1I4DD

Crystal structure analysis of rac1-gdp complexed with arfaptin (p21)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
177
structure length
177
Chain Sequence
b'QAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARFAPTIN 2
molecule tags Signaling protein
source organism Homo sapiens
publication title The structural basis of Arfaptin-mediated cross-talk between Rac and Arf signalling pathways.
pubmed doi rcsb
total genus 60
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2001-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1i4dD00
5EUQB 3I32A 1YJ5A 2WJHA 5CB8A 1KJYA 4AIIA 4RD2A 2YKGA 3K70D 2C03A 1YVDA 1HYQA 2V9PA 1W49A 3SEAA 5DN6D 1BYIA 2ZJOA 2IYVA 1KI2A 2ECKA 1EESA 2D2FA 2WJIA 4Q21A 4O0MA 3X2SA 1E2EA 2YNMA 4CRWB 1NKTA 2ZEJA 3U61B 1IHUA 1KKMA 3DHWC 2QSYA 3TKLA 1XFAA 2MSDB 4B71A 1HT1E 1GG2A 1UBGA 3LO5A 5DYGA 2CVFA 2G1JA 4ASUD 2VHQA 4FWIB 3QKTA 2AFIE 4ZDJA 3IHLA 2FPKA 1L8QA 5DYIA 3FMFA 2YOGA 1U81A 2QA5A 4KVAA 4CYMA 2XEXA 2HF9A 3AKCA 1RW4A 4JJZA 4KFUA 4PQYA 5DI3B 3ZIAD 4DSTA 4ZKDA 2WWGA 1Z2AA 3ZVLA 4HLQB 1EWRA 1GVNB 3J81k 4MDFA 1XJCA 1CRQA 5JJKA 4MKIA 4UNQA 2A5DA 2IT1A 2XNDA 1E98A 1N2CE 2OAQ1 4D2IA 1RYHA 4DCSA 1E79D 1G3QA 1AGPA 2XITA 4N0DA 1UBCA 1DO0A 3AF2A 4WVFA 5AUOB 3LVRE 5B30A 2RGXA 4JIMA 4TQAA 4OL0A 5CM8B 2MMGA 2VSXA 4OJQA 3RC3A 1Z6AA 4C2TA 1Z22A 2BEKA 2ORWA 4M22A 5FPKA 1P2VA 2ZE5A 2QQEA 1KMHB 2QTVB 3IO5A 4Q4HB 1Z0AA 3JZMA 4LUCA 3LLUA 4B32A 1M6NA 5DHFA 3AVUA 2BMJA 3MWYW 3ONWA 5IT5A 4L16A 5AJWA 3IKJA 5FR2A 2R6CA 3BERA 3ZS8A 3Q9LA 2TMKA 4QNRA 1TX4B 5TB5A 4B47A 1LVGA 1T0JB 3GJ8A 2OXRA 4TL8A 2D7DA 2CCJA 2VTKA 1QHXA 4IRUB 3IHWA 5GJBA 1Q44A 3TK1A 4TSFA 2CMKA 1XRJA 2XXAA 4QRHA 1GZSA 5J4HA 1C9KA 3GLHB 2QU8A 3QOFA 4R71A 2ZU0C 3LXXA 1U8AA 1U2RA 3K9NA 5FUXA 2G83A 2ZVQX 1HH4A 4XOIA 3B13B 2Q0HA 3VR5A 3I4LA 4HB2A 1SVLA 2CL7X 3H2YA 3SBEA 1Z29A 1KTVA 4QGGA 6Q21A 721PA 3PVSA 1SXJD 3AH8A 1XTQA 4KO8A 5JS8A 1W47A 2I1VB 1UDWA 4PC2A 4X8MA 3U3RA 1MV5A 1H65A 4PZYA 4XD7A 4O3MA 2GCOB 1JQJC 3GLIB 2J46A 3SC3A 3L8YA 1FNMA 3CONA 1BMFA 1GRNA 2FGKA 3NH9A 1SXJC 5FI1B 2ONKA 4D80A 3CPHA 1E2MA 2QUZA 2A5YB 4HSEA 3VR6A 1E9EA 4CW7A 1N0VC 1U0HC 1AZTA 3GFTA 2ZQ5A 1GOTA 2WOOA 2XOKD 4DEYA 4DLTA 2G9NA 2W58A 3ZQJA 1MH1A 1EG7A 1G8FA 1G19A 2GK7A 2ZRAA 5K8TA 1TQDA 1QHSA 2QEQA 1DAEA 4DRZA 3L2OB 2O8FA 2ZTSA 1KO4A 5BN5A 5HKKA 1IM2A 1VYVA 1A2BA 1AGRA 1DAKA 4Z54A 2WV9A 3D6TB 3QXSA 3AVTA 1CU1A 4Z1MA 1OYYA 1GRRA 1X8KA 4LJAA 3ADDA 1BO6A 3I72A 1NVVQ 2KWIA 4DT1B 2REBA 4PQRA 1LTQA 4QL3A 2D3WA 1VIYA 4HB3A 5CDFA 3JVUA 4TMVA 3X1DA 2IS6A 2DFNA 3IEUA 5BQ5A 2HDNB 2KBFA 2WSSA 2NPIA 5KU1A 1CR1A 2BJVA 4AI6A 2H16A 4AD8A 3TNFA 3VU9A 4R98A 1XEWX 2OSBA 3TIFA 4KITB 2O8DB 3NC1C 5EE3A 2C96A 2QBYA 2WJJA 2BV3A 1D2EA 3W6PA 4EUNA 5FL3A 5H70A 1E1QA 1OFUX 2ZJ8A 1COWD 4U02A 4U7DA 4C2UA 3CNLA 3SYKA 3RS3A 1WP9A 4RZUA 4XJXA 2IEYA 4NTZA 1OKKA 3NBXX 2C2HA 1KAOA 4C0KA 3KQNA 1X1RA 2NMVA 3BH6A 3CUEF 3NEYA 2P67A 2Q9CA 1SZPA 4C0HA 3QF4A 4X8HA 2VO1A 4LHZA 5G53C 3DZ8A 4GOKA 2ZS8A 1AK2A 2SHKA 4HLDA 2WPDA 3IBGA 2GNOA 3SHFA 1LB1B 3W3ZB 1JALA 3BFXA 2FX3A 1DBSA 1CULC 3QXHA 3RC8A 4M4SA 2YOHA 1ZM9A 1YE8A 1HURA 1KGDA 2BDTA 2XZPA 2Z0MA 1E9SA 2WWFA 2WKQA 2Z6VA 3JVVA 4BLPA 3KB2A 3L0SA 2ZJAA 3GFPA 5JRZA 4M9ZA 3T1TA 1G8HA 1BMFD 3GJXC 2IYZA 4G5OA 4RD3A 2G88A 4HLUC 5TV2A 2O8DA 1XDBA 2WHXA 2ZRHA 3PCRB 1BS1A 5E3HA 4FMCB 3QUSA 3RS7A 2NO6A 4TQ9A 5HCIA 4CEHA 4PHTA 1XNJA 1T8UA 3CH4B 2VHUA 2BC9A 3B78A 1U94A 2QG6A 3GLGE 1Z83A 1SKQA 2ZSAA 2XNDD 3MCAA 1IXZA 1XCPA 4CIDA 1RRCA 1NLYA 2WPDD 1MO6A 5G3ZA 2QP9X 4HDOB 2ZS9A 5L3SB 1M74A 3RS2A 1HE8B 2VSOA 3K0CC 4CT5A 2UZ3A 3HDTA 4WOPA 5FPHA 3T35A 3QKUA 3ZS9A 2WAXA 2GJSA 3EZ9A 5L3QB 1II8A 1LFDB 2HUPA 5KNCA 1JXOA 4AKHA 2ZUBA 2E9SA 5DNYB 1PV4A 4YXWD 1IQPA 1P73A 1XWIA 2ZI3A 3EZ7A 1KOFA 1KI6B 2QY9A 2QM8A 3B1WA 4PZLA 1JPJA 2OFXA 1ZVQA 1Q1QA 2VP6A 4Z8XA 1YZKA 2J3EA 3CX8A 4WBSA 4YMTA 1XTSA 5FBVB 5J4YA 4YDSA 3V4RA 4AKGA 1LF0A 1Z8FA 2CHQA 4GP6A 4EFNA 3K0SA 2BJWA 4QBGB 2MSCB 4M8NE 3GPLA 1N5JA 4JLMA 4S2EA 1OW3B 1Z6YA 1QG2A 2IS2A 4Q47A 1MABB 1XMJA 1N6IA 2GEUA 2XOKA 4IXMA 5DN6A 4FW9A 4BRWA 1QZXA 3FOZA 3CBQA 3GJ0A 4M1KA 2QNRA 3A6PC 3K9LA 2QORA 1GITA 2VHTA 3B82A 4UNPA 1KK1A 2P6UA 2ZU6A 4NPHA 2FDCA 2PLRA 3PJRA 5FL7D 1CP2A 2F3TA 1TAGA 2CCGA 4DDWA 1E4VA 3IILA 4A6PA 2ATXA 1ZNZA 4RKFA 2BBOA 4P4UA 4IDHA 3REFA 3FWYA 5G40A 1RPZA 3RANA 2FSFA 1G64A 3W8NA 2H7VA 1W44A 1G8PA 1A1VA 1Z6GA 3IBYA 1WDTA 3PUYA 4JLAA 4OJKA 2QBYB 1E9FA 3D8BA 8OHMA 4TZ0A 1OXXK 1YR9A 3ZZ0A 3O8DA 1FNNA 5P21A 3RNLA 2X19A 1XTKA 3KJEA 1NRJB 1W46A 1ZC4A 1FUKA 1Z0FA 3LDAA 4QG7A 2C5LA 2XZOA 2WTUA 3O8CA 4Q7MB 3MMPA 2GETA 3EC2A 2CJWA 2WWIA 1IY0A 1K6MA 1AA9A 1ZIOA 1CRPA 1Q21A 5FTNA 2XAUA 2BKUA 3HU3A 1NMXA 1RVDA 1NI3A 3M1IA 4ZCLA 1X86B 1C1YA 2XB2A 3PUXA 4W5JA 4JL6A 1DAGA 2ORIA 5HCNA 1EFHA 3WP0A 2QT1A 3AF4A 1XCMA 4RFSA 1ZNYA 4RVCA 2JATA 4TLAA 3W6NA 2J0UA 3UWOA 2DCUA 1XD2B 5CITA 1GFIA 3BK7A 1II0A 2OILA 2NQ2C 3PXGA 2D74A 2DWPA 1UKYA 2PLFA 3TQFA 2XJ4A 1E2NA 221PA 5TDHA 4V0MA 3GJ7A 4FXPA 4KU4A 3H86A 4NCHA 4DHEA 3K0AA 2XTZA 3CNOA 2JLVA 1KI7A 4KLZA 1IY2A 