1I4DD

Crystal structure analysis of rac1-gdp complexed with arfaptin (p21)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
177
structure length
177
Chain Sequence
QAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords ARFAPTIN 2
publication title The structural basis of Arfaptin-mediated cross-talk between Rac and Arf signalling pathways.
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2001-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1i4dD00
4YXWA 2QT0A 5LB4A 1Q1EA 3LV8A 1BO6A 4BLSA 2VIIA 1BIFA 1CJVC 4LV8B 4MYCA 5EXPA 3RSOA 4TZ6A 2P67A 3QKUA 4ZI3A 1MO6A 4Q1EA 1QRAA 1KI7A 1GL6A 2ZYUX 2UVQA 3B1WA 4KLZA 4V0MA 4YMWA 1XTJA 2OXRA 2G1JA 4RCZA 4PQYA 2ZYVX 4TLBA 3W6PA 1WBDA 2CE2X 3K0FA 2ZRJA 1EWRA 4C0SA 4GNKA 3VKHA 1G41A 2OG2A 3I3SR 2Z83A 3HPRA 1JQJC 1KSHA 1P2UA 2WWXA 5J4HA 1DEKA 3THWB 3ZJYA 5AR1A 1M1YE 3N2IA 2GBLC 4QJ5A 3MMPA 1DE0A 2GILA 2OILA 3L43A 2MSDB 4TTRA 4D80A 4RFSA 2AHOA 3WXMA 1F2UA 2D62A 3KJIA 4RKEA 4WZBE 1FNNA 4Q18A 2MSEB 1UKEA 3GMTA 1E0KA 4PTLA 3GLHB 4BASA 5LD2B 2NO0A 1N6PA 4YONB 4DLYA 2WWHA 3EWSA 1KOFA 5FOVA 2GBLA 4Q00A 3R8FA 2ZRHA 3KKOA 1SKQA 2NTYC 4PPFA 2W2TA 1F2TA 1KY3A 4TT3D 1KJYA 2QSYA 3QBTA 4NYIQ 4RJLA 4FCVA 1IN4A 2AD1A 2F1JA 1W36D 3ZYCA 2ZRNA 2FMXA 1FX0A 4HZUB 3VHLB 2PL3A 2H1LA 3K9GA 2ZXUA 2BJWA 3DOFA 3OE7A 1U2RA 2RGXA 3SJBA 1LNZA 4KYUA 5GJCA 1NG9A 4P4UA 2CLCX 1U0JA 1ZP6A 4TLDA 3RRMA 3SFVA 4XD7A 1IJFA 1OJLA 1SVOA 4BZPA 621PA 5JRJA 3NVAA 5DI9A 1Z28A 4D6PA 3KQHA 3A1TA 2CNWD 3PEWA 3GEHA 1GNPA 2EYUA 3I8XA 1TU4A 3CIOA 4IDPA 5C18A 1NMXA 2GJ9A 2ORWA 2QSZA 2C9OA 4RD0A 1GNRA 4NONA 3PUWA 4RD1A 2D2FA 3X1DA 4YMUA 2CL7X 3RAPR 1XBTA 2PT7A 5FL7D 3QXXA 2Q6TA 4M2LA 1N6RA 4M1YA 1KGDA 5JJKA 4TYPA 3SJAA 1QHNA 3K9HA 3B8HA 4TMZA 1E79D 1DAHA 1KJWA 3MLEA 4UXIA 3CM0A 5HR5A 1IM2A 4L15A 5BXQC 5KNCA 3SJZA 5FTMA 2W0SA 1E1RD 3CZQA 3SN6A 5IK2A 2D2EA 3HJNA 3IQWA 4IW3B 1P4SA 1SVIA 2QMUA 2ZAOA 3PENA 4V03A 2KE5A 5J4KA 1IN5A 1TQ2A 3LW8A 3J81k 1UPTA 5ANRB 3UATA 4AKIA 1U0LA 1KK1A 2HCJB 4RZ3A 3KB1A 1G8YA 4C2UA 1C1YA 5BWMA 2G3YA 1JR3E 2CL0X 2G0NA 5F3WB 1VPLA 1RZ3A 3W3ZB 2D3WA 4US1R 1E2QA 5KNDA 2VL7A 2QA5A 1ZM2A 2HYDA 2J9RA 1NVVR 4FWIB 3TSOA 3AVVA 3D7MA 1SVSA 3CONA 3JZAA 4GOKA 2XGJA 2RHDA 4C0QC 4E03A 5GVSA 3I4LA 1JXMA 4G3XA 1FP6A 2ZIAA 4JKYA 2GJ8A 3NWJA 4JJZA 1DAIA 2ATVA 4PPQA 4KSBA 2QM7A 1TF5A 2B7CA 4EAQA 5JBQA 5E7MA 3CRMA 4PO9A 1CRQA 1T3SA 4LHVA 2F43A 2GNOA 2ODBA 2OT3B 3T34A 4WW0A 1TEVA 4JT2A 3R9WA 2OFXA 4PR0A 5AUPB 2ZPTX 3GQBA 3QUSA 4D0LB 1UJ2A 1YRBA 2NPIA 2YWFA 2EU8A 2OSBA 1SHZA 1EK0A 2OV2A 1P2VA 3C5HA 3PV0A 4HYYA 2RGGA 5DGXA 3LFUA 2WJJA 1VG8A 3QENA 1MABB 4EFLA 1OKKD 2EWVA 3QEJA 4KFRA 1IN8A 3THOA 4Y0AA 3LX5A 3G0HA 1XF9A 1YZUA 2A7QA 3IHWA 3IKJA 5DO9A 2AX4A 4TSFD 1R0XA 5FBVB 1E96A 3GEEA 2JLWA 5SZIA 3MJRA 4R9UC 4QKQA 5B58C 1M6NA 2AXNA 4CVNA 2OCAA 2RGBA 2JJ8A 3U7EB 3W3AA 4F92B 1NN3A 1W2HA 4IXMA 3R7WB 3AKCA 4D4JA 1F6BA 2CCGA 3L0SA 1OF1A 2VTKA 3IIJA 2ZJ8A 3O8CA 4I99A 4B73A 4PAQA 2EWWA 1QHSA 2GF0A 3EIQA 3I73A 2GEDA 1Z6AA 1WB9A 2R6FA 3A6PC 4QXAA 4RD2A 2GVZC 3DKPA 3IQXA 1DPFA 2ZU6A 3U7HB 2PLRA 2YC2C 3CPJB 4A82A 3AVYA 1G3UA 2YOGA 4POAA 1G1MA 1PUIA 1WDTA 3CBQA 1E4YA 3CH4B 1LV7A 1H65A 1ZNYA 3OAAA 4PAMA 3ZZTA 4DJTA 2PJRA 4ABYA 4PZZA 3QKSA 4HUQB 1WXQA 2MSCB 5A0FA 4D0NA 3ADKA 2P6NA 5SZJA 1KNQA 4RD6A 2VHTA 1AGRA 4LJ8A 3NXSA 2WWFA 4QFMA 1S3SA 1Q1BA 1UKYA 2HUPA 4B33A 1CXZA 3QKTA 1UBGA 4M53A 4LDJA 4V02A 4AKHA 2YV5A 3BH6A 2NO9A 2PBRA 4A0FA 3IEUA 4PO8A 2C96A 4NDZA 1CR1A 1XEFA 1JR3A 2CK3A 2Q3FA 3AP1A 3OIYA 4IDHA 4LPSA 1QVRA 2Q21A 1R5OA 4MITA 1SZPA 3ZVLA 5FPKA 4CEIA 1LB1B 3MSXA 3IBYA 3ND9A 2QQ0A 1UFQA 4QBGB 1E9DA 1NG1A 2PEYA 1E2GA 1A1VA 4DUGD 4QNRA 4QJ3A 3L0PA 5KHOC 3PJRA 4JLNA 5EP1A 1HQYE 4B3DA 4B32A 2Q3HA 1E0JA 2JLQA 2HJVA 1ZM3A 3IHLA 3RLFA 5FBWB 3ZVRA 5EP4A 2IXFA 3D8BA 2PLFA 3NC1C 4KVGA 4TLCA 3IIMA 1IN7A 4LC0A 1VIYA 3BD9A 2XJ4A 4XVQA 4YC7A 1NKSA 1FL9A 3QXSA 2IYWA 4GP6A 2HT6A 2XTNA 2PT5A 3OEEA 3K0SA 1KMQA 1JPJA 3N2EA 4I81A 1AQYA 4FIDA 3BORA 4II7A 4HAYA 2ZRIA 2O8FA 3FOZA 2IXEA 4LSGA 4D0GA 2XNDA 3MFYA 4HB0A 1HT2E 1SULA 4NL4H 1DBSA 2ZRDA 3VR6A 2J59A 1W7AA 4GMXA 3QE0A 3C8UA 2ZE8A 3MWLA 4ZV4A 2ZJAA 2HDNB 2XOKA 2H17A 1T3LA 3AEZA 4TN1A 1UBCA 5TARA 1LTQA 1ZM4A 4WOPA 1KI9A 1F3OA 3QI2A 4V0OA 5BQ5A 2CMKA 3CH5A 4UXHA 3C14C 5AJZA 1RRPA 3CPEA 3EA0A 1GILA 1DVRA 4P4SA 3BS4A 1TMKA 1MO3A 3IPYA 3FB4A 2V4ZA 1KK0A 3QJYA 1H8HD 4FMDB 4UXJA 5BW8A 1N5KA 2P5SA 1GRQA 1UEIA 1II8B 4E22A 5HZHA 3PUYA 2J41A 2ZS8A 2QGNA 2O0KA 4LBVA 1T91A 1M8PA 3BBPA 2C2HA 1KI3A 2ORVA 2G6BA 1JEDA 4HLDA 3FMOB 3LQQA 4GOXA 4RFVA 4QNMA 5LBIA 1R5BA 4ARZB 3KJEA 5JFGA 4EFMA 5LPNA 2IYXA 5FUYA 3FYHA 3IDQA 3THXB 5FOTA 1UADA 2FV8A 2A5GA 2F1RA 4RSGA 1U8AA 1U9IA 3K70D 1R2QA 4OJKA 2GK6A 5HKKD 1KI2A 3CF6R 1VIAA 1NVWQ 5FR1A 2WAXA 1FQKA 3GFPA 2N1BA 1W4RA 1KIMA 1NJFA 2FA9A 1N6IA 4DDTA 1Z2AA 2C78A 4A8JC 2REBA 4NU0A 1BMFD 5JEEA 2GK7A 1VHTA 1GL9B 4D82A 3I5YA 2QMOA 5FR2A 4CT4B 3L82B 1LVGA 2EW1A 4JMPA 1IAQA 1XXHB 3VR4A 2FU5C 4U7DA 3GJ7A 5M04A 1NI3A 4L9WA 2OHFA 2ZSAA 4JYCA 4UNQA 2IUTA 2W6ID 3VR3A 3EPKA 1KKLA 1TL7C 