1I4DD

Crystal structure analysis of rac1-gdp complexed with arfaptin (p21)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
177
structure length
177
Chain Sequence
b'QAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARFAPTIN 2
publication title The structural basis of Arfaptin-mediated cross-talk between Rac and Arf signalling pathways.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 60
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2001-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1i4dD00
1GVNB 4Q1FA 4LZZA 5EZ5A 4ARZB 5F3WB 4DZZA 4XVUA 1ZCAA 4G5RA 2CBZA 3SOPA 3GFTA 5FPKA 2FJUA 4FW9A 5G3ZA 4C9BA 4D4MA 3EPHA 1Z2AA 3SC3A 4JLKA 4XWKA 4TSFD 2GZAA 3DL0A 4BFVA 4TMWA 4TQUS 1Z5ZA 1KSHA 1D5CA 2ZE8A 3CWQA 1NY6A 2REBA 1I2MA 3RYTC 2VP9A 3CX7A 1G5TA 1IN5A 1KI9A 4NYJR 3E2IA 3KQKA 1KI4A 5UKDA 2RGBA 2ZYTX 2F43A 4X8HA 4B48A 1RVDA 3C5CA 1CBUA 4EQ6A 2RGAA 3MJRA 1E9BA 1F2TA 1KNQA 5EE5B 1PV4A 2ZSBA 1HTWA 4OK3A 2H5EA 5HKKD 4RFSA 3WHLA 4G5QA 1KI6A 4DCSA 2BMDA 2RGGA 3ADDA 4C3ZA 2MSDB 2G83A 1W7AA 1UBGA 3GLHA 4NE2A 1Q12A 5IT5A 3GLGB 3C4JA 3ZVMA 2GESA 3X1ZA 1II8B 4ZDIA 1F2UB 4PO1A 3RRMA 3PUVA 4ASUA 1FZQA 5AJVB 4WOPA 3LW7A 1SXJE 2O8BA 1ODFA 4FWIB 3UANA 2YINC 3BH7A 1FX0A 2EYQA 4DLUA 2N42A 3BH6A 3LO5A 2VP6A 1MO5A 1EFRA 2ZU6A 3A58B 4BZPA 1HV8A 3C8UA 2IUSA 5AWFC 1G21E 3LBNA 5C4GB 2CL7X 4A0FA 1P6XA 4PC3A 4Q01A 1T5LA 3AF4A 3IILA 3LLUA 3Q7QA 1Q0UA 2J9RA 1WBBA 1E98A 4BFYA 1COWD 4MYUA 1Q1EA 1A7JA 2QGNA 2PX0A 4ABYA 5FUXA 5LB4A 2D06A 5KYKA 4RY2A 1N6IA 3JVUA 3QE0A 5JCZA 2WWGA 4DBLC 3T1TA 1SVIA 2J0VA 1P3JA 1F5NA 4EPYA 1LF0A 1P9NA 2P5TB 3FWYA 3QKUA 2IA5A 4IDOA 2CLDX 4EPWA 1ZNWA 3ONWA 3P27A 3GEIA 4R71A 1CKEA 1DAIA 2OBNA 1LB1B 4BE7B 3K0CA 2DB3A 1A82A 1US8B 2MMGA 3LY5A 3CNOA 4TQ9A 2R62A 2VP5A 1KI3A 2Q9BA 2EFDB 4GDFA 1GILA 4R7ZA 1Z6AA 1ZM9A 4PSVA 1Z06A 5IK2D 3WMEA 3AM1A 4D0NA 1UBEA 3IBYA 2AWOA 2DR3A 2NZ8A 2C9CA 3QXJA 3CLVA 3QVVA 1DS6A 1KK3A 2IS4A 2QMHA 1U98A 4GNKA 3K53A 2VP2A 3PEUA 4LYHA 3F8TA 2ZRIA 1HQYE 3BS4A 3M4YA 4DVGA 1QHSA 3AKDA 3KDSE 4I81A 3KQUA 2IX3A 4B6EA 2G0TA 3OIVA 5GVRA 4R98A 5HR5A 2OG2A 1PUIA 1R6BX 1W0KD 2H8KA 3QBTA 1KY2A 4JLNA 5L3QA 1B0UA 3U3KA 2QBYB 1RFLA 3B2EA 2ZYUX 4YLGA 1KJZA 1NY5A 1VG9B 2WOJA 4A2WA 3U3RA 1E1RD 4Q7MB 5EUMA 1OXXK 3MJHA 3MMPA 3RS0A 2XNDD 1XTSA 1IY2A 2A5FA 2JIZA 3UG6A 1Z0JA 4ERNA 3GJ6A 1NN5A 1YJ5A 2DBYA 2JLRA 1N0VC 2ZJAA 4A0RA 2VHCA 1X86B 1ZJ6A 1X8KA 3VR5A 4FMCF 4GP7A 5TB5A 3VR1A 1DBSA 5CIQA 2ZRGA 5C2JB 1UAAA 4CEIB 2IXEA 3WMGA 2A5YB 3F3YA 3AEZA 3MSXA 3K0AA 4Q4HB 3AVWA 4B3XA 3VTKA 2IYUA 4TYWA 2UVQA 4LDJA 1R8QA 4P4SB 2G1JA 1UADA 2IWRA 4OI0A 1E2KA 2NMVA 4IKEA 3B9PA 2WJGA 3W5IA 1G8FA 4AG6A 2RGNC 3A37A 2NPIA 3VU9A 3K9LA 1UPTA 5JEEA 2V3CC 2FV8A 4PAOA 1XPRA 2P65A 4Q19A 1ESNA 1KI2A 4DC9A 2RB4A 4JBWA 4I99A 4C7OB 2QEQA 1WA5A 4DLSA 5FBVB 1TADA 1GKIA 4AYWA 4W5HA 1LVGA 1NVVQ 1FFHA 4DEXA 4DT1A 4MDEA 4GI7A 821PA 5FUWA 2R6CA 1WE2A 4C0AC 3QKRA 2Q0HA 1UFQA 1XMIA 1FQJA 1RIFA 1ZIOA 3I72A 4A36A 3LQRA 5EE0A 2GJ9A 1RZ3A 3VR3A 3PEVA 5FL7D 2RHDA 2GDJA 2O8EB 1CU1A 1Z0AA 2Z6VA 3DEFA 3BK7A 1G6OA 4PANA 3QPVA 1V43A 3Q85A 2Q6TA 4KODA 1LS6A 1D6JA 1CJTC 2AD5A 3SJZA 2IF2A 1XEWX 3MAAC 4B2LA 4JLDA 1FOEB 1U90A 1UF9A 4FCWA 4BZQA 2W6JD 2WWYA 1E0SA 1W0JD 5DH9A 1FL9A 3UWKA 3SYLA 5J4KA 2FGJA 3EZ2A 3JZAA 4RZUA 5J40A 4GL2A 3DKPA 2ZI9A 3CW2A 3BBPA 5EXTA 2OCAA 1QZXA 1GNRA 4D80A 1W5SA 1HT1E 4G0NA 4JZKA 4EDHA 1QVRA 3AGPA 3Q9LA 3CZQA 2G6BA 4NHOA 1Q22A 3P32A 1VKJA 3A8TA 4C30A 2CVFA 1GSIA 2A5DA 5IF9A 4AG5A 1N3BA 4NCJA 2IS6A 1GNPA 3WY9A 3QF4B 2CK3D 4MKGA 2WJYA 1P7CA 1ZC4A 4PZLA 1C9KA 4ZKEA 2VEDA 1ZM7A 3OEHD 4IEEA 2B8WA 3HDTA 2A2ZA 1RC8A 2XB4A 1AGRA 2QT0A 3I4LA 4MRPA 3FB4A 1XXHB 5SZKB 2IYLD 1LY1A 3QEJA 5KU1A 2ZR9A 3TGPA 2IS1A 1FPMA 3SQXA 2PZFA 3GLIB 2W2XA 4G5OA 1Q20A 3GJ7A 5FTKA 2GHIA 1A5TA 3NBFA 5IHPA 4O3MA 4DIEA 4V0OA 2ZITA 4GPTA 1IY0A 4CEJB 4WVFA 1AK2A 5G3YA 4KFTA 4IDPA 3EWAA 3GFPA 4D4KA 1FW6A 1VTKA 3BORA 3LBHA 4POAA 1XD9A 2H57A 5K8IA 3H1TA 1OLOA 4NBSA 1J7KA 3C16C 4QM7A 2WHXA 3SR0A 5K8TA 5HCIA 4MGKR 3P26A 3HWSA 4QBIA 4NCKA 1E0JA 5LBIA 1CJUC 2OUKA 4YMSA 4Q9HA 2GILA 5E3HA 3AH8A 4HZUA 2OO7A 2EWWA 2DYKA 2ASEA 2DPXA 4FXPA 4K81B 1GDDA 3VMFA 2ATVA 1HE8B 4PSAA 3WRXC 2HV8A 4OI4A 3T61A 2J87A 1NG9A 4HAWA 1UBFA 2XTZA 1Q21A 2GCNA 1MO3A 1FUKA 5GJWC 5FUVA 2NQ2C 3T06B 2QGZA 3TSWA 1S9HA 5L3SB 1ELOA 4B74A 4DSTA 3R20A 4B43A 1NKTA 4QL3A 3LQQA 5AUQA 3AVUA 4I1OA 4LY6A 1ZM3A 5DISB 1XJCA 3KJGA 2J0UB 1Q3HA 3IKJA 3SYKA 4E22A 1CIPA 2ZSEA 4LJ7A 4PPQA 3R7WA 3EIEA 1Z0KA 1SGWA 2A5JA 2WVJA 3DO6A 1R2QA 3ZQJA 3S1AB 3DHWC 2CNWD 2G9NA 2LKDA 2PLFA 1NBME 2HT6A 2JATA 4MGZR 2WOOA 3A36A 4GZLA 1HEIA 3KQHA 4LJYA 3KB2A 1Y3AA 2X2EA 1XX6A 3FKQA 2H18A 1GFIA 4GT1A 1A2KC 5G53C 3PUXA 1SHZA 3N2IA 1W36D 5BN5A 1XTKA 1F6BA 2PT7A 1KK1A 4JKYA 5SZHB 2SHKA 4HB2A 4Q9LA 1DG1G 1W44A 5EE9A 3SE0A 3TKLA 4B76A 1X1SA 1EG7A 2RGXA 5DI3A 2MMCA 3C7KA 4YONB 5JSZA 1GOTA 4G5GA 1XEXA 2ZRCA 4Q1AA 3KJIA 1E1QA 2JEOA 4DCTA 5L3VA 4LYAA 2P6UA 2HLDD 4WZAE 4TTPA 2Q21A 2AWNA 1E4YA 4TMVA 4LJ9A 1E0AA 1Y63A 1S3SA 1IONA 1HA3A 1N5LA 1NLFA 2XSZD 2V9PA 