1JG1A

Crystal structure of l-isoaspartyl (d-aspartyl) o-methyltransferase with s-adenosyl-l-homocysteine
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
215
structure length
215
Chain Sequence
b'EKELYEKWMRTVEMLKAEGIIRSKEVERAFLKYPRYLSVEDKYKKYAHIDEPLPIPAGQTVSAPHMVAIMLEIANLKPGMNILEVGTGSGWNAALISEIVKTDVYTIERIPELVEFAKRNLERAGVKNVHVILGDGSKGFPPKAPYDVIIVTAGAPKIPEPLIEQLKIGGKLIIPVGSYHLWQELLEVRKTKDGIKIKNHGGVAFVPLIGEYGWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein-L-isoaspartate O-methyltransferase
publication title Crystal structure of a protein repair methyltransferase from Pyrococcus furiosus with its L-isoaspartyl peptide substrate.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase
total genus 70
structure length 215
sequence length 215
ec nomenclature ec 2.1.1.77: Protein-L-isoaspartate(D-aspartate) O-methyltransferase.
pdb deposition date 2001-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1jg1A00
1QYRA 3KQQA 5ICCA 5FUBA 5DTRA 3IYLW 3ORHA 3M6WA 4E33A 5IKMA 4CTJA 3EVFA 1QAMA 3PFHA 3TOSA 5K01A 1VPTA 2FK8A 4GQBA 1KP9A 2ADMA 2AOXA 3HCAA 5H02A 5DWQA 3BKXA 3R3HA 3THRA 5GOZA 2H1RA 2JH8A 2VP3A 1ZKDA 3EGIA 1WG8A 2HTEA 4KRGA 3TQSA 5LQRA 4MHTA 3EVCA 1R8XA 3PT9A 3R0QA 1YZHA 3HNRA 4PYKA 4BLWA 3ER8A 2ZFUA 1EJ0A 4GOOD 3FPHA 3P8ZA 2AOWA 2B25A 2Y1WA 3P9CA 2GLUA 2ZIGA 3LKZA 3UJ9A 1PJZA 2EJUA 4LECA 1SG9A 1UFKA 2ONZA 2PSSA 4KIGA 2FRXA 4EKIA 3LCVB 5DTMA 4RTOA 4LWOA 3I58A 1Q0TA 1HMYA 1EQAA 5EMKA 2HWKA 5F2NA 5DXJA 4C08A 2JHAA 3KR0A 3OE4A 2DULA 2CMGA 3ERCA 4KDRA 5FA8A 5CCXA 4RTPA 1YF3A 2PLWA 5C9ZA 3SSNA 4AZTA 4HGYA 3P97A 2P7HA 4FSXA 5KQRA 1VQ1A 2IDJA 5F2KA 3UWPA 5HIKA 1JG2A 4CXMA 4DF3A 1EIZA 4PINA 1QANA 5DM2A 3GRYA 1TW3A 3LHDA 2C7PA 4M37A 1IXKA 3KHKA 3KKZA 2WA2A 4DMGA 4E2YA 4KIFA 4R05A 4AZVA 5EHGA 4C4AA 2V74B 3R9XB 1YFLA 4OQEA 4RTQA 3LDGA 3EGVA 4GBED 1ORIA 2BR5A 3JWGA 1NW7A 3KQTA 5E1BA 5FQNA 5LQKA 2I7CA 3O31A 1XCJA 5FHRA 3SX0A 4F86A 4RYLA 4KW7A 1RJGA 5U4XA 3AXSA 1G55A 3CKKA 3I9FA 2VDUE 5LQCA 4KDCA 3EVZA 3HM2A 5M5BA 1MJFA 5K09A 5LQUA 5DM4A 1L1EA 1D2GA 3KPJA 3CGGA 5E1OA 3UJBA 4DKJA 1P91A 4QQNA 3NWEA 2CMHA 5EMMA 2AOUA 2UZ4A 4HTFA 1G38A 4GF5A 5CVEA 2QYOA 3DMGA 2ZIFA 4AZSA 1IY9A 5HZMA 4YUVA 3UJ6A 4XUEA 4A6DA 2Z6AA 3GRZA 4M36A 2FYTA 2EG5A 2AS0A 5DRTA 3AY0A 5DTQA 2C7RA 1PRYA 4CKBA 4PYJA 3MAGA 2XYVA 4GOND 2PV0A 5DXAA 1JG1A 3BXOA 3KR9A 4OBXA 5HFJA 4BLVA 5GINE 2VDVE 5K0BA 1XXLA 4RTKA 8MHTA 4MWZA 4P7GA 3KR2A 3SR4A 5EPEA 1R00A 2PXAA 3OU7A 4YV0A 4HH4A 1JQEA 2YQZA 3B89A 1RI5A 4Z2YA 3KQMA 4YUXA 1G8AA 2P8JA 1KPGA 3GXOA 5CVVA 3EEYA 4PONA 4Y2HA 4ZTBA 3UJDA 5CIYA 1BHJA 4X63A 4MTLA 1O54A 3DXXA 3MB5A 5HIIA 1KPIA 1HNNA 4RTMA 1R8YA 5FTWA 1VLMA 4HC4A 2DPMA 4FS8A 3LL7A 2GA9A 5DT2A 3GRUA 3HCEA 4EK9A 1XCLA 3DULA 4GOMD 4U7PB 3TR6A 2F8LA 1SKMA 1JG3A 3HCFA 2Y1XA 2JG3A 4OA5A 5K0FA 1X19A 2N47A 3T7SA 5IH3A 3PX2A 4RV9A 3X0DA 2PJDA 4YUYA 1NW5A 3NDIA 1VL5A 1ZHFA 3NVMB 4RVFA 4ER5A 2NXJA 3IHTA 9MHTA 5DX0A 1JG4A 3E23A 1EJ6A 3HTXA 4X61A 1U2ZA 1NW8A 2IH4A 1NV9A 1FPQA 3R6TA 2P1DA 1VIDA 3BWMA 4M7RA 5LQAA 3AWIA 1F3LA 3ANXA 4RTJA 2AOUB 2AR0A 3QOXA 3SM3A 3JWIA 1L9KA 4HTFB 3GJYA 3LDFA 3OU2A 3UJ8A 2VZ9A 2A14A 4HG2A 4C05A 5JR3A 5FWDA 3A7EA 2QRVA 3P2EA 4V0QA 3UZUA 2OY0A 4P58A 4EVIA 1RI1A 2QM3A 1VBFA 3KU1A 1ORHA 2B9EA 1WY7A 1X1CA 2G72A 3KPYA 3MTEA 5DLYA 3FRHA 4HRAA 4QQKA 5T67A 5ICGA 3HP7A 2BM9A 4P7FA 1KYWA 1WS6A 5K03A 3MCZA 1NBHA 4MIKA 2AN5A 4RTLA 1BOOA 3ELYA 2XVMA 3FUXA 2BR3A 3A4TA 1TW2A 3DLIA 3FPFA 3MCTA 4HGZA 4NECA 2R6ZA 1G8SA 2ZZNA 3PX3A 4PYIA 5EZSA 5HOQA 4F84A 2YXDA 2O05A 2P3LA 5EIWA 3TPZA 1SUSA 1L3IA 3BGVA 4P7KA 3GCZA 2UYCA 5LSAA 3UA4A 3K6RA 3FZGA 5JUWA 3BWYA 4FSDA 1NW3A 4PYNA 3G5TA 2P40A 3A7DA 1ZQ9A 3A26A 4F85A 3P9KA 4CKCA 3B5IA 3OFJA 4FR0A 2FPOA 3PTAA 5E9WA 3BGDA 4O29A 4XCXA 5CM2Z 4IV8A 4CTKA 4IKPA 2GPYA 5E8JA 4EMSA 3NVKI 1QAOA 3V8VA 4GEKA 3MERA 2V7EA 3QV2A 3SSMA 5E9JA 4B17A 4R6XA 4C06A 1NT2A 3UJCA 3SXJA 3LSTA 2H00A 1SVUA 1X1DA 4DQ0A 5CD1A 1O9HA 3KQYA 5C1IA 2GS9A 1X1AA 3KPWA 4QVGA 5T6BA 4K6MA 2I9KA 2NP7A 2UYHA 1BC5A 4YMHA 2IGTA 2B78A 1RJDA 3G2OA 3RIEA 5FWAA 3TFWA 3G8AA 1NW6A 1P39A 1I9GA 3BKWA 3EPPA 1G6Q1 1YB2A 2PX4A 2P3OA 2ZLBA 2QRVB 2Q41A 3LBYA 3P2KA 4H0NA 5EEGA 4GC5A 3G5LA 3TM5A 2IBTA 2LD4A 2OB1A 3GIWA 1VP9A 2PT9A 3I5UA 4ATNA 2AVDA 1JQDA 2BZGA 4C03A 5K0GA 3LBFA 5DSTA 3ELDA 3ELUA 1FJXA 1KIAA 4YUZA 4E70A 3NWBA 4PYLA 3NJRA 1Z3CA 3A25A 3BWBA 1B42A 2ZZKA 5EKXA 2P7IA 1I4WA 2AVNA 2JJQA 2OO3A 1NBIA 5BW5A 2ZZMA 2PKWA 1TPYA 3CBGA 4PGGA 4BLUA 5CUQA 2AOTA 5B1SA 4PNEA 3CCFA 3LECA 4EKGA 4YUWA 4OA8A 5ICEA 1RI4A 4AUKA 3EVAA 1EAMA 1VE3A 1ZG3A 5FA5A 2FK7A 1UWVA 3B3FA 4YV2A 5K0EA 1R18A 4OX9Y 5LR6A 3EVBA 4RSRA 4ER6A 3TKAA 4E32A 1N2XA 2ZSUA 1FP2A 2AZTA 2PXCA 2VS1A 2G1PA 4PWYA 5GP1A 3FUWA 3HCDA 3LCCA 2YVLA 2ZWAA 5HEKA 3SMQA 4YMGA 5KQSA 3LKDA 3OPNA 5DX1A 3TM4A 3FYDA 3SGLA 1BKYA 3BUSA 5T64A 2HV9A 2C7QA 3NTVA 5GM1A 2PBFA 2IBSA 3HVKA 2FHPA 4GOLD 4PCLA 4QTTB 3DOUA 1YFJA 3FUUA 2ORED 4X41A 2NXNA 3RODA 2ERCA 3LGAA 3B3JA 4L7VA 3T7TA 3BZBA 4M38A 5CVJA 1AF7A 3P9IA 4G56A 3EMDA 1DL5A 2O0LA 5HIJA 3TMAA 4BP3A 5ERGB 5DPMA 3DUWA 2EJTA 2PX5A 4QTUB 2BR4A 2BH2A 