3QF4B 1NY6A 2P2LA 2OBMA 1I4DD 1NSTA 4EJSA 1DO0A 4HAXA 2X1VA 3DEFA 1E3MA 1WBBA 2CL6X 1VCIA 3ZIAA 1GWNA 4Q9IA 5TXGA 4XH9B 1I2MA 4X8MA 2JIZA 2UZ3A 3AH8A 4LX0A 3EAQA 4Q19A 1OIVA 3X1XA 3AVQA 3KKNA 1AJEA 1U94A 4KO8A 2UKDA 2VP5A 2XSZA 3NBXX 5EE0A 3H0KA 1G5PA 3SBDA 4Q7JB 5B57C 1GP2A 3HU2A 3GLGB 1D2NA 4IRUB 1D2EA 2A2ZA 4A1FA 4N0EA 3OFND 2XX3A 3R9IA 2DFLA 3ND8A 3KXLA 3EC2A 4HLQB 3P27A 3IPXA 4C30A 2D7CA 4C3ZA 2OESA 3QXHA 3SU8A 1XZPA 1W0KD 2NZJA 3BXZA 4EQ6B 1QDEA 4BECA 5L3QA 1NN5A 3BFKA 5FTNA 1P73A 1T8UA 2P6UA 2QEQA 4R2HA 4X8HA 1ANKA 2G88A 2ZRPA 3TRFA 5AUOB 4GMDA 4JBWA 1HURA 5JMTA 4W5HA 3T1OA 3RRNA 2VSXA 4M9ZA 4A2QA 3HU3A 3FE2A 2CEAA 1IY0A 1DADA 4AURA 3KQLA 2YKGA 3RDPA 4P4SB 2E9SA 3TAHA 3I8SA 1NMZA 5J4YA 4DVGA 5DN6D 1G3RA 2E1RA 1Y63A 1P60A 1Z22A 3H2YA 5EE5B 3SBEA 4DCVA 1GG2A 4OQLA 1WQ1R 2REXB 3O47A 5P21A 2ZU0C 2OCPA 2VHUA 1MH1A 5J5CA 2A9KA 4Q4JA 2V7QD 4OQNA 4A4DA 1A82A 2VP6A 5TY0A 2QP9X 3WBKA 3I5XA 4HDCA 2J5XA 4D25A 3IILA 4DCSA 3CNNA 2JGNA 2VHQA 3BB3A 3SQXA 2BWJA 3UK6A 1DAEA 2Y8EA 1IOZA 1ZUNB 4FMBB 5KSZA 1IXSB 1Q12A 1HTWA 1AQUA 3U61B 1H8HA 1IONA 3MWJA 4B35A 2JLSA 4EFNA 3NHAA 1JQLB 5E3HA 1OFHA 4HB4A 1LF0A 1NNEA 1ZIOA 5G3YA 2JCSA 3P32A 1OE0A 1KYIA 3P26A 5CLQA 4LJAA 1DG1G 2ZJ5A 3CZPA 4Q1CA 2QORA 3WHKA 2C03A 3I72A 2CE7A 3Q85A 5DI3A 3RS3A 1NVVQ 1NF3A 3I92A 4O2RA 4FMCF 4DLZA 2FOLA 3FPAA 1NVXQ 2BEJA 3U60B 1N0VC 1KDPA 1HUQA 3DL0A 2BMJA 4A8JB 2P5TB 2ZR9A 1XCMA 1KTVA 3AVWA 4OQXA 1E98A 1SXJD 4TL7A 4DXAA 1AS3A 2IUUA 2DPXA 5IDVA 1AZSC 1T5LA 1US8B 1OIWA 1RYHA 5D3QA 2IC5A 1DO2A 3THYA 1Z0DA 5K8TA 1RVDA 2VP0A 3U6KA 1SVLA 2OLJA 1YZKA 4DLUA 1NBME 4WXRA 5TV2A 2BBOA 3W34A 1T4GA 2QE7A 3RS5A 4BUJA 5JEDA 4IFBA 3K9NA 5FTKA 1KSGA 2W6IA 1NVUQ 4KI0A 1YZTA 3B9QA 3U2QA 4C0JA 2VLIA 1SXJE 1YZQA 1CS4C 3QG5A 3NBYC 4A36A 2QENA 1VCMA 2ASEA 3DZDA 1PLJA 3GEIA 4QGFA 1VG9B 2PZEA 2O0JA 3O8BA 2IYZA 4B34A 4DDUA 3A1SA 5L3SB 3IUYA 2XITA 1NLZA 2ZRMA 4DLWA 1ZC4A 1E9RA 3PFIA 2B8WA 1HT1E 3V4FA 1J8MF 2BMFA 1HEIA 5JS7A 2F3TA 3O8DA 4OBEA 4JJKA 3OFNA 5JS8A 1H8ED 3GJ0A 1M2OB 2D4HA 1G3IA 2WJGA 3HWSA 3KUDA 4HLCA 1W0KA 4GZMA 4LBYA 2GJAA 1QHHA 1VCOA 3NKVA 1KO5A 3KKPA 1BYIA 3VX4A 2NPFA 3B1XA 3VR5A 3GCGA 1U8YA 5HZKA 4M9XA 1E94E 3RS4A 5FTLA 2WZQA 1HE1C 2NZ8A 3BFVA 1XPUA 1KZ7B 3QBVA 3L8YA 3MWYW 4MKIA 1DTSA 3BIFA 4HLUC 3UMRA 3OEHA 821PA 2IYQA 3DM9B 1W4AA 4L4UA 3FGNA 3A1VA 4DEYA 2CLDX 4ZKEA 4Q47A 1XU4A 3ZVMA 2DWOA 4C0KA 2WSSD 2O8EA 4IJMA 4NYMQ 4LHZA 3CX8A 3NBZC 4OHZA 3NH9A 2PMDA 3ASYA 4TL8A 2FWRA 3EX7C 1N6LA 2GDJA 2CHQA 1AZTA 4QHYA 4IVPA 5DI3B 4GI7A 3TW8B 1Q1ZA 3AGPA 3QY0A 4LZZA 4A0GA 5CK4A 1T6NA 5G41A 4DSTA 4DT1A 2K5UA 3CKLA 3PUVA 2ZRFA 2V55B 2J0QA 3KFVA 2WJIA 3MUFA 4PO1A 1W4CA 2ZREA 4Z8XA 3B1ZA 4AK9A 3WMFA 5E7JA 2IYLD 1P9WA 2WIAA 2PX0A 2WPDD 3UKDA 1KMHB 2RH5A 1TPZA 4HAVA 3EPJA 1FW6A 4JVNA 3TH5A 3LA6A 2DHRA 2HV8A 1RYFA 1N5JA 4MYTA 4AYXA 4DHEA 1Z0JA 3IBGA 1G7CA 3A1WA 4BLPA 5JRZA 4FWTA 4D4MA 2JJ1D 4AC9A 3X1ZA 5E7IA 3ADDA 2VP9A 1E9AA 2IYYA 1KI6A 3RYTC 3QPUA 3EARA 4KXFB 2GZAA 2NMVA 4UNSA 2IBMA 2YINC 1VYVA 3HP1A 1NBMA 5FOUA 3BH0A 4XWKA 2QROA 1TQDA 5LB2A 4ZCIA 4B3BA 4DKXA 1J8YF 1E4VA 1R7RA 4URZR 1MV5A 3ZD7A 3QEOA 4CEJB 2YJTD 2YWEA 1U8ZA 3EPLA 1HY3A 1KK3A 2YC4C 2DR3A 2P0EA 3QF7A 1RRFA 2ZRCA 4GPTA 1DARA 1G16A 3BB4A 2NG1A 3ASZA 3SHFA 2VQSA 2ONJA 2CLSA 4L9SA 4EPTA 4ZCMA 2A5JA 4KHZA 1TTTA 5DIFA 2F9MA 5CM8B 3ZS8A 5IHPA 4NYJR 2I1QA 4BGDA 3VFDA 2JATA 2KBFA 4EPXA 1JALA 1X8JA 4B6EA 1UAAA 2ERYA 3MGCA 2FPLA 3DMNA 3Q3JB 1IBRA 4ERNA 2FEMA 4JLKA 1PLKA 2HEIA 2VA8A 1EFRD 2IEYA 2QY9A 1GAJA 3ZZ0A 1CP2A 1AS2A 1CBUA 4LYAA 4QG7A 1OB5A 2YZ2A 4ZKDA 2IS2A 4IFEA 4BE7B 5JWHA 2ZS9A 1RJ9B 1KI8A 1UDWA 2QRNA 4V0NA 3WY9A 3LO5A 3RSLA 4UNRA 2IS1A 1IN6A 4G5RA 1I2DA 4HB3A 4DSUA 2ODWA 2JDID 1XWIA 2H8KA 2DYKA 4Q4HB 4N3NA 1E2KA 1JBKA 4M21A 3AKYA 2JJ2A 2GHIA 4CEHA 1HE8B 2LKDA 3A4LA 2OFWA 3LXXA 5G53C 1E1QA 4D2IA 5EP2A 1COWD 5KPDA 4PX9A 3FTQA 1D6JA 2RGCA 5AUQA 3OHMA 1E2NA 2ZE6A 4BFTA 4B3GA 1P9NA 3A36A 3KQUA 4P33A 8OHMA 4QM7A 2ZRLA 1S1CA 1YE8A 4C7OB 3KB2A 2XNSA 1S1MA 3KFXA 4PSVA 1XD2A 2RGNA 2QNRA 4WBSA 4Y0VA 1QHYA 1X8LA 3FKSD 5FOSA 1X1SA 4B74A 4JBYA 1NJGA 4DLSA 3QKRB 4YDHB 3NDPA 2LWIA 2RAPA 3HR8A 3SFZA 4NE2A 2OZEA 3AUXA 1KDOA 5KDLA 5AJWA 4ASUA 3AVOA 4US0R 2ZEJA 3SEAA 4KFSA 2ZYTX 2QTFA 4KU4A 2FSIA 4X8LA 2ORIA 1ETUA 1OYYA 4ZPXA 3GLFE 1XEXA 4FI3C 5CIQA 4BLRA 3DZ8A 1ZAKA 3C4JA 2CDNA 3K0FB 4BPBA 1Z0IA 1EFHA 3ZGXA 1OH7A 2ZR7A 1XCGB 4B71A 1QHIA 2ZRGA 1Z47A 1YJ5A 2VYFA 2ZR0A 2WWYA 2DFTA 1FQJA 1SKYE 2QBYA 4XIGS 1MRSA 1WE2A 2BBSA 3ZDQA 1G9XA 4RFSB 3RABA 3A37A 3LQRA 1F2UB 2CBZA 3MJHA 1Z06A 1TADA 4HSEA 5DHAA 4TYNA 1R0ZA 1JPNA 1G20E 2AWNA 2QAGA 1ZD9A 4IDNA 2EVWX 3CWQA 4KVAA 3QPVA 1LW7A 4NZYA 1ZMXA 3ZVNA 1PVOA 3AF0A 1RRCA 4MDEA 1G291 2JJ1A 2ANCA 3BERA 2OCBA 3VTKA 3WNCA 3WBJA 2MMCA 1FMLA 2Z4RA 4A0HA 1SQ5A 2LKCA 4FD2A 5FTJA 2WSMA 1F2TB 4UNNA 1AM4D 2Z0MA 2WICA 1KHTA 1Q22A 2G83A 4DIDA 5C1BA 1N5LA 5D3MA 1FX0B 4FCTA 2GWHA 1EFCA 1X6VA 3B13B 1W1WA 2J0SA 1W36C 2FGKA 2ZYWX 4Q7KA 2P3SA 2RGAA 5JWOA 5JZVA 4RZUA 3TMKA 1IHUA 3KJGA 1ZCBA 4HEJA 2WWWA 2PCLA 4LCBA 1AKEA 4WIAA 