2ZI7A

C4s dck variant of dck in complex with d-dg+udp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
240
structure length
218
Chain Sequence
b'IKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSTGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLVPILTLDVNEDFKDKYESLVEKVKEFLSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Elucidation of different binding modes of purine nucleosides to human deoxycytidine kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 218
sequence length 240
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zi7A00
1ZVQA 2B8TA 1T4GA 2CHVA 1QF9A 3Q5EA 3AVPA 2YC4C 3UMSA 5BQ5A 3KUCA 1T0HB 1SVOA 2R6AA 1Q1ZA 1P75A 1ZUHA 4DWJA 2WJYA 2QPOA 4W7SA 1NSTA 3NC0C 5DH9A 3HPQA 4ON9A 2QA5A 4QXAA 2XXAB 1KDOA 2H92A 3E1SA 3E70C 3THYA 4IRUB 5ANRB 5BYJA 1BYUA 3TK1A 4D80A 1ZIOA 3SJCA 1KGDA 2BCGY 2WZQA 4BZQA 1L4YA 2R8RA 4GDFA 2J5XA 4MGIR 4TLAA 3T5GA 1WB9A 5FR2A 1UFQA 1YU9A 3ZDQA 1N3BA 1XCMA 5JSZA 1PLJA 4DEXA 1AQUA 2V7QA 4M1OA 2G0NA 3SJBA 2VSFA 4X8LA 3ZVLA 3IEVA 1CEEA 2DY1A 3VR3A 2WJVA 1JNYA 1WRBA 2OCBA 1J7KA 1E2MA 1JR3A 3PUZA 4Q02A 5J4KA 2QROA 4Q4AB 1OIXA 4PO8A 3SOPA 2PT7A 3GLGA 1VCMA 3W8RA 2ZE7A 2VHUA 1G16A 3IIJA 3KJHA 1HE8B 2ZANA 3CONA 1CULC 2XEXA 5F2EA 2J59A 1FUUA 2BV3A 4DB2A 1SULA 3V9PA 2O8EA 2G1KA 3NEYA 4HATA 3WBKA 1Z0IA 5DI3A 2AFHE 5JFGA 2O0JA 2D62A 4XD7D 2QBYB 3UANA 2P6NA 4M1KA 2QM7A 3JVVA 3P4XA 2XNSA 1Z6AA 5HCIA 2OG2A 3UWKA 4AYXA 2ZRAA 4DJTA 3ZD6A 2GEVA 2NZ8A 4CEJB 4Q4HB 4ZPXA 2OLKA 1DAGA 2GEUA 4IKEA 2HYIC 3FMFA 5FR1A 4US0R 3PUWA 3RWOA 4OQFA 3SYKA 2DFLA 3T1QA 3GFOA 4WXRA 3U7EB 1UKZA 1GKIA 3HPRA 5IHPA 3A6PC 2VHTA 1BIFA 3C41J 3I62A 2WPDD 3MWKA 3ADDA 1XTRA 4CT4B 3N2IA 1GOTA 4D0LB 4II7A 1XTIA 2P0EA 8OHMA 3FKSD 1F6BA 1U99A 3CRW1 5J47A 1Q1BA 3TW4A 2ZS8A 1XMJA 1E2NA 4B71A 4N1AA 2PMDA 1II9A 1JPJA 2CE2X 5E7MA 2FV8A 4L9WA 4OL0A 3LXRA 1GL6A 4ESVA 1E69A 2P5SA 3EA5A 1Z0FA 5C4GB 2ONJA 2NOAA 3DM5A 1EESA 1FP7A 2WBLC 2XZOA 4R2HA 4HB2A 2W6ID 1E0KA 2XXAA 1XB2A 1LY1A 2QU8A 1KKLA 4G5QA 5K8TA 2KI5A 2NG1A 221PA 3EG5A 5J4VA 1KO1A 4QHSA 4PANA 4WVFA 2WICA 1Z6TA 1B0UA 2FGKA 2GK6A 4AIIA 4TYWA 3U7FB 1E2JA 1U81A 1L4UA 2E87A 1K8RA 3A4NA 2CCJA 1KZGB 2IYWA 4IEEA 2HXYA 3UK6A 4DT1B 4HB4A 5BWMA 3NBXX 4MKIA 4RJLA 2G6BA 2ZSBA 1JQJC 1O87A 1A4RA 1SVIA 1TUEA 1C1YA 1XD2B 5AWFC 3TVDA 3ZYCA 2IYLD 3TUZC 1JR3E 1YR7A 3I8XA 1G1MA 1ZM7A 1UDXA 1DAMA 4CYMA 4DHEA 2FFQA 3QEJA 5JWHA 3N2EA 2WVJA 1P2UA 1QHGA 4GZLA 3TGPA 3SN6A 3VKWA 4NYMQ 1GP2A 1ZUIA 4CDGA 1RRFA 4DDTA 4KSCA 5AJXA 4RKEA 621PA 2JLSA 1N0WA 3ZGXA 2D74A 1RYHA 4W5WA 1P4SA 2CEAA 1NVVR 2XTMA 4FMDB 4NBSA 2ZS7A 3K0EA 1N6HA 2KSQA 2Z5FA 4OHWA 2BJWA 4O2LA 2OFXA 1BH2A 4P4TA 2QBYA 4GP6A 1FUKA 4JZKA 3N5CA 5TDHA 4KFRA 3LAWA 4ZI3A 3LH5A 1NVUQ 1U8AA 1Y63A 4XD7A 3EPJA 4Q4HA 4AG5A 2FSGA 3R7WB 2WAXA 3TH5A 3ZS8A 4AD8A 4G5OA 1LTQA 4LI0A 4U02A 1JXMA 2QT1A 3CRRA 2O52A 4TL7A 1NN5A 1COWD 1U98A 3CNLA 3TUJC 1DTSA 1N2CE 3LA6A 4OQXA 1XX6A 1SVSA 4HUQB 3LBIA 4CEIB 2WTUA 4O2RA 4G01B 4JYBA 3CH4B 3AGPA 4YONB 1L7VC 1X86B 1E2EA 1T5IA 2WPDA 4Q03A 3RANA 4E22A 4B3GA 3QIAA 4BFXA 3FKSA 1YVDA 3RYTC 4AK9A 4D4MA 1AJEA 1F2TA 4CEHB 4C3ZA 4ZV4A 2YWHA 421PA 1V43A 4Q66C 5G3ZA 1KIMA 3ASYA 4Z54A 3MJRA 4ZO4A 2JLYA 2C78A 2WAYA 2H5EA 2CJWB 1Q3TA 3WP1B 4I4LA 3SBDA 5L3VA 4V02A 1SVKA 4HDQB 4BQSA 2W6IA 2ZRLA 4GOKA 1YZLA 4BZPA 2ZPTX 3I72A 4EUNA 2OFWA 2W6JA 1VTKA 2ZRKA 3EASA 5FTJA 4NPHA 5G3YA 4DT1A 1FMJA 2JJ1D 2BBWA 4WZBE 4I99A 3FHTA 3REGA 3B60A 4GP7A 2HT6A 1W36D 3ETLA 4Z8YA 3B1XA 1FQJA 2Z4RA 3CR7A 3M6AA 4N3NA 1P2TA 2OCPA 2QENA 1JJ7A 4B74A 4H1VA 2JJ8A 2QMEA 4B33A 1RIFA 2RB4A 5DHAA 3T12A 4BFTA 1XD8A 3UMFA 1ZJ6A 4C0BA 1ZD9A 3ZLJA 1SQ5A 1D2EA 4F91B 3X1XA 1E1QD 4LYAA 5IT5A 5TMPA 1N25A 1AM4D 4TLEA 4RD1A 2GJKA 4AKIA 2QMUA 1W36C 1K5GA 4BGDA 2NQ2C 1N0VC 1GILA 2F9LA 1OW3B 2QGZA 2ZS9A 1LVGA 4DLZA 1G4UR 1BMFD 2ZJZA 3H86A 1S1CA 1XWIA 2O8DA 3SZRA 1G17A 2OZEA 3KXLA 3LDAA 4AG6A 5JWRA 3DMNA 1N6OA 4JLNA 1DPFA 2REBA 2IYSA 2VRWA 4HLUA 4IVQA 4DVGA 5EE9A 4ZCMA 3BFVA 4JVNA 2O5VA 1NBMD 1ZNYA 4CEIA 1NP6A 2OLJA 3CPJB 3OFND 4ZCLA 2WKQA 1COWA 1P2VA 5FTNA 4JKYA 4L9SA 3CKLA 1VYTA 2ZUDA 4ZDJA 4JT2A 3BORA 4WXPA 2AKYA 2MMCA 3QF7A 2VP0A 3X1YA 2JAQA 3VU9B 5GJBA 1CJKC 3MAAC 4POAA 3I92A 3VAAA 3WYGA 3MFYA 4AC9A 3ASZA 4KYIB 1KI4A 3J81k 4CEHA 2ATVA 1F2UA 1O3YA 5C4MA 2FZ4A 4B44A 4C0JA 5L8VA 3TLXA 4Q19A 1G8FA 1TF5A 1F48A 3A1VA 2X8AA 4PZLA 3V4RA 1EXMA 1NLYA 1GNQA 3KX2A 3QXHA 4DLYA 1IJEA 2D3WA 4IDQA 3OEED 1SZPA 2CJWA 3CNNA 3M4YA 2BC9A 3SYNA 1E2HA 5IF9A 3W34A 5BN3A 2DFKB 2EWVA 3K70D 3AUXA 1EGAA 1KK2A 2GK7A 3MLEA 4RZUA 