3O1HB

Crystal structure of the tors sensor domain - tort complex in the presence of tmao
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
300
structure length
296
Chain Sequence
DEKICAIYPHLKDSYWLSVNYGMVSEAEKQGVNLRVLEAGGYPNKSRQEQQLALCTQWGANAIILGTVDPHAYEHNLKSWVGNTPVFATVNQLDLDEEQSTLLKGEVGVDWYWMGYEAGKYLAERHPKGSGKTNIALLLGPRTKPVTTGFYEAIKNSDIHIVDSFWADNDKELQRNLVQRVIDMGNIDYIVGSAVAIEAAISELRSADKTHDIGLVSVYLSHGVYRGLLRNKVLFAPTDKMVQQGRLSVMQAAHYLRHQPYEKQASPIIKPLTPKTLHDDTIEESLSPSEYRPTFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Sensor protein TorS
publication title An asymmetry-to-symmetry switch in signal transmission by the histidine kinase receptor for TMAO.
pubmed doi rcsb
source organism Vibrio parahaemolyticus
total genus 99
structure length 296
sequence length 300
ec nomenclature
pdb deposition date 2010-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o1hB02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o1hB01
3HV2A 1P6QA 1DG9A 4DN6A 3VNBA 1GCGA 1PNTA 1YVUA 2GX6A 3CG0A 3O1HB 1XHEA 3LUDA 4HNRA 4N47A 3F73A 3ROFA 2FQXA 8ABPA 1R8JA 2ZWMA 4JB0A 1B00A 4IMIB 2FXIA 4Q6WA 1NATA 5JS2A 2A9RA 5JNRA 4RZSA 1SRRA 1YS6A 2PAFA 3R0JA 3SM9A 4EYOA 2KYRA 3CZ5A 5T7BA 2NT4A 3BRQA 4RK5A 4MAAA 1Z18A 3OLVA 5DGCA 1M5TA 3GBVA 1DRJA 3G85A 3EQZA 3O75A 2YHAA 1ZITA 2HQBA 2RDMA 3GV0A 5IX8A 5KQGA 4RKRA 2FQWA 2MSLA 3LUKA 4IMJB 3CLKA 4OG2A 3SQNA 4F8JA 5B3JC 4W5NA 4IRXA 4Z4IA 1LJUA 2PUGA 2MYUA 1RNLA 3FMVA 3LUJA 1QP0A 1MB3A 1URPA 2IDMA 4KQCA 4MR7A 3F6PA 4F06A 1WETA 1BVHA 2M98A 4EY3A 2LIVA 2QR3A 3HUUA 2JVIA 3SG0A 1VPWA 1PEAA 4OLAA 4G97A 4MR7B 3EDCA 2JRLA 4ZMRA 1E6MA 2FKAA 4P98A 4MS1A 4FE7A 4TN5A 5B3JA 5HSGA 1UDRA 4TLMB 5JNVA 1QMPA 4WXMA 1PEYA 4MS1B 1DBQA 1Z17A 5KC8A 4PYRA 5CHYA 4NCAA 3A0UA 4MGEA 1LJLA 3H5VA 2R47A 1JF8A 3HSYA 1FSPA 3TMYA 3N8IA 2HJ9A 5DTEA 1NXVA 4RY0A 1W25A 4IF4A 3HZHA 1KGSA 3HJFA 4YV7A 3BBLA 3CU5A 2H0AA 4WWHA 1BA2A 3CG4A 6ABPA 4QYWA 4LDAA 4XFKA 2PUFA 3GA5A 2GWRA 2JVJA 4RDCA 4Y9TA 3QELA 3VNAA 2DRIA 1ZESA 2LPMA 4LE2A 3IP6A 4RK6A 1EWTA 1RXEA 3QELB 1DC7A 4WZZA 2AYXA 1Z16A 4HYEA 1U8TA 2L19A 2ID7A 4YS6A 3M9WA 1DJMA 3HO1A 3OLXA 2J48A 4RU1A 4NQRA 5EWJA 3GBPA 2CD7A 4FE4A 4MYRA 3RVNA 3L6UA 5EWJB 7ABPA 3LKVA 3OLYA 5FBKA 4KVFA 1QPZA 1EAYA 2LP4Y 4RWEA 2MYPA 1QP7A 1F4VA 1DCKA 4Z4EA 4G0ZA 2GBPA 5ABPA 3QX8A 4P1ZA 1JFTA 2MSKA 3P9YA 1DCFA 3I5AA 3B2NA 1KRXA 3OO1A 4KNYA 1YIOA 2PMCA 4D6YA 4YP9A 3QLUC 4TMYA 4S05A 4G0YA 1M5UA 3BRSA 4W5TA 3Q7TA 3DGFC 1P8AA 3RVQA 3H5LA 3O21A 1Z25A 2H3HA 2LBPA 3CRNA 4ML3A 3H1FA 5JNUA 2WJAA 3C97A 4NICA 1GUDA 2PL9A 3N0XA 3N0RA 4G0MA 5TQ2A 3MQ4A 1USIA 5IUNC 3O2QB 3OQMA 3HXMA 3FFXA 3UKJA 2RGYA 1LBHA 3QEKA 1MAVA 2FEPA 2NZUG 4YRZA 4EYQA 3KS9A 5CNJA 3Q7RA 1USKA 5TQ0A 4EGSA 2JBAA 1QP4A 1JH9A 1E6LA 1RPJA 2A9QA 4YGXB 4N41A 3K9CA 1TVMA 4MR9A 4LZLA 5TQ0B 1NXTA 4YCSA 2JBAB 1QQBA 4ETIA 5BRAA 4N0PA 4MR9B 3E61A 4RS3A 3Q9SA 4D6XA 1Z26A 4MS3A 4QPJC 5GQSA 1VLZA 5EWLA 2FMFA 3D8UA 3QLTA 3H1EA 4G0QA 1A2OA 1LBIA 3MYYA 2PKXA 4MS3B 4MR8A 3JPWA 5EWLB 5TPWA 2FTKE 3C3MA 3DGEC 3JPYA 4KK4A 4MR8B 3KLNA 4NV3A 3CNBA 3RVJA 3A3KA 5TPWB 1ISRA 4XASA 4LE1A 1JDNA 2IOYA 2MYTA 4JP1A 4L85A 4LX8A 3CS3A 1K66A 4ZMSA 4MS4A 1AB6A 4ETNA 3G1WA 5GOTA 1P6UA 4RK1A 1Y1LA 1VKRA 1EWKA 3T38A 4MS4B 4CBVA 4KRFA 5KI6A 1W9HA 2V0NA 5JNTA 1NY5A 3EJWA 3N75A 2WRZA 3LUHA 1A04A 4M88A 4N76A 5IEBA 3OO0A 1E2BA 5D2CA 1XWWA 4O1HA 4Z4GA 1VRVA 3DLHA 1C0EA 2FMKA 3KJXA 4FB4A 3HCWA 1BAPA 2XDYA 4RXUA 3T6KA 4B09A 2BGGA 4Z0NA 3HDVA 2NUBA 2FQYA 1HEYA 3N53A 4MQFA 5EWMA 3RQIA 3TO5A 4YLEA 1AB5A 4MLCA 3LUGA 3EULA 4F12A 4EVQA 1M2FA 5IBQA 3LKBA 4MQFB 5EWMB 1CHNA 1DP4A 5C5EA 2E4UA 1ZGZA 3HK2A 4LRQA 1TM2A 3GRCA 3M6MD 1YS7A 1TLFA 4GPAA 3Q7SA 1JYEA 3NNDA 3O1JC 3KHTA 2WWVD 1MB0A 1U04A 3QX9A 3MM4A 1Z12A 4D74A 3LUFA 3N6VA 4H60A 5JNSA 1KMIY 2R4QA 1NXSA 3BREA 3LOPA 3NHZA 3EODA 4RXMA 3F6CA 3TX6A 2PUDA 4MRMA 3KG2A 2IKSA 1JX6A 1DCMA 2L18A 5DLEA 2E4XA 3KSMA 4Z4FA 5I4CA 3HVRA 4MRMB 3RVMA 3KCNA 5BR1A 1JLKA 1JYFA 1D5WA 1A0OA 3FDFA 1S8NA 3E3MA 4MQEA 5JS1A 1ZAYA 4ZPJA 3L49A 4G86A 4JB2A 4YO7A 4RV5A 4MQEB 4G0OA 3GL9A 1MVOA 5HM6A 1LK0A 1IIBA 2JK1A 3QEMA 1SXHA 5TQJA 1EFAA 1CYEA 1P2FA 4RSMA 1L5YA 4N0QA 2ZAYA 3QEMB 3ROTA 4IILA 4W5QA 1DRKA 4H3KB 5KQPA 1D4ZA 4KMRA 1RZRD 4WXEA 5KQMA 1YK0A 1ZDMA 4KREA 3RH0A 1H9CA 1FFGA 1TMYA 3T8YA 5BRJA 2QSJA 1JWLA 3RVKA 4PEVA 3IPCA 2B4AA 2CHEA 4GNRA 3GYBA 4EVRA 2RJNA 3EQ2A 2PE5A 3LUCA 3QLUA 3OLWA 1U2PA 1RXIA 4L4UA 3LMKA 4JAVC 5TPZD 3LTEA 1E6KA 3NBMA 2A9PA 2RJOA 4RKQA 4EUKA 1D2AA 3UK0A 4Z4HA 4PICA 1JDPA 4QICA 1JL3A 3URMA 3I09A 3JVIA 1RZRA 2WMYA 3A0RB 3HS3A 3OM1A 4XLTA 1QO0D 2NT3A 5DCLA 3HUTA 2FW0A 1MIHA 4JOQA 5FWYA 2VK2A 3EAFA 1U2QA 2JB9A 4WT7A 4OTZA 3C3WA 1D1QA 3JY6A 5T3YA 4RK4A 1D1PA 2PL1A 4JA2A 2IPAB 4H3HB 4KV7A 4PZ0A 1OXKB 1NXWA 3OMXA 5FWYB 3IP7A 5IC5A 3QLVC 2TMYA 2QVGA 3NNSA 2R25B 4UHJA 4KZKA 3SNKA 2VYCA 2E4VA 3H5OA 3ILHA 1M2EA 2WY2D 3IP5A 3IDOA 4EYGA 2PUAA 1USGA 3H5WA 1YMUA 1NXPA 4OATA 2FVYA 1GLGA 2F8TA 5CNIA 2E4YA 4WUTA 3Q41A 3EGCA 2B1JA 2M1ZA 3KTOA 3D02A 5TE9A 3O2SB 2QV0A 3H6HA 3RVOA 4F3TA 3OM0A 1QO0A 3QLVA 1Z2DA 5HKOA 2Q5CA 1QNLA 1BDIA 3CHYA 2CWDA 