1JG1A

Crystal structure of l-isoaspartyl (d-aspartyl) o-methyltransferase with s-adenosyl-l-homocysteine
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
215
structure length
215
Chain Sequence
EKELYEKWMRTVEMLKAEGIIRSKEVERAFLKYPRYLSVEDKYKKYAHIDEPLPIPAGQTVSAPHMVAIMLEIANLKPGMNILEVGTGSGWNAALISEIVKTDVYTIERIPELVEFAKRNLERAGVKNVHVILGDGSKGFPPKAPYDVIIVTAGAPKIPEPLIEQLKIGGKLIIPVGSYHLWQELLEVRKTKDGIKIKNHGGVAFVPLIGEYGWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords protein-L-isoaspartate O-methyltransferase
publication title Crystal structure of a protein repair methyltransferase from Pyrococcus furiosus with its L-isoaspartyl peptide substrate.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 70
structure length 215
sequence length 215
ec nomenclature ec 2.1.1.77: Protein-L-isoaspartate(D-aspartate) O-methyltransferase.
pdb deposition date 2001-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1jg1A00
2C7PA 1NW3A 3FTCA 4GOMD 3TMAA 1L3BA 5K0GA 1VE3A 3BWBA 1UWVA 3QOXA 3KR9A 4HGZA 1EIZA 3BT7A 4DF3A 4FS8A 3OPNA 3IV6A 3G88A 5LQAA 3DLCA 4RTSA 5ERGB 2JHCA 3KU1A 4DKJA 5EGSA 3QV2A 3KQSA 2BR3A 4DCMA 4RTRA 3TKYA 1RI4A 1ZKDA 5ICGA 4C04A 5EMKA 1RI2A 4CTJA 2BH2A 1UIRA 5LQNA 2WK1A 1AQIA 5GM1A 3V8VA 4BLUA 2CKDA 3GWZA 4C08A 4A6EA 4X60A 4FT4A 4LWOA 1O9GA 1KXZA 3JWIA 5E8RA 2AVDA 2VZ9A 2Z6UA 2H00A 3OFKA 4L7VA 5K0NA 2ZCJA 3KPYA 2JJQA 5ICCA 5CCBA 1B42A 4IV8A 2AN4A 2HWKA 1KHHA 1N2XA 3FTEA 2B2CA 3SM3A 2OY0A 5DXJA 2ONZA 3I9FA 5DM2A 4C03A 4PCAA 5T64A 2HR1A 2NP7A 3FUWA 4AZTA 3OU2A 1G38A 2NXCA 5C1IA 3G2PA 5EZSA 2C7QA 2Z6AA 4X1OA 2YXDA 5DT2A 4YUXA 3EVCA 4OA8A 3VC2A 1SG9A 3PB3A 3G2MA 2NXJA 4PGGA 1NV8A 2NNWB 3OU6A 5EPEA 2NXEA 3KR0A 4GEKA 3DUWA 5C9ZA 2GAFA 1G8AA 3HVHA 3I58A 2ZFUA 4EQZA 5FQOA 3KR1A 5EKXA 5T67A 3SSNA 3LDUA 2V7EA 2IH5A 3JWJA 2WA1A 3MCTA 4P7JA 4PWYA 1JG4A 3P97A 3PX3A 3LPMA 4C05A 3O4FA 3P9KA 4KWCA 3Q7EA 2IDKA 5E1DA 3P9CA 3BWMA 5EIFA 3EGEA 4GOOD 2GS9A 4OA5A 2C7OA 4KIFA 1BKYA 3UJ7A 3GIWA 5EEHA 5KVAA 2H11A 4EVIA 4M38A 3IHTA 2DPMA 4QPPA 5DXAA 3P9IA 4RV9A 3R9XB 2AN3A 1XTPA 2XVAA 2YVLA 3FUXA 3OZSA 4AZVA 4BP1A 4GC9A 5DLYA 2G8NA 3UJDA 3CCFA 3EVFA 2AZTA 2R6ZA 1KYZA 3KQMA 2NYUA 2YQZA 2Q41A 2PLWA 4IV0A 4P58A 4QQNA 2QRVA 3UJAA 2HNKA 3HA5A 3P2KA 3UA3A 2ZULA 3SGLA 4MQ4A 5D1NA 5E9QA 3K0BA 3SX0A 1JTEA 1JQEA 1G6Q1 3G7UA 3BWYA 3KQYA 5CVDA 1P91A 2PT6A 2I9KA 5EMLA 4QVGA 1KPHA 1ZGAA 3AXSA 4PIMA 5FA5A 5K05A 3B3JA 2BR5A 5K0EA 4PYJA 3LECA 3BKWA 1WXWA 1F3LA 2QM3A 4KDRA 5F2NA 3R3HA 2IGTA 1RJEA 1XDUA 3MAGA 4GC5A 5HIIA 1AF7A 1D2HA 4H0NA 3RODA 3UFBA 3I53A 3TM4A 3GU3A 5DTMA 1NE2A 3PVCA 4MTLA 3OU7A 4PYLA 1YUBA 5GIPE 2G70A 3ID6C 2XYVA 5KYGA 4CXMA 1WZNA 1DCTA 4PNEA 4F84A 4E32A 1NBHA 1XDZA 3SSMA 1R6AA 4DCGA 2VDVE 5EVJA 2QE6A 1YF3A 2JH8A 4E2XA 4A6DA 5HFJA 4BLWA 4KIGA 3A7DA 3NJRA 2R3SA 5ICFA 2PBFA 3KQOA 4GOLD 5E1BA 2P7HA 1WG8A 2AVNA 3EVEA 2ZZNA 3O31A 3P2EA 4Z2YA 3CBGA 4PGHA 2Y1WA 3P8ZA 5IKMA 1M0EA 1JR4A 3ERCA 1JSZA 1FP2A 3HP7A 2NXNA 1SQGA 1L9KA 2O0LA 1T43A 2HMYB 2PKWA 4E30A 5DSXA 4PINA 5BW4A 4P7FA 5LSAA 5EEGA 1Q0SA 4RVGA 5CM2Z 3T7RA 3OCJA 4ISCA 1D2CA 3DXXA 3F4KA 5FCDA 3U81A 4KVZA 1HMYA 1DUSA 2P40A 3P9NA 4MWZA 2AOWA 2YTZA 5DRYA 3E05A 5CUQA 4ZTBA 3GXOA 3C0KA 2VS1A 1ORIA 3EMDA 3MERA 1P1BA 1RI3A 1KP9A 3MB5A 2GA9A 3THRA 4BLVA 3S68A 1O54A 3O7WA 4YV2A 2P35A 2PWPA 4WVLA 4X63A 5JR3A 4MHTA 4IWNA 2EFJA 1VP3A 2JH9A 2PXCA 5K0CA 4ATNA 3EPPA 5E8JA 1VBFA 3FYDA 3NWBA 5FADA 2YR0A 4QVKA 3KPUA 3G5LA 3ME5A 2AOTA 4CTKA 3A26A 2P3QA 3GNLA 2LD4A 3EVAA 3KQPA 3B3FA 1XJ5A 3QOWA 3FUUA 2N47A 5HIMA 1L3IA 1QAOA 2ZIEA 3FPGA 3NDIA 2Z6QA 3EEYA 2PX5A 2OKCA 5FULA 5EKUA 4PYMA 5C0OE 1RJGA 4OQEA 2AOTB 4P7KA 2QY6A 5GIOE 3ANXA 2P3LA 1KPIA 5F2OA 2G1PA 2ZLBA 3FPHA 1NW5A 3HCAA 3LL7A 3R0QA 4KDCA 4R8SA 3MHTA 2O05A 3LHDA 1G55A 3HA3A 3KPWA 5H02A 3TRKA 5EQJB 4RTOA 3TOSA 4FSDA 3KR2A 4M37A 1I4WA 2NP6A 2AN5A 4PYNA 1P1CA 4PYOA 3DH0A 1FP1D 5KQSA 1ORHA 1NKVA 4WXHA 3BKXA 2PY6A 3UBTA 4PYQA 1FPQA 4Y2HA 4DZRA 3M4XA 4K6MA 3PTAA 3BZBA 3MTEA 2JHPA 4FP9A 4KRGA 3G2OA 5BW5A 4GF5A 3FUVA 3TQSA 4FR0A 1NW6A 3FPFA 4E2ZA 3CGGA 4RTJA 4RTNA 3B3GA 10MHA 3T0IA 3DLIA 2GB4A 3DTNA 4O29A 4LG1A 2PWYA 4GQBA 3SMQA 5FWAA 3EGIA 5ICEA 5EZQA 3EGVA 3SXJA 5FWDA 2AOVA 3UJCA 4LECA 2DULA 1XCLA 3H2BA 4YV1A 1QZZA 3LBYA 4MIKA 2B25A 3AJDA 1EAMA 1RJFA 2VP3A 4V0QA 4RWZA 5K0LA 3AWIA 4R05A 1PRYA 4DM3A 2ZWVA 4F86A 3BUSA 3DULA 4RVFA 2WA2A 2YX1A 5CVVA 5K01A 1EJ0A 2HTEA 2GH1A 3KPVA 3L8DA 3CJRA 3P71T 4GOND 4FSXA 5E9JA 4EKIA 5HIKA 4YUWA 1BHJA 3PX2A 2OB2A 3OZTA 5DRTA 3JWHA 2PSSA 3DXYA 2ESRA 5EHGA 3TR6A 5E9WA 4X41A 2OO3A 2OPBA 3V97A 2O57A 4X61A 1QAMA 2PGXA 5GM2A 4FT2A 3GRUA 1X19A 3E23A 2P41A 3KQVA 1SUSA 1TPYA 4HC4A 4OBWA 5FQNA 2P1DA 2VDWA 2AOUA 1INLA 2FPOA 2O07A 3FUTA 5T6BA 4RYLA 4AZWA 4ER6A 5GINE 1SVUA 5DX0A 2QRVB 1XCJA 3LBFA 2UYOA 3EVBA 1AQJA 3UJ8A 3UJBA 3ORHA 3CJTA 1V39A 2I62A 3IYLW 3KPJA 2P3OA 5DPMA 2PT9A 3EEOA 1JQ3A 5EG5A 1YFJA 2AOUB 3RW9A 3NVKI 4R6WA 5CIYA 1NW7A 4CKCA 1R18A 1QAQA 1NV9A 4YUZA 2ERCA 4B17A 1VL5A 5FHRA 1QYRA 3C3PA 5HEKA 1BC5A 5E1MA 4BP3A 1IXKA 2IPXA 4RSRA 2K4MA 5HOQA 2UYHA 2IBTA 2IH4A 4LWPA 1N7JA 9MHTA 1D2GA 