2OUKA 3LD9A 4Q66C 1L4YA 4L16A 1TEXA 2J45A 2ONKA 521PA 1RPZA 3T5DA 3GLIE 1OHHD 2F9LA 2ZS7A 3TLXA 2AFHE 2C98A 4XTCS 2ZM5A 4AD8A 3AF3A 1EXMA 1SGWA 2OE2A 4MKFA 4JLPA 4TT3A 3PCRB 2ZRAA 1FZQA 1S0UA 4PC2A 121PA 3AQ4A 3MG9A 4B2IA 1L8QA 2IXGA 4W5JA 4LV6A 1Q3TA 1J2JA 1Q3HA 2DBYA 2DWQA 4BEBA 3PG5A 1EX7A 3EPHA 1VYTA 3EZFA 1DELA 3FDIA 1OW3B 3Q5DA 1G4AE 4GBMA 2N42A 4ILEA 1WF3A 4NP6A 5IRCD 4C4PA 1CJKC 1DAKA 3GJ3A 3EZ9A 5GJBA 1PJRA 2N46A 2IYRA 3UPUA 2CNWA 4M9QA 1XPOA 1F60A 4C0BA 2AN9A 4KSCA 1FOEB 4M22A 2QMEA 4V0KA 2J0UA 3EWAA 2Q9CA 4Q21A 5TDHA 1PV4A 1W0JD 2A3RA 1NIPA 3UANA 1CR2A 1NN1A 3HPQA 4P32A 1QHGA 2FJUA 3M6AA 5FL7A 4B47A 1E99A 2H7VA 2OO7A 4M9SA 5DYIA 2CJWA 2NOAA 5G3ZA 5LDDC 3CNLA 1X86B 3M0EA 3K09A 1P2TA 1XEXB 2WWGA 1E79A 2F6RA 3QIAA 2BM0A 3G5UA 2X2EA 3GLFA 1ZRHA 5H68A 4BFVA 2XB2A 4OK6A 1XD9A 3IGFA 1W46A 1E1RA 1ZNXA 1YVDA 2ERXA 2WKRA 4B2LA 2WM9B 2WOOA 3B60A 2IX3A 2WJHA 2DY1A 3TKLA 2BBTA 3KL4A 3VU9A 5H8WA 3UG7A 2FSFA 5L3VA 1TF2A 3KXKA 1TQ6A 2HLDD 4KJZA 2F43B 4QOSA 5UKDA 5KYKA 3PVSA 4O3MA 1KJZA 1Z0AA 1OFTA 4JBXA 4K46A 2W58A 1GFIA 4QC2A 1FUUA 4DLTA 5EJEA 4PZYA 2QPTA 1XRJA 2ZAMA 4LC1A 1CU1A 2GTPA 1XX6A 1P7CA 1ZC3A 2ZANA 3RS2A 3CX7A 2IF0A 4M1MA 1D9XA 1DAGA 4LK2A 4YMVA 2XTMA 4S35A 1MRNA 3OESA 2A5YB 5JSZA 2EQBA 1NN0A 5FFMA 4RKFA 2O8CA 4CT5A 4LOAA 4ZDJA 5EUQB 5KOYA 5JWRA 1D5CA 4DB2A 4JVSB 3PXGA 3TNFA 2DCUA 5AJVB 3L8ZA 3SYNA 3Q72A 4URVR 4B3FX 1HQCA 4EIWA 2BBWA 4U02A 3TBKA 4HUTA 1XJCA 1HH4A 2ZE5A 4DZZA 4QJ4A 3QXJA 3U44A 3VKGA 1K8RA 1SHKA 1E0AA 1G5TA 5JJIA 1G7SA 4FN5A 2AR7A 1CULC 3A4NA 4LY6A 421PA 1OKKA 3LBNA 3SQWA 1FMJA 4LBZA 2Z5FA 3AGQA 3TSWA 5DYGA 4KFUA 4MGKR 3GLIA 3ZZUA 3RWMB 1CTQA 1V43A 2GEUA 2OAP1 4TSFA 3RWOA 3WRXC 3TVDA 1ZUIA 5JCPA 4GFDA 1G18A 1G8HA 1YZGA 1U9IC 3CPHA 3CRQA 3FKQA 2ZI4A 3LY5A 1KNXA 1G21E 4TQAA 3NHBA 3AUYA 3SYLA 3NDBB 2BHRA 4TL6A 1UDXA 2C8VA 3QKSB 2ANBA 4OI4A 2LCFA 1OIXA 4IEIA 2ZI3A 4JSYA 1XMJA 4TMTA 2YWHA 2F3RA 4Q48A 5AJXA 5KSPA 3GFOA 4URXR 1DG3A 5BYJA 1SVWA 4LHXA 5GJVC 5KSYA 1Z63A 3PQCA 2O0HA 3BK7A 2FPKA 4DEXA 2C9YA 3U3RA 3C7KA 2GXAA 2MMGA 3VNUA 2C77A 2ZSDA 4LI0A 3ADBA 4MGZR 2JLYA 2FFBA 4AYTA 2FFHA 4EJSC 1U99A 2ZQ5A 4EPRA 4G5GA 4HDQB 2R6GA 1BH2A 4CEIB 3PEYA 2WHXA 2GAAA 4A9AA 2J7PD 3P20A 2W83A 4A15A 1JEEA 1TUEA 3QVUA 4Z1MD 1N6OA 1DAMA 3JVUA 4L8GA 2VO1A 1KI1A 2VSOA 3VU9B 1AIPA 2W6JD 3F0TA 1JXOA 4DDVA 4ZIRA 4IOMA 2O8DA 4Q1FA 1W44A 4O0MA 4YQFA 1W5TA 4WZAE 3VMFA 3W8NA 2QI9C 4P4TA 2B6HA 2ZUCA 3CWZA 3RRYA 1W0JA 4TLEA 5J4LA 4MGYR 4DC9A 1AA9A 3SZRA 1GM5A 3E2IA 3I32A 4CDGA 5JHHB 4ZDKA 4LWZA 5FL3A 3B85A 2WJVA 2CCKA 2CVFA 2O8FB 3E1SA 1YKSA 2I4IA 3Q7QA 3LVRE 1ZU4A 2I1VB 1P6XA 3T5GA 1EFUA 3A58B 3TGPA 2OBNA 1GOTA 4DUGA 1XPRA 5GJWC 2PX3A 1VHLA 4Q4AA 4B48A 2OFOA 1OFUX 1XTRA 2C9CA 4LRWA 3WYGA 2BMEA 2HLDA 4V0LA 3LNCA 2QP3A 1OYWA 3CF2A 2RB4A 4D26A 1GIAA 1TU3A 4LYFA 5A4JA 4DLRA 4ACBA 4TTPA 2VH5R 3K0CA 4R2IA 4C9BA 2CXXA 1WMSA 1G3QA 4E09A 2A5FA 3C41J 5EE9A 4XWOA 2QTHA 1GDDA 1Z6TA 3D6TB 4PHHA 4G5SA 2J1LA 4MA4A 1XB2A 2OXCA 5EXTA 5C4GB 1Z5ZA 4MUAA 3GLHE 4EPVA 5KSOA 1UBEA 1M74A 1T3HA 4MUBA 3JZMA 3K0AA 1L7VC 5C4MA 1CLUA 2ZJZA 1GVNB 3ONWA 2TMKA 2V9PA 3PITA 1MO4A 3GP8A 3FMPB 5JHGB 1UM8A 3LWNA 4IVRA 4CGZA 2XB4A 5KUTA 4B44A 4QHSA 4TMXA 3BWDD 1CKEA 5E4FA 1P9RA 1L2TA 2QG6A 3UIEA 3W9YA 4GDFA 2GCOA 1O3YA 2YWGA 2L0XA 3PEUA 3F3YA 1T5IA 3NEJA 4P3YA 4Q1BA 1VMAA 2JASA 3KJHA 3BAFA 1AKYA 4ESVA 4IOKA 1CR0A 1N6NA 721PA 2G0TA 2XXAA 2OM2A 2RKOA 3WYFA 4A0RA 2ZRBA 4YDSA 3NEYA 2R2AA 3EZ7A 3U4QA 1YR8A 5G40A 1LS6A 3SE0A 4R98A 2AD5A 4IOLA 2YNMA 3WP0A 2BKEA 2X2FA 3DM5A 4BLOA 1R6BX 4R7ZA 1O87A 2HXYA 5GADl 4FXPA 2JA1A 4KCGA 3UWKA 3AF2A 4MRSA 3SDZA 1U0HC 3KTAA 5DHFA 3GFTA 2DFKB 1IXRC 3EC1A 2W00A 3LBHA 3TUJC 2ZJBA 5TMPA 5J4VA 1G6HA 1Z0KA 2QN6A 1ZW6A 5CYPA 4GZLA 2Z4SA 4CRWB 4JLDA 2IW3A 2PMKA 4ZIRB 1II0A 2KBEA 4EJSB 3CR7A 1OXXK 1F5NA 3WNBA 1R0YA 2QQEA 5HKKA 1XTIA 2VF8A 4BFUA 4U5XA 3CR8A 5CJPA 5KU1A 1NSFA 3BH7A 2BVNA 3C15C 4NTZA 5IF9A 1BMFA 3FHOA 1NY5A 2BM1A 5AWFC 1FNMA 2GZHA 2V6IA 4JS0A 4Z8YA 3RRZA 1QHXA 4OHXA 2X19A 1KO7A 4YLGA 2J7PA 4BZXA 3PIRA 2W2VA 4LHWA 4PANA 1P5ZB 1S9DA 3HU1A 5DISB 2O52A 5IT5A 5CDFE 1KY2A 2RGEA 5L3QB 3VAAA 1YRAA 3WMEA 3A4MA 4X8OA 4PC6A 2KI5A 5DNYB 1ESMA 1YZLA 1B0UA 2D74A 3E5HA 3W5JA 5F98A 1VG1A 2G77B 2PJZA 4HAUA 3WNDA 2OCYC 4P0TA 3THWA 2FDCA 1SVKA 4IKEA 4JLMA 1GRNA 2QP4A 1JR6A 1JB1A 1AK2A 4JL5A 3TE6A 3DVLA 4W5WA 3S1AA 1R5NA 3B6EA 1JNYA 4B3CA 3GJXC 3ZS9A 3H86A 4XD7D 2EFGA 1Y3AA 2ZI6A 4F4CA 4WAUA 3GLHA 4BLQA 4TYYA 4TYQA 4Q4JB 5B30A 1ESNA 1KO8A 2NO6A 3ZQJA 4DLVA 2YHSA 2FZ4A 1EX6A 1E2LA 1E2HA 2ZI5A 4NKRA 1S3GA 3X1WA 4B43A 3R20A 3VKWA 3V00A 1ELOA 3NTUA 1EESA 2XAUA 4HZUA 4XSHA 1FFHA 2NQ2C 1B23P 5DN6A 1OSNA 4IEEA 4QGHA 1N25A 1DAFA 3WRYC 2Z6VA 2ZSFA 3T35A 5FBQB 5TB5A 3OIUA 4M1SA 5DLQC 4JKIA 1E2DA 1VDZA 2V7QA 5EXXA 4BQSA 4KFTA 5H70A 5KNBA 1OV4A 3MCAA 1VTKA 3B78A 1Q20A 4PPNA 2FFQA 2ODNA 5JECA 3VQTA 2PZGA 3EASA 4ZO4A 4IOJA 3KDSE 2RCNA 4O25A 2J0VA 1X3SA 3B2EA 4FMCB 2J7KA 4M1TA 4C2TA 2AK2A 1E2EA 3H4MA 3DOEA 4JIMA 4RZXA 1A4RA 2OAQ1 2ZSEA 5C46F 2ECKA 2BC9A 3BE4A 4G5OA 2V1UA 