3JVDA 1BDHA 1ZN2A 3HM9A 1Z13A 1JHZA 2JCGA 3MA0A 2QVCA 4ETMA 5JNWA 3GWGA 5PNTA 5CNKA 1C4WA 3I45A 4Z99A 4OLBA 2HQOA 4KFCA 1DC8A 2WB4A 5KQLA 4LDZA 1ZVVA 2VUIB 1SXIA 4KK3A 3IPAA 2FLKA 2F8SA 1ABEA 1EWVA 5KWSA 3DLBA 5DKFA 2YHBA 3HEBA 5CNMA 2N9UA 2QXYA 3KYJB 3TD9A 2GKGA 3ILYA 2CHFA 4G0PA 3H5TA 1CEYA 4RXTA 2MSWA 2FEWB 2QW1A 2L17A 4N03A 2PUCA 5FWXA 3T95A 3FFWA 1Z2EA 3OQOA 1YTUA 3K4HA 1ZGGA 2QU7A 3O1IC 4ZYLA 1ZHHA 5FWXB 1QQAA 2FSPA 5IEJA 3GT7A 4DQDA 2PUBA 4KPYA 3KKEA 2AYZA 1F51E 9ABPA 4F11A 3H5IA 1BDJA 4UHKA 4E7OA 3HDGA 5IUKC 1DBWA 2PLNA 3OLZA 1ZH4A 2R48A 1NXOA 3LFTA 1NXXA 3KYIB 1GUBA 2JVKA 3DBIA 5ED4A 2HPHA 1FFWA 4XXHA 1FFSA 2P9HA 3NNNA 1QKKA 5F64A 1TJYA 1PHRA 4Q6BA 5BQ3A 3DZDA 3MIZA 3H75A 2FN8A 1Z15A 4Z9AA 1APBA 2IPLA 4JASB 3S99A 4QYMA 2I6FA 4YWHA 3CTPA 3CFYA 4HNQA 4RK7A 2FMIA 3FGZA 4PE5B 3FFTA 1PNRA 4KQ9A 2GI4A 2LUOA 1ZH2A 2OQRA 1ABFA 1OXBB 3O2JA 3IP9A 5KC9A 1SXGA 5IUJC 3M9XA 3H6GA 3H1GA 2O20A 3RVRA 1DBPA 3NHMA 1PUXA 3CKMA 2PJUA 5FBHA 1T34A 1YK1A 3F7NA 3QK7A 4TLLB 4YR7A 4RY8A 1I3CA 1JBEA 4MLDA 1KRWA 3N0WA 1ISSA 4Q7EA 2L2QA 3SAJA 3JS5A 4Z9BA 1SD5A 3RVPA 2HSGA 3SY8A 5E3JA 3OQNA 2WJWA 4MPTA 4IGAA 4RY9A 3CZCA 4ZJPA 3OMWA 1FQWA 3A10A 3O74A 3TB6A 2ID9A 2FEKA 1EHCA 3MF4A 6CHYA 3C3KA 4LE0A 4Z4CA 3RVSA 2W42A 5IULC 1NTRA 4E7PA 2FN9A 4OBBA 4EYKA 1GCAA 2PUEA 3Q15C 1K68A 3JTEA 4RK0A 4O1IA 2FLWA 3C6QA 5C5CA 3BILA 4XAQA 1J56A 2P4UA 4XARA 3MMNA 4EVSA 1U0SY 4G0XA 2IPNA 2E4ZA 2X7XA 4O5AA 1JFVA 3RVLA 4S04A 1YMVA 4HNSA 1L5ZA 3UUGA 3W9SA 4DADA 1JFSA 2E4WA 2FMHA 2NZVG 2VUHB 3KLOA 5TQ2B 4NCBA 2IYNA 2MYNA 5TPZA 2QZJA 4W5RA 2A9OA 3I42A 1DZ3A 2IPMA 1ZY2A 1XHFA 5HQJA 3LUAA 2HQRA 4W5OA 2OENG
chains in the Genus database with same CATH superfamily
3ENWA 2OB2A 2C5AA 1GCGA 2CF5A 4DDUA 3CG0A 1T4BA 2GYYA 3ZZMA 1H2FA 2XDQB 4RVDA 3C6KA 3R5XA 3D3KA 4DDTA 5CFQA 1BZYA 4MRPA 3F9IA 3TZBA 1NATA 2OO5A 2VK4A 4BB5A 3DHEA 1P7VA 3SM9A 1JSCA 3OQIA 3JWEA 3OJEA 3ZWWA 2HCRA 4J76A 5A71A 2VAWA 3O2NA 4LK3A 2Y66A 4D99A 3CV3A 1ZJYA 3D0KA 3L41A 3ZDFA 1AKWA 4REMA 3VPGA 3EY9A 2HMYB 5CM9C 1Y4ZA 1ORHA 3P4XA 5KQGA 2QZ4A 2FPWA 4MWGA 3X1WA 2VH1A 1LDGA 2Q0SA 4ZK6A 3RIHA 1I4WA 4L27A 1KZYC 1ONNA 1PO7A 3OBBA 4JFAA 3RYHB 3V2IA 2YWBA 3EMKA 5HKLA 3ZU2A 4N8EA 1WHSB 3JATB 3K72B 4HX5A 4ZEMA 4LY0A 1NP6A 4MRAA 3FMIA 1L5QA 4Y2UA 1ECJA 4OXNA 3AM4A 1PEAA 4RAQA 1XDGA 2JRLA 3HP7A 5BQFA 4XPIB 2FKAA 4G5QA 3WNDA 2R6R1 3L8GA 1TEXA 3UIEA 2YXLA 3L8ZA 3HXOA 2VDVE 1BCRB 1R0ZA 3Q7QA 4O2AA 4DLWA 2PQ0A 4MCJA 4CFZA 1L8XA 3DDWA 5EZ6B 2VF8A 1KDPA 1ZSVA 2H1WA 3TDMA 2VF7A 3BF7A 3LW8A 3A6KA 3H7IA 1GR0A 2DWQA 2Z2IA 3LL7A 3NRCA 3FNHA 4XGQA 4H7FA 1T4MA 2BIFA 4E1VA 4EO7A 4RHEA 3EIWA 4FSXA 1NLYA 3KZKA 1G5IA 1KQNA 4E09A 2V65A 3BFPA 3K96A 4ZC8A 3E1GA 2BFDB 4MCHA 4TS9A 1BA2A 4AL4A 1R0WA 2ZE8A 2C2HA 2ZYWX 5AVQA 2AKEA 4O4JA 5EJMA 4M53A 1ODKA 1SXJC 3GNTA 4JLMA 4MOWA 3PVSA 3TRHA 3GNSA 3BK7A 2XUDA 1BEEA 1RKVA 1ZG3A 1CIJA 1GRRA 3UF0A 3QELB 3JX9A 2AYXA 3K2BA 1VLJA 3HLKA 3GZ4A 4PX9A 3LY8A 2R87A 1MOPA 4V2UA 3VR1A 4ESOA 2I7DA 3ZDCA 1FXUA 2ID7A 3N6XA 1TUBA 1OZ0A 2R5FA 1BS1A 1ZJ5A 3GBPA 4EJMA 2CD7A 3P5SA 3STVA 4MDFA 4CMEC 4L50A 1T2DA 4C5CA 4WZAE 4U8HA 1XRMA 2NTYC 3ET5A 1B2RA 3PUVA 3F6RA 4IWXA 4PYOA 1QPZA 4C4OA 5BVHA 1SA0A 2R8YA 3PNPA 4HGZA 3SEZA 3CVVA 2CLDX 3ZNNA 3WY9A 4N6NA 3AOEA 4JBYA 2DQ4A 4I55F 4KXNA 4L0DA 2C98A 3HEAA 1W29A 1MA0A 1GL7A 1H3EA 1KDVA 1G3IA 1RWQA 2MSKA 1H4QA 4RNCA 5D5HA 2ETXA 3LU1A 3QWIA 4G1CA 4L57A 2A30A 3C8UA 1HNXB 2GNAA 4ALJA 2XA1A 1FQJA 1GQRA 4OJYA 3MERA 4S05A 5H70A 4NFYA 1S9DA 5I7WA 5D1HA 2Q1UA 4HNVA 2GZHA 3R3JA 4GPTA 5EMHA 3H2GA 2VJLA 4L51A 4F56A 5AFSA 3E22B 2R6JA 3MJEA 4FUQA 1N0HA 5E8JA 1YZHA 3SXUA 5A7FA 5CFMA 4KWTA 2IU4A 1ZM9A 2G0NA 2W2XA 3ICQB 3NXKA 3OX4A 3CEJA 4Y1EA 4ZVQA 4BFXA 1Y5RA 4Z7NB 1RC1A 3ND6A 1KH3A 3N0RA 4ZARA 3A3YA 1USIA 1OA1A 4TUYB 2X58A 1F0NA 5A4MS 1MAWA 4PZEA 1YZYA 3VO9A 5DBGA 4A0GA 1UANA 3DB2A 3LQ2A 4BWVA 2PEYA 1UZUA 5FQOA 1KI7A 3RYIB 1Y5LA 2YY5A 2UUAB 1IEWA 3Q7RA 4D9IA 2Q1SA 3O3MB 5TQ0A 4Y2HA 3MMZA 3IEPA 5FOWA 2N3ZA 1T3LA 4K40A 5AKGA 1Q0UA 2HHAA 4JHLA 1BDIA 1ULBA 3Q7PA 2Q27A 2ZFUA 3AR6A 2YIVX 4MEAA 3DNMA 2PR7A 3GVXA 2VEOA 2IXBA 4DLLA 1GSOA 4S0XA 2XDAA 3EAQA 3RTEA 4DNXA 2NOAA 4Q9LA 2WWTA 1R9MA 1XL1A 3BMOB 1E63A 3I04A 3MEQA 2D1TA 2F4NA 1NF2A 1VLZA 3IUPA 3QFHA 1QFYA 1MV8A 2RGCA 1JSLA 4M1OA 3WP0A 4X24A 3CLTD 2O8VA 2QN9A 2K2WA 2OZPA 1BRMA 1QIGA 4UNPA 2PGIA 2EW2A 3BJIC 2X0RA 3NRBA 3R7DA 4IAOA 1VJCA 3QYJA 1KMHA 1XNHA 5JHHB 3CNOA 4LI3X 5SZIA 4WL0A 3VR0A 2HV9A 2ORVA 1ZM2A 4RA6A 3ND8A 2YS7A 3IMCA 3WIDA 4LE1A 4YUWA 1HDEA 1QAQA 2Y9MB 5LA6A 4B85A 3MVEA 4WZAB 1V3TA 3ABZA 4WK2B 4E5MA 1US8B 3F96A 4PYJA 2R0QC 2G07A 1AB6A 2FCRA 4GMFA 5BYJA 5JYDA 1DAGA 4F21A 3NXSA 3ESXA 3KQPA 4KMSA 2PDAA 2DG2A 1EWKA 4MS4B 4JQOA 5I9IA 5G0SA 1TQ6A 1JBQA 3K0EA 4Y0AA 4Y3UA 3KB6A 4DUGA 2P7HA 3HKEA 5TGZA 3UCFA 1IWPB 1T2FA 2WNIA 1GG9A 4MP6A 1WDWB 3DT6A 4GT1A 5E0OA 1J99A 1XWWA 2VP3A 2WJJA 4MUJA 3U3KA 2WTNA 4WTOA 5HRCA 4R8MA 1TFRA 1N5JA 2JAQA 2Z9CA 1C8LA 1ULUA 2YWEA 1SC4A 2RHCA 4I1UA 2IUUA 1JILA 2YMLA 4YJGA 3LVRE 1DAEA 1MGPA 5ECWA 3PJRA 1KI9A 2O2SA 2ZANA 3V1UA 1DKMA 2LV8A 5C52B 3BWXA 4CMHA 4OQYA 2IYPA 