3CO5A 3HP1A 4L8GA 2W83A 3OAAA 5SZJA 2F55A 3BOSA 3A36A 3KKMA 4I1UA 1CLUA 2YV5A 4BUJA 3H84A 4QFMA 1DPFA 1G8YA 2GJ9A 1Q1ZA 2FPLA 4MRSA 4OQNA 3LFUA 4A0RA 2O8EB 3OHMA 1LV7A 2AD1A 2I4IA 2IYYA 2I3BA 4Q1DA 4TTQA 4CZ2A 4YMVA 4XTRA 1E9BA 1GWNA 4AYWA 1OB5A 1YR7A 3VAAA 3L43A 4Y0VA 3FTQA 3TSWA 4TT3D 4R2HA 2OBLA 2CXXA 1W5TA 2CK3A 4Q02A 1WA5A 4BLQA 1N6PA 2PH1A 3HWSA 3AF0A 1X8LA 4BASA 1FW6A 1OPXA 4DBLC 3LBIA 4C7OA 1IBRA 4Z1MD 1WB9A 1LS1A 2J0QA 2QGZA 2HT1A 4B34A 4LCBA 1R5NA 4EJSA 2CE7A 1R7RA 2C04A 3OIUA 4IVPA 2QTHA 1N5KA 3RWMB 3GFOA 3AGQA 2GDJA 3CPEA 2GK6A 2RAPA 1XZPA 4BGDA 1N5LA 2VPPA 1GILA 1UFQA 3T34A 2R6DA 2EQBA 4FINA 3G82C 3T1QA 2GBLC 1N6LA 1E0AA 1ZNXA 4YONB 2PT5A 3CWQA 4MGZR 2F9MA 2FFBA 2FV8A 4BLOA 5ELXA 3EX7C 3THWA 1YQTA 2A5GA 2BMDA 4A4DA 1F5NA 2QSZA 3DVLA 3VNUA 1W4AA 3KUCA 3K0FA 5EP4A 2GJKA 1NN3A 3AVQA 4PC6A 2NZ8A 2ODWA 1P2UA 5FOXA 3ND8A 3SJAA 3PQCA 4BRUA 4MGKR 2E1RA 2F1RA 3K0AB 4IJMA 2KB0A 4LYJA 4AYTA 4AKIA 2C77A 5FL7A 4LY6A 3FDIA 3KFXA 1NBMD 4TLEA 3LA6A 2KI5A 5F98A 3B1VA 4KAXA 1D5CA 4PAMA 2WJVA 4M1MA 2V1XA 4JLBA 4RY2A 2IA5A 3SFVA 2IXGA 1J90A 1V43A 2WWYA 1JR3A 5CM9C 2DBYA 2W6JD 1S8FA 4OHXA 4WZAE 1L4YA 1IN7A 3F5FA 4LJ5A 3GD7A 5CB6A 3QSYA 3ICEA 2R9VA 1PLJA 5TXGA 1MO3A 3R8CA 4H1VA 4TYPA 4IW3B 5KPDA 3V9PA 1ZM2A 4W7SA 3A1VA 1HA3A 3X1WA 2FN4A 1HV8A 3BORA 1E3MA 5FH9A 4ZI2A 3MG9A 4MKGA 4Q1AA 1QDEA 4Q9JA 3TQCA 2XSZA 1JEDA 5L3VA 2RH5A 2C9OA 3RS4A 1E9DA 2LKDA 4IOLA 4ACAA 4LYHA 2AKYA 2DHRA 1E2FA 3CNNA 3QKRB 2Q3FA 5GJCA 3SYLA 4Q4HA 1Z07A 2GJ8A 4RZ2A 1KI1A 1R0ZA 1T5LA 1UEJA 2ZANA 4XVUA 2P5SA 4KBGA 3AF1A 2QAGA 3BH7A 3UANA 1G3RA 4OK5A 4NE2A 5L8VA 4Q4AB 1Z06A 3C14C 1Z6XA 3H0KA 4FMDF 4A8JC 1ZUHA 3ZIAA 4HUTA 2KJQA 4A8JA 2F6RA 1G5RA 4BZQA 4Q48A 1E2KA 2BBWA 3C16C 4C4PA 3OIVA 3QF4B 1IN5A 1VDZA 2GF0A 4E09A 3KXKA 4NYJR 1G7TA 1X3SA 5C46F 3I8SA 1KI9A 1J2JA 1ETUA 1SULA 5G41A 1CTQA 2V3CC 4CGZA 4BEBA 2DPXA 5JJIA 4UKDA 3P26A 5AJYA 3LNCA 2Z43A 2IYLD 2QP3A 3QKRA 2NIPA 4FCVA 3WNDA 4YMSA 4UJ5A 4PANA 1GNQA 3GLIA 4IFEA 3OIWA 5LD2B 5KO2A 2H57A 2ERXA 5AR1A 2ZJ5A 3UWKA 4KYUA 2IUTA 3ZVRA 1W4RA 2ZI6A 4H1UA 2HXYA 4IDNA 4LSGA 4WIAA 1KDOA 4TMZA 1VHTA 4URYR 3WYAA 1KDPA 1G3MA 2IEZA 4OQLA 4RD0A 2CE2X 3B85A 4JSYA 1U8ZA 2JCSA 3PR1A 3IO3A 4JVMA 2EU8A 1FP6A 1O3YA 3RAPR 3QENA 4C0QC 4LHWA 2PJRA 1PZNA 3EIHA 4Q19A 4B76A 3PEWA 2OLKA 3DMDA 1NY6A 3IDQA 3BE4A 2AK3A 5BN4A 4TMTA 2JJ2D 4Q1FA 1E4YA 4PXAA 2C78A 3TUZC 4QGHA 4TQUS 3OE7A 3N5CA 4RD6A 2H5EA 4UNSA 4GOXA 1G17A 2A30A 3CLVA 1ZMXA 3CM0A 3DEFA 2ODEA 1FL9A 1DELA 2V8OA 1KK3A 3NBYC 2DFLA 1F3OA 3I92A 3WNBA 5IHPA 2QL6A 4EIWA 3R20A 1E2LA 2CHGA 2UVQA 1AKYA 2ZI5A 4L15A 5D3QA 2RKOA 2YVUA 1ZUIA 3PIRA 1ZU4A 3QXXA 2R8RA 4LJ4A 3IEVA 3BWDD 4L4UA 3I62A 3CIOA 2G3YA 3ETLA 1PLLA 3VKWA 2EFDB 4NYIQ 4XSGA 3KQKA 4M1WA 4PFSA 4MRPA 4M9SA 4D81A 3BS4A 3K1JA 2HLDA 4NBSA 4DCVA 5KNBA 2QAGC 4QHTA 3NC0C 4C0JA 1SVSA 5E7JA 2PT7A 4N1AA 3R7WA 5JWRA 2L0XA 4D82A 1RIFA 2ZJBA 1NN1A 3D3QA 1NMYA 3KB1A 5FPYA 4W9MC 4L9SA 3C15C 2HT6A 4D4KA 4DLWA 1ZP6A 3LW7A 2WWWA 2CLDX 1N6KA 2IBMA 3LW8A 4OQMA 3OE7D 3W90A 2RCNA 1VCNA 2P0EA 1EXMA 1Y63A 4B2LA 3K9GA 4D0NA 4B3GA 1E6CA 3K70C 1YZQA 1HTWA 2V7QA 2WWHA 4MKHA 4NL4H 2ZAOA 5L3QA 3N2IA 2HV8A 5D3MB 1G5PA 5AJVB 2ZUDA 4DT1A 1SXJA 3F3YA 4GRAA 1HT2E 2O0HA 4RCZA 3KTAA 4A0GA 4G5SA 1U99A 4WXPA 4LC0A 4FWTA 1RC8A 2YWEA 1SVMA 3A1UA 3VHLB 1CJMA 1US8B 2ZYWX 2LWIA 4A9AA 5BW8A 3UG6A 1J7KA 3QVUA 4QJ4A 3HR8A 4Y0AA 2OO7A 5FPTA 4GP7A 3ZJYA 2IUSA 3B2EA 4LBYA 5G3YA 5BN3A 1NSTA 4LYFA 4WW0A 2QAJA 1P6XA 4D4MA 2QN6A 2WVJA 4I81A 5KYKA 3SR0A 1VCOA 1II9A 2JLWA 5K8LA 4LRWA 1TF5A 1VG8A 5H1YA 4IOKA 1G9XA 2B7BA 2VQSA 2WMOB 3OFNA 2W0MA 3VNVA 1E9CA 1PUJA 4Q00A 1GIAA 3Q85A 3TW4A 1UKVY 2RGGA 3CZPA 2IX3A 1S9HA 1DAMA 521PA 3GCGA 4G3XA 3EPKA 1S0UA 1WXQA 1ZCBA 2BM0A 2AXPA 2W0SA 3X1ZA 2OCPA 1BH2A 1P7CA 2G1KA 3OFND 4PO8A 4A0HA 1OE0A 3CF0A 3SDZA 2DB3A 4NP6A 4ZDIA 1R0YA 5CLLA 2ZRNA 2AL7A 1XEXA 2NGRA 2GJAA 3MLEA 1T0HB 1H8EA 2B8TA 3TE6A 2WIAA 2FH5B 5AUPB 2PJZA 4PQFA 2CL6X 2QGNA 3FVQA 4PC1A 3ADCA 3AEZA 1W48A 4PAQA 3T15A 3MJRA 4C7OB 2X2EA 3A8TA 1C4OA 5KDDA 3H4MA 4TTRA 2B21A 3DDCA 4KFSA 2O8CB 2O0JA 4UJ3A 3UPUA 2JLUA 1F2TB 5DISB 5EE9A 3CRVA 1D2MA 2BWJA 4RFVA 2ZROA 3T5DA 3FHOA 2WAYA 2FFAA 1KMHA 3PEUA 3KQLA 1M7GA 4IEEA 3MAAC 3A1TA 2HXSA 4E22A 4G5QA 1Q20A 3EZ2A 1GTVA 3IIMA 2EFEB 2OESA 5JI3E 1TMKA 4FMBB 3RS0A 3R9XA 3Q7PA 4FMDB 1KSJA 3VR2A 4PZZA 4NZYA 4XH9B 1YZTA 4DLSA 1Z5ZA 5FBLB 1ZD8A 2AD5A 4AKEA 2CK3D 1E2IA 3U6KA 2ZRLA 4BFTA 4OHWA 4A8JB 1OB2A 2FSGA 5FUWA 3QJYA 2OE2A 2PZFA 2JASA 3MRSA 4Q7JB 1TUIA 2AXNA 2BOVA 3B9QA 4GFDA 2F7SA 2JGNA 1KNXA 5JWHA 3SN6A 1CBUA 1QHYA 2AX4A 2FSHA 3WRXC 4PSAA 2EVWX 5FOVA 2JLZA 5CLQA 1K5GA 3B8HA 2O8CA 3IIKA 4CEJA 3W9YA 1HQCA 4W5WA 4EPWA 3T06B 4UXIA 1XD2A 2YJTD 4IDOA 1NIPA 2QQ0A 3KKNA 3L0PA 3U3KA 1VECA 1Q0UA 3OEED 1UAAA 4Q9KA 1EFTA 3NHAA 4UXJA 2ANBA 1AS3A 2PX0A 1YHNA 3VFDA 3KKOA 1N25A 4LBZA 3TGPA 4MH0R 4B2IA 1JR6A 3Q7QA 3E5HA 3UXMA 2J9RA 4LJ6A 3D7MA 3LVQE 2FWRA 4DLRA 1QG4A 3ASYA 5TVKA 2OCAA 1G41A 1GKIA 4U5XA 1T4GA 4MYUA 3UMFA 1KDRA 1DADA 4DLZA 4PSVA 2WJYA 1CKEA 4J0QA 1E2PA 4PO1A 2JDID 