1Z0FA 3AB3A 4Z54A 2DWPA 1ZUHA 3T1QA 2UZIR 4LJ9A 1II9A 4S2EA 1Z2CA 2GVDC 2X8AA 3C16C 3DO6A 1Z29A 5JJLA 3WMGA 3K0EA 4US2R 3THYB 2FGJA 3O8RA 5JI2E 1OT3A 2IYTA 4M1WA 4LJYA 2NO1A 1I4LD 1NRJB 4IHQA 1SXJC 1UKZA 1Z8FA 2VP4A 4GOJA 1S4QA 4NCJA 5FUWA 2IWRA 3CRVA 5A5GA 1Z6XA 2H16A 1KO1A 4E5UA 3FMFA 4DRZA 3NG1A 4F4IA 3TVTA 5HCIA 3WYAA 2IWHA 4HB2A 1T9HA 1N0WA 4D4LA 4D4KA 1G4UR 4M0LA 3NBFA 4LBWA 1E32A 3B1VA 1KAOA 5DE3A 4C0AC 3EA5A 1E9BA 1P75A 1SXJA 5CDFA 3KQNA 5F9HA 3TQFA 3I61A 1N6HA 2V8OA 1KDTA 1K6MA 3KKQA 5FUXA 5H1YA 1L4UA 2R62A 3WP1B 2R65A 1E2MA 3IEVA 1UKVY 1Q44A 2R8RA 1YR7A 3KQKA 1KSFX 3S1AB 5AK0A 4B6FA 2EFCB 2IS6A 4J0QA 1HA3A 3F5FA 5CITA 2ZETA 4GP7A 1J70A 2ZI9A 3FHTA 1EGAA 1E2JA 2VRWA 3E70C 4XWAA 1OFIA 1QHHB 4OQFA 4KV9A 4H9GA 5FBRB 1MABA 4Q1DA 4IDQA 4PXAA 3VHXA 1GSIA 1R0WA 1VCNA 5F2EA 3AKDA 3Q7PA 1PLLA 1P62B 3ZLJA 1GTVA 4BRUA 5FPSA 2NO7A 2V54A 2B21A 5C2JB 4G01B 4RY2A 1T0JB 5EZ6B 1F48A 2A30A 3BOSA 3N5CA 4N1AA 1IY2A 2VHCA 3Q5EA 2VF7A 3FWYA 4OK3A 4UJ3A 1BS1A 3TW4A 1G8PA 1ZNWA 4PC3A 2RGNC 3FVQA 3UXMA 2FZLA 2FE4A 5K8IA 1E9FA 1OH5A 2GXUA 2FPMA 2IYSA 3OAAD 1E2FA 1H8EA 1IY1A 2F1HA 3R7WA 3SJCA 3W6OA 2WWIA 1D9ZA 4FINA 2ZVQX 3H84A 3QNUA 2O8EB 3RVBA 2HYIC 4XVRA 2GCPA 4CW7A 1NLFA 5EQTA 4EPYA 2IHBA 3U6BA 1Z6YA 3CUEF 4WZ6A 4QBFA 1CJTC 1KAGA 2CHVA 1CRPA 2G9NA 3T1VA 1RIFA 1FUKA 1OXUA 2XEXA 3EXAA 4DLXA 2V6JA 2BMDA 4DT1B 5BN4A 3NC0C 4H1UA 4I1VA 4EPWA 4TZ0A 4KAXA 1ZNZA 4JLJA 3UMSA 1C4OA 3LRPA 2GESA 2CK3D 1JR3D 5FBLB 4NBSA 2V3CC 1NL3A 2HJGA 3C5CA 3SS8A 3CRW1 4RCYA 2Z43A 3LDAA 3SYKA 1W48A 1RFLA 3VNVA 2VSFA 1ZD1A 2B92A 2JLVA 2H92A 4HUQA 4WA7A 4W9MC 2WSSA 3LVQE 1G8FA 2BV3A 3BC1A 1VKJA 1XMSA 5KPJA 4Q1AA 2ZITA 1QF9A 3KXIA 2GXSA 2QAGC 3BRWD 2BJVA 1KI6B 1P2SA 3AKEA 2JLUA 1ZM9A 1GITA 3DDCA 1KK2A 2IS4A 1ODFA 2SHKA 1GKUB 2QMHA 2VEDA 2KSQA 5KDDA 2KB0A 1A2BA 3OEED 4PC1A 2WPDA 5EXSA 3ZH9B 2ZROA 1E2IA 5FI1B 1XXHE 3KUCA 4KLNA 1SXJB 1R4AA 4Q4LA 4URUR 5CB6A 2XNDD 2RMKA 4EDHA 3TUZC 1OXTA 4JZKA 5EE3A 2XZLA 4PHFA 4Q9KA 2GXQA 2JAQA 1SVMA 4C0LA 1Q1QA 1LFDB 2DFNA 1P3JA 2J3EA 1Q57A 3B5JA 1OB2A 5HCNA 5HTKA 5BYKA 2JLRA 4TQUS 1CF4A 1S9HA 1TAGA 1Z83A 1YU9A 2XOKD 3HYRA 1S96A 2FNAA 2IUSA 1XD8A 4G0NA 2IYUA 2IT1A 1GRRA 3PUZA 3WHLA 2GEVA 3GLGE 2WKPA 4M1KA 2D7DA 2BIFA 5FPHA 1D2MA 1WCV1 2QT1A 4PHGA 2C04A 5KO2A 5SZHB 2IF2A 3DMDA 3P1JA 4I1UA 3ADCA 3TUIC 3TR0A 3AP3A 4Q5IA 1JAIA 3K8YA 4NPHA 5BN5A 4K8OA 4BFYA 1FP7A 3A1UA 1GKIA 4XTRA 1TQ4A 4BFWA 4GT1A 1XMVA 4JL6A 3GPLA 3VR2A 2F7SA 1D8TA 3EIEA 1KKMA 3EZ6A 1CIPA 3T1TA 4OL0A 4EKDA 3ICQB 3GD7A 4IXNA 4JSTA 3CW2A 4Q03A 5B2ZA 5B64A 1G17A 3SC3A 4CEHB 1G7RA 2QTVB 1XFAA 4DCNA 1AS0A 5FPYA 3MWKA 4IDOA 1G6OA 3ETLA 3H1TA 4OYHA 1Z6GA 3HDTA 5HE8A 4FMDF 3MD0A 2ZUDA 1X8KA 2ZSBA 2V1XA 2ZJOA 3ECCA 2GJKA 3REGA 1EFRA 2H5EA 3TIFA 1XD2B 2QPAA 1II8A 3K09C 4CZ2A 1GNQA 3MAAC 4DBLC 1ZVQA 4HAZA 1FTNA 5EUMA 2YOHA 1JJ7A 1RW4A 4GRAA 4L5BA 4R71A 5FH9A 4FW9A 4CYMA 1G3MA 2JDIA 3FHCB 2QM8A 4PC7A 1PZNA 1OLOA 5CJ2A 4I1OA 3K1JA 4LJ7A 3M1IA 4HZIA 2B8TA 5CLLA 4ARZA 3UWOA 2Q0HA 2CVHA 1COWA 4QGAA 2EFEB 1WP9A 3THXA 4AG6A 1BYUA 2ODEA 4WXPA 2I3BA 4MRNA 1WRBA 3QVVA 3TR5A 3U7FB 1KSJA 1QBKC 4PSKA 4TLAA 3SOPA 2QU8A 3ZIAD 3Q8XB 3FKSA 5CM9C 3MRSA 1XJQA 4DSNA 1P61B 4PAOA 4TQ9A 2QBYB 2NGRA 4NYMR 1QVAA 2JIZD 4LGMA 4AKGA 2E87A 1CJMA 1LS1A 2FH5B 2R6AA 4B2PA 5CB8A 2XSZD 4MDFA 4TMKA 3T15A 3BJIC 2WIBA 3B7GA 2IEZA 3QQ5A 1TF7A 4JT4A 2QAGB 2WAYA 4I1SA 1Q21A 2FFAA 1E9SA 6Q21A 1TUIA 1R8SA 4RD3A 3SHWA 1XXHA 2PCJA 1KI4A 3T61A 4NCHA 2GCNA 1J7KA 2GA8A 1XDBA 3DPUA 1X1RA 1JJVA 1UF9A 2QPOA 1RC8A 3QF4A 1KZGB 1OH6A 3ICEA 3TQCA 5D3MB 3TSZA 1S2MA 3GJ6A 1N3BA 3HR7A 4QBHA 1M7GA 3W5IA 4A6PA 1GUAA 4DCUA 2JLXA 3BFXA 2D06A 3L0OA 2C95A 5DSZA 3VR1A 1Z3IX 3AVXA 1G5RA 2YVUA 2HF9A 1E69A 3R8CA 2H18A 3GLGA 3BB1A 4M1OA 4UJ5A 4Z51A 3FFBA 5KTYA 4A92A 3TK1A 1E6CA 2AKAB 2FEOA 4G1UC 4H1VA 2W2XA 4I4LA 1KO4A 1E9CA 2AWOA 2EFDB 4XOIA 3ZQ6A 3AF4A 4EQ6A 3U3KA 4NCIA 4OQMA 4HATA 3F8TA 1W36B 2EYQA 5EE1A 2QAJA 5FOWA 3T12A 4AG5A 4TWZA 2XTZA 4GSYA 3TJZA 1W5SA 3I1FA 5SZKB 3KX2A 2A5DA 3L2OB 3X2SA 2BKUA 4W7SA 4ACAA 4NYIR 2C99A 1CR4A 3QG1A 3RC3A 4B75A 4LJ4A 1W2GA 1EWQA 4NCNA 4GL2A 1GL7A 4F91B 4ZCLA 1QG2A 3VX3A 4ZDIA 3OIVA 3AP2A 1GZSA 2O8BA 1OHHA 4JVLA 2VBCA 1M7HA 1ZIPA 5EP3A 1KDRA 1QZXA 4DDWA 2J0UB 4UKDA 3CX6A 4JVMA 1XTQA 4QBIA 2O5VA 3LLUA 1IJEA 2BCGY 2VHJA 3LX8A 4AWXA 3BGWA 3IIKA 2VPPA 4JLOA 1MOZA 1CJUC 1NLYA 2CJWB 3R9XA 5FUVA 4DSOA 5AJYA 4OHVA 4KITB 1NKTA 3ZD6A 4LJ5A 3W6NA 4JLVA 2R9VA 5TVKA 1IXZA 2HCBA 1BKDR 1MO5A 4XSGA 3GLFB 1MR3F 1T8TA 4MH0R 4M8NE 4URYR 4CIDA 4F38A 2QGZA 4Q9JA 2WOJA 4LYHA 4KYIB 1ZBDA 2KJQA 3JVVA 5FOXA 4XVUA 2BEKA 3QSYA 2OBLA 1SKYB 2WJYA 2QZ4A 2HXSA 4LPKA 4UNPA 2AKYA 3N70A 3AVTA 3CF0A 4QM6A 4CF7A 3GJ5A 4YMTA 2VP2A 1TX4B 1A2KC 2ZUBA 2EFHB 1VYUA 1Z07A 2QE7D 3IO3A 1U81A 1G19A 3PUXA 3RS7A 4B76A 1XEWY 2OLKA 4BFZA 1VG0B 3U3MA 5JSZB 1ZD8A 4OHWA 5K8UA 2O8CB 4Q7MB 1JI0A 4RZ2A 1N0UA 3K0CC 2QL6A 4A8JA 3DKVA 1N6KA 4PQRA 4PZLA 4OI0A 5J47A 3RS0A 3SI7A 1AGPA 4NYJQ 1US8A 5CK5A 2GETA 3U44B 1JECA 1YR6A 2FSGA 4C0HA 4P31A 2J87A 3M4YA 2WBLC 4ITRC 4HI0E 