2VWPA 3C3BA 4ONEA 5J4VA 3RADC 3P94A 5DEOA 2DH5A 1VE7A 5B4UA 2QTWB 4EO9A 2V4MA 4BUZA 6PFKA 2E4UA 5I6DA 2PGNA 5G0TA 3VH2A 1VG1A 2ZKLA 1YCGA 2VT3A 3BICA 3WICA 1ECLA 3D3JA 1E2PA 1YF3A 4F5ZA 2XAUA 1PAUA 3S2GA 1CB0A 2J6BA 5AM1A 3G2LA 2WIAA 1LQUA 3SICE 4WN9B 3D0RA 3DE7X 3X1KA 1LTQA 3WNVA 4RVGA 3AV0B 5KX5A 5KYNA 5NLLA 3WK7A 1JQ5A 3PEWA 3GZJA 2XB6A 1D03A 4I19A 5T57A 4PNEA 1FX1A 2JI9A 1N8NA 3FI0A 4H3VA 3AR5A 5CYPA 4ZIRA 5JAUA 1ZM4A 4MRMB 4WECA 2O7SA 4KUEA 2VAVA 5BR1A 3H1PA 3WJ1A 4DM3A 1EJ6A 3KT3A 2G0TA 4GICA 5FTLA 1YVPA 3B5IA 4GQIA 4MQEA 1QIKA 3O93A 1M8JA 1LWNA 3IYLW 4G26A 3ILVA 4GKVA 2ORWA 4Q1DA 3AC0A 5LDHA 1L7BA 3AUSA 5ADHA 2X5JO 3DT8A 4IS2A 4ZVSA 3MOSA 1QHFA 4FLEA 1M6VA 2GNOA 3TRDA 4GM1A 4HLUA 2HWKA 4I9FA 5CJPA 1ZXLA 3W5IA 5LJIA 4U2DA 2EERA 1TVKA 4UFOA 2W5UA 3UJBA 3B78A 1GUFA 4L76A 1D1SA 1N0UA 3FPCA 3GRVA 3VYSB 3FTDA 3AY6A 2WTUA 4WXEA 2Q4DA 1G9TA 1ZDMA 4PYNA 2LWIA 2FPIA 1H23A 2GAJA 2POCA 2WTAA 3GRRA 3FGOA 3RVKA 2VHWA 4YXFA 1J6UA 3T3DA 1KGDA 1D2GA 1GCUA 2YS6A 4LYJA 4LYYA 1Q11A 3STYA 4QTUB 4JI4B 2YFHA 3BSSA 4TVBA 1C4XA 3AEUA 3V1YA 2MCFA 3E18A 1EEXB 3AOGA 1X8XA 3T3NA 4M37A 3GCWA 1JT2A 3NBMA 5GM2A 3EXHB 1X7XB 4LG1A 4RPKA 1MLDA 3GIWA 4MVJE 5FLEX 4AMGA 3K35A 3UK0A 1QB7A 1QZZA 4B3XA 1YVRA 1PR1A 1P9NA 3N2EA 3QGMA 1UMCB 3PNBA 4MIEA 4YONB 3UJDA 2ZI4A 3VDMA 4IGEA 3MW8A 3PXAA 2ZYHA 3WLFA 3IQHX 4K28A 4BQQA 2OORC 1ITZA 2J3JA 3P9SA 3NS7A 2AR0A 4RVUA 3EAFA 5P21A 2Q1TA 1RPNA 4HLCA 4WT7A 4BNVA 3ONWA 1BJRE 4KLNA 4XD7A 1O0CA 4GVPA 4RK4A 4B8ZA 5LMNB 2XBLA 1Z4KA 2IPAB 4ETIA 4LHSA 5E6UB 1JEQB 2R1VA 3QLVC 5H3CA 3OHSX 1NR5A 3GJ5A 4Y1RB 1C30B 3DKVA 2FOIA 1VL2A 5JPDA 1OBFO 1PSDA 2J0SA 3OEWA 3L7LA 3VTKA 4Q9HA 2VJBA 3DHNA 3IP5A 1USGA 1GN8A 3JRWA 4YXWA 3VPXA 2YWXA 5DLDA 1UCFA 2C8JA 1QYXA 2GZMA 3OZTA 1R12A 2WPDD 2YQ5A 4A7PA 4DLZA 1CHDA 3O9VA 3SN6A 1CIPA 2J9YB 1PFWA 1TIKA 1VYTA 2NNWB 3KR0A 3OM0A 5F33A 3CBGA 3IBCA 1IB6A 3AX6A 1JE0A 1QIJA 4RF4A 3TF5A 3W5HA 1T5DX 3TLXA 1WTAA 1L4MA 1DINA 1DI0A 4EMUA 3PGKA 1LRJA 2HU5A 3EXFA 1B7GO 1G8YA 3PXBA 4EHLA 4ZXPA 4A73A 3KDPA 3U7JA 2IYZA 3MTIA 3NO4A 3CLUC 1ZOOA 2QX4A 3DBRA 4G3XA 1EP3B 5CR9A 4QM7A 1DC8A 3ANLA 1X80B 3T5TA 4LOAA 4DA4A 3FETA 3FWKA 1DJPA 1LU9A 3N70A 2WJGA 1MIOB 2ZI3A 1OFTA 1M34A 3G5LA 3UG7A 4YNBA 1EWVA 2R79A 3DLBA 1SOWA 2CMFA 2I4LA 3OVMA 5EJ8A 2XXAB 2YJNA 5LA6F 3R23A 1QX3A 3ILYA 3LBYA 2BFNA 2GEBA 1R8YA 1I13A 1RQGA 1YS4A 4ZQFA 5JCJD 1ECPA 1K98A 2UXDB 5CA0F 5TMPA 2B0CA 4TTTS 4ZYLA 2LGJA 4KQ6A 5FWXB 2XI4A 5C81A 3GLQA 3A4NA 3KVRA 4FGJA 5L3RA 1I30A 4RZ3A 4KPYA 1ZWLA 9ABPA 3ZU3A 1NRXA 4FFMA 2WM3A 4UHKA 1YS1X 1X1DA 4JENA 4NU0A 3IQDB 1NXOA 2AOUB 4Z53A 1BXGA 2JLAA 4KXQA 2HA2A 1OWLA 3MFYA 1IMOA 2V97A 4JVOA 1GUBA 5JNLA 1GNLA 1LS1A 4C0LA 5JCPA 1FFSA 5DBOA 2P9HA 1KQFA 3DO5A 2P2CA 3RYFA 3WL3A 1OFHA 3BRWD 2J3LA 2WVHA 3MTBA 3PXEA 4ZEXA 4HGQA 4L5YA 3H9GA 2P1DA 2DKNA 4Z9AA 2Z8ZA 5TXGA 2X6TA 1XFDA 5BUZA 3PIDA 3KEGA 2C97A 2QN1A 3BH7A 3KOYA 3KZNA 4A36A 3R5FA 1PVOA 3C15C 1MO4A 3C5EA 3FFTA 3WB1A 2W6ZA 1ZOPA 4Q5IA 4AX4A 1EQ2A 4WBXC 4E5NA 1IZYA 2FFRA 2BGMA 1J0BA 2GN4A 4B35A 5I01A 3IXMA 2XWQA 1GGNA 4NX2A 5IBRA 3UT6A 4AS2A 1L4BA 2ACEA 4F60A 1HMPA 1RACA 2WNSA 2PUTA 3PXCX 3G23A 4TKVB 3D3EA 4UM7A 2O7VA 1G0NA 2YVUA 4Y9RA 2INGX 2CJWA 1YQXA 2X1HA 4MWEA 4B3BA 1H1TA 1IVYA 2QENA 2XZDA 4FSHA 4JYMA 1QXSA 2HCFA 2XTZA 4X93A 3FLBA 1Z0KA 3EW7A 4PC6A 3OEYA 4R9NA 1VCNA 1B3RA 1VI6A 2H06A 2PZGA 3ESZA 1GOTA 4YROA 5FUWA 2QIPA 3DE6X 4R8RA 4AYWA 2HPAA 2WABA 2IPOA 3RM3A 1VLVA 2UZ3A 2VHCA 3U1VA 3A3NA 1XP5A 2GBLA 4V38A 3RYCB 5JXJA 1DZIA 4CLEA 4DMMA 1Z6YA 1NNSA 2Q5EA 3JQGB 4PO3X 1A9RA 3V2UA 2XRFA 2IXTA 3AP1A 2GKSA 1N6LA 1H2YA 1T9GS 2R00A 3GGCA 4AUNA 3UPUA 1P2SA 2J8ZA 2JIQA 4Q9DA 2Q4BA 4MA4A 5DSTA 4JODA 4U5QA 2P6PA 5ENZA 4JI6B 1LS6A 3RVLA 2XW6A 3KC2A 3SSNA 1N32B 4ALIA 5IN5A 3GJSA 1GL9B 1K8YB 1Y9EA 2AF4C 2LKCA 3HA7A 3QLJA 4NZNA 5FL7A 1S8OA 3CO0S 2IYNA 2IL1A 4BTVA 4QUJA 1XTQA 4Y6RA 3FF4A 3GY0A 4O59O 3M3DA 3ZCRA 1DC5A 3RC1A 1IUOA 4YTEA 1XEXA 4O6VA 3H11A 2QYTA 3ML1A 1TOAA 4FMBB 2C4NA 2ZJ3A 4WGFA 4CHGA 4X62B 1QLJA 1ULSA 2EFGA 4K9MA 4UJ5A 2RKWA 1NHGA 3D2CA 4MIKA 1P1KA 2HLDA 3ZTTA 2FUKA 1QOZA 4MV1A 3DDOA 3V4VB 1EESA 4ISBA 3OURA 1B00A 4EO4A 1U3GA 3OCWA 3T7TA 5B2ZA 3CLVA 4M9CA 5GJCA 1DTSA 3VR2A 2P7IA 2VDWB 4D1YA 4QIHA 4NSNA 1ATZA 4BLVA 1FYXA 3OD5A 1SXJE 2XMRA 2C3PA 3KXPA 4D3DA 2WK1A 1GZHB 1GTL1 4CKCB 1QHYA 3PI7A 5JYBA 4DUPA 4B2PA 2FZVA 1V2GA 4RD0A 4GYJA 2Q99A 4FLFA 3IIKA 5BYAA 4EA6A 3PA8A 4PYKA 3PQ4A 4D82A 4QGSA 2GK3A 4XZ3A 1T4CA 3NTRA 1E7QA 4H1UA 4KSCA 4BAUA 1LJUA 4LDQA 4O0LA 5JY1A 5K8JB 4MUBA 5CFRA 4CQJA 2JIBA 2Q5QA 4X61A 5HXAA 5CVTA 1U3TA 5A5VA 2IGTA 2YXBA 2UVQA 3OFSA 1NVTA 3QYAA 3TUJC 4N3AA 1J8YF 1NY6A 1OLSA 1NASA 2DTXA 1LH0A 3EDCA 3QMWA 4JVNA 5DI3B 3ZIUA 1DX4A 3JALB 5I7VA 3C5HA 3NYIA 4AQDA 1C1XA 4AJPA 3KZXA 2BN4A 3P0HA 1RYZA 1UT6A 4MB6A 4MS1B 3K9WA 3RSGA 3VZSA 4D56A 2JNWA 2GBGA 3EMDA 3F9RA 1TIBA 2J41A 5L4LA 4CF7A 1X0XA 3AYXB 2QYHA 5FCDA 1F6DA 4X5OA 1QTIA 2XYGA 2GDZA 3D6MA 3NRJA 3QEAZ 3VOAA 4G23A 1VBFA 3T9DA 4OXQA 4WWHA 4AMYA 1Y80A 3JVUA 2VOJA 2XVAA 1BXRA 2J5BA 3NLLA 5FTWA 1V3QE 1YDMA 4LAFA 3U7IA 1B74A 4BFVA 3I4CA 3ELYA 2PGAA 4Q37A 