2ZI7A

C4s dck variant of dck in complex with d-dg+udp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
240
structure length
218
Chain Sequence
IKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSTGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Elucidation of different binding modes of purine nucleosides to human deoxycytidine kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 218
sequence length 240
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zi7A00
3CR7A 1HYQA 3PCRB 1E96A 2QRNA 1L4UA 2OSBA 4QJ4A 2XGJA 3ZVLA 4DEYA 3SU8A 4P32A 2O5VA 4JLKA 4ZKEA 3B7GA 4TLDA 4G1UC 1P73A 3SQXA 4IKEA 1GRRA 4OYHA 4NYMQ 3MG9A 1E9EA 4LJ8A 1W48A 4AKIA 1I4DD 2BCGY 2DYKA 2VP9A 1EXMA 3DDCA 3NH9A 4RY2A 3X1WA 4JMPA 1QHSA 4ACBA 1MH1A 4AKHA 1KI7A 3N70A 1KOFA 3D8BA 1NIJA 5DI3B 4C0KA 3K9GA 4R98A 2O8DA 1M8PA 5KDDA 3QNUA 5HCNA 4Q4LA 3W8NA 1FMLA 1NIPA 1QF9A 1XD2B 2R2AA 2ZE6A 4RFVA 2ZROA 4O3MA 1US8A 4LJ7A 3OEHD 2FA9A 1EFTA 2FWRA 2VP6A 2QU8A 4XOIA 1FL9A 1AQYA 1XTIA 1II8B 2PEYA 3B13B 4Q47A 4TLBA 2ZS8A 1Q12A 4ZO4A 4Q9IA 4F4JA 3EPHA 4B44A 3SI7A 1Q57A 5EXTA 4R7ZA 1F3OA 2DWOA 4D4JA 1Z06A 3KB1A 3QIAA 1CULC 1ETUA 2QGNA 2ZQ5A 3M1IA 3SNHA 3K9HA 3FOZA 3K09A 2PMKA 1E2PA 1E2IA 1XEWX 1AZSC 4N3NA 3TVTA 4GNKA 4Q7LA 4DSTA 4W5WA 2QMOA 1H8HA 3EWAA 1KTVA 5EZ5A 4O0MA 4B6FA 2R6GA 1ESMA 1P4SA 3B1VA 4OHVA 4QBFA 2IS2A 3CWQA 4BFWA 1MO3A 1QVAA 3EZ7A 2WPDD 3VR1A 1T8UA 1Z0DA 2DCUA 3W90A 1G19A 2WSSA 1RRGA 4BECA 3AF2A 4KJZA 4URZR 1ZP6A 5E7MA 2O8DB 2H17A 4FXPA 2YINC 3DMDA 1E9AA 1Z22A 4G3XA 1AS0A 1KYIA 4AIIA 3KQHA 3UPUA 1US8B 5F3WB 2QI9C 3QBTA 1ZNWA 2J0UA 4W7SA 4IVRA 3M4YA 2TMKA 1R7RA 2QBYA 3UXMA 2Z6VA 5FTMA 2D62A 1JEDA 3JZMA 2AD1A 3K0EA 4RCZA 4BLPA 3NVAA 2IXEA 2FZLA 2J9RA 4LYAA 1E2KA 2GBLA 2JDID 4DCUA 4M9XA 4RD4A 4RZ2A 4XWAA 3PUYA 1G64A 1E9DA 3KZ1E 4JVMA 3CH5A 3EPJA 1KK3A 3VHLB 4NL4H 4PPNA 2GZHA 2W83A 4ZCMA 3R8FA 2H1LA 4UXHA 4PX9A 4Q7MB 2VP4A 1MOZA 3H1TA 1OFIA 1GKUB 3AF0A 4F7WA 2KWIA 4JLOA 2EYUA 4AY2A 4Q9KA 3C16C 2GESA 1ODFA 5G3YA 2KB0A 1VYUA 2J45A 1LFDB 1VIYA 3B2EA 1BH2A 4D6PA 3CNNA 3SJAA 4IXNA 2V1XA 3B78A 2GVDC 4QGHA 3GJ3A 4BRWA 5EXSA 5GVSA 5SZKB 3SQWA 3UG6A 1BO6A 4QHTA 4HB3A 5FUVA 4B48A 2ZUDA 2FSFA 2H5EA 4IDHA 1SXJD 2D74A 4OQNA 5LB4A 2J5XA 2ANCA 1Q44A 4NCJA 1G8PA 2IBMA 4TLCA 1NN1A 3D6TB 1OYYA 4UJ3A 2ZRCA 4NYJR 5FUWA 4JLPA 3IHLA 1ESNA 3KQNA 1XXHA 1WQ1R 2J0VA 5K8UA 1RIFA 2KI5A 4NBSA 5KHOC 2GEUA 2ORWA 1D2EA 2WWIA 4Z1MD 1MKYA 4OQXA 3ZH9B 2HCJB 3JZAA 4ZPXA 2QPTA 3SC3A 4HLDA 3KQKA 1W2HA 2IC5A 4JLBA 2HYIC 2AK3A 5DNYB 1XTQA 1G3QA 4C2UA 4LHZA 5BYJA 4Q1BA 4IJMA 3MSXA 2QUZA 2OE2A 1GM5A 4FMCF 3UWKA 3W8RA 4POAA 1QBKC 2A5GA 1N2CE 5EXPA 2IS4A 3Q72A 1WP9A 2EWWA 2JA1A 1Z0AA 2VSXA 2FG5A 5P21A 2GAAA 1DAHA 1ZNXA 2GF9A 4M9QA 2AFHE 2NO6A 2OESA 3PV0A 1JR3D 4DSOA 2AWNA 3K0SA 4DDUA 3J81k 1GTVA 3BK7A 1A82A 1EWRA 1UBGA 3FE2A 1NY6A 1J70A 2A5FA 3HPRA 1P2VA 4LHXA 1HV8A 3NWJA 3RNLA 2QQEA 3D31A 2FEMA 3OFND 2WKRA 1OXTA 1ZUNB 2GJ9A 1S8FA 2VEDA 4MGYR 2BV3A 4KFUA 1OXXK 3ECCA 3LQQA 1O87A 4HATA 2IYTA 2DWQA 4V0LA 1UKEA 3QXXA 1S9DA 2WJIA 2RKOA 2CCGA 1P9NA 4GMDA 5HTKA 5JWRA 2DB3A 3X2SA 5JECA 5L3SA 1X3SA 1DOAA 3BORA 2GZDA 1XEXA 3NKVA 3U61B 5DE3A 4DLUA 5TARA 4LC0A 4WW0A 1NP6A 2PCJA 5EP3A 4Q1AA 3NIBA 1E2QA 3T15A 3OESA 4QHSA 4B33A 3NDBB 3OF5A 3CRRA 1U8YA 2JLYA 3THWA 5AJXA 2OBLA 4BWYA 1VTKA 2C03A 3CX7A 4JSTA 2JJ2A 4P4UA 3AEZA 1W46A 3I32A 4KSCA 2IYWA 3R9WA 1HH4A 1VG9B 4B3XA 1G3IA 3R9XA 3BFKA 2G9NA 4AC9A 5E7IA 3ADKA 4HEJA 4TYPA 421PA 5AUOB 1DG1G 4A82A 4M9SA 4B2PA 1JPJA 3I5YA 2VTKA 5ELXA 1IY1A 2YWHA 4EFMA 4B3FX 3KTAB 3KXLA 3ONWA 3PFIA 3ZQ6A 3MFYA 1PVOA 1AS3A 3T5GA 4BLRA 4A15A 1TEVA 3F5FA 5SZJA 3MLEA 4NDZA 3FKQA 1LW7A 2VYFA 3OIWA 2FSHA 2OBNA 4OI0A 2IYSA 2XNDD 1N6LA 3WP0A 2IF2A 1XEXB 5L3VA 1VCOA 2P5SA 4Q48A 4Z8XA 2R44A 1XRJA 4B3CA 1M34E 3LVQE 4E03A 2EFEB 5JCZA 2VIIA 1QZXA 4Q7KA 4RVCA 3WNCA 5L3QA 4I1OA 4LV8B 3U44A 1S1MA 5TDHA 4M1TA 4UXIA 4URXR 3THWB 3B6EA 4P4SA 4BZQA 2GXQA 5M04A 1VHLA 1MV5A 4JT4A 1U81A 1Z6GA 1SULA 4C3ZA 1Z0FA 621PA 2ZYUX 3BE4A 1KK2A 3VR6A 3GJ4A 1U98A 4V03A 1NJFA 2IYXA 2NZJA 1M1YE 3RSOA 2C9CA 4JLVA 4IFBA 4TQAA 4JLDA 1GZSA 4IDPA 1OKKA 4NCIA 4PFSA 3QI2A 4IOJA 4QFMA 3WNBA 1BMFA 3MWJA 3H4MA 1U9IC 2JJ1A 5FBWB 2NPFA 3TR0A 1JB1A 4EFNA 2GEVA 5DHAA 4ARZA 3PUVA 1G5TA 3RWMB 2ODBA 3C7KA 3BJIC 5TVKA 1FP6A 1XPRA 2V7QA 1ZUIA 1COWA 1FOEB 1ZD8A 4LHYA 2RCNA 4YMTA 1E9BA 3VU9A 1E4YA 4Q7JB 2Z83A 3WRXC 1XFAA 3C41J 2RGXA 5J4KA 3QKTA 2XTZA 3W6PA 4EPTA 4KSBA 1E2FA 4E07A 4MRSA 2QE7A 1H8HD 3CM0A 3AGPA 5G41A 3RS4A 2CVHA 5L3QB 2O0HA 1PLJA 4DEXA 2AWOA 2IYYA 2R8RA 3AUYA 4TMWA 4NKRA 3LNCA 3SEAA 4LBVA 3CKLA 2WIBA 1GG2A 1MRNA 2ZRDA 1KSJA 1RRFA 2W6JA 3GJ5A 5B57C 5LDDC 1TUEA 4GOJA 1UPTA 3IQXA 4WOPA 2A5YB 3BAFA 1DS6A 3R8CA 4LJ9A 2WSSD 1KI2A 1TMKA 4PO1A 4ZV4A 4XVUA 2F1IA 2QZ4A 1ZBDA 5GJCA 3CIOA 1V43A 2F55A 3TJZA 5AR1A 3N5CA 3JVVA 1E2GA 5KNBA 1GVNB 4RJLA 2NMVA 3AUXA 1U0LA 2Z4RA 4D0LB 2QPOA 4LJ5A 5TB5A 1R5BA 5GVRA 4XTCS 2JLQA 4U02A 3LDAA 4WVFA 1A7JA 2OFXA 2OZEA 3L82B 4JLMA 1KSFX 3SYNA 3O47A 4CVNA 1WXQA 1JNYA 4OQFA 3T06B 4DIDA 2QGZA 