2HF8A 4Q7LA 2NIPA 4UQOA 2FG5A 3B82A 2JEOA 5FI0B 3TAUA 2CCJA 1RKBA 3DHWC 4BRWA 1P72A 4JLBA 2BCJQ 1OH8A 1XJ0A 2ZI7A 2AL7A 3PEVA 3GLIB 3IO5A 3RC8A 4MKHA 4AYWA 2W0MA 4MQBA 3CNOA 2R44A 1XMIA 2Q9BA 1JAHA 3Q9LA 2J46A 1DOAA 5L3RA 1T0HB 2HT1A 2GZDA 2BOVA 2ZJYA 1YQTA 1M7BA 3CLVA 1OPXA 2Q9AA 2R6DA 1OXVA 4YMSA 5L3SA 4NCKA 3AV0B 4TMVA 1XNJA 2R6CA 4O2LA 1HYQA 4MYHA 2A78A 3OEHD 3GJ8A 2ZRKA 1W49A 4KBGA 1XTSA 5CYOA 4AI6A 2IHYA 2RHMA 2WVJA 2JLZA 3A8TA 5GVRA 1XTKA 2O8BB 1J99A 3GJ4A 1A7JA 4NMMA 1E9EA 4TTQA 1YR9A 2ATXA 4OI2A 3QOFA 4PSAA 1WA5A 4BLTA 4LYJA 4NH0A 2H57A 4M4SA 4A2WA 1LY1A 1TNDA 2OEPA 1ZYUA 3OZXA 4HAWA 2B7BA 3B1YA 1FTSA 4JYBA 4KODA 5K8LA 4OHYA 5JCZA 3K70C 5JI3E 3KKMA 1U98A 4JLAA 4MRPA 3W90A 2GKSA 4NHOA 3REFA 4FCWA 5J40A 4DB4A 5L8VA 4YXWD 1K5DA 5HE9A 2QRZA 3AVPA 4QL3A 5BN3A 1ZU5A 4OJQA 4Q9HA 2WKQA 3SNHA 3QPWA 1G7TA 1GKYA 1R8QA 3LBIA 3RANA 4A2PA 2F55A 4A6XA 2O8DB 1K5GA 1N2CE 4PQFA 4PFSA 5F9FA 2C5LA 4Q9LA 1E0SA 5JLJA 2IA5A 1LF5A 1Z08A 3P4XA 4DIEA 4U00A 2ZJ2A 3CO5A 1UEJA 1VECA 3QXCA 4AY2A 4OI1A 2FX3A 2ZVPX 1XCPA 3D31A 3P4YA 2REOA 2ZE7A 1EFTA 4RVCA 2DB3A 2WMNB 3RHFA 1NBMD 3NIBA 4PHTA 1DS6A 5DH9A 5KDOA 4AKEA 4E07A 3I62A 3HYTA 3K9LA 4V0ME 1XEWX 1KMHA 4Z1MA 4Q4AB 1C9KA 1HV8A 4F93B 2IK8A 2W6JA 1ONBA 4BFSA 1RRGA 3UMFA 1RE0A 4OKSA 2IL1A 1I4TD 3LH5A 3SR0A 4MRVA 1XP8A 2GJSA 3KZ1E 4G5QA 4Q01A 3FFAA 1Q0UA 5LD2C 4AIIA 1ZINA 2G1KA 5E95A 2QUZA 3X1YA 3U7GA 2GF9A 4BFXA 3LAWA 1PUJA 3U3JA 4ZDWA 4DCTA 3OE7D 4IVQA 5ELXA 1NP6A 2FF7A 4BEJA 2FSHA 2WV9A 221PA 1N5IA 3OIWA 4JL8A 3V4RA 4CEJA 4DWJA 4MKGA 2GRJA 3K0AB 4TYWA 2CHGA 3AF1A 1UBFA 1BOFA 2AFIE 4OK5A 3NH6A 2X77A 1QG4A 3LLMA 1MKYA 2YOFA 3RNLA 1U90A 2XZPA 4KBFA 1G8GA 2GCOB 2KWIA 1NMYA 3CRRA 1EG7A 3G82C 4PPGA 1M34E 3OF5A 2JJ2D 3K53A 4D81A 5EZ5A 4XJXA 4B3XA 2ZTSA 1ZCAA 1E1QD 2XXAB 4QGGA 3L0IB 2AK3A 2P65A 2AXPA 2YYZA 2PZFA 2PEZA 3LXRA 3U4QB 2FN4A 3CB4A 2IYVA 1S8FA 1AN0A 1G64A 3D3QA 1W47A 1XZQA 4EUNA 3U5ZB 1ZJ6A 3FMIA 2BDTA 3EG5A 4TMWA 4BZQA 4F4JA 1YHNA 1E2PA 4F7WA 5IK2D 4ZI2A 2PH1A 3U3OA 3AVUA 1RJ9A 4Q02A 4URWR 1FPMA 1OXSC 5HPYB 3KTAB 3LW7A 1IQPA 5CIWA 4ON9A 4K81B 4ASUD 2XJ9A 1V5WA 4Q4HA 4MGIR 3EZ2A 1CEEA 3W8RA 3UG6A 3EIHA 4MRRA 3K70B 2WMOB 4HDOB 1ZM7A 4WVFA 1J90A 2XZOA 1MT0A 4QRHA 2RGDA 1R10A 2Q3MA 4QHTA 4BWYA 4RD4A 2GAOA 2F1IA 5AUNB 2P6RA 1W4BA 4HLUA 4MYUA 1YZNA 4ESHA 3B9PA 4N0DA 4C7OA 3V9PA 1A5TA 4TL9A 5FPTA 4LV5B 1NIJA 4LHYA 3T06B 3AM1A 2WTUA 4LUCA 3PR1A 4LJ6A 3EW9A 3QKRA
chains in the Genus database with same CATH superfamily
1ICIA 1VA4A 3IEKA 3N6XA 4JJ8A 2AC7A 2BI8A 4L75A 4W8HA 5LB4A 3S27A 3U49A 2VIIA 1CJVC 1VP9A 3GV0A 4WTOA 5EXPA 1E62A 1UUFA 2CXUA 2NT4A 4UBIA 3QKUA 1ZH2A 1J06A 1EJ0A 3MB8A 5DWVA 1NXPA 1QRAA 3FSGA 1GL6A 1PR1A 2B69A 3COPA 3ETDA 3B1WA 3MTDA 4KLZA 4V0MA 4WCFB 4WXHA 5IXSA 1OILA 1BA2A 4OGFA 4OL9A 3AESB 2ZYVX 3KEMA 1CF9A 3PPVA 1W1IA 1VI5A 3PFHA 1J07A 3W6PA 1CY4A 4ER6A 2ZYIA 2JRCA 4DFDA 2EGUA 5AIBA 4GUAA 1SKMA 1KA9H 2JGRA 3I30X 2QMZA 4YV7A 5LP1A 5LQDA 1P2UA 1F2VA 3BHIA 4NBRA 4ZO6A 3N2IA 5AR1A 2GBLC 4QPDA 2RHHA 3NONA 4BNDB 2EKZA 1PJZA 2RJOA 2Z8ZA 4L08A 1MJGA 2BEVA 4R2WA 4TTRA 1NRWA 3GEBA 3R5TA 2HRRA 5HRCA 4EI9A 2IZ5A 3RAGA 1K7YA 3SQDA 5HOQA 1FNNA 1WXGA 5M3BA 3TDNA 1R9JA 3SF0A 3DUFA 1I1QB 4KGVA 3R2JA 1RVV1 3FBGA 4HQNA 1N6PA 4EB6A 3EVZA 4HPXB 3PL5A 2WWHA 1EEHA 4IIUA 5KX5F 4IQ0A 1KOFA 2VUUA 4QT4A 2RK4A 1CETA 3A3NA 3MGAA 2ARKA 2ZRHA 5E9AA 4DM3A 4Z4HA 3IHTA 1T9ZA 2H29A 2NTYC 1AB5A 3GVHA 4O2BA 2UVDA 1Z12A 4NABA 4HL6A 4O4IB 1S7GA 3R3WA 3DHNA 4X90A 1RI5A 2W2TA 3ECAA 5T6BA 4TT3D 1KJYA 3E23A 3FPEA 5LOVF 3W4JA 4FCVA 2WU4A 5I4IA 5IXJA 1C1HA 2AX3A 4HZUB 2QM0A 2PL3A 4NBLA 1JJAA 2H1LA 4P86A 5AKHA 2BJWA 3DOFA 3OE7A 1M34A 2Z8YA 2I8CA 4WFIA 4ZO7A 1F5SA 2YJGA 4I66A 4YAWA 1H4TA 2H00A 5FKJA 4ZVNA 4KYUA 1I0ZA 3EIFA 3TI9A 2X7XA 3GGDA 2R6JA 4R40A 4W8OA 3X2EA 4IIBA 4E5PA 4KH1A 3B6JA 4N3GA 2X23A 5IWAB 1IJFA 1U3WA 2AZXA 2ZSJA 1DGQA 2WLSA 5CNKA 1TI7A 4D6PA 4O4JA 1RT9A 3FNIA 1DC7A 1FFSA 3GUVA 1SOUA 2CNWD 3DBLA 1Q7RA 4ZJZA 3K9BA 2W6NA 1G2PA 2EGGA 2VN8A 3GEHA 4GDMA 3JVDA 4FJ0A 5K3BA 5AVTA 4JELA 1NMXA 4YAEA 1BX0A 1P1IA 2AMFA 4N5IX 5H59A 2QSZA 4C14A 1JHPA 5HUHA 1MX5A 4FLMA 4EDFA 3PHIA 4P4NA 4S24A 2QJOA 2W2KB 4EG3A 1OAKA 1W9MA 1XBTA 4NU8X 2PRZA 2VYND 5KKCA 1JSRA 1RYBA 2FCRA 3QXXA 2HY7A 3OFKA 1KGDA 4M1YA 4TYPA 3F9CA 3SJAA 3EVBA 3O0DA 2Y0EA 3LO8A 4EBFA 3A1DA 3BXPA 2CXSA 3GZ4A 2E6UX 3CM0A 2BFFB 2OZLA 2O19A 3RJMA 4BWFB 4RLHA 2JCYA 1IZZA 1PF7E 4GC9A 2W0SA 1QS0A 1E1RD 1NI4B 3CZQA 4W1QA 5IK2A 3FFTA 1EFPB 2NTNA 1TFRA 1SO8A 2QMUA 3FCSB 3R44A 4IW3B 4DIFA 1NMQA 3NJ4A 4ZVVA 1M67A 1I24A 3HBAA 5ED0A 1CJSA 1VJTA 5J4KA 1IN5A 1X15A 1NM5A 2WVGA 3RYIB 3TL6A 3DYBA 4NXMB 4AKIA 1RKUA 3WGMA 1U0LA 1KK1A 1F20A 4G0OA 4JD5A 4E5KA 1L4LA 1ODCA 2UVPA 3OBIA 4E13A 2XE4A 2G3YA 4R2XA 2XYVA 1RQLA 3GRUA 3R76A 1YTLA 4IJQA 4Q6BA 3W3ZB 2D3WA 2PKCA 5ADUS 1LVHA 1PBNA 3ZLTA 3ZWCA 1VHDA 1VPVA 2VL7A 4NS1A 3HFGA 1M1ZA 1NVVR 1YZHA 1QNFA 3GVPA 3TX2A 4CR8A 3OTOB 2CSUA 3CPSA 1FLAA 1SVSA 2I6SA 3I45A 5E1OA 4C2AA 3JZAA 4GM0A 4ZCPA 4CKCA 1SQ6A 2RHDA 3FB1A 4QGSA 3LUHA 3U4DA 4G3XA 