3EVDA 4OX9Y 3LCCA 5K0JA 4GBED 3G8AA 3GDHA 5EHIA 4RTPA 3C6KA 2EX4A 1X1BA 1I1NA 3M70A 4F85A 1BOOA 3NVMB 5HZMA 5MHTA 4YMGA 1TW3A 2GLUA 1EJ6A 5EOVA 2V74B 1RJDA 3MTIA 5JUWA 5P8WA 3TM5A 3UJ6A 1TW2A 4DMGA 4EKGA 2PXXA 4E31A 2ZIGA 2ADMA 2B3TA 2YXEA 2UYQA 4JXJA 3A4TA 5F2KA 4PONA 3ELWA 4YMHA 5HIJA 3LX6A 2BZGA 3TPZA 2F8LA 5LQCA 3P2IA 4E2WA 5BP7A 1NT2A 2QYOA 5GOZA 1KPGA 1RI5A 4RVHA 4RVDA 3RIEA 1MHTA 1IM8A 2EG5A 3LKDA 3A7EA 3B7PA 5DX8A 5K0BA 4QQKA 1YZHA 1HNNA 2EJTA 2ZWAA 3DR5A 4DQ0A 3G8BA 2EJUA 5CCXA 4ER5A 4POOA 1ZHFA 5DM4A 1FJXA 2E5WA 3IEIA 5K03A 2PX8A 3GJYA 3BGDA 3OZRA 4ER7A 1X1CA 3FPJA 3HCCA 2CMGA 3BWCA 5D1HA 1N7IA 1O9HA 3GRVA 3TLJA 1NBIA 2XYRA 2ZZKA 3K6RA 1L1EA 2OZVA 4CKBA 3SSOA 3LCUA 5B1SA 1F38A 1R00A 3R24A 4U7TB 5LQKA 1G8SA 3PFHA 1EG2A 4RTQA 3T7SA 2ZW9A 5DTRA 4ER3A 1VIDA 4EMSA 1FBNA 2FK8A 4RTMA 4RTLA 4E2YA 3E7PA 3CVOA 2JHAA 3SR4A 4FGZA 5CD1A 3VYWA 1U2ZA 3EVZA 5CVJA 2OXTA 2UZ4A 3OE4A 2Y1XA 1JTFA 3SVZA 3LCVB 4G56A 3VSEA 3HM2A 4QPNA 2ZSUA 3LSTA 1NW8A 2BM8A 5DWQA 2XVMA 3KQTA 3A25A 3FRIA 3FZGA 3DXZA 3HCFA 2YXLA 3LGAA 3LDGA 1JG2A 2ONYA 1SQFA 3DP7A 3I5UA 3NDJA 2ZZMA 2YUIA 3FTDA 5HILA 2ZBPA 2ZIFA 3OFJA 4OBXA 5M5BA 2CL5A 2PJDA 3UJ9A 1VP9A 2H1RA 3NTVA 1VLMA 3B5IA 3GGDA 2OYRA 4HTFA 2ZBRA 1JG3A 1P39A 1QANA 2FHPA 2IFTA 3CC8A 3ELYA 3GRRA 4QDJA 4EK9A 2OBFA 1JG1A 3HVJA 2UYCA 2P7IA 4XUEA 5DM1A 1R8XA 1XXLA 1YZ3A 3DMHA 3LKZA 1WXXA 3TFWA 5LQJA 3DMGA 3C3YA 3NW9A 2ORED 3E8SA 4HTFB 1XVAA 3BGIA 3CJQA 2KW5A 1X1AA 1AV6A 2B78A 4XUDA 3LDFA 2XYQA 5G02A 5IH3A 5K8VA 5BXYA 4R8RA 2BR4A 2O06A 5EMMA 3MCZA 3B89A 3I64A 3D2LA 3M6XA 2HV9A 3GRZA 4IKPA 4RX1A 5CVEA 3PT9A 3NMUF 3G2QA 5GP1A 3KHKA 1VPTA 3FTFA 2C7RA 2FRXA 3ER8A 3M6UA 2VDUE 3ER9A 3A27A 4CWAA 3NWEA 5DM0A 5FHQA 1ZG3A 3FPEA 5E1OA 3BGVA 3ELUA 2AS0A 1R74A 1WS6A 2FK7A 3BXOA 4R6XA 1RI1A 5EMJA 5E2AA 3THSA 3HCBA 1M6YA 4M7RA 5LQUA 3KQWA 3PS9A 1UFKA 5FUBA 3UZUA 2I6GA 3CKKA 3JWGA 4PYKA 4C4AA 3ELDA 3R6TA 5K09A 3DOUA 3HEMA 4M36A 4ER0A 4E33A 2I7CA 4Y30A 4PIPA 3HCDA 1WY7A 1XDSA 3Q87B 3MQ2A 5FTWA 4UOEA 4YV0A 2CWWA 3WSTA 2ZBQA 5U4XA 2CMHA 3FRHA 3M33A 4PCLA 5E2BA 4AUKA 2JG3A 4YUYA 1MJFA 3AXTA 1H1DA 4QTTB 1L3CA 1DL5A 1R8YA 1SKMA 4BY9E 3GO4A 5LR6A 2GPYA 1M6EX 3KQQA 2XBMA 4HG2A 4FZVA 3AY0A 2G71A 1Y8CA 1I9GA 1ZGJA 2IBSA 2IDJA 3EVGA 4PYIA 1IY9A 5DTQA 3HTXA 3KKZA 2PX2A 4QTUB 4HSGA 2FCAA 3M6VA 1YB2A 5KQRA 4C06A 4HGYA 3PFGA 4V0RA 3G5TA 2B9EA 4XCXA 2PX4A 3HCEA 3X0DA 5DX1A 3GRYA 3UWPA 2PV0A 4P7GA 1ZQ9A 1EQAA 1PJZA 2IP2A 3MGGA 2ZVJA 4HRAA 4KW7A 3TKAA 3UA4A 3G89A 2P8JA 1VQ1A 2ZTHA 4AZSA 1KIAA 1KYWA 2AR0A 4HH4A 4RTKA 4DA4A 4C07A 2IIPA 3PLAE 3T7TA 1YFLA 3HVKA 2AOXA 2BM9A 5FA8A 3C6MA 3REOA 2IH2A 2A14A 5KS2A 8MHTA 3HA7A 4OQDA 1JQDA 2PVCA 4YUVA 2G72A 1JSXA 3M6WA 4AX8A 5CVUA 3VC1A 7MHTA 2PXAA 3EMBA 1SUIA 1G60A 3GCZA 3DMFA 1KR5A 2FYTA 5DSTA 4E70A 1OR8A 3HVIA 3OE5A 4GUAA 5GWXA 4NECA 3FYCA 3HNRA 5LQRA 2OB1A 4XUCA 4QDKA 4CKEA 1Q0TA 5K0FA 4U7PB 5EIWA 1X1DA 5EC8A 1Z3CA
chains in the Genus database with same CATH superfamily
1CQXA 3R41A 3PQ6A 2HCTA 3W5AA 2VPPA 2HT6A 1AV7A 3EDRA 4UXJA 1JQKA 2B6NA 1A8UA 3U3KA 3R5XA 1BQ4A 4B71A 5IVKA 3KU1A 1NJ8A 2X8JB 2P9CA 4EFDA 2Q3MA 1GTVA 1A2QA 2GPWA 5EMKA 3VNQA 4B3BA 4ENTA 3KXLA 4OHYA 3U60B 3UC9A 4RMHA 3HY4A 7REQB 3CE6A 2UZ1B 3PTLA 2PL1A 5B3JA 4E5DA 4MVJI 2A5GA 2GJ8A 1ZNXA 5FWXB 3UOWA 1L7VC 3UK1A 3CHYA 1SUWA 1V95A 4YC7A 2D0PB 2FZWA 3B9BA 2QT1A 1CY4A 3TQIA 5HZGA 4F3NA 1CIVA 5LYJB 5GJBA 2UVDA 1B42A 3CRZA 3SQXA 2W6QA 4IAOA 4DG8A 1B6GA 1CS4C 1JIIA 1OXVA 1VYHA 1KJQA 1NMSA 2C2MA 4HI0E 4S1NA 2Y92A 4D9HA 3F6RA 1ZHOA 1EWQA 4U2EA 1QJ4A 4GBGA 4ZOLF 3SNKA 1A5TA 1KQ3A 3KK0A 1Z45A 4NTZA 3N0WA 4PFSA 3ECCA 1XNGA 2P5TB 2FGJA 4MRVA 3E81A 1J9EA 4OQ4A 1Z63A 1KEPA 4CV2A 4YUXA 5CFLA 3R5HA 3U5ZB 2YQ5A 5JNSA 5IEJA 3NTLA 5BSHA 3PQEA 2EF1A 5CP8A 3PE4A 2Y6VA 3CUSA 2JL1A 1QFMA 4OVKA 4YALA 2FSSA 5FIUA 1YE3A 5EJGA 4LXHA 4ZU3A 4DN6A 3QX3A 1ZVQA 1YS2X 3IIEA 4BMNA 1SBTA 2YH2A 5IM5A 2IVFA 3NI2A 3LDUA 1PO7A 2V7EA 4PZ9A 1SPXA 4UEWA 3T7JA 1ILWA 1CHNA 4R3WA 1PT9A 3O4FA 1LBSA 1MXFA 1Y1PA 1I1HA 4I5EA 4Y9UA 1KA9H 1DCMA 1Y5MA 4HVTA 2BVNA 2G09A 2NZ8A 4QGGA 3EGEA 4GOOD 1ITZA 2C7OA 1W88B 3A05A 4GX5A 2NPIA 1SU4A 3K2EA 5KC9A 2ETXA 5EEHA 4L0QA 1U2GA 3H1EA 1UPFA 4L07A 4M38A 4QPJC 3A6ZA 2COKA 16PKA 2A78A 2DPLA 4C5BA 1U02A 2C00A 3RAEC 1EYZA 2NYUA 2F67A 2GZ1A 2PH1A 4P58A 4PLHA 2QRVA 5JMPA 3DCYA 4D8VA 1W1IA 2G88A 3R75A 4DTIA 2O8DA 4ZYWA 1DEKA 3G7NA 1CUEA 1YQWA 1IVNA 3I2KA 2P9HA 2VOEA 3I04M 2LTAA 4MR7A 2XE7A 1KHTA 2VF8A 3IBSA 5K05A 3KV1A 5A9SB 3QFRA 2VP9A 4A8TA 4JOQA 4BU0A 4EG8A 4KQWA 2PU5A 1Y3AA 3ST7A 1VSUA 3HDYA 3G0IA 1AC5A 3O38A 2IGTA 2RI0A 4TLMB 4IIHA 4H0NA 3H9JA 1XRLA 4PC2A 1ZK3A 1TAUA 1GRCA 4QARA 5CXSA 1YUBA 3W6PA 2OHGA 1JDUA 2R7MA 3PR2B 2FVXA 4YS6A 1USWA 5HDBB 1KJIA 5K51A 3SS9X 3ID6C 2HU7A 5KYGA 1QDEA 2V1XA 3RYIA 3B7WA 2OQRA 4B76A 1ONPA 2J5QA 3TOZA 2L0XA 3JVIA 1E9RA 1U1EA 1X9IA 1WV0A 1YB7A 4XWOA 4XM0A 3UV7A 3RIXA 5DGDA 1AQ6A 4F4CA 4Z0TA 3KQOA 4H1VA 1KMCA 3JAWB 3V7UA 2C0PA 3S2SA 3RV4A 4YMTA 3TINA 2AVNA 5JQGF 1SKYE 3Q3HA 1OILA 3ZPXA 2QR2A 3CBGA 1EX1A 1ZNZA 3A6KA 4UTPA 3L0OA 4X1KA 1M0EA 1XZQA 2XUQA 2WWHA 5KVQA 1JDBB 