4NBUA 4M1TA 2XWSA 3OOHA 4UUBA 5FB3A 5IBQA 5SICE 5BOSA 5BSKA 1YRQA 3N3AC 4YRGA 3PE3A 1TFUA 1HE4A 2NZXA 3VSDA 2Q5IA 3CRRA 4L28A 3T41A 2GXUA 3PI7A 4DCTA 1SNYA 2HPAA 4KQMA 221PA 1TC1A 5F7ZA 5A5GA 2JJ1A 1U0GA 1VLQA 1VYVA 2R7AA 4PEVA 1J21A 2GAOA 4QHYA 1T4MA 3R74A 4PAWA 4O25A 4QPNA 5BWNA 5BYAA 4OHCA 1EXNA 1SXJC 5EEGA 3IEUA 2DWPA 4YREA 1NXXA 3CEMA 3OZEA 5T4HA 1ISHA 1V6AA 1JG7A 2ZR8A 1KAEA 3CRQA 4BMVA 4RDHA 2X7XA 1AKNA 2ZWVA 1QYDA 2YMLA 1A95A 3H4TA 3NGXA 5GJCA 4H7DA 1LB1B 2XNDA 4XYLA 2VHZA 4AY2A 3OQIA 3VZPA 5DM2A 4NTZA 1RW4A 3ZCSA 4BP3A 1WMBA 3GCDA 4BE4A 2RCNA 3QXGA 5T5QA 3Q8WA 4IFEA 1NR7A 4FYIA 1K7SN 3UYLA 1NG1A 1Q5PA 1WTCA 2QPOA 4UHBA 5EHQA 3KO8A 5C4GB 3R9KA 3WDLA 1RWXA 2E1RA 1ZH2A 1ZITA 3MMXA 4KSBA 1VBFA 2X7JA 3OFND 2G9VA 4PZLA 3ZJ5A 1SU7A 3BE5A 1MRSA 1NZDA 1SBCA 4UHKA 5JLJA 1G63A 1II9A 1GLGA 1ISGA 4WMLA 5LA6B 1RYEA 4YAOA 3CIFA 1AUQA 3EFHA 1EP3B 3NIDB 2HNKA 1M1NB 2ZJ0A 4NQZA 4MPPA 5DCYA 3MTEA 1UJ6A 2Z6AA 3BWCA 5DVZA 3I61A 2X2FA 2QY6A 2PQMA 2AMYA 1J1ZA 4ZWNA 3DPSA 3ND6A 5BSUA 3KLOA 4CMBA 4FS3A 5GJBA 3HS3A 2VUIB 1KI8A 1YS7A 4LOHA 4PHTA 4A1FA 2HPZA 3RIYA 3OMLA 4P32A 2NU6A 2PMEA 5IDQA 2PZJA 2JKVA 2JBWA 5JCXA 1I6LA 1XQ1A 3GD5A 3M3PA 5LC1A 4OKIA 2WVJA 2C1EA 4YJFA 4UC0A 4WESA 2P6UA 5CB4B 3DBLA 5EHGA 3F6PA 4E32A 2QXTA 4DMRA 4N5MA 4OB8A 1UXIA 3C6XA 3R9XA 2EW1A 3U13A 4LGYA 2Y4NA 2JVIA 1J99A 3GVCA 1T8UA 2VPIA 1JA0A 4TMTA 2WZCA 2ZTSA 4WFIA 2ERCA 1F06A 2VOEA 2WSYB 5IARA 4BAGA 4WTOA 2R751 2HA2A 1JT9A 5P8WA 4R71A 2QE7D 3G2KA 4CIXA 1L4YA 2ID7A 3OFNA 2FW7A 4JLOA 5IVIA 3E2PA 3L6UA 2CGEA 2I62A 3BIFA 4HH4A 4PLPA 2A5FA 2C2HA 3I12A 4L5AA 3QVJA 1PZNA 2GN1A 2PGOA 2VPTA 1JR2A 1KVUA 1BDJA 2PWAA 2PLRA 2QMZA 3A37A 3FCAA 3INYA 3N0TA 3DEIA 1BVRA 4LCEA 1JQKA 1T8RA 1OLXA 4NZZA 4ZCSA 3TDKA 1E58A 5EKXA 1Q6ZA 3ZD7A 2H8GA 4I8IA 5A9SB 1UBRS 4BMDA 3RYIB 4KL8S 2PJUA 1KEZA 3OY2A 4BLSA 1P1IA 3CN7A 3WICA 3DV2A 1EFDN 3SFVA 2GJKA 4N82A 4WFJA 2GLTA 3N7UA 1KS2A 2Y1FA 3LCRA 3MN1A 1PZGA 2Z8YA 2D13A 4YDRA 1VGQA 4ZV9A 3HSKA 2B8NA 4FT4A 2F90A 5L4LA 3IP6A 3AW9A 1A88A 3OQ1A 4FB4A 2XB8A 4QU0A 4HUTA 3C70A 1NI3A 1CS0A 1UC8A 1X1CA 4OHZA 1PJRA 2D0IA 2CXTA 1IG0A 2XX3A 3SC6A 5JSZA 1UP7A 1RYNA 2XUOA 3WGOA 2WG1A 4LKOA 4KQJA 1P73A 5K0TA 4L07A 3C4VA 4Y3UA 1GGKA 4FNAA 4AS1A 3MTAA 1JNXX 5KTYA 1E2PA 2V74B 1UAAA 2XA2A 1GEGA 4K6GA 1XLWA 1JP7A 2CJFA 1TYBE 3ND9A 3DNMA 2OMEA 2AC4A 1Z45A 2QE7A 2C95A 4JVLA 5FL7D 4BNHA 3PHCA 1NG9A 1G6KA 2BFMA 4S1TA 4EB6A 2W2XA 3PVSA 1T0JB 2NYRA 3B3GA 1E1RA 2I6UA 1CEQA 2DF8A 2I2XB 2NSJA 2QQGA 2ZLBA 3IIIA 4ZU3A 4ZCRA 4X1KA 1RRVA 1RMYA 4RV9A 1TJ4A 2B4YA 3NUGA 1N6HA 4YAFA 5HE9A 1XYGA 1NGSA 4QG3A 3UAGA 1OY1A 3TDMA 3QFHA 2XF8A 3JAMA 3NJ4A 2FMFA 2M2IA 2ADMA 3GDHA 3UWOA 2WQ7A 3GJ7A 3O83A 3JRWA 1PG2A 4BVHA 2CXSA 2H7CA 5B5SA 2PLWA 4ZKDA 1NBAA 4FNGA 1BD4A 2WM2A 4E5DA 2NYUA 3PDHA 5KQPA 1ZVQA 3FX2A 2HRZA 3U40A 2E89A 3GFQA 4NLLA 1Y37A 4NPAA 1HZZC 3WXMA 1PSDA 1OILA 4DFDA 5MF6A 1FLAA 2V58A 3KSDO 5ICEA 4TUYA 2QX7A 1E89A 1FTQA 1XWIA 2QKYA 1EBUA 2WHXA