1FP6A 2ZIAA 5EVJA 1SEVA 4EUFA 4J0GA 3L6OO 1YASA 4YP7A 1S2OA 2QM7A 3K1TA 4HADA 5IVDA 1E9VA 4I1YA 4IMIB 3CRMA 1H5QA 2R5WA 4MZXA 1MAUA 4LHVA 4UEWA 2ZJ3A 3Q9UA 3LUGA 5EJ6A 4K9MA 4FNOA 1WM1A 2IIVA 3NAMA 3TKYA 4PR0A 1WHTA 3GQBA 4D0LB 4MARA 4MQFB 4OXNA 1H2AS 2NPIA 2OSBA 3PWSA 3ZG6A 3LUFA 1C5KA 3OZDA 4FC6A 3B8EA 3SBXA 5EHZA 2GSDA 1RLUA 2WM8A 3FUVA 4GI5A 1OKKD 2QR5A 1IZYA 1DIAA 2ACEA 1LSOA 3HHEA 2A7QA 3IKJA 3CE6A 3D6MA 3VDMA 4PYIA 2AX4A 5B3LA 2DR0A 4MVJD 3TW0A 2RHTA 3VAZA 1P4GA 2OCGA 4DQDA 2AJBA 4RVFA 4NULA 3C70A 3GAFA 3TCXB 4QTUB 3UYKA 2H4XA 4QKQA 2I2XB 2F1OA 2JI8A 2AXNA 3P9QA 3DCIA 4KYTA 4BB0A 3BCRA 2RGBA 1LQUA 4D9EA 2UUOA 3P2MA 4MWSA 3W3AA 3U7EB 5JO0A 1CDDA 3EUEA 3GLSA 2PLAA 2YVKA 1O6BA 1PNQA 2ZWIA 3GVIA 3I2KA 1I4WA 4RU1A 4YNBA 1SA0A 2OGZA 3DZGA 1NVEA 5EAIA 4AG3A 4ZMBA 2VTKA 1QIIA 3D3EA 1KEUA 2MSLA 2PMFA 3IIJA 4ALMA 4F7DA 4IIJA 1HDZA 3D6HA 3KQMA 4CV2A 1TU0A 2TRSB 1PSDA 2X6RA 1KQGA 1LRLA 4PWYA 3ZDRA 4ZCTA 2ZAGA 1GG9A 1YDHA 1JLLA 3H1GA 1PP4A 4QXAA 4TXNA 5I8PA 2GVZC 1DBVO 2FPWA 5BN4B 2Q2VA 1AZLA 4DS3A 1DOHA 1EWVA 2PLRA 4A82A 3COYA 4QE3A 5C8VA 3I9JA 4KV7A 1VJ1A 5TGZA 4AXXA 1BQ4A 3M3PA 3C8MA 5I7RA 1YQUA 5JQGF 3OEWA 4QELA 1WB4A 1E4YA 2C8JA 3CLTD 1LV7A 1ZNYA 4GR9A 1DDIA 1JLRA 1HZJA 1IBLB 1BXRA 1HT3A 2C4VA 3HCDA 2C2KA 3CINA 2Q5IA 3FUWA 3PPWA 1WXQA 3QKSA 4D0NA 5SZJA 1BGWA 4Y98A 3U9LA 2HDOA 4KNWA 1GUZA 4RD6A 2HJ9A 4C22A 1AGRA 1ULAA 2ISQA 2WWFA 3M33A 1Z8NA 2CMFA 1OVGA 4JQZA 1UXOA 1Q1BA 1T2DA 1UKYA 2HUPA 4RK7A 3C3PA 1FDRA 4HX5A 5JSKA 2AF4C 4AQDA 4BVGA 3QVWA 1N32B 4L0CA 1QCYA 4QUEA 4OQ4A 3DO8A 5C2JB 3DDHA 3ZOZA 1UMBA 1CRLA 2E4ZA 3JQBA 4X97A 2W4QA 1P4JA 1QVRA 2Q21A 4X3CA 3IEMA 3MT9A 4MITA 3EGCA 5FPKA 5KNDD 4C5AA 5LQCA 2IDMA 4M6WB 3G89A 3SMQA 2O1XA 1NG1A 1E2GA 1E8DA 1Y4ZA 4QNRA 1REQB 5KHOC 3HRHA 1V11A 2P2GA 4JLNA 1PN3A 4CM8A 3E0XA 4KGXA 3WISA 2BFDB 3ZHRA 3IHLA 1QYVA 2EZUA 5C4IA 3ZVRA 5EP4A 2Q4DA 3BRWA 2G9ZA 4MV1A 2OZPA 1D4OA 2PLFA 3CZRA 3D8BA 1HLFA 3HCRA 2X3UA 4TLCA 3N2GB 3IAEA 2DHCA 3IIMA 3OD1A 3I52A 3ES9A 3W06A 4LC0A 3BD9A 4K40A 4JUDX 4WK0B 4RQTA 3L7MA 1I8TA 5IYZB 4G1FA 2IYWA 1M2VA 4GP6A 4UATA 2XTNA 3EY9A 4C6SA 1FC0A 5GOZA 3OEEA 4AP9A 5IM4A 1CY0A 2X3YA 4I81A 3ENVA 3EF3A 3OTQA 3KQVA 3JSXA 2ZRIA 3HWRA 3D6JA 2B37A 1M2FA 3IKLA 4HAYA 3VSCA 5BY2A 2XNDA 1GFSA 1U7PA 3MFYA 4FFNA 1JHQA 4CM4B 4NY1A 1V3VA 1KVSA 1BHQ1 3ID6C 3NGLA 5I47A 1YFJA 3IOEA 1AQIA 4JY7A 1RHJA 2QXUA 1W7AA 5INTA 3GGCA 4GMXA 2OM6A 4MLDA 3BUSA 3QNMA 4K5QA 3W7AA 3QLVA 5A3QA 1VL5A 2J4DA 2ZE8A 5AI5A 2ZJAA 1UDRA 3TNDA 4ARBA 1TC2A 2Z9DA 1LJ8A 3AEZA 1YJAA 5KOJA 3QFFA 5ALTA 5LIPA 3K96A 5EJGA 4J43A 4WOPA 4Y2UA 2P9QA 5BQ5A 2A7XA 3S4YA 2BFBA 1RRPA 3OHSX 5BSRA 3SF8B 4KNYA 1X9GA 1RWBA 3OQNA 3BS4A 1TMKA 2RE8A 2VJOA 1XTBA 1G2OA 4LZOA 5E0OA 3WB1A 1OX4B 3RODA 4HSGA 2P5SA 3STUA 1UEIA 5F1OA 4ZQEA 3KTFA 2OO5C 4WY8A 4GI3A 4MVJF 1XAJA 4NU6A 3PUYA 2WSIA 2PMEA 2GZSA 2HO5A 1CB0A 2OAGA 2FQYA 1RPTA 3O94A 2PZAA 3VGPA 3WKCA 5A7HA 3KSBC 2O0KA 4LBVA 4QYIA 1OLSB 3F8SA 4CQMB 2JRLA 4WLVA 5DSTA 4PYLA 4X00A 2G6BA 4HLDA 5JD3A 2R1ZA 2Z3WA 2II6A 2QZJA 2H2FA 4G67A 1A98A 4HGPA 1TIPA 2YN4A 3EXEB 4A5OA 4ARZB 5C81A 5IF3A 5J23A 2IBTA 5CBPA 3UK7A 1QDLB 1JGTA 4YECA 5IH3A 5ALOA 2A86A 3VA7A 3HBJA 3IDQA 2XVZA 3G5TA 1IE3A 4FGSA 4RVNA 5FOTA 1LBQA 1UADA 1KQNA 4ISBA 1LLQA 3UVEA 4XR9A 2JA2A 1FFXB 3GMDA 5L7WA 1OJ7A 3RVSA 1U9IA 3NO4A 3K70D 4WJKB 4MIEA 1RQPA 4Y2TA 1BVUA 4H4CA 4EG0A 1E60A 4OJKA 1D6SA 1FSFA 3R7AA 1X9IA 4YH1A 2YIJA 4GKKB 3EHDA 1VIAA 4KPUA 3O3NB 5FR1A 1UBJS 3GFPA 3SOZA 2B1JA 3R7NA 3HGQA 1QV7A 3PSAA 4FOLA 1VXOA 1WHSA 4NU0A 3ZY5A 1RM5A 1LPPA 1NTOA 1N2EA 2JAPA 2NAPA 3OLCX 4D82A 5DXAA 5ARDA 2Z2XA 4G56A 3FA2A 4CT4B 2RI0A 5HMMA 1LVGA 1ZIDA 2EW1A 4HX9A 5FI5A 4BVBA 4ICIA 1ES9A 2Q3JA 1YACA 4H0FA 4EO4A 4Q39A 4JYZA 2FUEA 1NI3A 2X4GA 4M83A 4ZMSA 5M04A 5G4KB 2QIPA 2VAPA 4UNQA 2POQX 3EPKA 2FEAA 4FONA 5C53B 1TL7C 3U1TA 3EVFA 4UBKA 1SK9A 2P2LA 2G06A 3UK0A 2YICA 3UGJA 3KZVA 1DO0A 5DW0A 5H7XA 1THGA 2VKTA 4OHKA 7ADHA 2QGFA 1E3MA 1YDFA 1VCIA 3ZIAA 5JH7F 4WBNF 2DBZA 1CRZA 1LK0A 2FETA 2VA9A 4Q9IA 5CG2A 4X8MA 2ZPUA 1OIVA 4WNAB 1V7ZA 1M2NA 1WTAA 1JZTA 2PMCA 2ZIZA 3EBPA 3CH7A 3R5KA 4KO8A 2WTBA 3NBXX 2X5NA 5EE0A 3RYHA 5BT8A 2XQFA 2IEBA 1AHNA 1XWFA 4J0EA 3AM5A 3DEAA 1A8SA 1GP2A 4CM1A 4YT2A 3GLGB 3DAYA 3OZAA 4KMMA 1O96B 1CEQA 1ZXXA 3BRSA 3DMTA 2GARA 3MPOA 2A2ZA 5JE8A 4N0EA 1YUNA 2AC2A 3OFND 5JPDA 5CVJA 3DGEC 5EJAA 4WQMA 4FE7A 1TK3A 3WLMA 3EC2A 1IBKB 3P27A 2NZWA 2NT3A 3U3ZA 4AIRA 4FZ5A 4C3ZA 4BO6A 1XZPA 4W82A 3GRPA 4YQEA 4GVPA 3GO4A 3CCFA 1VIVA 3OG9A 2P6UA 2XQIA 1ZI8A 7ABPA 1JFLA 2ZRPA 3TRFA 5AUOB 5B6JA 3G23A 2PKYX 4CMHA 4YUXA 5LKRA 3F4KA 1CZLA 4W5HA 2HJWA 3SXJA 1H2RS 1NUQA 4XUDA 2JFYA 1SCAA 5F4ZA 3HN7A 4DNXA 4ENSA 3FLBA 2MYNA 5AKJA 2YKGA 3RDPA 2C7RA 4PONA 5LP6F 3LK6A 5IJ0B 1SVUA 2E9SA 3ZWXA 4DG8A 5CTJA 3LKDA 4QPJC 2B25A 4Y6LA 5F2OA 1SCKA 3FSJX 3W6ZA 1G3RA 1GNSA 2E1RA 4KRGA 2PUCA 3ZV3A 1Y4UA 2V0NA 3H2YA 3WK8A 5HIKA 3OCZA 4RSHA 4Z1OA 2QXTA 1QP0A 2REXB 3O47A 3PQ6A 1EVKA 4MKRA 2VPXA 2Z58A 3E58A 3WLKX 4F9FA 4OQNA 4Q9AA 1A9QA 3GROA 2CVQA 1Z25A 3BX1A 2WIFA 4A5SA 