3BX1A 2NXNA 4R0VA 4IJQA 3RIGA 3HYCA 4J9UE 4MCJA 1BXGB 2ZB7A 4RCYA 1I0ZA 4PNHA 3EGXA 4I0WB 5EEGA 4HT3B 5EJ6A 3T7RA 2Q9UA 1Q1EA 2DLDA 1D2CA 5JH7A 4K1LA 1W30A 1YKFA 2HB6A 3U81A 4XQCA 1N1MA 2WM2A 3BF8A 1EUDB 3M4ZA 2JIDA 3P9NA 2HK6A 3PHCA 3QJGA 4IUBS 5E6RA 1MRNA 5G1OA 3ORSA 1E4YA 5DRYA 4ZAXA 4MYDA 1HE1C 3FFTA 3H86A 2X0RA 3WNQA 2A88A 1ZVVA 4YQEA 5A71A 4RZ2A 3QE0A 3UV3A 2F1OA 1DINA 3ICWA 1ZFNA 3PWTA 4KLNA 3GF4A 3TZEA 3C24A 2A6PA 3WMRA 2REOA 1XZDA 4YRKA 1K7XB 3EAFA 1RHMA 1T8UA 1E1KA 4WZBB 2G77B 4CIYA 4II7A 3TIFA 2RK4A 1XWIA 2YR0A 3GUVA 2XKAA 3ME5A 1NMQA 1HX7A 3SC2B 2ZSKA 3LTEA 4OJNA 2FPLA 3UWPA 3GNLA 5E3JA 1KNQA 1WPXA 2RB5A 3EVAA 2NVWA 3I1JA 4TKUB 4ZT2A 2I9PA 1TA4A 4JZYA 1JIVA 4KIWA 5FTKA 4CW7A 2PCJA 1O96B 3EW9A 1TEZA 1ZUIA 2Z6QA 1PUJA 2BSAA 1GLGA 3EXHB 3RIHA 3ZIUA 1U7UA 2WFLA 2FQWA 1R9MA 4N9QA 1M0TA 2FF7A 2G9NA 3V8BA 2VSXA 3KOOA 2GM3A 4UUBA 4EG3A 4QOGA 4EW3A 1SCJA 3FPHA 1NW5A 3KAQA 2E49A 2AFIA 4XDGA 3T3HA 3W1WA 4E09A 4AQ7A 4EG1A 1AO3A 2ONKA 5HK8A 3C8MA 4PPFA 2QRGA 1LPMA 3LAWA 1UINA 4L4RA 3ZV6A 3L0CA 3QY9A 5GGXA 3KX2A 4MVYA 1RXCA 2VJKA 2BGLA 1UZUA 2W8ZA 1P1CA 4IICA 2R7AA 3DH0A 3QQ5A 2B98A 2N42A 4R4JA 2CV2A 3K3PA 2IZ5A 3R8FA 1P19A 4FKMA 5CK4A 5FTNA 3UKJA 2HJGA 5IT9A 1FW6A 1QHIA 1IJEA 2GEDA 1NMZA 3TTYA 4EY5A 1RWBA 3QSYA 3CISA 3UJPA 2H2GA 2DTDA 3L1IA 4I1VA 1HL7A 1VL8A 3CEAA 3CZPA 3D2AA 1YB1A 1N75A 4EQ6A 2HK9A 5AVSA 1QG4A 1XJWA 1TUBB 4J1QA 1XTKA 2IYNA 4R9RA 2ZSIA 1PQPA 2MSEB 2Z3WA 2CZCA 3RFCA 3LZ6A 5LWQA 2FX5A 1FMJA 2RAFA 1XZPA 4UQLA 3LBYA 3DBHB 1RJFA 3QWAA 1WP4A 4FBGA 5C81A 4BWGA 1IZ9A 1J25A 3D2BA 3KNZA 1DAPA 1O0BA 1WDKA 3MWYW 4Z4EA 3EQ2A 3DULA 4RVFA 4MDYA 5CVVA 1QUFA 5HIKA 1DZIA 2Z9BA 3QEJA 4MJ3A 4RKWA 2G9QA 2ZWIA 4X3CA 4BNMA 5D87A 3TEJA 4XFKA 2ZJ1A 3Q7RA 4R40A 4YQZA 4ESEA 5AVWA 1JHZA 4GE3A 3ZD8A 3OQMA 1PZXA 2BKUA 1CF2O 1IB0A 5FQNA 2VDWA 2UVQA 3PKJA 4A23A 1FFHA 1QS0B 4BEBA 2HJ9A 4OXYA 4PPNA 1GTRA 3ZZ1A 3QYAA 3EVBA 1B6SA 5FUXA 1CY0A 1AQJA 4CF3A 4DA7A 2WWIA 2I62A 5JAHA 4WUTA 4A91A 3MWDB 1ODJA 4G5SA 4G5GA 3RUAA 3IBFA 4A8HA 4R2KA 2IHTA 2ODNA 3A2MA 3A4YA 4MLZA 3G3EA 4UAGA 1GNVA 4RS4A 5TNXA 4AYWA 1FFXA 4DYVA 4GZ3A 2WZDA 4URWR 5ALQA 1RWPA 2WJZB 5H3CA 1GADO 4O0LA 3LOUA 4BLSA 3OQOA 1XPUA 1O8CA 4B6RA 2I1QA 3JARB 2WJJA 3MGAA 1DEAA 2DHQA 3BA6A 1S01A 2WJ6A 1P29A 2XX3A 3PPWA 5ALNA 5T8KC 1G5TA 2OGSA 4R2XA 3GLGA 1T5TA 1V9LA 2I71A 3AHIA 3PDIA 4RJLA 4URHA 5BOVA 2FP4B 1TJ4A 3H1BA 1RWXA 3TZBA 2EFDB 2F8LA 1UXOA 1CJKC 5E4JA 3VC3A 4IG4A 1P5ZB 2XEXA 2QXUA 2WMDA 4MWGA 2ILVA 2WTXA 1UF9A 1IBRA 3BB4A 5BRNA 3L7LA 4BMOB 3IE0A 3KEFA 3UOGA 3K4PA 1HNNA 5DB4A 2HSJA 5JI2E 3SWWA 2Z1NA 3P52A 4IH1A 1FJXA 2QUKA 3WDSA 3RS7A 2CL0X 2PX8A 3HJUA 3F8WA 1KO8A 4BQOA 2IX9A 2CMGA 5HRUA 1QHXA 4CPDA 3AO0B 4KI7A 4KWHA 3A1DA 1N0WA 3Q41A 1AUPA 5EJIA 3NIGB 2GN0A 5JY6A 4J76A 5FULA 5BUCA 3RU3A 5L3QA 1JHOA 1XALA 4L73A 5CFZA 3JYHA 3DQPA 1EI9A 4FNGA 5C32A 3L8ZA 2X76A 1VB3A 1MIOA 3N0TA 4CMEA 3NHSA 4IMPA 4Q9AA 4RTMA 4MHSA 4E3WA 2JHAA 4Q7LA 4DIUA 5JIBA 4LJRA 1K6MA 3FVRA 4F96A 5AW7A 3L3BA 5A9RA 1QHNA 4KXNA 2UZ4A 1XD8A 2Y67A 3BD6A 4HZUB 4DUZB 1Z73A 4FINA 4L3WA 3I9OA 2QF7A 2GTHA 4HDSA 4US0R 3KZMA 3N9IA 4J49A 2IHNA 1PYDA 1V1RB 1Z6PA 2V6MA 2YASA 1GRNA 3DWIA 3KQTA 4FX2A 3ZHUA 2WLTA 4LF5B 1D03A 3RS9A 2ONYA 4D96A 1KQNA 5TT1A 4ZGGA 3P9QA 2YC4C 5AKXA 3TTXA 4INOA 2A9RA 2O1SA 3GFVA 1Z7YA 4Q4HA 3V7NA 3FTQA 4X24A 2XUOA 4BAZA 1RFGE 2WHEA 1YRYE 1TVMA 2IFTA 4LE1A 3VYTB 1KYTA 4JLAA 3UHPA 3ND9A 2Z4RA 2VT7A 2RGEA 4FDTA 2HO5A 3CG0A 1KI6B 5BSEA 1OPXA 2A7QA 4GR4A 5DM1A 3WIDA 3EZFA 1DT3A 1R0CA 2H57A 2JBHA 2OSVA 5K8LA 5KYKA 4MWDA 1F20A 2R84A 3HEBA 3PQFA 4PICA 1E9CA 4L51A 1L5YA 4O2BF 2BDTA 3OFSA 1GO2A 2XYQA 2V96A 3CM0A 5BXYA 5KX5F 1MF7A 1GQYA 2JD2A 3FVQA 4BX0A 5CA1F 3B1WA 3MVEA 3W5IA 3FLMA 4G85A 1Y3BE 5HE8A 4UBLA 2A84A 2YJTD 5H8WA 3F2IA 4F4JA 4G8JA 4ZO9A 3ZD7A 3L5OA 2QLTA 3E4DA 3QVGB 4H3SA 3D0OA 5KYYA 1UBJS 2BEWA 4UUOA 2P90A 3NWEA 2HUPA 3JAKB 5FHQA 4FFNA 1YJBA 4M0FA 1ZHHA 3JQFA 2CCJA 3ELUA 1DAHA 3EDYA 2XB9A 1SXHA 4MNTA 4L22A 4B4KA 4EB0A 5C8YA 2H4YA 2W22A 3HCBA 1YFKA 5LQUA 2H5LA 3KQWA 1QV6A 2FMKA 5I9LA 3ZCRA 3ELDA 1Z0IA 5F3DA 3QVKA 4QE3A 3KFVA 4CHGA 1M1UA 4YONB 1PR9A 2RSLA 3GUUA 4EA8A 5AJVB 2RHMA 4DV2B 4CEJA 2GJSA 1NHGA 2E82A 2QN6A 2ZJAA 1NAHA 3J7AC 3W2TA 5AW3A 5L7WA 2KBFA 3W2IA 1KU0A 1JJIA 1IN8A 3NEJA 3RVQA 1X80A 1L3CA 1YS9A 3DPSA 3U3XA 2F43B 2QRJA 3PFCA 2NO5A 3OBIA 3KTAB 1JP7A 1E3IA 1R37A 1TO2E 3B53X 4MW5A 5LFAA 1SWWA 2XBMA 1CC1S 1U8EA 3TTVA 4JJIA 4O4LF 2C5BA 1O6CA 1KH3A 2QL6A 4JQZA 2QSUA 5TMEA 4CL8A 5IJZA 5LQMA 2HMUA 2GSWA 3W04A 4K40A 4UPVA 1EFVB 3KETA 3DQQA 5DTQA 3WXBA 4QU8A 4QYIB 2PFGA 1ISFA 1JWAB 3DBRB 5CT8A 4XQ9A 5KQRA 3MXOA 5ILGA 4BLRA 4RULA 3MJSA 5A4MS 4HATA 421PA 1I4LD 1OSNA 4MP6A 4EA9A 2PKEA 5DX1A 2J31A 1P75A 2YS6A 2WVAA 3A9SA 3LLSA 4NZMA 2HNBA 5H16A 3QMWA 2V0GA 5KYUB 1LQ2A 2AD5A 3F9CA 4KUGA 4UMFA 4W8HA 4WIAA 4AY6A 1RCFA 2BFEA 1PVDA 3HFGA 2ZUVA 3LWBA 5G4LA 5BSTA 3ZGOA 4WKNA 3AZPA 3MD0A 4ZOCA 1TKBA 1VG8A 1GCUA 1LWNA 2P6OA 1A3CA 1YULA 3DBOB 4MYUA 4UUMA 1D5CA 2AOXA 5CW2A 5CX1B 3WWYA 4N8EA 4ALJA 1N1DA 3QSGA 3JRWA 2NQTA 4V1CA 2IH2A 4KR3A 4XWGA 2Q5LA 3F74A 5KS2A 5JFOA 