3Q87B 1NKVA 5EG5A 3UJ7A 2ZULA 1VP3A 2CKDA 4E31A 3FYCA 4R6WA 1JTEA 4QVKA 5FHQA 4FT4A 1L3BA 3ELWA 5HIMA 3KQWA 3FPGA 2WA1A 3CC8A 3FTDA 4C04A 4QPNA 2PWYA 3HVJA 3OU6A 3UJAA 4BP1A 3T0IA 3JWJA 4V0RA 2VDWA 3DMFA 2CL5A 4HSGA 3P71T 3E7PA 4DM3A 3NW9A 4E2WA 2H11A 2PXXA 1AV6A 3KQPA 1Q0SA 2PVCA 3DR5A 5LQJA 2AOTB 5K0CA 3UBTA 4EQZA 2HR1A 3D2LA 5K0NA 3O4FA 4RTSA 1QAQA 5K8VA 3C3PA 3MHTA 2JH9A 2IPXA 3DXZA 2XVAA 3Q7EA 2UYOA 5C0OE 1N7JA 5BXYA 4XUCA 1XTPA 5BP7A 1KHHA 1SUIA 3FPEA 4UOEA 5MHTA 1KYZA 1XJ5A 2EX4A 2IH2A 2B2CA 2QY6A 2YXLA 2Z6UA 3EEOA 3FRIA 2OYRA 5KVAA 3JWHA 2ZVJA 2IH5A 1UIRA 1WXXA 4R8RA 4POOA 5E2BA 4RTNA 2HMYB 3BT7A 1RI3A 4PIMA 2GH1A 1DUSA 1G60A 5EVJA 3IV6A 4QDJA 4AZWA 1MHTA 2OXTA 5F2OA 5E8RA 1FP1D 1JSZA 3HCBA 3T7RA 5EZQA 4E30A 2UYQA 5LQNA 2G70A 1AQJA 3CJQA 3SSOA 1XDUA 2YUIA 3P2IA 3FTCA 2OKCA 3E8SA 3M70A 1YZ3A 4BY9E 1P1BA 1XDSA 1ZGAA 3HA5A 4RVHA 3LPMA 1V39A 2R3SA 3G2QA 3GRRA 4DZRA 2ZCJA 2ZBQA 2ZIEA 2AN3A 2YX1A 3B7PA 4PCAA 1Y8CA 3DLCA 3OCJA 1M6EX 1SQFA 3MGGA 3FUVA 5E1DA 2B3TA 3H2BA 2ZTHA 5DRYA 2I6GA 3K0BA 3LX6A 2OZVA 3DP7A 3KQOA 1L3CA 4GC9A 5CVUA 1D2HA 3EVGA 3C6KA 3KQSA 3M33A 4AX8A 3HA3A 4LG1A 3VSEA 2ZW9A 1R74A 5BW4A 1DCTA 5EEHA 3DMHA 4KWCA 4RVDA 2E5WA 3FTEA 3FUTA 2G71A 3GRVA 3PB3A 2EFJA 3ID6C 5K0JA 5KYGA 4XUDA 1ZGJA 4C07A 3HEMA 3NMUF 3VC2A 1KPHA 5DSXA 5DM1A 1SQGA 3TRKA 1I1NA 1JTFA 3C6MA 3O7WA 2ZWVA 2Z6QA 3EGEA 3GO4A 3PFGA 3V97A 2GAFA 5EIFA 2PY6A 4IV0A 3LCUA 1P1CA 2OB2A 4PYMA 1WZNA 3MTIA 3EVEA 4QPPA 4OBWA 3BWCA 3M6UA 2NXEA 4MQ4A 4IWNA 4E2XA 2NNWB 5KS2A 3A27A 3THSA 4JXJA 2ONYA 4A6EA 4ER7A 3BGIA 2P41A 3GNLA 3PS9A 5FCDA 2YXEA 3AJDA 1WXWA 5K0LA 3R24A 3CJRA 3G2MA 5E2AA 2OPBA 3OFKA 5EC8A 4X1OA 3RW9A 5K05A 3AXTA 3TLJA 4DCMA 1OR8A 1X1BA 2P3QA 4WXHA 5EOVA 3ME5A 3SVZA 1XDZA 2IDKA 3G7UA 1YUBA 4RX1A 5D1NA 5GIPE 5GM2A 1JSXA 2IIPA 3I53A 3OZTA 3GU3A 5P8WA 5EHIA 2BM8A 3C3YA 1M0EA 1RJEA 1NE2A 1KXZA 1AQIA 1T43A 1F38A 1RI2A 3M6VA 4GUAA 3C0KA 1O9GA 3I64A 5EGSA 3GGDA 3GDHA 3IEIA 4R8SA 5E9QA 2O06A 1NV8A 4ISCA 4PGHA 4FP9A 4PYQA 2WK1A 4KVZA 4RVGA 2ZBRA 2JHCA 1D2CA 3OZRA 4FT2A 2QE6A 5EQJB 3KPUA 3KQVA 4CWAA 3G8BA 3M6XA 4YV1A 3L8DA 3PLAE 2KW5A 2PX8A 5HILA 3EMBA 3GWZA 3QOWA 4RWZA 4DA4A 3F4KA 4QDKA 5G02A 1EG2A 1KR5A 1R6AA 5GWXA 2CWWA 4LWPA 3EVDA 2NXCA 2AN4A 3LDUA 1FBNA 2JHPA 1H1DA 4U7TB 3G2PA 5EKUA 5FQOA 3UFBA 5EMJA 3VC1A 2OBFA 3G89A 2XYQA 3MQ2A 3WSTA 4FGZA 2NP6A 3REOA 3PVCA 2I62A 2K4MA 3TKYA 3DXYA 4OQDA 2P35A 4WVLA 4E2ZA 2C7OA 4PYOA 5D1HA 3UA3A 2PWPA 2YR0A 2AOVA 10MHA 2YTZA 4RTRA 4CKEA 2G8NA 2ZBPA 4X60A 3DH0A 3G88A 4P7JA 3FPJA 3U81A 2IFTA 3NDJA 2XBMA 7MHTA 2NYUA 2XYRA 1M6YA 3E05A 1XVAA 2PX2A 3ER9A 3HA7A 3HCCA 2PGXA 3OZSA 4Y30A 3KR1A 2ESRA 5DX8A 5FULA 3VYWA 5FADA 3FTFA 1QZZA 3KPVA 2IP2A 3CVOA 3HVHA 4DCGA 1JQ3A 1N7IA 2HNKA 3OE5A 1IM8A 5GIOE 5CCBA 1JR4A 3HVIA 5E1MA 3S68A 3B3GA 2O57A 2GB4A 5ICFA 5DM0A 4FZVA 5EMLA 4ER0A 3M4XA 3P9NA 3CJTA 5CVDA 3DTNA 2FCAA 1INLA 4PIPA 4ER3A 2O07A 1RJFA 2PT6A
chains in the Genus database with same CATH superfamily
4EI7A 3VVBA 5ITWA 2CXNA 5J23A 2JFHA 3GFVA 4CTJA 3G0CA 3FPSA 4X3PA 5DE3A 2J46A 4RFVA 1KP9A 3HADA 4TRJA 1EWTA 1CUWA 1YI8A 3COPA 4JEIA 5AI5A 4F38A 5ADWA 2Y0PA 4KWIA 1KH1A 2PRJA 4PX9A 3A1CA 1A04A 5EAIA 3PT9A 4MHTA 1E2DA 1PD0A 1YZHA 2SHKA 3BMOA 1QDEA 2NPIA 1F4PA 3NGXA 4R9SA 3BMQA 3CLRD 4PTYA 2O1SA 4AUMA 3P9CA 4MWDA 4XIGS 2GLUA 4BWYA 1H1TA 1C7JA 3M9XA 2XKBA 2DUWA 3IB6A 4X7MA 1JIUA 5TQ2B 1N6LA 2B4YA 2YYSA 4J3FA 3ONFA 2IUUA 3P32A 1NX9A 4N12A 3FHLA 1JJFA 2FN7A 1O3YA 2YYYA 2V7UA 2REOA 3IA2A 4FLFA 3TQIA 621PA 3NWOA 3TIIA 1N6NA 2OV3A 3G7NA 4M0DA 3TSAA 3ZEAA 1G2QA 3EE6A 1DAFA 4PNZA 3VTKA 1WVMA 2YV4A 3QUCA 3P97A 5B2FA 1ZCJA 4H4DA 4RK7A 2HK8A 1EVLA 4JI3B 4CN8A 1QZTA 1I4OA 2A94A 4F04A 1GQQA 1H3EA 4IVQA 3TUIC 1RLMA 2D2FA 2PXHA 3DBIA 2YFKA 4H6PA 3KKKA 5NULA 1KDYA 1CS0A 3H9CA 3ON5A 4AZVA 4DIEA 2WABA 4MWOA 4YWHA 2QX7A 3NFYA 1CY7A 3LDGA 3WQRA 1QO0D 1YIAA 5L3QB 1UKVY 2ZUWA 2R8XA 1ZXBA 3V00A 3DQQA 4HWPA 1Z2NX 4U6NA 4ZOLB 4BLQA 3ZG6A 5DLEA 2DPXA 3F6EX 2C59A 1FVFA 5JWOA 2FP4B 2C88A 5ALGA 5EE1A 4D9HA 5KB3A 2HGZA 1C7ZA 3X2EA 3CT4A 3TFQA 1OPXA 3VR4D 2GNOA 5H0IA 3UJBA 2HZ7A 3PHCA 4WXPA 4Y1FA 2A0KA 2CNKA 3FJOA 3OE7A 1Y4SA 3EEBA 4H31A 4JJKA 2CMHA 4E51A 2ONKA 1KE1A 4QGSA 3GPBA 2JFOA 3K1AB 1M74A 4JJ8A 1X3LA 4QPDA 2HRBA 4CUKA 3EWSA 1BS2A 3M81A 5G0WA 2XD9A 5EPUA 4B33A 5EUQB 2XZDA 3QXCA 4JZYA 4A9AA 5DSZA 4V0NA 2QR3A 1J09A 2J87A 3RUPA 4IWYA 2WSLA 1ACLA 3DC2A 3E22A 5DTQA 4YT5A 2ODTX 4QSHA 2BEWB 3IDSA 4CKBA 2XYVA 1ZY2A 3OZDA 4PYJA 1EB9A 4ZARA 3BL6A 1NBOA 1NC3A 1U2TA 1XXLA 2Q3HA 3DBLB 1PQ4A 4LOIA 1JWLA 4R0MA 5IC6A 3GLKA 5B3JC 1N2IA 1P60A 1Q7TA 3THYA 1OIVA 1JPVA 3MLEA 3R77A 1QZ3A 3TZHA 3FHTA 1KF0A 3KU4A 3DDSA 3FFBA 1ES9A 1KPGA 1WB5A 1SBIA 2IYUA 4FU0A 3LUHA 1UH5A 1M9NA 5E2IA 2ZJOA 1DAGA 2P5UA 4TN1A 3NHYA 4PW0A 5KX5A 1TIBA 2GZMA 3MN1A 4U8GA 4MCAA 4QFBA 1CHNA 1R8YA 2ZJBA 3RBZA 2WIKA 3JVVA 4HC4A 4BO0A 1MENA 1Z18A 4XYLA 2DGDA 3HJNA 3DDHA 5CT5A 1A1VA 4OLHA 1ND5A 3S1SA 3VRHA 3G17A 3SJ7A 3VU0A 3OLXA 2YNMA 3BIFA 3W6NA 3H5NA 3HB0A 1QDUA 1F8GA 1XMXA 2LPMA 2VHUA 3H4TA 4EFKA 3MAJA 1BDJA 1PVVA 4KIUA 4ARUA 1PKEA 3OC6A 1RWPA 1JPNA 