1KO8A 3AVXA 2VHJA 3AKCA 4V0KA 1TX4B 5FL7D 3W6OA 2QAGC 4MRPA 4TSFD 2WHXA 2JJ1A 2YWGA 4KLZA 4QGGA 5JECA 3R9IA 4JKIA 1RW4A 4Q5IA 2GCPA 3LBHA 5C46F 4WA7A 4NCKA 1G19A 3EC1A 2A30A 3GJ4A 2CHGA 4N0EA 4Q7LA 3K70C 2F7SA 2V55B 4K8OA 1NSFA 2GZAA 1Y3AA 4P4SB 2WOOA 3U2QA 3R8FA 5E3HA 1HYQA 2K5UA 3GJ3A 3SJAA 3X2SA 1MO3A 3IQWA 4ARZA 2GAOA 1QDEA 2WWXA 4IOMA 1TPZA 2WWIA 1E1QA 2WWYA 3AVTA 2J3EA 2YINC 3M1IA 1DO0A 1GM5A 4NTZA 5L3SA 2PZGA 2ZUCA 5HTKA 3TAUA 5C1BA 3ADKA 1CRQA 4B48A 5JHGB 1XPRA 2C9YA 2RGEA 3AVOA 4Q01A 1W4RA 4C0KA 5EUQB 4URUR 1BMFA 1NN3A 2YV5A 1G6OA 2DB3A 4KVAA 4KODA 1P72A 3BB4A 5FOTA 2RH5A 2I1VB 5DSZA 4CVNA 2NO9A 1C4OA 5CB6A 3VR6A 3HU2A 4JL6A 2YOHA 2NPIA 3GQBA 5FOVA 3UATA 4AI6A 1EX7A 4RFSB 1NBMA 1E9SA 2ZSFA 4P33A 3OFNA 2VSOA 2BOVA 2GZHA 3CF6R 4MYTA 3ZJYA 1YJ5A 4OK3A 3H84A 2AKAB 4Z1MD 5FOXA 1NY6A 2QN6A 3R8CA 5EP1A 2PBRA 3B8HA 2ZRIA 2D7CA 4C4PA 2IW3A 1E9BA 1J99A 2ZTSA 4TT3D 3DKVA 1JI0A 3AF0A 3CBQA 3CRVA 4Q1EA 3EAQA 4OKSA 5EXTA 2B8WA 3I32A 3THWA 4KITB 1W0JD 4KFTA 3C8UA 1CLUA 4S35A 4IDNA 1JXOA 4V0LA 1OXUA 2V6JA 1HQYE 4M0LA 4Q4LA 3NDBB 4Q1FA 4QFMA 1GDDA 1S8FA 1I2MA 2QAGA 1FNNA 1S0UA 2C5LA 2H7VA 2ZRMA 3OEEA 4LCBA 4EJSC 3BH6A 4IFEA 2J0QA 4NYMR 2ZR9A 4OYHA 2OFOA 4L5BA 4PZZA 2ODBA 4DBLC 1W2HA 3MRSA 4F93B 2EWWA 5KNCA 3EXAA 3AB3A 4GNKA 5FPSA 3C14C 3GJ8A 2ZE5A 1BOFA 3I73A 3L0SA 4XVQA 4BEJA 5FUYA 5BYKA 5EUMA 1T3HA 5FL7A 2FFAA 1KSJA 2P6RA 2AR7A 2R62A 2CCGA 4TSFA 2OHFA 2A5YB 5JLJA 3IHLA 4JVSB 2QRNA 5LBIA 4HI0E 5KPDA 5CB8A 3IHWA 5JCPA 4WZAE 4LHXA 1ZC4A 2FN4A 4PAQA 2QP9X 1E94E 1JR6A 4C0HA 4QM6A 3B82A 3R20A 1DOAA 5CYPA 2IF2A 1I2DA 4MGKR 2GJSA 1M8PA 2HYDA 3BK7A 3NH9A 2R9VA 2ZYWX 3KZ1E 1HTWA 4HSEA 5BW8A 3EPLA 2XZLA 1E4VA 2WV9A 1EWRA 5HZHA 4A0HA 5JI2E 1SXJC 4LJ6A 2QORA 1WMSA 2ZRFA 1Q3HA 1XCGB 2W2TA 3CH5A 3DVLA 4W5HA 4YMVA 1RVDA 1Z08A 1G3QA 2F1HA 4FCVA 2OBMA 4F38A 3SFZA 4LJ7A 2BMFA 4C0AC 1X6VA 3KTAB 1RJ9A 1ZNZA 5KU1A 1DS6A 4HEJA 4DEYA 2OCYC 3MUFA 2PJZA 2IWHA 1KI9A 2IS4A 1QBKC 3GEEA 2VLIA 4RFSA 2HV8A 3PG5A 3GLIB 3EPHA 1HA3A 1Q1QA 4JT4A 2J45A 4E09A 4OJKA 1RYFA 2C98A 3PXGA 1NLFA 2ZYTX 3NBYC 3OEHA 4GMDA 3WNCA 3B78A 5H70A 3CZPA 4X8HA 3CO5A 1KO7A 1P9NA 4IFBA 3U60B 2OESA 4LPSA 3W6NA 3RRYA 1N5KA 4KBFA 4Q7JB 4IDPA 3ZVNA 4Z1MA 1VYVA 1W2GA 2FSFA 1KO5A 1IN4A 2RGAA 3TR5A 4A2PA 4ILEA 2RGNA 1AIPA 4M1SA 1E9CA 2ZSEA 3AKEA 4DIDA 4JSYA 2GKSA 4I81A 2O8BB 4TT3A 4KO8A 4EFMA 1I4TD 1WCV1 5LB2A 1TTTA 1FPMA 1ZP6A 4GOXA 1J90A 2ZI6A 3AVUA 4OK5A 4OQLA 5FBQB 1OPXA 3ZQ6A 2F1JA 1UEIA 4PO9A 1W0JA 1MRSA 1TNDA 1U0HC 5GADl 2PX0A 3IPXA 3PEVA 2G77B 4M2LA 2FG5A 4HZUB 1XJCA 4F7WA 1GAJA 3NXSA 5H1YA 3THXB 4FMCF 1KMHB 4KHZA 1MABA 1QZXA 3PEWA 1CF4A 4U5XA 5JZVA 3ND9A 4PPFA 5FOWA 4NYIQ 2REXB 1Q44A 3H1TA 1UKYA 1XEFA 2QGNA 4P0TA 4DXAA 3OESA 1WXQA 2KJQA 3PVSA 1KHTA 3AF4A 1KI3A 3EW9A 3RS7A 1KSHA 5EP2A 1SHZA 4A92A 1G8YA 3QOFA 5FBRB 1UKEA 3T1OA 2NO7A 3P32A 1HEIA 1T5LA 4TWZA 4TYYA 2ZAMA 5HE9A 1HH4A 5CDFE 1KKMA 3MSXA 4JLBA 4Q9JA 3LVQE 3Q8XB 3QXCA 2WM9B 2FEOA 3ECCA 4QGFA 4TMZA 1AA9A 1VG8A 3BRWD 4RFVA 3T34A 2QI9C 2H16A 4QGAA 5JBQA 3CNOA 1TU3A 1G9XA 4RD4A 2GXUA 4B2PA 3W3AA 4TN1A 2IYZA 1XEXB 3LD9A 3RS2A 5D3QA 1G3IA 1FZQA 4AKEA 1QG2A 3A36A 1M7GA 1G291 1W5SA 2GCOB 4TMWA 2VA8A 2W00A 4Q9LA 3S1AB 2QM8A 1RFLA 2VEDA 3GJXC 2Q9BA 3KTAA 4L16A 2XOKD 4MUBA 2XGJA 4PTLA 1XXHA 1AKYA 2XB4A 1R5BA 3B85A 3DO6A 4IXMA 3B9QA 1WDTA 3M0EA 5TB5A 3FDIA 2GVDC 1KJWA 2OXRA 4DCTA 2CL6X 2OAP1 2RGBA 1ZCBA 2ZRDA 2ERXA 3FOZA 3A8TA 2ORVA 1JAIA 2FWRA 5E7JA 2ANCA 3LFUA 4AURA 4KXFB 2BKEA 1AKEA 3FYHA 4DIEA 4IHQA 1W49A 3PQCA 3FMOB 4LHZA 4R2IA 5EXSA 4RZ3A 4PSKA 1ZU4A 2ORIA 4NCHA 2EFEB 2FEMA 4DKXA 5JCZA 4NYJQ 5JEEA 4JLPA 1B23P 1UEJA 5D3MA 1MV5A 2J0SA 1NI3A 2UZ3A 2ZROA 2JLWA 2D2EA 2N46A 3BIFA 1G3MA 5CJPA 2ZJ8A 1ZM9A 3JVUA 2F55A 1E2KA 4OI2A 1GSIA 3C4JA 2XNDD 5EZ5A 2ECKA 4V0ME 4DLSA 4EDHA 2ZJYA 5AUNB 2CMKA 2ZI4A 1MO4A 4QJ4A 3HU1A 4Q9KA 3CRMA 2VP9A 2O0HA 1E9DA 3THXA 3QKRB 3HP1A 4PAOA 4PAMA 3GFPA 3O8RA 2CL0X 3K09C 4KCGA 3WHLA 4M9QA 4PO1A 3F5FA 4TZ6A 3U6BA 5EXXA 1XTJA 3QE0A 1YKSA 3IEUA 5EP4A 3U3KA 1W1WA 5KHOC 3OIUA 3AGQA 1GG2A 3FVQA 4Q4JB 2IS1A 1Q20A 4M1MA 4C2UA 1D2NA 1OYWA 4DCNA 1NRJB 5UKDA 1BO6A 1M1YE 3NC1C 5IK2D 1QG4A 2ZJ2A 2OSBA 2WJHA 4LHVA 3ZS9A 1SXJE 4XVRA 5A0FA 5SZIA 1LFDB 5TXGA 4QL3A 4NDZA 4W5JA 2OBNA 5BN5A 3MMPA 3O47A 1F5NA 2BEKA 2ZYVX 1OXSC 2CDNA 3LVRE 1AS3A 1G64A 1XEXA 1Q0UA 2BBSA 2QUZA 3QJYA 5CK4A 1SKQA 1XJQA 3D7MA 3RS5A 4AKGA 1AGRA 2GCOA 4LOAA 2XB2A 4A2QA 2QSYA 4LBYA 2BM0A 2JATA 1XXHE 2HUPA 4JLVA 2PJRA 2WOJA 1OHHD 1S3GA 1Z22A 2X77A 2Z83A 5HZKA 3OHMA 2HXSA 4DLWA 4HAVA 1XPOA 2J7KA 