4XIJA 3LQ2A 4EELA 4UDXX 3N2GB 4YUVA 2OOKA 1AHPA 1Z5VA 5ELMA 1MB4A 1J7KA 3GCZA 1FCJA 1HTBA 1L6IA 3BCRA 1E79A 4WSOA 2E0IA 4YGXB 5AKYA 1FJGB 2ZWPA 2XLCA 4DRZA 4E88A 1H22A 4EFLA 1PTJA 5AVYA 4NE9A 3PDUA 1GFZA 1F8FA 1ST3A 1W59A 4G0MA 4G4GA 4N48A 4BMXA 2O3UA 1ZC3A 1G9XA 3PPVA 2AMLA 3CF6R 4GR9A 1FQKA 4MV6A 5EIWA 1SO8A 4E4RA 3K8ZA 1GDHA 4MV0A 4QUGA 5SYAA 2X8JA 4LRTB 3CX8A 5LQDA 3D0RA 5E6UB 4AJKA 3PNQA 4MEJA 3KR9A 1IOZA 1NVKA 4HGZA 1FRQA 3BRWD 2XB6A 4KG7A 5KNCH 2J85A 3RSFA 4RSGA 1E9BA 3RWMB 5AJXA 4PXYA 4GI7A 5CR9A 3ETGA 3QEAZ 1EFLA 2UZ1A 4ZWNA 2R6R1 3Q0TA 4UHFA 1GPUA 2X8LA 5FWXA 3QF4B 3W06A 1T1GA 3BDIA 1T1EA 1S2IA 1EP3B 4YCNA 5P21A 4B83A 1QK3A 3D3NA 3NT2A 1E7WA 2D5CA 5GM1A 2CNLA 1YRWA 2WKSA 4LZNA 1J06A 4DV6B 3BAFA 1HWYA 5FAXA 2YWGA 5C46F 2C8JA 1O9GA 2QJFA 3UICA 2W83A 4JI6B 1FMFA 4OGGA 1B74A 2GHQA 3EWAA 3GGJA 2Y2VA 4L9SA 5K0NA 3WZLA 2VBIA 2X0EA 4C0XA 4PSAA 4V03A 3W5DA 2I87A 1X7WB 2J5BA 4QTYA 1H6AA 1OH8A 1Q2XA 1R88A 4O2LA 4YRPA 1K8XB 3UUEA 3V2UA 2X15A 3AL2A 2EAUA 1PKEA 2AEMA 3EC2A 3SBOA 1DJMA 1TLTA 3PT5A 1U1CA 2XIQA 3OU2A 3ITEA 3OZVA 3HJHA 3AEZA 3V4FA 1ND6A 1E6MA 2C4KA 2HMTA 3H7AA 4O02B 2GARA 2E5LB 1OJ7A 1Q14A 5FLYA 3EQ7A 3K15A 3G0DA 3ML1A 2QRPA 2EX1A 3PTZA 4RHFA 2FEWB 3EY9A 4Q00A 2H48A 3KZVA 2O4UX 3N7TA 2G82A 3TRJA 3HVHA 3FPCA 2AFHB 3QVLA 3W3AA 1CQWA 4BHTA 5I7WA 1GTL1 2AQ8A 1QBKC 1POWA 2VDMB 3D5EA 4QEZA 2NZ2A 1Y7IA 2MSLA 3A1EA 1RHKA 1W88A 1H2EA 4N5LA 1M8PA 3JWJA 4JITA 4JODA 5BSMA 3TNDA 2EKPA 1J00A 1JHVA 1BNCA 2IDKA 2IOHA 3HDTA 5IJWA 3VR2A 2RFLA 3BJMA 3DG9A 3IVCA 5I4BA 2IE0A 4PHHA 4H6PA 5TQ2B 3UJ7A 3PHJA 1NNLA 1BHSA 2B94A 3JQQA 5AFSA 3ANSA 1OZAA 1XF1A 4A10A 2ZJZA 3PUXA 3CBQA 4JL6A 2NSHA 4WXYB 5LDGA 5A9SA 4WH0A 1E3EA 3WGYA 2Q7OE 1JHXA 3MTBA 2Q3FA 4P53A 1C8BA 3OHPA 4KHZA 4EJ6A 5EZ6B 4BO7A 4XIIA 2MR6A 3IVRA 4RZUA 1JQEA 3NC1C 3D6FA 2DHRA 3FF4A 1GNLA 3W3AD 5JSFA 4TROA 4BO6A 3N8HA 2XGMA 3OPYI 2PQ6A 4K6CA 5MDHA 1N5DA 5ITVA 1GHTA 3C6ZA 1JEAA 1TZBA 1R12A 3R3HA 1E3DA 2BSXA 2VRWA 4HB0A 4CODB 4DSOA 4W5TA 1YV9A 2NNLD 3TM4A 4CIXA 2HWUA 5F64A 4UFPA 4NJEB 4U4AA 4XZ3A 3VR2D 4KBGA 5JEEA 4O4HB 2CYBA 4XGQA 1AF4A 4FN5A 4QXMA 3TX6A 1DJNA 3TIXB 1E9FA 4ZAFA 2YNMD 4RHCA 3KOXA 2VXOA 3JAWA 4MWCA 1DC8A 3MGBA 4M22A 4XIFA 4Y8VA 1Z5ZA 4HEA1 4M1YA 2W8BB 3C1AA 5EVJA 2QE6A 4V0NA 4A6DA 1QFZA 4D41A 1TU0A 5DGXA 3TH5A 4LYDA 4W8GA 3VHRA 4A2PA 4EEKA 5IAOA 4GG1A 2FI1A 2Q1XA 1IATA 4DUGA 1BXGA 3H5IA 1G9TA 4L57A 3GJ4A 2VBGA 4KQ2A 3T99A 4BJ6A 2XOEA 3WTBA 2I4IA 2C2OA 1U7HA 2QX8A 1JR4A 2PA3A 2ZXEA 2HBYA 5K5EA 3F1LA 1M76A 4CE6A 1EUDA 1T9AA 5FWNA 5SYMA 1IK4A 4DTCA 4AULA 3RRNA 3C41J 2JI8A 3U4DA 1ZAYA 2AF3C 1TYCA 2IUTA 2ODBA 2YFQA 3FM9A 3PV0A 2CXQA 2X6RA 3RYFB 4QDTA 3PJGA 3OCJA 3WAKA 1UWKA 2V5UA 1XGKA 3BHJA 2AOWA 3OIGA 2VUIB 4IF6A 2BP7A 4WZBA 1HE5A 5KSWB 1JAZA 3C6BA 1ABBA 2M32A 3II6X 1U94A 4U9HS 1FNCA 2PZBA 3SC2A 3STHA 1EIWA 5CLQA 2YWJA 2I3DA 3MBIA 4ISBA 5J2TA 1J8VA 1T9GS 4TKUA 3TGLA 5FLKA 1FK8A 1K5GA 1O96A 1X7GA 2YV4A 3NPAA 2C9OA 4FXPA 4UCWA 5DHUA 5DISB 1KVSA 3EXHA 4H1WA 4LDRA 2REQB 3I5MA 1ZN7A 3LO8A 3NBZC 4DUGD 2PL3A 1C1DB 2VZEA 2FDXA 5ALKA 3LQYA 4DFDA 4MI3A 3L41A 2G5TA 1N1EA 4C4ZA 6CHYA 4R9SA 1XJ5A 2XOXA 2OEPA 1KJ9A 4C7OB 4DDVA 3LI2A 4GWGA 1C9NA 2A5DA 3A9WA 4DCVA 4IEIA 3OAAA 4LVUA 5ERXA 1VGQA 2QY6A 4A3SA 1DRJA 5JRDS 3O3OB 1SCNE 2YHIA 3JWEA 4HQFA 4P5DA 2FSHA 4A7PA 1MAUA 2AG0A 1VL0A 4RJIA 3T34A 4C30A 1UDWA 1WW3A 3SN6A 4COOA 4PPGA 3KPWA 1WB9A 2EZTA 1QVVA 1ZD3A 5CFOA 1B8VA 3ZJTA 1QTQA 3OJLA 2B5OA 3BVPA 2CL6X 3LT1A 4CDGA 4C7XA 1HSZA 4U7GA 3ZX4A 4DR5B 2O1XA 1FPQA 5JVDB 1V1MB 3R3ZA 5C8DA 1TUBA 1HBJA 2FSIA 4XYBA 2GJKA 1TKRA 2JLRA 4DLYA 5C1OA 2Q0XA 3V00A 1X70A 4L3VA 1VPVA 4FR0A 3Q9LA 4ZREA 5E2IA 4LY9A 3DBHA 3T0IA 3DLIA 1P3JA 3DT6A 5I8WA 4YRBA 2MCFA 2FSPA 3QBVA 2M6KA 3UJHA 4Q6WA 3R1IA 1CFZA 1OX6A 2AOVA 3OAAD 1BS9A 1A9XB 1T5OA 1E4EB 4YI3A 3D7KA 4KNYA 2AC4A 3HKEB 3RWBA 1ADCA 3GA7A 3SX4A 5JLJA 5LP1A 5AM5A 2VP3A 1I3KA 5BSUA 5IDQA 3PUJA 4F86A 4QXOA 3N2LA 2G67A 1G19A 4MVJE 3ZDFA 2CHGA 1PZMA 3AL3A 1D5WA 4D79A 1Q0ZA 2FR0A 3SZLA 2ENWA 2FVYA 4URFA 3ZH2A 4FSXA 4J8PA 5FORA 2YJ3A 2ORYA 2ZK7A 5BVGB 2XCSB 1AKNA 1PVVA 4UHBA 4URVR 1QS0A 4YUWA 2PSSA 4I50F 5B4TA 4BFYA 4F46A 1UBRS 1UJNA 2R86A 2HM7A 5DHAA 5TT0A 4OQXA 3E23A 4DM4A 1HQKA 2M2IA 2JI4A 2Z4TA 4K03A 2DG2A 3I83A 4HC4A 3MWDA 4UPEA 1CKEA 2NO0A 4K9KA 2YY7A 1HQDA 2JKYA 1KZ7B 1DDOA 1U4SA 3GPBA 3QU9A 3H2SA 4WLVA 5J63A 1S9HA 4Y6LA 1YR2A 1DQYA 1PJSA 4B6PA 1HY3A 1Q16A 1K5HA 1C2YA 1XV5A 2M98A 3GD7A 3LBFA 4RKFA 1ONOA 2VH5R 4YDSA 4UXHA 3ZWKA 2QTFA 3L1KA 5FUQA 1NAIA 5TE9A 3A8TA 1AKYA 1XP8A 4JJ8A 4P8RA 3NVKI 4MQFB 2IP4A 1Y9ZA 4DLWA 2XEDA 5CIYA 1QAQA 3ASVA 1JH9A 4CUJA 1VL5A 3AUXA 3ZWBA 1STOA 2QIPA 2MT9A 1SKYB 3SX2A 5HRAA 1IXKA 4QFMA 3JARA 3S2EA 1E6LA 2QLMA 4N01A 1N7JA 4HXFB 3TI9A 4OJTA 5D51S 4WX2B 4LV6A 2Z8YA 2ZJOA 2QUIA 1E98A 2WD9A 1KMMA 2EX4A 4LHVA 3TFOA 4ECEA 2DM6A 2FP4A 2P9YA 3ISVA 1M8FA 2EEZA 4XLLA 5FD8A 4X6LA 2RGRA 1P1IA 3PR3A 4DMGA 1C0LA 1RWKA 2HBRA 1OZHA 4Q9KA 3ZBUA 1FTSA 1AN0A 4RH1A 4CM8B 1HF3A 3N6XA 2ORIA 4JFRA 4R1MA 1P1JA 3QFSA 1GPLA 4WTOA 4WFQA 1CUGA 4BP9A 4BECA 3ZKAA 3HJGA 5AVVA 4BE4A 5DGHA 4CUZA 3EFOB 2XQVA 