2GO7A 5KOYA 5FL7D 1YQEA 2FN4A 1IUPA 2QD3A 1M10A 2ZOSA 5KDDA 1EX7A 1VYVA 1RMTA 1VIDA 4M7RA 3JD2A 3A2LA 5EIHA 4DJFC 1KQNA 1T3ZA 2FX2A 1X7GA 4HI0E 3RYTC 3QOXA 4FC7A 3PKIA 1YTUA 2VAVA 5BMOA 2VZ9A 1RWQA 4HG2A 1HC7A 1BGWA 2AUMA 2I8LA 3FDZA 3ODGA 3P96A 4L8YA 2QRVA 4OLBA 2Q6LA 4KCGA 3NDBB 1BKDR 1E1KA 1V96A 5CEJA 1QQTA 5HGJA 2C4MA 2P9ZA 1OIWA 3EYAA 1P3JA 1CR6A 2PZKA 4ZTZB 3KEFA 4LMAA 4NFHA 1GN9A 4IDFA 2XXAA 1GP2A 1ZD5A 3H9UA 5ALFA 1DXOA 4FI3C 3MWEA 1I2CA 3BAZA 4C1BA 5DHPA 1SVOA 2HMAA 3I8OA 4FKBA 4IIEA 3ETNA 2GSWA 4H77A 4RTLA 1Y8QB 2FPPB 1TW2A 1FP4B 4OL0A 2ZREA 3S2YA 1SQ5A 2G9RA 1VL8A 4KGVA 4KLNA 4P3OA 3WI7A 3U40A 1DAMA 1V4BA 2HNBA 1AGNA 5IDXA 1DBQA 5K4HA 1SXJD 2CXXA 1UZMA 2O05A 2GVZC 1XTTA 1V4NA 3RYIB 2ZTVA 3OE1A 4P7KA 4BUJA 5D87A 5SZKB 1DBRA 1SVMA 1B0UA 1NJ6A 3NH6A 5KYNA 2O19A 5HP4A 3UA4A 1XMJA 1BCSA 4GR5A 4DGQA 1FNCA 1OWPA 4U0JA 1A71A 2HNAA 1TCBA 1Y3BE 3Q12A 3KZMA 1HI9A 4MS3B 4NJMB 4DEVA 4ZOQI 2CF5A 1J33A 2VUTA 4O29A 1ZUD1 4L4UA 4YRBA 2C61A 2CJYA 3UKJA 4IHJF 3JAKA 2N46A 1EFVB 3K73O 4P8RA 3P4XA 4K86A 2RGXA 4G0VA 1DAHA 4CGZA 1B93A 4G84A 1QF6A 4OHKA 4Q3EA 4D80A 4TQAA 4DWJA 2VF7A 4MZDA 1HNZB 1JA1A 2GS9A 2JD1A 4WLFA 2UVPA 3ENVA 1XLWA 4UXJA 1BXRB 1OT5A 2HUPA 4TTPA 4Y7CA 1LBEA 1GQ2A 2JANA 3CB4A 3L0BA 4CEHA 4JSYA 4BASA 5J1SB 1YMQA 4GC5A 1WY5A 4M1KA 3CX7A 5E4FA 4PC6A 3JALB 2AZXA 1IDN1 2CNOA 3EXHC 1QHFA 4CJXA 4C03A 2X9VA 4P22A 5DHAA 3STUA 1WPXA 3QXXA 2I6UA 3INTA 4G81A 4A7PA 4QJIA 4PYLA 1Y7IA 4A92A 4X94A 1WZIA 2H1SA 1I4WA 3HXKA 4S2UA 5KTOA 3E48A 4I99A 3BHMA 4XRRA 3AI1A 5D01A 5CUQA 2G28A 3I6BA 5ALIA 2UZ1B 4GG1A 1F2UA 1HDGO 2J32A 1UEIA 4IIUA 5AK6A 1GL6A 4XAQA 1NW9B 2JI9A 3DP9A 1ID8A 6LDHA 5L3SA 1XD2B 1H2FA 2P6NA 3B3FA 3R7WA 5EJ6A 1ML3A 1MG0A 3D81A 4K9MA 3U7JA 2Q5JA 4M7PA 1DQRA 1QE5A 1LPBB 1NAIA 4IJ6A 4YH1A 3BE4A 3W1WA 4BVKA 2QRGA 5FV4A 1X0XA 1REQB 4BKPA 3FCYA 4AN0A 1PFUA 4ETNA 1Q0UA 3LLCA 4QZVA 4Z53A 4EELA 3A2KA 1KEUA 2ZUSA 4G4GA 4N0MA 2OYSA 5T64A 4BMNA 4OK5A 3UOWA 3P9PA 4YRLA 1HFEL 3Q3HA 4ZWNA 4QTTB 4JR2A 2R8BA 2VUSA 5IUJC 4UOZA 2AG6A 4ZI7A 2GXAA 1RD4A 2ZT6A 3HH8A 3L05A 1WMAA 2PUBA 3DZIA 2QS9A 2O0LA 3DVAA 3F7TA 4HMPA 3KK0A 5K6TA 4PLGA 1HSOA 3TNYA 4D8YA 1VCOA 1GCAA 4QTUB 1U9CA 4ASUD 3ES9A 1ANKA 1VJ5A 4XXHA 3I6YA 4M0LA 5CB4A 1A7KA 4AAYA 3SK0A 4BVFA 4HMOA 4Y2GA 2VUHB 3UXHA 2G5CA 2HCTA 3FCOA 3KQWA 3A3OA 3SF8A 3CC8A 1ZMTA 4M1YA 3AEKA 3BSSA 1SXIA 2XH8A 3OU6A 2IYZA 2X8AA 4OHRA 2FMHA 1SD5A 2BEJA 2Q45A 5KDLA 3S99A 1YKGA 3ESXA 1BXGA 5TVKA 5GAJA 4HXGA 4LDPA 4IH9A 4DCOA 3NHKA 2XRFA 3D2LA 5P21A 4NBVA 3QGMA 1LEHA 4EY6A 5I9NA 1Y1KE 4E3WA 3DVSX 4RTSA 2O2JA 1YQ9A 4X5OA 2YCLA 3A6KA 4XGRA 4QU0A 3QY0A 3TJRA 2FRDC 4BQEA 3VHLB 2G9VA 3FY4A 5KINB 1KYZA 2HK7A 3OFNA 5C4GB 3RC2A 1N9GB 1G21E 2QSZA 4WY5A 2IH2A 4LHWA 2BTQB 1C0PA 1CUBA 2XQFA 1TAGA 5E6RA 2WRZA 1ZESA 1EM6A 2ZVJA 3KBBA 3KFVA 4KQ2A 1JAIA 4X24A 4C0BA 5BURA 2IH5A 3HLYA 1J0XO 3EGDA 3GWGA 3UTCA 3D6UA 4PLVA 4WBNA 2BUCA 4BGEA 3GA7A 2ZRNA 2GRUA 2H3HA 3JTEA 4NZ9A 4XYMA 3BQNB 4U7HA 4GGMX 4IIYA 3RU7A 4BO3A 1I9CA 1JTVA 4DRXA 2M1XA 5U9CA 1H3NA 4CUJA 5I47A 4WZAB 2X6RA 3W6UA 2EZ8A 2G9UA 4RIIA 4H6WA 3NHMA 2ZBVA 4JP1A 5ECYA 5HE9A 3AHCA 4GBJA 3CTPA 3S2IA 2I67A 4Q48A 1FEZA 2ZQ5A 3BQ9A 4DZRA 2ZCJA 2TS1A 1CUCA 3NOVA 3MJCA 4U02A 3J81A 1NR7A 1ENOA 1UFVA 1G3UA 2TYSB 1VKZA 2VZLA 3ZDYB 3OJXA 2NZVG 5DRYA 1YVPA 5HK8A 2IL1A 3GFRA 1U4NA 5EWJA 2IYWA 3I4CA 5L7YA 3TI7A 3W78A 4GKJB 1PG5A 1U2SA 4CBVA 5J2UF 2H5LA 1L7NA 2H06A 2GJ4A 2VO1A 3JQ9A 1OF1A 3ZXSA 2I8CA 3BL8A 4LCJA 2I7XA 1UDRA 4TMYA 4MUBA 3SICE 1Z6QA 4O1IA 3N58A 4CM5A 2QHXA 2XNDA 1TA9A 2X7JA 2Y1OA 1RM3A 1G5QA 2Z1MA 3HGQA 4E5DA 4OHXA 1B8NA 2ZWVA 4C4RA 2VWQA 4KP7A 1ZI9A 4DXHA 1HEIA 3O8QB 4NS1A 5ENVA 3LCUA 3V7NA 4AZ0B 4Y2YA 3SC4A 4C7KA 1OLOA 5BQFA 5T7BA 4O8CA 4ZCIA 2GPNA 4P92A 5SICE 3TDMA 1KYQA 1WF3A 1Z74A 4UHJA 3KRTA 3TQRA 5LOVF 1SCNE 1W47A 3ADPA 5AW4A 4L50A 3WLEA 4NPCA 4YAWA 4MAAA 2F8TA 5E2AA 1QYVA 2JAHA 4W9NA 4Y6PA 4GE3A 3OSUA 4ALNA 1M8PA 3LUAA 1A9YA 1I5RA 5I8ZA 2FFQA 1UC9A 1YR8A 3IO3A 3OZTA 3IULA 1V8PA 4QUBA 1XAJA 4AP9A 3RGGA 4BV3A 1TIKA 3WYCA 3AZPA 2VQ6A 1KORA 2E5FA 2W48A 3O9VA 1M6NA 1XMPA 3EH1A 4KXUA 5TF0A 3T1YB 1JVBA 4AWXA 1G0NA 1V8DA 3IEIA 5IS2A 2YDYA 1EFUA 1L7OA 4XFJA 2WK1A 3F74A 2LR0A 3LC2O 1E1DA 2ACEA 4QU9A 2VJQA 1LWNA 3TW6A 1L5QA 2BV3A 3PIRA 2D0DA 1YU9A 2VT6A 2OGTA 2KW5A 2ZRGA 4RMIA 3UN1A 2P27A 2Q5QA 2WPDD 4FX5A 1OV6A 3WAJA 2VDJA 2I99A 2Q5HA 2FKAA 4FFRA 3WBBA 5EMJA 1NM5C 1WUKS 1XAHA 4L74A 1T9HA 2O20A 4GMFA 3HM9A 2P2ZA 4HR7A 5C46F 1L5RA 2CLOB 4QYIB 3M6AA 4HLQB 5SZJA 3QOYA 1ZUNA 1VSQA 1JLLA 4ME6A 2DR2A 3VZQA 4BJ5A 3NBAA 4C3UA 3VJKA 4FQ8A 4CM8B 3Q88A 4IW3B 2AR7A 2P5TB 3GQBA 1C3JA 3IOBA 2FOIA 3EZ7A 3OZSA 1XMIA 4TQ9A 2JCBA 2EZTA 3GJ5A 4LDJA 1XZQA 1MB0A 3LQYA 4Y2VA 5DHSA 4TYNA 1JQ3A 3AUYA 2R8OA 1QX4A 3ET4A 4RF2A 3CCCA 1O1YA 4EB0A 5BR8B 1NN5A 2WTNA 1LS1A 2J45A 2OORA 3V1MA 4MCIA 1YB6A 3PYMA 3H5WA 2R8PA 4MI9A 1AGYA 1EX1A 1WW2A 4WKOA 2XUHA 4ER3A 3UIEA 4OXIA 3WGZA 4BXOB 1PSDA 2ZJ4A 1URPA 3B52X 4OQNA 4ZYUA 2VT7A 4G5OA 2B6NA 4B7XA 2FKNA 3CBQA 2B69A 2JLCA 1GKIA 3ZX5A 4CKBB 4DCJA 2AOXA 1XZAA 3IVXA 3EF0A 4R2XA 1SC6A 2WTBA 1IVNA 1WG8A 5ALDA 3QYAA 