1P5ZB 5FTJA 2QROA 2OZEA 4P3YA 5LD2C 2IYWA 4B43A 4JJKA 121PA 4PPQA 4LOAA 1M8PA 2PZEA 2EWVA 2VP0A 2QRNA 1TNDA 2VHJA 2IYXA 3ZD7A 1WBBA 2ZYTX 4JMPA 2BEJA 4NONA 5GJVC 3LX8A 4KJZA 3WXMA 5LPNA 3AVOA 4KYIB 4KSCA 3WRYC 4ASUA 3LRPA 3VX4A 4DUGA 5FTMA 4Z8YA 2C9YA 2N42A 2LCFA 2RGNA 3IQWA 1IAQA 2GF9A 2EFHB 4M2LA 5AK0A 1LY1A 3AKYA 4TLBA 2CNWA 3R7WB 5EXPA 4TZ6A 2J59A 4WA7A 2QMOA 5DIFA 4TYWA 1CJKC 5JFGA 5B64A 4KODA 3LBHA 5BYKA 3AV0B 1LW7A 2OBNA 4UNNA 1W4BA 1TUEA 4D26A 1NLZA 3QBVA 1KSHA 5EE5B 1KO8A 4KXFB 3TVDA 2Q21A 4Z51A 4BFUA 4HYYA 1HY3A 1YZUA 1RYFA 4NKRA 5FBQB 1F2TA 5CYOA 1UF9A 3F8TA 4ZIRA 3Q5EA 1B0UA 3DKPA 2RHDA 1N6HA 5KOYA 3LY5A 2EFCB 2ZJYA 3A37A 5A0FA 2GWHA 4HDQB 1OFHA 2LKCA 2CVHA 3T1OA 4II7A 1W4CA 3HPRA 1D6JA 4B2PA 4KSBA 2ZR0A 3U3MA 4QBHA 2GEVA 1IY1A 3ZQ6A 3B7GA 1Q3HA 2GXQA 3I3SR 3T5GA 3X1YA 1CR2A 1XBTA 5KSZA 4LJ8A 3RRMA 3JZAA 3PG5A 1WMSA 2EYUA 4UXHA 2GZAA 4QKQA 3CX7A 4CT4B 4DVGA 2QP4A 3KJHA 3T1VA 3EPHA 3RABA 2P6NA 1QVAA 3M0EA 1W2GA 2VP5A 4HZUB 1FZQA 4F7WA 4GMXA 3EIQA 1RRGA 2BBSA 3VKHA 4DIEA 4HUQB 3AP3A 3NHBA 3QXJA 3NDBB 3A4NA 1E96A 5E95A 2CLCX 3KXLA 4CEHB 2EW1A 1KI8A 4PC7A 4LPKA 1AS0A 2NO1A 4LX0A 4JKYA 5JCPA 1KJWA 5BYJA 1P60A 4BFXA 1U9IC 1TEVA 3G0HA 1S96A 3GJ3A 3GLFB 1M7BA 3CF6R 2GESA 1ESMA 1X8JA 3SJCA 1TF7A 3QNUA 4JLJA 3I1FA 3U7HB 1E79A 1GKYA 4EFMA 1DVRA 2EWWA 3CR7A 2B7CA 1KI6A 1RJ9A 2NO9A 1NP6A 4DSOA 1Q57A 3QEJA 1GL6A 4JLNA 4C9BA 1EFRD 1ZM4A 2GAOA 3LXRA 4RKEA 1UBFA 4CF7A 1OV4A 3U7GA 1I4TD 4DB4A 1Z0IA 5E7IA 3ZZTA 2ATVA 2JLSA 3OEHA 2OCBA 1OXTA 1QRAA 4GZMA 4IOMA 4DSNA 1X1SA 4A15A 3QKSB 2BCJQ 2GCNA 5E4FA 2RGNC 5AJXA 5AJZA 4Q1EA 5BXQC 3CKLA 4GI7A 1E99A 1GP2A 3ZGXA 1MOZA 1Y3AA 5FOSA 2XXAB 2CJWB 2QAGB 1KY3A 3BB1A 4IVRA 1KYIA 1W36D 1W7AA 2A9KA 2NOAA 3PV0A 2VP2A 1RKBA 1FFHA 1HEIA 1FTSA 4JLOA 1TQ6A 3AVWA 1P62B 3EWSA 3QVVA 2PMDA 2ZIAA 2WZQA 1VCMA 2O52A 2X1VA 1XTRA 4ON9A 3AVXA 3KJGA 1EFCA 4AURA 2ZE6A 1NY5A 2OM2A 5FUVA 1EX7A 2JIZD 4C0SA 1PVOA 4DLVA 2WWXA 2KBEA 4TL6A 4OK6A 2YYZA 2ASEA 1ZC3A 4EPVA 2W6IA 1VG0B 2CNWD 1E1QD 3RSOA 4FN5A 4BEJA 3X1XA 2ZI9A 3BIFA 4C0AC 4RZ3A 4AG5A 2GZDA 4LJYA 3PEVA 4ZPXA 3QKSA 4HAWA 4HLCA 4DZZA 4PPGA 3SQXA 4HAXA 2UZIR 3U44A 1TU3A 2Q3MA 3B1ZA 1P3JA 1SHZA 5J4LA 4AYXA 3SQWA 3B5JA 4JS0A 1EGAA 1S9DA 2O0KA 1JECA 1H8HA 4N0EA 3GLFE 2REOA 1BIFA 2X2FA 1F6BA 1VCIA 1MRNA 1JXMA 1KNQA 4E5UA 4V0NA 3IQXA 1FX0A 1VYTA 5C2JB 4US0R 3TUIC 5EQTA 2YWGA 3FPAA 1W0JA 2OFOA 5FBWB 5IK2D 5FOUA 3IGFA 1G16A 2D2EA 4F4IA 3THXB 3QIAA 4F92B 2J0UB 3GEEA 3F0TA 1IN8A 5LBIA 1RZ3A 3I5XA 3ZVMA 3UIEA 1VKJA 3ZLJA 3O8RA 5A5GA 1E1RA 3GLHE 5DO9A 1RRPA 3OEHD 4DUGD 4DCTA 4EFLA 4V0KA 5KDLA 1A82A 2WIBA 4OYHA 1JNYA 2FEMA 4DCUA 1XB2A 3FGNA 1ODFA 3KFVA 1VG9B 1XTJA 2VP9A 1K5DA 3IUYA 5EP2A 2HCBA 1JEEA 4TN1A 1J70A 4P4SB 1AN0A 4DLYA 3Q3JB 1CR0A 3DMNA 1KMQA 3TSOA 4OKSA 1CR4A 2AHOA 2D62A 1S1CA 1G21E 5EZ6B 3FYHA 4KV9A 1CS4C 5HZHA 3E70C 3DOEA 3U7EB 3PITA 5KSOA 4B3BA 4JBWA 2YZ2A 3FE2A 4C30A 4MKFA 2NO0A 5FI0B 3QXCA 4L9WA 2GCPA 3LWNA 5IF9A 1VG1A 2PMKA 2G77B 1HE1C 421PA 2IYQA 1NBME 2R65A 3NTUA 3AUXA 1SQ5A 2QE7A 4ESHA 2ZUCA 4DCNA 5FTKA 5KSYA 2IF2A 1NN0A 5FPSA 3THWB 3H1TA 4WZ6A 3BFVA 1MRSA 4DDTA 1P9NA 3L0IB 2V55B 1GUAA 2FSIA 2O5VA 3ECCA 4AC9A 3EPLA 4K46A 3EIEA 3U2QA 4XWOA 2IYRA 3N2EA 1JAIA 1P4SA 4D4LA 3SFZA 5LB2A 5B57C 3BD9A 3QPVA 1E9AA 1P9WA 2C95A 2OT3B 2VA8A 4EAQA 1N5IA 1VPLA 1JI0A 4HAYA 1FOEB 1OFIA 2IHYA 1R8SA 2ZJ2A 4XD7D 2ONJA 1XJ0A 2H1LA 621PA 5F9FA 2WMNB 5J40A 4B33A 4NU0A 2ZR9A 4E07A 4XSHA 2VBCA 1L7VC 4DEXA 1ZIPA 1UJ2A 2BCGY 2FG5A 2GRJA 2ZSDA 4ZDWA 4B3FX 3MJHA 1W36B 4AG6A 2Y8EA 5FTLA 3LAWA 1XXHE 1Z6TA 2DR3A 1XD9A 4NCKA 4UQOA 5JSZA 2Z4RA 3UK6A 1ANKA 4TL7A 2IS4A 1F48A 1UM8A 4M1TA 1IOZA 2P65A 3MUFA 3TUJC 4QHYA 5J4KA 2GEDA 4FCTA 1OH5A 1WRBA 1B23P 3U60B 3RYTC 1VYUA 3GLIE 4BFYA 3DKVA 5EZ5A 5EJEA 5JS7A 1H8HD 1G18A 4TWZA 3KZ1E 1W0KA 1IXRC 5LB4A 2QE7D 2YWHA 3WBKA 3VTKA 2OEPA 1FTNA 4E03A 2W2XA 1T8TA 3NXSA 2IXFA 1KY2A 1BYUA 4ZCIA 3GEIA 1GRQA 4MRVA 4JSTA 4PO9A 4Q01A 4MQBA 2NTYC 1W0JD 3BFKA 3GJ4A 5TY0A 2ZYVX 4RJLA 1XPOA 2GCOA 4GBMA 2ZS7A 1AQYA 1RRFA 4CEIB 1KK2A 3QG1A 3GJ5A 1QHIA 2Z5FA 1TU4A 5FOTA 4US2R 4EPRA 2VSFA 2XX3A 2OUKA 2DFKB 4XVQA 2RGDA 5K8UA 5E7MA 3FKSA 4UNRA 4RD1A 3D31A 2FEOA 1YZNA 1G4AE 4HZUA 2ZXUA 3KKQA 2OV2A 1N6NA 4URVR 1JB1A 5DGXA 2J5XA 3E1SA 4B48A 2O8EA 4NDZA 2F1IA 2W00A 1D9ZA 3EWAA 4JL8A 4L5BA 4NCIA 2FFQA 2QI9C 3RHFA 5CK5A 4A2WA 5FBRB 2VYFA 4BLTA 2J7KA 4XWKA 1FP7A 3C5HA 1GKUB 1A7JA 1Z2CA 2BVNA 5CK4A 5L3RA 2XZLA 3AP1A 3ADKA 1KZ7B 3E2IA 3PENA 4HEJA 1P9RA 1XP8A 4WAUA 2FF7A 2FU5C 4W5HA 1G5TA 5CYPA 5EP3A 3S1AA 1XPRA 4PR0A 3BC1A 5KTYA 5JECA 4Q7KA 3UMRA 1V5WA 4BECA 1YU9A 1UKZA 1T5IA 2A78A 3PUZA 4NMMA 1YRAA 2J0SA 2K5UA 4FI3C 4EQ6A 5FUYA 4LK2A 1EX6A 3EW9A 1WBDA 1Z0DA 4HLUA 5DH9A 1ZINA 2P6RA 2B6HA 1W5SA 1CEEA 3PUWA 2ZPTX 2JJ1D 3G5UA 3WP1B 3NDPA 2DWQA 4MITA 2MSEB 3SNHA 5SZHB 1XTIA 2EFGA 3WBJA 2H17A 3DM5A 1KZGB 4HDCA 3SU8A 2HYIC 2QZ4A 1UADA 1VTKA 1AS2A 3SE0A 4ZDKA 3Q72A 4F91B 2YC4C 5JEDA 4O25A 2JJ8A 2QMUA 1S2MA 2QM7A 1U0LA 4M21A 2VIIA 2ORVA 2NPFA 4Q9HA 1TF2A 2RMKA 3EG5A 2XTNA 3AVVA 3CZQA 4R2IA 2HLDD 