3SN6A 3A4LA 3IPYA 1AS2A 1IHUA 4B2PA 2OBLA 3ZVLA 1KTVA 4JT2A 4Q1CA 2WWXA 4G5SA 1X6VA 1P9WA 3LVQE 1FNNA 1E94E 1PLJA 2VRWA 2WJHA 3ECCA 3NH6A 4LHXA 4DB4A 1N0UA 3AP3A 1U9IA 4ITRC 3GMTA 2BJWA 2O0HA 3AP2A 1X1RA 4X8LA 3UATA 1GNQA 4EIWA 3MWYW 1YRBA 1YHNA 1JR3D 1XCGB 1JQLB 2GJSA 5H70A 3W34A 2WPDD 1X3SA 3U44B 1QHGA 1TU3A 1TUEA 2J45A 1J8MF 1GAJA 4DCVA 2GKSA 1EFCA 1XDBA 2OZEA 3B1ZA 3CIOA 3O8BA 4LHVA 4TMXA 2DFLA 3T35A 3UIEA 3ZLJA 2C9YA 1ZAKA 1UKVY 4MRNA 5TDHA 1U2RA 1QHHB 1YZNA 4Q00A 4FI3C 3GJ8A 3U4QB 2O5VA 2D7CA 3OZXA 4L8GA 1ESMA 2ZSDA 2JLQA 4Z54A 3NKVA 3MRSA 1GM5A 2RGDA 1XTRA 1ZUHA 1U99A 4BECA 3FE2A 4AYTA 3WYAA 3SJAA 3P20A 4NYMR 2LWIA 4AC9A 4PHFA 4HDCA 2XOKA 2C99A 2W0MA 2BCJQ 2JLWA 1JQJC 1RRPA 1EK0A 2V1XA 2R9VA 1SULA 2ZVPX 4I1UA 1ZD1A 3ZD7A 3WNBA 1TUIA 3MWJA 3AVYA 1T3SA 3EC2A 3A4NA 2A9KA 4ZIRA 5KNBA 2J59A 2XZPA 3SJBA 4W5WA 2O0JA 2PBRA 4A2QA 1Q1QA 3ICEA 2GK6A 2X19A 2XNSA 1VECA 2CL6X 1DVRA 2GK7A 3DZ8A 2P6RA 4TYNA 4JKIA 4LBZA 4LV8B 1OFHA 2YKGA 3ZDQA 3P4XA 4BZXA 4OHXA 3NEJA 4OJKA 2ORIA 2CEAA 2ZSAA 3OEED 3LX8A 1NL3A 3OAAA 5KPDA 1KO8A 1HH4A 4EJSC 4JLOA 1MABA 1KDRA 2D2EA 3U7EB 5AJZA 1P2VA 4OHZA 1OHHD 2EW1A 3NEYA 2ZETA 4IXMA 4TL9A 1NKSA 2KI5A 1TMKA 4KXFB 1RRFA 3K9NA 3BFVA 3RS3A 2X77A 1E9RA 3SFZA 3NC1C 4DLTA 3EXAA 4LHZA 2X1VA 1UKEA 4TTQA 4LHYA 3I8XA 4PZZA 2QRNA 1W0KA 2FX3A 1GRQA 3MWLA 3CBQA 3TRFA 2HYIC 1GL6A 2QE7D 2WKQA 2IHBA 3IEVA 3RS5A 1OFIA 2QNRA 2OEPA 2ZM5A 2I4IA 2AXPA 2YWFA 3B60A 1E0KA 1YZLA 1ZU5A 4I4LA 1O87A 2HEIA 4JSYA 3ZZ0A 1ZRHA 4GSYA 5P21A 2J7KA 2D2FA 1KKLA 2J41A 2RH5A 2QTHA 3OE7D 4HUQA 4A82A 4D4LA 1G5RA 1KZ7B 3BWDD 5KO2A 1W49A 1KY3A 4DB2A 4CVNA 3QG1A 1JBKA 1AJEA 4QNMA 4XOIA 5AUOB 5F9HA 1CJMA 1NN1A 1G3QA 3N5CA 4QC2A 4A8JC 5J4HA 2VHQA 3DM5A 5JWOA 2H7VA 2AFHE 1II9A 2Z5FA 2VPPA 4RKFA 1BS1A 2DY1A 4X8MA 3KQLA 1AN0A 4FMBB 3OIWA 3X1XA 1Z8FA 4D81A 3KKNA 4DUGA 2BWJA 3ADKA 3BD9A 5GJBA 4DIDA 3L0IB 1QHXA 4F93B 3HU3A 2WSSD 2ZI3A 4WBSA 1R5BA 1ZIPA 3RS2A 3WBJA 4XD7A 1DPFA 2CHGA 2IYXA 4HLQB 2ZYVX 2B92A 2WAXA 1U8AA 2RMKA 4LC0A 5FOVA 1XRJA 3F0TA 2TMKA 4H1VA 5AR1A 3U6KA 4ARZA 1CP2A 4U02A 421PA 1G7SA 4Q9IA 4FN5A 3ZVNA 1KO4A 1YVDA 2A78A 2CE7A 3MGCA 3X1YA 2F55A 2IHYA 4CT4B 1XPUA 2QAGC 3MUFA 3T34A 2HYDA 1KO7A 3RS4A 1TF7A 3PCRB 1XZQA 1PLLA 2KE5A 2VSOA 2AXNA 4I1VA 3ZVRA 2FA9A 1R0ZA 3AUYA 2ZJBA 3T1VA 4V02A 3VAAA 4KHZA 1ZNXA 2ZRLA 3H2YA 4Q4AB 3ZH9B 2FEMA 4NYIQ 4L9SA 1NRJB 4OHYA 1SXJA 5DN6D 1W5TA 2YC4C 3THXB 3DM9B 2VLIA 4M22A 1G9XA 4IFEA 2CCGA 3BFKA 4NCIA 4NCHA 2BC9A 1DAEA 2AR7A 1GG2A 4LJ4A 4ACAA 4II7A 4PO9A 2IYVA 3JVVA 1X8JA 5J47A 2GAOA 5GVSA 2PCLA 3NIBA 3OIYA 5KTYA 1G19A 1IN6A 2JJ8A 1JXOA 2JJ1A 4Q1DA 2A7QA 2W6ID 2VP0A 4OI1A 4BLOA 3CH5A 2OCYC 2YOGA 1G8GA 1II8A 1F2UA 1BH2A 4LRWA 5D3MA 2AX4A 4H9GA 5FBLB 1N0WA 3FHCB 2FE4A 3Q7PA 4NKRA 2YWGA 3V9PA 4URXR 3KKQA 2GXAA 3HU2A 2VYFA 2WJIA 4Q7KA 3K09C 4B34A 2FFQA 3CRQA 4TTRA 5AUNB 1W36C 3TUJC 5FOSA 1OE0A 2V8OA 2Q9CA 3AF2A 2A5GA 1GRNA 1VYTA 2OAQ1 3TAUA 3ZQ6A 2KWIA 1R5OA 3QKTA 4PC7A 4LJAA 2XGJA 4NONA 5CYPA 3FMOB 3B85A 1YZUA 3M6AA 1EXMA 4PC1A 4GOJA 1Z6TA 1G41A 3Q3JB 4TT3D 1TF5A 2VBCA 1PUJA 2IYSA 3FMIA 4FMDF 4OQNA 2F7SA 3V4FA 4Q4JA 1KYIA 5EXPA 4BQSA 3CR8A 1XU4A 1E9CA 2BBTA 3UKDA 1QHIA 3BJIC 2ANBA 3LV8A 4XSHA 4IW3B 2A3RA 2ZJZA 4UXJA 4LWZA 1CXZA 2ANCA 5AJXA 2J0SA 5C46F 1S1MA 3KXLA 1BO6A 4MGIR 3ZIAD 3CNNA 3SFVA 4BEJA 3QXSA 3SI7A 4DLXA 4DCUA 1U8YA 2NO9A 2GAAA 4AKEA 3I1FA 4C0KA 4YMUA 3MFYA 4EJSB 5JRZA 1CRPA 4HI0E 4M1TA 3BB1A 4QGHA 1Z63A 4Q48A 4KLZA 4PZYA 2IEYA 4LK2A 3PUZA 4TMKA 3SHFA 1TQDA 4B47A 5KUTA 3MG9A 3TR0A 4PXAA 2JDID 5HE9A 2ZRNA 4MKHA 4D25A 1CLUA 1JAHA 2VIIA 1M7BA 1FTSA 4HAVA 2GNOA 2YVUA 2CHQA 2ZE7A 3FPAA 4WXPA 3QXXA 2PCJA 2R6DA 1HY3A 1AQYA 1BMFD 2ZANA 3AUXA 4PQFA 5FOXA 1FNMA 2J7PD 1S3GA 4TMZA 5LB2A 1H8HD 1OIXA 2ZE5A 2ZRFA 3L43A 3CRW1 2P5SA 3B78A 3W90A 2NTYC 3PEYA 1KK0A 2VQSA 3W6NA 3SZRA 2AL7A 2ZRDA 3GLGE 2NOAA 4LSGA 4PPFA 4AYXA 1IN4A 3B13B 1FUUA 2ZU0C 3TQFA 2GRJA 3N2EA 2QSZA 3CF0A 3KX2A 2XTNA 4YXWD 1WRBA 2O8CA 1QHNA 3GD7A 4FCVA 2NO0A 2VF8A 1OKKD 4Q4HA 1G4UR 2QRZA 4H1UA 4A8JB 4UNQA 1W4RA 2CNWA 3ASZA 3BERA 4R2IA 5FI1B 4WXRA 2QP3A 4IXNA 5K8LA 2IEZA 2CXXA 3WP1B 4KFUA 1W1WA 2HCJB 3RS7A 5EP4A 2OSBA 1HURA 5TVKA 1XEWY 4EPTA 1G3IA 1ZUNB 2FPMA 4V0NA 1T8TA 1RKBA 4TLAA 5J4YA 1TQ2A 5G40A 4NZYA 4D2IA 4L4UA 3EWSA 2P6NA 5EP1A 5HZKA 1KMHB 2WKRA 3L2OB 5JECA 3QUSA 3KJEA 2FSIA 1J99A 3LRPA 1T91A 1E9AA 3B8HA 5JRJA 2F43B 2IS2A 1J70A 1OFUX 2JJ2A 2QAGB 4B3CA 2GXUA 1BIFA 3RDPA 2CL0X 3TW4A 3H86A 3W5JA 5SZJA 1OH5A 1F2TB 4Q21A 1EFUA 4HB4A 1OXSC 4HSEA 1OH7A 2O8EA 1VHLA 1KI6B 3L8ZA 5E7MA 1L8QA 1MKYA 3BB3A 4JVLA 4D6PA 2ZEJA 4B3GA 4LV6A 2BDTA 6Q21A 3H0KA 3A1SA 1KAOA 3BFXA 4PX9A 5AUPB 2XZLA 2GJ8A 2ZAMA 2P67A 2Z0MA 2GCOA 3OFNA 4P3YA 5DYGA 5HPYB 5KSZA 4JVSB 1K5DA 3UWOA 3A6PC 1IN7A 4BPBA 1AGPA 2AKAB 4QBHA 3FMFA 2C77A 4Z1MD 5HTKA 1H8EA 4G1UC 3V4RA 4JLAA 5LD2C 1IQPA 4HUTA 1T0JB 2VSFA 4MYHA 4ZDJA 2ZRMA 2XJ9A 3D3QA 4W5JA 2FF7A 2VHJA 2V1UA 3K0FB 4URWR 1YRAA 3LDAA 4EFLA 3NBXX 4AI6A 1TAGA 1JAIA 3N70A 3ZJYA 2ZI4A 2A30A 5L3RA 2ZTSA 1KKMA 3QQ5A 4QXAA 1MV5A 2YYZA 2AN9A 5EXXA 