3UW1A 1GTZA 1OPRA 4IUBS 2ZFUA 5HRAA 3ZBPA 1KSJA 1VL6A 5ILQA 3STYA 4HWOA 1QFSA 3WBFA 4FBLA 2IYRA 3S8EA 1TK2A 1JU9A 3NPAA 4J2OA 4WE3A 2ZIGA 1QO7A 2ZG6A 3VAYA 3LKZA 3NDRA 1X9IA 3DEFA 3KLOA 1W46A 1IPEA 3AP2A 4J7XA 4LECA 4IJQA 2NO6A 4H3VA 4F5ZA 5KX5B 3QHQA 2HDWA 5DTMA 3FH0A 1K86A 1Z35A 3JQRA 1P2UA 3U44A 3DNMA 2O23A 5DHFA 3PX7A 1VKNA 4HGQA 4LJLA 5C1DA 1DC3A 4TMZA 2C5LA 4AQDA 4JC4A 4WBXC 4FYHA 4WH0A 4Y2XA 4EJFA 3TSYA 1QWSA 1OFVA 3ER6A 5COBA 1TGVA 4AZTA 2ZETA 4HGYA 1IVSA 5F2KA 2E4ZA 4IDGA 1JP7A 1Z6PA 5JW6A 4UBOA 2D5LA 3HFSA 1QIFA 5CM9C 1DQNA 3EHDA 4MUAA 3HV2A 2XBLA 3LC0A 4DAEA 1WP4A 2AUTA 1NPYA 3OCYA 2WP8J 2CFSA 3QVGA 2O8BB 2IOFK 3Q0EA 4S1PA 3BERA 3E9ZA 1RC1A 2VVTA 1LX7A 3MMXA 4RD2A 4YAGA 1MU0A 4KFTA 1C3OB 1C9EA 4MJ7A 4NBWA 5AOBA 3P0FA 1T0JB 4JWKA 1DOZA 4AWBA 5LP6F 1V7CA 2CXPA 1XO1A 3MUNA 4QYWA 3TIGA 4CLRB 3F71A 3UV3A 4C88A 4D43A 3RYHB 5C81A 3VC1A 3B82A 3FDZB 4EUEA 5IVKA 1AUOA 2LWIA 2GR9A 4B6RA 1J2TA 1PL6A 4IJMA 4KQ9A 4C6TA 3ZY2A 3V4PB 1UP6A 4QRHA 3WX0A 1TMKA 3R20A 3GW8A 3RSHA 3FYSA 4QJ5A 1C0IA 1AUPA 4MS1A 1HEUA 4DYDA 3V8PA 2VK4A 1E58A 1BU8A 2NV0A 2YN0A 3BXHA 5HZMA 1U7UA 4A6DA 4CR8A 4M36A 1RCUA 1RKUA 3QWBA 3K4HA 3ROZA 4MUMA 2M98A 3AY0A 2H7VA 2IV7A 4IOKA 4K3VA 4TKUA 1NN1A 1VLVA 2VT2A 3MAGA 1VLJA 2VP2A 3IQXA 5AOAA 3V1NA 2VXOA 1LDGA 2XDAA 3FETA 3OJ0A 4RA6B 3VKGA 1FDSA 1ZOPA 3BEOA 3K4QA 3KLPX 4HATA 1RKXA 1SOMA 3KR2A 2P6RA 2IY8A 3R0ZA 1LLQA 1MX3A 2BE9A 4QQ8A 4R2LA 5H4HA 2FSPA 2GCOA 1IN4A 2BJHA 4K8RB 4M1WA 3TLGB 3U1TA 2PZAA 3W79A 4LF5B 1Q7EA 1HYQA 1OYYA 4TOIA 2I2BA 1P0MA 5DYWA 5EHZA 3A06A 3TQHA 4RK5A 1H8EA 1HF3A 1P4SA 1Q2XA 5T41A 1O54A 3D7RA 3GNQA 3PDIA 5ILOA 4Y9DA 1L1FA 3SN6A 1KS9A 4H7JA 5ARBA 4X6UA 1XELA 1ESMA 4E2FA 1EP9A 3WL8A 2OBBA 4IX1A 2J3DA 3PYXA 4DCUA 3DZ8A 3BX1A 3ZDDA 5EKSA 4HOYA 5K0FA 1C9DB 5K6RA 3I42A 2V7QA 1GSIA 2VYQA 4IVNA 5DGTA 5LQMA 2FFJA 5AW0A 3LHFA 4MV7A 2WI8A 3ZH2A 1Y6ZA 5AJXA 2IKQA 2J85A 5BRNA 1U2ZA 2I6FA 3KFLA 5SV2A 5I51A 1J20A 4A73A 3FZEA 2P6UA 2WB4A 2Y4OA 4RFLA 5I9SA 3AWIA 2IDZA 2GJSA 3SM3A 5CITA 3DDNA 5JXGA 3NDPA 4CG3A 4WK2B 2IGBA 3OA0A 4YRMA 3QYFA 1BD3A 2ECQA 4JBLA 3TIVA 4OGGA 1BVRA 4CQMA 5JC1A 5AVWA 1KFKB 1QGYA 1QK4A 2HBRA 4M54A 3P9ZA 3C1TA 1X15A 1GPDG 4QXAA 2OY0A 4OFXA 2RMKA 2QM3A 3DJYA 4R1MA 4AURA 4BE4A 3CINA 1Q74A 5AI6A 3WLMA 1R0LA 4NCKA 3V48A 5IJZA 4IGIA 5TMEA 2EFCB 2CJWB 3MCZA 3OZXA 3AU8A 4ERNA 3A9TA 1IUOA 2I4NA 1EK6A 3M9LA 2IK8A 3TO5A 4AN1A 1KZ6A 3T5AA 4UMFA 5EE3A 2PKQO 3ELYA 1TM3E 4FNOA 3LPCA 3R9WA 2KLBA 2E4VA 2XB8A 4F2HA 1E2PA 4XVRA 1QHXA 2PVPA 4RO0A 1W94A 3UXEA 4RSGA 4TUYA 1E0KA 1DX6A 3H97A 1U3VA 1E2LA 1X7ZB 4HGPA 3I3SR 2HH9A 4MRAA 1T1JA 3LV8A 3OUUA 5CRIA 1AKEA 2DUNA 1I1HA 1SN7A 4S1NA 4V0OA 3L8MA 4J1TC 2FPOA 1KOGA 1QM5A 2AT1A 4M98A 5ICSA 3CZPA 4CTKA 2J3MA 1IJEA 1RXEA 2EBFX 1M8KA 1X77A 3K96A 1TU3A 3P9QA 4FK8A 1YQWA 2IIBA 5IMSA 3RFXA 5E9JA 1HNWB 2YJ4A 3FE2A 4BTLA 4I4TF 3ZU3A 2BGKA 1BWRA 1W25A 3LRPA 1RHRA 1M1NA 1P5HA 1WPRA 2DU8A 3AY7A 3ESBA 3HWX1 4IO1A 1E1MA 4L5YA 4O4IF 2CD9A 4O2BF 4BRUA 4PHFA 1V2GA 1ECJA 1JIJA 2WU8A 1A8HA 3MNFA 5T5QA 1AMOA 4IHJA 2UYHA 3AL2A 1SXJB 3G1WA 3KV1A 1GN8A 5FWAA 3BKWA 1E9SA 3IJEB 3U3OA 4IIDA 4B3IA 2XOEA 5GY7A 5EJFA 1NFRA 1GGKA 1QMGA 1H4VB 2R6AA 2A9PA 3OTHA 1OCEA 2WPNA 3DV9A 4IS3A 2LD4A 2OB1A 1KBZA 1M33A 1YCHA 1XIVA 1W76A 2BD0A 3CPEA 3PUJA 4JQOA 2IKSA 2OO7A 2ZRAA 2J30A 1Y7LA 3LCRA 2PR2A 4I4CA 4AJIA 3VU9B 4EHLA 5DSTA 3FR8A 3ZHSA 1U7HA 1T5TA 4E70A 5HK9A 4Y1RA 4D02A 1CUYA 3P0RA 4A82A 4Z3KA 4BRZA 4MIYA 2RGBA 3V1UA 3CBGA 3FG9A 3CSDA 2GD1O 4C7BA 2IOFA 3OQBA 4LA4A 4HVLA 3MRSA 4NAUA 4DIOA 1RFGE 5AJYA 1R4NB 3EFEA 2XB4A 3EVAA 4ROTA 3S1AA 2X4GA 4AUKA 5FA5A 1JE0A 1VSUA 4M9RA 5E6RB 3UWOA 2JIPA 1W581 1QZUA 3SE0A 1QH1B 1R18A 4IRUB 3D02A 4DB4A 3EVBA 1QLWA 1W34A 1WW8A 3BFJA 3DYIA 4BIIA 4IZOA 4YAFA 1H85A 2VL7A 1R0CA 1Y4AE 2EW1A 4NWIA 2PXCA 4B6QA 5HUQA 3A37A 3GEIA 3QP9A 1XT6A 3N39C 3FUWA 4IUDS 4DRXB 2ATEA 4YS6A 1LBIA 1MF7A 1RYBA 2A35A 3JAWA 3ORRA 4QO7A 1DTWA 2AFHE 4YMGA 3IR6A 1W6RA 1M67A 5C4MA 1HT0A 1QG0A 2ZI3A 3FYDA 5DBGA 3W04A 4EKNB 1I80A 2V5AA 2VQ3A 1AKYA 2B34A 3MRVA 3NCHA 1CF2O 3QE4A 3RRNA 4DM7A 4F96A 2Q29A 4CR6A 1UM9B 4HDOB 2GJAA 1DC4A 1YFJA 3T7EA 2Q5CA 4DNQA 3D59A 5EJ8A 4M38A 4DJJA 2OZLB 1Q22A 4N3CA 4KO4S 5EWJB 4NK5A 4BP3A 4MO2A 2XGJA 5LU8A 2V6FA 2VRBA 4BMYA 3W9UA 2KM1A 2OUIA 2NZXA 1OGIA 1X1QA 1PUXA 1GG5A 3GGSA 1OFIA 1ZW6A 4Y6LA 5TMBA 3HUTA 4GMDA 4HTAA 3D3WA 4R6WA 2O4UX 4FJ2A 5ALEA 1TK3A 2WA1A 1J22A 3IQDB 1IBLB 2OGZA 2WMNB 3D0KA 3QE2A 1ARZA 1ZU5A 2FR8A 2O2CA 1IL0A 2V5VA 3GT4A 4H6XA 4PQGA 4RKRA 3RWMB 4A4DA 1RP7A 2PUDA 4HNGA 1RYZA 2B4KA 1LV7A 1M2EA 2JJMA 3NV7A 5CVCA 5F1OA 3B8HA 3LP5A 2AHRA 4HNQA 2O1EA 4BMXA 1NULA 4BBPA 4CLOB 5F98A 3DKKA 4NP6A 1XZJA 4OQFA 1N8TA 1U8UA 2YJGA 1BCRA 1W4LA 2KI5A 4MDYA 2JGIA 3QE3A 5CP8A 3A9SA 4E12A 4JLSA 5K8VA 2NSLA 3KFXA 2AK3A 3IAFA 3NM4A 3WIDA 4DJEC 1US8A 1BN7A 1WDKA 3DXZA 5BWLA 4ZVPA 4ZAVA 1RQNA 3ED5A 3ZCVA 5FBRB 5IJ0A 3J81k 2VLBA 3VUFA 2Q1UA 3FMPB 4MX8A 1JBEA 5EFZA 2D06A 3IT0A 1FRVA 3WRYC 1SCQA 1TPZA 3E58A 3DE0X 1JHOA 2DY1A 3LQ1A 4GMKA 2GF2A 1NURA 1E1RA 2Q3FA 4KJZA 5CH3A 5K6AC 1RI3A 3LG2A 1PQPA 1UQRA 4I6JA 4KYUA 4TL9A 