3IMFA 3O84A 1QTRA 1NOIA 4OU4A 4E31A 1N5KA 1J2UA 3QXJA 1ZSYA 1LVGA 4OQLA 4PAOA 1TUIA 3G2NA 3VU1A 1WX1A 1K2VN 2PK3A 3E82A 3RREA 4NBWA 3V7NA 3VJKA 2D2XA 3FD8A 1V11B 4YT2A 5KTSA 3IUEA 3GA0A 4WI1A 1PWZA 2QMOA 3LPDA 1DOAA 2EJTA 1CZNA 2ZS8A 4AZ0B 4LXIA 1GTSA 4LGYA 4HQFA 2WG1A 3AFOA 1OJLA 3E84A 2I2AA 4BZXA 3SDSA 1ARZA 4D2IA 2A92A 3FKSD 1AQUA 3IQFA 4JROA 4R5HA 4KYTA 4I4TB 5BMVA 4UD2A 1E2MA 1GA4A 3KT0A 1N2HA 3QKRB 4B0PA 1H2RS 5ARCA 1SXJB 3AVQA 2MR5A 1MOSA 1QVRA 2C4UA 3QBDA 1K7YA 1U31A 1A7JA 3EUFA 4OF4A 3DKKA 4X7PA 4R16A 4ZI7A 2GB4A 1C9KA 2QD1A 4FFBA 2J5RA 4FJ2A 4MSUA 5EZYF 3D54D 4FYWA 5HJEA 2ZYTX 3K8ZA 4LZAA 1E1CA 1G2IA 4O4HB 3B2NA 3FPBA 2D1QA 1EP2B 4GLFA 4EF4A 1YWGO 3H7AA 3I3OA 4KYVA 1XX6A 1TW2A 4D6YA 2FJUA 1TJ3A 4P08A 4PBRA 3JQAB 4AXBA 1UDAA 2HF7A 2CDBA 3UWOA 2BMEA 1X2EA 2CB0A 3CUVA 3QW4B 2XEXA 2O0JA 3TFWA 4ITVA 3T7JA 4JP8A 1NC1A 3B6ZA 3ZHQA 2FH5B 3A6JA 4P83A 4DRXB 4ZCSA 5HJ7A 2XE8A 1A1SA 3P0EA 3MD9A 4W5HA 3U4CA 1WWKA 2P9FA 4NICA 1JTFA 5AM2A 2V7VA 3ABSB 2OV2A 1ESNA 1XPRA 2YJ4A 2BFCA 3WK5A 4D0LB 4DV2B 3I39X 2YHUA 3I9OA 4G1EB 4LZZA 4Y2PA 4CI9A 1PNVA 6YASA 3BF8A 1YCHA 5H80A 5C4IA 5M3BA 2P78A 4OHCA 1TAGA 2R5WA 3O03A 2F9MA 1NSTA 3AZOA 3NIBA 2HSDA 3N7UA 3WRXA 3L06A 4F93B 4TTPA 5BNTA 2A9QA 4MAFA 5EXEA 1D7OA 2WAYA 2JLBA 3U7QA 5B7QA 1E3QA 4LBYA 3JCZA 3IJEB 2BL4A 3SKYA 2IEAA 5DLYA 4I7EA 3GW8A 3KSRA 4QOHA 4TXHA 2GRAA 5IP5A 1OXVA 4ZA2A 5KNDH 1DVRA 2RK3A 1CQIB 3P9PA 3E03A 3ZJYA 4WFQA 1ODJA 1CFZA 4YAJA 4RGVA 2I62A 4BL5A 5SZKB 3SIPA 4MS3B 5IT9A 1I5EA 1II0A 1GA1A 1NMZA 2Q4EA 3B8EA 3DV2A 4HNAA 5K3CA 5TPWA 3MHTA 5J2UA 2IX3A 1PR2A 4C4RA 4MR8B 3DKIA 1YJXA 3IHLA 4WNAA 2L0XA 1EZ4A 4U3JB 4JP1A 3AU9A 4TRRA 4YJDA 4KQWA 4W5JA 1GNQA 4INJA 2V98A 3L02A 4G1BA 2E0IA 4QBTA 1U7XA 3AR4A 4ND6A 1SPXA 3KDAA 3MBKA 4PLTA 3PC6A 1Y9DA 1PFKA 1R4NA 3FNRA 5AKEA 4NYMQ 4JMLA 3T38A 1DWQA 3HP1A 2IHTA 4PAWA 4A1OA 4X00A 4QRDA 1VBNA 4J7CA 2V54A 3FR8A 1FVOA 2UUPA 1NJFA 1UIMA 3LA8A 2PFGA 3LG2A 3A6PC 1I80A 4LF9B 5ALWA 2X8JB 4KVZA 1RQRA 3HB1A 1COWA 4A1FA 2WDPA 3HE3A 4CF5A 1NBIA 2W93A 2OD7A 3ADPA 3B13B 4HFMA 1XRJA 3ZCXA 5KVAA 3ZE8A 4KR2A 2Y1EA 2M6LA 1SVWA 5F5NA 2PD6A 3KZCA 4HGNA 3VR6D 4FMCB 3ZJUA 3B6MA 3M3HA 2BKAA 2FUG6 4JV5B 2ZRIA 3RO7A 3VR4A 3N53A 2CV0A 2N42A 3HY4A 4MQFA 1KJQA 4P4SB 3KQHA 1L4NA 1XTUA 1AB5A 4K9QA 3VX4A 2ONJA 3R7SA 2GPYA 4BASA 1NR7A 2D06A 2D54A 1PDWA 1OLXA 5WRFA 4BBJA 1WCYA 1PK8A 2Y93A 5K0CA 4OB6A 1KFBB 3MWLA 1W46A 3UWDA 4EG5A 3MGGA 3CRVA 4QBFA 1N92A 1U5CA 2V96A 4HBGA 2XMCA 4NZMA 4XIIA 4DEXA 2GSDA 1S3IA 2R86A 2GHTA 4Z51A 1E77A 2HWYA 1LRKA 3KHTA 3NG1A 5MFPA 2NTEA 2XOEA 3OM8A 2G5GX 2PKQP 3C5VA 4ZT3A 5IMSA 1N6OA 3OEED 2CVFA 1PR0A 4CM8A 2BBOA 4QOGA 4TWJA 3EXIB 3JTMA 3QXGA 3ITDA 1KNQA 4BJ1A 2JGAA 3B6EA 3BQ9A 3ZHVA 4QFCA 2ENUA 3L6OO 5EL0A 2FZWA 4EG0A 4O25A 5E6SA 2X8LA 4HWPA 3Q40A 5F3DA 2GPWA 4ZHQB 3AF5A 1PWXA 2GCNA 3AVPA 3D0OA 1QYVA 3HMKA 3QPCA 1JYFA 2DHQA 2GZSA 1VL8A 5FBVB 5KS2A 5DHPA 2ZBVA 1SCKA 2BR3A 4L6CA 5CB6A 3FUCA 2R4UA 3LIPA 3E2IA 1B6GA 1U8ZA 1T1EA 1C50A 3CUEF 3LHIA 1SZJG 5AHRA 3IOCA 3QEMA 1KO1A 4IDNA 1ZKDA 1J2EA 4BV3A 2PBZA 3L43A 1QRUA 4K46A 3NHJA 2YYYA 2CLEB 3T5MA 4KO4S 1N1MA 5IJ0A 1T4GA 1DAOA 1P1FA 3GLSA 3KWJA 4AMZA 3E35A 4XRRA 1G3QA 1VE9A 2J6IA 5FA6A 1JTEA 1NJ5A 2P40A 1T9BA 3KEQA 1O5OA 1JKXA 1KH2A 3LF1A 1DTWA 4PR0A 4NV0A 1YU9A 3VH4A 2PPVA 1CE8B 3KR1A 3O0TA 1AMUA 4DAOA 2YNMC 5AVSA 1KR2A 1KEWA 3RE1A 2PFSA 3FYUB 5EP4A 1HYGA 4I4IA 5HK9A 3PNYA 4O2BA 3CONA 3QX3A 3IIIA 1GADO 1IWOA 2HV8A 2WTXA 4GZ5A 4MRVA 1E0DA 1UJNA 1WHTA 4LF4B 1UK9A 4R40A 5BT8A 6REQA 3V3KA 4BNIA 5IVKA 2GN0A 3LTEA 3X43A 4BO2A 4RZHA 1THMA 1N2EA 2IX9A 2OT3B 3R75A 1CQJA 3SX0A 2HM7A 2QRUA 2ZS9A 2FSUA 1ZH0A 1JR3D 1Z56C 3PTLA 4G89A 4BGVA 4BB6A 5AM0A 2CSUA 4L8YA 4U2EA 1DQSA 1ZRMA 3LPAA 3JAWB 1ZL0A 2FW0A 2ZIFA 3N86A 4P0PB 2O4CA 1O94D 2Y76A 4N3BA 3KQNA 1T25A 1YBVA 2CZQA 4R2IA 3EYAA 5T3YA 2Y0PA 2ZPTX 5F51A 4YWHA 4E4RA 1B6RA 1E69A 3BQMB 1Y1QA 1LCIA 4X7RA 2H48A 4ZT7A 1G42A 1P7ZA 4QGGA 4X3CA 3SNKA 5HHTA 5AWFC 1UMBA 4OKIA 1CF4A 2Q0XA 3OE5A 6ADHA 4GYYA 4C6TB 5BSUA 2ICAA 4FNOA 3RS9A 2J3MA 1DRUA 4JI0B 4E5KA 3ZX5A 3BMXA 4NV1A 1CPYA 3TKAA 4WZBE 2QLFA 3ASUA 1KYTA 3PP8A 3F6BX 4UEJA 2PUJA 4ZD6A 1O9BA 2M1ZA 1H2WA 2QV0A 4AN4A 2FG6C 4IX1A 4RMIA 4CLOB 4ECEA 4LMPA 2WJVA 3X0DA 4MA5A 3E7XA 1PZFA 4BVAA 5JANA 2P3SA 2PS0A 3NVAA 1E4OA 3ES9A 2WYIA 3DEFA 5TQVA 4FWTA 3CUSA 4ENQA 3DXXA 3FTCA 4ZQEA 5K8LA 2PKRA 2AZTA 4DLTA 5EQFA 3MQFA 2C5HA 3LT2A 3ICCA 1QB8A 2IEIA 1CS0B 2IYWA 2P9ZA 3G5MA 3FCEA 4C7XA 5BXYA 5FX2A 1CZLA 1VA5A 2P67A 1FLNA 2QRNA 1L5LA 3VV2A 2MOKA 1AHHA 4HNHA 3KO8A 2Z6UA 2OM6A 1L7VC 2BFWA 2QUAA 3G9TA 2JD2A 2P9JA 1U3WA 2VDPB 4W1QA 4HV4A 2F8SA 1ZCAA 1SIUA 1GR1A 5KWSA 3ZWQA 2FRDA 4UNSA 4HVLA 5GVSA 4BQNA 2BD0A 1EUDA 2JDID 1OVGA 1M72A 3GMSA 2F8TA 3KV3O 3B1FA 4RNDB 5E7JA 2BLLA 4MUIA 3C8MA 4MITA 1XAHA 2GESA 1U5BB 2AXPA 2CHFA 3COSA 4LPKA 3NHUA 1E9RA 2YL2A 2QW1A 4HY3A 2BCJQ 5D85A 4HFNA 5H3HA 4N03A 2AMJA 1PLJA 5KINB 3QUSA 4P3OA 5KSPA 3HYSA 1ADCA 3ESYA 3AL3A 3UXHA 2J1LA 4R2KA 4DEYA 3CR7A 4DZTA 3D6JA 3GT7A 3WK4A 3VJRA 5DX1A 1Y48E 3OEHA 3B3AA 4NZPA 5L3QA 5IUKC 4AJHA 1K5DA 3R6LA 3QJ5A 4KIGA 4QLBA 1U0EA 