4WOPA 2Q9BA 1OB2A 1UXIA 3V4OA 5JALA 4OYYA 4WXRA 1KI3A 2C1XA 2WP0A 3ZHOA 1XMIA 4LBWA 1XQ6A 4D02A 4FE3A 4POOA 2E5WA 4F71A 2BKVA 3BEOA 3PQ8A 1T0IA 5JU6A 4DR4B 5C1BA 1DIRA 5KNDA 4KXVA 3DL0A 5KWJA 4ZJPA 1O9HA 4M0PA 2I80A 4G84A 3LUCA 4NCKA 4OAPA 1FYWA 3LCUA 1MX9A 2F3RA 3P9XA 4HAUA 2CVQA 2XCLA 3L6CA 4OMUA 1CX9B 2K87A 4HY3A 4JLNA 4RQUA 4AY3A 2BOVA 4HZUA 4BO2A 1SC9A 1WD7A 1M2NA 1S2NA 2GETA 1H5QA 2GLTA 2VYQA 4XRRA 4ER3A 1NC1A 2HA6A 1H1TA 3GFOA 1EZ1A 3NEPX 4FFMA 4Z54A 3W8FA 3V9PA 3U48A 3OOJA 2ZJ8A 4C5AA 4DCNA 1FVHA 2HJWA 4UE3S 4G8CA 1T8SA 1MV8A 3OLCX 4EUSA 5DWVA 2FGKA 4QPNA 2JBAB 3UWMA 2BM8A 4RQBA 1WBJB 1MABB 3CNBA 4YXFA 5DWDA 4QUEA 1SQFA 1M34E 4P80A 8OHMA 1TZMA 2OCBA 1R27A 4YRDA 3TLYA 4S0ZA 1KI6A 1MGPA 5AJZA 3DYBA 5JD3A 3EIHA 1AS3A 1NYRA 1QGDA 2X0IA 3U7RA 3X2EA 4AS3A 3D8NA 4YV2A 2PZAA 3B7GA 5EXPA 3VRHA 3F0TA 4HZGA 3OTIA 2OXEA 4J7AA 1W4CA 5ALHA 1JZTA 4NH4A 3WQBA 4PYRA 1KVTA 3U4AA 4NP6A 3T52A 1X1TA 2OBBA 2AN9A 4H77A 5D5HA 5GONB 5JY1A 2VRCA 2VPIA 2R00A 4A27A 2DQYA 1A9RA 4DJJA 2R8BA 3QVGA 1U8TA 2FPXA 4DV5B 2IZ6A 4FFPA 3WRXC 2QX6A 3JAKA 4HRVA 3F3MA 3HSSA 8ATCA 1FDIA 1YTUA 3MCZA 2ZUSA 2AI3A 2FPWA 3OOWA 4W6QA 4XKJA 3BZWA 4GRDA 1I10A 4YGYA 3RFXA 5FF9A 2B1IA 4Q7KA 2WJIA 4MQEB 1XRNA 4RH3A 1E2HA 4ZCLA 5U9CA 1GG5A 4TV8F 3FPEA 1J33A 5AVJA 4ZU1X 4KRFA 1JZQA 2FSFA 1CUZA 1WSWA 1U3DA 4MARA 1VA4A 1F5SA 3CT4A 3ZDDA 2WSSA 2ZRIA 4ND8A 5HCIA 5HFNA 4R3NA 4HUTA 2F43A 3WK6A 3KTAA 2QRHA 5LXTF 1EHYA 3OWXA 4G5OA 2Y99A 1A4RA 4UNIA 5FTWA 3LT0A 4J0DA 1TCBA 2VRCD 1T8TA 3BH0A 1FC0A 4E08A 4YUYA 1DNPA 3EXAA 1H1DA 1EFVA 1A9QA 1JPNA 1DL5A 3WSVA 4EYQA 4QYIA 1SUEA 3F6BX 5JNLA 2W2NA 3AUAA 1J9GA 1WB6A 2HF7A 4RL6A 3B82A 2FZ5A 4EGQA 3VR6A 4CIDA 4YWJA 2JCVA 3ZI0A 4AICA 1GSIA 2QR5A 3A9CA 4EDHA 1DKQA 1TQHA 3LF1A 5KYUA 4ZCTA 1E2FA 1ZJYA 4O5OA 3D4IA 3U3MA 3ZD9A 2ZE8A 4V0RA 2FX3A 3FTPA 5KINB 5BR8B 2H4FA 3ABOB 2Y27A 2YYZA 4ZI7B 4ZK2A 3O83A 4AKSA 3VNVA 2D0OB 2WSSD 3O7MA 5CX1A 2Q0SA 3WFIA 3ZVMA 1LV7A 4HNSA 4HWPA 1DG3A 1VDMA 4HAOA 3F5FA 3UK6A 3G89A 3UG6A 1KK3A 3BHNA 1CUSA 2H4XA 5DLEA 1Z7BA 3MUFA 5ESDA 3JVVA 3N2GA 4YP9A 2VAMA 3O4VA 4DA6A 2Z8XA 4Q1EA 4PSVA 1QUEA 4BZPA 3LX5A 3IL2A 2BM9A 2VG8A 1P9RA 2WDPA 2QNIA 4MVCA 1EZZA 4KMOA 1KS9A 4EG0A 4D5EA 1EVYA 1GCOA 4W5WA 4IEFB 2PEYA 2AE1A 3SG0A 2B92A 4FYYA 1JHUA 2NPOA 3A1NA 4RKRA 1ZUWA 5L3ZA 1ZGBA 1CFJA 5DCWA 3RJMA 3VR6D 1KRWA 1SUIA 1G60A 2RAPA 4E70A 1M1YE 4A73A 4KN6A 4CIAA 4NV0A 1R4MB 2W2QA 3L4BA 1Z7GA 4IHJA 4MGYR 5E6UA 4FW9A 2P4SA 1QYCA 5F76A 4AQYB 1GNTA 3M9WA 1Q2UA 3PNOA 1V48A 4L9AA 3FHJA 4AYXA 4B31A 1FMCA 3WSWA 4D9FA 2HWWA 4Q9IA 1W5AA 2P4QA 2VH2A 3F3SA 4MIOA 4FGUA 1Y48E 1YCFA 3L7CA 4OGWA 4UASA 1MU0A 1VG1A 4YACA 3E70C 3UPDA 3L4EA 4AMZA 4BNDB 5K7SA 1ZCJA 1Q74A 1M1ZA 1VE3A 2FW7A 2P68A 3QF4A 4Q3AA 4QPDA 4OHZA 4Q4CA 4B7AA 4CKEB 4QPCA 3KTFA 1U7WA 1L8LA 2OBLA 3ZXUB 4E46A 2DYKA 5F35A 3KOZA 2YXNA 2ZI7A 5F9MA 3TKYA 3AI3A 3WL5A 4YRCA 1R6XA 2GNOA 4N4AA 4HH3C 2VTDA 3TAXA 2XV1A 2GUWA 5GQSA 2BM0A 2N75A 1X7WA 2N1MA 2VNHA 3F9RA 2YNMC 4JX8A 4UBNA 1FFDA 3GWZA 2P2SA 2Z0MA 1GGFA 1VKOA 4AL4A 1NOKA 1TFUA 3DZBA 4JP8A 5G53C 1QONA 4LWOA 3DDSA 3VSCA 1QRUA 1T0HB 2VZ9A 4FZ3A 4NARA 1NMXA 3N28A 1NQXA 3F78A 4XQ0A 3AF1A 2VYNA 3BFJA 2ID8A 3G0OA 2QL9A 4CTOA 1IQPA 1OWPA 4ZAWA 3CX4A 1ATZA 1U9YA 3KYJB 5H0IA 3TB6A 3PLRA 3DOIA 3DQZA 5ABPA 4JZKA 1PX0A 4X7BA 5ICCA 2ZATA 2CLIB 1F17A 5EY5B 3I0NA 1S2DA 2CB9A 2FEOA 4K0RA 5L7TA 4KQMA 4YNBA 4ZK6A 1UBFA 5K4AA 1U9CA 4JHLA 4CKXA 2MYTA 4ZMSA 2IYUA 2JH3A 2OZPA 4IZHA 4OIFA 2OQIA 5F51A 5KOIA 2AFHA 3IUQA 4WADA 4FX5A 1ZCFA 3ZOZA 3GFBA 4Z7QB 5HUJA 3VKWA 4O4IB 4PGGA 2X40A 2IUYA 1ENYA 1QE5A 2H29A 3FNFA 3IP9A 1L5SA 1P7ZA 4ODIA 3T5DA 4BEJA 1C30B 1FE8A 3TL2A 3S2ZA 3CEPB 3RREA 3OX2A 1ENPA 3DEJA 4RS3A 4Q3CA 2A0WA 4TMZA 2LW7A 2C2HA 5CXXA 4L16A 3EF0A 1WCXA 3M6AA 1HFWA 1UFVA 2J4DA 3DOJA 1AGPA 4ZRMA 2VYND 1JG4A 4PWYA 1Y8QB 2HKIA 3P97A 4H60A 1RXVA 1ZRHA 1JHPA 3PGKA 1TTPB 4R68A 3DTVB 2I4NA 2VIIA 4BYGA 6AT1A 1L7QA 5B2ZA 3NTQA 4MCHA 1U0OC 4RV4A 3DEAA 2AMFA 2DPMA 3NHAA 1ZH8A 3RE1A 1V9SA 1SBNE 1Q84A 7AT1A 3IAEA 2RBEA 1AY0A 4TTVA 2R6ZA 3H1AA 2IXAA 1ZLXA 3B70A 4RENA 4FLMA 5FTMA 1E18A 1I8TA 1E9VA 1W5SA 3G68A 3JPYA 3R09A 4JC4A 2Z5LA 1KFBB 4JGIA 5CB8A 2XKJE 1NNUA 3AH8A 5EMLA 1E2LA 4IXWA 1M6HA 2BR5A 4ZOBA 5KDLA 3OEEA 1AXGA 3U1TA 4G4SP 4L50A 4O4HA 5ER6A 4W1RA 4UU1A 4JJ6A 3WQRA 1EESA 1ENOA 3RBZA 2NX2A 4GKBA 2BE9A 1XDDA 3PHIA 2W8BA 3O8LA 1K68A 3G8CA 1OWLA 4J2TA 1EVJA 1O6GA 2B1RA 3VPXA 1QIJA 1E5QA 2REXB 2H3EA 2ZBUA 2ZWOA 3EF3A 3MS7A 5GIPE 4K0KB 1WABA 2GVDC 2XYVA 2IF2A 3HPRA 4P5EA 5H3HA 3STXA 1E96A 1EXNA 3KEMA 3U9SA 4M0MA 5JECA 1A7KA 3KUKA 5B4VA 3PG5A 2JH8A 3DE2X 4ZPXA 4YN3A 2MTBA 3IC5A 2WRZA 4ND1A 4XUGB 2OHJA 3QJ5A 4HDRB 3R6LA 4YRJA 1LDGA 1HLDA 3O4JA 1U0RA 4MJLA 4PFQA 1J8QA 4J3FA 2QM7A 3IUPA 1IN5A 3CVYA 2W42A 1Z8DA 2H4HA 3P2EA 2XT0A 1M67A 4HQ6A 4JP3A 1C4OA 1SCDA 2AE2A 5CYFA 1N8NA 3RYFA 3T5AA 2R65A 1YJ8A 2ZCVA 3OEED 3K0CA 3EFHA 4S3MA 1GPBA 2O0LA 2ADFA 2C20A 4FPXA 3OTOB 5DSXA 1UKYA 5ANRB 4PINA 2PSDA 5IULC 1MTZA 3F96A 3PF8A 1E2JA 3A2LA 4RVGA 4A8JA 4F93B 1FFWA 1TQDA 4KQCA 1UL1X 1BXKA 2RG7A 3HC7A 1WSBA 5KDOA 3NHPA 3ZHYA 4EI2A 4D8YA 