2R6AA 2N1BA 3QEOA 3BB4A 2GAAA 1E2GA 2ZI7A 2ZRPA 5KNDA 1KO1A 3KQHA 4CEJB 3W6OA 1AJEA 4IKEA 1ZYUA 1WQ1R 1Z08A 1OIXA 1N6OA 2C98A 3TR0A 3R9WA 1JJ7A 1OXVA 2FOLA 4IEIA 4NYMR 3QQ5A 1E0KA 5UKDA 2QENA 4V0OA 5J47A 4JVNA 3C7KA 4JLVA 4URXR 1AM4D 5EXXA 4MRNA 1KI4A 1OJLA 4G5GA 5EE0A 4A2PA 1IJFA 1XMIA 4BZXA 3K09A 3K9HA 5J5CA 1NSFA 1MO5A 2VF7A 3CB4A 1QVRA 4HAUA 3UKDA 3QI2A 3RDPA 3THYA 5CDFE 4QGFA 5TMPA 4LGMA 2ZRBA 3DZDA 4GOJA 4M1YA 1JJVA 2F9LA 4POAA 2XGJA 1A2KC 1I4DD 1R0WA 5TARA 1YKSA 4TL9A 2BMEA 2CL0X 3VX3A 3GLGA 1LS6A 2P2LA 5GVRA 5JZVA 1NF3A 1PJRA 3KX2A 4C0LA 3R9IA 2YHSA 3L8ZA 2QMEA 4P4TA 3ZZUA 2JDIA 4R9UC 2V54A 3S1AB 3TAUA 4BFSA 1G7RA 3AVYA 1E2HA 4GMDA 3NG1A 4BFZA 3K0FB 4Q4LA 3VHXA 4HB0A 4TLCA 2I1QA 2GVZC 3U44B 1US8A 2ZI4A 3DL0A 4OBEA 3BGWA 2QRZA 4B6EA 4Q66C 2QTFA 1XCGB 3C4JA 3TAHA 4B35A 4ZV4A 2WBLC 4FD2A 1QBKC 4QHSA 4V02A 1UBEA 4DXAA 3GLHA 3MWJA 4HI0E 4C3ZA 1Z3IX 2A5JA 3KTAB 1EFRA 3A1WA 3PUVA 1ZNWA 4RZXA 2H8KA 1MABA 3QE0A 3ZDQA 3W3AA 1T3LA 4Q4AA 2R6GA 4DC9A 4P31A 1U98A 2YWFA 1TTTA 1VIAA 2QPTA 4KI0A 4QXAA 1NVXQ 2CBZA 1L2TA 4PC3A 1KSGA 2P5TB 4PHFA 4PX9A 4KHZA 1AIPA 4F93B 2JLXA 1TPZA 3ADBA 4LDJA 1BKDR 4Q1BA 1DAHA 4X8OA 5HPYB 2GTPA 2ZVPX 1EFUA 4TYYA 4PPNA 1DARA 4JZKA 3WHKA 3GLFA 1R5OA 2FMXA 3LD9A 5A4JA 4ERNA 1GM5A 1OIVA 5CIWA 2OCYC 3IPYA 5DHAA 1KK0A 2ZRCA 3C5CA 4LV6A 2D06A 1KHTA 2QPAA 3EC1A 2GXUA 3K53A 2KE5A 4QJ3A 2R2AA 4MA4A 5HR5A 4Q9IA 4NYJQ 2R6FA 2YC2C 1Q3TA 3QY0A 3HU1A 1GL9B 1JQLB 3FMOB 4Q4JA 1RJ9B 2F1JA 1G6OA 2RB4A 1KO5A 2HJGA 2F3RA 1JAHA 3K09C 3LX5A 4BLSA 3ZVNA 3ND9A 4RD4A 3EASA 1T9HA 2AKAB 1Q1BA 3LQRA 4JBYA 4DSUA 1OH8A 4P0TA 1NG1A 1ONBA 1T91A 2C8VA 2V4ZA 1VMAA 2WM9B 2VF8A 4TMWA 4IOJA 2DWOA 1ZD1A 2VEDA 3NBFA 3TSZA 1SVWA 3QBTA 5GJWC 2ZSEA 4M9QA 3I5YA 2V6IA 2JAQA 2HEIA 1MO4A 2GZHA 4B3XA 1U0JA 3ZD6A 3W5IA 2GA8A 1CF4A 1Q1EA 2OXCA 3CRW1 4IDPA 3RRNA 3EPJA 3CH5A 2QPOA 4ZI3A 1QF9A 4V03A 1NN5A 2O8BB 4YDHB 1OH7A 4TYNA 1D2NA 1SVKA 4LC1A 3L82B 1TEXA 2WJGA 2JIZA 1ZRHA 5IDVA 4Q1CA 3WYGA 4PHGA 1OF1A 4HAZA 3HPQA 4AK9A 2J87A 1FMJA 1KIMA 1M34E 1XMVA 3U7FB 4I99A 3EAQA 4OQFA 3HR7A 5C4GB 2Q3HA 2F43A 5F2EA 1DOAA 4G0NA 4NCNA 2RGBA 1J8MF 5H68A 3DOFA 5J4VA 3K0EA 3P4YA 1FX0B 3K0CA 2R62A 4LJ7A 5F9HA 2ZRKA 4EJSC 4M53A 1SVOA 5K8IA 4BLRA 5L3SA 1LF5A 3HJNA 3OZXA 4NYMQ 4OI1A 1E2DA 3EA0A 5DLQC 1M1YE 4Q4JB 2Z83A 5ANRB 1XPUA 3TMKA 2CHVA 3C8UA 4I4LA 4LWZA 3KDSE 1OYWA 2BIFA 1FQKA 1G7CA 4JVSB 3TBKA 3A58B 3BB3A 2AFHE 1NG9A 2FNAA 2H18A 1DEKA 2Q9BA 1SKYB 1ZUNB 2WKRA 2YINC 4QOSA 3WY9A 2OLJA 3RRZA 1P2SA 1IONA 1G7SA 5CIQA 1W0KD 2FJUA 4A82A 2PZGA 1W2HA 5DSZA 2BMFA 3ZH9B 4BWYA 3A1SA 4B3DA 1ZU5A 1F60A 2XB4A 2XSZD 4JLPA 1VHLA 2W2VA 4Q03A 1BOFA 2CLSA 1QHGA 3U4QA 3RRYA 5CJPA 3MWKA 3C41J 2RGAA 4WXRA 1G3UA 2Q9AA 3B6EA 3OIYA 3TH5A 1JR3E 4KCGA 1NIJA 1U8YA 2ZRDA 1ZM3A 4DB2A 4JL5A 2ODBA 1H8ED 2GKSA 3IIJA 4CDGA 4LBVA 1MR3F 2QT0A 3A4LA 2ZE8A 1A5TA 3RSLA 2OFWA 1ZAKA 3AVPA 4MYTA 3VR1A 2FFHA 2PCJA 4QM7A 4HAVA 4LV8B 3OF5A 4I1SA 4QC2A 1JPNA 4BQSA 3TJZA 1R0XA 2ZRGA 4MGIR 3SJZA 2PBRA 3ASZA 4PPFA 4ZKEA 3LQQA 3UATA 1GNRA 4KBFA 4G01B 5IRCD 4HZIA 5HZKA 3FKSD 1GSIA 4IHQA 2VP4A 1J99A 1G20E 3B9PA 3DPUA 4YQFA 3BXZA 2ZE7A 4G5RA 1FUUA 4DWJA 1DS6A 2KSQA 3THXA 2JJ1A 1AQUA 1TL7C 1XXHB 2E87A 4XVRA 2J45A 2F1HA 1QHHA 4YLGA 5EUMA 1W1WA 2BKEA 3LLMA 1ESNA 1ZW6A 3U5ZB 2HCJB 1E94E 1FPMA 3P32A 1SKYE 2VH5R 1KDTA 3SHWA 4Q9LA 4B73A 2ZSFA 1IJEA 4YXWA 4AY2A 2DY1A 3TW8B 3R8FA 1DE0A 1HUQA 3THOA 4YMUA 3L0OA 1T3HA 3I8XA 4MUAA 1DAIA 2A5FA 5EE1A 4OI2A 2REXB 3LV8A 4KLNA 1NVVR 1GL7A 3AB3A 3U3OA 1YZLA 1NVWQ 2RGCA 2WICA 2WSMA 3AGPA 2O8FB 1E69A 3KL4A 3SS8A 4C0BA 1QHNA 4V0LA 3P20A 3AP2A 1AZSC 4MGYR 4OI0A 3LBNA 2BBTA 4JLDA 3VKGA 1O87A 5JSZB 2HF8A 4OHYA 2G6BA 1IN4A 3DO6A 1SGWA 1I2MA 3BH0A 2BHRA 1T3SA 1XEFA 4M9XA 2JJ2A 5KUTA 1G4UR 3FMIA 5KSPA 4TT3A 3OESA 4ARZB 2IK8A 4JT4A 4PSKA 1QHHB 2NZJA 2AN9A 4US1R 3GLGB 3HYRA 5JI2E 1IXSB 4NYIR 4ZO4A 3I61A 4IVQA 1RFLA 4P32A 4ZCMA 2F43B 2NO7A 3CW2A 4QM6A 1I4LD 4ESVA 1G1MA 2J41A 4DLXA 2DYKA 3M6AA 3U4QB 1UDXA 2HJVA 4BFVA 5B2ZA 1E1RD 2CDNA 4QBFA 4V0ME 4HB4A 3TR5A 4F4CA 4TYQA 1E32A 2W6ID 1U90A 4GNKA 1ZD9A 1E0JA 1R6BX 5JBQA 3KQUA 4JYBA 1GDDA 1CJUC 2MMCA 2XNSA 3W34A 1N0WA 1GNPA 1LNZA 4KVGA 4LPSA 4EPYA 3GJ6A 3Q5DA 5JHGB 1P75A 4R7ZA 3CPJB 1E2JA 4K8OA 821PA 2V1UA 4JYCA 3AKEA 5H8WA 1D9XA 1COWA 5JJLA 2IF0A 1OSNA 3O8BA 3VR3A 4DKXA 5KDOA 4GL2A 4LHYA 1E0SA 2Z4SA 1XF9A 1RE0A 3FFAA 3QG5A 1AKEA 1JBKA 1G8GA 2GVDC 3N70A 4XIGS 4EJSB 3K8YA 1J8YF 4EDHA 4D6PA 1S1MA 4DLUA 2A3RA 1R10A 4LHXA 2W2TA 1TQ4A 1OLOA 1ZJ6A 4CVNA 4URZR 4OK3A 1R2QA 4ACBA 5JRJA 5EP1A 1XEWY 5AWFC 2PX3A 3W5JA 2GBLA 1CJTC 4GT1A 2PL3A 4OHZA 5SZIA 1PUIA 5KPJA 2AR7A 2OHFA 1P61B 3HYTA 5FOWA 2P3SA 4JKIA 3AM1A 4DIDA 3FHCB 1DG1G 2W6JA 3RS5A 2ZJZA 3EZ6A 2IS1A 2VHCA 3OEEA 1ZBDA 3KJIA 1MT0A 3CX6A 2GILA 1R4AA 2EYQA 3FKQA 3U3JA 3NEJA 5D3MA 5JEEA 4QNMA 4K81B 1XD8A 1NKSA 3VMFA 4GDFA 2JEOA 2IYTA 1S3SA 2FZ4A 3QF7A 4BZPA 4S35A 2ZRIA 4CEIA 4OI4A 4M1OA 2ZYUX 1OFTA 4TMKA 3WYFA 3RLFA 1EWQA 5GADl 2IUUA 2A2ZA 2WOJA 4RCYA 4A6XA 3U6BA 1KKLA 4ARZA 1WE2A 2IYSA 3LH5A 2RGEA 4DJTA 3SZRA 2J0VA 4QBIA 