1Z47A 3MMPA 4KLNA 2GF0A 2ZYVX 4CEHB 4BZPA 4OK6A 2W0MA 2IWHA 1T3SA 3IIMA 2JLVA 4ZIRA 2ZETA 5FBQB 1I2MA 5GJWC 4TSFA 1IN5A 1SXJC 4PO8A 4PXAA 2B7BA 1LTQA 3PEYA 5H8WA 3CF6R 2FEOA 4LJYA 3MWKA 1E9CA 1S3GA 4HLUC 2C96A 5E4FA 3RANA 1OXSC 2BBTA 3GP8A 3U7FB 2UVQA 4Q4HB 4CGZA 4TYYA 3TW8B 4HAUA 2IUTA 1XCGB 1XTKA 4NYIR 1N6RA 4LBZA 3IGFA 3I3SR 5FPYA 5B64A 4OJQA 4A4DA 4Q03A 3GEEA 1K5DA 3QKUA 3WMFA 3WHLA 2WSMA 521PA 2IF0A 2Q0HA 2BC9A 1RZ3A 1E9RA 2VO1A 3IBYA 4IDQA 1KK1A 1IONA 4ASUA 2FH5B 2FGJA 4LUCA 5FOVA 1OW3B 2FPLA 2NO9A 4IEEA 4EKDA 3KUCA 4DT1A 1FUUA 3KJGA 2HF8A 1ZUHA 3TMKA 2PZFA 4L5BA 4KU4A 4PHGA 1N5KA 4JKIA 4PHTA 1F2TA 1P9RA 2YKGA 1K8RA 4HAYA 3K0AA 1V5WA 5AUQA 2QTFA 4JLAA 4R71A 3THOA 3AVPA 2GJKA 3T5DA 4ZIRB 1L4YA 4A8JB 2ZJZA 2V1UA 5IHPA 4D26A 3AF4A 3LV8A 4Q00A 4C0SA 1RRPA 2O52A 3UMFA 4A0GA 3REFA 1CF4A 3VKHA 1N0VC 1XD9A 2BDTA 4PSAA 5G40A 5E3HA 1TX4B 2WKPA 2WWWA 2VQSA 3DL0A 3U3JA 1K6MA 2O8CA 4EPVA 4UNPA 1YRAA 2P6RA 2AD5A 4DLTA 1N6HA 4IHQA 2ZSDA 3LBIA 3KQUA 1IXZA 2DFTA 5SZHB 4TTPA 2PMDA 3RRNA 2OM2A 4Q4AA 2GK7A 1JECA 1I2DA 4QJ3A 2BHRA 3GD7A 5C2JB 2WWXA 2RHDA 1OSNA 2Q9CA 2QEQA 2REBA 4N0DA 2DBYA 1JR6A 1P2UA 4IOMA 2OLKA 1OF1A 1N6IA 2GJ8A 2IHYA 2OXCA 2QORA 2ORIA 3I8SA 2KBEA 4DT1B 3H0KA 2C98A 3FMIA 4TL8A 2F1RA 1UKYA 2O8EA 5CM8B 4HI0E 4QOSA 4Q18A 2C5LA 1CXZA 4MRVA 4Q21A 4I4LA 2ONJA 2ZE7A 1S0UA 3K0AB 4HYYA 4Y0VA 5CITA 1OB5A 2BMJA 5JSZB 1MO6A 3X1DA 4DLZA 3ZVMA 1TADA 5FTKA 2CLSA 1G7CA 4DCSA 4NCNA 1E0KA 1GOTA 4G5SA 4DKXA 3TR5A 1Q21A 4NHOA 1NN0A 4O2RA 3MD0A 1QG4A 1W4CA 2BEJA 4W5HA 2JJ2D 1E0AA 1TTTA 3PENA 2OFWA 4NPHA 1XMIA 2ZAMA 2O8CB 4QKQA 3R9IA 3GLFB 2CE2X 3B1ZA 1KO1A 1N3BA 4URUR 4PHFA 3EG5A 4XJXA 4LV6A 3VQTA 4Q4AB 2WM9B 5FOWA 3SZRA 3RRMA 1W36D 4DLXA 5L3RA 1Z0KA 2IXGA 1II9A 4Z51A 4NCHA 4ZCLA 1DO2A 2WTUA 1SQ5A 1M6NA 1XTRA 2XB4A 4MKGA 4MUAA 3I62A 3A58B 1SVIA 4F93B 3WMGA 1NY5A 5HR5A 4AKGA 1EX6A 3WMEA 3CRW1 1TUIA 2O8EB 4Q19A 1OXUA 3EARA 5IK2A 4OQLA 2R65A 2RGAA 2VSFA 2ZRFA 4NYJQ 3ZIAA 2V8OA 4C0HA 1OT3A 1G8GA 1MRSA 2J0SA 1KJWA 1ZU5A 2Q3HA 3W5IA 4Z8YA 3HU2A 5HE8A 4C0LA 1X8KA 1T5LA 2N1BA 1OE0A 3SS8A 1N5IA 4EJSB 3LAWA 2FFQA 1KNQA 4MRPA 4D81A 2CL7X 2OFOA 2CBZA 2J1LA 3KB2A 3LX5A 3QOFA 1KI6A 1VECA 2BMDA 4TL7A 3BGWA 2UZ3A 4V0ME 3THXA 3IO5A 1DBSA 3LBHA 2Q6TA 1OKKD 2CVFA 3QXSA 1PJRA 1CJKC 1BMFD 4Q9HA 5FTNA 1FTNA 2ZJ5A 4DZZA 3K09C 1GP2A 2JJ1D 4M0LA 4OHXA 1ZINA 3TK1A 5HKKD 2PBRA 1M74A 3EAQA 3VX4A 2DY1A 2YC4C 4AYXA 4HDOB 5FOTA 4E09A 2ZI6A 4C0BA 2V7QD 4PSKA 3E70C 1DAFA 1XD2A 1WE2A 1TEXA 1COWD 5JLJA 2ZR7A 1NSTA 1KO4A 4Q1EA 3SHWA 3CO5A 1DTSA 1T5IA 3AKCA 5JRZA 4RFSB 1II8A 2WWFA 3O8CA 1EGAA 1D2MA 4FCVA 2I1VB 4GZMA 1KNXA 4JKYA 4HAXA 4KXFB 1XTJA 4I99A 1J8MF 2BBOA 4E22A 1ZMXA 1RC8A 4Q1FA 1GILA 3KJIA 2C8VA 4P4TA 2JCSA 4XIGS 2ZUCA 3FMFA 2V4ZA 1G3MA 3PXGA 5FOSA 1KDRA 3LFUA 2ZYTX 2W6JD 1R6BX 1Q1BA 2W2XA 1UFQA 3TQCA 3A1WA 3GFOA 4JL8A 4GT1A 5CDFA 1KI6B 1C1YA 1SVKA 4A9AA 2GBLC 3R20A 5HZHA 4MDEA 3Q7QA 3THXB 1OIWA 1ZM9A 2JJ8A 1Q3HA 2OO7A 1U0JA 4B3GA 2VHCA 4EIWA 3A36A 3EA0A 3EW9A 1LF0A 3LVRE 5DIFA 2BJVA 5J5CA 3W34A 2WHXA 2YOFA 5A0FA 3QEJA 1XJCA 1N25A 1TPZA 2R6CA 1QVRA 4CDGA 4BGDA 2HYDA 2OCYC 3DKVA 2XZLA 1KI3A 4PZZA 2D3WA 5K8TA 1DAGA 5EXXA 4A0FA 3UK6A 2KBFA 1G16A 3QG1A 2VHQA 1XMSA 2G0NA 3KKOA 2KJQA 3IKJA 4B3BA 1XDBA 5KSPA 1HQYE 4F91B 3U7EB 4LRWA 1TNDA 1GAJA 1TQ4A 4RD6A 4ZI2A 1SZPA 4FIDA 3TIFA 3BRWD 2NPIA 1YRBA 2QP4A 2X2FA 1TF5A 3FMPB 4S35A 5BN5A 2PX0A 2NIPA 4I1UA 1YZQA 3RSLA 4Q5IA 3KFXA 3T35A 5F9FA 1G41A 4TSFD 1DAKA 1ZC4A 3LO5A 4MYCA 1E3MA 2CHQA 2MMGA 1FX0A 3VHXA 4EUNA 2QAGB 1Q1ZA 2DFNA 1RFLA 1MABA 1XEWY 3Q7PA 1U8AA 3GLHE 3ZVRA 2H7VA 1U0HC 4XSHA 4ITRC 2P5TB 3U4QA 1ZCAA 2IL1A 2FZ4A 2EFHB 5FFMA 2ZI5A 2ZRNA 3RRZA 3B1XA 1O3YA 1VCNA 1KI8A 4HUTA 1M2OB 2GK6A 3VR4A 2XEXA 2WWYA 3QF7A 2PEZA 1CS4C 2ORVA 5FBLB 4ASUD 2HJVA 1W1WA 2HEIA 3PQCA 1Z8FA 4NONA 4HLCA 1NKTA 4D80A 4K46A 2XNSA 1OFHA 4FD2A 1ELOA 1JAHA 2A9KA 3A4NA 3ZS9A 4YQFA 5IRCD 2I1QA 2ZM5A 2WOOA 2JLWA 1ONBA 3C14C 2QRZA 1CR1A 4GFDA 5FPTA 4A2PA 3LW7A 3NBFA 2IHBA 1HUQA 1BYIA 1NBME 3KDSE 8OHMA 5L8VA 3U3MA 1YZLA 1TQ2A 2YVUA 3PEVA 3AVVA 1OH5A 1VPLA 2GAOA 2PT7A 3ETLA 3NBXX 5KSYA 4C4PA 4F92B 1HE8B 1Z83A 2EU8A 1II0A 1KJZA 1Y3AA 1FX0B 4MQBA 2XTMA 4TZ6A 2GCPA 4CT4B 1MABB 1VYVA 2J7PA 4ESVA 1RRCA 4AYWA 4CF7A 3RS3A 3C4JA 4I81A 1DPFA 1GFIA 1LY1A 3U4QB 3RVBA 2F7SA 4PC7A 4HLQB 1CR0A 3HJNA 3IEUA 1BOFA 4XWKA 2GNOA 2XJ4A 1VIAA 4X8HA 5JWHA 2QNRA 1R8SA 1F5NA 2FMXA 4RCYA 3ZGXA 2ERYA 1G291 5GJVC 3TSOA 2EFGA 5J4HA 1SVOA 2IEZA 2WAYA 2FJUA 2WAXA 4C7OA 3ADBA 2PH1A 1Z6XA 2NOAA 1TU3A 1ZIOA 1G8YA 1DELA 1YU9A 2ATXA 4KVAA 1EFUA 2MSCB 4FI3C 4ABYA 4TLEA 4DXAA 4CT5A 3CPHA 2G6BA 3G82C 5LB2A 5LD2B 2RGGA 1M7HA 3ND9A 1JI0A 4K8OA 3SYKA 4D2IA 2YWEA 4IDOA 3ZVNA 3SJCA 1B0UA 1T0JB 1KY2A 2VP0A 4DIEA 1OLOA 2JLUA 1W36C 3Q9LA 1W5TA 1H8EA 3P1JA 1XTSA 1KI9A 3PVSA 1GWNA 4QGFA 2BKEA 1W0JA 3W9YA 1E94E 1FMJA 2CHVA 3ZZUA 3QPVA 1R0ZA 1UDXA 3FWYA 1QHNA 4XVRA 3I5XA 4L4UA 3SHFA 4BFYA 4D4MA 2R62A 1NMXA 4PC6A 2RMKA 4RZXA 3A1TA 4FWIB 1FP7A 3PJRA 2XITA 3RABA 3C5HA 3T1QA 1FW6A 3LLMA 5KDLA 2K5UA 1J7KA 5JJIA 