5A5DA 5HVNA 2G9VA 2V55B 3C6XA 2I0FA 2REQA 1SXPA 4ND2A 4B7CA 1C1DA 4DLZA 1NKTA 3K5HA 3JVUA 1E2UA 1E5LA 1FTYA 3D5QA 2H06A 5IWAB 3I0ZA 1IY1A 3PWKA 4GWLA 3SFZA 3VFDA 3IPXA 4C7OA 2IOQA 4ATNA 1R0LA 1YZLA 1RTTA 2VT6A 4A16A 4YROA 1ZA2A 3G5LA 4G8DA 1ZAKA 5C51B 2IEGA 1P7PA 3TLZA 1WLYA 1A7AA 4JLBA 1Q11A 2VHJA 4YP5A 3SR0A 3ZJ4A 4RM2A 3UAWA 4JXXA 2NGRA 1JUDA 1K8ZB 1ODKA 3HH8A 4WKOA 1XKQA 2JDID 3TZLA 4OKIA 3WB9A 1UZLA 2TMDA 1KVUA 3X1JA 3ASUA 1ZN8A 1UWLA 3BE4A 4PCVA 3VYVA 1DOZA 1KPIA 4YRRA 1B3BA 3EOBI 4R8SA 4O4JB 2ZYDA 1BU8A 1FSZA 2Y0EA 4TVBA 5DK4A 5A5EA 5BYBA 5B3LA 1NUHA 1TIPA 1V1MA 3GROA 1JJ7A 2PTHA 4FJ0A 5JVDA 1ILEA 1P7VA 4X65B 3L0YA 2AEFA 3H9EO 1V26A 3IOYA 1NVBA 2QK4A 3HLYA 1PG0A 5HF9A 3T5TA 1EVIA 2QD2A 1DPFA 3TEFA 3ETCA 5BW6B 3OUZA 4TLLB 3NHFA 4K6MA 3GFTA 4BMPB 3GVIA 4HXEB 4UOZA 4DIEA 6NULA 1A9XA 2LDBA 3RPEA 2JIBA 1P8AA 2C5EA 3CNEA 1E4EA 3LNTA 5DBGA 3MRVA 3HKEA 4G4JA 5AHWA 1CS0B 1TZCA 3CKMA 3QHQA 5SZJA 3TRIA 2HIGA 4OBBA 4PO3X 3TSZA 2Q4BA 1HDIA 1C9EA 4RQAA 4JI5B 2QM0A 2YOFA 3VH2A 2CXUA 2QJRA 4F4DA 1HG1A 1OLOA 1P73A 2GBPA 3IPYA 5LKRA 1U4NA 4A82A 3GT7A 4HNRA 5BVGA 3A6JA 4G09A 2V6BA 4QXPA 4RA9B 5DXFA 3N59A 1F2TB 2E4AA 4TXLA 4YPVA 3SF0A 1HQCA 4TXNA 5CH3A 2CDCA 1YA4A 2F8MA 2GH1A 3L8DA 4YAFA 1VKHA 5IF3A 1RC8A 2ZIWB 1BHJA 4PZPA 3GZNB 1M54A 2ESRA 1VMDA 1MCZA 2BTQB 1SKUA 1DADA 3H3XA 4M1WA 3Q8WA 4JT9A 5GV8A 3V97A 4P4LA 4KTVE 4FT2A 3GRUA 3TWOA 3SICE 1PFGA 1KSFX 5IJ9B 1SUSA 2EQ5A 4P3NA 1HYQA 1A76A 1JMVA 1XZHA 2R8XA 2OCIA 2QUBA 3SKYA 4CFYA 1J2RA 3F98A 4MQFA 2ZRPA 4RF2A 3TQQA 1J6UA 1TXGA 1MX1A 4ZZ3A 2E3JA 3LHFA 3SZUA 1N6LA 3TLBA 3CY6A 3ROFA 1SKAA 3Q3VA 1V39A 1EUQA 4MCIA 2HQRA 3TUIC 3BH7A 1QO0A 1TVCA 1YBFA 3NIWA 1JYFA 3D3JA 4MA0A 5CT4A 5IHPA 2NU6B 1CDDA 1NX9A 4B8YA 1PT6A 1NV9A 3D7SA 4BDTA 5A3RA 4N5NA 1FSFA 3V5NA 4QIHA 1LLCA 3W2FA 1ZINA 3LBHA 4C2TA 3WNVA 3N8NA 3EY4A 1G5FA 4YRNA 2VCYA 2WAAA 5T4EA 2OCDA 3LUAA 4BGEA 5K0JA 4IMJB 4V0OA 4LI3X 3R5KA 3BRSA 1VHWA 2PVSA 2D1SA 3LFHA 1O4WA 3ZK8A 4FGKA 4CM8A 4HGQA 4Y1FA 2RHOA 1V8PA 3CPJB 3ZXYA 2PGIA 3HCNA 2WKQA 4YMGA 3DDUA 3SFVA 4I1YA 3TM5A 3DPUA 2HDOA 4M7OA 3HY6A 3EFOA 2BGKA 4H3HB 4ME6A 1XDBA 1XG5A 1AKVA 2XUJA 2ZE6A 2NADA 2PWZA 3PLNA 2DFVA 5AH0A 3IOEA 5JXJA 3EE6A 1H2AS 1QO0D 1FRFS 1PG5A 2OC9A 2QYOA 4JS0A 4L15A 4CJXA 2FOIA 3KVVA 3B7PA 2QVZX 3K30A 3LQRA 3L05A 3H83A 3CMMA 2AHOA 1JXAA 4TT3A 4DZZA 5CCXA 1L4NA 1WDTA 4OB6A 3QBEA 4RMGA 4MPDA 3M4NA 2R8OA 4N41A 2WB2A 4R2HA 1PJQA 1EWKA 1QIMA 5CFQA 1TM1E 3T54A 3DFFA 2C31A 2HXGA 1Y8AA 2ECKA 1T1IA 4EGFA 1UMDB 5C8XA 4FEYA 3R24A 4U7TB 2QN7A 2ZKIA 4H27A 4KKVA 5K6AA 3FOFC 2WG0A 4MUIA 3TL6A 4D3XA 4DQUA 4MW4A 2CNKA 4RJ2A 2E4UA 3M8KA 2JBAA 3RSLA 5AHKA 4OOEA 4E2YA 1OB5A 1MABA 1UJCA 1U3TA 4DDKA 3NQ41 4LNAA 3BIXA 2FFAA 4H3VA 2HSEA 2OXTA 4BO0A 3EH1A 4M89A 4WA7A 3SZGA 2JLAA 2VJOA 3TXYA 5I4KA 1GNQA 1FP6A 1SEPA 4TT3D 2QBYB 4LNUB 2P9TA 1TC2A 2FMTA 1QZUA 2OXFA 2B4RO 3L8YA 4WACA 4B6JA 2D7CA 1V71A 3UMGA 1A9PA 1DQNA 2CCGA 1JG2A 1I2MA 3EASA 3UGQA 1PR1A 1S0UA 4D3ZA 5F4BA 1RRKA 2PMFA 1CUUA 4BMYA 2CMKA 2GPTA 3WOVA 1VG0B 5G40A 1TKCA 4F2GA 2E4YA 3CC8A 1AQNA 1IY2A 4D0NA 4GPIB 2BFFB 2KLHA 2PQ0A 4Q9LA 4EY4A 4AP5A 2CE2X 3IFSA 4ARCA 1X8XA 3CXUA 5KNBA 1JQAA 2QMZA 2HQ1A 3B6MA 2ZT6A 3WHLA 1PZHA 3IHWA 4F91B 1RRMA 4BFTA 2XZDA 5KTMA 4FNMA 3GT4A 4GVLA 5L51A 3FR8A 3AY3A 4YP7A 3M6XA 5I9BA 3WIVA 3UW1A 5C8YF 3WL3A 1HQYE 3PT9A 2GBGA 2Z3ZA 2JB9A 1KK1A 2QGZA 2X4GA 4PQYA 3SVLA 3V34A 3V4LA 2R44A 2X2EA 1TE2A 3HJBA 3I8OA 4ZT6A 4BBZA 1PNOA 1KI4A 4M54A 1FX1A 2DFKB 1I3MA 1L4FA 1MLDA 1XQWA 4NENB 1T5SA 1QFYA 4EHFA 2SKCA 2HA2A 2MINB 2XIJA 2C61A 4G97A 3DDZX 3THSA 4M7RA 4IYRA 5IAAA 1S2GA 3PQ4A 4EARA 4ZHSA 5HBGA 3AR5A 3CN9A 1V5IA 4ETNA 1GV1A 4KDFA 4OI1A 3KKEA 1RBQA 4GSLA 1BN6A 2XZPA 4MP3A 3ZJUA 4TQUS 5D3ZA 3NHJA 3RLFA 5KNBD 4KEAA 1PR0A 3B85A 1ND5A 4NAUA 3M33A 2PRZA 3RK1A 4EENA 1N5IA 2Q29A 5HZKA 3BMQB 1Z37A 2A9VA 2ZIAA 3HK2A 3NT4A 1Z82A 4GKAA 4BY9E 1D7AA 3VHLB 1KAHA 3Q8MA 3PEWA 3D31A 4OM7A 1KYQA 3IPRA 3D0KA 4AP6A 2QQ5A 2HF8A 2ZI5A 1W0CA 1AE1A 4K9PA 2P4HX 1KDZA 2QRMA 2XCUA 5LD2B 3ZGZA 4FFOA 1D6NA 4ZI7A 3OJXA 2W2OA 2VAPA 5AJWA 3NETA 5MF6A 2CMDA 2JRCA 4R3UC 4HSGA 2J6HA 3O2QB 4Q3BA 1XTVA 2ID7A 3P4YA 3EQ8A 1G64A 1S3FA 2HA3A 3TPCA 1YA6A 4F4UA 4XXHA 1T36B 4N7RA 2ZT5A 1OU0A 1IJBA 4EVRA 2WHPB 2NO7A 5IM4A 1JQJC 1JR3E 3ZQUA 5AIBA 1E69A 4KW7A 2DBRA 1E3WB 3PNYA 5A4JA 3ZI4A 5ECDA 4P22A 2G3YA 1GZSA 1L5RA 1F3OA 1ECPA 4JL8A 4N49A 2OC4A 4NYJR 1M1NB 3NHYA 1GSHA 3LKVA 4XX0B 4PC3A 1R4MA 1SHUX 3GVXA 2Z08A 2ZTVA 2FUCA 3QLUC 4KMSA 4R1TA 5K3OA 4I3HA 4FMCB 1AGXA 1JQDA 1CZRA 1R8QA 3Q3GE 2PMWB 3QZUA 4NOKA 4U3JB 2JCBA 3LNCA 4Y2JA 1SUDA 2X9NA 3A36A 4HLUA 4KQJA 3VC1A 4KI0A 4AX8A 5BN5A 7MHTA 1SCIA 3G2KA 1KR5A 3E9NA 4BNDA 1Y3FE 1DAEA 4JEMA 2WSYB 4B79A 3PL1A 1E2PA 4X84A 2QL7A 3FYUB 3HNRA 3M9XA 3FBGA 3TLXA 2XE6A 4BQFA 5IYZF 4CKEA 2PANA 4FR2A 1QO7A 4BQQA 2M9MA 4MUEA 1MTOA 4HGPA 2IC5A 4JSTA 4LSZA 4OKNA 1X1DA 3ZYZA 1CU1A 3FTCA 1J2TA 3TSCA 4JGGA 3SEZA 4IZOA 3Q0IA 3EQZA 4MVXA 2E6UX 1PNVA 4I6JA 5E7QA 5FLEX 4JHXA 4ESHA 4KNVA 2J33A 1UMBB 1YUNA 1JFRA 2IEIA 5LYJF 2IOFA 3BBPA 1IDN1 2ONJA 3CVWA 4RTSA 5CGZA 1XZFA 3AESA 1ZJWA 1CYDA 