2W0SA 5TVKA 4L8GA 1N0UA 1E79D 3MWYW 4FXPA 4URXR 1EFTA 2GTPA 3K9NA 4NZYA 5EE3A 1P9WA 4BFVA 4IDHA 4Q9HA 3U4QB 1IOZA 1FFHA 2JLQA 4OBEA 3FGNA 1DAFA 5B30A 4M9SA 1ZINA 2BIFA 2C99A 4DZZA 2XJ9A 1XP8A 1XU4A 4ZIRB 5KSYA 3ZD7A 1G18A 4I1VA 4BLRA 4A8JB 3TMKA 2GJAA 1RE0A 3FB4A 5DO9A 1LW7A 4PC1A 1GWNA 4B73A 4BLPA 1G7TA 1S2MA 4TTQA 1YZNA 2Q21A 3K09A 1FMLA 3AVYA 5AR1A 6Q21A 5DNYB 2R65A 3KKPA 4MGYR 5LDDC 2O8CB 4JL5A 2ZR7A 1NNEA 4OHZA 3AVQA 2AK2A 1YZUA 2W2VA 3QKRA 4JLOA 2XNDA 3ICQB 2V9PA 4DDUA 4K81B 3DM9B 2OBLA 4QBFA 4C0QC 2IEZA 4QGHA 4OQMA 2YOGA 1R4AA 1WA5A 1UBFA 4QNRA 3CLVA 1FOEB 2QY9A 5LD2B 4IVPA 3ZIAD 3FWYA 1YRBA 4NH0A 3L82B 1YZQA 4BFYA 1CBUA 4D0NA 3U5ZB 2RGXA 1VDZA 2ZYUX 3SDZA 1M6NA 4JVLA 1E0JA 4UNNA 3GLGE 3G0HA 1FP6A 3L2OB 4Q4AA 1P5ZB 2F1IA 2YNMA 2J1LA 4PC2A 1NVWQ 1NG1A 3D8BA 4YMSA 2ZRNA 1SGWA 2UVQA 1SKYB 3IBGA 3IILA 5IK2A 5JMTA 1OB5A 1IY1A 2V1UA 4DSNA 1Q57A 1RRPA 2HJGA 2NO0A 2VF8A 5CM9C 3BH7A 3GLHB 3LV8A 3SC3A 2ZJOA 4JS0A 5E4FA 2ZI7A 3LLMA 4CEJA 1WF3A 2J9RA 3PEYA 2IC5A 3X1ZA 1IN5A 4B3CA 1MH1A 4B76A 1Z2CA 4XIGS 2CK3D 4DDWA 2KBFA 4OK6A 2C77A 5KDDA 3B1YA 3BFKA 2FNAA 1OHHA 1T91A 1ZU5A 2EQBA 4R71A 1AK2A 4FCWA 3WBJA 4WW0A 2QG6A 4KAXA 3IGFA 3I5YA 1IM2A 1XFAA 4FMBB 4HLUC 1E79A 4PX9A 3U3RA 4YMWA 1GRQA 1GNPA 4JSTA 2FU5C 4JLDA 3TW8B 4B34A 3UG6A 2BBTA 2ZRBA 3CUEF 1UF9A 4M1TA 2A5DA 4QHYA 5CK5A 1DBSA 2F3RA 3GLFB 1U94A 2FF7A 2QTHA 3K9HA 4NYIR 3T1VA 3ADCA 1KI8A 3QUSA 1S96A 3FKQA 3MWJA 3LY5A 1VIYA 1IXSB 3DDCA 4UJ3A 4UNQA 1OXXK 1Q1EA 4OI1A 1DG3A 4PC7A 5J4LA 3R9XA 4M22A 1XPUA 3UIEA 2YHSA 1CKEA 2QPTA 1RKBA 3ZVRA 2JDID 2YC2C 1TQ2A 4GBMA 4FINA 4ZKEA 2IUTA 2WWWA 1E2QA 2Q6TA 2RKOA 2ZI3A 4ITRC 4BFWA 1XD2A 4BLQA 5F3WB 4LC0A 3WMEA 3F0TA 3FHOA 2A5GA 2GJ8A 2NZJA 5DHFA 1H65A 2CHQA 4TMXA 3ZIAA 2FPLA 3VTKA 2A5JA 2BMJA 2IYTA 1YR8A 2RHMA 4FW9A 4KJZA 2E9SA 1JPNA 2OEPA 4QKQA 2VP2A 1JECA 4B3FX 2J0UB 4O25A 3C15C 3AEZA 3BFXA 1W44A 1PZNA 1R0WA 2R6CA 2E1RA 3OIWA 3Q3JB 1DO2A 2VF7A 3GLHA 2CNWD 4MYHA 4PQFA 4CW7A 2HEIA 1KSFX 2QQ0A 1JJVA 3EZ9A 4LJYA 2X1VA 4D4JA 4CIDA 2EFCB 2GWHA 1CS4C 1R6BX 4E07A 2ODWA 2ZVPX 3HJNA 4NL4H 3R7WA 2WMNB 4B2IA 3QVUA 3VNVA 1II0A 2ZI9A 3BC1A 4MYUA 1CR2A 4NYJR 3LBNA 3TR0A 1GFIA 2J7PD 2PLRA 4HUQA 3A4LA 1J70A 4FWTA 3VHXA 2J0VA 2V6IA 5KYKA 2AWNA 2FE4A 4A36A 2CVHA 4C30A 2CK3A 1II8B 4M1YA 1R0XA 2B6HA 1OH5A 5EE1A 3RAPR 3DOEA 4ACAA 3PITA 1UDWA 2GXQA 2ASEA 2WSSD 3P27A 1N6LA 3MD0A 2JLZA 3SR0A 1D9XA 1YZKA 2W83A 5AUQA 3GEHA 2P2LA 2XJ4A 3IKJA 4BFSA 1CR4A 4BUJA 1AQYA 3B13B 1S3SA 3KQKA 3DHWC 4DB4A 3B2EA 2V4ZA 5TV2A 3PV0A 2ZRHA 1G8HA 3GLFA 2KB0A 2YJTD 4ZCIA 5KOYA 1KI1A 3KQNA 1KI7A 1E9EA 1N5IA 4LSGA 2CVFA 4Q47A 1G3UA 4A6PA 1KZ7B 4G0NA 3IO3A 4RD3A 4DC9A 3PUXA 4LJ8A 4LRWA 2GJ9A 2PEZA 4DLRA 2RCNA 4QM7A 5EP3A 1XEWY 2GA8A 2GETA 4LV5B 4Q18A 2OILA 2IL1A 2F6RA 3MGCA 3L8YA 2O8FB 1Z2AA 3LWNA 2JDIA 4NONA 2H1LA 1TMKA 4CZ2A 5K8LA 1T8UA 3RS0A 1Z6GA 3RVBA 2FSIA 4TQ9A 3NHBA 5JEDA 3GD7A 4M53A 2GVZC 3BJIC 3DZDA 3KQUA 1E32A 3BB1A 2RGGA 3BGWA 2J0UA 1GIAA 2QNRA 1US8B 1XZPA 4Q7MB 4EQ6B 4FIDA 3VNUA 1N6IA 1DADA 2WIAA 1Z6XA 1FQKA 2CE7A 2F9MA 3RDPA 3KQHA 1OJLA 2IYVA 2ZETA 4C9BA 4EKDA 3O8CA 1G5TA 1XZQA 1RC8A 5HCNA 3T61A 1G8PA 5KNDA 4AYTA 3I5XA 3PIRA 1TUIA 2G1JA 2FSHA 2WSMA 2CNWA 4RSGA 2Q9AA 2B7BA 4MDEA 2GXAA 1VKJA 4B35A 4M9XA 4F4CA 3U7HB 1GTVA 1OH8A 4LV8B 2DPXA 5AUPB 4B32A 3B1ZA 4EAQA 2RGDA 4HLQB 1FX0B 3FTQA 1T9HA 4ZKDA 3RC3A 3DOFA 3NVAA 2JLVA 3L43A 1DARA 1II8A 1XCPA 1XRJA 1QHXA 2J7PA 4LZZA 4OI0A 4S2EA 1HUQA 2F43B 4LJ9A 3P1JA 1X8LA 4LYFA 4LYJA 4HZIA 1D5CA 3VU9A 4HB3A 1PUJA 3GJ6A 5JI3E 2WSSA 1U2RA 3TRFA 4AWXA 3BERA 3Q9LA 1M7HA 4B43A 4US1R 5A5GA 3TBKA 4HAYA 3T06B 3TVTA 3P20A 2GZDA 2AX4A 1OSNA 4MRVA 1RRCA 3THOA 4UNRA 2SHKA 3EZ6A 3A4MA 1KJZA 4BLOA 5FPKA 3NH6A 3GFTA 2YOFA 3E2IA 1U9IA 2EW1A 3TQFA 4PSAA 1GVNB 3B9PA 4YC7A 1NLZA 3RS3A 2R6FA 1E2FA 4IVRA 1XTKA 2EFDB 2JIZD 1W5TA 2RGNC 3IPYA 4D82A 3B7GA 4HLDA 3LQQA 1KSGA 1XNJA 1OIVA 5FFMA 4EPXA 1QHYA 4GSYA 4NHOA 5JWOA 2R6DA 5FI1B 3KJEA 2O8FA 3I8SA 1G6HA 1ZMXA 1ZW6A 3D31A 5FTKA 4AKHA 3K0AB 3OE7D 3AUYA 4YMTA 1P6XA 1OB2A 3A37A 1S1MA 4GPTA 2ZVQX 2BMDA 4I1OA 5FPYA 1WP9A 1P7CA 1IN6A 1IAQA 2FGJA 2G0TA 4G5GA 4E03A 3F3YA 1K5DA 2HLDD 2ZIAA 4KLNA 5FUVA 4TYPA 4OHVA 2EFHB 2BMEA 1LS6A 2UZIR 1US8A 2CLCX 4P4SA 2BWJA 1OKKD 2KWIA 3GEIA 3IUYA 3P26A 4V0OA 1R8SA 2CBZA 2V1XA 4RCZA 2FA9A 2LKCA 4ZDWA 1OE0A 3K8YA 4US2R 1D9ZA 4F92B 1XMSA 4HB0A 3AVWA 1E6CA 1U8YA 2C9OA 5EQTA 4PZYA 3FFAA 4XOIA 2NGRA 5DGXA 4HLCA 2N42A 3WYFA 1A1VA 5KDOA 1EFCA 4G5SA 3NWJA 4PHGA 4M21A 3WRXC 1Z5ZA 4LGMA 4TTRA 3AF3A 5DLQC 1FX0A 4WAUA 1J2JA 