2C2KA 2HF8A 5LDDC 1PV4A 3HQ4O 3LFTA 4JBGA 1U63A 1DE0A 1T9DA 1JGTA 3D5EA 1N7GA 2JVKA 3DLAA 3CBQA 4GUAA 3GEDA 1FFWA 1RJWA 1LDMA 1XQ1A 1Z0UA 3ETGA 3FH0A 1CJBA 2B37A 2BR5A 4AIIA 3MJVA 3TW8A 5FNVA 1KAOA 1MOQA 1QHNA 2AW3A 1E79D 2FK8A 2M32A 3E58A 5CVCA 5JCJA 1S4QA 2JC3A 1IY9A 3QVLA 3I9LA 2EG9A 3NH9A 1JALA 2C5FA 2D0DA 2YHIB 4UHDA 1DJQA 1L4EA 4Y2QA 4Q4HA 2DYKA 3E4CA 4HGYA 3RUFA 4M7PA 1NVMB 2BZSA 4HDCA 4HNQA 1GXSB 1MH9A 2IIPA 3G5AA 1CRQA 5CVEA 2C96A 5K3FB 3U19A 3TZKA 1Y1SA 4WZBB 1C3EA 2B5OA 2CK3D 1DG3A 4FCVA 4B6JA 4E6EA 5JWRA 1RJ9B 4M55A 3F4BA 1E8NA 1A9OA 3AUJB 1C2TA 2UZ4A 3KYDB 3ZKWB 1PR6A 4U7WA 2BEUA 2UZ0A 3OZSA 1TK9A 2WUGA 1ISJA 1MORA 1SUFA 1AUOA 3F7NA 4L4YA 4WKOA 1V5IA 1IJEA 1GG2A 3GBSA 5DM70 2HZ7A 2WIDA 3C6XA 1NZJA 3BRWA 3SJBA 4Q7EA 1QSGA 2L2QA 2W2OA 2N46A 1WABA 2BSQA 5LMCA 2Q1XA 2PYIA 4IHJF 2UV8A 1RM3A 4R84A 4Q4LA 4Y8VA 4MPTA 2VP9A 3G2HA 4F92B 3TGLA 2E37A 3NDRA 3V8BA 2OZVA 4GRDA 4NCHA 3VI3B 4G5XA 2ZWPA 4Q7JB 1V1JA 1ZN9A 2VYFA 2ID9A 3TB6A 4N0EA 1O96A 1RYEA 4OQQA 2QP9X 4YRIA 4IZ6A 1SUIA 3BWVA 2VR1A 4PXAA 2CC2A 4BMPB 3W6ZA 3VTZA 3QMPA 4XRGA 5BNFA 3ZV3A 4BV2A 4GMXA 5B7NA 3W04A 3O7MA 2ILTA 5M7EA 3HPRA 2NXJA 1G2PA 3IPRA 1U9CA 4UEQA 3K70D 1OGIA 3PWZA 3C3XA 2DEUA 2GO7A 1W75A 1P60A 2PX6A 4WY8A 4C0HA 1KEUA 2FQQA 4JJGA 5DNEA 3WLNA 1L5ZA 3H16A 4E5SA 1NOJA 2QKYA 1MEEA 1M1ZA 1F5NA 3FN4A 3WLRA 2Q49A 1LUAA 2Q0QA 3WWYA 4QNRA 3QMMA 3QEBZ 2HU2A 4ILKA 1R9GA 5ANRB 1TB4A 5CCDA 1NJ1A 2ZYVX 3UH1A 4UVIA 4LJSA 2VF4X 3UBTA 2BDTA 2CFOA 1OX5A 2HMSA 4FD3A 1XF9A 4GC9A 1V8DA 2EOAA 1IM2A 2IBTA 4XX0A 3PQ2A 1BOFA 3QNWA 2NP6A 1M1XB 1XJCA 1A71A 2OHGA 3D3QA 4IQGA 1M8GA 3A9UA 2NU9B 4RZUA 5DXJA 5A5EA 3A2NA 2QG4A 2GVDC 1JXAA 3AKEA 4IQFA 2IOFA 8ABPA 2DE0X 5J47A 4IMIB 4QQFA 2BHRA 3V2HA 1FVHA 3OIVA 4JLPA 4OJKA 4Z2YA 3T7CA 1I6MA 4MROA 5JSUA 5KQRA 1W8IA 1XTPA 3HKBB 1FDVA 4BQEA 1UC4B 4Y2SA 5H82A 3H87A 4DT1A 1TO1E 4WDQA 2IHVA 4B75A 3CX8A 5I51A 3D4LA 1RYYA 4L4ZA 4ZXFA 1CNEA 2P68A 1RPTA 3JQ7A 2MTBA 2XV1A 4LZNA 5HF8A 2MSLA 1E18A 1EDBA 1BQ4A 4YUVA 4JGBA 5KNBA 4HP8A 4IRXA 1KXJA 5AK5A 2DLNA 4QELA 1JB1A 1EFCA 4QHSA 4UMFA 4BU0A 1YQ9A 4GMGA 1DAKA 2YN0A 2CV2A 3T3OA 2D1FA 4M7RA 1CB7A 4R0VA 2EJVA 4N9QA 2O19A 3L4BA 3NANA 221PA 2JFOA 2Y1OA 4L8GA 1U6KA 2OOSA 4QL3A 5EHIA 2QV7A 1E1RD 3S2YA 2ZTVA 2FHSA 3M5WA 1F3LA 3VAYA 4AMUA 3AVWA 4GE0A 3DYVA 3U7GA 4R4JA 4S35A 1A5ZA 3GHYA 3L92A 4FP9A 3H0KA 5EMJA 2D2FA 3JYNA 4ER0A 3BEOA 1LK5A 4EHHA 3UMGA 1DBQA 2Q3LA 2GK4A 3I83A 4FC7A 2FSIA 3SZLA 1UOPA 2IY7A 4M1QA 2JCSA 3SXPA 4YAWA 5JBQA 2WIFA 5ADWA 4A8PA 1KJWA 4RF2A 3LOUA 4DA7A 1G66A 4CLXA 3U5TA 4UU0A 2A0WA 3TLJA 1W25A 1SC1A 4MYHA 3BHIA 4ZYZA 4HDRA 3M6WA 4KQGA 3NDIA 5EMKA 3CG4A 1MJFA 1VGQA 2HEIA 3J80A 5KDLA 2NUAB 1R16A 2IGBA 2Y1XA 3GJQA 3DAGA 2PBRA 4FHCA 5IXJA 1U2GC 2CVZA 3NETA 4XOUA 4ZP1A 1CDDA 1GAJA 2G83A 3GQVA 1AHPA 2KJQA 1HWYA 2HMAA 5AI5A 3G68A 5LN1A 1X1SA 2B0JA 2OR3A 2FB9A 3E7FA 7REQB 2O6LA 2UUBB 3TOVA 3T7EA 3WB2A 4YS6A 1GIAA 4BVLA 1C29B 2J48A 3VR3A 2D0OB 3LDAA 4UZFA 1FFBA 4KLZA 1TCUA 2BFFB 3RYTC 4Q3OA 3KQOA 5BWOA 1T5IA 1VSTA 4OX9B 5LZ5A 1BA3A 1ZD8A 3MT0A 3OLYA 5C80A 1OIWA 2D5LA 3GO4A 1OIVA 1U94A 5EJFA 4BX3A 5IKMA 5BRNA 2H6EA 1G5HA 3L6CA 5M2QA 2FWNA 1UK8A 3S2FA 4YCDA 4I5FA 4Y1GA 1REQA 3DG9A 4XEHA 5A4AA 2GBPA 3UC5A 3D3WB 2H3EA 4WRRA 5BSFA 2BHNA 3ZNOA 3F5MA 5EE0A 5DGIA 1FSFA 1X9IA 4PCLA 4AJ4A 3I58A 4BFYA 5DNYB 4FZJA 3AKZA 4BXOB 4KNYA 5D7BA 5DGHA 2XQFA 4LMRA 3E53A 1CS4C 1KOFA 1QYCA 5FORA 1KDZA 2C92A 1G7SA 4BPRA 3WGKA 2PWZA 4BJ5A 1RHRA 2IWHA 1Z68A 4ECAA 2V7GA 3OU6A 4MUEA 3UO8B 5BN3B 2V6JA 4DM7A 4AWBA 4CL8A 2REQA 1Z6PA 4N7RA 1KZ6A 1U4OA 2HZBA 2NSDA 3OKFA 4EFKA 1UK6A 3WX0A 5F23A 4MV6A 4EB6B 4TSFD 4L0QA 4UUPA 4HSGA 1Q3KA 1OW3B 4G4SP 3CRNA 1ZIOA 3NT2A 5J4YA 2G9UA 5JT1A 3M3PA 5K8TA 2RGNC 1EE9A 2BSAA 2AW5A 2F1IA 3N8NA 3KVYA 5C8YA 3FFXA 4V03A 3WA6A 3V1LA 3LXRA 4OA8A 1V25A 3WGQA 4X9XA 4KP7A 3HP4A 5JAOA 1Q15A 2EBHX 2ST1A 1UJBA 4JFRA 4QYIA 5JSZB 2I3ZA 4JX8A 5KYXB 3IT3A 4FDLA 1MT3A 3GPDG 4KKXB 2YBEA 1XYYA 1Z0AA 3D6UA 3OZCA 5KTRA 1DEAA 4YGXB 2XWSA 1D9ZA 4JHXA 5SY4A 5AVWA 1G9XA 3W1VA 1M1NB 4X84A 2HCTA 4Q24A 4UHBA 1JP7A 2XZOA 4L9WA 1F9AA 1SU4A 1ADGA 1C41A 1QFJA 3NMUF 3PLNA 4C29A 5JR3A 4QPJC 2O3JA 3GLTA 3L1KA 3K1AA 5LQJA 2W9XA 2YRFA 5IANA 3GGOA 1V5GA 1Z5VA 2P9TA 5EUMA 5AW3A 1E5VA 4A27A 1FZTA 1KEZA 2G76A 5EWLB 1Y5MA 3PKIA 1HV8A 1E92A 5DZSA 4DJJA 2VDRB 2RHLA 1P7YA 3AFNA 3CNBA 4TMWA 4NH0A 2ANBA 3E3AA 2NXEA 2FPPA 4N6OA 4QT0A 2P4HX 4K9SA 4HNTA 3DV0A 1LW6E 3V48A 4GZ3A 4R1NA 2H1CA 3QH4A 1XCLA 5IXYA 4RK1A 5F2EA 1CY4A 1HXHA 3CCCA 3OOSA 1KK1A 5DRYA 2V0NA 4RPHA 5EP3A 3ZIAD 2BGUA 3THYB 3LUHA 4YRDA 2ZJAA 4B3DA 1MRZA 3PQ6A 3GVIA 1T9CA 4EJ6A 3KKLA 3GLGB 1OI2A 2ZVJA 3VC7A 2W43A 2BGKA 4Y2YA 4TV9F 3KWLA 4Z4GA 2JFQA 4QDZA 1T8YA 4LHEA 1JV2B 1G4AE 3OU2A 1DBIA 4BO1A 1LK7A 5AW0A 2QBYA 4L9SA 2RH9B 1EU1A 5EQDA 4B09A 1PYOA 1U99A 4U6NA 1QK5A 1V43A 2D0IA 5CLQA 5D01A 3TO5A 5AOAA 3WL8A 3EULA 3IKJA 4DOMA 1BC5A 3ANYB 3LKBA 5AH0A 3ZV6A 3GCGA 2REOA 3GGPA 1IL0A 3ILSA 1Y0BA 3FCCA 3MFQA 4KX5A 4R2XA 2B92A 3HLYA 4PC1A 1SUPA 4DQ0A 3KJHA 4YR9A 3EWNA 2VZ9A 1RJEA 1N5DA 1Q0ZA 4KGVA 4MGYR 4QUKA 4ZQIA 2I55A 3FFAA 3BTOA 3R5SA 