4KV9A 2PL3A 4NYIQ 1IBRA 4AYTA 5CB8A 4C7OB 4GSYA 2G0TA 1M7GA 1AS2A 2ZRBA 3I73A 4DB2A 4JL6A 3CX6A 3VKGA 4X8OA 3L0IB 2A5JA 3KTAA 3QPWA 2ZI3A 5IK2D 2RHMA 1OYWA 4B47A 1E9SA 4KI0A 1F6BA 2X77A 1EK0A 4M1MA 2CHGA 4D4KA 2X2EA 1W7AA 3ZIAD 4G5GA 4J0QA 4LJAA 1IXSB 1UEJA 1NSFA 4M1YA 4GBMA 2ZI9A 2ZS9A 3LD9A 4DVGA 1P72A 4PTLA 3KXKA 3T1TA 2CK3A 4IFEA 4DDWA 2JAQA 2CDNA 3UMSA 2AR7A 2QL6A 3BOSA 3G0HA 1CIPA 1LNZA 4LYHA 1F2UB 5DO9A 4TL6A 4O2LA 3PITA 4GDFA 4B74A 1E0JA 4UKDA 2V54A 3K0FB 3U3OA 4CYMA 4O25A 1XP8A 2DFKB 2XXAA 2FV8A 1IN7A 2O0KA 2C78A 2I3BA 3I92A 3TUJC 4QC2A 2P65A 4TQ9A 4LSGA 3L0PA 1SVSA 3CX8A 3CZQA 4IOLA 3RWOA 2VP2A 5EE9A 2BEKA 3Q85A 3EIQA 2F3TA 2FDCA 3B60A 4F38A 2NQ2C 1X1RA 4PPFA 4MDFA 4LY6A 5JJLA 4DC9A 5GADl 4B35A 2W6IA 1A2BA 2GTPA 5GJBA 1DVRA 2ZS7A 3AB3A 1GL6A 4TT3A 4JBXA 3GLHB 3FFAA 5C4MA 3CUEF 2G88A 1G3UA 1OIVA 2CE7A 5FR2A 4ZDWA 3OIUA 1VCMA 4MRNA 2IS1A 4HB4A 2FSGA 1KO7A 1Q0UA 4OK3A 1C9KA 4RSGA 1CJUC 3L43A 3IILA 2CEAA 2IEYA 3SJZA 5IF9A 2WMNB 4WZBE 4M9ZA 3ZD7A 5JS8A 4KFSA 4CEJA 1P6XA 3PEUA 1CRPA 4U7DA 2J46A 3LW8A 2JATA 3CF2A 2A2ZA 2XXAB 3HDTA 1Z2AA 1ZYUA 3SFVA 3SN6A 2X19A 4MKIA 4A1FA 4BLOA 4M21A 4ZKDA 2XB2A 2L0XA 2O8BB 2FOLA 4Q9JA 4BFXA 3BH0A 1Z6TA 4DLRA 1T6NA 1EG7A 5BXQC 5J4VA 1JALA 3IHWA 4NZYA 4V0OA 5AJZA 3L8ZA 2RGNA 3D3QA 3AVTA 2B8WA 1DARA 1KI1A 3VAAA 3E5HA 2Y8EA 4DJTA 1Z07A 4PR0A 3GLFE 4MGKR 2HCBA 1IHUA 1HT2E 5EE0A 2XX3A 3HWSA 3DPUA 4LBYA 3SOPA 3MGCA 3QE0A 4HAZA 3QVVA 2MSDB 3VNVA 4NH0A 2GZAA 2V6JA 1WRBA 4CEHA 2VA8A 1Y63A 2CMKA 1D2NA 2QQ0A 1L8QA 3ZQJA 3FYHA 4CEJB 1A2KC 3TE6A 3TVDA 5CLLA 5FR1A 4IVQA 4LC1A 121PA 3SJBA 3LXRA 5C18A 4G5OA 2A78A 5KNDA 1G9XA 4FMCB 4C9BA 2W2VA 4Q4HA 4QNMA 1NMYA 2LWIA 1NLFA 1NL3A 5HPYB 4B34A 3WYFA 2GWHA 4QG7A 2AXNA 1KSHA 4LJ6A 1G7RA 4DBLC 1U94A 4BZXA 2KSQA 2ASEA 3UIEA 3THYA 2B21A 4DDVA 3DZDA 2AFIE 2ZE8A 5EE3A 4PAMA 2ZU0C 4AURA 4KODA 1HQCA 3U7GA 4XVQA 1TF7A 3RS2A 1YR6A 4OI4A 1RPZA 4BFSA 1JBKA 4QXAA 2H92A 3BIFA 5AWFC 1E1QA 1WB9A 2ERXA 3B85A 4KFTA 3M0EA 4RD1A 1BIFA 3AGQA 2GILA 1OXVA 4PAOA 3A1SA 5H70A 2OEPA 2G1JA 2A5DA 4YMUA 1UKVY 3GJXC 1G3RA 1KAGA 1J90A 3GLGE 1Z63A 2E1RA 3AF1A 1N6OA 1SKQA 5CK4A 4WAUA 4EQ6A 3MJRA 1HT1E 1UF9A 3E2IA 1MR3F 2E87A 3C5CA 1CLUA 1GRQA 3QY0A 4RZUA 3WYGA 4A8JA 2J7PD 2YHSA 3P32A 3A6PC 1N6NA 4QRHA 1QHHA 4PC3A 5J40A 3L2OB 3OZXA 4LV5B 4G5QA 2EFCB 3OEHA 4OHZA 1OH7A 3RC8A 3QQ5A 1Z6AA 2QP3A 3BBPA 1EFRA 1A4RA 2BBSA 3K53A 2Z43A 4GOXA 2F9LA 5LPNA 2FGKA 2HF9A 5BW8A 2BBWA 2IUUA 3X1YA 1E6CA 2AL7A 4KAXA 4DWJA 1GDDA 3THYB 4FMDF 4LYFA 3KKNA 3EA5A 3P26A 1QHIA 1YE8A 1AGRA 3JVUA 4L9SA 1CU1A 2NTYC 3N2EA 1NN3A 3LX8A 1TF2A 4RKEA 4Y0AA 5D3QA 4OHWA 1JJ7A 3VMFA 5DN6A 5SZIA 3QSYA 2AXPA 2F3RA 1Z0JA 2ZREA 1WBBA 3K70B 2WJVA 4IRUB 2D4HA 2FPKA 2W0SA 4KVGA 3GEHA 3RS0A 5FTLA 3FPAA 2VLIA 1G6HA 1H8ED 4EQ6B 4ZI3A 1ZIPA 2NGRA 2MSEB 2QT1A 2CL0X 2ZITA 3OEEA 2D2EA 1XJQA 3PG5A 5JSZA 1W0JD 2HT6A 3CNLA 3OIYA 1QHHB 3TLXA 2O8FB 2BMFA 2YWGA 2WBLC 1J8YF 5B2ZA 1WMSA 2PZEA 1NVXQ 3K1JA 1X6VA 2ZRPA 2ZRJA 1RYFA 4Q02A 5KNCA 1MT0A 1W4AA 2C95A 4DSUA 1TQDA 2OT3B 4GZLA 3L8YA 2HLDA 2Q9AA 4EPWA 2FNAA 5AJYA 3GLFA 4BEJA 5EJEA 2IW3A 1P3JA 4FCWA 3SE0A 1IN8A 4OL0A 2HDNB 2P6NA 2XZPA 3DMNA 3IIJA 4L8GA 2HV8A 2RGBA 1QHGA 1T9HA 1XBTA 2B7CA 4K81B 1CTQA 4XSGA 5JJKA 2W00A 4LGMA 1HE1C 3QVUA 4LI0A 2QMUA 4HZUB 1VCIA 1E9FA 4WIAA 2QMHA 4JLNA 1FUKA 1Z0IA 2GRJA 2PCLA 2C77A 2BKUA 3I72A 3W3AA 5JZVA 3B8HA 3BWDD 2Q9BA 1E2EA 2CK3D 2QM8A 2P3SA 2JLRA 2QSYA 4TL9A 3UKDA 1WBDA 4I1SA 3S1AA 3ND8A 4KLZA 1OH6A 2LKDA 1OJLA 1UJ2A 4G0NA 1DAMA 4KYIB 4II7A 3CW2A 4US1R 1Z2CA 5KYKA 2JGNA 5JFGA 1ZNZA 1PZNA 1LF5A 3T61A 3LWNA 1QRAA 2ZVQX 1AKEA 2YJTD 3VX3A 1SKYE 2XSZA 1E2NA 4EJSA 2FF7A 4JVSB 5FI0B 1K5GA 1GIAA 2ECKA 5CB6A 3A1UA 1T4GA 2J3EA 3KJEA 1WDTA 4QBIA 1NVVQ 4OI1A 1C4OA 4HZIA 1GKIA 4IVPA 1GNRA 3V00A 2GXAA 2CJWA 1LV7A 3GLGA 3A4LA 1R10A 1SVWA 2ZEJA 1G7SA 1NVUQ 3K0CA 4HUQB 4W9MC 1AIPA 2H18A 1IOZA 1TAGA 2W6ID 3CRVA 3FB4A 4TT3D 5D3MB 5DH9A 4A0HA 2AHOA 4P31A 4HAWA 4C30A 2F1JA 4UNQA 1YR8A 4UQOA 3FMOB 4TYQA 1J99A 1G6OA 2PJZA 3F8TA 1XU4A 4RFSA 2VHJA 1ZAKA 3S1AB 5DLQC 4B75A 3UWOA 2GXSA 4MYUA 2XZOA 2OV2A 3BXZA 2BM1A 4PAQA 1CR2A 1YQTA 1S2MA 1ZNYA 3QKRA 2IWRA 2C9YA 1YZKA 3CWZA 1PUIA 3LBNA 4M1WA 1KMHB 4QM6A 4JT2A 3TQFA 3WY9A 4H1VA 1XPUA 3KJHA 4BPBA 4DLSA 2ATVA 3KXIA 1TU4A 3A8TA 3AKEA 3QUSA 5EE5B 1CBUA 1CKEA 1ZCBA 4JYBA 1R0WA 2HJGA 1Q3TA 2WJGA 1IM2A 4M22A 4P3YA 2CLDX 4TWZA 4A2WA 2QMEA 2CJWB 3HYTA 5EE1A 3GLGB 5FH9A 3L0SA 3WP1B 2QTVB 4GOKA 2PJRA 3X1XA 3OAAA 3KFVA 1LS1A 4UJ5A 3TH5A 4WXPA 1E69A 1G17A 1YZTA 1Z5ZA 5JEEA 5J4YA 4OBEA 2ZSEA 2ZIAA 2ZRKA 1F60A 1NKSA 1VDZA 1KJYA 3B5JA 4JS0A 2ZYWX 4QNRA 1IQPA 1U8ZA 3IDQA 4PANA 1W2GA 5CIWA 4MGIR 4PPQA 5A5GA 2F43B 1KMQA 1LB1B 2HXSA 1T8TA 3KUDA 4C0QC 2QPAA 2ZR9A 1DO0A 3MRSA 3V4RA 4XD7A 3GJ7A 3R7WB 3ADDA 3DKPA 5CJPA 3QEOA 3CNOA 2BIFA 3HP1A 5E7JA 3TGPA 2QE7D 2F1HA 1ZJ6A 4KFRA 3QKRB 2C04A 4KHZA 1Z29A 4AI6A 4D0NA 2GCOB 4OJKA 1NF3A 2XOKA 2BCJQ 3EZ6A 4LPSA 3LA6A 4M1SA 5KTYA 5TV2A 3AVWA 1HEIA 2QAGA 3HR8A 4A6XA 1T3HA 1R2QA 3NEYA 1OB2A 2RB4A 4ILEA 2B6HA 4LYJA 3FHTA 