1E9AA 2JASA 4PPGA 3EIHA 1KO4A 2ZR0A 3HYRA 3VR1A 4DCUA 5G53C 1NBME 3OZXA 1EK0A 1G20E 2P65A 4R9UC 4OJQA 1EFUA 2GBLA 2WKPA 1N5LA 2AXPA 2GAAA 1E4YA 2WIBA 4ZDKA 2NMVA 1VPLA 4ACBA 4CT5A 3QF4B 1KI6B 2AXNA 1CJUC 4K46A 2ZU6A 3DKPA 4IXNA 1VIAA 1R0ZA 4MRNA 1FTSA 4X8MA 3KUDA 4L15A 1OFUX 2RGCA 3PCRB 1W48A 2YWEA 2FDCA 2H57A 4UNSA 3WXMA 4LWZA 5HKKD 3MWLA 1KK1A 2ZI5A 4MRRA 4C0LA 5KSPA 1TEXA 3SNHA 1Z28A 2UKDA 4OHXA 1D8TA 3AKYA 3KB2A 5CJ2A 2DWPA 4PHHA 1ZAKA 1J8YF 1DEKA 2J46A 2I1QA 3GCGA 2GF9A 1U90A 3PEUA 2WWHA 4PXAA 5J4YA 2VH5R 5GVSA 3K0SA 2OUKA 3L0PA 3BH0A 3SI7A 2JIZA 3K0AA 1E0SA 4NKRA 1JBKA 2O0KA 5CIWA 3UWOA 4BE7B 5C2JB 3QKUA 3W8NA 3EARA 1P60A 1NG9A 1M74A 2MSDB 5EE5B 3CF2A 1LNZA 1TU4A 1NF3A 3OE7A 1VECA 3H2YA 2IXEA 1TAGA 3ADBA 3THYB 1GRNA 1NIJA 3GJ5A 5GJCA 3SYLA 2GRJA 1ZD8A 1P62B 4TTPA 4N0DA 821PA 1OT3A 1WE2A 4HUTA 2HLDA 3QY0A 2FX3A 5FH9A 1TF7A 3RWMB 2ATXA 3CM0A 3KDSE 3QI2A 4A6XA 4O3MA 1HY3A 4TL9A 1FW6A 1OKKA 2QMHA 2QEQA 2WKRA 2V3CC 5JSZB 4TLCA 3Q7QA 3L0IB 4BLTA 4MA4A 3AM1A 2PCJA 3VKHA 1OIWA 1E9FA 2IF0A 1ZIPA 2ZSDA 2GESA 4GRAA 5JHHB 2HF9A 3KFVA 5P21A 2EU8A 4D81A 1A82A 2PH1A 2IHBA 3KKOA 3I1FA 1IHUA 3TJZA 2P3SA 2R2AA 3QPWA 1FL9A 4O0MA 4CF7A 2HJVA 1T0JB 4Y0AA 3GLIA 4HAWA 5KO2A 2IBMA 3QQ5A 4PQRA 3CPHA 3OAAD 2XAUA 1ZM2A 3QF4A 3RRNA 2D2FA 2ZREA 1Z0AA 1PV4A 2ODNA 1TQ6A 3QG5A 2ZXUA 5JRZA 3RS4A 5IRCD 3U3MA 3BB3A 3DMDA 2X2EA 5B2ZA 3SHWA 4HDCA 4WOPA 2Z0MA 4PPNA 3LNCA 4PR0A 3LX5A 1DE0A 1M7BA 4KSBA 1A2KC 3HR8A 2NIPA 2O8BA 3QBTA 1YR6A 1SVLA 3QVVA 4PC3A 3LW8A 4KI0A 3VKGA 5HKKA 1G7SA 1GITA 1KTVA 3CZQA 4P31A 1DAKA 3IQXA 1Z0DA 3PFIA 2IEYA 1P73A 1R8QA 3TIFA 3WNBA 4HZUA 1YZGA 2YWFA 5KDLA 3HU3A 2AHOA 5KSZA 5KSOA 1KMHA 2VP5A 1TF2A 3CR8A 4ASUD 2JEOA 1IY2A 4FMCB 1W4CA 5DI9A 2AFIE 3NTUA 3DL0A 3U7GA 1AN0A 4Q21A 5DIFA 4C0SA 1IQPA 2JLRA 3QXJA 2VP4A 1R5NA 4DSOA 1OXVA 1W46A 2ZQ5A 4B6EA 4NCIA 3AKDA 4LUCA 1JAHA 3AQ4A 3EPKA 5SZHB 2CLDX 3FPAA 3K0FB 4YLGA 1YHNA 2XX3A 3PR1A 3T5DA 1XF9A 2EVWX 2WWFA 5B64A 2ZSAA 3IBYA 2RHDA 1ESMA 2V54A 1G4AE 4D2IA 3QBVA 1J8MF 3AP2A 5DE3A 2PCLA 2WJIA 1UPTA 3LO5A 3KFXA 3UKDA 2Z4SA 2B21A 1PUIA 2ANBA 1KJYA 3TNFA 3SHFA 1ZBDA 5BXQC 4Y0VA 4URYR 3L8ZA 1MO5A 1KK0A 5IDVA 2PMKA 1X3SA 4BRWA 5K8IA 3EX7C 1E2DA 2FH5B 2BHRA 3WYAA 5KPJA 4XSGA 4ZI2A 3S1AA 1CJMA 4A0FA 4CRWB 3B1VA 2AD1A 5A4JA 4C2TA 1DAIA 1N6NA 4JJZA 4NE2A 5B58C 3AF2A 3GLIE 4MGZR 5GVRA 2W58A 3W9YA 1KNXA 1N6PA 1D6JA 3QENA 4LBZA 4PFSA 4FMDF 1Z8FA 1KAGA 2QE7D 4QBHA 2XOKA 1JQLB 4U00A 1OV4A 2A9KA 2Q3HA 4IJMA 3BD9A 3A1SA 2VIIA 2NO6A 2ZE6A 2H17A 3IIMA 3RSLA 3W5JA 3SJZA 2QTVB 3H0KA 3LRPA 3OAAA 2ZITA 4IW3B 5L3QB 3ND8A 2LCFA 2OM2A 4BECA 1U0JA 4GOJA 2BBOA 3QXSA 3SBEA 3U3OA 2C9CA 1W4AA 4Q1DA 4UKDA 4G1UC 2DBYA 1ZYUA 2HCJB 2HDNB 2Q3MA 1IN7A 1P3JA 1DVRA 1YZTA 4Z8XA 5J4HA 1YRAA 2BEJA 1VCNA 3HDTA 1DAEA 4E5UA 4A8JC 2ODEA 4JBYA 4XTCS 1HT2E 3TSZA 3GMTA 4MH0R 3V00A 1N6RA 3LQRA 1VCOA 2FFBA 2NO1A 4JYCA 5J5CA 3CF0A 4IOLA 2DR3A 1R5OA 2W2XA 4P4UA 4GL2A 1GKUB 1ZC3A 1CU1A 2C2HA 4JLJA 1WBBA 1G7RA 2GHIA 3EZ7A 2BDTA 3W5IA 1F2TB 3CPEA 3QKSB 4NCNA 4B47A 3QXXA 1EG7A 3AP3A 2F3TA 3HYTA 1OXTA 2ZAOA 3CRQA 4ASUA 3H4MA 3U61B 5DYIA 2GNOA 3VX4A 1OH7A 1KAOA 4Q4JA 2B92A 1ZNXA 2BCJQ 2DWQA 3JZMA 2N1BA 1IBRA 2W6JD 3K0FA 1I4LD 1LV7A 2LWIA 4KBGA 4KU4A 1E98A 4RD6A 2WWGA 2XTZA 3G5UA 2MMGA 2KBEA 3RABA 2CXXA 3W90A 1OFTA 1YE8A 2QL6A 3B1WA 4TLBA 5LD2C 3T1TA 3R9WA 3NKVA 1TEVA 2OV2A 2F1RA 2R44A 2XITA 2HCBA 5AJYA 5FBVB 4BWYA 2C96A 1BKDR 4XJXA 3CX6A 2QAJA 4AY2A 2LKDA 2OO7A 3DZ8A 4Z51A 2X2FA 4LJ5A 4DLVA 3OF5A 4QHTA 4D4KA 1XEWX 4LBVA 5AJZA 4MDFA 3KQLA 1XTSA 2FOLA 1GNRA 3K0CC 3DEFA 1CR0A 5SZJA 1HURA 4Q7KA 4Q9IA 4MRSA 1CJVC 4QJ3A 1XMVA 4HAUA 1ZM4A 3A1UA 3FMIA 3AH8A 3UG7A 3U44B 4DDVA 2Q0HA 4ESHA 1R2QA 4EFLA 4B3BA 4LV6A 4KFSA 4A82A 3CB4A 1TL7C 3Q85A 2NPFA 4YQFA 3U4QA 1RPZA 4UQOA 5AUOB 2D4HA 4RCYA 2QE7A 4MUAA 5GJWC 5CLLA 1BYIA 5F98A 4PSVA 1Q21A 4ZIRA 2O8DB 2DHRA 3AP1A 5L3QA 5KUTA 1X8JA 1L2TA 1VMAA 4A8JA 3B6EA 3TSWA 4HAZA 3TUIC 1MR3F 1XJ0A 4B6FA 3U6KA 3AVVA 4DCVA 3F8TA 1M2OB 2A3RA 2QMOA 2VTKA 4RY2A 1IXZA 5JRJA 2GCNA 4I1SA 1Q22A 1DELA 2VP6A 2XZPA 4PHFA 4AYWA 1ANKA 3CX7A 5EJEA 4MYCA 2O8CA 4P32A 2FZLA 3C5CA 1E0AA 3LXXA 1OLOA 2JA1A 1G3RA 2JJ2D 4FWIB 4XWAA 4BFUA 4QBGB 4LJAA 2J41A 1P2SA 1OFHA 2C04A 4URVR 2BVNA 1ZUNB 3B5JA 4UXIA 2ZRCA 1LF0A 1OF1A 1EFHA 1QVRA 3NBFA 2FPMA 3A1TA 1F2UB 3QKSA 3C16C 3FHCB 4LBWA 3WNDA 2HT1A 3CWQA 1NN0A 3D3QA 1E3MA 1QHNA 4IEIA 2FPKA 4EPVA 3W6PA 3I61A 3K9LA 4LX0A 4R7ZA 3ZZ0A 4YXWD 2Z6VA 3WHKA 3N70A 1N5JA 4A15A 3GJ0A 3SFVA 4OI4A 4WIAA 4EPTA 1PJRA 1F60A 1WQ1R 4TQAA 2JLXA 1OH6A 4WBSA 