5LDDC 1W36B 1LV7A 1N6NA 4MUAA 3QF4A 4YC7A 4M8NE 2OLKA 5HZHA 1JEDA 4FWTA 1OXVA 3K0EA 1WMSA 1M34E 3F5FA 4PPNA 1R0WA 1E9SA 2L0XA 1NLZA 4E09A 4B6FA 3LXRA 1E79D 3SQWA 1XXHA 3SDZA 2FDCA 3EPJA 1GL7A 1LFDB 3TUZC 3X1DA 4B3DA 4Q9JA 3PJRA 5KDDA 2C2HA 1OIVA 3AF0A 3E5HA 3GLIA 1NN3A 4KCGA 3QI2A 1DAGA 2REXB 3FKSD 3CR7A 1Q44A 1R5NA 3L0PA 3MCAA 3R9XA 1JI0A 3OEEA 2XZOA 4K46A 2Q3HA 3CNLA 3PIRA 4QJ4A 1KAGA 1RW4A 3KTAA 4OQXA 1NJFA 1CJVC 1RRCA 1OHHA 1KI1A 1G18A 4YMTA 5DIFA 1NN0A 2FZ4A 4GZMA 4IOKA 1XTQA 2OM2A 4QM6A 5GJVC 5FPSA 1NG1A 3IHWA 1OJLA 3QIAA 1KDOA 4F38A 1OXTA 4HB0A 1XD8A 4YDHB 1DOAA 4KAXA 1I4LD 1QRAA 4EUNA 3R9WA 3GCGA 1G20E 2ZI5A 4FCTA 1NSTA 3THYB 2HXYA 4M9QA 2F1IA 1UEJA 2GXQA 1XD2B 5DE3A 1LTQA 1D2EA 4A6XA 1YR7A 2R6GA 2OLJA 5FFMA 5JBQA 2FNAA 1QF9A 2RKOA 4JMPA 1JNYA 4MITA 3CPHA 3PEWA 4WAUA 2B21A 2IUUA 3U7GA 5BQ5A 2HXSA 1NBMA 4PAMA 1TQ4A 5CDFE 1QBKC 2C98A 1K8RA 2XX3A 2Z4RA 4G3XA 5L3SA 2V55B 2FPLA 2PMDA 5FOTA 3C14C 3EC1A 3FHOA 3AVVA 4F92B 1E69A 1KNXA 5DHFA 4DWJA 5EZ6B 5EJEA 4L9WA 4TZ0A 4PR0A 1HUQA 2WMOB 4Q1EA 4XSGA 3SHWA 5JS8A 3IIKA 2EVWX 3KFXA 2CJWB 5IRCD 1ZNZA 2IYQA 2IF0A 2JA1A 4IVQA 3S1AA 4MGYR 2IBMA 1XF9A 2UKDA 3T1QA 5EP3A 5J4VA 3BOSA 3WNDA 3K70C 2GCPA 2D3WA 4RJLA 4PHGA 2FU5C 3BC1A 2V7QA 3M1IA 2RGNA 2IL1A 4R2HA 3GPLA 1E96A 1UKYA 2AK2A 5KSOA 5KDLA 1XXHE 4MKFA 2ERYA 1GZSA 3U61B 1EWQA 2ZRBA 3Q8XB 1CRQA 2WMNB 3QKSA 1GITA 4LI0A 4Q18A 1N5KA 1VIAA 4OQLA 1KO1A 3GLIE 1DTSA 4BFUA 1SVWA 1ZD8A 1KMQA 1TEVA 2XB2A 2BVNA 4Q47A 2AHOA 3K8YA 3FDIA 2JLVA 4ON9A 4A2PA 3AF1A 2GBLC 5BYKA 1G3UA 3FYHA 3TIFA 3CPJB 1XMVA 5DN6A 1RE0A 5KPJA 1Q1ZA 1OFTA 1CTQA 1GP2A 2NO6A 3QOFA 1ZYUA 2OE2A 1AA9A 3H84A 4M1OA 3GJ0A 1EGAA 4C4PA 5B30A 3GJ3A 2VP4A 3WYGA 1G7CA 4ZCLA 4JBYA 3QPWA 4FD2A 4BLSA 1ANKA 4D0LB 1MRNA 4RZ3A 3T12A 4ASUD 1Z0IA 3I3SR 4TWZA 3LH5A 4OBEA 4TN1A 4DJTA 4L16A 2BM1A 1R0XA 2ODEA 1G3MA 1P62B 4A0GA 1R10A 2BMFA 4MUBA 3JZMA 1EFRD 4F4JA 3B1VA 1G8YA 1N6OA 2FSHA 3TLXA 3EZ6A 2BIFA 3PXGA 1QHHA 4BGDA 5LD2B 4M1KA 1E99A 1N5JA 3VKWA 2ONJA 4Q03A 5KNCA 3U4QA 4AK9A 1P9RA 4WA7A 2WM9B 1F3OA 4NU0A 1JPNA 1S1CA 1G291 2UZ3A 3AP1A 1P2TA 4HAXA 2VSXA 2HT1A 4WZ6A 1KI8A 3W8NA 4YMWA 1O3YA 1M1YE 4TL6A 3W3ZB 3NWJA 3ETLA 3EZFA 1LNZA 4UKDA 3RHFA 2WWHA 2H17A 1ZU4A 2BKUA 3ADBA 1XNJA 1H65A 2R65A 1XZPA 2XXAB 2PLRA 4CT5A 1AKEA 2JCSA 4TSFA 1MRSA 4KITB 3UPUA 3TNFA 3BH0A 4QGAA 1ZVQA 5CLQA 1M6NA 3A1UA 1ZC3A 1DAHA 3NTUA 4QFMA 4RCYA 2JLUA 1JB1A 1RJ9B 1KO5A 4DLRA 2H92A 3BXZA 2J46A 1G6HA 3LVRE 4N0EA 2ZS7A 3PUYA 1EWRA 2UZIR 4KVAA 1KIMA 4JVNA 3EAQA 4JVMA 2EFGA 4UNRA 2FGKA 5SZIA 1NVVR 1HQCA 2QENA 2GEVA 1XMJA 4OL0A 2I1VB 2BBSA 3TBKA 2YHSA 3WRYC 1IXSB 1GUAA 1SZPA 1J90A 3QXHA 4X8OA 5HKKA 1QDEA 4D4JA 4M9ZA 221PA 5CK5A 4TMTA 2FSFA 1IOZA 1KSJA 4PC2A 4AIIA 1IM2A 2AFIE 2GJAA 2MSCB 2REOA 3CRMA 4AURA 2D74A 4UXHA 1UBCA 4IDNA 5DI9A 1D8TA 3V00A 2OFWA 1AS0A 3HU1A 1CR1A 1T3LA 4Q66C 2HJVA 2W0SA 1SVKA 3GLFB 1N6RA 3Q5EA 4DRZA 1H8HA 4B2IA 1XCMA 4DDVA 4F4IA 5M04A 1BYIA 2ZIAA 1Z0DA 3KXKA 4XTRA 4LUCA 2WV9A 1QVAA 1V5WA 2HCBA 3FGNA 4GP6A 4DLVA 4LBWA 1COWA 4LGMA 1YQTA 5DYIA 2P0EA 4B32A 1N5IA 2LKCA 4V0KA 4CW7A 1E2PA 2ZS9A 4IHQA 4UNSA 3AF3A 5JMTA 1W4BA 2ZJOA 3K0SA 3LW8A 4P0TA 3ZZTA 5BW8A 1XJ0A 3WBKA 2E1RA 5JZVA 2C03A 2W83A 2B7CA 4DHEA 1G8PA 5CYOA 4M21A 4MA4A 1W46A 2NGRA 1VCMA 1N2CE 1W47A 4JL8A 2HF9A 1F48A 2IUTA 4US2R 2RCNA 1A1VA 3K70B 1E3MA 5DI3B 5IK2A 1IN8A 1II0A 3AKCA 4NYJQ 4JLMA 4JT4A 4P4UA 4C0JA 1UM8A 4A6PA 5AJYA 1QG4A 4HAUA 2OFOA 3NXSA 1WB9A 4TLBA 2OT3B 3FVQA 4US0R 1B23P 2BMEA 3TUIC 2N1BA 3TK1A 3P1JA 4N3NA 1SXJC 2EFHB 1UDXA 5EQTA 3O8CA 2JLXA 2QTFA 1NSFA 2ZRKA 2V6IA 4B3BA 4TLEA 1K5GA 4S2EA 3ICQB 1CF4A 1EFTA 4KBFA 2OCPA 2V4ZA 4IOJA 5KSYA 1E4VA 1TQ6A 1E1RA 2O8FB 4Q4AA 1E2IA 2XNDA 3QSYA 2WSMA 1IAQA 3THXA 4LJ8A 4HB3A 4IOLA 3KZ1E 2QSYA 3VR2A 3QVUA 1E9DA 2QP9X 3L82B 3RLFA 4CGZA 3RNLA 4NPHA 1WCV1 3GEEA 4LJ6A 3SBEA 3OF5A 2QM8A 4LC1A 1T3HA 3VHLB 2FSGA 2OCBA 5FOWA 1XFAA 4DLYA 4A92A 2YZ2A 4Z1MA 1N6HA 4URUR 2F9MA 2Z43A 2GJKA 2GZDA 3GP8A 1Q1BA 3R9IA 1NIPA 2V6JA 4UJ3A 2GETA 1G7TA 2E9SA 2BJVA 2FWRA 4MQBA 3UMSA 4C0LA 4DSUA 3VX4A 3LLMA 4JLPA 3QY0A 1N25A 4OI2A 4DDWA 2O8DB 2PX3A 1FQKA 2ZPTX 1I4TD 4A1FA 5J5CA 5JLJA 2ZR0A 4ESVA 3B5JA 1E9FA 2C78A 2O52A 4RD2A 4CDGA 5KNDA 1Z6XA 2DFNA 4CEHB 3RANA 1PLKA 3FFBA 3VR4A 2W58A 4ZIRB 1R0YA 1AS3A 2WWIA 3EA0A 3VNUA 3VX3A 4CRWB 1EX7A 5EE3A 2Q9AA 1RYHA 3GJ4A 4L15A 2B6HA 4HEJA 1KI7A 3PQCA 4QHTA 4UNNA 4WW0A 1CS4C 2R2AA 3I32A 2Q3MA 2FEOA 3HR8A 1E79A 1E2QA 4Q7JB 5FTNA 1EX6A 2OV2A 3C5HA 1OF1A 3L8YA 2PL3A 3A1WA 2GXSA 4IEIA 5DSZA 3TSZA 1SVLA 2CHVA 1BYUA 4RSGA 1OW3B 1MABB 5FL7A 1S96A 4GOKA 3FKSA 3HR7A 1E9EA 1SVOA 2QTVB 1DG3A 2C9OA 2F1HA 4HLUA 3IHLA 4PTLA 2EWVA 2ZRPA 4JBXA 2WICA 2ZREA 3DOEA 3K1JA 3ZZUA 5F2EA 4EJSA 3IIMA 1EESA 4GRAA 4V0ME 3QF7A 5K8UA 2W6JA 2RHMA 2R44A 3R8CA 3TR5A 2NZJA 2ZJ8A 1W0JA 3CUEF 3QNUA 4S35A 4Y0VA 4MYCA 1KGDA 1VHTA 2C95A 2CCJA 1SVMA 5JJKA 4AD8A 3GLGA 1SQ5A 2BOVA 4KJZA 2R6AA 4GMDA 2QMEA 4Q7LA 2OHFA 2QMUA 4JS0A 4OK6A 2QA5A 3QG5A 1IXRC 5CJ2A 4M1WA 3CRRA 2JLSA 8OHMA 3VKHA 5FPTA 3IPXA 3DPUA 2FPKA 1HYQA 3DVLA 4ZPXA 