1Q77A 4EHKA 4EMUA 1S2GA 5AK3A 5LC1A 4TLLB 4KREA 4ZHQB 3CNNA 2DTXA 1NW6A 1PR3A 3HI4A 1WNTA 3K32A 1B3RA 4JSRA 2K2WA 1YBAA 4N5DA 1FEZA 2PDAA 1Q12A 2Z1NA 3VC1A 4DQKA 1XKQA 3U61B 3BZUA 4AMUA 1H8HA 4RMNA 2A59A 2DWCA 1IONA 3DUWA 1J2TA 3CC8A 3ESQA 4IMJB 4UNIA 2E48A 3M1YA 2JLSA 3MTQA 5LNK6 4UPEA 3S1SA 1FX1A 3FMGA 1OFHA 4HB4A 3RF7A 3HU5A 4FGJA 2HADA 3JWIA 1T2CA 3G0DA 1QZTA 3MINA 4LNUA 1EH5A 2Y71A 4LXTA 4PIPA 4Y6SA 1XNGA 2JCSA 3P32A 4LMPA 5FLKA 5K3FA 4NFLA 1OE0A 2PRJA 5IKEA 2KLBA 3U48A 3DHVA 4R05A 2Q07A 3OZFA 4EF6A 5IZCA 4DR4B 1PT7A 4OM7A 1QNLA 2BF7A 1ODTC 2IY9A 4PFQA 3WHKA 5DULA 1S2IA 1OXKB 2CE7A 4R68A 1R8YA 2WUDA 5DI3A 3RSGA 4BJHB 2YWJA 3I92A 4Q3NA 3V4VB 2F90A 1H66A 2O7RA 5E38A 4DG9A 4QYSA 3IT0A 2BEJA 3BZWA 1N0VC 3U60B 4M0UA 5KYNA 2YN2A 5KQLA 2J9GA 2VJMB 1HUQA 3MQ2A 1XLTA 1ZH8A 3FTCA 5H4GA 1GYRA 2RKWA 4H7FA 1JEYA 1FNCA 1XDGA 5HK8A 1XCMA 4V2IA 1C0LA 2FPPA 4K6KA 3I64A 4H1HA 4OQXA 5I8ZA 3EG9B 4MIYA 5ES3A 1DC8A 1PGPA 1M76A 1UMDA 4NSNA 1AN9A 2DPXA 1DEHA 2FLVA 4BTVA 1GA1A 5BNFA 3FAKA 1DV2A 1HRKA 2IC5A 1VJ5A 2TMGA 3KAPA 3QW2A 1VFPA 1RVDA 2FOXA 3HA7A 4MRMA 4O63O 4UDXX 2VP0A 4CNBA 3HACA 3U6KA 1XZLA 5JCOC 3AY0A 5F77A 2BBOA 4E6EA 1X7ZB 4P5EA 1Y7HA 4YJ3B 1T4GA 1OTXA 1KQFA 4BUJA 5JEDA 3PKIA 2A6PA 5FTKA 1NVUQ 2WLTA 1K75A 4RDCA 1D1TA 3B9QA 2GDZA 1HR0B 1H5NA 2Q4RA 1G6Q1 2PJDA 2XQJA 2CDCA 1OWLA 4NJMB 4Y2GA 2QENA 3B51X 1VCMA 1N9GB 2VDPB 2AZTA 4P7GA 3DZDA 3WYBA 3UT5A 3D4LA 4JHXA 1W6UA 1P0FA 4BBAA 5C8XA 5I7VA 3AKZA 2INGX 1TM4E 2COUA 5IPFA 1NWHA 4KXYA 3D02A 4KDRA 4UHDA 5E1DA 4W5TA 2GBFA 5AW5A 5JDCA 2I7DA 4OAOA 3FLAA 1C3VA 1M2WA 3IUYA 1FIUA 1C9DB 4K6GA 4R5HA 1BGXT 2A9RA 3RW9A 3PQFA 4DYDA 4CG2A 3E9YA 1IPHA 9ATCA 2B8WA 5AYVA 1HT1E 3BK2A 3JWHA 1KL7A 2BMFA 1HEIA 2YDYA 3BTOA 4CLOB 2GA9A 2P2CA 3BGVA 5CXQA 1GAQA 4NNOA 2D5LA 3OKCA 2RSLA 4D4IA 5JS8A 1SNYA 1VLZA 5CH3A 3TTSA 1JIJA 4RTQA 1MEOA 3HKEB 1G3IA 4I4NA 4FGKA 4OQPA 3RFFA 1EGMB 1W0KA 2OV1A 3FNEA 2JFBA 1OYVA 2GJAA 4J07A 5EHXA 3NKVA 2R00A 1Y6RA 3VSAA 4GLOA 4DM4A 3IDOA 5LQRA 2BMVA 4UHKA 4Z4EA 3BGDA 5CDGA 3NANA 1DV1A 5TS3A 3ZQUA 2IXBA 3EYWA 4TWBA 1L4BA 3GHYA 1JS1X 5NULA 3RS4A 1DCFA 1MTZA 3BFVA 1F51E 3QWFA 2PGXA 1ZGBA 1YIAA 4GEGA 4MPRA 3SC6A 3BIJA 3VI4B 4BMPB 1RLJA 3JALB 1DTSA 3IDZA 1KAQA 3WO0A 4N48A 2JKVA 3OEHA 2BSXA 2EZ8A 2IYQA 4RS3A 1N2SA 1E18A 1PRYA 1M2GA 2W43A 3HLKA 4B7ZA 2RAUA 4DR1B 3H19A 4RIIA 4ZCQA 1HOTA 3LHDA 2CLDX 2WF5A 3AI7A 4PLCA 1CF2O 2BEWB 1DG9A 1XU4A 2B5VA 5F5LA 1PWZA 5KNBH 2WSSD 2PA3A 3RTBA 2ETVA 3REQB 3BT7A 5JSUA 3NBZC 3SLRA 3G8YA 4QICA 4OHZA 3Q4GA 4RAQA 3EX7C 4Z7QB 1J4AA 1QG6A 3F5SA 4IYRA 3FAZA 3LC0A 2CHQA 4IVPA 1H6AA 4U0KA 3BSYA 2GUWA 5DSXA 3AGPA 1UWLA 3L7BA 3QY0A 4LCEA 3V46A 1VLLA 1L4HA 2WT4A 1R12A 3F6BX 5G41A 2DT5A 4I2VA 1JMVA 1ZL0A 3TN7A 1L3CA 2J0QA 1KMMA 3F6RA 3LXUX 4AK9A 1FVXA 1IDOA 1YZVA 3ZD8A 5E7JA 2WPDD 1JWAB 2PX0A 3EGDB 3HS3A 1EB8A 1P2DA 2PRSA 2PYIA 4FD3A 3QOYA 3IMEA 4UPVA 1EP1B 2PSJA 1LRKA 3B6MA 1UIRA 4JVNA 1KEPA 5H81A 3WLJA 4AUEA 3WDLA 5IARA 1Z0JA 4EJ0A 1SIOA 2GZ3A 4BVFA 4YP9A 1GUYA 4JBGA 5CVCA 3X1ZA 3H2JA 5E7IA 4BDTA 1MVOA 4IH9A 1OPRA 2VP9A 1E9AA 1HYEA 2FWNA 3BF7A 2OY0A 2ZIUB 3GLQA 3LGXA 3ROQA 1U2EA 5F33A 4EHAA 3J7TA 3OT1A 3RYTC 3EARA 2G1AA 1KEKA 3G2MA 5K1ZA 4ENTA 1L7QA 4QBKA 2IBMA 5CX1A 4G2NA 2FKNA 4JWKA 4Q4CA 1B7GO 5BPHA 3KSUA 4OJYA 2YYSA 1ONSA 3ZCRA 1KQ3A 3LUAA 3A4YA 4ZCIA 1AK1A 1Z2DA 5AHXA 4BNJA 2HA4A 4B3BA 1J8YF 2RB5A 3AILA 4P98A 4CTNA 3MJSA 3ANTA 5BMVA 5KKAA 1SOMA 2JGEA 2YJTD 3SIRA 1WQ3A 3EPPA 5DGDA 4F1WA 4MNTA 2FEPA 4DGSA 3OZCA 4ZI7A 1DRKA 2P0EA 5A02A 5BRJA 2C31A 3PF8A 4Z0HO 4U7PB 4HP8A 2VQSA 8GPBA 2ONJA 1ADBA 3AZPA 4C6RA 2OQIA 5K51A 1Z0UA 4CCSA 4L9SA 4PGGA 3RKRA 4KHZA 1TTTA 3CB2A 3C87A 2F9MA 1VKRA 2OBBA 4XFJA 3LRTA 3UCEA 4L4ZA 2VNKA 3K20A 3LTEA 3I1YA 1X8JA 4X1KA 4MR9A 4L6CA 3MGCA 2PVPA 5COQA 1IBRA 2ZB4A 1UXGA 1UBHS 1Z33A 2PKQP 3AHJA 5BW6B 2WM3A 4JLKA 4ANFA 3I01A 2VA8A 3ZK7A 1Q1NA 3OZ7A 2OXEA 3AYZB 1EDDA 2R2GA 4YLYA 2IKSA 1AS2A 1CBUA 4LYAA 4AKTA 2XMRA 2FK8A 4L5IA 4PICA 3HVRA 3VJRA 2ZBFA 3EQ9A 1UDWA 2QRNA 4I36A 4X20A 2EHJA 3G17A 1ORRA 4HQLA 4XUCA 4FYYA 4UNRA 1DEAA 2HFJA 5A4MS 5HK9A 1RLMA 3LKZA 1VJ0A 1I2DA 1YB7A 4LZNA 1G8AA 3O8OB 4QEDA 4YXFA 1WPRA 5A4KA 4DMKA 2RAVA 1Y8QB 3I6ZA 1Z16A 4HWTA 1JBKA 4M21A 3AKYA 1GRVA 2COEA 2GHIA 1E5XA 2Q7XA 4HNHA 4KK3A 1ULBA 3I4FA 2QTVA 3A4LA 2OFWA 3IH5A 3K4PA 4Y2HA 1YSCA 1COWD 5EP2A 4PX9A 4IV5A 1HDCA 3WA6A 2RGCA 2X8JA 3IYLW 1CUJA 2DHEA 4ZT5A 1Z15A 4R9NA 3STTA 4GUDA 2ZE6A 3FYUA 3M6XA 2H9IA 4OYRA 4RPHA 4WGGA 8OHMA 3ILXA 3NAGA 1SRRA 2XNSA 4KE9A 2QNRA 3TPZA 1X8LA 3FKSD 5FOSA 3IP6A 1D3AA 3MUOA 4XGQA 2DUUA 2NAFA 4J49A 3NDPA 5FWYA 2W37A 3WL7A 1TCUA 3SC2A 5LMUB 2YJNA 3HDQA 3NHYA 3R1IA 2CBXA 5KDLA 5AJWA 9MHTA 4J76A 1T8WA 1ZA1A 2ZEJA 4US0R 4BMYA 5HVNA 5ITZB 4RQAA 2ZYTX 3D3NA 3L8EA 3RU2A 2C59A 2P9TA 2QTFA 4AULA 3RUIA 3L5OA 1K4MA 5L53A 1OYYA 4QXPA 3TDKA 3N1UA 4I4TB 1HQDA 1WVGA 3WS7A 3GLFE 3WLOA 4F2GA 4DTCA 4UREA 2SKCA 2C2OA 3KYBA 2HPVA 1DQRA 1VE9A 4FJ2A 4OJTA 1B14A 1M8GA 1ZGAA 2LE0A 3A9SA 3JZFA 4MUHA 2V5UA 2AJDA 3TIIA 1R4NB 1XI2A 4B4DA 1FSPA 1M6EX 4C78A 5BOSA 