3AF1A 1E99A 1W0KD 2ZRJA 4M4SA 4Q1CA 2JGNA 3ZQJA 4BPBA 1NMXA 3TSOA 3T15A 1MKYA 3QPUA 5CYOA 2G3YA 4JMPA 5DN6D 4TYNA 1IN8A 4F4JA 5F9FA 3U3JA 3ZH9B 1UBGA 4A9AA 1IJFA 3K0CA 1Q12A 2TMKA 2CCKA 1E2GA 1FTNA 5LB4A 3QNUA 2GEDA 1G8GA 2IXGA 5EE0A 1R0YA 4P3YA 3RRMA 3SE0A 2VL7A 3VR2A 2XSZD 2IUSA 3SU8A 1W36B 1A2BA 2QTFA 3GJ7A 4XWOA 2A7QA 3KL4A 3V4FA 3VMFA 2W0MA 1T8TA 2ZE8A 3IO5A 1CP2A 1T6NA 2QQEA 1CTQA 5H8WA 4JLAA 1R7RA 2FFHA 3IIKA 4JL8A 1G5RA 3U44A 1VG1A 3O8DA 1X1SA 4ARZB 4EFNA 2P5TB 2IK8A 3CW2A 4H9GA 3LW7A 3MG9A 4NCJA 2IWRA 1LF5A 5L3SB 2C95A 1NKSA 4V03A 4F4IA 2ZRPA 3CX8A 4QNMA 5FI0B 3ZZTA 4DSUA 4NU0A 1UJ2A 3I4LA 2G9NA 1P9RA 1G7CA 1KOFA 2ORWA 2R6GA 4A4DA 2IYUA 1Z07A 3FFBA 4BFZA 5HR5A 5EXPA 2IYRA 1OYYA 5EZ6B 1Z0JA 5TARA 1GL9B 4EPWA 5JJLA 1S9HA 3WP0A 4MKFA 3ZZUA 5GJVC 2J87A 2AK3A 2ZJAA 3FE2A 3HR7A 4PPQA 4DLXA 1AS2A 2IUUA 1QVAA 3PUVA 2H18A 3GP8A 5HE8A 1Z63A 4FI3C 1W47A 2YZ2A 3FMPB 1GUAA 4BLSA 3VR5A 1E2PA 2DCUA 5FPTA 3NBZC 2FMXA 4YMUA 2VHCA 1K6MA 3EWAA 4MQBA 2B7CA 2JJ2A 3K53A 5C18A 1U9IC 1SHKA 2BJVA 1XBTA 2G83A 4XVUA 4H1UA 2RMKA 3ONWA 2PLFA 4TQUS 4IDOA 2OT3B 1H8ED 3THWB 1AZSC 3CIOA 4TMVA 5DISB 2VYFA 3RC8A 4TYQA 1QHHB 4LHYA 1LS1A 4LPKA 4R98A 3QEOA 4YXWA 1AS0A 1SKYE 3KXIA 4A0GA 3BXZA 4FN5A 2OE2A 2QAGB 4ZDIA 1A5TA 2PZEA 1NIPA 1UBEA 2WJJA 4BASA 1E2IA 3GLHE 4M1WA 1W0KA 4YDHB 3K70B 1AZTA 1QHSA 1VYUA 5DN6A 3NG1A 1EFRD 2VQSA 4QG7A 4RVCA 2VO1A 4LDJA 5TY0A 5B57C 4DLTA 2AN9A 2ONKA 4DUGD 3UXMA 3ICEA 5G40A 1Z0KA 1NVXQ 4BEBA 3KXKA 2MSEB 1WBDA 4URWR 4Q48A 4J0QA 5E95A 1JEDA 1VG9B 4KYUA 3RLFA 3UPUA 3PJRA 4TZ0A 4M9ZA 4A0RA 3PUYA 1OFIA 1N6KA 1R10A 4EPYA 3JZAA 1F3OA 2XSZA 1FNMA 2GXSA 3TE6A 4JBWA 2H8KA 2HF8A 2QP4A 2QT0A 3DPUA 1D2MA 2P67A 2A5FA 4D6PA 3VX3A 1XD9A 1RRGA 1BS1A 2BKUA 2IYYA 4QC2A 5F9HA 4DCSA 1CR1A 1VHTA 3EZFA 3OIVA 5JJIA 4PQYA 1CRPA 1MRNA 3LLUA 3SS8A 2GF0A 3KKNA 4OHYA 1E9RA 3A58B 3K1JA 5FOSA 3GPLA 2EYUA 4UXJA 4C7OB 5KNBA 3AV0B 1PLLA 4B3XA 1NMYA 1P61B 4EPRA 3GLFE 2GBLC 2C03A 5BN4A 2IS6A 3KB1A 1YQTA 1QHIA 4RZ2A 1RJ9B 2Q9CA 4KFUA 3EWSA 1E96A 2QPAA 2G88A 5CIQA 4M8NE 2YKGA 1S9DA 1C9KA 3OEHD 4HDOB 4A1FA 4HAXA 3QG1A 2BM1A 2ZJBA 1JALA 2DFNA 3RSOA 4UJ5A 1TQDA 2AL7A 5SZKB 1UBCA 2XTNA 3SQXA 5FUWA 1EWQA 1NN1A 4B2LA 2MSCB 4WZ6A 3WMGA 1XMIA 2VPPA 2GDJA 2OAQ1 4MKGA 5L3RA 4TLDA 1X1RA 4G5RA 4EJSB 4JBXA 2VHQA 4Q1AA 3EA0A 1GRRA 1KDTA 3BOSA 3RHFA 4FD2A 4TMKA 2YYZA 1QHHA 3UMRA 3C5HA 2Y8EA 4HYYA 1G41A 4DLUA 5DYGA 1MT0A 1NMZA 1H8EA 3KJGA 1I4DD 4RKFA 1E1RD 2A2ZA 3OIYA 4IOKA 5FTMA 2L0XA 1IXRC 2V8OA 1ZD1A 2QP3A 3QPVA 1NJFA 2EYQA 3X1DA 2EFGA 3I3SR 4EQ6A 4JLKA 1HQCA 3MJHA 1A7JA 1HV8A 1MABB 4X8OA 1XDBA 2JCSA 3BS4A 3BWDD 1M34E 4QJ5A 5FOUA 3KKQA 3EIQA 2I3BA 4G3XA 1UAAA 2PX3A 1EX6A 2D06A 3BE4A 3NEJA 4RD0A 1U0LA 4BZXA 1CIPA 2ZEJA 1EFRA 5CM8B 2ZJ5A 5J40A 3RRZA 3VR4A 2DWOA 4DUGA 1SXJD 3X1WA 5FPHA 4D4LA 1TQ4A 1ZCAA 4JJKA 1H8HD 5CDFA 2Z43A 3L0OA 2GILA 4MKHA 1SXJB 5FUXA 1KDPA 1XTQA 3ZVMA 1JB1A 5H68A 5JS8A 2QSZA 1KDRA 4KV9A 5K8UA 1L8QA 2IT1A 4PC6A 3PENA 2F43A 3BBPA 1QRAA 5M04A 1ELOA 4ERNA 4C7OA 4U7DA 3EIEA 3TAHA 4UXHA 2DYKA 4QRHA 4YDSA 721PA 5CITA 3SQWA 3WY9A 2IYXA 1SVWA 2ZUBA 4JVMA 1W4BA 1Z3IX 1HE1C 2OXCA 1XXHB 4IOJA 1NVVQ 4LYHA 4NP6A 5AJVB 2Q3FA 3CWZA 2D7DA 1KY2A 121PA 3EZ2A 4BRUA 4XWKA 4A2WA 1KY3A 4LJ4A 1PVOA 1HT1E 1DG1G 4PHTA 1NJGA 1VG0B 4KVGA 1NY5A 1NL3A 1Z47A 4QBIA 1Z06A 1NKTA 5CLQA 3A1WA 2DFTA 2QRZA 2ZM5A 3Q7PA 3Q5DA 3LX8A 4Q00A 4EIWA 5D3MB 4D26A 3K9GA 1ONBA 4EJSA 4D0GA 5KTYA 1W7AA 1G5PA 4FCTA 1MOZA 2IA5A 2AD5A 4XTRA 4DSTA 4L4UA 3BAFA 4NMMA 4UNPA 4V0NA 521PA 4ABYA 4GFDA 5FBLB 2IX3A 1RZ3A 1S4QA 4GMXA 3VHLB 3W3ZB 3RNLA 5JS7A 4LY6A 1UM8A 3Q72A 1KMQA 1CXZA 1IY0A 1ZM3A 4GT1A 4V0MA 4TL6A 2PL3A 4RD2A 3T35A 3NHAA 1E1RA 1AGPA 3D6TB 1KNQA 2V7QD 2KE5A 4LC1A 1GKYA 2AWOA 5AK0A 4GZMA 1UKVY 2C8VA 3SEAA 1ETUA 4I1UA 1JR3D 1DAHA 2IYQA 1PLKA 1TADA 1YR9A 2ZRGA 1KI2A 1T3LA 1GL7A 3IDQA 4TMTA 4B75A 1VHLA 1Z6YA 5ELXA 2WJGA 3WMFA 4LHWA 3KJIA 4B3DA 5FTLA 3C7KA 3GLGB 1V5WA 2A78A 2IHYA 4QOSA 2REOA 4URZR 3TQCA 3VFDA 3MCAA 3NIBA 1ODFA 1SXJA 4XH9B 2VBCA 2WMOB 5FBWB 5HPYB 2IXFA 1Z83A 2QZ4A 5AJWA 2O8EB 2CLSA 1H8HA 2ERYA 2NTYC 5E7IA 2JLUA 5DI3B 2CL7X 1SVMA 1KI6A 4JIMA 1MO6A 1GZSA 4MITA 4JLMA 3NDPA 1KK3A 1UADA 1X8KA 2FJUA 4D25A 2PZFA 3HWSA 3VQTA 1VCIA 3TKLA 2IS2A 3WRYC 2RAPA 1ESNA 4DRZA 1CJTC 4XSHA 2I4IA 4OQNA 3E5HA 3EC2A 3REFA 4CGZA 1E2LA 2X19A 4W9MC 4RZXA 2ZU0C 1U8ZA 1LB1B 3KKMA 3O8BA 3P4YA 1KYIA 1ZRHA 5JJKA 5LPNA 1JEEA 1ZNWA 2OCAA 4TL8A 1Z29A 4LK2A 5G41A 2P6UA 2VSXA 3G82C 4GI7A 1G21E 1T3SA 2YVUA 3QSYA 5FL3A 3QKTA 2PEYA 2PT5A 4Q1BA 1IONA