1TX4B 3LXXA 5KDOA 3DMNA 2E87A 4Y0AA 3VNVA 3EZ9A 5JWRA 1VMAA 3RRYA 2CK3A 4AKIA 2CVHA 2LCFA 1CULC 2PH1A 4DSNA 1YZGA 3OEHA 1S8FA 4RD3A 4UNPA 5BXQC 1E2JA 1Z0FA 2PJZA 2R6FA 4DLWA 3EX7C 3K0CC 5JJIA 4TL7A 3RVBA 5BWMA 3NG1A 4PC6A 1J2JA 3THWB 1U0HC 2BBOA 4XJXA 4YMVA 1JXMA 4URZR 2JLYA 3IQWA 4A8JA 2IYRA 5B57C 1NP6A 2X2FA 1CR4A 1I2DA 5DNYB 1NMZA 1VPLA 1Z07A 3PFIA 4M2LA 4TYYA 1C1YA 1US8A 2FOLA 2GF9A 3T5GA 2ODNA 2AK3A 4R9UC 4B33A 3VR6A 1VYUA 1ZUIA 2F3TA 2EYUA 3OIUA 4XIGS 5C4MA 3K70D 3A4MA 4PSKA 3RRZA 3PUWA 2YOHA 2JASA 3QENA 1E1QD 4MRVA 3THOA 2EU8A 2WIBA 4IDQA 1KMHA 3HJNA 5TV2A 1OXUA 1SHKA 1T0HB 2F6RA 1T5IA 3CKLA 3E70C 3QBVA 4I1SA 2FZLA 4JL5A 4RKEA 1NF3A 1CJKC 1R7RA 1XMSA 1MR3F 2YWHA 3KJHA 1E2MA 1NVWQ 4OKSA 4TYQA 5AK0A 4Q4LA 4Z51A 5FTMA 3I61A 1SXJB 1ZINA 3RSLA 3GFOA 4LBVA 2QAGA 2OXRA 1Z6YA 2QMOA 3SBDA 2VTKA 4KYIB 5ELXA 2QBYA 3U3JA 4JLVA 4OQMA 5LPNA 2N46A 4D26A 1E2FA 4U00A 3LD9A 2ZSFA 2PZEA 1E2LA 3U3OA 3B1YA 5BN3A 4MDFA 4IFBA 5FOUA 3KXIA 4CF7A 4LCBA 4QBFA 5D3QA 3A1VA 2ECKA 2RGCA 1S4QA 3KL4A 3SEAA 3EPKA 1GKYA 4N0DA 5JI3E 4M1SA 4OJQA 2ZUBA 1T8UA 4DEYA 5JFGA 1PVOA 2I1QA 1DADA 2GEUA 1U8ZA 4U5XA 5D3MB 1AKYA 3CPEA 2KBEA 3ND8A 2PMKA 1YZKA 2ZS8A 3A1TA 1DEKA 3CX8A 4HZIA 4CEIA 1G4AE 5FBQB 2WAYA 3U6BA 3HPRA 4MYTA 3WP0A 3BIFA 4GMXA 2BBWA 1DAKA 2DWOA 1CR2A 4CYMA 1ONBA 2DWQA 3IBGA 4P4SA 4YDSA 1XB2A 3Q5DA 3SS8A 3X1WA 1U94A 3K0FA 1OSNA 1F60A 2J3EA 4RD0A 2XOKD 1IBRA 3RWMB 3D7MA 1LS1A 4F91B 5GADl 3IGFA 2XJ4A 1E32A 3HP1A 4NL4H 2JLZA 3K09A 2G0NA 3AVOA 2J1LA 3O8DA 1MOZA 4QHYA 5FPYA 5H8WA 1TTTA 2NO1A 2W00A 4Q4JB 4C7OA 5A4JA 1T6NA 1KZGB 1LW7A 1E2GA 1G64A 4BRWA 1XTIA 1P4SA 5E4FA 4FMCB 4RD1A 2ZRJA 1NMYA 2HLDA 4P32A 4N1AA 5ANRB 3UG7A 4IVRA 1SKQA 1TPZA 4HLCA 3DMDA 1YKSA 4EQ6B 3G82C 3OAAD 4Z8XA 2JGNA 4UQOA 3AKEA 2XSZA 4RFSB 4M1MA 3PITA 4IRUB 2Y8EA 1HE1C 1Z28A 3WXMA 3KUCA 3WYFA 2DFKB 3ZYCA 2KJQA 1IY1A 3REGA 3GLHB 1NNEA 4TZ6A 4B35A 3HYTA 3WHKA 3L0OA 3D31A 4JYCA 2CLSA 4NP6A 4MKIA 1L2TA 2B7BA 3EIQA 4EPXA 1JR3A 4DDTA 3SYNA 4G01B 2WPDA 1I4DD 2ZI6A 4NYIR 5DO9A 1D9ZA 5BN4A 2O8BB 5CDFA 4PFSA 1FX0B 1RRGA 4MRSA 3CZPA 4A9AA 4NCNA 2IW3A 3ZS9A 1K6MA 1M7HA 1JPJA 1KK2A 1EFHA 5E95A 3THYA 1FMLA 2D62A 4EPRA 4BASA 1Z83A 1XD2A 1W4CA 3CX6A 5B58C 1VYVA 4XWAA 2WWFA 3GLHE 1OPXA 2EQBA 3B1XA 3TSOA 2ZQ5A 2PZGA 4WIAA 1M74A 1GL9B 4M9XA 4BLRA 3CF6R 1KOFA 1N6LA 1ZM4A 4V0LA 5FBRB 2ZUDA 2O8CB 4OHWA 1G16A 1PZNA 3CB4A 4M1YA 3AGQA 3B82A 621PA 1TF2A 1ZCBA 4D0GA 3SU8A 2AD1A 4PQYA 5KSPA 4DUGD 4LX0A 3T1OA 1OYYA 3TQCA 3IIJA 4BRUA 1AQUA 2YOFA 2CJWA 3CWZA 5CK4A 4XD7D 4B73A 4QNRA 1A4RA 3KKOA 1N6KA 1MO4A 4PHTA 5DHAA 3AQ4A 3W6OA 4ACBA 1SVSA 4CEJA 1FTNA 1X8LA 2GWHA 3U5ZB 5F98A 1ZW6A 2BMJA 3MD0A 3ADCA 4URYR 4DKXA 3EPLA 3I5XA 2ZI7A 3W3AA 4LV5B 4BFSA 5CITA 2BKEA 2G77B 2ORVA 4TYPA 1OYWA 1ZNYA 2QPTA 3LA6A 5L3QB 1CEEA 4F4CA 3TE6A 5JHHB 4EKDA 4PO8A 4U7DA 3WNCA 1UDWA 2VHUA 3TVTA 4IDHA 5JWHA 3EASA 1TNDA 4AKHA 5TY0A 2WTUA 1Z47A 1ZM2A 2HJGA 4LHWA 3PG5A 3QXCA 5FI0B 3TVDA 3CM0A 4ZKDA 2QE7A 1YR8A 3DKVA 3B1WA 5JCPA 1SXJD 4A4DA 3UMFA 4KFRA 1E2DA 3LX5A 3U7HB 1VG8A 2QUZA 2ZYWX 2GCOB 3EZ7A 1JR3E 1JECA 1KDTA 2W2VA 2BCGY 4C0QC 2J5XA 2QPOA 1OV4A 2JJ1D 3OE7A 4B3FX 2PEZA 3K0AB 3TAHA 5CJPA 2ONKA 4ZO4A 2F1JA 2DFTA 4PAQA 4NYMQ 2ZROA 4OK5A 4RD4A 4US1R 3FTQA 1M7GA 1NJGA 1Z29A 2IXGA 4UJ5A 2BEKA 2YV5A 3IO3A 2J0UA 4DCNA 3CF2A 1KDPA 4PPGA 3FOZA 1R8SA 3NC0C 3VU9B 3GJXC 5JI2E 1IJEA 2I3BA 1E2EA 4ZI3A 1XP8A 4EAQA 2IYZA 4QKQA 1N6PA 3CRVA 3KFVA 2WSSA 3QEOA 1BKDR 3DDCA 5FBWB 4DT1B 2QZ4A 2RGEA 4KBGA 4JJKA 4JSTA 3QKRB 1YZTA 1YE8A 5EP2A 1AZTA 5CB6A 4AY2A 3AV0B 4LPKA 2XXAA 1RPZA 2GTPA 1Z2CA 1DO2A 2QT1A 2Z83A 4C0BA 3L0SA 2C5LA 5FR1A 3EA5A 3ZD6A 2QORA 2P3SA 2WZQA 1R4AA 1RJ9A 3HPQA 1FP7A 2PEYA 3KTAB 5FR2A 2FN4A 1KJYA 1ZBDA 4LYJA 2IWHA 1XJQA 3W9YA 1U9IC 2DWPA 2D7DA 2OAP1 2FG5A 2BEJA 3ASYA 1S0UA 2IYWA 3AVQA 3OESA 4JLBA 4BEBA 5KHOC 2VO1A 3ZS8A 1W48A 3SJCA 1UEIA 4P33A 1VIYA 4PHHA 1MO6A 3DZDA 1OH8A 3IO5A 3MWKA 1FP6A 4O2LA 3GQBA 4E03A 2XTMA 4GOXA 1P75A 1LF5A 1M2OB 2ZUCA 1FMJA 3KB1A 5G41A 2YNMA 1JR6A 4KI0A 1U0LA 2FH5B 2CMKA 2XITA 2W6IA 5C1BA 3U44A 1NVUQ 4GBMA 3UMRA 3I5YA 4RZXA 1Z22A 1OT3A 4XVRA 2GEDA 2WKPA 2OILA 2F9LA 3CONA 3PVSA 5CM9C 3WMFA 4E5UA 3U2QA 1OH6A 3LBIA 4EPVA 1L4UA 2IYTA 3AB3A 4KU4A 1VCIA 4MH0R 3I62A 2VL7A 3X2SA 1IXZA 1GTVA 1P5ZB 4EFMA 2QL6A 2VF7A 3GLFA 3PV0A 5FTJA 4QBGB 1G5PA 1YU9A 2QY9A 2O0KA 4QGGA 3PR1A 2YJTD 1NMXA 1D2MA 4ZI2A 5L8VA 1U0JA 4BFTA 4LJ5A 2H1LA 4P31A 4BFZA 4F7WA 3K9GA 3K9HA 1AZSC 5GJCA 5E7IA 5FUYA 4UXIA 2EFCB 4Z8YA 3HYRA 4KV9A 4TT3A 4QJ3A 3LWNA 2ATXA 3OHMA 1NLYA 4RD6A 5CLLA 2GA8A 4GFDA 1JJ7A 5TARA 1C4OA 3EIHA 3D6TB 1VCOA 3B7GA 3BRWD 3NHAA 4V03A 5FH9A 2ORWA 2GZHA 3Q72A 4JL6A 3ZIAA 1OB5A 3T15A 4O25A 4B71A 1KHTA 2WWWA 1WBDA 3QKSB 4MRRA 4OHVA 2D4HA 2HUPA 4QJ5A 3IEUA 4PQRA 1DO0A 1MT0A 5E7JA 3G5UA 4HZUB 4OYHA 4AWXA 4JLJA 1T4GA 3O47A 2HF8A 2V54A 4NTZA 3IUYA 1T9HA 5FL3A 1TU4A 2JJ2D 2BHRA 2JDIA 4LBYA 2QU8A 4KYUA 2H16A 3W6PA 4CZ2A 1JEEA 1OB2A 5F9FA 4LYFA 1L7VC 2NPFA 2R8RA 1P73A 2EFEB 3EW9A 1BMFA 4XVQA 1W2GA 4Q5IA 3ZGXA 2JIZD 4M0LA 1XEFA 2J7PA 2YWEA 2QQ0A 