3BAFA 4AWXA 4F4JA 1N0UA 1G291 4PHHA 4I1VA 1MKYA 2ZR7A 4YMWA 2ANCA 3AF3A 3V00A 1DO2A 4MYHA 5EXSA 3W8RA 1G6HA 4MYCA 3P4XA 4A36A 2JLQA 2ZETA 4IDQA 2D7CA 3ICQB 3EZFA 4HUQA 4P4SA 3P27A 5C18A 1NVUQ 1XMSA 4RSGA 5DI3A 1NJGA 4EPXA 2G0TA 4H9GA 4Q18A 2IC5A 4ITRC 3TVTA 1SXJB 4EQ6B 3PFIA 2UKDA 3NIBA 1XX6A 3PEYA 1X6VA 2B92A 1F2UA 1DG3A 1SXJE 3TRFA 4A1FA 4DDUA 3AKDA 1GAJA 1KI3A 3WNCA 4NCJA 4TMXA 5DI9A 2ZRJA 4KFRA 4PAOA 3VU9B 5HKKD 2GXAA 1HQYE 2VLIA 4KFTA 4LBWA 5BWMA 3TLXA 3NVAA 3BRWD 1S3GA 2CEAA 4ZIRB 4RFSB 2PCLA 4JVLA 4TSFD 2G0NA 4MRRA 3KKPA 4XTCS 2IYUA 3MD0A 1M2OB 1OT3A 4BE7B 4ABYA 1XEXB 2PEZA 4Q7LA 3MFYA 4U00A 4A92A 1U9IA 1KO7A 4MDEA 4N3NA 4BPBA 2IHBA 1R5BA 2FZLA 4G1UC 1E2QA 4OQXA 4FCWA 1L4UA 1M7HA 2OG2A 2Q6TA 4O2RA 1D8TA 3B1YA 4F38A 1E9RA 4ILEA 2DFTA 1OIWA 2FPMA 4IFBA 3IPXA 4LV5B 4WZBE 2IWRA 4P33A 1N6RA 1EK0A 2BM1A 1Z63A 3B1XA 4URUR 2OAP1 1JR3D 2J7PA 4MUBA 4GZLA 1SVIA 2AK2A 3KXIA 4OHVA 4QGAA 2J7PD 3BBPA 4LJ9A 1KAGA 2JA1A 4B74A 3RVBA 3FMPB 3CRMA 3SOPA 1G3IA 3FB4A 5JLJA 1FQJA 1Q12A 5JWOA 5C1BA 1WF3A 4IXNA 3GMTA 4TLDA 4D25A 1FMLA 1XXHA 3NH6A 1OXSC 5IK2A 1P2TA 2IXEA 2C99A 5FR1A 4Q5IA 4BFWA 5CJ2A 5HE8A 3T12A 1OKKD 1K8RA 3AUYA 1UPTA 3RWOA 1YR6A 1I2DA 3EXAA 4FIDA 4NH0A 4M0LA 2XJ9A 2OBMA 2VL7A 3THYB 1Q22A 2GXSA 3BJIC 3WHLA 5HTKA 2ZRMA 1XZQA 3CF2A 5JCZA 2ZSBA 5JHHB 2IWHA 4XWAA 2V6JA 4GSYA 1ZM7A 1ELOA 3MWLA 4YC7A 2YOFA 2ZITA 5FFMA 1Z0JA 4NHOA 5SZKB 3Q8XB 4LYAA 4HATA 1PLKA 3QPWA 1CJVC 2B8WA 3VR4A 5AUQA 1NMZA 3FHTA 2D4HA 3T61A 3ZYCA 4B75A 2AWNA 3MSXA 2X77A 5KHOC 1KSFX 2AWOA 4TTPA 5LDDC 4EKDA 2JLYA 2HYDA 1A4RA 1DAFA 3EARA 3P1JA 2A7QA 4GPTA 4LI0A 2C9CA 4O2LA 3UMSA 4B6FA 5M04A 1OH6A 2V7QD 4I1OA 1XJQA 1YZGA 4A2QA 1OHHA 2GHIA 1OXUA 2PEYA 3WMEA 3KUDA 3REGA 2WSSD 4EPTA 5B58C 1P72A 1Z28A 2FGJA 2QMHA 3VQTA 1XU4A 2CCKA 2R44A 3CR8A 3FFBA 3WMGA 4B44A 5C4MA 2VRWA 1WCV1 3GQBA 4X8LA 1NBMA 4QJ5A 1YR8A 1TQ2A 2XTMA 3CRQA 1NL3A 1CXZA 3SJBA 1UKEA 5AUNB 2JLRA 3DM9B 4PTLA 3O47A 1SHKA 2WKPA 5HE9A 1UEIA 3WMFA 1TADA 3OAAD 1NJFA 2IW3A 3NWJA 3CRRA 4LZZA 2ZREA 4A0FA 4JT2A 5GVSA 4JLKA 3I73A 5JMTA 2IL1A 5EXTA 1R8QA 1IN6A 2ODNA 1NLFA 1F2UB 2ZAMA 3QPUA 5DE3A 4D0LB 3SI7A 1KJZA 1CIPA 2FE4A 1T6NA 3NBZC 3NKVA 1YRBA 3UG7A 1NNEA 4JBXA 3GEHA 2RHMA 2H92A 4FMCF 4B3CA 4D4JA 4M1SA 2J1LA 3AQ4A 3EA5A 5F3WB 1II8B 1OHHD 3CWZA 3HU2A 3K70B 1Z0KA 2FA9A 3M4YA 1DTSA 1Z47A 3SBDA 2ZM5A 3GP8A 2NG1A 2ZRFA 2X8AA 4URWR 4DDVA 1S4QA 3B60A 1W36C 3A4MA 3SYNA 2N46A 4LHVA 1N3BA 2O8BA 1ZCAA 4D0GA 3MGCA 3V4FA 2ERYA
chains in the Genus database with same CATH superfamily
1KL7A 1E63A 3QEKA 3WAJA 4GH5A 2J32A 4RD2A 2YKGA 4KQFA 3RYFB 5ALWA 3E9CA 4G1EB 2DQ4A 5DLEA 2VQDA 1KI2A 3NNSA 1S7GA 4R8SA 3LP6A 3PC3A 2H2IA 4Q21A 3X2SA 3KVOA 1E2EA 1SOMA 2YNMA 5TGDA 2XQKA 5JO0A 1JKJA 2ZEJA 5AQ1A 4J6FA 1WXEA 1IHUA 4O4IF 4YWHA 1JQAA 2JBAB 3PFKA 4EJ2A 4GW3A 1A96A 3WG9A 1JG1A 1WOYA 3FSRA 2XT0A 3BDIA 3LO5A 5B6IA 3NYWA 2CVFA 3EXEB 1VC2A 2GHQA 2L2QA 4B5LA 3CA8A 3LOPA 4M1EA 1THTA 1X92A 1R6AA 2AFIE 2VXYA 3FRIA 4ZDJA 4LMRA 1B26A 3S2EA 1Q1NA 2MU1A 3BIJA 4CQMB 2QA5A 4CYMA 1FTGA 2HF9A 4D8XA 3O83A 2YFQA 4YUWA 1IPEA 1W96A 3MD9A 3ZVLA 1ZWKA 5AOAA 3OUUA 3HVJA 2Z95A 3OF3A 5KKAA 3J81k 5DWQA 4UNQA 5LFAA 3SVLA 2YWRA 3L8MA 1AU9A 2OAQ1 5FI3A 4CMIB 3WLFA 4Z2YA 1DO0A 3B48A 3D7SA 1R50A 3LVRE 4TQAA 1RQ2A 3GLTA 2Q07A 2Q6IA 4ATNA 2QQEA 3IO5A 3QLEA 1V16B 3VH3A 5JISA 3L0YA 4LUCA 2W2KA 1W581 2X1LA 3HRHA 3GD5A 1JG3A 5IDQA 1WCYA 4PFKA 3DEJA 4IHKA 1LDMA 3GP5A 4QT4A 3PHLA 3BERA 1A4UA 3HP7A 3Q9LA 3U1TA 4BFCA 4B47A 1USWA 5TB5A 1T0JB 2OXRA 3NHUA 4TL8A 2CCJA 2VTKA 3QE3A 5EJ9A 1E6WA 1FLVA 2YXPX 4IRUB 1Z15A 3ZGZA 3G59A 4REOA 1LSSA 1L4HA 2I9PA 3A14A 1OA0A 2GFIA 1KBQA 1KAQA 1RC0A 1UJ5A 4MW4A 1T36A 2XXAA 1MQAA 3ZK9A 1JJBA 3GLHB 3S2GA 4KXQA 2ZU0C 4RLHA 3K9NA 3AM3A 1UPBA 2C5SA 2P6PA 4Q3NA 3B13B 2F8TA 3VR5A 1Y9JA 3ELUA 4DLWA 1SVLA 4WZAB 2CL7X 1KTVA 2A3NA 6Q21A 2Q4TA 721PA 1NHWA 2QV7A 1V8PA 3COYA 4ALLA 1MV5A 3FH0A 3CY6A 4O3MA 2HTFA 4ZHQF 1NM5C 2CDCA 2EZ4A 1JTEA 2C4VA 2FPWA 1V37A 1V5EA 3C85A 4M8SA 4CHGA 4CKYA 3GLIB 1H1LA 2QX6A 1QCDA 3CONA 4Y8VA 3WNQA 1Q0ZA 3SZUA 1DJQA 4R68A 3Q3IA 3T3HA 3CPHA 1D2RA 1PGOA 2P7HA 4OB7A 3RB8A 3WOHA 3ZV5A 1JR2A 4HSEA 3VR6A 2PGLA 3F6CA 5ADWA 1N7IA 1J2RA 1XAGA 4ZWNA 3H5NA 3M3DA 2HMUA 3T3IA 3KKEA 3E81A 2B2NA 3HEBA 4DLTA 5F7OA 3ZDYB 1BXGA 2J9FB 2VYCA 5BSHA 2GK7A 3BMNA 5K8TA 2XR1A 1QFXA 4NSNA 1T1EA 1DAEA 1XL1A 1RTTA 3N53A 5E8JA 3HJTA 3E9EA 4ZOEA 2W43A 2P27A 3VU3A 1IM2A 4YJ2F 1YASA 1P4GA 3EXFA 3IC5A 3QXSA 3E7FA 1DC5A 4O2BB 2JFVA 3CV3A 4QA9A 5AKZA 1CU1A 5F21A 3ZH2A 1E7SA 1RP1A 3DEKA 1IXKA 3QXGA 4FJ2A 5EN4A 4C7JA 4F9TA 2J4CA 1BO6A 1NVVQ 2KWIA 3KLOA 2W8BB 4F97A 1ACLA 2H2HA 2ZBRA 4HR7A 1YS4A 3IAFA 2H0RA 4HB3A 4CU2A 3N2ZB 3NRCA 1H1LB 2H0AA 4EK9A 2IIBA 2KBFA 1C9YA 1UBOS 4Q93A 1XU9A 3EG9B 4F2GA 2ECFA 1HYBA 1O08A 3EUEA 4ZI7F 1W93A 5ENVA 5I4CA 1KYTA 4GLLA 1XEWX 2X5XA 4MV6A 2GPYA 3TIFA 4JP1A 5C9ZA 2O2JA 4XE5A 3EULA 4G85A 4CJXA 3DE0X 8GPBA 3W6PA 2VJOA 3PVCA 5FL3A 1Z6PA 2YJ4A 4WA8A 3RD5A 1OFUX 2ZJ8A 2M6LA 4C2UA 3CNLA 3A70A 1JDZA 1KJNA 1P6QA 2H7YA 4YROA 2PWBA 4RZUA 4DMUB 4E5MA 