chains in the Genus database with same CATH superfamily
2FQYA 1W96A 1QF9A 1RWNA 2W2QA 3Q5EA 4GYWA 4RE6A 4F60A 1Z5VA 2XRMA 2YC4C 3AVPA 1T9CA 3L5KA 5DNDA 2J32A 3UMSA 4AJNA 1T0HB 2G07A 4QUAA 1P75A 3KV1A 5IDXA 1ZUHA 2HOQA 2GZRA 1TI7A 4DOMA 1KZ9A 3PIIA 1FNSA 5DH9A 3HPQA 4ON9A 2I55A 2XHZA 4Q4DA 1O4WA 4DCMA 2PL1A 1KYWA 3C45A 1KVSA 3D7KA 5MF6A 3TK1A 1Q6ZA 4D80A 1HDGO 1ZIOA 4MI6A 3SJCA 4D8WA 3NWPA 3P0FA 1PVVA 2EX1A 3CYFA 3H3FA 2IHZA 3RSHA 1J1IA 1NU6A 4ZTBA 3H6GA 4GDFA 4E2XA 4J0CA 1KXJA 1JG1A 2HF2A 4L07A 3OD1A 2AEFA 3MPOA 1P29A 1QP7A 4KNVA 1UFQA 1Y1QA 1Z5NA 3H13A 4HDMB 1XCMA 5DYYA 3KXDA 3WKCA 4DEXA 3ZWXA 1XELA 2VDRB 2WFLB 3O94A 5DTMA 4Z53A 1JKJB 2G0NA 4PGAA 1CEEA 3JQFC 2G36A 1I36A 1NATA 1V3UA 2DY1A 1GUBA 2OCBA 3EVBA 2BFDA 3FYDA 5T4BA 1YS7A 1QCZA 2A1UA 5JAHA 4RPIA 5LIPA 1RWVA 2OBBA 2CJPA 2HJRA 2G9RA 2JZOA 2C9ZA 2PT7A 1D7AA 4FDMA 4NZOA 1VCMA 4P4GA 5TR9A 1YDEA 1E6UA 3BPSA 1JEAA 3ZHZA 3FLAA 3IV7A 3K7EA 3IIJA 3N3BC 3ABSB 4HG2A 5DDIP 1RYDA 3C3DA 5TMDA 2V58A 2XEXA 1P44A 2XT0A 4QELA 3DZKA 2BV3A 1SULA 3I2KA 3V9PA 1A04A 3ECAA 1L4NA 4S1VA 5FP0A 1BA3A 1U7XA 5K0EA 2RCYA 4MS1A 3FAZA 2VJLA 3PJEA 3FRIA 2D62A 4IAOA 1EX1A 2QBYB 4DL9A 2QUKA 3C7AA 3UANA 3WR5A 3AIOA 3ISJA 4G4JA 4RXMA 3JVVA 5EJ9A 2WU4A 2XNSA 3PI6A 3RUPA 2GRUA 4AYXA 1C0LA 4D0RA 3ZD6A 4CM9A 2GEVA 3BXXA 1PR4A 5FFNA 3NHSA 1T9KA 3FMFA 4GYKA 4JI3B 5KTPA 5FWXA 2OK7A 1ISIA 2WF9A 1CDEA 5KC8A 2PU5A 3A4IA 1RADA 2BFNA 4WXRA 3L6OO 4IDCA 3OTHA 2XB9A 3VNRA 5IHPA 1NJ5A 3INGA 1BIFA 2YJ5A 2VCEA 5DCLA 3MWKA 3NUZA 4GM1A 5IJ0B 5K5EA 3N2IA 4NCBA 4TKZA 4JV5B 2PIDA 3FKSD 4HS4A 1LCIA 4ESOA 3UAWA 3CXRA 4NC9A 3TD6A 3TW4A 2WT9A 3GT0A 4BTVA 2ZS8A 4EA8A 4EARA 3IP5A 4G86A 1E2NA 2D0PB 3KSMA 3DS8A 1NWCA 5IMSA 2Z2KA 1F2VA 4B71A 3O3CA 2PVSA 4BNGA 3OJFA 3JVIA 3A9RA 1JLLA 2BYTA 5JZBA 1XQWA 2O5RA 3C3EA 4O2AF 4EEXA 5TLSA 1SK8A 1F0YA 3ZCTA 2ONJA 1HDRA 5C4GB 5JJCA 3GZJA 1C14A 1U2GC 4MQUA 3OG9A 5IUKC 3SP1A 3FW1A 1FP7A 4DJAA 4R2HA 2OBFA 3ZHQA 2XXAA 2F17A 1LY1A 1DX6A 2P6OA 3ET4A 1KKLA 5K8TA 4LJSA 5LJIA 2KI5A 2NG1A 3ASVA 3EG5A 3ZHBA 3R9XB 1KO1A 1LFAA 1N3LA 1HM5A 1OROA 4M46A 3JD2A 3S2SA 3JAKA 2ZXEA 1UM9B 4CG2A 2O57A 3A4NA 4MCAA 2IYWA 2AVNA 1P7WA 3B52X 2UZ0A 4PSDA 5C1DA 1EG2A 1MJGA 1O87A 1EFKA 4QYSA 4Q93A 1C1YA 1XD2B 2C31A 1E1LA 2J5KA 4R8SA 4WFJA 3TO5A 4DS3A 4D9HA 1YR7A 1WHSB 1G1MA 1ZM7A 2DULA 3KXPA 3ERCA 1DKQA 5EPEA 4U9HS 4RTKA 1ZIXA 4NMXB 3V1NA 2GN9A 3MGBA 3N2EA 3WHPA 1QHGA 4KMRA 5IXYA 4UBMA 4NYMQ 5E6RB 1B6RA 3RRJA 4CDGA 4A6EA 1RRFA 2OC9A 3ANYB 4PBRA 4NZZA 1DAOA 5A5FA 2JLSA 4XGIA 4Y1FA 2E5FA 1JIKA 4W5WA 1NC3A 4IQ8A 3X2FA 4NU6A 2R6ZA 3MZ0A 4WEOA 4OHWA 4AZ0A 2WEKA 2BJWA 4P4TA 1LA2A 1PJTA 3DCIA 3TZQA 4AO6A 3DV2A 1LDMA 4OSPA 2FN7A 5TDHA 4BS9A 2XVMA 1WPGA 3SC4A 4W5NA 2NUTB 3E82A 1IVNA 4XD7A 5JSFA 4Q4HA 6PFKA 2AEMA 2YYSA 2II6A 3TLZA 4AD8A 1HZZC 2CUZA 1BKYA 4G5OA 4Y2VA 1P4HA 1LTQA 5E8JA 4JXKA 2QT1A 2MT9A 4YJFA 3TLMA 3L0CA 1NN5A 1COWD 2PRJA 4G0UA 1DC5A 3H2GA 3LA6A 3PBKA 4FILA 4HUQB 5B58T 3E9QA 4U7WA 4MVJF 5JDIA 1GL3A 3DTVB 1EEHA 1W9HA 2WVGA 3F96A 3KVRA 4O2RA 5CB4A 2ZAGA 3RYFA 5B1SA 3T95A 1J39A 4QAQA 1PR0A 4AS3A 4KKXB 1W52X 2BZSA 1OWLA 5SY9A 4FHDA 2I4OA 2J9ZB 1IZ7A 1N2ZA 2XZDA 2ZGVA 2DQZA 4MPTA 4HYTA 1P6QA 5C8YF 1T2VA 4J43A 1T5IA 2WPDA 4PYRA 2GAFA 2HQRA 3RANA 3TTXA 4E22A 5BP7A 1OBVA 1YO6A 3WI7A 2G7ZA 2ZZKA 5FAKA 3CLUD 3R3ZA 1DT5A 1F2TA 1L5OA 1Q5PA 3TXYA 3NEAA 1JQAA 2YQZA 3H6KA 1N3YA 2GM9A 4PAGA 4C3ZA 1G59A 2PUGA 1EM8A 1QRSA 1V43A 3UXYA 3G8BA 4JR1A 4KMMA 4RTJA 1SB9A 1Y82A 4R1TA 1C9JA 2ZT7A 3TI9A 1PBTA 5C8VA 2FUG1 1TTQB 1NZDA 4Z54A 5LYJF 4ZO4A 2LD4A 2PKQO 5IHXA 2JLYA 2C78A 2QZPA 4LWPA 3AJ9A 1BCRA 3HQ4O 1I1OA 4WK4B 1QWSA 5K20A 1BD3A 2FPXA 4HDQB 3Q0IA 2W6IA 4WCFB 4YCNA 4GOKA 2GD1O 3GFRA 1ZLYA 3I72A 1GNLA 1QO0A 2QN8A 2HCTA 2W6JA 2ZRKA 3E8SA 3NRBA 3OU2A 1I2CA 1NXSA 3OQ1A 4KMOA 1A96A 3EASA 4HY3A 5G3YA 1KFEB 4DT1A 2IH5A 2JJ1D 1G5HA 2VDLB 3ZGOA 4I99A 3JQGA 3UJDA 2QUHA 4DIOA 4EHFA 2UVDA 2WF6A 3BGVA 3I45A 4G5YA 3KVNA 3KCQA 4W9NA 3ZKWB 3ETLA 4L8LA 4RDHA 3SSMA 4EM6A 5MGBA 3M6AA 2D6FA 1ORIA 1PE0A 4N3NA 5T3YA 2QENA 1JJ7A 2ZJ1A 1BDBA 5EMMA 3W4JA 1LU9A 4N18A 1BG6A 4O4JA 1J5EB 4DLPA 4QDTA 2C2KA 4BFTA 1XD8A 1B74A 3WIDA 2G9ZA 2BUCA 1WCIA 1U9ZA 4HDRA 1MZPA 2WM8A 4HZGA 5EMLA 4R3WA 3COVA 1N25A 4YAOA 1A98A 3DZCA 1AM4D 1D1SA 1C1HA 1VKHA 2G80A 3IAS1 4GKKB 1T6BY 2FWIA 4MR7A 2M6LA 1C3OB 1SU4A 3DP9A 4HPXB 4HWTA 3UOAB 1YUMA 1O6ZA 2CDAA 2V9CA 4ANFA 1ZH8A 2EGUA 2XKAA 1OW3B 2XYPA 1QC5B 3D2BA 1U3TA 1BMFD 3VZBA 5KVVA 1GTRA 1XWIA 5JYCA 2P4HX 1B6GA 1G17A 1G2OA 3CC8A 4DQVA 3KXLA 3LDAA 1AK1A 1QQ7A 4U6NA 3SF8A 1O0BA 