4CIDA 3RWOA 2QP4A 1XCPA 2O8FA 2XEXA 4FINA 2GBLA 3NH9A 3FMPB 3R8FA 1YR6A 5AJWA 4C2TA 3OFND 3P4YA 1GIAA 4A0HA 2FMXA 2C04A 3KUDA 4TLDA 4NDZA 4O2RA 3KQNA 3U7FB 1L4YA 2OXCA 3R7WB 2HDNB 5B64A 1H8ED 1ZD9A 2F1RA 1BOFA 3I92A 2G88A 4YXWA 3TJZA 3NHBA 1KSFX 5CIWA 1NIJA 3AVPA 4RVCA 1OKKA 3BAFA 1GWNA 3GLFE 2WJJA 1G17A 2ZJ5A 2P2LA 4TL8A 4DXAA 3I8SA 4L5BA 4C2UA 3G0HA 4JJZA 3EARA 3TMKA 3UXMA 721PA 2QM7A 5A0FA 2ERXA 2F3RA 1VDZA 1A2BA 2QG6A 2O8DA 2QAJA 2NIPA 2ZE6A 4Q9KA 1ZP6A 5FPHA 3W8RA 4QHSA 5JSZB 4IJMA 4M53A 3NDBB 4CEHA 1AIPA 1XEXB 3DOFA 2J0QA 1P61B 4KSCA 3T5DA 2DHRA 5IDVA 5C18A 2ODBA 2G1KA 2Z4SA 1VG1A 1JJVA 2IK8A 4RFVA 3LAWA 3LFUA 4HLUC 4V0MA 5H68A 2KSQA 4XH9B 3LNCA 3MLEA 2QI9C 2ZJ2A 1AM4D 2VH5R 5B2ZA 4EFNA 4DLZA 5JHGB 1WF3A 2K5UA 3B9QA 2C8VA 2G3YA 1SKYB 3O8RA 1Z08A 4ZDKA 521PA 2PT5A 4W7SA 1ZMXA 4AKGA 1S2MA 5EE1A 4XWOA 1IJFA 2IXFA 2NO7A 4LPSA 1XTJA 4RZ2A 4IVPA 4Q1BA 1OIWA 2KBFA 121PA 5J4LA 3KKPA 2VA8A 4C0HA 2QPAA 2QQEA 3FHTA 4BFWA 4KFSA 3BGWA 3NVAA 4KLNA 5CM8B 4ZCIA 1YZQA 4KO8A 2ZXUA 3NDPA 1UKZA 1G7RA 1Z6GA 1Z3IX 2WIAA 4Q02A 4QOSA 1VG0B 4QRHA 3RSOA 4IOMA 1SKYE 2ZJYA 5HE8A 2KB0A 1Q3TA 1TL7C 4HDQB 4HYYA 2CE2X 4TLCA 4URVR 4BWYA 4TQAA 2GVDC 3TH5A 5CB8A 4HATA 4HLDA 1D9XA 4HAYA 3RC8A 2CCKA 3KKMA 1E2NA 1NBMD 1E6CA 2ZVQX 4FIDA 1XBTA 1WP9A 5KOYA 2BM0A 2FFBA 3AKYA 3U60B 4NH0A 1J8YF 1HT2E 4DSOA 3IQXA 2AKYA 3CH4B 3AVTA 1DARA 1G1MA 2W2TA 4WZBE 1P2SA 1U81A 1QHYA 2QN6A 2IT1A 2WJVA 1S9DA 3RABA 3GJ5A 4O0MA 3RRNA 3BE4A 1CR0A 3C15C 1PJRA 3E1SA 5TMPA 1P72A 3THWA 1XPOA 4HDOB 1QG2A 2DCUA 2YC2C 1KJWA 5DLQC 3AVXA 3RAPR 3GEHA 2ODWA 4BLTA 4A15A 3UK6A 1MH1A 2V7QD 1NI3A 2X8AA 1D2NA 4M4SA 3REFA 4W9MC 5HCNA 4RCZA 2GVZC 2C96A 4D82A 1W4AA 4NMMA 2OFXA 4BLQA 3FFAA 2XAUA 2ZAOA 2ZR7A 5DGXA 4BUJA 1P2UA 2FFAA 2RAPA 5EUQB 1NVXQ 2ZRAA 5JS7A 3VHXA 1ETUA 3ND9A 3I73A 1TEXA 5JJLA 4ILEA 4B44A 1GRRA 3NBZC 5A5GA 3D8BA 2FFHA 4M9SA 2WBLC 4E07A 2MSEB 4FMDB 1JALA 1W2HA 5TXGA 2JAQA 2QROA 1RYFA 2IYYA 3VFDA 2OESA 4YQFA 4JYBA 4HUQB 1DAFA 2NG1A 4XTCS 4ZDWA 1WDTA 1G3RA 3J81k 4OQFA 5EXSA 3CO5A 3SNHA 3M0EA 4JIMA 1UJ2A 2IC5A 4QGFA 2Q3FA 5FTLA 1XWIA 4ZCMA 4LOAA 2B8TA 3QJYA 2ZRHA 1Q57A 1E2HA 3BB4A 4KVGA 3VQTA 1G8HA 4K8OA 4C0SA 4KSBA 3B6EA 4J0QA 3TW8B 4ESHA 5BYJA 1DELA 2BV3A 2OBMA 2VHTA 4BLPA 1GKUB 3PENA 1DAMA 1VCNA 5H1YA 4B75A 3IDQA 2PJRA 5JEDA 2CDNA 1M8PA 4ZV4A 4QG7A 3VKGA 4P4TA 3U3MA 1WQ1R 4HAZA 3RC3A 1YR9A 3C41J 1DE0A 1KSGA 1WXQA 2GF0A 3NBYC 4BFXA 3QPUA 3EG5A 2CLCX 3H4MA 4DDUA 1P60A
chains in the Genus database with same CATH superfamily
4ARZB 3AL2A 4FQ8A 4ZV7A 3HSSA 1RM4A 1UBSB 2E4VA 1ZK3A 2JD0A 2WF9A 3TDKA 2CV2A 1C9YA 4C9BA 2OUIA 1TZCA 1Z2AA 2YMQA 4UVGA 2AZMA 4G23A 4IJ5A 4OHOA 4TSFD 3SC3A 1EU1A 2EKLA 2C4TA 3VM6A 1MN6A 3WGLA 1IOLA 2C42A 3URMA 1Z5ZA 4RQTA 4RAQA 1F8FA 1XNHA 1D5CA 1GR0A 4EKEA 4EL5A 4PGFA 2ZYHA 5AK6A 3UFBA 2JG3A 3RYTC 5EHNA 4JXZA 3Q6NA 1U7TA 2XDAA 2WFLB 2H65A 4FWBA 4JX9A 3L6RA 4LRSB 4YT5A 1IN5A 1BTOA 1HXHA 2FJPA 2HSZA 4DL9A 1XRRA 3JATB 2ZYTX 2A57A 2F43A 3MELA 3COWA 1ECLA 1F8XA 4D8TA 1MIOB 4DSAA 4QT4A 3EQ6A 1QVZA 3VJKA 1N7GA 3MJRA 2VDVE 5DBEX 5EE5B 2IW1A 1LKZA 2ZSBA 2BTQA 1E0DA 3ZEIA 1T9CA 2FN3A 3WHLA 3HKBB 4FDLA 4L4ZA 3EFOB 3WB1A 4DCSA 2BMDA 1O95A 1QH0A 4X62B 3HXTA 4U1RA 1H6AA 4JB0A 3ZTWA 3L6DA 1W7AA 1SHTX 5JJ5A 1FMFA 1MX5A 4R9SA 4FFDA 1I7PA 1O6FA 1YGPA 1UBGA 3AR7A 2DPHA 1JJAA 2HJ9A 3GLHA 3C4JA 2XMPA 4J0HA 5ICMA 4OFWA 4OMCA 1QPZA 1V16B 4PO1A 4UVEA 4AN0A 1FZQA 1V96A 3PGXA 3SK0A 4BGVA 1K75A 1JHZA 3RUHA 4JHXA 3RQIA 3QVJA 3WFZA 3PQ3A 2PDAA 4UAGA 5T8KA 4X64B 2RHHA 3RVRA 2G67A 3JQ8B 1D0SA 1EFRA 3A58B 4F5ZA 1K88A 4MUGA 4MW0A 1T29A 1AGXA 3BJZA 1I6KA 2Z5LA 3IMFA 4R6XA 4RTPA 1CV2A 4X84A 2Z8ZA 2CL7X 3N9IA 2Q3BA 4AO7A 4Q01A 2WI8A 2NVWA 5H4GA 2ZT7A 4C05A 2FW1A 5A5EA 4ZV9A 4GHWA 4I4IA 4OB7A 4Y2HA 1BS2A 4EY7A 1FXWF 3D0QA 4FFMA 2BUAA 5TQ2B 2X6RA 4AF6A 2HQ1A 3EGXB 2PX0A 3D7NA 2H7XA 3PTAA 5GY7A 1NC1A 1OFGA 2F64A 5A02A 5KYKA 1WABA 4RY2A 4D9CA 3JVUA 1YU6A 4XI9A 1AT1A 2C94A 5KNBD 1SOWA 1LF0A 2BLNA 3CZ4A 3SJ7A 2IA5A 3AT1A 5DCYA 1UAGA 2CLDX 3HM2A 1SRRA 4E5DA 4FS3A 5K1ZA 3OOHA 3GEIA 5IAJA 5CEFA 1ZK4A 2BEWA 1TU0A 1JXAA 3JR3A 2OG1A 2CXHA 1BMDA 3CZMA 4LXYA 3RFTA 4XIYA 2B7LA 2MMGA 3CNOA 5LLTA 1GPAA 2ZPAA 4L4YA 2I3GA 3WLSA 4ZEVA 1KI3A 3EVCA 1PW7A 2IYNA 4P81A 4Y6QA 1GILA 5CFLA 1R4NB 4TUYA 1L4LA 4TRJA 2H9AA 2XD4A 3ROZA 4BNGA 4HT3B 5EWMA 5GONA 2ZG6A 4ZMRA 4D0NA 1UBEA 3IBYA 4PWZA 5IWAB 3VSDA 4DR2B 3RADC 2Q49A 3HCCA 3CLVA 3QVVA 1C30A 2XUDA 4MTLA 4RO0A 1KK3A 4RTLA 1P1JA 4XSVA 2QMHA 4GNKA 4RY9A 1BQEA 1UINA 3FROA 3K53A 3UK7A 1PUXA 3BN3A 3RKUA 4Y6RA 5HUQA 2AC7A 3D6FA 5CFRA 3AG5A 3V4VB 3WL8A 2A5LA 3AKDA 4M87A 1ZFNA 5A6SA 1P1FA 1FJHA 4F1KA 5CTAA 5FNVF 5GVRA 4B7ZA 1QB7A 2OG2A 1ZEJA 3QBTA 3U31A 2JRCA 4M0FA 3JRWA 4F45A 3TQSA 3BXHA 1B0UA 5JMOA 5GZ6A 3LECA 3MTBA 4YRLA 5ILQA 3A9UA 5C8VA 5F23A 1U63A 1Z2NX 2ODPA 3ISTA 4KE8A 1Z73A 5K0ZA 4A2WA 3P2KA 3U3RA 3X43A 4PTZA 5C1OA 2H63A 1SOVA 2IHTA 5T4FA 3F4KA 5AOCA 5DM2A 1WUHS 1XTSA 1HG0A 1XZCA 2ZVDA 4XKJA 5DX0A 1WSAA 1YC2A 1HETA 1XPJA 1CWUA 3TEJA 1NN5A 1NYLA 3TQQA 3DE0X 4KTVE 1VHWA 4RPIA 