4G0OA 2CXSA 3SQDA 4YRIA 2I1LA 4QU8A 1U9ZA 3C5EA 3C7AA 5I9TA 5JS7A 2AUNA 2NQ8A 4H18A 3RUDA 3AR5A 3TZEA 2JD0A 3HXQA 1P1HA 5EZQA 3WWEA 3CH4B 4L8VA 2FI1A 3LUKA 1XDUA 4MMYB 4JFAA 5IX8A 3G7SA 1OU4A 1P2SA 5HF9A 4DJ5X 4Z9AA 3KL4A 1G8FA 1XDSA 1ZGAA 4W5JA 1LVHA 1VIYA 1KY2A 3N7AA 4XPIB 3GRRA 3U39A 1X70A 3MT7A 2OA0A 1W35A 3OHPA 1N3YA 2GZ3A 3LIPA 4FYYA 4HN9A 4I9FA 3IQIX 1Y1LA 3UYKA 3PUWA 5AVYA 3GF4A 1ZUNB 1U8CB 5TEVA 2LDXA 4XLLA 4HXEB 4KWCA 2ZKLA 4KK3A 3RE1A 3FA2A 3QU5A 5BN1A 1RZRD 4ZCRA 5FUWA 4QGGA 4FI3F 2W2OA 2WWGA 3JR7A 3RS4A 1Q91A 2JARA 3AUJB 2A5GA 4DLUA 3SBOA 4NH4A 5AESA 4WNAA 3M5CA 3ZV7A 5J2UA 4S0ZA 1L1RA 4UZFA 1WV0A 5KAMA 1R27A 2PZFA 1YZQA 3BAFA 4TRMA 1E98A 3MVEA 3WL7A 5JCPA 4F6RB 1OI3A 4BZWA 2LKDA 2D0PB 4PYMA 2GEFA 3B48A 3VMMA 5BSVA 4JJZA 1N4AA 1T2DA 2Y1FA 3LT4A 2XZOA 3M6UA 2FQQA 4TL6A 1ACMA 1UBUS 1Y3IA 3D9QX 4IEEA 1ABFA 2R4QA 4K9LA 4W82A 3WZLA 2VSXA 4D9GA 1RJWA 3E9DA 5DEIA 2HU8A 3QMPA 1YVRA 4MEAA 1WXWA 1Z5VA 2QK4A 3GEPA 1NUQA 3OFKA 3TW0A 2RHMA 2CL7X 4KR2A 5KUTA 1BQ4A 1FTSA 3VC3A 3WKDA 2G06A 4NU0A 4PRKA 3MJEA 4GW3A 4RLFA 4V0SA 5AHOA 5FTNA 3ULKA 5LOVA 5GM2A 1FQKA 2PUFA 3HU1A 2VTBA 3ZYZA 2AG1A 2OHVA 4MQFB 3FCCA 3GFGA 1CRWG 1X94A 1EM8A 2C4VA 3I04M 3EDQA 5DFAA 4AJ9A 1F38A 1W7AA 4QJ4A 1LNSA 3ND8A 3RS0A 1KWKA 2W6IA 2FUG6 3FWHA 1G3MA 4I81A 3N0WA 4PGHA 3KDSE 1U8AA 1HOTA 2JJ1D 3A9VA 4KSBA 3CZAA 5JZOA 3AEXA 3EMBA 2JCXA 2P4HX 1KVRA 2RH4A 2V4UA 5TNXA 3ZWAA 3L46A 4P3PA 4ENPA 1B2RA 1WXEA 4IG9A 1A2OA 2JZOA 4GR4A 2ZITA 3DT9A 3CSSA 3NWJA 1CJUC 1U0HC 4GE0A 2XYQA 2YJNA 1P9OA 1E5QA 1N2EA 1NY5A 3E53A 1SUFA 2AXQA 4FDVA 4FGZA 5EYPB 2A7QA 3WMXA 4C6SA 5AI9A 1LW7A 3BH7A 1RLIA 1XZLA 3BD7A 3FFXA 3ZZMA 3AUTA 1JF8A 3KALA 3QFSA 1U3FA 4XSHA 4LGVA 4LPKA 4Q6BA 3UCEA 2HIHA 3SU8A 4BBZA 3KYCA 3DAYA 4CKXA 4ZYTA 2MDTA 2BDTA 1GUYA 1XCMA 3KO8A 1Y7TA 2QUAA 3RK0A 4F3RA 3K0AA 1Y1QA 3OOEA 3GZNA 5JFOA 1NNEA 4TRNA 4D57A 1B8OA 5G41A 4M0CA 1UBEA 4IGEA 5M2QA 1DRVA 2X9NA 3PUIA 5JD5A 4ZI3A 1LPNA 1P45A 1V11A 3VO1A 3ZCPA 4YMUA 1C81A 5BQXA 1QQ5A 4Q93A 5I7SA 2J41A 4L8GA 3X1DA 3E5RA 4IZIA 4N3NA 1KYXA 1O77A 4Q1FA 1U1EA 1YD7A 4KR9A 1WL8A 2PUJA 3KAPA 2NQTA 3KT0A 3PCRB 1Z0KA 5JY1A 5SZHB 2HIAA 2HWUA 2JGKA 5J63A 3DAHA 1E4VA 3DTNA 4HL6A 4YMIA 1QYRA 1BWSA 1HE4A 3AIKA 4IPTA 5DTRA 3GLFA 2O8CB 1OBVA 1ULUA 3AUUA 1PK9A 1PK8A 1DEAA 2OFPA 5K45A 2HT6A 2X7XA 2C2XA 4HDQB 1L7DA 1G1MA 2H7YA 4MULA 2NVUB 4BGVA 2IU4A 4YP1A 4WZZA 1X87A 2VPQA 1DDGA 4U3JA 3DSRA 4F4CA 2WSMA 1EJ0A 1TJPB 4GOOD 3KV3O 4MUIA 1VMKA 4UAUA 4GXNA 3CVXA 1ODTC 1QGZA 5KU7A 3H2HA 2R7MA 3SMVA 1OLXA 1PJZA 3COZA 1UWLA 2PSSA 1KAOA 2DTEA 1CJCA 2FRXA 3FPBA 3MJHA 4WASA 4WJKB 3SKYA 3ZPXA 5AM3A 4NNOA 1O0BA 1NG9A 3GLRA 3KJXA 2P9QA 3GT7A 4ZEWA 2W0SA 1E2QA 5AJWA 1T2VA 1NBAA 1U11A 3A4MA 3O1HB 2C2KA 5JMOA 2NVBA 2XQKA 1J0EA 2VP9A 3KE9A 4B46A 4PAOA 1OH7A 4N3GA 1O0SA 1Z33A 1Y6QA 2G1KA 4LS3A 4NSNA 4DSUA 5F64A 2EZUA 8ADHA 1FDOA 3FWZA 3UWKA 5LU9A 4IHQA 1SPBS 1NVVQ 3KETA 4V38A 4DLLA 4J94A 4OKIA 3ZE0B 2A58A 5T4FA 3V8NA 2IPAB 1IXKA 1A5ZA 1WD5A 1KKLA 3GLVA 3K9NA 4UREA 3W1EA 2HSGA 4R05A 3RGWS 3M83A 3M2PA 3DMRA 2A86A 1Y4DE 2HB6A 2KBFA 3IRVA 3OTWA 2NU9B 5IDVA 2FA9A 4KI0A 2BR5A 3TW8A 1FW6A 3PWZA 2FPRA 3L7OA 5CA0B 2DKOA 4HWSA 3V3TA 2N3ZA 3QU7A 4RHTA 3RJTA 1MVOA 4UVDA 1IOWA 1IPFA 3HEBA 2R1ZA 3OF3A 1BHSA 1YI1A 4YRPA 4MRSA 2BC9A 3NEYA 3OEHD 3W5CA 4CUZA 3CR8A 3EVZA 3S70A 2I03A 2PGAA 2DWCA 4PSVA 3A6HA 3QPBA 3L40A 5LQUA 1EVZA 1HFKA 5H83A 1DLJA 1G5FA 5LP6A 4RACA 4YP6A 4B3XA 2FOXA 3IR7A 4D8XA 4M7WA 2J0QA 1TJ3A 1CY1A 1SVSA 2W2TA 4GLFA 1RKBA 3WLSA 4MARA 2E6KA 3CLVA 2UZ4A 2CD7A 2IUYA 1WCYA 1Z6TA 2QRKA 3QKWA 4HAOA 4HTFA 4TTTS 2Q7DA 1Q0QA 3A4YA 4AJNA 4ZIRB 2R2AA 1W2GA 4I1SA 1KJ8A 3OLWA 3UGKA 1LJ8A 2Z95A 5IG2A 5ALMA 4E5KA 4DNPA 1YL5A 2AWNA 2QX8A 1A88A 1UJ5A 2VF2A 3RT9A 3MHPA 3WKAA 1SIWA 2HCJB 1F2DA 3SQOA 5DTJA 4FBMA 4TUYB 2WHXA 3Q98A 4ENQA 1JEYA 3UENA 1F60A 1Q1NA 2GO1A 3BWXA 2H4XA 3QE0A 3IUSA 4NZZA 4MGEA 1VKOA 2ZIZA 3V6MA 1AHIA 3MCVA 4AG3A 3KT6A 1GVNB 4NLLA 4ZTBA 5CIYA 4LF8B 2C9MA 1V8OA 1YBMA 3OLZA 2LP4Y 4MXDA 1VE6A 3GZJA 4GAEA 4UCWA 3ZHYA 3D7KA 4HRVA 4J6FA 4FS8A 1SBZA 3TGPA 1Z4QA 3B5JA 1BDMA 2OLKA 2X4DA 3O84A 4B82A 3HXLA 4IZHA 1LBQA 5CK4A 1SKMA 3OZ7A 2WTAA 1U9IA 1OH6A 3C3CA 4U2GA 5FL3A 3VR4H 3LPLA 1XU4A 1X19A 1JU3A 4XIJA 1E77A 1DJQA 1L4GA 3PD1A 4RV9A 2BEUB 2X2FA 2R60A 4BFWA 1W36B 1E3JA 3HA2A 3NHZA 1YAJA 4PO9A 1ZHFA 4MRNA 4ZEVA 2M6KA 4OGLA 1HX7A 1P77A 1A77A 1HQKA 2ZCVA 5FORA 1F06A 2Y4NA 1KO5A 2OGSA 1IATA 2X23A 4X61A 5GV7A 3KZVA 5FWXA 4TYMA 4II7A 2HPAA 3W8RA 5A0TA 3LHSA 4FTWA 5DYYA 2BMFA 2XTJA 1OFGA 1PV1A 2P1DA 1YQGA 1X8JA 5FOTA 5GGXA 4JJIA 4E22A 4IR7A 1RZUA 3HB5X 1D03A 4KMSA 3HV0A 3WNBA 5BUQA 4WN9A 3MQFA 4Q00A 3ZV5A 1KQGA 3IXQA 1FMFA 5ITZA 2GBGA 5HOEA 1NRJB 5TIIA 1DELA 3HRHA 3A10A 4QFMA 4CF7A 2QG9A 3I6QA 1GL9B 1TE2A 3T7DA 5A9RA 3UGJA 3GLHA 4ZKEA 3L7YA 2QMUA 2BCGY 2QTGA 5IUKC 3GDFA 4OIMA 1EK1A 3FRHA 3WLOA 1S4MA 4PPGA 4WOPA 4YRZA 4G67A 4CKZA 2BFFA 4F4JA 1W5AA 1RQGA 3KJQA 2PO7A 2C9ZA 3TS1A 3AUXA 1CVRA 5IYZB 1V6CA 2AN5A 2X0EA 5B2EA 4JD5A 4NPHA 3JD4A 1AKRA 4BAUA 1Z62A 3A4TA 3ONEA 4FZ3A 4AW9A 1CDDA 4YCNA 1ZH6A 1AGXA 3ZJYA 2HJRA 3VOBA 4CLDA 4F84A 