4LNUA 4DFDA 4UM9B 4BZZA 4RA9A 4TLAA 3QX9A 3VYRB 3K5HA 4MMZB 5LB2A 2H00A 5KJ1A 1P2BA 2B8JA 1UOEA 1W2WB 3ROZA 3SYKA 3W5UA 3EG9A 4MKXA 3TS1A 1OBVA 1W36D 3ZHOA 1KR5A 4PPYA 4MUFA 1S8FA 4UPDA 1PF7E 4B7AA 1M2OA 2QSYA 4CKBB 1AKQA 5DCYA 1IFXA 1XU4A 2XJ9A 1ACMA 4ZQGA 4C76A 3TG8A 3Q2OA 2FSVC 5D84A 3OPQA 2OVBA 1P1IA 2Q4TA 4ZDIA 2PSEA 3ZD7A 3MLBA 3UW1A 4CKEA 4D8WA 1Z28A 1K6MA 1P0IA 2OM2A 3Q4GA 3CF2A 5BYKA 4NDZA 3PBKA 2DHEA 3WMFA 5C8XA 4Z9XA 5ALOA 1I4EB 3DD1A 3T0FA 1Q7RA 4YCCA 1T1JA 1ZEMA 4G5RA 3KEMA 1AQJA 2O23A 3KSZO 3AQ4A 1KAGA 4ER5A 4AJEA 1DXQA 1PJBA 2WD7B 1KEEB 1K6IA 2Q2WA 1WUJS 3BEDA 3B36A 3C7KA 3V4PB 2E85A 2P2SA 4RADA 4BEWA 5C4GB 1PQYA 4U39A 1VHWA 5KJ6A 3EA4A 1NBWB 1OBOA 1I6KA 2H31A 2QUKA 3AJ9A 1JWLA 3WGIA 4PEVA 4JU9A 2JFPA 1PBNA 1NTOA 1NQTA 4L75A 2RJNA 4PZCA 2QORA 4BQOA 5K8UA 1DAHA 2PSJA 3DAFA 3H4IA 3ZE2B 2EVWX 5HS6A 2B9VA 2CJPA 3H99A 3VNVA 3JQRA 2A9PA 4UEWA 1A5BB 4RKQA 5D5PA 1J33A 1D2AA 3BDAA 2XQGA 2I2FA 2JF0A 1QAMA 4Z4HA 5BR8B 2WYHA 1YB6A 1FRQA 1ZUIA 4L4RA 4EH1A 3PGXA 5FFFA 2OCIA 2ZYAA 1GJRA 1XRLA 1NI4A 2YWDA 3TQIA 3V4FA 3FF1A 3W5VA 1LX7A 4ODIA 4PHHA 3CUTA 4UDNA 2QPLA 3LHSA 4LJKA 3PQ3A 3AB3A 1XMOB 4WEQA 2IRWA 2ZXEA 3DP7A 2OFXA 4IM7A 2VK2A 3AXTA 2ZPUA 1B26A 4AT1A 1HNNA 3D2LA 3D6VA 4JLUA 5CLGA 4K0KB 4UMDA 1XA3A 2DLCX 1Q7GA 1F2UB 2C4WA 2G80A 3DEIA 3KU1A 1UFQA 2HXGA 3DMTA 2GBIA 2QDXA 3SHOA 5I7OA 2XNCA 3JYLA 4Y7DA 2ZWAA 5ALNA 3GRAA 4DF3A 2JGNA 1R64A 3VJLA 1PJ2A 2E2WA 4U2GA 2IDJA 5G3ZA 5GGXA 5AKYA 5EZ5A 2HFKA 3PGA1 1YMUA 1QYDA 4Q19A 4UCFA 1LW7A 3T4XA 4X60A 5AI6A 2WP0A 4AWAA 2VZEA 3EGOA 3HB4X 5KHAA 3KZMA 1AGXA 2DR2A 4EGCB 3SBXA 3TLZA 1SEVA 1IXSB 3RVOA 4F4HA 1PYDA 5LQCA 1JFRA 1R8SA 1Z2DA 2XCLA 3M6UA 1I5RA 4PANA 1O94A 3U44B 2OO7A 2HWUA 4XWKA 5LU8A 1THTA 2CWDA 1EI9A 2PD4A 2V7TA 5JMTA 2YX1A 4KXMA 4AM8A 1JECA 2XMGA 5FBWB 3A1EA 2NNLD 1C4WA 1FQOA 1NX6A 3ABOB 3GUZA 3H2BA 4ZDKA 3CWQA 3MGAA 3EHDA 4DAEA 4MKRA 5KQLA 1N9ZA 3LKZA 4H4EA 1FL9A 2CF6A 3QOYA 4HDKB 3I1JA 1FP4B 3NH6A 2XNJA 4EW2A 3EIEA 3HB9A 1FPMA 2FW1A 1U7DA 4QNMA 3PGVA 3KKOA 3RK0A 1JKFA 2Z5VA 3BCSA 3HGMA 3T3MB 2TMKA 2CYAA 4U1RA 9LDBA 2NTJA 5ES4B 1RYNA 1JMYA 2P91A 1PZGA 2CNLA 4L2IA 5AI8A 5H9VA 4YAIA 5CLJA 2GEKA 1D4FA 2L17A 3HCRA 3OTWA 4KXLA 2HJGA 1M1YE 2JGMA 1YTUA 3GP8A 3PDJA 1QQAA 3SVZA 3TXYA 1QIDA 3RBAA 5I7RA 1E1YA 1B93A 3KKEA 1UBKS 1W5FA 5IM4A 3HZZA 4L5CA 1D4OA 3RKSA 4O4IB 3HDTA 4M98A 5B58T 2V6MA 2VS1A 4GEKA 5IVDA 3GAMA 3SYMA 4W82A 4PQEA 4ZVPA 3SHWA 3G17A 4ZOQI 2JDIA 1Y37A 1RADA 4LJRA 2HRQA 4B6RA 2EP8A 4CW7A 1F8GA 4RABA 3FE2A 5I7EA 4XVRA 3VYUB 2ZB2A 5LYJA 1M5RA 4LNHA 3TOXA 1QKKA 1QHIA 4YJ3F 3E4DA 3BFKA 4IYRA 1DEOA 4E03A 5DNAA 1K0FA 2G71A 2IZOA 2A1TS 4NPAA 4WLNA 4LYFA 3UA4A 4P5EA 1JVNA 4Y0VA 4ZOLF 4EIWA 1W87A 4F8YA 1G98A 3HEMA 4JASB 1AU9A 2VDOB 4K6KA 4P4GA 2O8CA 3U31A 1D04A 3T3IA 1J0DA 2ODWA 2WU3A 2IU0A 4MYDA 1OAKA 5HK8A 1OHHD 4IFTA 4FDTA 2RIPA 4QGFA 2MSEB 2WINI 2GF0A 4W9RA 3WXBA 1GPDG 2QW8A 3H6GA 4XDZA 3QF4A 3CC8A 1BWRA 2VA9A 1D6SA 3BWMA 3RS5A 4B7CA 4BKQA 1U6IA 4HMOA 1DKOA 3CNLA 5AUOB 2AL7A 1TJ5A 2ZJ8A 1UADA 1SWVA 1GQFA 1YK1A 1ZI9A 4G56A 3UYLA 4FDUA 1U8AA 3N0WA 2RKOA 4RVSA 3TTSA 2LD4A 1N25A 1BH2A 3PHIA 4D3YA 1N0VC 4J94A 4YX9A 2HSGA 5ALXA 2LIPA 2Y92A 2JJ8A 4GSKA 3N2KB 4OGFA 4RY9A 2XQIA 4S0ZA 3X44A 1KY5A 3EFBA 5F35A 3AVYA 4ZJPA 1CYDA 4O3FA 4M99A 4QEKA 4CKXA 5M04A 4IEFB 4U9HS 3FJ1A 3KOZA 2FKNA 4G07A 1UDCA 4JYBA 3RSFA 4J0GA 3TAHA 2CK3A 3E7DA 5A3SA 3RRZA 4CMGA 4ALLA 5JUWA 3VZQA 4EA9A 2GTIA 3RBVA 1CRWG 3USES 1TGVA 2FGJA 2H11A 3B7PA 1GZSA 4M0FA 5KX5F 4L9AA 1KKLA 1D0IA 1DQNA 1HYQA 1JMKC 2UYOA 3CLSC 3PF8A 2BPOA 1BWQA 5EINA 3ZY5A 4EHNA 4US1R 4RD2A 1ONBA 1J06A 1YMVA 3CX7A 4FJ0A 3GEPA 5CPFA 5DN6A 4A8JA 5HP4A 4R6XA 2EU8A 1KI2A 4Z4QA 3N5KA 3IEMA 1ML4A 2JCYA 2QNRA 3OOHA 4FN4A 5SZHB 4F71A 1PCXA 3LRPA 3TG2A 1G9SA 1JFFA 3DAYA 5EPUA 3MUEA 1LVHA 3SQWA 2MYNA 5AUPB 1X38A 3FROA 1WZIA 2IPMA 3JSXA 1M33A 1ISFA 2FSSA 3SE0A 1PSWA 5JHGB 5KOIA 4Q7LA 2E4AA 3M89A 1XLVA 4ER3A 1P6QA 1SC6A 3ZD6A 3HUEA 1YVUA 3ZCSA 1Z2PX 4RLQA 4GMDA 4CM3A 1HE2A 3WISA 4Y2TA 1H0RA 5EIBD 1Y9ZA 4PC7A 1HFJA 1FU8A 1Z62A 2HSJA 3FIJA 3GFQA 3GGJA 4JB0A 3NYWA 4ZVUA 3UMJA 3LOQA 4AY6A 1SRRA 3QBEA 1YDWA 1XU9A 2DPYA 4U9IS 3S1LA 3L8FA 3V33A 4S1TA 3FX2A 4YALA 5HR5A 1P0MA 4KG7A 5DMHA 1RXVA 3AW9A 3U3OA 4HX9A 3F71A 1P3Y1 5KYTA 1NT2A 2AUMA 1XD9A 1F17A 2XNKA 5JIBA 4F9EA 1N1EA 1Q0LA 2Z57A 3SX2A 4F3RA 4UREA 3GV0A 5CX1A 2ONYA 3T35A 1JNYA 3BA6A 1B8OA 3F90A 3MRTA 4RKRA 4ENPA 5C8ZA 2I2DA 1TZMA 1HE1C 1PJLA 2NZ2A 1MO2A 4HDSA 1G1MA 2LDXA 4FT2A 4F3CA 5JCOC 3FCOA 4QSMA 1C9NA 2C84A 3BBPA 3P96A 1HX7A 1VB5A 2R6CA 4R6WA 1YQEA 4KQCA 3T9CA 3QA3E 3HYCA 1OWPA 2ZRHA 1EFDN 3IHTA 2BH9A 3QVUA 4YV0A 5CT6A 4CCAA 1EINA 1O8CA 1PL7A 5HBGA 4MR7B 2NVOA 4JEMA 4CM4A 2CUZA 3K1TA 2HRCA 5FUVA 4GL2A 1B6TA 1XMQB 4EUHA 1XD2A 3DWIA 3EGXB 2VJKA 3O7WA 1SCDA 3SU8A 3VVLA 2PKCA 4ZI2A 5HZKA 3NOQA 2IHBA 5KOHB 3W9UA 4EX7A 4GECA 1RBYA 2XUAA 4WFIA 3VQTA 4PYRA 4FSDA 3A1WA 4MGEA 4UDXX 3WGYA 3KQWA 5HZHA 1SB8A 2X86A 3WWEA 1IDOA 2AKYA 4GQAA 2P4SA 1VCMA 5KPJA 4FWIB 1CNMA 1EIZA 2ESRA 1NXVA 1O6CA 4D7AA 1PP4A 2V58A 1OX4B 2W2KB 1H22A 3MAGA 4CNBA 1TNDA 3A6FA 1U0HC 1E1RA 