3KJZA 1RI1A 4GP7A 3SGLA 2LW7A 1VXOA 4FFBB 3TOVA 3FOEC 1H4TA 2GM3A 5C52B 2ZRGA 5C2JB 4CEIB 1T10A 3ELWA 1K86A 1PZHA 4YJHB 5BMVF 3TD6A 1A5SB 1Y3FE 1IRXA 3K0AA 1R6AA 3L02A 3FWNA 3VPCA 1NR5A 3TG2A 3W9SA 4GI2A 5A1TA 3KS9A 3S5JA 4RK0A 1UADA 2H59A 2V6BA 4LZAA 2NMVA 4IKEA 1RTTA 2XNJA 3B9PA 4M9UA 2DXIA 4RESA 1G8FA 5DM60 4UDXX 2RGNC 2H11A 5JNVA 2NPIA 3AFNA 4TV8B 3ABZA 1UPTA 4JB8A 2V3CC 1UT5A 3COSA 1ESNA 1JHXA 4DC9A 4C5BA 1WHSA 3T7TA 3EUAA 4DLSA 3U9LA 3BFPA 4CETA 1TADA 5JVDB 1VHQA 2VUHB 2Z6AA 4R9RA 3INGA 2XYPA 5HJ5A 5JU6A 3UMVA 1LVGA 3IL2A 1NVVQ 2JKYA 3CLUC 2CXRA 1O9BA 4ZU6X 4LZPA 4DEXA 3DXZA 4WBNF 5JSHA 4LFBB 821PA 4ROSA 3ITKA 4P2BA 4RHXA 3EQ9A 4QWWA 3I28A 3ZCQA 3UPTA 2AE1A 3QKRA 4NCBA 1AO0A 1HLPA 1SH7A 2Y05A 1QYIA 3VBCA 1FQJA 1RIFA 1ZIOA 1EDOA 3KC2A 4PYOA 4PX2A 4R05A 5F12A 3LQRA 3G79A 3L77A 2HPAA 4ZQGA 4EG3A 2B36A 4BN4A 1KC1A 1TECE 1Z0AA 1PK8A 2R11A 3BK7A 1G6OA 4HNHA 4QTZA 1R6VA 1W93A 4MP8A 3QPVA 4J0EA 4Z9AA 4C07A 2Y1FA 1D6JA 3QU9A 3UWDA 1R4MA 3WG9A 2A0KA 5E1OA 5AW7A 3TL3A 2H7CA 3MAAC 4NARA 5MGNA 2X4GA 2XUZA 5GPBA 4LNUB 2W6ZA 4FCWA 1RSZA 4BZQA 4C0XA 1PJTA 4JGBA 4MKXA 1YE3A 1E0SA 1MENA 1TVEA 1V1MA 3NDIA 5FO1A 1TAUA 1UJNA 1E7SA 5H3HA 3DFKA 3DA8A 1W52X 4RZUA 4E6EA 5M2QA 5J40A 4GL2A 2ZI9A 1WU8A 5EXTA 4UTZA 2OCAA 1QZXA 1LBHA 3QKIA 2WTAA 4D80A 5IABA 4XWTA 3KJXA 1E5TA 4K6MA 1RZRD 1GG5A 4JGIA 1QVRA 2R1TB 1U28C 3OQ1A 4CMJA 3SIWA 5JS6A 3C48A 4R83A 4ZO6A 3KSDO 5AW2A 2N9UA 1GUYA 3DCNA 4K9DA 5KOIA 1JEJA 3CT4A 3E18A 4JBLA 1EWYA 4L5YA 3WXBA 3SLKA 5KYUA 4P5PA 5CU7A 1GSIA 3L79A 4AG5A 2ZYGA 4MI1A 1JBQA 2KQUA 2R97A 3J81A 4I14A 3DTVD 2KW5A 5C8YF 1V3QE 2OMEA 2VNHA 2XF8A 2JW5A 3BWBA 1YL5A 3WWEA 4E2FA 3KWLA 2JIBA 4KQJA 2ZB2A 3DD1A 1LPOA 2B8WA 2F48A 3HDTA 3UF0A 2HBRA 3ACBA 3WGGA 1AGRA 2QT0A 3I4LA 4M0PA 3BIWA 1LY1A 3QEJA 3DE2X 2OC4A 3FDJA 1PHPA 3Q40A 1N34B 2IS1A 4PAWA 4RA9A 4DQXA 5FEUA 3A28A 4K9OA 4ND2A 4ZWNA 2XV1A 3WIUA 5JH7B 2QZ9A 2WYHA 3D6VA 4FFNA 4G5OA 1Q20A 2ZT8A 1Z2EA 3JV7A 5E0OA 3V1TC 1E5XA 2GHIA 2HIHA 4Y2RA 1GA6A 3O1LA 3PNSA 4JBHA 4OO3A 1L1FA 3WLLA 2AC4A 5DTQA 2ZITA 2W2LD 5JAUA 2D7JA 3I2KA 4MUHA 1E60A 4WVFA 3RTAA 1UL1X 2EF1A 2VCYA 3NT2A 3OZFA 1U5AA 4PZPA 3EWAA 4D4KA 4PBSA 3F6YA 4WHMA 3OX2A 2JIPA 3HKDA 1D4ZA 2YIVX 1UMDB 1F9EA 3E53A 4UEWA 3H1TA 2MINB 2OZLB 4C6SA 4UDOA 3C16C 1PL0A 2PZ8A 3X1JA 4WSOA 3DP9A 3W0LB 4ZCTA 4QBIA 3EGIA 1HTTA 5D5HA 3S7TA 3V7UA 4R8MA 1CJBA 4MV4A 2OUKA 4YJDA 5BRJA 3E7WA 2GILA 3DBRA 4JBGA 3TD9A 1MAAA 1D4AA 4YRCA 2OO7A 2EWWA 4E31A 4KC0A 2LNDA 3N07A 5AO9A 1Y8RB 5BUSA 4YVFA 4W1SA 1KJ8A 4ZVRA 3WRXC 3QI7A 3T61A 3UFXB 1QVVA 4Q3NA 5KWEA 4AICA 2YFHA 5AIBA 4F4FA 1NG9A 3DQQA 4IIFA 4K8RB 4R1OA 4REQB 1J20A 1Q21A 2GCNA 4FP9A 1MO3A 4F9TA 1RZUA 3N8NA 2NQ2C 1JNXX 4XR9A 1V5IA 1NXWA 3A11A 4ZREA 1ELOA 5D1NA 5J2UB 3STHA 5DLEA 4B74A 2EHJA 4MW7A 1Z8HA 3HDHA 3K5HA 3LQQA 4QQRA 2G72A 4AJKA 5EAIA 4FFRA 1CNFA 1QH8A 4I1OA 1UMCB 3OF3A 4OAOA 3U56A 2XIJA 4IH9A 3WL7A 3WKBA 1KH3A 2OV4A 4E22A 2J30A 1QFJA 3HFSA 3CSDA 1YI8A 3U9SA 2W4MA 2O3SA 3N0WA 5KVAA 2VWGA 1Z8NA 2WVJA 3DO6A 1SUIA 3KE8A 4PCAA 4WBXC 3DHWC 1RQRA 2CNWD 4JQCA 5GM2A 2G9NA 3PQ7A 1CJSA 1NBME 2HT6A 1CQXA 3O3MB 1YK1A 3A32A 2G04A 4JP5A 4YGXB 5FDFA 3UHOA 3L7DA 3A36A 3KB2A 4HOYA 1L5QA 4M76B 2A0UA 3HI4A 1UBRS 4RHYA 3SD7A 2DR0A 4YRMA 3C70A 1S02A 5G53C 3EVGA 4DQLA 3CG0A 1J2TA 3K5IA 2V6FA 3QBEA 5LC1A 1G66A 1XTKA 1QUFA 2O1WA 4CBVA 2XQKA 1M9NA 3TRJA 4HN9A 3L7NA 2IDJA 2D1SA 5SZHB 4QPDA 1EP9A 4Q9LA 1W44A 5JMWA 4KO1S 3WWPA 2BD0A 1RYDA 2LDBA 5ALJA 3FPGA 1PX2A 3IKVA 5SV2A 1GOTA 3RYIA 1M73E 1PQ4A 3A6GA 3FI9A 3DP7A 3W2HA 5CW2A 2P6UA 1L8LA 2QLLA 1CDDA 2MYNA 1LUAA 2AFIB 2PY6A 2EAUA 4KWIA 3HY4A 1DU4A 1E4YA 4A0QA 4IHJF 3OKAA 4QOEA 2VHXA 1E0AA 3R3UA 4PG8A 3ELYA 1K0FA 1VPDA 2I2CA 1HA3A 1N5LA 1T0UA 1HWYA 1NLFA 2G9QA 3G68A 1YHYA 1M75A 2V9PA 2XSZD 4WACA 3A4LA 3LFTA 1AS2A 1IHUA 1YVEI 1P9OA 2EJVA 3NOXA 3ZVLA 4B2PA 1V7CA 4JT2A 4JQZA 5REQA 2I1LA 1E8NA 3EXEB 2YV4A 3LVQE 1KBQA 1PLJA 1WR8A 4C0HA 3D0KA 4LHXA 3S40A 3DHYA 2RONA 5B1DA 2HW8A 4NOJA 1J2YA 3WNZA 2Z2ZA 4O6VA 2NLOA 1KPGA 1TB4A 1VJ0A 1YB4A 2HPHA 2WLTA 3CTMA 3UATA 4HJXA 4CQJA 1YHNA 2HRZA 1CK4A 5GMOA 1IBMB 1QHGA 1TU3A 5L4SA 4XJSA 2XB6A 3EXHA 1EFCA 1RI4A 1XDBA 3HJUA 1V48A 3O8BA 3PXXA 4FEYA 4MI3A 2XNHA 3FF1A 1UKVY 3THRA 4W1PA 2BZGA 5TDHA 1QHHB 1VJRA 2J07A 4HQFA 1ZK1A 3FZYA 2VDPB 1PS8A 1N2EA 2XKBA 5ARBA 1NRXA 2H2FA 3KDPA 4WZBA 2JLQA 3NKVA 4MPJA 3N3AC 2R8YA 4BNMA 1S2IA 4P80A 4BVBA 1C2TA 3G8DA 5HUHA 1U99A 1JSCA 4RK1A 1AE1A 4IQ8A 2LWIA 1B74A 1IEQA 4OAQA 3EVNA 5HJ2A 3QA3E 1JQJC 2Q6VA 4HS9A 4XDZA 1RRPA 1EK0A 2AHRA 2ZVPX 4I1UA 3WNBA 4C2BA 2FAXA 3MWJA 5AVOA 3F7NA 5HTOA 3AVYA 3RYHA 4EJ0A 2A9KA 2ODQA 5E1DA 5LDGA 2Q62A 4W5WA 4A2QA 2VS1A 1L8OA 3ICEA 4IO0A 1XYVA 2IQ5A 4BMZA 2GK6A 3VYTB 2NU8A 1VECA 2UXCB 4YRPA 1GGEA 4TYNA 3MYYA 4LBZA 1BA3A 1U8XX 4XB2A 4BMSA 2XUQA 4CMKA 3PXAA 2D8AA 4YB8A 3FYUC 2WT9A 1RBZA 4KSYA 1WXXA 4BZXA 5I7WA 1XZEA 4WEOA 2ORIA 3TXXA 3W5AA 3FVTA 5KPDA 3C7TA 1NL3A 2OP0A 3VHRA 5C1DA 5MN6A 2VCEA 4KN9S 3ANMA 1DBVO 2D2EA 4EYQA 4G1MB 1ZRMA 5AKLA 1QH1B 3GUVA 2P0YA 2EW1A 5FTWA 3PHHA 4MZXA 4V2UA 