3N6XA 2IEYA 4NTZA 1OKKA 1DQZA 2G7ZA 1GO2A 4J7CA 4LXQA 4V39A 3GH3A 4CWAA 3BH6A 3CUEF 1MH9A 2FWAA 3S8YA 2P67A 1YL6A 4ALMA 3P9PA 5G53C 4J0JA 1U7XA 3MA0A 4R8LA 1B7GO 2J9GA 3OEYA 1QAOA 2A8YA 1CDZA 1AK2A 4ETIA 3ZPXA 5KJFA 2WF8A 4J0EA 5CEFA 4H6PA 5JXJA 4PYLA 1WZIA 1LB1B 4KO4S 1JALA 3W3ZB 3DFIA 5C35A 3RC8A 3KT6A 3B6JA 1YE8A 2XZPA 1E9SA 4R5HA 2HDWA 1R5JA 5KOHA 4UVHA 4AWBA 1T5DX 2PM8A 2ZJAA 3MT8A 2IHKA 1NW3A 5JRZA 4M9ZA 2C3PA 1GR0A 4RD3A 1NBHA 1EFDN 1VJRA 2FW8A 2OHJA 4LXGA 3GT4A 4U2EA 4XCXA 2O8DA 1XDBA 2OQIA 2WHXA 2ZRHA 3G5AA 3KJQA 4HDSB 4YNBA 1BS1A 1LTHR 4FMCB 3WISA 5E3HA 5JALA 3NDJA 3WKAA 2JBWA 2NSDA 3BBLA 1U3TA 5K4GA 1XNJA 2HRCA 4L4XA 3GGGA 1D1TA 4KZPA 3UY4A 3WWDA 1L8XA 3Q8LA 2HA7A 1FFYA 3PPYA 1D2GA 1SKQA 2AVDA 2OO3A 3WGLA 1IEXA 3BYZA 5D7NA 3MCAA 2XNJA 1ULTA 2PVCA 4CCYB 2X0JA 2WPDD 4NFYA 1MO6A 2QP9X 3OFVA 4HDOB 3V3TA 4KN9S 2V9ZA 1O4VA 3EISA 3I01M 3HDTA 4WOPA 5FPHA 3T35A 4CF6A 4U2GA 3NASA 5L3QB 2YHIB 2HUPA 3IS3A 4KI7A 2H6EA 3V4LA 1UJMA 3T8YA 1LPAB 1XA3A 2ZI3A 3OWXA 1KOFA 2QY9A 3OF2A 3B3JA 3BMOB 3WIVA 5FWNA 3A2KA 1S4MA 5K6TA 1JPJA 4RJTA 1CZKA 1Q1QA 1TKAA 1ZVQA 2I29A 2OBXA 4L2IA 4ENSA 3CX8A 4I5GA 2R7NA 1XTSA 4NZ9A 5FBVB 4AKGA 4F11A 1AF4A 2BE7A 1AXGA 3SQLA 3DF9A 2NXWA 4QBGB 2MSCB 3MRVA 4AF8A 2ABWA 5HOEA 4HTFB 3GPLA 1NHGA 5HJ2A 5CP8A 4V38A 2IS2A 3BWXA 4Q47A 3MBOA 4AJPA 4INPA 4LZNA 3BE5A 1MOQA 3KUUA 4LWQA 1DU4A 4J91A 1JDSA 4WBXC 3FOZA 5JIBA 2QNRA 3A6PC 3K9LA 3VPAA 3LPLA 1ORWA 1U9JA 8MHTA 3B82A 5E7QA 4M38A 1ONOA 2P6UA 4NPHA 2PLRA 4Y2QA 5AI8A 5FL7D 1CP2A 1MQ8B 1MAWA 2PO7A 2CCGA 3JQ9C 3OLWA 4HVCA 4CIAA 3WAGA 4BPRA 3AF6A 1UAYA 1WMFA 1J21A 4UU1A 3Q11A 1JX6A 4RA6B 3W5HA 2H51A 1UC4B 1ZISA 4FYIA 4RKFA 1RXEA 1IOVA 4IDHA 2R1TB 4Q39A 4XPIB 2BD0A 5B12A 3GFVA 4FDVA 2ZKLA 3CW9A 4AZSA 1G64A 2XMCA 3I6MA 4MO2A 5ALGA 3DZFA 1U11A 2ZB2A 4JLAA 4OJKA 3FWHA 3COZA 4TZ0A 2BEUB 1GZHB 4HX5A 1DMSA 2N9UA 4L3VA 2WU1A 4X6YA 3T6KA 4TLMB 4HH4A 4K1LA 2K7FA 1EPUA 2VWPA 4YQEA 4E7OA 3G2OA 4RK4A 1QTRA 2AZ4A 3IALA 2BZGA 3H2GA 3PRHA 2DPGA 3PE4A 5HFAA 1M2VB 2PSJA 1W46A 1FUKA 4DZRA 3LDAA 1L5QA 2V3WA 3JYHA 3U9TA 1J2EA 1XCBA 2XZOA 4WHMA 3BFJA 2WTUA 5BQXA 2G06A 3HB0A 3MMPA 3X43A 1ILEA 2COEA 5T67A 3H87A 3LKZA 3TQSA 2RC5A 3DUFB 3LGAA 1AA9A 2ETXA 2ZYHA 3AL3A 3NGXA 4IIJF 4M88A 3S2YA 1PGPA 2YIJA 2BKUA 3NKLA 4C0XA 2H3EA 4FYWA 1RVDA 1RWBA 4IMPA 1X7XB 3PRJA 2EL7A 1X86B 3ZEAA 5BURA 5D85A 2P9TA 1T6XA 4RLQA 4ALIA 2XB2A 1PYOA 3S7TA 4P54A 4W5JA 2O9JA 3DJYA 3QELB 4MS3A 3VH1A 4JUIA 5HCNA 4JFRA 1EFHA 2ZWPA 4CLDA 3AF4A 2BELA 4RVCA 4UTRA 2I34A 3W6NA 1UEXC 1Z4IA 1QK5A 1U0RA 1TIBA 4MVJH 4P80A 4WECA 4EHIA 4C4XA 3TB4A 1ATIA 5CITA 1II0A 4M36A 5EJ8A 5K6RA 4YRAA 1YNSA 2OILA 5JASA 3G9UA 4RKQA 2WJZB 3SLGA 2G82A 1T8SA 2O14A 4QUJA 3MC1A 3FOBA 3TQFA 2AC2A 2XJ4A 3R44A 5TDHA 3K71B 3N76A 3NHFA 4JAVC 1OLUB 1MNQA 1VBMA 3GJ7A 1A9SA 1XQWA 4QLAA 1KH2A 1OREA 3UMVA 4DHEA 3UBTA 2BONA 2R1VB 3CPSA 4HNHA 5KTPA 3KZXA 3O4GA 3HYSA 3LCJA 3W2HA 3WGJA 3E8XA 4L8GA 1QRDA 1QQ5A 2PVSA 3CSSA 3VZQA 2JAOA 4B3IA 5JZSA 1LFAA 3TQOA 4Z4IA 2F55A 4GIBA 3BOSA 3CUUA 1R74A 2UUBB 5BXYA 5JNWA 3RTEA 5IC6A 3H84A 1XTUA 5TS2A 2F4NA 1J00A 1XNHA 2H48A 1DPFA 5AKJA 2OKCA 1B8UA 2GJ9A 1Q1ZA 3WYCA 3EVGA 2Z56A 1ZR4A 4A0RA 4JY7A 3OHMA 1LV7A 5EWMA 4CZ2A 2I3BA 1BCSA 3LZCA 4BO0A 5LU8A 2YX1A 3WXBA 1GWNA 4AYWA 1ISMA 2FG7C 5HBGA 2COUA 1OB5A 1J9EA 2YJ5A 4Y0VA 4EECA 3ILXA 3CWCA 4G23A 2GBPA 1FIUA 1CFZA 5KYUB 5CD1A 1ZWLA 2XYGA 1U7DA 1PD1A 3GOHA 1IM8A 5DMXA 5MDHA 1WA5A 1N6PA 1O94D 2ZPAA 4EG4A 2MYPA 4FFOA 5EHIA 1D2AA 4HVLA 3HB4X 1FW6A 2C2MA 2Y1CA 4MNTA 3GRPA 1H5UA 4BMNA 1LS1A 1VRWA 4FI3F 2QZJA 4X90A 1TTQB 1ZPDA 2JCBA 2HT1A 3NHLA 5E0KB 1BDBA 1R9NA 1XCOA 3LGSA 1IK6A 1V9CA 2AF4C 3L7AA 5BW6B 2CE7A 3TW6A 3OIUA 4NQRA 4Y3UA 1N5KA 3KOZA 3AGQA 3AR2A 1Z2EA 1DINA 1BRMA 3VI4B 4BGDA 2VPPA 2WSLA 2DR2A 4PR3A 3BE6A 4RA6A 2CJXA 3BJMA 3I37X 3T34A 1YRYE 4BDTA 2EQBA 4KUGA 1GQFA 4DHWA 1Q95A 4I50B 4ECAA 1ZIYA 1Y5RA 4ERXA 5ITZB 1CZHA 1ZNXA 2NXEA 1PNOA 3L9XA 3I4FA 2F9MA 4EH1A 2FV8A 2V5UA 1GU0A 1PJBA 2WM3A 3PXAA 4IMRA 1DHRA 3VR6D 4KXUA 2BMDA 4RAQA 3DVLA 4CIWA 2ENUA 3FPFA 1XYYA 9LDBA 1GEEA 4UEKA 5EP4A 1FLDA 2GJKA 1G8KA 1T3ZA 2NZ8A 4BRUA 1OXBB 5ALNA 3TOCA 3USCS 2VCYA 1XTZA 1AHIA 4L5AA 4RKWA 2FN3A 4O33A 1TMOA 1VJCA 3L8HA 1N7JA 4H17A 4K9LA 4KQ9A 2KI5A 4KAXA 1D5CA 4MGHA 2WJVA 3HN6A 3DZKA 5ALTA 2VF4X 3D0KA 4MVJP 2IXGA 2J3DA 1J90A 3EGOA 3RBZA 1JR3A 5HKOA 2C7RA 4PFQA 1HDCA 2W90A 3QYJA 2CJYA 2VJKA 3TEFA 3ROKA 4YP7A 3OZIA 4WD3A 5A4AA 1UR5A 2HEGA 3EYAA 2PLAA 1SOWA 4WEOA 3EXIB 3K15A 3QUAA 4ZJYA 4O2AA 2B1IA 3R8CA 3AK4A 1UDBA 1SQSA 3E2MA 3OZEA 5BV1A 3PQDA 3L4BA 4TYPA 1CZUA 2HNKA 4PYQA 4EBFA 2G28A 3GH1A 2C7VA 1KA9H 1UH5A 3V9PA 4KNWA 5IPFA 3BL6A 3JWJA 1E3MA 1MVLA 1Y5NA 3BZUA 5IP5A 3ZE1B 1JH8A 2GM3A 3MG9A 1NX9A 2JFWA 4YAEA 4JFAA 3BTUA 1L5GB 3MXTA 1T0UA 3O91A 2Y68A 2LKDA 4PLWA 2BRUC 1JDPA 5EJGA 1Y4DE 1NFRA 1YS2X 2GEKA 4H4CA 2O19A 2ZB4A 1XFDA 3DZGA 2I6UA 3NO4A 1WNTA 4GD3Q 1F0YA 4Q4HA 2QRHA 1ORIA 1Z07A 4OGFA 1T5LA 5EUCA 4XVUA 2ZANA 3IBSA 2P5SA 1GPH1 5E4TA 3UB2A 4AMGA 1L4LA 1VJTA 2GFQA 1PW7A 4OK5A 3UANA 3V32A 3ROFA 4A73A 5AJHA 