5L4NA 4LJ9A 3JRWA 3QNUA 3TUZC 2PL3A 2ILTA 3L07A 4ZP1A 1XTUA 1A3CA 1DEHA 3DFZA 1JBKA 2B92A 3H1AA 3H86A 2BSAA 3JTMA 3JWEA 4HFRA 1KY4A 4ZJPA 2VHTA 4H3SA 4C2AA 5LSAA 3V1YA 4DY6A 1ODSA 1Z6AA 1OXMA 3ONNA 4X7RA 3MMZA 1B14A 1JXOA 5KWIA 1KAMA 4NENA 3B60A 1S9DA 3RJMA 2BVNA 2AB0A 3BGDA 3L4EA 1XPRA 3GEMA 2CFIA 1T0HB 4MR8A 4HYYA 4AKIA 1J24A 1XYYA 3EB9A 1QAOA 2IEBA 4ZXFA 3GJ0A 3MERA 2F17A 4TYYA 3IP5A 3FYTA 4ZQEA 4JDUA 1I0IA 1FRQA 5DDIP 2RIPA 1APBA 1E79A 1O9HA 3V7YA 2Q5EA 4FWIB 1X1AA 2G09A 2AJTA 3I34X 3OJEA 5AVVA 4QEKA 1RYYA 3G2OA 2QN2A 3L6EA 1BGXT 1GA1A 1F6WA 1H8HA 1XTKA 2MTBA 3N8NA 3QBJA 1RRMA 4XM1A 2ZIVB 1EKXA 3Q8XB 4I4TA 3P2KA 2VJMB 5KYWB 4OI0A 1OYVA 2BFCB 1OWLA 2GCEA 2PA3A 2XAUA 1LRJA 3EZ9A 4O2BA 4O4IA 3ZR4B 3CVWA 5G0TA 2OZEA 4Z9YA 1GD1O 5G1PA 4CQNA 1NNUA 1EGQA 3H2ZA 4Y2PA 5JWRA 3HU5A 1KIAA 5EE0A 5TQ0A 2WWIA 5JS2A 3NJRA 3SD7A 1B42A 3KT8A 4UQOA 4JBNA 2UUPA 4PVDA 3VTAA 2I65A 4RZXA 4L4ZA 5DT9A 3URMA 3KQKA 3QKSA 2CHQA 2XW6A 3G8CA 5JNRA 1CRLA 2FX3A 2IYXA 4ZCQA 2VAWA 4IIJB 1I4LD 3NIBA 4HFJA 4OYHA 2RH9B 4L9WA 5BVHA 4NYIR 4FJ1A 1BX3A 1ZK3A 2Q46A 5JZVA 5B55A 1YRBA 2YOFA 5KVVA 1SHZA 1NZDA 3R7LA 3VX3A 1Y4UA 2E49A 3ZS9A 2IWRA 4C4OA 1BN6A 2ATCA 2Q1TA 2OD2A 2VS1A 2WTMA 4J2TA 3KSDO 4RDCA 3SS8A 1O5TA 2A67A 2AFIB 3GG9A 1E4YA 3OE7D 4HJXA 3SNHA 2G9NA 2J3EA 1RFLA 5CT8A 1EGAA 1MO2A 2YZ2A 3V33A 3D0OA 2IQ5A 1RJ9B 2G4VA 3H9EO 4EW3A 2Z0MA 1IRIA 2QTVA 4QELA 5TT0A 4WINA 5A62A 3GLIE 1WZ2A 1NMZA 3LGAA 3B3JA 4JLBA 2A78A 4Y8VA 3WBJA 4DA4A 3JZIA 1AF7A 1PW7A 2E0IA 1UK9A 2JKYA 4G56A 4OV6B 1KFJB 4HAWA 3OT1B 2P62A 2ZE5A 5FYQA 2VEDA 3HGTA 4AY6A 1E3MA 3M4JA 2RKBA 5KSPA 2AEEA 1HLDA 1C7EA 1G4UR 1XOIA 1Z5WA 3AFMA 3GJ6A 3TEMA 1NKVA 4B6GA 1SXQA 3YASA 1J49A 2SKEA 1XVVA 1CYDA 3EEQA 4RSHA 3ELWA 2HHAA 2Z9BA 1QFXA 1QPBA 3FPGA 1J07A 4XDYA 2K7ZA 4LWQA 3TD2A 3NAGA 4NJOA 2GJ8A 2HA2A 1H4QA 3COSA 4JOQA 1GZSA 2VDWA 1H69A 4DM3A 4J0QA 2RGUA 1LSJA 1FFEA 1QHEA 4BNHA 2ID9A 2H1WA 4TVBA 1SU6A 1P2DA 2AOTB 5LQJA 2QT0A 3MSXA 3HE3A 2ZSFA 3KOXA 5E7MA 2WINI 1VJDA 5DI3B 1EA5A 1JHDA 1LX6A 2XB6A 4QWMA 5AK4A 4O59O 2O7VA 4L5IA 1PNVA 3LA6A 1J4AA 1V3VA 1CZHA 3C3PA 3MHTA 2QWXA 1HG1A 2FP3A 4NJEB 2XVAA 2X4LA 4JNCA 5B3JA 1WCIA 4IEFB 1XTVA 4QX6A 2CE7A 1GTJ1 2KBEA 3E27A 2C31A 4N03A 3FPEA 3RO7A 3LMKA 5KOHA 1B6GA 3TVTA 1VYUA 3LLVA 1TQ4A 5IVDA 4MV0A 3U31A 4LJAA 1R12A 4J2HA 1FSPA 3IMGA 4Y2RA 5LMZA 1Z28A 3T9EA 2UVDA 3IJPA 3RJZA 4KQ6A 1YC2A 2EFHB 2VOJA 3I9V1 4PRYA 1S2NA 3PYLA 4YEDA 2YQ4A 5H80A 4BMVA 4EA9A 3JQCA 5K3CA 1UT6A 2DHRA 5ER9A 5HIKA 2O2IA 1H9CA 3O2SB 4EHJA 4AECA 1SFRA 2NVOA 1K2WA 4L2IB 1P62B 1MABA 1FP1D 1P2TA 3HCBA 4B7ZA 3DC7A 4G8JA 3RUCA 5HGXA 3SLRA 1ZL0A 2Z8YM 3H05A 3Q2IA 4QGHA 3AVVA 4Y98A 4DIUA 3P2IA 3L0DA 3ADDA 4PFSA 4W6ZA 2OZPA 1NATA 2FWBA 4EL0A 3R2JA 1OA1A 5KYXA 4GO1A 3LUDA 4XLTA 1K97A 2YX1A 2M2IA 4TTIA 2WYWA 1Y8CA 1YU6A 4JX9A 1RPNA 5HR5A 4U2DA 1A5BB 1TUBB 2IYYA 4J29A 5CTAA 3AVTA 3OG9A 2PAFA 2I4IA 2RARA 5DGHA 2FF7A 3L92A 3KQOA 4N0EA 3CMCO 1G20E 5B1YA 3W8NA 4FZ5A 4AMGA 1N2SA 3CUEF 1SIUA 2P9FA 2UAGA 3MOIA 2C9OA 3O9MA 3EPKA 3D8HA 2HO4A 3FOZA 2QVZX 1KMQA 4GECA 2NN3C 3K0AB 1PZFA 2WAYA 3PB3A 4Z4CA 4HDMB 3ID6C 2ZRIA 5K0JA 1HDYA 1CE8A 4BXOA 1QR6A 4M1TA 3TEJA 5KTYA 1ZGJA 2XCIA 4ZJUA 5FWNA 1Q7BA 3PQCA 3OM0A 4MK4A 1Z0SA 4MS4B 2AE2A 2XBUA 1FS6A 1O4WA 1M1YB 2NO4A 1OU0A 2G63A 3C3DA 3K9CA 3QKRB 3R3WA 4B75A 1JQAA 4C7XA 4LI0A 3M4ZA 1IEXA 1JR3E 2XNKA 3FVQA 1GUFA 1P0CA 5CHYA 5BQPA 3ZE6A 4Z1OA 1C0EA 3EVEA 3FRJA 2MU1A 2ZVDA 1EHYA 3EBPA 4HVTA 4UQPA 4E2XA 4EQ6A 1JFVA 2GN2A 4GNRA 1UCFA 2BW0A 2Q4BA 2YYAA 1H2EA 3ETJA 1X1EA 1YZNA 1C1XB 2IP4A 4FE4A 3ZVLA 5MGBA 3L8CA 2QN7A 2VJYA 5CM8B 4ZT7A 1OTHA 3L0CA 2DLCX 3KSZO 3IKLA 4A26A 3PC4A 3VVCA 3RU9A 1BW9B 1OR8A 3H11A 2IDKA 2SICE 3IV9A 3GUCA 3PZRA 4WERA 2D13A 1WIWA 2IIPA 1N57A 3FNRA 2ACVA 3L8EA 1LWOA 3G5MA 2E1RA 3ZI4A 5BOVA 3AINA 3K2BA 2EZ4A 2XQJA 5F7JA 3A9WA 3E3LA 1TCUA 2OD9A 4J0IA 2CDBA 4MPJA 3HRIA 3IV7A 1C9JA 2CFRA 1NUSA 1X9GA 1X2BA 3GCGA 4M1OA 1E2NA 1G7SA 5COAA 2CYAA 3AYXB 1NIJA 1QQ6A 4C7OB 3IP7A 3QG5A 2ZS7A 4ZAWA 721PA 3OOWA 2OP1A 4RWZA 4FN4A 5EQDA 1IOZA 4LTMA 5EKUA 4LF7B 2QBYA 3VZCA 2RE8A 5KJEA 5AVTA 4QUGA 3OZAA 1Q17A 3B1JA 1B3BA 3GROA 1Z0ZA 1VDZA 4L4XA 1KQFA 4IBOA 4N0PA 4BVGA 5IJXA 5D1HA 1ZL2A 4FONA 2QLBA 4BNNA 4DUGA 10MHA 4Q4DA 2CLKB 2ZK7A 4YAUA 4CKEA 2G8NA 3JVEA 3OT5A 4R2WA 2M32A 4PYRA 1XUOA 2WF7A 2HHLA 4Z8XA 4AY4A 4ZREA 1C9KA 2P2YA 2XVXA 2XYRA 4RPJA 4YECA 3MRXA 4JJ4A 4ENRA 4BNLA 4CM1A 1F1BA 2DETA 1Y7HA 2FPIB 4NMWA 5FWYB 3FTFA 3KPVA 3UGQA 2J9FB 1JI0A 3N2NA 1SBTA 5DOVA 3UT5B 4D4GA 4TWZA 3KJNA 3F5QA 3HVIA 1QHIA 2OMKA 2O57A 1PWHA 3JS5A 2X0NA 2HDHA 3HCRA 5EMLA 3PUKA 4KOAA 2JAQA 4HP8A 2PT5A 5IAEA 1SOWA 2QTLA 1NP3A 3DBRB 3KKEA 3SZ3A 5BOSB 3ESZA 2DSTA 2Y27A 4JLMA 5JE8A 5JS8A 3PF8A 3PRHA 4UHHA 1IN7A 3C24A 1U6IA 1YZKA 3IXMA 1HZZC 1UJ4A 3QXHA 3JY6A 1OXVA 1LSOA 4G63A 1HL3A 1RAGA 1XWIA 5AK5A 5L3VA 4GQBA 4UJ3A 2XNHA 3HCAA 1YOBA 4MV1A 3ACDA 4LUCA 3UATA 1WMSA 3HPRA 2XD4A 3R3HA 1PJ3A 4I36A 1HYEA 3REFA 3GN1A 3K3PA 3TTXA 3OOSA 4Q3DA 4MQ5A 3VO9A 4CMIB 5CEFA 1NVDA 1VPDA 2QRJA 5D8DA 2VN8A 4ISBA 1M0WA 2CY0A 2ZT5A 3IPAA 3R5SA 1KDPA 2W2KB 1BJTA 3FOEC 1RWVA 