4M1OA 4B6EA 1N0UA 1Q22A 4A0RA 1FTSA 2QP9X 2ZRAA 5FPHA 3DHWC 3I61A 4RZ3A 3GEIA 3K8YA 2AX4A 1E1QD 5FL7A 5BQ5A 1IAQA 2ODEA 3I4LA 2EFDB 4ZDKA 2WIAA 3QG5A 4QBHA 4MRRA 2KE5A 2R9VA 1XXHE 3GJ8A 3PUXA 5UKDA 3CRQA 3K70D 4B3DA 1A5TA 4G5RA 1SVLA 2EYQA 3BH6A 5AJVB 2AKAB 3T12A 2Z4SA 4V02A 1EWQA 2GJAA 2WMOB 4TTQA 3H86A 3ZZ0A 2YC2C 2IT1A 2LKCA 3B82A 3MJHA 2PLRA 3NBYC 1R0YA 4MKFA 2JLXA 2XAUA 2AN9A 5DISB 2SHKA 2AK2A 2G83A 4ZDJA 1D5CA 1L2TA 5EUQB 2OG2A 4JVNA 4TMKA 1NLYA 2ZJBA 1QG2A 3VKWA 4CIDA 1G21E 4DHEA 2GKSA 2QN6A 2QAJA 3DM9B 1E4VA 1D9ZA 2YWFA 1CR4A 2CCJA 2C99A 3CR8A 1X1SA 3AKYA 3MAAC 4JBYA 2ZTSA 5AUPB 1JPNA 2REOA 4NU0A 4XWOA 4URVR 3M6AA 1EFRD 1JQLB 1XD8A 2OAQ1 4BRUA 4ZCIA 1XMVA 2YYZA 4Q01A 1NG1A 2FPMA 1VG0B 2PT5A 4HDQB 1Q1QA 3QPUA 4GRAA 1KY3A 2CLCX 1AK2A 1QDEA 2I4IA 3EC2A 1W0KA 1UBCA 3LQRA 1X86B 4Z54A 5FUXA 2ZU6A 5BN4A 2R6DA 5JMTA 5JS7A 4FWTA 2IYRA 3AM1A 4GMXA 3DEFA 3NC1C 4BFVA 4Q1CA 5EQTA 4EPXA 1XMJA 5DN6D 4RKFA 4WXRA 3LH5A 2J41A 3LLUA 5B30A 3ICEA 1HURA 1P9WA 1OPXA 2J59A 3BC1A 3EIHA 5FI1B 5TMPA 2JLZA 3GMTA 3V4FA 5FL3A 1SKYB 1WF3A 4MYHA 3RAPR 2O0JA 1U90A 2ZRHA 1ZC3A 3OEED 4BFTA 1E2DA 4GL2A 4U5XA 3ZDQA 1N5LA 5CJ2A 3X1ZA 5CM9C 4YDHB 2OUKA 2VH5R 2WOJA 4WBSA 4V0MA 3TAHA 5J47A 2P0EA 1ZD9A 1P2TA 4AKEA 5AK0A 1KIMA 5F98A 4YXWA 1JAIA 2OXRA 4QGGA 3VFDA 2ZI4A 2WZQA 4ESHA 3RHFA 3BFVA 1FNMA 4MGZR 2WICA 2HLDD 2ODWA 1GSIA 4MKHA 1VG8A 3KL4A 4KBFA 4AG6A 4E5UA 1E1RA 1NVVR 4LX0A 1LVGA 2OCPA 1DADA 5EP2A 3B1YA 3TRFA 3ICQB 1UBEA 1U2RA 4PHHA 2PZGA 2VL7A 1UEIA 4NCKA 2EW1A 3W6NA 2NO0A 5IT5A 2DR3A 1P75A 2WVJA 1KKLA 4H9GA 1KK0A 1GL9B 4B73A 2F6RA 3TBKA 5KUTA 3U6BA 2ONKA 2ZJ8A 3MWYW 3VR5A 2Q21A 3F0TA 4CW7A 2VP5A 3DVLA 2YOHA 2WV9A 4Q9LA 3VR2A 2WWGA 4TMTA 1W47A 4JZKA 4S2EA 4AD8A 4B2LA 1P5ZB 3B1WA 4NP6A 5FOXA 2GDJA 1VYTA 1QHXA 4Q4JA 1E2HA 3TW4A 2VBCA 3I8XA 1CJTC 5E95A 1D8TA 4PO9A 1JJVA 2V55B 2D06A 2NG1A 3AH8A 1KKMA 2UKDA 4L9WA 2ZRMA 2J0UB 2X1VA 3DO6A 1HTWA 4YDSA 2FX3A 3EZ2A 2XSZD 4URWR 1AJEA 1UKZA 3ZJYA 2QBYB 4V0KA 5K8IA 4LZZA 5C46F 4QBGB 1F2UA 1N0WA 2IA5A 2RGEA 4R9UC 1EFCA 3B9PA 1P7CA 5AJWA 1W49A 3K0FA 1IY2A 1OH8A 3TSWA 1ZU4A 1QHYA 2ZJ2A 3SBDA 1Q1EA 2C2HA 4TTRA 4DLWA 4HAVA 3WRYC 3AKDA 5JWOA 3KQLA 2W58A 3DM5A 3O8DA 4OKSA 3U3RA 5C1BA 5BN3A 3QF4A 1Z6YA 2BJWA 3P4YA 2ZSBA 2FE4A 3Q8XB 1CRQA 3FHCB 4YONB 1FFHA 2WKQA 3B9QA 4DB4A 3PIRA 2OAP1 1N5JA 3QXJA 4TYWA 3TUZC 2ZSAA 1PLKA 1IXRC 4WA7A 4DSNA 4HB2A 2OCBA 1MO4A 4BFZA 3GFTA 2QENA 3H2YA 1GL7A 1YZNA 1G20E 3U2QA 1XEFA 3GLHA 4Q4JB 4YMWA 2IX3A 4Q1DA 1G5PA 3Q5DA 2OCAA 1BYUA 2RGNC 1AGPA 3CONA 4QHYA 4UNSA 2VRWA 1R5OA 2GHIA 5H68A 3A1VA 1G5RA 3SYLA 2ZJYA 721PA 3W6OA 4YLGA 4LBWA 3BD9A 3NEJA 2HUPA 4C2TA 3CRMA 1NN5A 1SHKA 1R4AA 4KBGA 1U99A 2VF8A 3BFXA 4A6PA 1XXHB 5LBIA 3T1OA 1XJ0A 4FMBB 3MCAA 2IK8A 3BERA 4L16A 3RYTC 1OIXA 4LJ4A 2O8BA 4AWXA 1OHHA 3IUYA 2EWVA 2GA8A 1YR9A 1SVMA 4OQMA 3OAAD 1NBMA 2ZRIA 1B23P 2HXYA 2DFLA 5KSZA 1G8HA 1UAAA 1FQKA 3QXCA 4TZ0A 2P2LA 3HYRA 3QF4B 2FFBA 2R6AA 4JLJA 4NYMR 1PLLA 1RVDA 1A1VA 4TMXA 1P62B 1OV4A 2RH5A 4WZ6A 3BH7A 1KAOA 1ZRHA 1KZGB 4PC1A 4PQFA 1DAEA 4XD7D 3CPEA 3ZYCA 2PLFA 4PZYA 3RLFA 3V9PA 4ERNA 3FDIA 2Q3FA 5FTJA 4B71A 3EPKA 5EP4A 2XOKD 3FTQA 3FKSA 3NBZC 2VSOA 1GRNA 2ZI7A 4BE7B 3VTKA 1H65A 3SR0A 1DG3A 1Z3IX 2RGDA 1DE0A 5JHGB 3A37A 3AVOA 4W5JA 4XH9B 3W5JA 4DCNA 3K70C 3ZLJA 4IOKA 5HCIA 1G4AE 2ANBA 2MMCA 1NVWQ 3EC1A 3QBVA 4TN1A 4JL5A 2H16A 1D6JA 4MITA 4D4LA 1E79A 1CP2A 1EFHA 3ZD6A 5L3SB 2X8AA 5B58C 5KPJA 1Q20A 1JQJC 3C8UA 4M4SA 2V3CC 3UANA 1HY3A 2JIZA 5EZ6B 1E0SA 2ZVPX 4A8JC 3DZ8A 5FL7D 2VHTA 3E1SA 3MWLA 4IDNA 4TQUS 5DHFA 1XNJA 4D25A 1KDPA 1XCPA 3AVQA 1KDTA 2QA5A 4LCBA 1NMZA 3IQWA 2ZSFA 1TQ6A 1ZM7A 2CXXA 1KSGA 3BS4A 3EPLA 3KKPA 5DYIA 2DWPA 4EDHA 2CNWA 4PQYA 1XWIA 1W4RA 1E2JA 2IXFA 5G3ZA 1ZM3A 1W36B 1ZVQA 1WA5A 4IW3B 1KGDA 4U00A 5HKKA 1NG9A 3AF3A 2OLJA 4NMMA 4RD0A 4DUGA 3EZFA 4PQRA 4X8MA 1ANKA 1M7BA 3OE7A 1EESA 2OBMA 3CH4B 2QT0A 5TXGA 3KKQA 1KI4A 4UXJA 1W0KD 2WJJA 3CPJB 2ZXUA 2ZRLA 1EX7A 1GITA 4URYR 4DLYA 4BFUA 3GCGA 4US0R 3EX7C 2YZ2A 3BB1A 3HR7A 4KCGA 1XZPA 2F9MA 3IPXA 1JXOA 3L0OA 3OHMA 5CYPA 2IYVA 3U44B 2QM7A 4PC2A 2E9SA 1IN6A 1SXJE 5IDVA 3U3KA 1XX6A 3QJYA 2ZRGA 4HDCA 4P4SB 3ZZTA 4UNNA 3PUZA 5JI3E 4TYNA 4B76A 221PA 4ZDIA 5J4LA 1RW4A 4GP6A 2NO1A 3WHKA 4LK2A 2NO7A 1MO5A 1I4LD 2GVZC 4MH0R 1XPOA 3IIKA 1RE0A 5CLQA 2ZUBA 5HE9A 1WCV1 3TAUA 3Q5EA 4CRWB 5BYKA 3P20A 5EUMA 5JRJA 2R6FA 1P61B 1KDOA 2J7KA 3K9LA 4YXWD 3EIEA 3U5ZB 1FQJA 4L15A 3AP3A 4JSYA 3GJ0A 2CCKA 2N42A 3N2IA 4ARZB 2JASA 3UATA 2O8FA 4GP7A 3FGNA 1E1RD 2A30A 4IEIA 4X8LA 2IYUA 1X8LA 3VU9B 1P2SA 2C9OA 5FBRB 1YKSA 3LXXA 1E99A 3MUFA 4P0TA 3KX2A 4HB0A 2N46A 4JBWA 2J87A 4V0NA 2J0QA 2EVWX 3H84A 3AVYA 4YC7A 1YJ5A 5ANRB 2Z5FA 3BB4A 1JR3E 3T34A 3GLIE 1R8QA 5F2EA 2QG6A 3NDPA 4B32A 5JBQA 1KO8A 4JJKA 1KO5A 1CEEA 5DSZA 5H1YA 4FN5A 2HT1A 4EJSC 1FZQA 1U9IA 3NC0C 2Z0MA 1G1MA 5JI2E 1FPMA 3Q3JB 2D7DA 4HZUA 1CJMA 3NH6A 6Q21A 1IJEA 4Q66C 4ACAA 3RRYA 3NTUA 4F4IA 1XZQA 3K9NA 1D9XA 5KDOA 2BM0A 1S9HA 3G5UA 2B92A 3AP2A 2IS6A 3CF0A 1ZW6A 3EASA 4GI7A 1NLZA 3UG7A 5EP1A 4WZAE 3DOFA 