3I4CA 1HLDA 3ACCA 3ELBA 1I7LA 2JIRA 2C3MA 2VYVA 1ARZA 2VYFA 3QE9Y 1E6WA 4JP3A 4KXLA 3DTTA 3P9RA 3Q0TA 4XM1A 4QLBA 3QM1A 3ESBA 3AL3A 1PAUA 2BP7A 3BF8A 3SHTA 2W93A 4HXEB 1I7NA 3A37A 3LQRA 3M70A 3UUFA 2BFAA 2OENG 4PX5A 1KAEA 1PI3A 1TADA 2B5WA 2EXXA 1IJBA 2JKZA 1JPVA 3GLVA 1R0ZA 3IAM1 3O1LA 4IQ8A 3PFWO 1L8LA 5TPWA 4TYNA 1ZD9A 2MWMA 4XCQA 1O89A 1BEZA 1EWYA 3VOTA 1ZMXA 1HE5A 4EHLA 4YCMA 4X54A 3AF0A 5CVDA 1BE8A 1PJ2A 2BGTA 2CBGA 2DKOA 3BERA 4MDEA 2OCBA 3N53A 5CH5A 3EVAA 5ALDA 1PJ3A 1HKUA 2I54A 3ZY2A 3MQFA 2AFIB 4MXDA 4GE0A 2Z4RA 5AVWA 1SQ5A 1PSWA 1ZUWA 2ZQZA 3DE0X 5AHKA 5FTJA 4EYSA 3NTLA 1KYXA 2GM5A 3DLPX 2PGDA 1V6AA 5DNWA 2QMQA 1QRUA 2V65A 3LGAA 3NYQA 1VZ2A 3E8SA 2FAXA 4FCTA 4K05A 4FHDA 4MCJA 1N0IA 5CAEA 2OBYA 3MRTA 4GZ5A 2O4UX 1X6VA 4FSDA 2E7ZA 1W1WA 4ZQIA 4HVAA 3A2KA 1RHUA 2ZYWX 3O3CA 3SE7A 2Y1EA 2IV3A 4RZUA 3TMKA 1IHUA 5IBRA 4HEJA 3RTDA 2PCLA 1AKEA 5A9RA 1WNFA 5A4FS 3LD9A 4I14A 1A9RA 4RACA 5AK6A 3NIWA 1TEXA 2JNWA 4GICA 5DYNA 2P75A 1NYRA 3NHLA 5EIWA 3NPAA 3T5DA 3W1WA 5KVAA 1JJFA 2ZS7A 1Y6FA 1XKTA 4I1RA 4XTCS 2ZM5A 3LOQA 2J07A 1OI7A 1Z8DA 4QOGA 1XQVA 1RCFA 1FZTA 2NXCA 4YQZA 4YRRA 2G72A 2LP4Y 3PCRB 1GZUA 2DTEA 2R8PA 2ZRAA 4CDRA 3FTFA 4DARA 5JAMA 3OE4A 3AQ4A 5JAOA 4ZGWA 2O8BB 1ZGCA 3D8RA 4CCYB 3S2UA 1E3SA 1GGVA 4JASB 4BEBA 2LBPA 4XYMA 3LLSA 1ENOA 1GTG1 2GFHA 4XSVA 2XEDA 2NXWA 1VYTA 3CF4A 3EZFA 1R64A 4N0MA 3VISA 5KJFA 1WF3A 3IP1A 2IV2X 3GJ3A 3FZNA 5GJBA 3KHUA 3DA8A 1QIFA 5B1IA 3CZ4A 3UPUA 3J81A 1XPOA 4H4EA 1F60A 2J31A 4C0BA 1AKTA 2G71A 1QUFA 4LXUA 4Z7JA 2VNIA 1Q5PA 4ND3A 3SEZA 5GM2A 2N1MA 4S04A 2HJSA 2JIDA 3LHIA 3QFRA 4V0KA 5FWYB 5BUQA 1MFZA 4K9QA 4XRRA 5IG2A 2XKAA 3CCCA 1JEQB 2Q9CA 4Q21A 5TDHA 2A3RA 4HGZA 1R0CA 5B7NA 4P32A 4B47A 4MUMA 2P7HA 2OO7A 2Q1YA 3OLZA 3VVCA 2NOAA 3B53X 3EQ2A 3NS7A 5G3ZA 4KC0A 4OB8A 3UFXB 1IK4A 3WK9A 3K09A 1C7JA 3HHPA 4HWRA 5KYUA 1XEXB 4IWXA 4MUJA 4KWHA 3GWZA 2J3MA 1VIMA 1HTBA 1PK7A 2X2EA 3GLFA 1ZRHA 2BUBA 5KWEA 5ABPA 1XTUA 3KIPA 2XB2A 5J9FA 3IGFA 2WKRA 2B94A 3QQPA 5FUBA 4MQ5A 4D79A 2F3QA 4I3GA 1ZWKA 4ZXFA 5I48A 1XVUA 1JZQA 3LSTA 1LX7A 2QJFA 1KYTA 3HZOA 2OP1A 4HC4A 3GRZA 4L51A 4YAKA 4QOSA 4AROA 2D8MA 2F43B 4HEHA 3T7SA 4MR8A 2JJYA 2TMDA 4L3WA 1JU3A 3D3WB 5TPZA 1THZA 3K9WA 4K46A 2W9XA 4QC2A 1V8ZA 4RA6A 4DLTA 4YUVA 4PZYA 3E5MA 1ACMA 3K3PA 4LC1A 2VG8A 2WDPA 4MHOA 2E4VA 2ZIEA 2YL2A 4I55B 3UUGA 3M6UA 1JDSA 1P7CA 2VQ3A 2WD7A 4B3MB 3NIGB 4K8RB 1D9XA 1E3LA 2HDWA 2VJYA 3CTPA 3RV4A 4A03A 3PD7A 5AHOA 1YA4A 2QX6A 3ZBTA 5A6SA 2QTMA 4Z4QA 3OESA 4YAOA 2A5YB 3KT0A 3M6MD 2IZOA 5FO1A 5FFMA 1ISFA 4CT5A 4YJ2B 1QHEA 4IJ5A 1KDVA 2P3LA 3VBCA 4JVSB 4EG8A 1MVLA 1SIBE 4A0SA 4BYGA 1P4AA 2GO1A 2JGLA 1PW7A 1Y48E 2XE7A 1HQCA 2VUTA 3N8NA 5B1YA 4JI2B 4KR0A 5A5EA 1J0EA 2B2NA 1PQ4A 4I5IA 5DBFA 4L95C 4CFSA 2W2LD 4KQEA 3MXOA 4G41A 4PAWA 3MLBA 3PYXA 1UXIA 1SHKA 4LVOA 4TV9B 3KQYA 1PQPA 1G5TA 3OU6A 5JJIA 2GPJA 3MFQA 3G1WA 5TNXA 3AF6A 3LCMA 2XODA 1N7JA 4HN4B 3D0KA 3FWNA 3S3TA 3TB4A 3O0TA 3G6KA 4LY6A 5U4XA 4C4YA 3QIVA 1KC3A 3MQ4A 1GL3A 2B7LA 2WNIA 2M6KA 2Z5FA 4MGKR 1WO8A 2POCA 3ZZUA 1CTQA 1XZHA 4CTOA 2FSUA 3NBUA 3RK0A 4TSFA 2EKDA 3UAGA 1ZUIA 3AUTA 3OD5A 4MJXA 5JVDA 1G18A 1G8HA 1O95A 1YZGA 4ZEVA 3UXYA 2ENWA 2ZI4A 5M34A 1J42A 1G21E 4JP8A 1CQJB 5FJIA 4OX9Y 5KQPA 1FTWA 2BE9A 1J24A 3ZUPA 5KU7A 1H1LB 3AUYA 4WXEA 2B4RO 3F1KA 1K97A 4QRDA 4P2BA 4TL6A 1UDXA 4FFVA 1EVEA 4R3NA 2ANBA 2ZT8A 5CLGA 3UHJA 4LTDA 1NV8A 1OIXA 4TMTA 5AHWA 2YWHA 3R74A 5JANA 5AJXA 1LDMA 3T3PB 4AO6A 1DG3A 5DN9A 1P2FA 1SVWA 1TMYA 1I1OA 2P6MA 2XGGA 3AEQA 1ECPA 5KSYA 2DLDA 4QU0A 1KZ4A 2XVXA 1L5KA 2JJMA 2V7PA 1PEDA 3R3YA 2AOUA 3U3RA 5EMMA 4FDVA 4MCHA 3KELA 2BGNA 4RADA 5AICA 3UM9A 4Z4CA 4RTKA 4IIDA 5DYWA 4F04A 5HKAA 2D1TA 4LI0A 3LWBA 1Z4IA 1QGED 4J0FA 1ZGHA 3U9TA 2O06A 2X5KO 2BHLA 2YZKA 1X1TA 4EJSC 2NYUA 3TM4A 4Z2YA 2B1QA 3NKLA 3P9CA 1WZ2A 3AV3A 4EPRA 5EJ7A 4E4RA 1UQRA 1ZICA 3PEYA 2RGUA 3P20A 3CVOA 1SUPA 5FLYA 3K9CA 3WIBA 2BONA 4MDHA 4Z1MD 2X7HA 1DAMA 4L8GA 2WB2A 3AIKA 1KI1A 3GNSA 3VU9B 1AIPA 3FCEA 1XKXA 1J0AA 1FU7A 4DCOA 4X7BA 3IJ5A 3AT1A 3W9SA 3WRWA 1AUVA 2AFRA 3F71A 4IG4A 3T7JA 3W8NA 1O6FA 5DHTA 3ZJ4A 4RZSA 4JA0A 3OCWA 1WOMA 1W0JA 2ZIXB 3AXTA 2G8LA 1W73A 3ESXA 4TLEA 4BBZA 5JZOA 1YB4A 4O33A 2QJWA 3EEFA 2FEKA 4GPD1 1U0EA 1NT2A 1B8UA 3A2MA 4M89A 1L1RA 1XDDA 2QR2A 3ISJA 1VE3A 3R4VA 4XPZA 5JHHB 5HQTA 4BXOB 1BDMA 2ZUSA 2GZMA 2ZBEA 1QK4A 2A84A 3K8ZA 4HQOA 5B7PA 5KCZA 1OZ0A 5LU8A 3DXXA 3F4BA 2CCKA 3PL1A 4XQ9A 3Q7QA 4KEAA 4C7VA 4ECEA 1ZU4A 2DU8A 4WKNA 1WXIA 3SJ7A 2QX9A 2QUKA 1GOTA 4R01A 4UUOA 1WCIB 1FK8A 1DXYA 1EXNA 1NW7A 2DVMA 2PX3A 4B48A 2OFOA 4S0ZA 2BSAA 3E18A 2VSNA 3JYHA 3RIHA 3U09A 3UAOA 1QLWA 1S6YA 1GDTA 2VJKA 4U7WA 4V0LA 1LI5A 4I50B 2QTNA 3AR9A 3CF2A 2EF0A 1PZFA 1ZA2A 2WA1A 3IVXA 3IVAA 1TU3A 4LYFA 6CHYA 4KJXA 2J9FB 5A4JA 2DH6A 4MV5A 7AT1A 3LUJA 4BDSA 4TTPA 2VH5R 3K0CA 5AP9A 1YWGO 2CXXA 4C9BA 3QZUA 2AN4A 2PS3A 1WMSA 3ROZA 2JS7A 4F21A 4XWOA 2O1WA 1DHRA 1GDDA 1G5FA 2QTHA 2Z3VA 3D6TB 4KDEA 2W5UA 4OH7A 4J1TA 2A1UB 2OXCA 1SPBS 4EELA 3CO0S 5AVQA 2O6HA 5AI4A 4EPVA 5KSOA 1SK8A 2EWMA 5HIIA 1TTHA 1UM9B