1ULAA 1L5YA 3B3QA 1YVEI 1B8NA 4UHBA 1FYVA 3PYMA 3LQYA 2KJQA 2CYCA 5ILQA 3SYTA 5B3AA 4Q48A 4BNNA 1Z17A 3DR3A 1PE0A 5LZ5A 5K0EA 1RAAA 3C8MA 4RHYA 2C83A 1V7PC 4C4PA 4E5YA 1UL1X 4HV4A 3DLCA 3QF4B 3S44A 4B9AA 2GF0A 3FYUA 3MGBA 4JWKA 3B8EA 5C5DA 1SHLA 2AZXA 3FYTA 4MP3A 4BCDA 3KPJA 2W6QA 4WNIA 2QIPA 5AOVA 3ZX4A 4YLYA 5K0GA 4J1NA 1J2JA 4YH1A 4JJ6A 4QSMA 4AMYA 5B7GA 1L4FA 1Y8QA 1A9TA 3LNCA 2XF2A 1NFFA 1XZAA 2IYLD 1UK9A 1N0HA 3MQFA 3TX6A 2QUKA 2W2QA 1SZJG 3KHTA 4CF4A 3QA9A 4MV4A 2WI8A 1T34A 1EAYA 3VVLA 2CV2A 3R41A 4XLZA 2VQFB 3VPHA 4CN8A 4IFEA 3HCCA 3ESYA 4DWOA 2ZJ5A 4KYUA 2P3OA 3UBMA 1CHDA 3D6FA 3ZVRA 1W4RA 3ITNA 3U3DA 1QIIA 2DQZA 1UMDA 3N9IA 4GQIA 4LSGA 1KDOA 1Z8NA 1VHTA 2GK4A 3N2KA 1G3MA 5F5XA 3W2FA 4ER3A 4EYQA 1SBZA 1Y4ZA 4OA5A 5FEMA 4JI8B 2Q8QA 3K94A 3ZNNA 3PR1A 4M7PA 4F3YA 1T1SA 4L8LA 1FP6A 2NYAA 3ETGA 1TUGA 5CR9A 3V34A 4FU0A 2R8BA 1XT6A 2X0FA 2J6CA 5FA6A 4ARSA 4C0QC 1MAHA 4LHWA 2PJRA 2AEJA 3NHMA 4Q19A 4B76A 3PEWA 3F73A 1IUPA 1UFRA 3DMDA 3IDQA 4EF6A 1WLYA 3BE4A 5I7OA 2PUGA 1Z7YA 5JU6A 2JJ2D 4YAGA 1EB8A 3IP8A 4PXAA 3A05A 4L0CA 4TQUS 2IZ6A 2IBTA 4X71A 2H1FA 1LC0A 2A30A 5EL0A 4B3MB 1TYZA 2E4ZA 3FI0A 1P0IA 1UP4A 4D6YA 1DELA 2V8OA 3QLJA 1RYYA 2DFLA 4RVOA 3TL3A 1GT91 4OLFA 2QL6A 4NK5A 2FWBA 4KQXA 2CHGA 1U0NA 4YAFA 4ZXFA 2C2YA 3EDQA 4IMIB 1LWOA 4LQ4A 4NF2A 4K1XA 3SBXA 3W5AA 2YVUA 5BRNA 2AZTA 1CVLA 1JSCA 1ZU4A 4IIUA 2R8RA 5EXEA 4DV7B 3IEVA 3FNHA 1QWOA 4L4UA 3MQ4A 1Y81A 3N8NA 1QIGA 1GD1O 2R5NA 3ETLA 3KTFA 4N0PA 2VTEA 3BMQB 1PL7A 2IHVA 4ZAYA 4JA2A 4PFSA 4BC0A 3L84A 4D9KA 3K1JA 2IYOA 2HLDA 2ZSIA 3KQYA 5DGHA 2QAGC 4QHTA 3NC0C 4NWIA 4QREA 3RU7A 3VYVA 4C0JA 4ZCRA 5CFMA 2D1QA 3JZFA 4W5OA 2QKYA 3R7WA 1XSEA 5JWRA 3IL2A 4TXHA 4GXRA 2JJYA 2QLTA 3ZWXA 3SF8A 3UGQA 3EGVA 1FXWA 2NP6A 2OXFA 3NWOA 5M5BA 4D4KA 2PFGA 3G9TA 2FZKA 1ZP6A 2ZBGA 3G7NA 4BATA 4DNPA 4WDRA 1N6KA 3C7AA 4RMJA 2IBMA 1YS9A 3IVMA 3K5HA 3EEOA 5J2UA 3TBFA 2FMFA 2H0QA 3ET5A 1PEAA 2IEBA 4FDMA 4WCDA 1PJAA 3OE7D 2AOWA 4UEOA 5KVQA 1VCNA 2P0EA 1BW9A 1Z0ZA 1MJHA 1H05A 4GVXA 2VH1A 5C7YA 9ATCA 3K9GA 3P0FA 1CY0A 2OB2A 1F1BA 1R00A 5LIRA 3T5BA 4NECA 3SEZA 5EJ5A 4DC1A 2J33A 4HMPA 4NL4H 1EP3B 1E6LA 4OXKA 4Q3LA 4BNTA 2ARKA 3PB3A 3P5BA 4LKOA 2OVFA 1G2OA 1VB5A 2CVZA 2VFAA 3N2IA 4RH1A 5D3MB 3CYFA 3EGDB 2IYFA 5AJVB 1JMVA 2ZUDA 1QF6A 3H16A 4DMHA 1ULBA 1EH5A 4IGAA 4C1NA 4EVRA 1T6BY 4A0GA 5DLYA 4F6LA 4ENPA 1BOOA 2PQMA 2OGWA 4LC0A 4DVJA 2O0LA 5EIHA 5JZOA 1SVMA 1YOVA 2BRUA 3A1UA 4PCLA 1IK4A 1QE0A 4LF4B 1O95D 2LWIA 1NUSA 3UG6A 5EHZA 3QVUA 2WAMA 4Y0AA 1C7ZA 2FPXA 5CXSA 2OHGA 2QVYX 3FDZA 3OX4A 2IUSA 4FTWA 4LBYA 4NEGA 1KC3A 2RHBA 2I67A 5G3YA 3T9FA 1N9GB 4GKVA 2CEKA 4DNOA 3WDLA 1RLJA 4D4MA 3EOAI 2QN6A 2WVJA 1F38A 1GZ5A 2HFJA 3ABZA 4RHFA 5K5EA 4RMIA 3W78A 5K8LA 4DIKA 1DEOA 2DULA 1U0EA 3O9MA 2SKCA 2GD6A 4IIEA 4F96A 2VQSA 1JQEA 3VNVA 3V5NA 1GPMA 1KF0A 3EXHA 3GNTA 3GRVA 4HF7A 4Q00A 3ICOA 4L2IB 1ODJA 2JEZA 2RGGA 2PK3A 2Q1UA 3CKMA 1JDBB 3OM1A 3KDPA 2V6BA 5LQMA 2C8JA 3IAHA 1S0UA 3FCXA 3JQ7B 3UWPA 1PK8A 3PPWA 2BM0A 2AXPA 2W0SA 3HYCA 3IAXA 4N5IX 5IN4A 5A06A 4Y9DA 4EDFA 2XCQA 3OFND 4PO8A 3UMYA 1FTWA 1OE0A 2W4QA 3CF0A 2GH1A 5JJCA 1GZ3A 3SDZA 3AG6A 3UW3A 3PC8A 5F7ZA 4ZDIA 1RXUA 5DEIA 1H69A 3NM5A 3TVYA 2ZRNA 2PNJA 3JQQA 2OK7A 4V1CI 2AL7A 5ELXA 3STTA 1XEXA 2NGRA 4I55B 3PHHA 4KAFA 3MLEA 4I5IA 1H5NA 4BMCA 1K8YB 1XMOB 1YBFA 3W2IA 1PCXA 3WJ2A 3LG2A 3GYGA 4AO8A 4BNLA 1KEKA 4RTJA 3B1JA 1JEYA 4U1RA 4PC1A 2IPOA 2WEKA 1P77A 5C51B 2UXCB 4PAQA 2VH2A 2Q8PA 2WUDA 3MJRA 1UM9A 1C4OA 1MOPA 3NU1A 3WGUA 4ZVTA 3RHSA 3AONB 1JN0A 3H4MA 4KX5A 1BW9B 2BN4A 2QTZA 2QX7A 3A27A 4KFSA 5DHQA 2O0JA 4EF4A 3IEXA 4UJ3A 3M8KA 3D3NA 2QRUA 1F0PA 4FM9A 1NVEA 2AJCA 3A3YA 3IPRA 3I2HA 4LE0A 5KOJB 3O2QB 4B6QA 3RUIA 4M49A 5FDFA 3EEBA 2HXSA 4GDMA 4EKIA 1AC5A 4TWJA 2D0OB 5DU2A 5I7WA 4MVJD 1NR1A 3S0JA 3BWEA 4XRGA 5JI3E 3PFCA 4Z4GA 4FMDB 4DY6A 5JJBA 2UDPA 4PZZA 3G5MA 3IEMA 2OUIA 2FUG6 3U80A 2Q5JA 4DLSA 2IUYA 4H0FA 1M1ZA 3UHFA 4RDHA 4JI0B 4X7RA 2YMPA 1E2IA 1MB0A 4BFTA 1UOOA 2RJ3A 4A8JB 1OB2A 2PQ2A 4ZVMA 3UH1A 1EUCB 4OA8A 3ITEA 5FUWA 2EP5A 1E60A 2OE2A 3PTZA 4M83A 4X20B 4FYHA 2JASA 3KHUA 2PX6A 4MKZA 2EFJA 3P4UA 2F7SA 2JGNA 3H5OA 4WPGA 1UBJS 1CBUA 2AX4A 4P38A 1TIKA 4P4NA 3FZGA 3ERCA 1E2UA 3BXXA 1YO6A 1V39A 4CEJA 2O8CA 5TIIA 1HQCA 3DBHA 1DC4A 1KARA 1SCAA 1XZEA 4UXIA 4BKOA 4Z7QB 2CB0A 3THRA 1XZNA 1F7VA 3L0PA 1YQ9A 1NVTA 3AOGA 1N4AA 3U3KA 5ALLA 2R0QC 1Q0UA 1M0EA 3NHAA 4ARCA 2WC1A 1QIHA 1ZXLA 1M2FA 2X0RA 4LK3A 3NMUF 6NULA 2JS7A 3VFDA 3TGPA 1N25A 3HKCA 1ORTA 1V1RA 2C5EA 2FCRA 3R6WA 3JWHA 4KPUA 4LBZA 4MH0R 4PX5A 3LHSA 4KC0A 4CIBA 3Q7QA 2PUJA 4LJ6A 2HMAA 2Z8YA 4H6XA 2FWRA 2EJWA 3A1EA 4HDNB 1TRKA 3ASYA 1EP1B 2PH7A 1TJ5A 4X0EA 3VJMA 4CTJA 3D8TA 2FPPB 5I4KA 1GKIA 1FU4A 5C3MA 1LQ2A 1T4GA 3CFYA 4DR2B 3KPWA 3NANA 3N2KB 1AMNA 3WLMA 2B61A 3BX1A 1ZGZA 4HK4A 1P29A 3RIGA 1WG8A 2HJ9A 2JGMA 5EKDA 2HLPA 1P5ZB 1RMQA 2AB0A 2QROA 4WY8A 2OZEA 5FTJA 1MV8A 4BNVA 2IYWA 5D00A 2R751 5KTKA 4BB9A 121PA 4QAQA 3T99A 3S2ZA 2E6UX 5T6MA 3UB4A 2VP0A 2EWVA 3CKKA 3LY9A 3Q6IA 4MKXA 4X7BA 3KT3A 1W52X 3JPYA 2WIFA 2VHJA 3ND5A 