3KQSA 1TLLA 1VE7A 3GP5A 3M4YA 4RTRA 2JA2A 5F5LA 1VECA 3GL9A 4IQ4A 1XZJA 1R6UA 1XWWA 2GK3A 3ROQA 4CTJA 1UIRA 4MO9A 3ZU5A 2D13A 3HP1A 1UWCA 1A04A 4C08A 1Q6ZA 2LZ0A 3VYUB 3A3YA 4M1EA 4GR5A 4W8OA 4CEHA 4BFXA 2GZMA 2AWNA 1XLTC 4BWVA 2GEBA 5LZ4A 2WM3A 4JA2A 3GJ7A 3OX4A 3HJFA 2YW9A 3RTDA 4AIRA 3WB0A 3N2KB 4U7HA 2VQ3A 2VWGA 2Y68A 1J8DA 4G67A 2YZ2A 2OLJA 5DXJA 2HMSA 1HE3A 3UUFA 4BKMA 4C03A 1Y4AE 2VYVA 5AM2A 1X8JA 4O4IA 2HR1A 3CLUC 1CUBA 4MUYA 1KQPA 4Q4DA 5J23A 3QE3A 4LZPA 1C30A 1UM8A 1G20E 2PBZA 5JAPA 3QOFA 3QFCA 3MWJA 2H1CA 3I5AA 3NU1A 4G07A 3C87A 2RIPA 2IJGX 2A94A 2XUHA 1E20A 2NXJA 3L7AA 2NNWB 2XUZA 4AFNA 3DYVA 1WAMA 2DSNA 1Y8QA 2JJ1A 1F51E 3CV3A 3ENZA 3NEYA 4IRMA 5EJFA 5SY6A 4JMLA 4CKWB 2ZYGA 4J0IA 2VAWA 1E0SA 5CB4B 1FTNA 3DTVA 2XLBA 2ZTMA 3FSGA 5T67A 1QH0A 5FBVB 3M1LA 2L17A 2JGMA 3PC4A 1AA6A 1CVRA 5EJEA 1GPKA 1UFOA 1CJUC 4C05A 4DV4B 3GFQA 2IXDA 1TO1E 4D0LB 3GP3A 5TGZA 2PZLA 3GNTA 3KUXA 4OA5A 3ZIAA 3DGFC 1D6SA 1I3CA 1PV4A 1G6HA 1P1HA 3DLPX 3GIWA 2AXNA 3NFYA 7REQA 4N12A 3K0CC 2XVAA 2VJNA 3KTOA 1BWPA 1IONA 1FX0B 4OTZA 4INPA 5BORA 2IE8A 3R0ZA 4P93A 4BP1A 1TJYA 4C0QC 2AI2A 3EVFA 2ZRKA 4DHWA 4N76A 4CBVA 1QC5B 2W11A 3ZWYA 5HQ3A 3E5HA 4A8JC 1FVFA 2AWOA 2HNKA 3C2QA 1Q1AA 1OC2A 3EA4A 3HA5A 4X90A 4AN1A 5KUTA 4HFJA 4BCCA 2JJ1D 1YQTA 3CF2A 2XNKA 4CLXA 3R9WA 2PT6A 3AIMA 1SMKA 1KPHA 1NJ2A 3DTVD 1GKYA 2RHRA 3FSGD 4EX6A 2XUIA 1E3SA 1WXWA 2CLEB 1Z25A 3FLEA 3TBHA 3EGCA 1V43A 2QR3A 3RRBA 2LV8A 3H8JA 2BFMA 2VT3A 5K45A 1WQ4A 4LXQA 5DTMA 2ZE5A 4E5UA 1EU1A 1RP7A 4OHBA 3QX7A 1QIEA 1W85B 3AT1A 2O52A 3ITNA 3ZIAD 4CDRA 1C1XB 2HLPA 4BFWA 4HDRA 1RAGA 1FMTA 1SOVA 5DTIA 4Z7NB 1CSEE 4DDHA 3IQZA 4LJ9A 3RDPA 4UE2A 3EYAA 3D59A 3O8BA 4M6WB 1TEXA 4HYQA 4HZIA 4K9DA 4Y6QA 1ZOIA 4AC9A 4B74A 2XE8A 4KIGA 2XZLA 3I76A 3CLRC 2OMKA 3ZDZB 1OFUX 2VPTA 1ST2A 1MX3A 2VHXA 4J7XA 3K9BA 4W1PA 1UC5B 3WGHA 2G6BA 1YDGA 2HCRA 3H5WA 4LMPA 4BFUA 1TB4A 3DE6X 1XN1A 5JTTA 2DHDA 1J07A 1G59A 3HY3A 3ACDA 3U7JA 2BFOA 1OXBB 3RSCA 2VDNB 1MAAA 3V6LA 2IEBA 4I2NA 4YJFB 4JJ4A 3Q5DA 1CBUA 2PZGA 3GLFE 2GXUA 1C9MA 2IIBA 4DYHA 2MSNA 3MFYA 3C8UA 1MW8X 3MJRA 1N3LA 5COBA 2E37A 4MS1B 1I33A 5J2TF 2WTEA 2WWWA 1RBMA 3NBYC 4ZVUA 2RGUA 1MORA 4IW3B 2E87A 3T7EA 4GE0A 5EJ7A 1DUSA 1M72A 3C8ZA 3V1NA 1W2HA 3J80A 1LKZA 3DZJA 1F06A 1T9CA 1LD3A 3VU0A 3ODGA 4AROA 3BSFA 2XNDA 3QOYA 3HR4A 1S4QA 3RVDA 1JRLA 3PC8A 5BSWA 1CDEA 2JFWA 4L0MA 4FIDA 4WVLA 4B7XA 1FF9A 5HSGA 1MAHA 1VP3A 3O84A 1C3EA 2CUTA 1P81A 1NJ1A 1Q1BA 5TX7A 3TTSA 3OLVA 2TMKA 1ODLA 1QOPB 4ZALA 3HBLA 5A5FA 2YINC 5F3RA 2FE4A 2BZ1A 3MT9A 4P98A 4E14A 1ULAA 4O4JA 2Q6IA 1R0SA 2D2FA 1GUZA 1QAOA 3KYDB 2ZIEA 2JVIA 1OT5A 1ZM4A 1AM4D 3A1UA 1KI1A 1NP3A 2VNKA 3DZFA 2Q6OA 1UBTS 2R7LA 2HC9A 2WNIA 3Q15C 1PN3A 4G26A 1O7JA 4HNAB 1RJGA 5M3BA 1QPZA 2V7GA 1T1RA 5ICMA 5F78A 1GPH1 2GBFA 4BBJA 2V7QA 3LPNA 4M9XA 3LHDA 4HDQB 2WYUA 1F2DA 3TRKA 1W0KA 1VIVA 3OQ6A 5JJ5A 3IRUA 2ZE7A 5IANA 2YVAA 2NP6A 1IHOA 4LAFA 3DONA 4E4YA 5I9TA 5ALVA 2RCYA 3IGFA 2Z1MA 1CS0A 3FDXA 2Q3JA 3JZDA 2JIMA 2VSOA 4ARVA 1RLIA 3CVUA 3W1VA 1KMHB 1SCUB 2DPYA 3ZLTA 2FF5A 1TM2A 1I7SB 4LJLA 2ZAIA 4HL6A 3WAJA 3RC3A 1AKUA 4N7MA 1B8PA 3FPFA 3L07A 2ACEA 4B6QA 2C8KA 4RA9A 3AFIA 1F2TA 1TD1A 6REQB 4UNRA 5TARA 5KTNA 2PWYA 3K09C 4I6EA 1YOVB 3EGIA 4RHXA 4Q3LA 1BFKA 1RPNA 2JGEA 3DS8A 2I4MA 1ZVMA 1EFCA 4WKCA 4CN8A 1N2HA 3NM5A 2MSWA 5AKZA 1F1JA 2Z56A 1W96A 4K9MA 4QD3A 4DR6B 4XEUA 4EBBA 2BTQA 3GXBA 4UBJA 5FFNA 1OZFA 1VSBA 1W0KD 2HFJA 4HKTA 3CIOA 3ZK7A 5BY2A 5JD6A 1CZOA 1UADA 4IS2A 1JU9A 4BC1A 1E9AA 2BEJA 3CPEA 1L7DA 4A5SA 3NUQA 4DIBA 2O59A 5TQ0B 3GLVA 4ZCSA 2PGXA 1NI5A 1WP9A 1X19A 3CTPA 3LYAA 1XQYA 3KQVA 2IEAA 2HEGA 1GKUB 1K9VF 4BATA 5JOQA 3G8YA 2COUA 2NU6A 1W4LA 2Q49A 3LK7A 2O07A 2FPOA 2W2PA 4XX1A 2ZRLA 3T1QA 2HZBA 4I8IA 5GGYA 3PJEA 4EG7A 2FWJA 1R9NA 4Y67A 4J2HA 1KZ6A 3CJTA 2HU2A 5EZYF 3IYLW 3U62A 5I4IA 1M7GA 1THGA 4WPGA 1SJ9A 2ES4A 1LVGA 4IFTA 4MW1A 3HYSA 4ALMA 4X9XA 2IT1A 1MR3F 4RAOA 3PIIA 4TL6A 5HFAA 1RWOA 2E6KA 1LH0A 1Z36A 1BJTA 2IHVA 2IPLA 3MC1A 4OHXA 1KZYC 1AMOA 3U7FB 3RVSA 3EVDA 1C9YA 3IJPA 1RLOA 5A3SA 1GTMA 1BKDR 2O1WA 1CD5A 2BGUA 4OJYA 5EFZA 1XI2A 3DOOA 3JD1A 5U1PA 2BCGY 5HZMA 3OZEA 1PQWA 5J59A 2YFKA 2C83A 2ZI3A 3NH9A 3GVHA 5DE3A 4OLBA 4LVNA 4QUJA 4C7MA 1M5UA 4MULA 4Y0AA 4LBYA 1KVRA 4LE0A 5DH9A 4QLOA 4CCSA 4GAEA 2UYQA 5JARA 3IXMA 3SFTA 1RQ7A 3HWSA 1VCOA 1GUAA 3EXG1 2AW5A 3MUNA 3PQ5A 5EIAA 5HIJA 1HG0A 3WGQA 2CGEA 3U80A 5BWNA 4RETA 1V45E 2GMWA 4G0NA 2ZWMA 1ECGA 4QWWA 4JLKA 1IN6A 1O6FA 1T8WA 3A7EA 2D4AA 3GOQA 3HXLA 4LI0A 2E21A 1S2OA 2Q5IA 4DA0A 1PNTA 5G3ZA 2EJTA 1JPJA 3G8BA 3IT1A 2ON6A 3EEQA 3IHLA 1HDGO 1H9AA 1LU9A 1ZHFA 2Y76A 1L0BA 3EIXA 1XUOA 1IEXA 1SQ0A 1EFDN 1UMDA 1Y9JA 3THWB 2O54A 1QIIA 1X1CA 2IW3A 4YRQA 1PEKE 3TZCA 1FJHA 1W8IA 3KFLA 1N7IA 3L6DA 3VU3A 1T5LA 2PGAA 1RYBA 3O9VA 5AESA 3ZTWA 5HKOA 5JCOC 4CLHA 2C9ZA 3SD7A 1NPTO 1F38A 2YY5A 4EYOA 2QM8A 3PFHA 4TSKA 4XFJA 1C80A 2FLKA 2WJYA 1U2SA 1W29A 4QGFA 4NEQA 3FDIA 1VIDA 4EMSA 2QBYA 4LNUA 2GHTA 4Q4LA 1LLQA 5CFNA 2BT4A 4RTLA 1P61B 4JR2A 5A04A 4UCQA 1DEHA 1JEOA 2VXBA 3BGWA 2PUVA 1NVGA 1VE9A 4PNZA 1L5LA 2H4ZA 4BNVA 4GXNA 1NASA 4XYGA 3CLSC 