2QSZA 2LCFA 3HU3A 3K0CC 1UBFA 3HPQA 2WPDA 3CBQA 2WWHA 3NHAA 4R2IA 1VMAA 3GPLA 2OILA 5CYOA 1T3LA 3EZ9A 3AQ4A 5FUYA 3VNUA 4BASA 5C4GB 5K8LA 821PA 1T0HB 1E98A 4H1UA 5KO2A 2D2FA 2P67A 4NTZA 4BQSA 4MA4A 2G1KA 2XJ9A 4A92A 1IJFA 4DCVA 2GXUA 1N6KA 3FVQA 5JCPA 2GEDA 4JYCA 4XTRA 1PUJA 4BUJA 1T91A 3AVUA 2A7QA 4D0GA 4M8NE 2VF7A 2JDIA 2EQBA 1AA9A 3SBEA 4EAQA 4TLAA 3IBGA 1E32A 1UM8A 3QENA 3O8RA 3PUWA 4PPGA 2YNMA 3ASYA 2QROA 1YZUA 2BOVA 3RC3A 4KO8A 1W44A 4AK9A 4KITB 3D7MA 5FPSA 4HUQA 2UZIR 1W4BA 3BB3A 3CZPA 4HSEA 1RYHA 5D3MA 1BKDR 2DHRA 4LOAA 5CK5A 4OK5A 1AN0A 1BS1A 1AZTA 1G18A 3AV0B 1S1CA 2NZ8A 3QKSA 2RAPA 3FFBA 2ODNA 2RGCA 1JXMA 2IYQA 3RS5A 4PZLA 3A4MA 2IUSA 3NG1A 1AQUA 2Q3MA 2DPXA 3CB4A 3KKMA 4KYUA 1PV4A 4TMZA 4EPRA 1P60A 1SGWA 5CDFE 3NHBA 5FBVB 3ZS8A 1FNNA 1X8JA 2FU5C 2CL6X 4QJ5A 1KMHA 3QXHA 2H57A 3U7HB 1OFTA 4DRZA 1G8FA 1KHTA 1DAIA 1SXJA 4LPKA 1AKYA 1OHHD 1ZM2A 4AG5A 2BVNA 4HLUA 4DDTA 3SFZA 1F2TB 1NBMD 2YV5A 3PR1A 1S4QA 4LHWA 1R5NA 4GPTA 2G77B 4YMVA 1DEKA 3WYAA 3HU1A 1S3SA 2H8KA 4US2R 4EPYA 4Z1MA 5AUNB 1N6PA 2IYZA 3WBJA 5A4JA 2FFAA 1XF9A 4N0EA 3GQBA 1AM4D 5FOUA 1TL7C 2QAGC 2GETA 2BWJA 2FN4A 4P33A 4OHYA 4NE2A 5CIQA 4IXMA 5FPKA 5DI9A 1Z28A 4DLVA 4JVLA 4M2LA 5KU1A 4FW9A 1W5SA 2WJHA 3QKSB 1G4UR 1GUAA 2F43A 2QTHA 1E2LA 3FKSD 1Z08A 1YHNA 3WBKA 5JHHB 3IPYA 4CEIA 3R7WA 4C0JA 2ZR0A 5G53C 3P4XA 1SHZA 4QGAA 4BEBA 4MUBA 2YOGA 3U60B 3IEVA 3EXAA 4OI2A 3GLIA 3VR3A 1JR3A 2GCOA 2FSIA 2GJSA 3AVXA 3WXMA 1IN4A 1G7TA 1ZD1A 1KZ7B 3PEWA 1SXJB 1E79D 1R0XA 1RKBA 2PX3A 3CLVA 1NJGA 1GKYA 2ZAOA 4M53A 4QL3A 1RJ9A 1NI3A 4I1VA 3EWSA 3OFNA 4BLQA 2JIZD 3U6KA 4LDJA 2W2TA 3RS7A 4C0AC 4A36A 4BLSA 4JIMA 2JEOA 2BMEA 2ZANA 3NXSA 2ZJAA 4N1AA 2VPPA 3REGA 1NRJB 3P27A 4B43A 3WNDA 5KOYA 4FMDB 1YR7A 4ON9A 1CJVC 1LS6A 3W3ZB 4JJZA 2ZPTX 1L7VC 2FFHA 1HA3A 4EFLA 3TNFA 2B8TA 5BWMA 3GJ6A 3TKLA 1VHTA 3GFPA 5F9HA 1I4TD 4CZ2A 2XTNA 4FINA 4YMSA 3LY5A 4PSVA 1GNQA 4BLTA 2D7CA 3FHOA 2OHFA 3C15C 2QY9A 3TUIC 1OFUX 4DCTA 4QM7A 3ADCA 4MYTA 1NNEA 2CNWD 4RD3A 3IO3A 1UADA 4CEIB 3ASZA 3OIVA 5KSOA 4M1KA 1GNPA 2VHUA 5DYGA 2A3RA 5DI3A 3UMRA 5JEDA 2AKYA 3DOEA 1VG1A 2REXB 1E2MA 2WJYA 3I1FA 3T1VA 4DUGD 4UNRA 4RD2A 2GCNA 3GLIB 1UDWA 4LWZA 1XCMA 2ZJOA 3RDPA 1YZGA 3SDZA 3OE7D 5LD2C 5HZKA 1S96A 1J2JA 2V6IA 2P6UA 4F4CA 1RJ9B 5DGXA 5KPDA 1XB2A 4LHVA 1VKJA 1ZM4A 4G01B 4A2QA 1IY0A 2V9PA 5TY0A 3LRPA 3O8BA 3TSZA 1F48A 2ZE5A 4R2HA 3AP1A 4FCTA 4B2IA 3F3YA 2JLSA 4D82A 4TMVA 1YVDA 2IYLD 1JEEA 2XNDA 2G3YA
chains in the Genus database with same CATH superfamily
1FDSA 1HYQA 3PCRB 3KSMA 2D59A 3PXAA 1L4UA 2OSBA 4NPCA 4FB4A 1I36A 2I71A 3SU8A 1VBMA 4ZKEA 1N1MA 1JPVA 4DCPA 5CEFA 4TLDA 4EUEA 1SXQA 5ECWA 3HDQA 2JFBA 3D6JA 4IKEA 4NYMQ 1E9EA 3QM1A 3KQPA 5K6AC 1KWGA 2REQB 4RY2A 3X1WA 5LYJB 4JMPA 3H5LA 2OXIA 2BGWA 5CB0A 3ZDAA 1MIOB 1GO2A 3BXXA 1HEYA 1NFFA 1KI7A 2ETXA 1KOFA 2C57A 3PHLA 4WOJA 3R8XA 1NIJA 3VDMA 5BOSB 3VUEA 1QQTA 2B9VA 3IAXA 2L18A 1JTVA 1HT3A 3ODPA 4I6EA 5J2UA 5HCNA 3VUFA 1XD2B 1QF9A 4O3MA 1Y3HA 2ZROA 3DOOA 4LJ7A 1FFSA 2FA9A 3OEHD 5F52A 2IVFA 1D6MA 1EFTA 1U2GA 5LQAA 3GLRA 4ZOAA 1WMBA 3FSGA 2CLHB 2NX2A 2YXBA 3QUTA 4OL9A 5AOBA 3SGLA 1IHYA 4XWYA 1PR3A 2BGJA 3FYUA 1SG6A 3VTAA 4F4JA 4NLLA 1Q57A 5EXTA 1AX9A 4OLBA 4F1JA 4R7ZA 4DQUA 5C0OE 2IYEA 4OATA 5FBZA 1JKJA 1CULC 5B4TA 1C30B 2QGNA 2A59A 2ZQ5A 3ANNA 1X1BA 3K9HA 3MJFA 3SNHA 1P4HA 4BO5A 3P2MA 4KSYA 4RSHA 5AM4A 3LUPA 3V34A 1XEWX 2F1OA 2ZG6A 3AYZB 4N3NA 2ZXFA 4LGYA 5FADA 4C88A 1PWYE 4Q7LA 4W5WA 1H8HA 1WVGA 3EUWA 1P1CA 1YRQA 3NHFA 4HDMA 4YN3A 3VI3B 4AECA 1LX7A 1HYGA 2R6GA 4HL6A 4N8DA 4MP8A 1NV8A 5LOVF 4RSMA 1LK0A 3SR3A 3B1VA 3DOJA 1HT0A 4OHVA 5GIPE 1M75A 1SA0B 2W9XA 3H9JA 1Y0BA 3EZ7A 3B1KA 4WNAB 4KX3A 3W90A 4NFLA 3DVQX 1G19A 4CKWB 2AN1A 2OD2A 1EFLA 1QYVA 4KJZA 4URZR 5D86A 1WLYA 2O8DB 1G5HA 2C84A 1NVDA 1WKCA 4FXPA 4G3XA 1Z22A 5LN1A 1KYIA 3TKYA 1BXZA 4AIIA 1GZ3A 3KQHA 5F3WB 3CNHA 2FUG1 5HYVA 2QI9C 2K87A 4IVRA 4J07A 2VJQA 3S27A 4JV5B 4LMBA 2O2YA 4YH1A 5KNCD 4XGRA 1R7RA 3K15A 2QBYA 3DOHA 5ELLA 2C5FA 1Y3CE 3EXG2 4JJ8A 4DQDA 3K0EA 4OQQA 4BLPA 5K8VA 3PC2A 1EWKA 2Q3BA 4RDCA 3C3WA 1E2KA 1DFIA 1KQOA 4BJ3A 3PPIA 3CXUA 4HH1A 4LOIA 4ZARA 1ESEA 1QMGA 1D6NA 1A8SA 3KZ1E 3HB9A 4NXNB 3OCVA 4YIHA 1AUVA 2GZHA 5FDFA 2C5EA 3DF7A 1H66A 2WUEA 2HSEA 2QG4A 2VVTA 3QWAA 3WWCA 2H1LA 3DLIA 3G88A 3QNMA 4PX9A 4P81A 2JFYA 1JIKA 3K9QO 2QYSA 5EXEA 4BNDA 2ZYDA 2ZIZA 3PKIA 5IZCC 5ED4A 3O92A 3B36A 3T9BA 5G3YA 1WZNA 3K1YA 2KB0A 2HWUA 2I33A 1VIYA 3HV0A 1Y1LA 1BH2A 4QOIA 4AZ0A 3SJAA 4N12A 3VO9A 4BNJA 3ET4A 5B2EA 5GVSA 4X62B 2B36A 3UG6A 1BO6A 1NW8A 4JB0A 5K20A 3RIGA 1FP1D 4QHTA 1ZGGA 1GNTA 2JK1A 2V7TA 4KMSA 4OQNA 5D3ZA 2D74A 1NR7A 4J6EA 2J5XA 3L84A 2JIDA 1A8QA 3FUXA 3HXTA 2A86A 2IBMA 3RBZA 1NN1A 3DV9A 3IKMB 2EKDA 1A9ZA 3PF9A 3ZWXA 4NYJR 1N2OA 3HFGA 3TLEA 1A7KA 1XXHA 5K8UA 2KI5A 3AUKA 3PNVA 1ADYA 4MUMA 2DU8A 2HMTA 4QPNA 3ZNPA 1KQPA 1O4VA 3MGKA 3Q40A 1GA4A 1TQHA 4EITA 4OQXA 2HCJB 4ZPXA 4GWLA 3RYFB 2QPTA 3DR5A 1Q1GA 1ODSA 3LTNC 1IZYA 2AK3A 1N1GA 4MW1A 4WK0B 1HYHA 4DMKA 1XTQA 5DNYB 1G3QA 3FPLA 1JDZA 6YASA 4C2UA 3RWBA 3S6JA 