3HWRA 5J5CA 3VSCA 2OFWA 5HW0A 1ECPA 1SG9A 2B98A 3WMGA 3L43A 3IVMA 3FMGA 3ACBA 3D5QA 3OFND 2GBIA 3IEXA 4RTOA 1WZUA 1N5MA 2YVQA 3DCYA 4MRVA 4K6HA 3NEPX 3TOXA 3WYGA 2QRUA 4AT1A 1V37A 2J9XB 3IC5A 2MMGA 1PNTA 2DULA 3ANNA 2XX3A 4EB8A 1DKLA 1YDEA 5C9ZA 5JASA 3Q2OA 2QN1A 4NBUA 3S55A 3UWPA 1L4NA 5IM4F 4B35A 2ILVA 1HYHA 1A8UA 1YB7A 1CY4A 2R6DA 4K6FA 2IEIA 1JDBB 1ECLA 1N5KA 2JATA 2JJYA 4MITA 2NQ2C 2Z56A 3HQ4O 4J0DA 3T4UA 3A6PC 1XYGA 2C7GA 1WXQA 4DMGA 4Z9XA 2IZ7A 1DDIA 1GU0A 3P9RA 1BGVA 4JP2A 4M99A 3ZX4A 1MOQA 3C39A 4L27A 3QF4B 4OHVA 4OQEA 5LQKA 1IE3A 4ZOCA 2XE4A 3CZQA 2BMDA 4H08A 2GETA 2W6JD 3E5HA 3O8OA 1X80A 3GDOA 4M49A 5FBHA 3RBVA 4KW7A 2FRDA 1Y5NA 1CG6A 2AKAB 1PLLA 2WKSA 3HBFA 3ZWBA 1AKNA 1RE1A 2BMAA 2XNCA 4JB8A 2DEUA 4Q4JB 1DUVG 3QFCA 1FU4A 3E8XA 1QYDA 3F6PA 4FHFA 5FNVF 4KV7A 2OV4A 4ABTA 5EQFA 1D2GA 1A7AA 5AJHA 1YS6A 5I8WA 1HSZA 1JB1A 1CZUA 3UK1A 5EMMA 4CIAA 5LMUB 1R0XA 1UXJA 2ZUBA 1FYEA 1UC4B 2QN9A 1H2AS 1PU2A 3AVOA 3KSRA 2V97A 3QEJA 3DEIA 2XNDD 4BWGA 2ZIFA 2PR7A 4CCAA 2CNLA 5HNKA 3WQQA 1NDHA 4KEAA 4UTRA 3R0JA 3ZGYA 1K5GA 3O26A 4L78A 1J2EA 3OQPA 4EG8A 4X95A 3OIDA 4DVGA 2D5BA 3DXFA 2FSUA 1IBKB 1YQXA 3I1FA 3MK31 4WPGA 4D2IA 3PGKA 1L4BA 1B23P 3G49A 2X2PA 3LP6A 2WD9A 3MD9A 4Q3OA 1NU6A 1S4QA 1LDEA 5JDCA 4MVWA 4QPZA 1TGYA 3HDQA 3S2UA 3ZWNA 3CCBA 4HJRA 4MRPA 1P7CA 4D9MA 5B1IA 3D6MA 1MQ9A 2R79A 4OQZA 1P9RA 4MTLA 1PJTA 4AROA 4FE3A 1F2TB 5LDGA 1GGVA 1VLMA 3KXPA 1K6EA 5LCXA 3QVKA 5IAKA 4DV0B 3NRBA 4OSPA 3IE0A 4KMRA 4X1KA 4NI5A 1A9RA 1I4DD 3SC2B 2F8LA 1B2LA 1N0UA 3FNIA 1ELOA 4ZQGA 4PS0A 2Q5LA 2Z2XA 4PSUA 1T36A 4D7AA 3QVMA 2IHBA 3JVIA 4LQDA 1H0HA 4NPAA 1PWZA 5DCLA 4DXAA 5A71A 3BC1A 3WDLA 4B2PA 3FWNA 2EIXA 3VR6A 4E07A 4HADA 3WNVA 3HTXA 1SQ6A 5FUYA 3MEQA 2UUBB 5I4IA 2NSDA 1CX9B 5MN5A 2UDPA 3F7OA 1G9XA 1Z7YA 3INYA 3UB4A 1FPQA 3QH4A 4JOBA 4RKQA 3GRAA 4ZCMA 3GY0A 1LI7A 3CFYA 1K3FA 5F51A 2EFGA 2AR0A 5FI0B 4CM9D 1N6RA 5DI9A 5A3JA 1QC5A 5C8VA 3OMWA 4MI3A 1XPJA 5DLDA 3TE6A 3WKEA 3LXRA 1E5TA 1EEHA 4C05A 2OVFA 5LYJB 4D44A 2VK8A 2WSSA 2HLHA 3L8GA 5A4JA 3A4LA 4HAXA 5FPPA 2FLKA 1M2OA 3VSEA 2PX0A 1X1CA 3KPYA 4CMBA 1C3LA 1BA2A 1X2EA 2OCGA 2YY6A 3L41A 4UHKA 5LC1A 1T5LA 2O2SA 5A7HA 2R8YA 3F5SA 1XNRB 2PPVA 4JLJA 3ISVA 3T7IA 1JZSA 3R41A 4OI1A 3I2IA 4DUYB 1H5QA 5EIEA 1TZKA 2PD3A 3GK3A 4PZ0A 4CM3A 5E95A 4HGZA 3QIVA 2OGWA 2V96A 2EAUA 4NV3A 5B3AA 4O6VA 1IIRA 3IURA 4RLSA 3RI3A 1E8NA 2DVMA 1TECE 1K68A 4XJSA 3ZXUB 4EJSB 3D7NA 1NM5A 3QEOA 2P3LA 3SAJA 3MJTA 3N53A 4KYVA 2ZR7A 5IHXA 5EQTA 1P75A 3N59A 4BO4A 2G08A 3W5DA 4ZZ2A 3GFFA 3T06B 4G0QA 4EVRA 1KU0A 2ENWA 3K6RA 2UYCA 2ETXA 3B6EA 3NEJA 5ABPA 1HTWA 1BIFA 2VI5A 2ZSJA 2F67A 2H4YA 2RGEA 3EQ8A 3QI7A 3SJUA 5GOTA 3CG4A 4XEHA 3VHXA 1H1LB 2QM8A 3GDGA 4IUYA 3ZNPA 4ERXA 5E8JA 4JR1A 3U4QA 4IMRA 4L28A 4D0LB 2CCJA 2BGGA 2Z3VA 1V2HE 3WS7A 1KA9H 2NAFA 1M6VB 4FR2A 3ZY4A 1U0EA 3DZFA 4BQFA 4PICA 5LDDC 3MMNA 4Y6RA 1DKMA 3L7NA 1MPTA 1PS8A 1QQBA 5ALTA 1G18A 5CD1A 3U6BA 2NZWA 5HF5A 1D2NA 4AIRA 5BSFA 3OTOB 3ONWA 2YN4A 1AS0A 3PFBA 3O4VA 5K8UA 1ZK1A 4G0MA 4G41A 4LXXA 5EUBA 3HNOA 2Z5GA 3PXDA 4IIXA 2QE7D 1NW6A 3BBPA 3F47A 3U60B 3N5CA 2BSQA 3T3OA 1ZVKA 1YV9A 3K1YA 5AM0A 3JPWA 1NTOA 5EPOA 3PICA 2C5AA 2AC7A 1VP9A 3U7QB 3STTA 5JDIC 4ZFNA 4L0CA 1A97A 1F0KA 1Z5ZA 2R7LA 2XCLA 5B37A 5E6UA 1DBIA 3QVSA 5JHGB 3ELUA 5ISMA 1YOVB 2BAGA 2JNWA 1PN3A 3INNA 3NWBA 1FUKA 3BWBA 4INPA 3NT4A 5BV7A 1BD4A 3HHPA 3U4IA 2YFHA 2Q4DA 2XDQA 1NI5A 2WUEA 4LQCA 5EP2A 3CTMA 1K08A 2NMVA 3CCFA 5NLLA 2ENUA 3EIHA 5ICEA 3RREA 3E6AA 4A16A 4OXYA 3VAZA 2QNBA 5B58C 5CAEA 1Z2EA 3EK2A 3KT3A 4Z0HO 1R5OA 2O7SA 2VJNA 2ZRBA 5HDQA 5IC5A 3DHYA 3MQ4A 5TV2A 2OZKA 2HLDD 1PZGA 2PVSA 3VR3A 5JJIA 1HLFA 2RHOA 4A0FA 1QX3A 4YGXB 5IT9A 4R2IA 2XT0A 2YVLA 5HEKA 2Z3ZA 4L5JA 3WGHA 1KYIA 1KZ4A 4P3XA 1MT3A 1RNLA 3E9MA 4B7AA 1ZIDA 2HV9A 1TTPB 2CJPA 4LXUA 4ZVUA 2HHJA 2BELA 2JCVA 3C1OA 3QEBZ 2IBSA 3FUUA 3QUAA 4KH1A 3UANA 1YC5A 1C0KA 4R1LA 1RZVA 1E4EB 2DLDA 3BK2A 1Z06A 3HO6A 1ZCAA 3ESQA 3STVA 3UJNA 4IVPA 4P93A 2XRMA 5DIFA 5KBYA 1AKMA 5AOVA 4CHGA 3EW7A 4QICA 2BH2A 5JFTA 5G0UA 1E5XA 1M0SA 2P68A 1YZFA 3EFOA 2H0AA 2O6HA 1NF3A 1YWGO 2YIVX 1TYAE 2FUNB 1XZ8A 2ZULA 3AF2A 4J4BA 1O0CA 3E4CA 5CFNA 2LCIA 4XGKA 1HE2A 3PFIA 1L8XA 2H9IA 1Z7WA 2PQ6A 3KIPA 4IDNA 3A0RB 4OU4A 3HVJA 8OHMA 5JQWA 1CV2A 3QG1A 3NHAA 4LY6A 1PEAA 1XTIA 1L0BA 1T4CA 2J6BA 4CV2A 3LOPA 3E70C 3FVTA 3MINA 3U7EB 1O2DA 4Q4AB 4NH0A 5L4SA 3LF2A 4NBKA 3WHKA 3I4LA 4ETWA 3AUFA 3AO0B 2YHIA 2QL7A 4HT3B 4UM9D 3DR5A 1MHPA 2QQGA 3DLBA 5K0CA 2Q07A 3LK7A 1ISPA 3TG8A 1BTOA 5CYPA 1JH8A 1R0ZA 2V7QD 5KVQA 4TS3A 1T4BA 2BGJA 1CUAA 1P0FA 4RGQA 1LLUA 2QP4A 3R6WA 3TVYA 4I55B 1V8FA 5IXJA 2D0IA 3QI2A 4I19A 3G68A 1ST3A 3W3AD 1TJNA 2G6BA 3ZTTA 4BNZA 4ZDIA 2GWRA 3BSFA 1ECBA 4O1HA 1CJTC 1M34B 1I0ZA 2HF7A 3D3KA 4YBZA 3SZGA 5C32A 4BDTA 1YS2X 4M87A 4FINA 5BWCA 1GFZA 2YXLA 5HBGA 1H4SA 2OYRA 5K5EA 5KVAA 1SHJA 1YR2A 5CJPA 4NXNB 1BVUA 1ONBA 2GAJA 4O08A 3DMPA 4IGFA 4TL8A 4XIIA 3PE6A 3WGOA 1ZFNA 3EA4A 4OREX 1EWKA 2HQ1A 4FMCF 4CQMD 3UT0A 2X1LA 1FX0A 4JVMA 4BJHB 4LE0A 1R66A 3TNFA 3QPCA 4AM8A 5C8YF 1BFDA 2QUIA 4TZKA 1K06A 3TG2A 2UZIR 1SGWA 2FPXA 3QJGA 5BWNA 