4U7WA 1U7OA 2WYVA 2CDNA 3G5MA 1GAWA 1CQJB 3LCVB 5DYIA 4EB6B 3C97A 3GJ6A 4TV9B 4HEQA 2HGSA 1UQTA 3KEQA 3KEGA 3WLIA 4F38A 1NQWA 2RJNA 1MPXA 5F5XA 1Y42X 2BFFA 3QE2A 4MVJA 3H11B 1W5BA 2C82A 4ZVLA 2QQGA 3Q3EA 1MP0A 4MRRA 1JAIA 1NJSA 3DOFA 4DWJA 1Z0DA 3JQPA 4J7UA 2WM9B 4RFLA 5JBIA 1BO6A 1R1DA 1VP9A 3C3BA 4D25A 4B7ZA 4IY1A 3GGDA 1R66A 5JASA 2C9MA 1E3JA 2CHVA 4HLNA 3KSZO 1HE2A 4J7CA 1A88A 5AICA 5FI5A 3WO1A 1LPOA 1YT5A 2YJ6A 1KEZA 1GZ6A 2HF9A 5HIAA 2BLLA 4MYRA 1R8XA 1RQLA 5DO9A 4BTVA 4E4TA 2GJ4A 3TSWA 4BVAA 2CJXA 3WRYA 3DAYA 3PNBA 1C4KA 3ADBA 2B82A 1SZCA 1U2RA 1L7PA 3AFGA 3AFHA 1E6KA 2A57A 1FOEB 1L4GA 4V24A 1WMAA 3DOCA 1W44A 2COEA 5IH3A 2FW9A 4C7KA 2H1FA 4NENA 2AG1A 4GOXA 1K9SA 2C92A 3W34A 5FOTA 1LCIA 2DT8A 2MINA 3ED5A 4E5YA 1VMEA 3NMUF 4OH7A 2C7RA 1DAGA 2VDUE 3QPCA 4ZVMA 3JQEA 1RCUA 4D0GA 3FCUB 4MVJD 2V98A 3D6HA 2F00A 3PC7A 3RC2A 4HNGA 3AVQA 3CTMA 1C4XA 1U3UA 1FSGA 2HIHA 1PP4A 1H2BA 1YJAA 3PS9A 1VSVA 2Z2XA 3UZUA 1ULZA 4UZEA 2I6GA 4PG8A 3BMQA 3OTWA 1IDOA 3GLTA 3RASA 4Z8YA 5TJHA 2FEKA 3QEMB 1XVUA 5G0UA 3T3NA 4XCVA 4PCUA 4KIUA 4KLCA 1YBVA 1WY7A 4L8WB 4NU8X 1UKAA 2CWWA 3WSTA 4IGAA 2BRUA 3ZCTA 1QYVA 2WUDA 2XZTA 1YDHA 2DF8A 1T4GA 5ITSA 1GCIA 2P9BA 2PZFA 4MUNA 5HS4A 1R8YA 2C5FA 1PSWA 5IZCC 3GBPA 1XHLA 2HJHA 1M6EX 2RONA 1GM5A 2OAP1 1NN3A 2VUSA 4QGBA 3WLHA 3VI4B 3G02A 4FHDA 1T36A 4IDHA 1I9GA 1RYEA 3PITA 1EWRA 4KCGA 4KL8S 3LT5A 4MKHA 2RBGA 2WHPA 4MYSA 3RM3A 4A8PA 3OF3A 4AG5A 2Q3BA 4D9KA 2IUEA 5HDQA 4ILKA 4KGVA 5B12A 5KQPA 1WTAA 3A2KA 1YB2A 1E3WA 4JASB 1KQGA 1LZKA 1PS0A 4ON9A 3W0LB 4B81A 5LQSA 1UQUA 1OXTA 3FKSA 4BE7B 5EP4A 5L3VA 1FXSA 1M1NA 1I5OA 3IAUA 4A1OA 1CF4A 3OG9A 1ACJA 2JIZA 2W9XA 4MGEA 3OPYB 4XX0A 1DEOA 1E6WA 1Q77A 1RHJA 1QR6A 3K1TA 3S28A 3TKAA 2B20A 1P2TA 2V7UA 5FFFA 3UYKA 2P8JA 4AZSA 4U2FA 1NM5C 4CV1A 3UMMA 2JKVA 2O2XA 2XWBF 4U3JA 1DV1A 4ILEA 4JBHA 1VPDA 4JYPA 3UUWA 2ZYWX 3GLRA 3HRHA 1YS4A 4JBYA 5I7RA 3EZNA 1NZDA 3QBTA 2JFOA 3P9SA 3BDAA 2JIRA 3QA3E 4RVSA 1V8OA 2Y9MB 3AYZB 3KZCA 1WSAA 4NG4A 4RL4A 2PLNA 2WJHA 3I9NA 1GZHB 2FUG6 2C3PA 1XEWX 2JAUA 2B4QA 3DMFA 3Q40A 5TPWB 1G16A 4O8ZA 3RS2A 2WF7A 3OWHA 1KKLA 2YWRA 5JEDA 5K99A 1LV8A 2OQ2A 3F5SA 2VF4X 1CY2A 1ODSA 4KE7A 1UMBA 2AIRA 3QVXA 3MZ0A 3H5LA 1E99A 4UEQA 3H04A 4BFSA 6Q21A 3VHXB 4OK6A 3DNFA 4PZZA 3TMAA 4E5NA 4ERNA 2UXCB 4MMYB 1SY7A 1VYTA 2JIZD 2NO6A 5K3EA 3G59A 3QYPA 3E9YA 1EIZA 1MQ8B 4JJ7A 4RD4A 2PDAA 1QHSA 3ZWWA 2GPJA 1PZGA 3QP9A 4JT4A 4ZT5A 5LQAA 1IULA 3MN1A 1GITA 2A59A 3K0KA 5ERGB 1XZMA 4PO1A 4Y2RA 1GT91 3QLTA 4Q16A 3H1PA 4FONA 2ZB2A 5JRZA 4CEIB 5BWCA 4IWXA 2EGGA 5LJIA 1ZITA 3RK4A 1NLYA 2CKDA 2PAAA 2XW6A 1X74A 1HEUA 5DFAA 1CVIA 1I1OA 5E8RA 3W6UA 4B4WA 4IBOA 4JA0A 5C2JB 3R20A 3VISA 2ZJ4A 3A4IA 3MT8A 3A0RB 4TS3A 1ODIA 4JV5B 1DAFA 4W6ZA 2C5AA 3DNPA 3OSZA 2EJWA 4K6GA 4DBLE 1MVNA 3NO4A 1PHRA 2JCSA 3E3NA 2HHCA 3LA6A 1TM3E 3SP1A 5KVVA 4NQZA 1GPDG 5ITWA 1YO6A 2ZIXB 1U0LA 4D3DA 5IF9A 4FGLA 2EP5A 3BB3A 2Z04A 5JCPA 1J0EA 1BN7A 1G8YA 1LRJA 2H17A 2R11A 3FUWA 3KD2A 5CLLA 5AW5A 4MA5A 3KL4A 3ZCPA 3KXIA 3REQB 4BGVA 2O2HA 4BKUA 3SS7X 4CKWA 3PFKA 4MWSA 5CB4A 3DLHA 5AK6A 3FMPB 4MTCA 4ZZ1A 4OA8A 3U9LA 3TNLA 3LW7A 1IU9A 1NXOA 1BWSA 2VP5A 3FGPA 3GJ8A 1NV8A 2YOGA 4NQRA 5ALYA 1TADA 5EPEA 1UAGA 1K4MA 2FN9A 1OAOA 1ZCAA 3D81A 1E1DA 3KR0A 3L79A 4H1TA 4LYFA 4N8SA 5A6SB 3EISA 4DIDA 2PX3A 4Q3DA 4C4OA 4TXHA 3AEXA 1VBMA 5HGJA 4ZHQB 3D8TA 5AK4A 4DBVO 4X1IB 1ZUHA 2C3YA 2WA1A 3C1UA 5FPYA 1G8JA 2XCRB 1LTQA 4Z3DA 3LUDA 3QU4A 3VR5A 2HXSA 3TO5A 2XXAB 3CA8A 1FX0A 3CNOA 4F1WA 1F0NA 1YJCA 2XD9A 1C7IA 4FWIB 1ZNWA 3U26A 1J5PA 3B48A 4LCJA 4TX1A 4V3BA 1ADGA 1K0UA 1K7SN 1QC5A 1ULUA 3AHCA 5DNVA 3SLKA 5BYAA 4HR7A 4C0LA 3ESDA 3PC6A 3QEOA 5DNAA 1B14A 2A2ZA 2Q1WA 4AJEA 4EPRA 4PN7A 1ZK2A 3FUXA 3OZSA 2WPDA 2WUGA 3K8QA 2ICAA 3NVAA 5T57A 1R0ZA 3KTDA 5EIBD 2IYPA 3WTCA 1UP7A 4PFKA 4O4HF 4EGSA 2LKCA 3MPUA 2Q41A 4M8SA 3T3PB 3P2MA 1AT1A 4MZDA 4UFNA 5DULA 3AW8A 4MB0A 1OFTA 4HYEA 4OQZA 3SGLA 3VO8A 1JTEA 1SVMA 2HX1A 5CVDA 1U0TA 3EPRA 1P91A 5U4XA 1GU1A 4QVGA 1PX2A 5K0EA 3AXSA 3ZBTA 3THOA 2FW1A 2D7DA 1W85A 1ONSA 2JJ8A 3LT2A 5LZ9A 1C1XA 3P32A 3U6KA 2MR5A 3CUVA 2CFSA 4EX7A 4K6HA 1RJEA 2APJA 4MVWA 2Y66A 4NMLA 2V7TA 1CIJA 2AYXA 3A9TA 2VRNA 5THKA 4M6WA 2OORC 1YD7A 1QGAA 4UBKA 4NZNA 1JDSA 2JK0A 4TYQA 3ZTTA 3CUEF 4MPTA 3M5DA 1KO4A 1XXHE 4ENUA 1P5HA 4CKYA 3C3WA 4LJ8A 4MAFA 1TT5B 3T4PA 1SWVA 5BXQC 3KSDO 1LFAA 3NRJA 3FE2A 1DCTA 2D6FA 4L4UA 1S3IA 2QSJA 1R6AA 2WPDD 1U1IA 4BCBA 3COPA 4FFRA 2MYNA 4B2YA 2DQSA 2H51A 3ENWA 4QICA 1E7YA 1N2CE 4G8BA 3DBVO 4YJFA 4IXMA 5ICFA 3ZCVA 4Q1DA 1H0HA 1TYZA 4CL2A 2WJVA 5AW1A 1QHHB 1TVKB 1IXZA 4X0EA 2P7HA 5E4FA 2I6QA 4LPSA 3NRCA 4KZKA 2BWJA 1XTRA 4DAOA 2C2BA 4MS1A 3OEHA 4D6PA 3AM1A 2ERXA 5IKMA 3RVLA 1H4VB 3KZ1E 5FV4A 1IZ8A 1XAHA 1Q1QA 5HMLA 3UYLA 1P9LA 2QN1A 2DLNA 3D0QA 3PDWA 5DI9A 4GXRA 5DLDA 1TTTA 2O0KA 7YASA 5E95A 4DJFC 5KYXB 2IU0A 3TSYA 1I6MA 3OO0A 4DCTA 1HMPA 1HK7A 1LSOA 2A1UB 1GQFA 3PPIA 2BGWA 4KFCA 1EK0A 1F6WA 1J97A 4GP7A 1IOVA 1H4TA 2FPPB 4DC1A 1PK7A 1ZRSA 1UMCB 3HU2A 2QTLA 2CLHB 4IOJA 4D4LA 5EPOA 4ZTBA 3MERA 1EDDA 3ZJYA 2PL9A 5AI6A 3I1IA 1SKBA 3IUNA 5KHOC 4J0GA 1Z7WA 2Y0DA