3J81A 2VUIB 3VV2A 3RPEA 5BYJA 4LMRA 5JAHA 2C2MA 1H4VB 3I83A 1F14A 4UNIA 1GM5A 3KHUA 3LT5A 4OGLA 4POAA 3UWKA 2IS4A 5A6SB 1N2CE 2QT9A 3BMOB 1UQUA 2Q5CA 1E3SA 2KYRA 3CU5A 3MJSA 1WP9A 3OJ0A 3PJDA 3Q72A 4M9RA 3EK2A 4NK5A 2NU6B 4R1MA 1G9TA 3ZHQA 1WU8A 1ABFA 2VSXA 1OMOA 5P21A 2A88A 1IJKA 4CNBA 4DSOA 3A28A 2OESA 1R64A 3PV0A 5TMEA 2AWNA 1GQOA 4LRXA 4RK5A 3DMTA 3OZTA 1PDVA 3ZK7A 1DV1A 4E6EA 1E7WA 1HC7A 1YL7A 2FETA 3WGZA 1E3LA 4C4SA 3DE3X 3GH3A 1EWRA 1J70A 2NTNA 3H1EA 3HPRA 4XX0A 3EIFA 3D31A 3MOSA 4L9AA 4G0XA 5EQDA 3N3BC 5LWQA 4R5HA 1E6WA 1S8FA 2VEDA 4TXLA 2E21A 1TVCA 4IX1A 3RSHA 3LQQA 3RUAA 3GA5A 2DWQA 4DSAA 2IUEA 1GSAA 2WHRA 1QRSA 2CCGA 5CMLA 4F6CA 1J56A 1CZOA 3R5XA 4GMDA 4I7EA 5KC9A 1K89A 4NZZA 3X2SA 2DB3A 5CCEA 5H3CA 1X3SA 3U80A 1XEXA 1IRIA 4FYYA 3PDJA 1Y4DE 4MDHA 4DKJA 1ZLXA 3DP7A 4JA2A 2C9DA 4DLUA 2I5PO 1NP6A 1QH0A 1R6XA 2GD2A 4Q1AA 3VAZA 3DW3X 1E2QA 2YYAA 3OESA 2FPIA 3AEUA 4I14A 4B33A 1R9JA 4OFZA 2VFAA 5LJLA 1U8YA 3THWA 3FWHA 3CX7A 2C03A 1V5EA 4BWFB 2WIKA 4ISCA 1QAOA 4WESA 2JJ2A 4P4UA 4X95A 1QTIA 4XLLA 3P2EA 4CM8A 1KDVA 2HX1A 2WYIA 1HH4A 4KPYA 1FYWA 3FYSA 1F0KA 2AXQA 4YJGA 5IAGA 2H9AA 1K7CA 1GV0A 4PIPA 1VPVA 4LOJA 4TKMA 4N0MA 2PYZA 4TV9F 1FBNA 4ZO9A 3B3GA 421PA 1ZN7A 1JIXA 3WGVA 5AUOB 5BVGB 1DAOA 3BD8A 4AJKA 3D4IA 1L7MA 1K7XB 5AK4A 1NJ1A 1EIZA 4B3MB 3REOA 4I50A 4B3FX 5C51B 2O7VA 3KTAB 1VSUA 5EINA 3IFSA 2IKQA 3ZR4B 2GKGA 4OMUA 3ID6C 5G2OA 4LXYA 4FC6A 1DDIA 3RHZA 4P7FA 5B53A 1KEWA 3T5GA 3FAKA 1PVOA 3OHSX 2VK2A 4C3UA 2HRDA 1TEVA 3IJRA 3ZWPA 3MLEA 2HUNA 3FKQA 4K2HA 2DT5A 2QZJA 1UJ5A 2JHAA 2WHPB 3OIWA 1W30A 2PT6A 4HQFA 3ZZ1A 5BMOA 1SVUA 1DZIA 2IF2A 1BFKA 2IYAA 1V5FA 4GUAA 2P3LA 5BMVA 2Q3JA 5L3VA 4K3VA 1XRJA 3GLTA 4L0QA 3LVQE 1YBAA 1VQ1A 3P8ZA 4RKRA 1B6RA 2B78A 2EFEB 2VDRB 2VIIA 3FUCA 5JCZA 2QX6A 4J4BA 5L3QA 2BHLA 3U44A 2H29A 4OSOA 2IQIA 2AI1A 3WNQA 3GOHA 4MI9A 3PEFA 4BZQA 1QRDA 4CR8A 2XYHA 4QNNA 4YCLA 1VHLA 3P94A 4WINA 2E4UA 1Z6GA 3EEIA 5FAKA 3CISA 1DJMA 3A06A 4BN4A 1C50A 1SUIA 1YJ8A 3UPDA 1UBLS 2IYXA 2M1ZA 2WT4A 3RSOA 1EB8A 1W8IA 4W6ZA 4CN9A 5DNUA 1YB2A 2HNAA 1CZNA 3W5UA 4D45A 1NPDA 5BYAA 3C24A 5JYCA 3BMCB 3MWJA 4IYJA 3S7ZA 2HPAA 3H4MA 1U9IC 3RR2A 4F2HA 4EFNA 2HLHA 1SUCA 2WQ7A 1UBNA 5B55A 3EGXB 2JFNA 2J32A 4M38A 4UHJA 4EGSA 3VZQA 3I2YX 5E9AA 4OH1A 2D5BA 3JQQA 1DBQA 1CUDA 2WILA 1COWA 1FOEB 1ZJJA 4KUHA 4YMTA 4ZQEA 4U3JA 2CF6A 2Q29A 2N75A 3PA8A 4Q7JB 5LMCA 3L9WA 2CJFA 4IVNA 2Z2ZA 2N3ZA 4DIKA 3RVMA 5JQGB 1ECBA 2P2NA 4L7VA 4EPTA 4LAFA 4JJ4A 1X1DA 3KKKA 1W52X 3WG9A 3EVEA 4E07A 5DVZA 2QE7A 3TEJA 1M0EA 4MS1A 2AFHA 1UT6A 2CVHA 3W5CA 4PLHA 1DFHA 1KEEB 2R8RA 3AUYA 1P39A 2JNWA 1A4UA 4NKRA 2PIAA 3CKLA 2WIBA 2XKJE 2A1TS 1AXEA 3EGEA 4OX9Y 3BMQA 1A2OA 5M29A 3NEAA 3AF5A 4UUPA 2A5YB 1L5OA 4YAIA 1DS6A 2IHZA 3R8CA 2Q8QA 4LJ9A 1TMKA 4JJGA 5E6RB 5HJ5A 4H4CA 4ZV4A 3N07A 2ZIXB 3IDSA 3NHLA 1BE6A 3ZOZA 2F55A 5A05A 2VXCA 4ZVKA 2I4RA 1I3MA 3INGA 5DB4A 3QXGA 1CUZA 2BFAA 2Q27A 1B00A 1SUWA 3ZU6A 2NMVA 1U0LA 2Z4RA 3Q10A 2W42A 4G8DA 3HL0A 3GUUA 1DUIA 3HCDA 4GX2A 2OBYA 2WU4A 3GMDA 2I7CA 1U8XX 3K2BA 4HVLA 4E1AA 1DIRA 1OFGA 3A1CA 3VDNB 3MT9A 1JQ3A 1SXIA 4ZPJA 1XVUA 3HH8A 4IAOA 3I30X 3IMEA 2XGSA 3N2NA 2VF2A 2OZEA 1NXOA 1NVMB 3O47A 5AQ1A 1WXQA 1JNYA 1GZUA 2HU8A 4JOBA 2QRKA 2ZYHA 5EKUA 1Z47A 1P6QA 2L82A 5KTNA 3L4BA 3ON5A 1IUPA 2IWHA 3BRWA 1U0RA 3UJ6A 3IIMA 2JLVA 3LQFA 5LUBA 2C54A 1CWUA 3UCEA 4ZOLA 3IVGA 5GJWC 2PX8A 3BCRA 5LM3A 1B14A 1ZIDA 1SXJC 3NHMA 4PO8A 5HS6A 3PEYA 1QRTA 5AXCA 3NBUA 3GP8A 5IFLA 2AG1A 3AJEA 4ZVQA 2UVQA 1N2SA 4Q4HB 1S02A 3IMKA 3EFHA 4O4LF 5KS2A 1DXQA 1EJ6A 4HAUA 2Q41A 2IUTA 1UPXA 4NYIR 3ITDA 2QYTA 2B99A 3EVFA 1N2JA 4YT8A 3EF1A 2Z30A 1ZVVA 4A4DA 3QKUA 1SUBA 521PA 5LDHA 2RGRA 2DPGA 2HBQA 4IDQA 3C4QA 5DGTA 4JBGA 2CXOA 5K3FB 1IONA 4ASUA 3CCFA 3D5EA 4WFIA 1RLUA 1EVIA 2FGJA 1CZHA 4XB1A 2NO9A 3C70A 1M34A 2XMCA 4EA6A 1QHFA 1PBNA 5BVHA 1KYYA 1QC5B 3H2KA 3K35A 1T1SA 1WDWB 4X97A 4RMHA 1TU0A 1DIBA 1QXSA 5CU7A 4HN4B 5BV0A 4HKTA 2ZR8A 4J0EA 4KU4A 2BFFA 4PHGA 4RIEA 4F84A 1AB5A 4Z0HO 1Y33E 4H59A 1F7UA 3LC7O 4OBBA 1P9RA 2XB9A 4BQFA 2J4FA 2B6NA 3BKWA 3CH7A 3HHPA 2C7QA 2JAUA 3WMXA 1TK9A 2P5YA 3OA0A 2JBAA 4G63A 1M2KA 5EC8A 3WR5A 4A8JB 3ZHSA 1M1YA 3KKEA 3H8SA 1FIUA 2GLXA 5FBKA 5F51A 4D26A 3AF4A 3LV8A 3M7IA 2VWGA 4Q00A 2X1HA 3DOUA 2XKKA 5LQSA 4CF3A 4YRJA 4N01A 5DSTA 4A0GA 2D8MA 5EJ8A 3VKHA 3ZQKA 2BDTA 4PSAA 4A91A 5E3HA 4CHTA 2WKPA 2VAMA 2GN4A 1SIUA 2VQSA 3DL0A 3U3JA 1K6MA 3RAGA 5F21A 1M5RA 4UOQA 1R6VA 3RGGA 4R3NA 3R6DA 4EPVA 1X2EA 3GLQA 4BMXA 3A6ZA 1RQ7A 4IHQA 3IP1A 1Z8DA 3FMVA 3VPFA 1KETA 4NC9A 3RREA 1IXZA 2FHPA 1G60A 1RABA 3WDLA 3HN7A 4RF3A 2PMDA 5HFAA 3U5TA 2GK7A 1ZXXA 1F8FA 4UBNA 4KE8A 5A2GA 1KMMA 4IY1A 4KPGA 2W4IA 1IDN1 2XMGA 2RHDA 3JTMA 4JUCA 4ZQGA 1OSNA 4ZRDA 2Q9CA 2YY7A 1PN3A 3RVKA 1OVGA 3OZWA 1OA0A 2GZMA 1GPLA 1OF1A 1N6IA 2GJ8A 4NV3A 2IHYA 2QORA 3I8SA 3WK9A 1TMYA 2EJTA 3ZW9A 1D2CA 1FDRA 1YS1X 1TLFA 3WGYA 2VAWA 1VSBA 4LVCA 1V16B 3DWEX 4TL8A 4EHIA 2O8EA 2BFEA 3FRIA 4HI0E 3U81A 2UUAB 1N8KA 2VYCA 2ORED 3NUZA 2GPJA 4MRVA 4FE4A 4UHFA 1KORA 2PZJA 3ZI0A 5HOEA 1C7ZA 