3WRVA 3SHQA 5KVSA 1IZ0A 3LCMA 2XEDA 4MMYB 3SFTA 1HMPA 2WKWA 2WSYB 2I2XB 1VPEA 2X77A 4NZ9A 3SFZA 3EPPA 3A6FA 1RRMA 4TVOA 3WA6A 3NTVA 1SCAA 3DAYA 2W37A 4JWTA 4LHZA 4DLTA 5C8DA 4Z53A 1UT6A 1YDEA 2QRNA 4ZQIA 4PS1A 1GZDA 4XX1A 2YVLA 1NLUA 4P36A 1GGVA 1KIAA 5DW3A 3R76A 3NRCA 3TRFA 3KO8A 4E46A 5JAZA 4P93A 3AILA 2QG4A 3EA4A 2VH1A 3OQMA 2JGJA 3QVSA 3UOWA 2QNRA 4GECA 1SVUA 4QFCA 3D8TA 3HI6A 1NWHA 4Q9NA 1Q5PA 2AFHB 2CVZA 3KCNA 4H2DA 5CPBA 3L9WA 5AJHA 2Y1GA 1R66A 1YZLA 1ZU5A 4I4LA 4U7JA 1BA2A 1MGOA 2WV7A 2ZOSA 3OFJA 1CQZA 1T26A 1PYDA 2RH5A 2QTHA 4A82A 3QP9A 3UMMA 3E8SA 1KZ7B 5KO2A 4Z9FA 3K6JA 1U5BB 1W49A 4F2WA 4DB2A 4CVNA 3QG1A 4TWJA 3B7WA 1AXRA 1HL7A 3OUZA 1EP1B 1RPNA 4GMGA 5G2OA 2H7VA 5JWOA 2I9KA 4LJLA 3GCXA 2IXTA 4RKFA 4D3DA 2DY1A 3HXOA 1AN0A 1KEPA 2XVMA 3NHKA 4P54A 2J3JA 1YQGA 1N8TA 1Z8FA 3JYPA 3KKNA 3ADKA 1IBCA 3BD9A 3KT6A 4D81A 1QHXA 2BP7A 1BJKA 2L69A 2X14A 3MJSA 4F93B 4WBSA 3T7CA 4DY6A 3PTLA 3AR4A 1WZEA 1YCFA 3MTEA 4HLQB 4MWTA 2B92A 4GI3A 1MX9A 2F1OA 2NYRA 1N5MA 4O4IF 4LC0A 1UC5B 2O8NA 3GWZA 1E59A 4H1VA 4INPA 4X65B 3U6KA 4B3SB 1CP2A 4AS3A 3DWGA 5JSYA 3CEPB 3R7BA 4FEGA 3I9MA 4IR7A 3GB9A 3WNQA 2UYCA 2A78A 4H1WA 2B3DA 1IBSA 3JQGA 1TI7A 3H13A 5AW4A 1RIIA 3NQ41 5AI4A 5THQA 4B7UA 4IXTA 5B1SA 3T34A 4DA8A 4D9MA 2YX1A 2RHOA 3OCVA 5AFSA 1TMYA 2IX9A 2R86A 1SBTA 3H3FA 4MS3B 4TLLB 4DJFC 2PPVA 3U4GA 3PCRB 2KE5A 3ZVRA 5ELMA 2IJGX 5JTTA 3A9CA 3T1VA 4ZC8A 4B9EA 5IG2A 3AETA 1CUFA 3O2JA 4HH4A 1V0JA 4HN4B 2PG3A 5MHTA 1ZDMA 4QICA 5K5EA 2R96A 1Z7WA 3ML1A 5IN5A 5DN6D 3THXB 2QE6A 4UPDA 3DEZA 2BMVA 2FZGA 3I83A 4MV5A 3WHIA 3VO9A 3ESCA 4G0UA 5FD8A 3BFKA 3Q7EA 1NVBA 1QYDA 1YQDA 3BEDA 1GG2A 1NOIA 1KERA 2QN9A 5E6SA 4II7A 5EUBA 3VOTA 3MOGA 3ZXIA 1AMNA 3UBTA 2VYQA 3C39A 3QLEA 3N2LA 2YNMD 5J47A 4PG6A 1Y6ZA 2PMCA 3NIBA 3OIYA 5GVSA 4ANFA 4H3SA 1XP5A 3NHJA 1ZVJA 3A25A 4Q1DA 2W6ID 3FPLA 4YQYA 5EQFA 3W8EA 3ZZ1A 3WDLA 2GEBA 3HKEB 3UOGA 4ZYXA 3ZTTA 4CI9A 5DHTA 2XBLA 3T0FA 4NULA 1N32B 3E82A 4G8DA 5CT8A 5DZSA 5HKAA 3KOYA 3ED1A 2JZOA 1NVFA 2ZCUA 1MOPA 2FE4A 3Q7PA 4NKRA 5K2MA 3HYCA 4I55F 4WXHA 2PANA 3FSRA 4MV6A 1NUTA 4QEZA 4BHTA 2VPIA 2WJIA 1K5HA 2B61A 4Q7KA 2FFQA 2RCYA 1ZOIA 4GVPA 4N5HX 3TUJC 4PZ9A 1OE0A 3DBHB 1ZS9A 2V8OA 4Y6GB 4U2KA 1FEZA 1LC0A 1GRNA 3E22A 3GUYA 3KEOA 1CD5A 2AN5A 3GYBA 3VU1A 3MHTA 4GD3Q 1I2CA 5ALQA 1ZK0A 2KWIA 4QBTA 1UDCA 3DO5A 4BBJA 3VVLA 4LJAA 2XGJA 4KXMA 4MQMA 2GZ2A 1SIBE 1EXMA 1RQLA 1YT5A 5B1YA 5DEOA 4TT8A 1G41A 5HF9A 4D6XA 4Y30A 5JAIA 3LKBA 1N1MA 3LPNA 1ZGHA 1UP4A 5CEJA 3GH3A 3KCQA 3SSMA 3WGKA 3BJIC 4HWTA 3LV8A 3ZDRA 4IW3B 3ASUA 2A3RA 2RARA 2NP7A 3N6RA 1U5CA 2GAIA 1BFDA 2VNSA 2PGJA 5AXBA 5C46F 4RIGA 5EINA 3VZCA 4EHFA 1S1MA 3RSCA 3BZUA 3CNNA 3K9WA 3B3JA 4DCUA 1U8YA 1H2EA 1U7PA 1NXQA 4C0KA 3RVSA 4WESB 4YMUA 3MFYA 2Q6IA 4HI0E 3BB1A 4QU0A 1J8DA 1FYXA 4TSRA 3S2IA 1Y3HA 2CXUA 1PRYA 1JDJA 3CEHA 2KX7A 3FVVA 2RGUA 3K6KA 4KLZA 4RSRA 3LUGA 3WYNA 1Z63A 2D1YA 3PUZA 2WF6A 2MTBA 3BQMB 13PKA 5D01A 5KHLB 3TR0A 2PH3A 2CJPA 1KYVA 2UV8A 3TNJA 1JH9A 3CU5A 2ZRNA 3CINA 3EDMA 3MAJA 5HE9A 1ZHOA 1W5FA 2XUKA 2VIIA 3W04A 4WLOA 3HK2A 1W76A 2GNOA 5CVVA 3D8UA 3QXXA 2G4CA 3DFFA 1B0PA 4FEEA 2R7LA 3CLTD 3DV9A 3FBGA 4PQFA 3RHZA 2IVZA 5BV2P 2PRJA 1FNMA 2BONA 4TMZA 1ZKDA 5AVRA 5ALZA 5DYWA 1AO3A 1QDUA 1RYBA 3Q15C 3TD2A 5IEJA 1J33A 1E5DA 3MTQA 1RRKA 3IP3A 3P0EA 4Z7QB 3OMXA 4ZCRA 3KR9A 2VQSA 2B78A 5IH3A 3SZRA 4YV2A 2WQ6A 2AL7A 1Y98A 4YYEA 2ZRDA 4XQEA 2ZYRA 3Q3HA 1MEJA 2NOAA 4BQIA 4PPFA 3GLGE 1EXNA 3A6HA 3OP4A 4Y2YA 3HH8A 2ZZMA 1FUUA 2PD6A 4YO8A 5AHRA 1CY8A 2RGWA 1K4YA 3N2EA 2QSZA 4A0GA 5BQFA 1WRBA 2J3KA 2O8CA 9ABPA 2ZVJA 1W5BA 4NJEB 2ZTHA 1CZLA 1R6DA 1WS6A 3WSVA 1JIQA 5C1PA 3B8EA 3VOBA 2NO0A 1OKKD 1Z45A 1G4UR 2D5IA 4O3FA 2P1RA 4H1UA 2O3TA 2DBRA 2RKBA 3ETGA 4UNQA 3ASZA 3U0VA 1GQYA 3MJCA 2F67A 2HCJB 4B7AA 2OK8A 2A1UB 1JDBB 1XEWY 5I01A 3FTEA 4EPTA 3O92A 4G37A 1J0CA 2FPMA 5KREA 4Z3DA 5EL0A 3TNLA 4FZRA 1RKBA 5D7BA 1D7AA 1TAHA 5G40A 4NZYA 4R1NA 4D2IA 3EWSA 2VNIA 5K3BA 2OHOA 3F97A 3O9MA 3E9NA 2AEEA 4EO7A 1KMHB 1M33A 1VC2A 3D4LA 4ZYVA 1OJ7A 2H1SA 1B41A 3FX2A 1NMQA 4BNFA 1E92A 1G6KA 5LBUA 3ZGVA 1T91A 1B0ZA 4R81A 2NUBA 1CFZA 2JJ2A 3S99A 5G1PA 1BIFA 3VKFA 3U3ZA 2CL0X 2Q6LA 3H86A 3PB3A 5F21A 3CJTA 1F2TB 2DPLA 1B16A 1Z56C 4H6PA 4HSEA 1VLQA 4N0PA 5KQLA 1WW8A 1IY9A 5BN3B 1HYEA 3LF1A 2R4TA 3GGGA 5AVZA 1O94C 1FP4A 3U4MA 4LV6A 4B3GA 2BDTA 4LOHA 4LZOA 4PX9A 3R7AA 4BNKA 3F9RA 3DV2A 1BCRB 3OPYB 2DQ4A 4ZJPA 5ALHA 5AVYA 2ZIUB 1XZLA 3GAAA 3F74A 4TS9A 2ASVA 2VBIA 3OPYI 4W6QA 5FQNA 5HPYB 4YAJA 4K0KB 3RLIA 4YBZA 1P31A 4MX8A 3UWOA 3A6PC 3Q2KA 4JUIA 5TJHA 1CRZA 5JJBA 1AGPA 1XQ9A 2CBXA 1ORWA 3TKAA 1NQXA 1IQPA 3UK1A 2H4JA 1J5PA 2RC6A 5DBGA 2OTCA 3W2TA 4KXXA 5BOSB 1JP7A 3C7CB 1RAIA 2XJ9A 2XPCA 4C4SA 1KQFA 3PC4A 2FF7A 2VHJA 3BE5A 4RTSA 1KF0A 3IAXA 3K0FB 4I1YA 4URWR 1YRAA 3VSEA 4KR0A 4AKHA 1DL5A 4EJFA 3T5AA 2BZ0A 3BX1A 1W87A 2YRWA 3CCBA 4LSWA 4WKBA 5AM4A 2ZI4A 1JT9A 3D02A 3DFUA 5C53B 3I05A 3KSAC 2YYZA 3UCEA 1W36B 1J00A 2OC9A 1XKQA 1LV7A 1N6NA 1WIWA 3NHSA 3OQ6A 1N9GA 1VDMA 4J0DA 2ZIEA 4MUAA 4TQGA 4YC7A 3T94A 5JNSA 4FWTA 1OXVA 