4NENB 1K4YA 1RABA 2RIRA 4DG5A 1LBTA 5GJVC 1SU7A 2FMUA 1OZFA 2I6FA 5LPNA 4KSCA 2X5NA 2B8NA 4Q4CA 4NBKA 3ED1A 2GPTA 4C88A 3T9BA 3ABSB 1F4LA 2XYVA 3VX4A 4DUGA 5LKAA 3ESDA 2C9YA 3NM4A 5U4QA 2LCFA 1XVAA 5AK0A 2EFHB 3OZBA 4C20A 1SC3A 4EYGA 4WLEA 4TLBA 2NU9B 3LWZA 3V7WA 5EXPA 1SG0A 2FLKA 3HUDA 2J59A 4M46A 2QMOA 3CRNA 4EJMA 1TT5A 1X1BA 3FVTA 3IHTA 3OMLA 2ZKIA 5H02A 3MJCA 2PUTA 4N0QA 4OREX 5B64A 1H9CA 5LC1A 2ISCA 3MM4A 4RZSA 4HYQA 4TTIA 1Z36A 2LTAA 4IDEA 2F17A 3KZMA 1DKQA 4JK3A 3GG2A 3RVOA 3M7IA 3QGMA 4Q3EA 1TQ8A 4DLKA 1JDJA 1W4BA 1RQXA 2X9GA 3FNRA 4K9SA 2G5CA 1Q74A 1TUEA 2JNWA 4D26A 5J2TB 5AP9A 3ANNA 3BHJA 4KXFB 2XQIA 3GB9A 1SUIA 1FVOA 3ZE0B 2GM5A 3ZOZA 4HYYA 4BFUA 4C5CA 1W87A 1KDYA 2O1XA 1F2TA 5HCUA 3F8TA 3HVKA 3TLBA 5A5VA 1CUYA 1GKKA 5ULLA 1L8LA 2PZ8A 1PFUA 3RCBA 2UU9B 2ZJYA 2DP4E 1ESDA 4GPBA 1J07A 3VI3B 4HDQB 5COAA 2C0CA 2W2MA 4MWTA 1W4CA 1U3CA 2AA3A 4JDUA 2EJUA 5JS1A 3I8OA 2MINB 4JLUA 1JSLA 2ZR0A 3DH0A 3A6ZA 5EIBC 3U3MA 5BOSA 1IY1A 2G4LA 1Q3HA 3B7GA 3ZWMA 4OUKX 4C9BA 2Q46A 2QUAA 1DX6A 3JTMA 3WGOA 4B6RA 2EYUA 2W4IA 3K5PA 4UXHA 2BR5A 3D02A 4IS2A 3JAMA 1I36A 2QP4A 3EVFA 3TOZA 5E4YA 3O5AA 2HRQA 4OIMA 4B84A 4MWDA 4YRBA 1W2GA 3LFTA 3O2JA 3NWPA 4WZBB 4P0QB 3DZHA 4EMUA 3VKHA 3NW9A 3Q98A 4DIEA 1M1YA 1OILA 3QXJA 3A4NA 2GLXA 2O1WA 1B8OA 4ZT3A 5G1NA 4BEVA 5E95A 1BMTA 1NUAA 4HH1A 4REMA 4G81A 1HPLA 2EW1A 1AS0A 3A6JA 3L49A 3TRHA 5IJ9A 1A8SA 2XUPA 4X64B 3RT7A 4CR8A 5FORA 5BYJA 1GAWA 1P60A 1ZGJA 1TEVA 2UV8A 3ZDCA 2D4AA 3L7YA 3RSFA 1TGYA 4Q34A 2XYPA 3LHDA 3K8ZA 2GESA 2BEVB 1ESMA 3KQVA 4G84A 4NZZA 2J4FA 4RY0A 5C8YA 3CLSD 1TF7A 3ML1A 3MRXA 3H97A 1UQUA 4JLJA 1C9EA 5GONF 3U7HB 3HB1A 2CVQA 3A4YA 4C2BA 2CLMB 4UHCA 1ISGA 2YXLA 1KI6A 3ANXA 1P9OA 3QVMA 1KAMA 1MTZA 3R5JA 4JQCA 2AG5A 1T2VA 3FOCA 3QEJA 4JLNA 4TKUB 2GCGA 1Z4QA 2WF5A 3PNPA 3OLYA 3HNPA 4CF7A 3M6VA 4FKZA 5ALQA 4EB3A 4WZAA 1PZFA 2R7KA 5JZBA 2Q7XA 2V7TA 5E7IA 4DB4A 2JLSA 1AHNA 2Q5QA 2B1RA 5E4FA 3CJRA 3QZUA 3UAXA 5H5JA 5AJXA 3JWGA 4JITA 4BVHA 4FNOA 4GI7A 2Y66A 1KRHA 2YRXA 2ICAA 2VJPA 3AZOA 1Y3AA 2XXAB 3REQB 3MJFA 3D1VA 3GFQA 2K4MA 3BB1A 2XNKA 3QVGA 1KYIA 3I04M 3O26A 3OTQA 1HFEL 4KMMA 4N5MA 1W36D 4PLHA 2OCGA 1W7AA 1LTKA 4BVFA 1PNVA 1JRLA 2MTBA 3PV0A 4JCOA 4YQZA 1RKBA 1HEIA 3WWPA 1JMKC 3OJEA 2QLMA 4GZ6A 5DN9A 3OQNA 4RF5A 3HXKA 3LUCA 1P62B 3NHSA 5A3QA 2PMDA 3LUDA 3TOXA 5THQA 6AT1A 2X1VA 1Y37A 4EG1A 4I9UA 3KJGA 5E9AA 3ZDBA 1UMBA 2ZIXA 1LUAA 1XAIA 1NY5A 4IHJB 4NDNE 5DIZA 3KKKA 3RJ9A 1QG0A 4WOCA 1XTBA 3RAGA 4HNQA 1PVOA 2YYZA 1Q7RA 5BQOA 1ZC3A 1SUBA 3SSAA 2UVPB 3DAOA 3LRXA 4LHEA 2W6IA 1VG0B 5G2OA 5FADA 5EEGA 2Q50A 3E82A 1E6EA 5AXCA 2ZI9A 3BIFA 3VBEA 4NCBA 2WRZA 3JZDA 4ZT2A 1D4FA 4AG5A 4LJYA 4ZPXA 3PEVA 4TXLA 4PPGA 3QVJA 4WLOA 2UZIR 5F33A 1NNSA 2CNLA 2O59A 4WESA 2Q3MA 3HGQA 2X42A 3SZGA 4KQGA 5LBTA 1P3JA 2EGHA 4CUZA 1O5TA 3KEGA 3W8FA 3B5JA 3TXAA 2J6IA 4YCNA 1XJ5A 3PLRA 2Y77A 4BV8A 1FC0A 1H8HA 4IEFB 3JAKB 4LTDA 2REOA 3H0EA 1DT3A 1VCIA 1OOEA 4H0CA 2IOFA 5FFFA 3Q0IA 4E5UA 2Y4OA 5G4KB 5IJZA 3IQXA 3KSMA 1VYTA 5DTIA 5C2JB 3H7AA 5IVIA 5CA1F 1XN1A 2EG5A 4GYWA 3FLMA 3FPAA 1X19A 2FW9A 2KLBA 1W0JA 2OFOA 1DIBA 2Q27A 4OYLA 1VKZA 4Z9AA 5FOUA 4E6EA 3UH0A 3HB5X 3RFXA 4BN0A 3OZUA 4QUKA 4C7BA 3OCXA 1OZ0A 3QIAA 4RSHA 4OAQA 3HG7A 2VDMB 3W3AH 5HFNA 2PGXA 2OGTA 3OOEA 1EIWA 1IN8A 2N3ZA 1RZ3A 3QFTA 1QGUB 3PF8A 3W2TA 3H04A 1VKJA 2V6MA 3N39C 1GPWB 1NUPA 2C1XA 4QLOA 1Y3DE 1X87A 4XQEA 3Q88A 1SB8A 4N18A 4Y6LA 4AAYA 3K6SA 2VYQA 4V0KA 1F9EA 1IAVA 1BCSB 4R01A 4CEHA 5ECWA 4OYHA 1JNYA 1NI4B 3NAGA 3R4VA 1XB2A 1G5HA 3FGNA 2GN9A 1JF8A 3IUYA 1K5DA 2A0UA 3EMBA 1B15A 3F98A 5A3SA 2ZM6B 1CR0A 3ZHZA 5I7HA 2POQX 3WLRA 1QP8A 1MJGA 4OKSA 1V5IA 2C7GA 1L1FA 1LX7A 4QOHA 2X9VA 4NMHA 5HZHA 3G1WA 3HNRA 1CVIA 5I9BA 3SX0A 2H9AA 3E70C 1IBMB 1K0UA 1DJLA 2OP0A 5EEHA 5K6AA 1Z7WA 4MI6A 5KQSA 2YZ2A 1A76A 1I7SB 2Z4TA 3HB7A 3HBFA 4G0PA 1RCUA 4C30A 4YT2A 3KB8A 2JFBA 3TI9A 1EK2A 1GYPA 1J8VA 1SXIA 4EM6A 2WHPA 2E2WA 4AMVA 2I78A 1X7HA 1WW3A 1JBEA 2QTRA 4HS9A 4FGSA 3AB8A 3AETB 4L50A 1VG1A 2IQ5A 3A2LA 5F1YA 5DP2A 4EYSA 1HE1C 1P0CA 2OGUA 4PTZA 4X3OA 3R7SA 4RGBA 3MHTA 2RHTA 1VLHA 4I8XA 3HDYA 3VR3D 4FKBA 4DCNA 5FTKA 1O54A 3X2FA 4MIOA 1NN0A 3B70A 2L18A 4HXYA 3RSHA 1G55A 3WB9A 4HNAA 4WZ6A 3ZUPA 5IBQA 5CDSA 4WFJA 3IPCA 3QVGB 1FMCA 2F1KA 1Z82A 2ZQYA 3U81A 2FSIA 3ECCA 4K7JA 5GAJA 1ATZA 4AMBA 3IPLA 3ZEIA 1PZXA 3JASA 1FCJA 4AQ7A 2AYXA 3DE5X 1ICIA 1JAIA 3WKBA 4ZEVA 5AW3A 3RFTA 3WK7A 2KQUA 4TM7A 5AQEA 5NULA 4UARA 1E62A 3H1EA 3OCVA 1MP0A 4BFLA 4B3RB 1JU9A 4QJIA 1N5IA 4HAYA 1FRFS 1N2IA 3DXXA 4MW6A 5DYTA 4DQUA 4N6OA 2XODA 1HXHA 1R8SA 1X74A 2ZJ2A 4IM7A 1E7MA 4F5DA 1OGJA 3O7WA 2QTBA 2X0EA 4ETWA 1RWKA 2WMNB 5J40A 2VPQA 4JEUA 4PNHA 3R7AA 3WQHA 1U0FA 2ZR9A 4E07A 1FSGA 1J2TA 5AVSA 1SZDA 5M34A 2IHUA 4QTUB 4HAOA 5TPZA 1LBHA 4U5QA 3WJAA 1NW8A 2GRJA 4ZDWA 4B3FX 4D41A 4C1BA 4AG6A 2Y8EA 1TPYA 4FGWA 1XZIA 3VSCA 1PJSA 2GFHA 4ZOLB 1V3TA 2WHRA 2DR3A 2BUBA 3LCMA 2PD6A 1SRRA 4NCKA 1JHPA 3OFSA 2ZBUA 4UQOA 1G6Q1 2Z2JA 3HL4A 4JZYA 5LQNA 3DXYA 3O2SB 3QX7A 5IWAB 2IS4A 4DR1B 1CY2A 1MRZA 4M1TA 1WY5A 2FYTA 4X97A 2P65A 3MUFA <