2ZE7A 1M1NA 2IP1A 1ND5A 2BSQA 1OB5A 1TYDE 1URPA 2OBBA 3NANA 2J0EA 4DLZA 4WK6A 4PNEA 4O2BB 3UV7A 1VZ3A 2C4UA 2C5BA 5J2TF 1GOTA 1VPDA 2DF8A 3A4TA 3UUFA 2HREA 3SXUB 4A5SA 4DKXA 1Q21A 3ZJTA 4KQ6A 4TS3A 2EP8A 2J48A 3QBDA 4NMHA 4KLCA 1QG4A 1W4CA 1SQFA 1L4MA 3O82A 1TTTA 1UJCA 2OFWA 4E11A 2ZAMA 4E4TA 2O8CB 4QKQA 3P9YA 5BT9A 4YMIA 1VBKA 1O8BA 2OOKA 1NW4A 5IJ0A 1KIFA 2PPLA 4KUEA 1YF3A 2CE2X 3QLUA 1KO1A 3MZ0A 3V8EA 3ONEA 1P77A 1TJNA 4KLRA 1B2LA 4URUR 4MZXA 4FHGA 5HKAA 3JQ9C 4UBJA 3DJYA 4XJXA 3U37A 4F56A 3UH0A 4U39A 1ZESA 3P97A 4Q4AB 3SZRA 4BKPA 3E15A 2O0MA 3STXA 4S1NA 5D84A 3RRMA 1QZZA 1V2GA 2AE1A 1KA9H 3JQDA 4RLHA 5DX1A 4DLXA 1E7RA 2E55A 1JJAA 1SNYA 2VSYA 4GX1A 2HIAA 5JZ9A 4JFRA 1DC5A 4Z7QB 1SQ5A 4PLTA 5U4QA 1M6NA 1FCJA 3TOVA 1QP7A 3CE9A 4F93B 4KRFA 1Y3BE 2E82A 2NSYA 3WMEA 2VRCD 3CRW1 1ISGA 4LG1A 3E7XA 5EJFA 1OXUA 1KJ8A 3OX1A 4LY9A 4KPFC 6AT1A 5CB4F 4OMFG 1O5IA 3P9CA 5JCJA 3HCAA 1FF9A 1A95A 2R00C 1E3DA 1T2DA 1IZZA 3ZIAA 2BLNA 3L18A 3UAVA 4ANFA 2IXBA 2Z2XA 2AC7A 2HLPA 3H0CA 4WXHA 2FWPA 4KRXA 4PG4A 1EUYA 1J22A 1XHFA 1D7OA 1U9CA 2CBGA 2O6HA 3QH4A 3HU2A 2B5WA 2IUYA 1NLUA 4UTXA 2C4NA 5HDQA 1UAGA 1EVKA 3GWGA 3KEOA 2FFQA 2JCVA 3NOOA 2X9LA 4J76A 5LA6B 2DUNA 4D81A 3ITEA 5LBUA 2OFOA 2CBZA 2J1LA 2I6XA 1NQOA 2ZATA 3LWBA 3LX5A 3RQIA 2Y77A 3VR6D 4JUFA 2ZTVA 4TTIA 4YJDA 2Z2KA 3HDHA 1PJLA 1V3TA 3H9GA 4W1SA 5IC6A 2PGIA 4V0ME 1KMIY 4OXIA 4PEVA 1DBSA 5CH8A 3THXA 1TTQB 3LBHA 4UQPA 2CVFA 3ZX4A 5F64A 4ZYZA 1TM1E 4QFBA 4R9VA 1ECFA 4KR0A 4U2EA 5FTNA 1FTNA 1Q0LA 2P8SA 5LQMA 2HU7A 3ROPA 4M0LA 2V97A 3OF3A 4RLFA 3TK1A 3V8NA 1SFRA 1M74A 2YJGA 4L5IA 2XBLA 1M10A 4UDOA 4GRDA 4FNGA 4UMFA 4D9MA 5FOTA 4QOJA 4Q15A 5HMMA 3E70C 1DAFA 3GG9A 3SQOA 3H8JA 3NORA 2HHJA 2NXWA 2J6HA 3EG9B 2WWFA 1MNQA 3PB3A 1D2MA 4FCVA 1N8SA 3P9PA 4CQJA 1N2GA 2XPCA 3F98A 4JKYA 2CXPA 2CHFA 4YCMA 1J8MF 4IIDA 4E22A 1DC3A 1ZMXA 1ZS9A 4FYVA 1YFLA 1RC8A 3JASA 5ESDA 2H4YA 2C8VA 2LZ0A 4EGFA 5AVUA 3AHIA 4HRYA 1M5TA 2Z3WA 4M0UA 5JR3A 2V4ZA 1E1CB 3V1UA 5FOSA 3ITNA 2H2WA 2ZYTX 2A3NA 3OQPA 1Q1BA 1UFQA 5F7JA 4AWBA 3TQCA 1J0XO 1G98A 1BEEA 4JL8A 5CDFA 2COUA 1KI6B 1FXWA 2QTGA 1G1AA 3ESZA 1KP3A 2CMDA 4KQ2A 1T9CA 1W88B 1GADO 3BIXA 4KP7A 2H1OA 3N2YA 3L7OA 4EIWA 2B3DA 4B3GA 1EM8B 3OJLA 4MUYA 4BB6A 1MAHA 5DCUA 2QZSA 3MGGA 5AYVA 4DQLA 2RH8A 2FCAA 4PBTA 3TJMA 5H9VA 3CF4A 1PIWA 4CM9D 2R6CA 5F3RA 5B4UA 1FFAA 4D3ZA 3TSCA 3E1GA 3UA3A 4GC9A 1M67A 1XK6A 4TTVA 5I8PA 1PDWA 3AR5A 1G16A 3MTAA 1CFJA 1RWOA 4KMMA 4BVGA 1H2YA 3FNEA 4IHJF 3HACA 2FEWB 4J8PA 1JHXA 3O38A 2P7IA 2G9ZA 3AU9A 3IKJA 3B6KA 4IFIA 5GONA 1O08A 1ZONA 2QVYX 3LC1O 4LRWA 5KSPA 3U7EB 2CZCA 2LPMA 4FIDA 1ZKMA 1HQDA 2QW8A 4NEGA 3S5UA 1R4ZA 2NPIA 5C1OA 2PBFA 3GW8A 3N2KB 3WMRA 5BN5A 3FMPB 3VXKA 2R1VB 2NIPA 3RKRA 1X74A 4I1UA 3RSLA 5EL0A 2AXEA 4CPDA 5F9FA 1G41A 4YJ3F 1M6EX 2Z6QA 3UUWA 4ALIA 2OYSA 2JEZA 4RK4A 4BTLA 4TV8F 1E0DA 1T1JA 4PLVA 1PX0A 4P92A 4PVDA 3VHXA 4EUNA 2OYRA 2R3SA 5BQOA 2V96A 1XEWY 4L5CA 4R9RA 3ZYCA 1QIKA 4FDLA 1U0HC 3S28A 4XGQA 2Z8YM 2WJAA 2XDQA 4ITRC 2YJNA 2VDMB 2Y3IA 4KTTE 2EFYA 1NDUA 5T4HA 4NX2A 2EFHB 1WXIA 2ZI5A 2JHGA 2ZRNA 3DDNA 5FFMA 3RRZA 4YPVA 4R69A 2QDXA 3AZOA 1ZOOA 3ITKA 4QIHA 4ZTZB 5D51S 2GK6A 3L1UA 2WWYA 2I2CA 1BVYF 2X76A 2HK7A 2WJ6A 1E7SA 5TSDA 4HNAB 2BL4A 2HJVA 1PI3A 4BX9A 3NTVA 3PQCA 3UEOA 3DBHB 4LXIA 3KG2A 2XNSA 1G2PA 2XWBF 4GPD1 5K0SA 3A4NA 2A9KA 5IRCD 2B3TA 1C9YA 4C07A 4D9BA 2H2AA 5JG7A 1CR1A 1KR5A 3DWFA 3F47A 5LQNA 4L7QA 2WJ3A 4LXUA 5FPQA 1QH8A 3FRJA 1E1LA 3KAKA 4X85A 1HUQA 1BYIA 1WZIA 3GRZA 3M89A 3U3MA 1YZLA 3ORFA 4MVJA 2YVUA 2O3QA 2YS7A 4ZVVA 4E21A 5ARBA 3RAEC 2GAOA 2PTHA 3SX0A 3PYXA 5KSYA 1XZMA 3PDIA 3E9QA 2BR3A 2Y92A 4RU1A 3TI7A 4DLKA 2IU4A 3C5WP 1V8ZA 1ECCA 3NGLA 1Z83A 5BWNA 3Q3GE 3EEBA 2CUNA 1FX0B 4LYEA 2QMZA 2XODA 4MVCA 1Q7BA 1PUXA 4C87A 1HDOA 5MN4A 2J7PA 1TZMA 3SQDA 4R2KA 4BOYA 1J2YA 2X40A 3T3IA 4CF7A 1D4ZA 1DPFA 1LY1A 5BURA 4AS1A 1GARA 3EXIA 1I3OA 7MDHA 1GUZA 1AURA 1LDNA 4ZZ0A 2WFMA 2XJ4A 1TMGE 4CMEA 3BEOA 1Z5UA 2JLCA 1JKMA 1OUMA 1R8SA 3F90A 4NG4A 4YRQA 4RCYA 3ZGXA 3HMKA 2AMFA 3UK1A 4D44A 2JIQA 5GJVC 2QDKA 5CFMA 1RRKA 4U9IS 1SVOA 1VKNA 1JMYA 3Q3IA 5ALTA 3QVXA 4JNKA 4DV3B 1ZITA 1R16A 4H3SA 3WA6A 4C7OA 2NOAA 5K01A 1P74A 1ZISA 4PX3A 2ZJ3A 5D3KA 4CKZA 2O5EA 3WC4A 4X84A 3JAMA 3EVZA 5AHOA 3G85A 3PQ8A 4B83A 1E3JA 3IE1A 3DOIA 2X7HA 4EX7A 3SYKA 3HUDA 4AJOA 1OBVA 1BX0A 2XE4A 4E2XA 4HP8A 5I3ZA 1AD2A 2Y76A 4IDOA 3S5JA 1JHZA 3F6EX 1Z2EA 2BONA 2J85A 4KXVA 5DJ5A 3WDMA 3ZX5A 2ZJ4A 5FQOA 1H4TA 2VYNA 4DIEA 3PXEA 3W0LB 3EFOA 1W5TA 1H8EA 3M6IA 4G0VA 1K06A 2WDPA 4G5XA 4TRRA 3CIFA 4ZQBA 3TTTA 4EA9A 2H00A 2UU9B 2BY4A 2EEPA 1DTWB 1PVDA 3GYBA 4N18A 4F1WA 2BFWA 1IVYA 1V95A 1FMJA 2XA1A 1J8DA 2FUKA 5CXXA 5ICFA 7REQB 1H4SA 2VNSA 1J2UA 2QE6A 2VPTA 4K9PA 1MLDA 2XDAA 3BGOS 4LXGA 4W8HA 1C7EA 4XOUA 4ZV7A 5AXDA 5BNFA 3F2VA 3RJ9A 4DWVA 4L4UA 4R40A 3KJXA 4D4MA 5LOVA 4ND2A 5KTTA 3PICA 1NMXA 2IVZA 3DKRA 4G89A 2QXTA 4J16A 4Z49A 3H9EO 2C7BA 4ZA2A 4L6AA 4YMHA 4GMKA 2FX2A 4IJKA 5L7YA 4MK4A 5JJIA 1YT5A 3G2KA 5GZ6A 3A6GA 3VZRA 3WLMA 2PL3A 2IPAB 1KL7A 4IIYA 2F90A 4CLRB 