1S3SA 5BWBA 2PUFA 1L1RA 2CXQA 5FI3A 5CK4A 1CY0A 2Z98A 4QBHA 3ROXA 2BELA 1IUPA 1P81A 1QE3A 2XUZA 4AULA 1YQWA 3OIYA 5JZSA 1ESMA 3QKSB 3VR5H 1ZESA 2XMZA 1SB9A 1ELOA 1EWTA 2EKPA 4QAQA 4TKLA 3LCVB 5JJBA 5ETJA 4WLOA 3AHGA 2ISQA 1Y8RA 4BNNA 3BHJA 2AG8A 5DNWA 2QM0A 3HO1A 3BL5A 5CIQA 3D81A 1TIPA 4AO8A 1M2HA 1PTJA 3T4EA 3ASYA 1IATA 1LLQA 4Y0NA 1MJGA 2H4WA 2AI1A 1LSOA 2FK7A 2CNWD 2WHPB 4BRWA 2JJ2D 4BP9A 3UMMA 3K71B 1JWBB 2BFEA 3B51X 3DEZA 3QVGA 3UB3A 1OREA 1VIAA 4EATA 2YUIA 1W44A 4HPXB 4Q00A 1DCKA 2Z6QA 2J0UB 2OY0A 4KQIA 1JQBA 1KYQA 2VSOA 4ND2A 1NRIA 1YGPA 1KQPA 4P1ZA 1SOUA 2WHXA 1EFVB 3ZNQA 4BNYA 2NX2A 5TDHA 4WBNF 1VIDA 3WV4A 4F2GA 1N2OA 2ZYUX 4NBVA 4R2HA 5COAA 5FFMA 2PKQO 5AVOA 1SIBE 3PR1A 3HA5A 4GOJA 4HZIA 3MAJA 4P7FA 4BN4A 5AVJA 8OHMA 4MARA 1I7QB 4HB2A 1M5UA 4LX0A 3M49A 3HU2A 5C32A 5LOVB 5A5DA 1FDSA 2POQX 2NUTA 5CHEA 1YJQA 4FC6A 2C54A 3UCEA 2G67A 2HD4A 4LXXA 1QQ5A 1RI3A 1X1TA 2A9JA 2G06A 4ZODA 4F2WA 4RJTA 3M82A 1P3JA 3Q2KA 4UAVA 4BN5A 3IQWA 1VQ1A 1X86B 2XF8A 2NU8A 1LBSA 3GR6A 3W6UA 2I8LA 1NP7A 3N0XA 1IBRA 2X9GA 1ORIA 1P9WA 1Q20A 1F0KA 2C4MA 1B0ZA 2HIAA 3BSFA 1Y9JA 5TQ2A 4DGQA 5I47A 2ZM6B 3DOIA 4MJLA 1W5AA 2WKPA 5FTMA 2DF8A 1MAVA 3W9BA 2WIBA 1PX0A 3K5PA 1GGFA 4XX1A 1Z4PX 3JSAA 3JQFA 5M29A 4IOLA 1AV7A 2RHRA 2NZXA 5DF1A 4N41A 4MP8A 1WDLA 2OHJA 1RE0A 4FFNA 1VJTA 3M81A 1HDIA 1I2AA 1SAYA 2JCBA 4OMFG 5F9MA 4D4HA 3B48A 3NAGA 2BEWB 3DMNA 1QRTA 4TSFA 4BX2A 4D42A 3THSA 1MRSA 4DBZA 1DQZA 1EFUA 1RI4A 4JR1A 1HL3A 3QLTA 5CEJA 2SKEA 3PQ8A 1YAJA 3GYGA 3RB8A 1JQ3A 1G8MA 4N7JA 1M8PA 1TZJA 4RVNA 1J7KA 2GN2A 4B44A 1MG0A 5BMOA 2QQ5A 2RHDA 4DRZA 4HXGA 4WQMA 3A3KA 2QA5A 4KE9A 2R9VA 5SYAA 4FGUA 4O4LB 2PZ8A 1NRWA 3W0LB 4L16A 2I0FA 4YMVA 1WHSA 1ZNXA 4IIHA 2JFVA 5GP1A 2COEA 2EZ8A 2HA0A 4FJ1A 2EW8A 5KKAA 1TMOA 4IW3B 4C08A 2G9VA 2DX7A 1ZA2A 3K7EA 2N1BA 1JDVA 1A2QA 2OPHA 2H1RA 4C5AA 1S2GA 1FDUA 5FYDA 4CG0A 5HFNA 4DBLC 2XWJI 4Y2RA 3NT4A 4QTYA 5CG1A 2P69A 1BCRA 1WD5A 3CSSA 1ZM7A 5CA1B 2OWDA 3CINA 3IDAA 5LLDA 5G40A 1RYFA 2G1AA 2XNHA 3KRTA 4OL9A 1E2BA 1R15A 1ULHA 2VXBA 1W4LA 2ZRLA 3KALA 4KNVA 5L7TA 4KRGA 2O48X 4FB4A 1OCEA 2Z58A 2GN8A 3LWZA 4IWYA 4OP3A 4TQAA 1IWBB 4EY8A 2ZRGA 2RAFA 1J07A 3FY4A 4DS3A 2C2ZA 2IVZA 3VDRA 3AETB 5F7ZA 4KFTA 3EZ6A 3PFIA 5AK6A 3EUAA 4C0BA 3RDPA 2BFDA 3HU3A 5IBQA 3AKYA 1BX0A 5KYUA 2P3QA 5AW6A 3GROA 1HSOA 3R7AA 1CETA 1CF2O 2AK2A 4AF7A 2D3TA 4LRQA 3ZIAA 2VNJA 4FGWA 3TE6A 4J4TA 3DVRX 3M6MD 3PUZA 3WWZA 2AFHA 1M1UA 1IUNA 4ARAA 1BVUA 3CT6A 5E2AA 3P2JA 1K3TA 4HQ0A 4YRRA 4G0VA 4F0JA 2REXB 3QE0A 5IJAA 3EBPA 4H7IA 4BGDA 4LKRA 3WXMA 5KZMB 3MYRA 1LVUA 2AOVA 1JPJA 1U80A 4NE2A 5LR6A 1V5FA 2XR1A 1POXA 1RAGA 3A1FA 4PLWA 1E5QA 2XTJA 1UT8A 2AC7A 2RARA 3KZ1E 3PL5A 4Q82A 3KG2A 4XUEA 1KDYA 3RC2A 1EK5A 2W00A 3SZOA 121PA 3PNVA 3FHOA 4J3NA 3JQ8B 1JX6A 4F96A 4V3CA 4YBZA 4HYTA 4Z4FA 4XSVA 4YAKA 3HVRA 1E2JA 4N3CA 3RR2A 4R83A 2R8OA 3HMQA 2FR1A 4TLEA 1D5WA 1H4SA 4F2DA 4OMDA 1C0KA 1W0KD 2G9RA 3NASA 1PQUA 3M0EA 4G86A 4TT8A 1TVCA 1WB6A 5MGNA 4BMYA 2B4RO 5HILA 4YJFA 3A9CA 3TTUA 2EKDA 3AR7A 4MNTA 4GG1A 4RSRA 3TLKA 4X0EA 4FNGA 3RHFA 4PC3A 3RV3A 1SXHA 3A1SA 1BE8A 1I3NA 2WU4A 4IOMA 1EDOA 2ZTMA 1WNFA 3VFDA 1KDRA 4TM8A 3AUFA 3ZWBA 4C3VA 2Q6KA 3OUUA 1YA8A 1RXSA 3HR8A 3MMXA 2C0PA 1IIRA 2W0SA 2NWQA 3GELA 3BPSA 3DOHA 1YKFA 1DEHA 2CEAA 5BXQC 1QHEA 3L8CA 4G37A 4L7VA 1OYVA 1UH5A 1GTG1 2PCLA 1TMKA 3RFUA 3LLSA 4W6QA 3TLBA 1T8RA 2ZAMA 3TEJA 3EARA 3H8WA 4ID3A 4YRQA 4K86A 2PXHA 4H7JA 5A7GA 1J2TA 4TUYA 3H2YA 4A10A 1MZPA 3D4PA 4XTCS 3BZWA 4RMHA 5JWHA 2WYVA 2XUHA 3M2PA 2AVNA 1SEPA 2QWXA 1JG6A 3MPUA 5K3BA 1NUHA 4K03A 3QLUA 4L1KA 4QD3A 3O91A 4OVKA 5LUAA 2Y0EA 4FCCA 3ZGOA 4UOZA 1CJTC 4YN3A 1IG0A 1PJZA 1DU4A 1FRFS 3UJ6A 1UP7A 3CJTA 2Q0HA 1YZGA 4KOAA 2GYUA 4M87A 5FHRA 1V1RB 5EJEA 3KLBA 4MYSA 5BOSB 3OZIA 1I1NA 1JZTA 4QXAA 2KS6A 1TKRA 4B33A 5FUXA 2P8JA 1KYZA 3BMOA 5E38A 3NIDB 1Q57A 1PWYE 2BMVA 2NT3A 4IR7A 3HUTA 1FUUA 4ON9A 4TKMA 5DCLA 3EDRA 3TIVA 3VVBA 1AZTA 1AK9A 5EEGA 2VQDA 1T13A 4OTZA 3JY6A 5LMUB 4ROTA 1SHJA 5KCMA 2VRCD 4HDMB 4X8HA 2VJYA 1DARA 2OC4A 2TMYA 3E5NA 1GQQA 2R25B 2D7JA 2AMLA 2IDZA 4KZKA 4L5JA 4OUKX 4ZVKA 1RU3A 2GXSA 5E7QA 1L1EA 3T94A 4BYGA 2Z6AA 4RQAA 4ZGBA 2DZDA 2JGDB 3RIMA 1C7RA 4OA5A 3IEUA 1DAPA 4H27A 2WY2D 3NATA 1TT5B 3W6PA 1O8BA 3AL2A 2H07A 1LPSA 3BXPA 1Q6YA 4HWTA 2UXCB 1CERA 2PV7A 3ZOZA 3K1ZA 3O8QA 1XNRB 1LSSA 1NUSA 3M70A 4BO0A 4ZDJA 5JTUA 4D9FA 3BGOS 5K3DA 3U5ZB 4F3TA 5T8KA 5DTMA 2V03A 3DDZX 3FOAA 4IIVA 4ZVRA 3D8BA 4BMZA 1NF3A 1Y4UA 3C4VA 3V7UA 4RULA 3HFJA 3CN7A 2P5UA 3FRHA 4MIOA 4Q03A 1DOZA 3NI2A 3HM9A 4XE5A 2JCGA 2V7EA 5BV7A 1YUNA 2PS9A 4UCQA 5FPSA 3LDFA 4UC0A 1BWPA 1Q7EA 2OP0A 1W4CA 1BG6A 4NEQA 2X14A 3N8GA 4Q4AB 4GI2A 4XWWA 1N33B 2A88A 3KFLA 3AHJA 2HTFA 4UBMA 2X22A 5ALYA 4B4UA 1ENPA 2QW0X 1XCMA 1ADYA 2OCXA 3CTMA 1S5PA 4EA7A 1AA9A 2RK4A 3W3AA 2KBEA 4TWIA 2AK3A 4X6UA 1DX9A 3PX3A 1H4TA 1KBQA 3ZV4A 3Q3HA 2YZMA 4QBGB 8LDHA 1K5PA 2VHZA 2WHEA 4J1QA 3GGDA 4E94A 5ICGA 5KVCA 4CV3A 3TRIA 1IXYA 2R1UA 5E6RB 1CEYA 3KB8A 5CA0B 5LYYA 4IKEA 5B2FA 5DIFA 2XLBA 5DJ5A 1A9ZA 3ELUA 1X8JA 5TX7A 1Z2EA 4HGPA 1HRKA 4UTZA 3UHJA 3VSDA 3DM9B 4RIGA 4V0LA 3FAKA 3O1IC 