1BD3A 3TVYA 5TLSA 3Q8MA 4TXLA 4PPNA 1R0WA 2ODAA 1JG1A 3AUUA 4OGKA 5AMXA 5F1YA 5K6AC 2QT9A 3JZDA 3DZFA 1IM8A 1QUEA 5EXEA 4E09A 1A9QA 3WR5A 1BMTA 1E3QA 1E79D 4G8CA 3HACA 4KH0A 1UP7A 5E2BA 2C1XA 1AQIA 3IAS1 3NWOA 4GYWA 4IQ4A 1OBVA 4LRYA 4F04A 4JP1A 1L7OA 3TUZC 3X1DA 3F7MA 3VDMA 2OL4A 4V38A 3V2UA 3OZEA 3SHOA 1WKVA 1OIVA 2QD2A 1NN3A 1LDYA 3B38A 3IAEA 4KCGA 2YXDA 5LXTA 4WI1A 3MCAA 4IF6A 1BGXT 2F8LA 3B20A 5DXAA 1L5LA 3RSFA 2B1JA 2YWDA 3I2JA 5A7GA 3PIRA 4BLWA 4F3YA 5F77A 2HSJA 3AB7A 1P17A 3UPDA 4DYVA 3BD7A 4OBXA 2AFVA 1NN0A 3EAFA 3GLQA 1D2RA 5DIFA 4EYGA 1YB1A 5KX5F 2YHIA 1NG1A 3OIFA 3IHWA 1K97A 4QU8A 4ER7A 1M1ZA 1JLLA 2VFAA 3GRPA 5BN4B 1OXTA 1OWLA 2BLLA 2D1QA 2HSEA 4E2XA 1PIWA 5IANA 3HKCA 3MOIA 3DSRA 1PD1A 3I45A 1RM5A 5DBHX 1W1UA 4FT4A 3N6XA 1G20E 2OORC 5BNIA 5CFQA 2HL6A 1LSSA 1WB6A 2Y6UA 2I8LA 3E6AA 2I5PO 5EIBC 1A27A 3QHQA 3THYB 2HXYA 1TIPA 4CFYA 4M9QA 2VAXA 4ZHQA 4YCMA 4B9AA 2H2WA 1D2EA 4GC5A 3SWWA 3VMMA 5EZSA 5C32A 5IX8A 1IVNA 2O05A 2R6GA 5DHRA 4A3SA 4ABTA 3ZU4A 4DCCA 4G5XA 1C4XA 1JHDA 4GGPA 4LXXA 5CNIA 1U11A 5JPCA 1P0MA 2VK1A 5BW6B 3UGKA 2HXSA 4TM7A 1TQ4A 2FZEA 1K8RA 1MPXA 2B1GA 2XHEA 1UWVA 4QDJA 4QDTA 1QC5A 2FPLA 4KR2A 1EIWA 1OZHA 1LLQA 5FOTA 2PKWA 4YUYA 2FWJA 2VSQA 4W63A 2Q1YA 4DWJA 1M1YA 5DCUA 4CF4A 2H8GA 2I8CA 2AVNA 4IGAA 5TPZD 4DV6B 4MUKA 4PR0A 3SHWA 5B12A 2DSNA 3LIIA 1K92A 3F2VA 1KZ9A 3A0RB 1Z7YA 3DDSA 3KFXA 1NVGA 4ZGBA 2Y67A 4RVFA 3UJHA 2IYQA 5CR9A 1RWQA 1U31A 5KTNA 3C6QA 2WTXA 4YAFA 3GZ4A 1RJWA 2UKDA 1NQWA 3BOSA 1E66A 2D3WA 2PA0A 4KGVA 2FU5C 3Q9SA 5F5NA 1QRDA 3M3DA 3AEQA 1U0EA 2RGNA 2IL1A 4R2HA 3LHIA 4JU9A 3V80A 4MJ7A 1VJCA 3SMVA 5ALTA 2I4RA 3DAHA 5EWLB 3GLVA 3LHKA 2IRWA 4JOQA 4X94A 5DM4A 4EGFA 4BKQA 4MKFA 3QWIA 5I7SA 5J63A 4BXOB 5BQPA 1QV6A 2CNDA 2IPLA 1GITA 1GZ3A 1ZOSA 3U1BA 5KINB 4LI0A 1N5KA 1PO7A 1KO1A 4CFSA 2O2EA 3ZGOA 3LL4A 3A7EA 1SVWA 1RR6A 4XDHA 3NTQA 4YRJA 1Z34A 1RBMA 1NNI1 2I0FA 3O7MA 2GEKA 4AUKA 1S89A 1TZBA 5CURA 4YPOA 2C20A 1D6NA 2GBGA 2JFYA 5EZYF 4ON9A 2MSWA 4P5EA 1E7QA 4W9RA 5A9SA 3IRVA 3AF1A 1K98A 8MHTA 3E7FA 2JBWA 4Z7JA 2QX7A 1JA1A 2WE8A 4N7BA 4RXUA 1I8TA 2ZWMA 2KS6A 3CPJB 4YJFB 5F51A 4DMUB 2D5AA 4TTAA 1SIOA 3A10A 4TTTS 5JATA 2DY0A 1Q1ZA 2HLHA 3GRUA 3LK6A 5B30A 3IQHX 5CXSA 3GJ3A 2A84A 1TYDE 1EXWA 4W5NA 3JASB 1X38A 4YUXA 3EG9B 2YDYA 3EXFA 4RETA 4ASUD 1FK8A 4W1RA 2JIOA 4DJTA 4OBEA 4ZK2A 1ML4A 3CF4G 4DQUA 2HU5A 2WD8A 3AHDA 3IQGX 2QZSA 1R9JA 2I2FA 3FB1A 4QNNA 1SEVA 2PRYA 1R10A 2IP2A 4WQMA 1W2WB 4EELA 4QA9A 1Z4JA 1I7DA 2J5RA 3B1VA 5LD2B 3EZ6A 4DQKA 2LIVA 5ICFA 4M1KA 2NZUG 4OUKX 1STOA 4CTJA 2I4LA 3UNXA 3U4QA 1XG5A 4WFIA 2W70A 1U28A 3MJVA 4WCVA 2WM9B 4AQYB 1F3OA 4NU0A 5FF9A 2X1MA 1S1CA 2IU6A 3TGLA 2BKVA 1CHDA 4AU1A 5AESA 2HK7A 4HAXA 4XYEA 4WZ6A 3R9XB 3CLSD 3W8NA 4NHEA 5CCBA 2GFIA 1W5AA 2AEFA 3NWJA 4TL6A 3WL4A 1BX1A 4BP1A 3C6KA 4CLHA 1HL3A 1MNAA 2FPGB 3BUSA 1B76A 1CUIA 1ONOA 1RHJA 3LLVA 5DNVA 1ZOLA 4J3JA 1PF7E 4UKDA 5LMZA 3EPRA 2WWHA 4KYTA 3V7NA 2BKUA 1H65A 2R65A 3DULA 3KAQA 2XXAB 2D5LA 4BDSA 1E3TA 3GA7A 4RFLA 4KITB 3UPUA 5ALKA 4TVKA 3TNFA 4HXGA 4QT0A 1H9AA 5J2TB 1ZC3A 3IV7A 1SCDA 2DPGA 2JLUA 1JB1A 1RJ9B 2V0CA 2A1TR 5F2OA 2YXEA 1T1RA 3H65A 4IP0A 2PXHA 4DS3A 4ENTA 1XTBA 2XMQA 3MB8A 4EY6A 2RBGA 2ETXA 2PIDA 1WXFA 3AZQA 2VT3A 3R3SA 4JVNA 3ZXSA 2EFGA 1A7UA 2QENA 1HQCA 4WXMA 2C83A 2C3YA 1NTOA 2C97A 4YV1A 1XMJA 3AZPA 4IXDA 3GQBB 3LGAA 5ALWA 3ZUGA 1FSGA 4W8HA 1V71A 1GUAA 3CGWA 3CE9A 1CUAA 4G97A 1SZPA 1J90A 4OHRA 1VRVA 1V11B 4QUKA 4X8OA 3LY7A 5C81A 4M9ZA 2VQ6A 1F12A 1QZ3A 4BJ1A 1PG0A 4LG1A 4TMTA 5K45A 1VL1A 1WY7A 1T6XA 2G6TA 2ILVA 3LX6A 2LIPA 2OV1A 3ONNA 4PC2A 4BIIA 1KRWA 1IM2A 2AFIE 2MSCB 3CRMA 3FOCA 2G17A 2GUGA 3NM4A 2PKQO 3EULA 3KQTA 4AURA 5CDTA 5T57A 2Z2YA 3H1BA 3M3PA 1SC4A 3G2PA 4CNBA 4B4KA 3ZDAA 3MCUA 4CODB 4ZT4A 3V9AA 3PXBA 1Y7HA 4B8YA 1W75A 5LA6A 4UM9B 1X80B 2W0SA 1OTHA 1SVKA 4LYGA 5CDUA 3GLFB 1N6RA 2EZ4A 1VKNA 2JD2A 1P4JA 2PL9A 1Q0LA 4MJXA 1XCMA 4B2IA 4DDVA 3IQEA 1CRWG 4IY1A 1UBHS 3UT6A 2JLBA 3GCZA 4XARA 2NVUB 5AI6A 2YXBA 4C6HA 2HA3A 4KN8A 4R3UC 4XTRA 1C7JA 5HIJA 3CSUA 3DPIA 3Q10A 3BMQB 4GXQA 1V5WA 4NFHA 3GT7A 4GP6A 4F6RA 1COWA 2DHQA 1J0XO 4MWSA 3CMCO 4IMIB 1ZY2A 4OD0A 1I5RA 1THGA 3NFRA 1YBFA 2BGRA 3JR7A 3HE3A 4NQZA 2NT4A 3IVCA 3S8YA 2YHUA 4K86A 1E2PA 1I3CA 4B87A 1MO2A 4NF2A 3PU6A 3SLGA 4UNSA 1T5HX 1XKTA 4WFKA 1N5OX 3GMDA 2ZYAA 3OBIA 2ZJOA 2Q27A 3QVKA 3K0SA 1T35A 3ZCPA 4FM9A 4DA0A 3LUJA 1FDSA 5EKXA 2I7XA 5BW8A 3UXYA 1XJ0A 4NU5A 4PIPA 3WBKA 4URFA 4B71A 4H16A 2HA2A 4MV7A 4NU6A 4C3VA 3QTTA 4GPIB 2Y1WA 4DVJA 1GPWB 1SRQA 1NX9A 2VZ9A 3NJRA 4HTAA 4K26A 1JKJB 1JMYA 1GYRA 1PKEA 2ZUUA 4M21A 4I6GA 3KOXA 3VYVA 4JL8A 3OM1A 2FWIA 4RADA 3N0RA 5DNWA 3OTQA 3NIGB 2MSLA 3LPCA 2COKA 2NV2B 2JFGA 2ONZA 4XAQA 1F9AA 5DI3B 5EPEA 2HREA 2BTOA 4LWPA 3ZE7A 2X4DA 3QYFA 4RV5A 2DBVO 4Z3KA 4I08A 1JU9A 4M6WB 1YRLA 3WGJA 3R3YA 3WLPA 5LQAA 5IUNC 4JT4A 3P2MA 5HFNA 1UM8A 5GIOE 2C2OA 1TTPB 4TX1A 5AJYA 3D6MA 2CFTA 4GM0A 2JAWA 3NXSA 4R6WA 4J0FA 3UMYA 1HZZC 3FVQA 1E3DA 4JBIA 5KCZA 3PHGA 2WHPB 1OAAA 1U4SA 1N2ZA 2N1BA 1X1EA 2EFHB 2DBQA 2VDRB 3F7TA 3LCVB 5EQTA <