3QX3A 4YMLA 3DMYA 3OI7A 4GSYA 1L5LA 1AZLA 2ZDHA 3OJXA 4R9SA 4XLTA 1DG9A 3CX6A 4LFBB 4H6PA 4X44A 3SJUA 4C4RA 3UW1A 2ZSHA 1K08A 3D43A 3E5RA 1P33A 1EEHA 4C6RA 3AK4A 3KHKA 3LYLA 1BXKA 2GHRA 5L4LA 4M1MA 1NQTA 2CHGA 4ZEXA 5EERA 1EK6A 2PAFA 1XDSA 2FN7A 4O8ZA 1LWOA 2NU8B 3SK0A 3BKXA 4HK4A 5IT9A 1C0KA 2OZKA 3DVRX 1FDUA 5FP0A 3CKYA 3ROQA 4GBMA 2ZI9A 2NSJA 1P72A 4PTLA 4R3UC 2VXOA 3KEFA 4DDWA 2VPQA 1QQAA 1GT91 2V7BA 4MR8A 2EP5A 1DBRA 3BOSA 2BFBA 2QD4A 4F86A 1XZCA 2H48A 3L7DA 4U0KA 3M9LA 4B0OA 3G0HA 1M2EA 2DY0A 2VTBA 5DO9A 1R88A 4AFNA 3HKEA 4O2LA 3PITA 1NFRA 3AG6A 4JJEA 4S1WA 1I1NA 4UKDA 1ZZEA 2GM9A 2XYQA 4O25A 2DFKB 5LU8A 2XXAA 1S01A 2HSWA 2JFVA 2X8LA 3LP6A 4C5BA 4S05A 3TUJC 4MI3A 1QHEA 2AC4A 4G85A 1NRWA 4QC2A 2P65A 1XZNA 3WLRA 3CZQA 2IBSA 3RWOA 2ZCVA 3C8ZA 1L5FA 1YIDA 1UBKS 4UPVA 5C80A 4HAIA 2MYNA 1YK1A 3FTPA 4PHCA 3VOBA 1AH2A 1P29A 1XMPA 3E9ZA 4F38A 4MKRA 1X1RA 3HDJA 5KTSA 1M1UA 1L5YA 3VGPA 3FSEA 2F59A 3B6JA 1JDSA 5HBRA 1L5KA 4YV0A 2OHJA 1EDOA 2EGGA 3OLZA 5GADl 4W5OA 2HJSA 1QTRA 1R27A 1CY6A 4JBXA 4QQ8A 4R84A 4IV0A 3RI3A 3ILYA 5IVIA 1OX4A 2FZKA 1G3UA 4EZEA 3V1TC 4G1BA 1L3IA 4MRNA 1A4XA 3LQ2A 3L8MA 1KO7A 4EVSA 1Q0UA 4OK3A 5EHXA 4DCJA 4NZMA 4JI1B 4RSGA 4ML3A 1ZCJA 2RHRA 3OUUA 3L43A 1B7GO 2CEAA 4BV9A 5J1SB 3WRYA 3ZD7A 1VLQA 4OGFA 5HQ3B 4KFSA 5K3BA 4QQRA 5JS8A 4CM5A 2CD9A 1YB7A 4EO9A 4U7DA 1TEZA 1CRPA 1W59A 3I9OA 4MRMA 2Q5JA 3YASA 3HDTA 1Z2AA 3SFVA 1VI2A 1E7MA 2B0CA 3SN6A 4HEA6 2XB2A 2L0XA 3EMVA 3OZEA 1WTAA 2FOLA 3NALA 2JIMA 2WB4A 1G6KA 2IIQA 1EE2A 3HB1A 4JHLA 2ENUA 5JCOA 5IPFA 4NZYA 1M2JA 3JRNA 3L5OA 1C3OA 3R23A 4F2GA 3G5LA 2AZXA 5ALLA 2I3GA 3EFEA 1KZ9A 1JX6A 4MV5A 3QWFA 3I23A 5AVVA 5K0LA 4FQ8A 4HJRA 3T7AA 3LHSA 2WV7A 2Y1EA 4CQNA 4MGKR 1UK6A 2HCBA 3ZQ4A 4ZC1A 4FM9A 2AOTB 4I55B 2VR1A 4X1OA 5K99A 4LZWA 4YY3B 3UB4A 3SOPA 3WLNA 4WKOA 5DTMA 4IIXA 4IG4A 3G89A 5FIUA 2FR8A 2MSDB 4YI5A 1C3LA 3ZTWA 1A96A 2YV1A 3CLUD 4EA7A 2P2DA 3C8MA 4CLHA 5LZ2A 1IWBB 1Y63A 1L4BA 3EPRA 1CS0B 2AG6A 1L8QA 4YJ2B 1K88A 4L0MA 4Q3CA 4J9UE 4FLFA 1TUBB 1N5DA 4ZVOA 3LDFA 3TVDA 5FR1A 1U9ZA 3HB5X 4PIVA 2XVMA 4LC1A 4LF9B 2FKNA 3SJBA 3D2AA 5KKAA 3FOWA 4RE6A 1JEQA 1X7WA 2BI4A 4B7AA 4N9QA 5A9TA 3DAHA 5CFRA 3ME5A 1NMYA 2G8NA 4WJKB 3VR4D 1GZVA 3TW8A 4OG2A 4PR3A 2WG0A 1JFFB 4LJ6A 5ENZA 1G7RA 3UJHA 3M5PA 4EI9A 1BXRB 4UOEA 2KSQA 2ASEA 2PWBA 5CFOA 4NBRA 3THYA 1RLOA 2R1ZA 4JX9A 2NAPA 5SYMA 1HQKA 3GIWA 1ZSNA 2VTEA 3U7GA 2ID8A 1XELA 4XVQA 2GOYA 1DSSG 3R6TA 4U2CA 3A31A 3AEKA 3GBSA 4QXAA 4Z2AA 1IG0A 5AWFC 2VHEA 2ZBDA 1I3NA 3QVWA 4RD1A 1W94A 1BIFA 1HXHA 2GILA 4HHEA 4OHMA 1NQUA 2D54A 1OAOC 5KOHB 1TFUA 4JAVC 4CCWA 4AJHA 2E37A 5KYNA 3AFMA 5I8ZA 4WNIA 3ZKWA 1U7PA 3E81A 1LSOA 4MKZA 1Z63A 2HAEA 1J5PA 1N6OA 2ODPA 5AVKA 1EXNA 4UFPA 3MJRA 4PIMA 1BE0A 3ZK8A 1P5HA 3NVKI 1X80A 1QIGA 4PSVA 3KHSA 3E2IA 1EE1A 2C1EA 3L8GA 3QY0A 4COOA 1MAUA 4L6CA 3D7KA 3A6PC 3MILA 3GAAA 1QHHA 1QV9A 2Z8YA 3TKAA 4LCEA 5CVCA 3OZXA 2OAGA 4WKNA 3V1MA 1PW7A 2ZIWB 3UAZA 1T1EA 1NQXA 5B1EA 5AVSA 5F5NA 5IBRA 4KZKA 5AI5A 3ZWAA 2CV0A 3RC8A 1RADA 4M0EA 4H27A 4ZAWA 2BBSA 4L07A 4NJEB 3LO8A 4BMDA 5BW8A 3EZLA 4HWRA 4D9NA 3BBLA 5TMBA 2PRJA 4TLLB 3EA5A 3EIOA 3SLRA 3U9TA 5JO0A 3AETB 3ZZMA 3GT3A 2NTYC 1PSDA 3NTLA 3RK1A 3CZCA 4JJAA 2X58A 2YN4A 1TVKB 4RKEA 2GBIA 4EUFA 5KI6A 1V3QE 2J31A 3PFGA 5DN6A 3R4CA 5FNVA 4BKMA 2AXPA 1CT9A 2F3RA 3PHBE 5BV7A 5JAQA 3RAJA 4O4JF 1XXLA 4PCUA 2C2BA 4BS9A 2EX4A 2IYFA 5EWMB 1HFEL 2FPKA 3P5SA 4QOGA 3C7CB 4YEDA 5CXSA 3DYIA 1TJPB 3HUFA 1OYOA 3GEHA 2Q8NA 4KVGA 5FTLA 1U65A 3K5PA 5IU6A 1BJRE 2G4LA 4BO7A 1A9XB 3DDHA 2VLIA 3QLJA 4EO4A 1OAKA 3IP8A 4KQKA 4DV4B 4MWTA 2CL0X 2ZITA 3WQHA 4LXXA 3ZJVA 2ODQA 1HRDA 1E2BA 1VFNA 1SIWA 1JQEA 5E38A 4RKWA 1DHTA 1ORHA 3N7TA 4YREA 4GPAA 9MHTA 3PR2B 2QN8A 4R1UA 6LDHA 2EG9A 3KV1A 3OUTA 3IL2A 3SYMA 1RVV1 4BMVA 3IUQA 3BXHA 1QH1B 1GN8A 1WMSA 5TPWA 2WFLA 1JLLA 1NVXQ 3K1JA 4Z3DA 2ZRPA 3LY7A 4P5DA 3V8BA 2ADFA 3ZDZB 1K2VN 3UCFA 1Y8QB 1RP1A 2YHUA 5DGDA 1U9YA 3C0KA 2OKGA 4HGRA 3GLFA 3OO1A 2GDZA 4YLEA 2IW3A 1P3JA 4BEJA 2BEVA 1XG5A 4QJIA 3SE0A 4DLAA 3U31A 1OQAA 2HDNB 3IRUA 3TNDA 4GKKB 2KQUA 3DMNA 3I6MA 5LQCA 4RTNA 5CT8A 4HSGA 1SB9A 3HDVA 1C1DB 1T9HA 2P78A 4EB6A 2B7CA 2PGXA 4K81B 1OFVA 2RI0A 4XSGA 3G1WA 3DGFC 4AJ9A 2PWAA 3RFCA 1HE1C 3QVUA 4LI0A 1DX6A 4H2DA 3VPXA 1VCIA 4KIGA 4UMEA 3BVPA 2QMHA 3H83A 2P9HA 4EMUA 1JEYA 1EDZA 4ABTA 2OY0A 1Z0IA 3C74A 1OLUA 1FU7A 2JFGA 3OQOA 1SUAA 4GYWA 1T5OA 3O1HB 5BW4A 5G0VA 5CURA 4PSUA 3BWDD 2H2DA 3GK3A 1E2EA 1IULA 1X7GA 4Q34A 2JLRA 2Q4RA 3PDWA 5CDTA 2BSXA 3A3YA 5BSHA 4KRGA 1U1GA 3ND8A 1OH6A 4PYKA 1HYEA 1Q0SA 1UJ2A 4G0NA 3W1WA 4I5FA 1Z7GA 1DAMA 4ER5A 4O2AB 1XNRB 1REQA 2QX9A 2VUSA 2VXBA 1K86A 2EEZA 1GTZA 1Z2CA 3DC7A 1GD1O 1PR1A 4OQDA 5E4JA 1KOLA 4EJ6A 3Q8KA 1Z33A 2ZVDA 2IJGX 5IJ9A 4OKNA 1KOJA 3ZV3A 4UUMA 5HIKA 1UXHA 1EHCA 2ZWIA 4UHBA 2EFJA 1D4AA 1JIVA 4DMGA 1I24A 3FPKA 3AHDA 4GMHA 1E2NA 4UFNA 4F6RB 1U3DA 5LR6A 2FF7A 4JVSB 1R4MB 5FI0B 2IV3A 3WLIA 9ATCA 2ECKA 3CRNA 5KAMA 4NWIA 5LP6F 1QIIA 1BDHA 2H2HA 3A1UA 3FRHA 1Z18A 3JD2A 4QUBA 5I4IA 4HFMA 5H9WA 1ADGA 1JG2A 1GUDA 1NM5C 2BT4A