1PWXA 3AHDA 4Q4LA 2VDOB 4JLNA 3VR6D 2W98A 2IYSA 2RJ3A 3O91A 4IVQA 4OXKA 4DVGA 1CFZA 2Y99A 3H04A 4ZCMA 2O5VA 2QN7A 5K3CA 3H2JA 1M2VA 2AOUB 4CEIA 2OLJA 1RXYA 5A3SA 2A4MA 3N74A 4CGYA 3HBLA 5FTNA 4JKYA 2VXCA 3CKLA 4TV8F 4Y2YA 4JOCA 4WXPA 3MCVA 5HX7A 5JAPA 2DB3A 3QF7A 1FSPA 2VP0A 1J97A 1ISMA 3ZDFA 4A16A 3VU9B 2JKYA 3MAAC 4POAA 4UBJA 4L5CA 3I92A 4IS3A 3WYGA 3LT0A 3MFYA 1VSBA 3ASZA 1ZXLA 1KI4A 3IE2A 3W79A 1MFZA 2ATVA 1O3YA 3CCBA 4FSHA 4P93A 3DLAA 1MIOA 2EWMA 3R5TA 3JQQA 1YV9A 4LGCA 5IYZA 3IKTA 5K0SA 3G0DA 2C4MA 2G25A 3LC7O 4HJXA 4P5DA 4EG5A 1TKCA 4I19A 3FOWA 3TLXA 1TF5A 1U4SA 3NPMA 3V4RA 1EHYA 3STYA 1EXMA 1PEKE 3DFZA 1GNQA 2VNKA 3KX2A 2HWKA 2P7HA 1XZJA 2UUPA 1IJEA 2VK2A 2BFCB 4NPCA 5CW1A 3T7EA 4JI2B 1NQUA 2BC9A 1KA9H 1SIBE 2RAFA 2VZ8A 2HTFA 4TYMA 1JLRA 1P1BA 3V1LA 1UFVA 3W34A 3FLMA 4C03A 2H2IA 5BN3A 2FSSA 3E81A 4P82A 2EWVA 2C0QA 2M6RA 3DFMA 1FMTA 1EGAA 3PE6A 2J3MA 2PGDA 5TRTA 2GK7A 1YF3A 2OXEA 1YVRA 3I6BA 4MP8A 3SZ3A 4CG1A 4V0KA 4UTVA 1GTMA 1FDOA 2PZJA 4QPNA 1UXOA 1UZLA 3QUQA 5KNDH 3DWIA 1XQ9A 4ETNA 4MDHA 4TSFD 4QGGA 4KLZA 1L7EA 3DSRA 2WTBA 1T8RA 4P6VF 1H42A 4KE8A 4X3PA 3OCWA 4Q0MA 4ZJYA 2ZULA 4Q5IA 1JYEA 2RGYA 4L7QA 4RX1A 3SPXA 1G19A 5GP1A 5LP6A 1FBNA 4Q82A 4U2DA 3QVKA 1YQQA 3JVEA 2AG1A 4LSMA 4N82A 3VVBA 2Z6QA 4ER7A 4ARVA 4IIJA 1YCGA 2O8VA 1O94D 1H9CA 2HSEA 2GZAA 2ZJ0A 2ZDGA 3U2QA 4CMIA 5HKAA 3OPMA 3SIXA 1GA4A 2BISA 1Y42X 9MHTA 4HPWA 1GGJA 2X5NA 4GWGA 3H1AA 1KJQA 1MAWA 3X2SA 1TLTA 4E2FA 1QDEA 1TCBA 2QW8A 2WWXA 3I4FA 2WWYA 1E1QA 2IZ7A 3H2SA 1U28C 1P5RA 1ZN2A 3DAOA 4XA8A 1WCWA 3BK2A 3RK4A 5HTKA 1Z12A 4EMBA 2UZ4A 3HY3A 1B16A 5FFFA 2HLHA 3B2NA 4Z4GA 1XPRA 2C9YA 5JS6A 3OOHA 3R0VA 2W2KA 2Y3IA 3ILYA 4NZPA 1I01A 1W4RA 4RF2A 3DNMA 2Y0PA 3NKFA 3OPQA 2BL4A 3NTLA 1PK7A 2AYYA 3FZNA 4FX5A 4PX3A 3KDAA 4URUR 1QTIA 2J5QA 1QK5A 2Y68A 4KWIA 4LXTA 3HRIA 4BVAA 4P9NA 1P72A 3ROEA 3L4SO 3LDHA 3W5AA 2WZBA 2NO9A 1XQ1A 3HU2A 2YOHA 3GQBA 4HGOA 5FOVA 3WLFA 4FN4A 1NBMA 3CSSA 2GN6A 2VSOA 4M0PA 4X41A 2YN0A 3ZJYA 3BK1A 4J91A 4ZJUA 2R00A 3H84A 3V4ZA 1U3FA 2JIQA 2OO5C 4R8RA 3TTTA 1O95A 2HJ9A 1X19A 1IZ9A 2DHEA 4Z1MD 3V1TC 1MF7A 5FOXA 4BJ3A 1IYZA 2G82A 3ER6A 1EBFA 2D7CA 4C4PA 3H1PA 1J99A 1L7RA 3IH5A 3GFVA 4HXGA 1K1EA 4HQ0A 4RY9A 3ZK9A 5YASA 4GXRA 4PGGA 4S2UA 3IULA 1B41A 4GQBA 5JD3A 3LY7A 4IUBS 3E3LA 3THWA 4PG8A 3AESB 2IYPA 3E22B 2HK6A 3EMKA 4KFTA 3C8UA 2FW6A 5JT1A 2B35A 1PGNA 3UK1A 3CH6A 4KQFA 1EX9A 4AX8A 4CDNA 2V6JA 1ZY2A 1CEQA 3NHFA 1CY6A 3N07A 1QH1A 1UQRA 1EXNA 2XQGA 1U2TA 1YU6A 3BRQA 1S8FA 3EEYA 1U9CA 4YJKA 1S0UA 3WLLA 5JY6A 1A5BB 1GPDG 3I09A 1ZA2A 2KW5A 4NNOA 4NYMR 4OYHA 3HNRA 5CA0F 2XE7A 4J4HA 1LI5A 4PZZA 2ODBA 4DBLC 2OZKA 3MTEA 5KNCA 4H1TA 1GZ6A 3EUEA 3CLTD 5E0KB 3R7DA 2XNJA 5FPSA 5K0JA 3PFWO 3COSA 3UEOA 5CD1A 4BFLA 2AFIB 2FRXA 3A1NA 1BOFA 4JB3A 3QKIA 3R7BA 5KOJA 5FUYA 3AL3A 2XMDA 1T10A 5CVEA 1KSJA 4WLNA 3NMUF 5JLJA 1MPTA 2A67A 4D5EA 1PS8A 3F2IA 4OHBA 1XYYA 5LBIA 3O9VA 1RXCA 4N47A 4B6SA 2X7XA 1ZGZA 3M6LA 5CB8A 5BOVA 4PYOA 1XRNA 1TXGA 1YOVB 3WYNA 3HC7A 3CLTC 2X3YA 4QBKA 2QP9X 1LSJA 1JR6A 3BQ9A 2PDAA 3B82A 1DOAA 3R20A 3W3AD 5AH0A 4ZOAA 1C7QA 4ARCA 3ZHSA 1R4NB 3RFCA 1X0VA 1TC2A 3NONA 1VXOA 2R9VA 3OT5A 3TQIA 5E6SA 2Z09A 1MXHA 1O96A 1T0UA 1JQBA 2VHZA 2XYVA 2VHWA 2K6GA 4DANA 4B3TB 5HZHA 2FVYA 1EFPB 3ZU3A 4A0HA 3HM9A 3LYLA 4FFNA 4Q24A 3L84A 2I2CA 4UFOA 1WMSA 2VNJA 3KALA 2AF4C 3C6ZA 2F1HA 1W30A 2HRRA 2OBMA 4FCVA 3UNXA 5ILOA 1HDIA 2BMFA 3DMRA 1RJ9A 4DV5B 4G89A 5I9IA 3E3OA 4ZXFA 4DEYA 2OCYC 1G9SA 1CUWA 1KI9A 1QFJA 2HY7A 3ZWAA 2H4WA 1J22A 4MIYA 3GHYA 1GVHA 5C5DA 3U4MA 4CR8A 1HA3A 2HUNA 2PT6A 2P9BA 4UVDA 4JT4A 4IX9A 1GGFA 1X80B 1XP5A 1U7OA 2J45A 3S68A 5LQNA 1RYFA 2C98A 2Q5HA 4CMKA 3P0EA 2XWPA 3SVZA 4IJ6A 3A9TA 4GMDA 1P4RA 2OQRA 4GZ3A 5AVJA 4KXWA 3KWLA 3V80A 1DFHA 2OESA 2Y1LA 1KU6A 2WHPA 4MWEA 4U0KA 3RRYA 3E23A 3T7AA 2DUWA 4URHA 4BNIA 2WE7A 2DKOA 4REQB 4DNPA 5ICGA 4IDPA 3ZVNA 1KFKB 3DXZA 5FIUA 2FWPA 4OLBA 1W2GA 4ZGGA 1KO5A 1IN4A 1DWUA 4A2PA 3HDYA 4ILEA 3ORRA 4G4GA 2RGNA 2ZSEA 1IM5A 5F52A 4DIDA 4EY7A 3TQTA 4TT3A 3R0ZA 2JIMA 4DTIA 4WA8A 4EFMA 2GZMA 2QU7A 3CKMA 1CVIA 3DLCA 3HKDB 1BMTA 3DBLA 1LSOA 5FBQB 2ZQZA 1UEIA 2X5OA 1K8XB 1MRSA 1OVGA 3FVVA 4O5AA 1SBCA 1W8DA 1LLDA 1L5VA 1Z4QA 2XODA 3LDFA 3N2GB 4NDNE 5FO0A 2BAGA 5CFOA 3THXB 5H1YA 3PJFA 1NUQA 2BZ1A 2W93A 1QFZA 2NSLA 1N2XA 3R40A 1D3AA 1SKBA 1SZCA 1S2GA 3AM5A 1PT9A 2ROQA 1Q0PA 5BVGB 1MOQA 2V4UA 4DXAA 4P0TA 3IP6A 2P2NA 1R0LA 5BUCA 5LSAA 3ZU4A 2FZ5A 4WKGA 2AQIA 1QOPB 4NZNA 5TS3A 4D4IA 3EW9A 3M82A 1EB9A 3VXKA 4KIJA 4A92A 3QOFA 4XCVA 3T1OA 2XUZA 3IUMA 3R7SA 1LQ2A 