2QU7A 5JADA 1Z29A 3QY9A 4GQBA 1E5TA 2ASEA 2FF7A 4CT4B 4MVCA 1WLSA 2YH2A 5K05A 1RRPA 2B69A 3FVVA 4BHTA 5CURA 2YRXA 4GR5A 3H5IA 3GMTA 4B3GA 4E7OA 3B7WA 5LKAA 3HB5X 1MEJA 1X8LA 1ZH4A 2B2NA 4XYBA 1L7RA 4J8PA 3RT9A 5CAEA 5K0LA 4DMFA 4W6ZA 5IYZB 1KAQA 1Y6ZA 2CHQA 3EPPA 4KUGA 3S40A 3UUEA 3T1YB 4BAGA 1UC9A 4XXHA 3CGGA 1F5SA 2WM9B 1ISMA 3AWDA 1PHRA 3NUZA 5B30A 5BSTA 3H2ZA 3DZDA 3V4LA 3ZZNA 1SOAA 4Y7CA 2Y27A 2ZIEA 1Z2CA 4IJVA 3D7SA 5E8RA 2R7LA 5IVIA 1VHQA 2JFZA 4LISA 3GFOA 2EJWA 5TMBA 1OC4A 1JJ7A 4ITRC 3IPXA 1A72A 5HE9A 5T41A 1HTBA 3DTNA 1CK4A 4RVOA 1EUCB 1OXBB 2QRVA 3QUTA 4N1AA 1U3DA 3D5TA 2DT5A 4R69A 1PZMA 5REQB 3HSSA 1GY8A 1JG7A 3H1GA 2X5XA 3G7UA 2YVQA 4IS3A 4GLOA 4I3HA 2VPTA 4Z8XA 1K1EA 3GFSA 5AK4A 4DA0A 4PRZA 1FFYA 3R5JA 1NC3A 1RSZA 5IVHA 5F4BA 3RFVA 1FDOA 1STOA 2YN2A 4ZVNA 4BNLA 1VIMA 1GITA 5JDCA 4Q39A 4S1OA 2FZLA 4HAOA 5JSHA 4ND3A 3TL3A 4Z9BA 2ZIGA 4QNNA 4ERXA 2XX3A 1A96A 4UMVA 1Z7WA 2WJWA 1NVBA 2C4VA 3ITNA 4HX2A 4OH7A 4LRWA 4PZYA 3QBVA 5AQEA 5GONA 1X7XA 5FL3A 4CCWA 5KWVA 4NNPA 4BMSA 2EWMA 2JI8A 1OHHA 2Z9DA 3ECSA 1UMCA 1CUCA 1GCIA 3I1FA 1EX1A 2PA0A 4H31A 4LE0A 1EUQA 3E5MA 5H3LA 4YECA 4C4XA 3EF0A 2P3LA 2AI3A 1FTNA 1L0BA 4WK0B 4A0RA 4N7MA 2UYHA 3NQ41 2PZFA 4H6WA 5IAOA 1EUYA 2J9XB 2X7XA 2E4ZA 4K2HA 4O5AA 5HF5A 5BR4A 4CHTA 2HAEA 3ZKAA 3LV8A 1JEQA 3EIFA 3FWNA 1WXWA 3KBBA 4URVR 1WBDA 2QGFA 4US0R 4MV3A 4NL4H 1ZH8A 2VUHB 3IULA 4MV5A 4RJ2A 5TV2A 5KMGA 5A4DA 1Z74A 4TUYF 1QQ7A 3TINA 1M6WA 1ZY2A 2BI4A 2KX7A 2X9NA 1KF0A 5MN5A 3FZNA 4G09A 4BE9A 1K6XA 2UAGA 4DV4B 1QH8A 3IV6A 5ALTA 2AZMA 1A2BA 4JDUA 4QRIA 2VJOA 2F1HA 2OBNA 4MPRA 1ZMTA 2EV9A 1VFPA 2EDCA 2XMQA 2XT9A 3ROFA 1SRQA 4E3ZA 2K5UA 3SK0A 3ECAA 2C4KA 2IYSA 4JI1B 3WO0A 1MABB 3GT0A 2F3TA 4YAOA 3SFTA 1T9ZA 4QG3A 1T1RA 1B73A 3O4VA 1SZCA 4MVWA 4NCXA 1BJKA 1JLRA 5EGNA 3AFIA 4BO9A 1S9HA 4CTOA 2ZBPA 3PHGA 4D26A 4KQKA 1X80A 2Z83A 5JYCA 2OHXA 1RABA 3N07A 3CLKA 3D8RA 1RP7A 2C9MA 4M0PA 1VGVA 4YJKA 1KSFX 2YMPA 3IDQA 1XP8A 5GAJA 1G7RA 1HORA 2IDMA 2DETA 2PX4A 1TKAA 2B2CA 3MWKA 1Y7TA 3HUUA 3W5AA 3PFHA 3OKCA 4QDTA 1TYCA 4OHUA 4S2UA 2NLOA 1FTYA 4TGLA 4TN1A 4XB6B 3SR0A 4GMKA 2G6BA 4JJIA 1NV8A 4MVJA 4Q3AA 3DZBA 2DUNA 4IIJA 1KZ4A 1XZCA 2H5IA 1BMQA 2HFJA 3BT7A 2JJYA 1X1RA 4M21A 5EXPA 4YT4A 2JD0A 3PD1A 1KQGA 2OV8A 4C14A 3R6WA 5AI4A 4LBZA 4YO8A 2FOLA 2I8CA 3EBLA 3INNA 5KC8A 3EZLA 3PEYA 1V0JA 1LJLA 2BGNA 2RD2A 3QFFA 1SUWA 3PHBE 1FSPA 4G9BA 4ITUA 4NU6A 5FR1A 3RIXA 2CE7A 5LIPA 4QATA 2OGUA 3N0TA 4TV8A 3IR7A 2B8TA 5J23A 5CFZA 4RVFA 1C3LA 5A3JA 5BOVA 5JO9A 1I2DA 1I4OA 1OVMA 1GUZA 2IE8A 1KP2A 2QP4A 3AV3A 3OZEA 3P0FA 4MW4A 4W8OA 3TFQA 3DLCA 5CCBA 2NV0A 3EEOA 5EI5A 4CLRA 1VCHA 3L0CA 1NE2A 4KU4A 3NWPA 1KJNA 4ED9A 2OLJA 2C83A 4RK6A 5B64A 5HYVA 1YKGA 2Q6VA 4HYEA 1N1GA 2I87A 4NRDA 4ZRDA 2LR0A 2PH7A 3L7IA 3JZDA 3CMCO 1EAMA 5CUQA 2FZKA 1NJ8A 4B32A 5AW1A 2VHVA 3DVAA 4PC2A 2I2BA 1UEJA 3RJ5A 5G53C 4UVHA 4TKVA 1OLUA 4PR3A 1QR2A 4K9LA 1F8XA 4NJOA 3UK1A 7ABPA 3RC8A 3H3JA 4V0QA 3IT0A 4AZSA 1FFDA 2LP4Y 2R65A 2ZIXB 3ZI7A 2Y1DA 1KO7A 2C82A 4Z4EA 1P1CA 1ODLA 2W2QA 2I03A 3U3XA 5ELXA 3LGAA 2PMDA 3C7AA 3IKMB 1WZNA 4DWVA 2H9IA 3PUKA 2QL9A 4F1KA 1BX3A 1KRXA 3RYCA 1FZQA 2PFKA 3KTAB 1MZVA 3O38A 4FFRA 4L3OA 1PN3A 1WTCA 2IHUA 3U3JA 4ZZ0A 1CR0A 3IOMA 3WIEA 3NDBB 1M2WA 2VZ0A 2FJ0A 3CR8A 1YR6A 3GMIA 4ENSA 1FEZA 2VP6A 1PT8A 3WLJA 1A9XA 1V8BA 1I7NA 1ZWKA 2Q6IA 2H4FA 3KX2A 4GM4A 1P8AA 4O5OA 4WA8A 1QYWA 2CLCX 1KY4A 2JAWA 2XWPA 5E9WA 1Z5PA 3KYBA 4OMCA 1WQ3A 2JJ2A 4R8LA 2FPUA 4JP3A 4BVGA 1HUQA 3CZRA 1G21E 1NQ5A 1VE3A 3CWCA 4CVNA 4B7XA 4DJ5X 3MNFA 2A33A 2VDUE 3B9BA 1U0RA 3C97A 4DBLE 2PL9A 3P9KA 1JSRA 4L22A 4RTKA 5A5FA 2O4UX 2WAMA 3EBOA 4RUKA 3UKOA 1PS0A 4D25A 5LQRA 3CVYA 4RYDA 1B0PA 4DKXA 1II9A 3P45A 5EJAA 5HUJA 2F3QA 5CU7A 1BHJA 3DVLA 5J58A 2JLCA 1P0FA 1SFRA 1Z4LA 1ZINA 2WTBA 4EGSA 3GEBA 3JYQA 4HWKA 1TVMA 1W85A 1YDEA 2C99A 1PV1A 1XWIA 2H1SA 3DBVO 3K94A 4FFLA 3B5JA 4FYMA 3ZC3A 1BXKA 3AKCA 1X94A 3NTLA 4WLEA 3ZHCA 1WJGA 2W6QA 4YRMA 3OQ6A 1OFUA 1HNWB 3JV7A 1B16A 2GDJA 1RT9A 4F2HA 3BB4A 3NVDA 3V6LA 3TECE 1D2NA 4GR9A 3WFIA 2OL4A 2WWGA 1RMTA 3MS7A 2QPTA 3OHPA 3AM5A 4LHZA 3KZOA 4DMKA 2CMHA 1NIPA 4Y6QA 4XUDA 3LC7O 3RUAA 1XMXA 4XIGS 1ZLYA 1U8UA 2I4OA 3SC4A 1Z75A 2MWMA 1HETA 4ID9A 4J07A 4AUMA 3AH8A 3RVJA 4EHDA 4M9SA 4QUDA 1G59A 2IOYA 1WMEA 2AE2A 3JZMA 3QFRA 1LLFA 5FYQA 3HBMA 1LPBB 4WUVA 1ECBA 2CXHA 3IBSA 4FYIA 1T29A 3LRXA 4YP0A 1TYDE 1K3FA 2OKGA 4NKRA 4RENA 5FWDA 4B43A 3SQDA 4BGUA 4X66B 1HZJA 1ZMOA 4KXUA 1LEHA 1ORDA 4OQMA 1GZ3A 1Y82A 4CI0B 2WRZA 3C16C 3EOZA 3RCBA 2VT2A 3PI6A 4ZKDA 4UMEA 4J6EA 2GVZC 2VBFA 1TCAA 4MUXA 2BUBA 1XRPA 4O1HA 2B7BA 1R66A 4HMPA 3LC2O 4RJKA 4M46A 5JAZA 1W5EA 1MVLA 3V7YA 3FYCA 3DR3A 3RVDA 3NIGB 1I0IA 4UJ3A 3FYSA 5IH3A 3B38A 1XELA 2PSSA 4RTQA 1COZA 2OE2A 2I3BA 3EYWA 3ZDQA 3OA0A 4CQNA 5I5EA 2UKDA 4X1OA 1R0RE 1DAIA 2XPCA 1G21B 1MU0A 4V0KA 5D6NA 5EWMB 3L7MA 1Y7LA 4MTCA 1DP4A 2I2XB 4JC8A 3TRKA 3LQQA 3HK2A 5NULA 4PGHA 1NMXA 3F74A 1OYYA 5AUQA 4ZFNA 4NFLA 1RE1A 1VPDA 4AYXA 1HR0B 2O59A 1J09A 4AJKA 3ESAA 4IEEA 1AA6A 2EZTA 2P1ZA 3MM4A 1V11A 3C3CA 3TTTA 5DLPA 2QMQA 3CB4A 1ZI6A 4K9KA 4UNRA 1IHXA 2EKBA 5DOVA 4OSEA