1UXIA 3DKVA 3LFTA 3ZJTA 4ITUA 2BCEA 1UQUA 1WU7A 5C5IA 4D4HA 1VIVA 3NGMA 5IKEA 4NV1A 4Q3CA 3G2QA 4HS9A 1C4XA 1GL3A 2CXUA 4BFUA 3Q3IA 4QTYA 3ZWPA 4K9DA 2YY7A 3MM4A 3O2JA 4ACBA 4BCDA 3IPXA 5JJBA 1JKJB 1PZMA 2QL9A 1UBKS 3QVXA 3K0BA 4RD0A 4URWR 5F4ZA 1KTIA 4HQFA 4E5VA 1YA6A 1OGYA 3VZBA 3CH7A 4EFLA 3HA3A 4LG1A 4RBNA 4E1BA 1AHNA 2GM9A 2GEBA 5BW4A 2DECA 1IWPB 2RC5A 2ECPA 2E5WA 3GMDA 1IFXA 3DJFA 2R6CA 3W8EA 4CU5A 1SCDA 2J6CA 5KVSA 3DZDA 3PITA 4YONB 4EYSA 1CUDA 3VSBA 1QIEA 1KZYC 4N5NA 2A0XA 3GYGA 4C07A 3W4JA 1CFJA 1EG7A 1R10A 4OQXA 5DSXA 3CZCA 4KLRA 1MB9A 4P84A 3TRKA 2AYZA 2AN9A 2CBZA 4NY1A 3WQBA 2YZMA 4YQFA 3SYMA 5AHRA 1GL7A 1XAIA 3EEIA 2P2CA 3NR2A 1V5WA 5JY6A 4TN5A 1S89A 3IQGX 3ZDFA 1AY0A 2E37A 4M1QA 3UMVA 3FTQA 2VHZA 5IABA 2A88A 2R00C 2RAPA 4R5MA 4EGSA 5DGXA 3GJSA 3ECSA 2QTRA 3U5TA 2YOHA 1KP2A 4DUZB 4RL4A 3IL2A 4RPCA 2Q4RA 1E1QA 2A1IA 3EOAI 5IT4A 1V5FA 3GLGA 4KXMA 4S1OA 5IJ9B 1ZM4A 2YVKA 2COEA 3FCSB 4LC0A 5EC8A 4Y3UA 3AXTA 4Q3LA 2V59A 5JSYA 2HD4A 1H6AA 3DKRA 4PN7A 5EOVA 3CW2A 1TVMA 5EA2A 4YJDA 3CZMA 4F72A 1UBSB 5E7QA 2HFJA 2XQIA 4K87A 3MWJA 1TEZA 4FWTA 1QOPB 1BEUB 2XI4A 4HNSA 4GEGA 1K6XA 4QNRA 5AXBA 4J1TA 1S2OA 4C3VA 2VJKA 3V4ZA 1KI8A 4OXQA 3WICA 5ILGA 1JIIA 2W83A 4DPMA 2GNAA 1K92A 2VBGA 4HWRA 2C77A 4Q24A 4EM6A 3Q10A 5EESA 4KAXA 1CZNA 1Y5LA 1XZGA 1YHZA 5G0VA 2SCUA 3DGFC 2QE6A 3SYKA 4A27A 4A15A 2V7PA 1OAOA 1ZGGA 4PAMA 5BW8A 4H17A 1J5XA 2GEJA 3PQDA 1YACA 4OJYA 5HILA 5TDHA 1A9XB 3V2UA 4RCVA 4OU5A 1N8SA 2V54A 3VR0A 3E18A 3WNZA 5HTKA 5KNCH 2CWWA 4ZDKA 4IKOA 1Y3FE 2I2AA 3G2PA 4W7HA 3G0IA 2JFWA 2O3QA 2P67A 3PJEA 3ZJVA 1AHHA 3FB1A 3U4AA 3ILVA 3LM8A 3OQMA 3BIXA 2CSUA 5B12A 5HJEA 5TE9A 2JKVA 4KDFA 3DXYA 2MSNA 1ADGA 2P35A 1U3UA 4W6QA 5EJMA 3AIIA 3KB8A 1B26A 3ZWKA 2YR0A 2QQFA 1H2YA 4FEGA 3FOWA 1TIPA 4HYEA 3WVNA 5I4BA 1ZNYA 2I3ZA 3GVIA 1SCJA 3H9QA 2GERA 1VRWA 3OF5A 3LBHA 2C00A 2O5VA 3HCCA 1KJQA 2PGXA 2IYFA 3BRWA 4DNXA 3NAMA 4WJZA 3RYCA 2MYTA 5AK0A 2ONCA 1N7IA 1W0KD 1IM8A 3NHJA 1HDCA 2PGJA 2PRZA 4INAA 1FUYB 4KPYA 4G0NA 2PCJA 4EGCB 1J7KA 1O6CA 3A28A 2XJ4A 3R8CA 4EPWA 1MO3A 3M4XA 1G4AE 4MW7A 4ZANA 2RHJA 5D00A 5IN5A 1GPMA 2FDRA 3ND7A 4YI5A 1RJFA 1PDOA 3OTGA 1D4OA 3WC4A 4G5XA 4RFSB 2DXIA 3FGPA 4NV0A 3IEMA 3K70D 4UUNA 3H5VA 1SBYA 1RAFA 1CERA 1MJ5A 1UWKA 3PFHA 1H05A 1H23A 3IQWA 4MW2A 5DK6A 4L3OA 1FS4A 2DZDA 2ADMA 5CCDA 5KSZA 5AUOB 2EJCA 3TZKA 1J56A 1WX1A 2QMHA 1EINA 3JWPA 5A4DA 1G21A 1ZJ6A 2VP3A 3K9BA 5EHQA 2RGDA 3TYXA 1K75A 2A5JA 2VDNB 1QSGA 3M4YA 4B3SB 4D45A 3U3RA 1MC1A 3BE6A 1GV1A 2QYHA 3TL3A 4NOLA 2ASEA 1JEEA 2GEKA 4XM0A 2VPPA 2MSKA 4MHSA 3FXAA 4XX0A 2N9UA 2WW8A 4DQDA 1X7WB 4CG2A 2RAUA 4LWOA 2BISA 1PFVA 2H85A 4BGUA 5UKDA 4B43A 1HR0B 1L4MA 3EZYA 3NBUA 5C31A 5ED4A 1L5VA 3ERCA 2H5IA 5H9WA 5FA8A 4RTPA 1YF3A 3OWOA 4QULA 2GFHA 2OAGA 4DQLA 1JMYA 1T36B 3IOCA 3MOSA 1RYEA 3BE8A 2FQWA 1N1MA 3DAGA 3M5DA 4G9BA 1ESZA 2JIMA 4I1OA 4JJ6A 4XD7D 4XKJA 3PD7A 3RYHA 5CDFE 2NYAA 1F20A 4G89A 3JD0A 2H2IA 1K8RA 1C2TA 2AJ8A 3HKCA 3KHKA 1TTHA 3ROEA 2JFQA 3RVLA 4NCNA 1I2MA 2EHJA 4KIFA 4D0RA 4GYKA 1C8KA 4HXFB 3AFIA 1PT6A 2V74B 3CEHA 4O1MA 4P81A 4PLZA 3QPUA 2A5YB 3GFPA 3JWGA 4WZBB 3A1NA 3ZE8A 4CCSA 5IM4A 1ZMBA 3W5AA 2Y6UA 4ZVRA 2P2NA 4KBFA 4A2PA 5CBKA 4OFWA 1I24A 5G4KA 3PI6A 4UVEA 5M3BA 2EKPA 3B38A 4P3KA 3WRYA 3I9FA 2YC4C 4MP6A 4GOKA 5H16A 3HM2A 4Z86A 4YRJA 2YINC 2WU4A 5EI5A 1E1LA 3WR5A 1RTTA 2FWMX 6YASA 5K6AA 1KI1A 4WFQA 1U1IA 3JQGA 3THOA 3V32A 3TKLA 2O9JA 2CDNA 3KLMX 2QLFA 1T1IA 4ND2A 1U1GA 3QX9A 4KWEA 5FR2A 1YE3A 2H48A 5FNVA 1RRCA 1GNRA 4OUDA 5F9FA 1VZ2A 1BOFA 2FQ1A 3QXSA 4YRCA 4F7WA 4UXIA 1KZ7B 1ONNA 4XTCS 3LBNA 3LXXA 4C43A 1MAVA 1S7CA 1UDAA 4XTRA 2NWQA 5JYEA 3A6EA 2VDLB 4KUEA 1T1SA 3HYLA 2NUBA 3OZGA 3HP1A 2X8JB 3QFFA 3SR4A 2QJRA 4R81A 4CL0A 1SKAA 9ATCA 4FOPA 3AW9A 1KAHA 1RYDA 1B0PA 2R66A 3B13B 3O75A 4UFPA 4QXPA 3UCFA 5BMVF 2P8JA 3C48A 4RXUA 3RJ9A 2W42A 1RQPA 4FMDB 4TXLA 1PFQA 1HURA 1YZUA 3B1YA 4UDXX 4YJHA 2APJA 4M1MA 3NOXA 5HIIA 1UEXC 4RTMA 3CW9A 2D8MA 1HK7A 3CX4A 1ZD8A 2V7BA 5DXFA 2PGDA 5JZMA 5DT2A 2IHTA 4O4HB 4XOUA 3JQ8B 3HSKA 2GD0A 3EXEA 5CDUA 3O92A 1JG3A 2DT8A 5A6SB 3HCFA 1ZCZA 3THWB 4P08A 5ITVA 4WV3A 4WY8A 5KQPA 2R1TB 3GCXA 3BFKA 1WSWA 4MUHA 1Z0AA 3ZJUA 3S4YA 4Z7NB 2ZWPA 3OEEA 1DIHA 9MHTA 3PFCA 5CVTA 1EVIA 3BDVA 1JG4A 4IFTA 1EJ6A 1DOAA 3LY8A 1F0PA 4P5EA 4WAUA 4PNPA 2OHFA 3CKYA 1QHGA 1IIBA 4IINA 3OY7A 4QARA 1MGPA 3CLKA 4PLYA 4BV8A 3KQUA 3EZFA 1SOUA 1IXRC 5CA1B 2EF1A 3N76A 2WKRA 3JYNA 4KPFC 2ZYDA 4DRZA 1PV4A 3ZUGA 2QZ4A 4F60A 5KO2A 3AB3A 4GH5A 1GJRA 4O4JF 5KMGA 1MBZA 1QUFA 3CLTC 2XDYA 1SPXA 2R84A 3O3CA 4PX3A 2I3BA 2IUEA 1Z36A 5A5EA 4KR0A 4Q01A 3L6DA 5C8XA 1GNQA 5L4LA 2PA0A 4I3HA 2OK7A 4Q1DA 5JBQA 1XRNA 1KK0A 2G72A 3W1VA 4BC1A 3CX3A 2BI4A 1W4ZA 3FJ1A 1YNOA 3LVRE 3FSJX 1UC5B 3NTQA 2OYCA 1KYWA 2EFYA 1N9ZA 3DFMA 3NHLA 2Q2NA 2B5OA 3P4UA 4MIKA 1RAAA 4YJGA 2RGYA 5F23A 1CZKA 2WZCA 3W5SA 2O2GA 3FN4A 4I8IA 3KG2A 1JUDA 2XNSA 3OQVA 5LBIA 4CKYA 3KDAA 1FJGB 1KEWA 3CNLA 4ND7A 4OXNA 3PWTA 1LPSA 1YHNA 2R6ZA 4RW0A 3WA6A 4D5EA 4BMPB 2QTHA 2UVQA 2VPTA 5JOQA 5KWJA 2ZZNA 1AZTA 2OC9A 2JEYA 4DTIA 1KNXA 3RAJA 5EIWA 2PZBA 5AJVB 4HH1A 3KZNA 2ZRCA