4XGRA 1T5LA 1C7IA 1H6DA 3GLUA 2ZAMA 3QOXA 4I08A 4MVXA 3O84A 5LXTF 1RBZA 3ZY6A 3DHYA 1M1YA 1QYRA 3MSXA 4MYSA 1G55A 1JLMA 4FFRA 4RGBA 4Q9JA 5IT9A 3DLTA 1UEXC 1FNCA 4MW9A 4EG4A 3FIUA 1AA9A 1Q1GA 4BO0A 1ZHFA 1VG8A 2MWMA 3C8MA 1NJ1A 4Q6WA 5CVCA 3UC9A 4HDKA 4TN1A 2ZJ3A 4YR7A 4Q9AA 1C7EA 3QUAA 4Y6QA 2A8YA 4QU8A 3E9CA 3EFHA 3EF0A 5ESXA 4ATNA 4AKEA 2E85A 3QE3A 2QRGA 1NV9A 1PFQA 2ZJ6A 2GCOB 2OORC 2ENWA 3A10A 3C6XA 1DEXA 4MQLA 1VIMA 4NEQA 4UNIA 4PYMA 3WSVA 3WYEA 4BVGA 1QE0A 1GO2A 4B6PA 4C4SA 3D1LA 4YQEA 1YS2X 4C05A 4PTLA 1I7DA 3CUVA 4M1QA 4RVDA 3HH8A 4QUKA 1DLJA 4Q39A 3IDSA 4AXXA 5A1JA 3P5SA 1P1HA 1DTWB 4HQNA 1EVQA 1RVV1 4ONEA 3GG9A 3MBOA 4MQ5A 3W77A 4CQLA 3B3FA 2QG4A 4CF3A 1DZ3A 2ANCA 4DIEA 4RY8A 4KXFB 3TDMA 4A5OA 1D2GA 1PW5A 4JH0A 3FMOB 3KYCB 1OI7A 3PL1A 3EXEB 4PSKA 1IB6A 2ORIA 5D1NA 2WHQA 2EFEB 4U7TB 4DKXA 5FF9A 5JCZA 4GE3A 1RHRA 3DWEX 2E0IA 1FFAA 2J3HA 1HFWA 4D1YA 3BD6A 2AKEA 5LA6B 2HBRA 3OTQA 1NI3A 4S1PA 1OD6A 2ATIA 2UZ3A 2ZROA 3U0BA 4J7CA 3E1KA 2D2EA 2N46A 4NH4A 4MUNA 3IT0A 4IG9A 5A06A 3D8TA 5CJPA 3CE9A 2V74B 2VUUA 3TDKA 3WGLA 2YRFA 4PTZA 4V0RA 1GSIA 3C4JA 3HGTA 1XSEA 3JWGA 2DPHA 1MFPA 2C8LA 1BMDA 3U19A 4NXNB 4RTLA 3MUOA 2LTAA 2CMKA 2ZI4A 3SD7A 3HCPA 1JEYB 3SLRA 5AK5A 2JH3A 2ZJ7A 3QKRB 3TBFA 2YHIB 3GFPA 2CL0X 4L95C 3L6CA 4A03A 3URKA 2GR9A 1XDDA 3WHLA 5CFPA 3GBPA 3HV0A 5I51A 3VPSA 3F5FA 1WS6A 1PK9A 1GU1A 1LQUA 2C3MA 2H1WA 2WUDA 5GONA 4KEAA 3KK0A 5CYFA 3V6LA 4F3CA 5FEMA 3QE0A 2C2ZA 3FSJX 2QK4A 3MT9A 4F7DA 2ODTX 3AGQA 5D6OA 2VDNB 3ZDZB 2KS6A 4L51A 3BKWA 1D2NA 1OYWA 3Q8WA 4C2UA 5KWIA 1DBIA 3R77A 4K6CA 3QX8A 1M1YE 5DM0A 5IU6A 1VP9A 3D6JA 3L04A 4F4UA 3V6MA 2ZJ2A 4HRVA 3B6ZA 2WJHA 1FVFA 1M0SA 2QNIA 1JMYA 4CI0B 3ZS9A 2EZ8A 2XTAA 2I6UA 5SZIA 1LFDB 5IWAB 4IQFA 3FZYA 4H7HA 3AB7A 3NDJA 3RKUA 2EFJA 1DXHA 4OG2A 1ZW1A 1ECJA 4PR3A 4BWVA 3F2VA 3TCXB 4BIIA 1G9TA 1BGWA 2IVFA 2BI4A 2O8NA 5CK4A 1WZNA 3A1FA 3EF3A 3HZZA 1OZAA 4XIYA 4XX0B 4LOAA 2V65A 1Z88A 2O9JA 2XB2A 2JFXA 3K2EA 3OJ0A 3KPUA 1X70A 3ZLTA 4ZGWA 5AW1A 1UBLS 1GAEO 1M1XB 4H6WA 3TYXA 1ADGA 2B82A 4MXDA 2WM3A 2X6RA 3TPCA 2X77A 5JXJA 1KYVA 2Z83A 3Q40A 3OHMA 1KS2A 2LDXA 4PIMA 4R40A 3F3KA 1K66A 4BP1A 1LJ8A 3UA3A 5DN9A 3DJFA 3EQZA 1N7IA 3G8CA 4RTQA 1BHQ1 3VPGA 2VWPA 1LBHA 4H77A 4XYEA 4EKEA 1UC5B 2CFCA 1MVOA 1K8YB 4Q9HA 1I6KA 1SG9A 2ZB3A 3U4QB 1H0SA 2Y05A 4L9AA 4OBEA 1E1YA 3HKBA 2ONZA 5HFNA 1DAFA 5A4IS 2O2SA 5DK6A 2BIFA 2C57A 2V03A 5ALYA 5K6AA 1XP8A 1OX6A 2GLUA 2V7BA 4EMSA 2HZ7A 5KSYA 3RSZA 1IM8A 4K88A 3FWHA 2PRZA 4J6FA 4O0LA 2ZWOA 4M9UA 3VISA 2E18A 3R5XA 1GTSA 1GWNA 3DOOA 3ZWYA 3T0GA 3UPTA 3PNMA 1ZI8A 1G7TA 3GVPA 4TMYA 5LQKA 1ZQ1A 4B85A 2FW1A 2XMZA 5K3EA 6Q21A 4E2YA 1BVRA 1NVBA 2ORED 3KKPA 5B1HA 1FYVA 3WB2A 4ZJPA 1NNEA 4WNAB 3G2JA 2X0IA 5DLYA 2XNDA 1CZRA 2HSWA 1J5PA 3IVAA 4HFNA 2HU7A 3LWDA 3OBBA 2IIVA 2OBLA 4BBJA 4DDUA 1U0EA 4QNRA 2G5GX 3FUUA 5CCEA 3FYUC 2W5UA 4R2WA 2R5WA 1WL8A 1CQZA 4BQRA 2QY9A 4MMYB 1Z36A 1JKJA 1ZBQA 1YRBA 2PT9A 4D0NA 3FF4A 3NWBA 4O8CA 3RHSA 2BFBB 4RGYA 3TW0A 3UKOA 3UV6A 2FFRA 3I01A 1PP4A 1FP6A 4QVKA 2ZUUA 3FSGA 4IIYA 3FTFA 1WVIA 2HJWA 4NZMA 2HLPA 2W6PA 2HWWA 2FPRA 4YREA 4KWCA 1NVWQ 3NU1A 1ZJYA 4GI3A 4XQGA 3ABIA 3D8BA 1DRKA 1N4DA 2R79A 2ZT8A 2ZRNA 1RIIA 3JTMA 2F00A 2ZWIA 3NCTA 4XYMA 5EJAA 2V1UA 5L4NA 3G68A 2GWRA 4LRTB 5FRDA 5WRFA 2A5LA 4XWWA 1UZNA 1RRPA 5JALA 2VF8A 4EDFA 4PZCA 1M76A 1FFEA 3OQBA 3LV8A 4TKLA 1P33A 3Q9UA 4DWVA 1U5CA 1TTPB 4J7XA 3HDHA 2RBEA 4HAIA 4ARIA 1H2ZA 3QWAA 3ODPA 4EY5A 4TSRA 3UICA 3GEBA 3RJMA 1EP2B 1OAAA 2ZI7A 3LLMA 1P5JA 1WF3A 1G1AA 3LYUA 4FGLA 2IC5A 4J9UE 3S28A 3WDLA 3QXGA 2EIHA 1G98A 1XWWA 3DKRA 4JWKA 3X1ZA 3ZK7A 4KDRA 4B76A 1YB4A 3IESA 2MYTA 2CK3D 4DDWA 1DTEA 3A4VA 4A91A 4EHHA 1JL3A 1P18A 2GCGA 4EL5A 3I04M 5IJ0A 1R00A 4WW0A 3GGOA 1NBIA 1EWYA 3H9QA 1UKBA 2BN4A 1IM2A 1XFAA 3VTZA 3DFKA 5K7SA 2PH7A 2I4LA 1E79A 3U3RA 4QTYA 4YMWA 3ZGVA 4QLOA 2FU5C 4QUEA 2J4DA 4EGCB 3TW8B 4DQDA 1CY4A 2UYCA 3LPDA 4UFNA 1EUCA 4RLFA 3I9OA 1UF9A 4KSYA 1UDCA 3GLFB 2ACVA 1YS9A 3S2UA 5B4VA 2HV9A 4MAFA 1NVKA 4J2TA 3USCS 1HE2A 1YUNA 1LK7A 3FKQA 3LCJA 3MWJA 4DYVA 1VIYA 1IOLA 4Z0PA 3WV4A 4WI1A 4GI5A 1DG3A 5BWLA 2HRBA 3JSXA 1E3QA 3R9XA 4M22A 5IBQA 1RQ7A 1YGYA 5JNLA 1OU0A 4ETWA 1KMNA 2QPTA 1UKCA 1RI1A 4UHBA 5EWJA 4CKCA 4OVKA 5LU9A 2WJ4A 1UM9A 1GY8A 1TQ2A 5DB4A 3EOBI 4DY4A 3I0NA 4WUVA 4H6PA 3T4EA 3PE3A 4RORA 4G85A 4BFWA 1QGZA 1V6CA 1Z7YA 3KAJA 4P7BA 4P80A 1XD2A 4QUDA 3IVXA 2R47A 3PGJA 4REOA 4PZPA 2O3RA 3EFEA 4RK1A 4LE0A 1JPVA 1UWLA 4FHCA 5A7GA 2EJUA 2GJ8A 3FPBA 5B55A 1QIKA 2A1TS 2QHXA 4QDKA 5DHFA 1HG0A 1ESEA 3N0XA 2BGUA 2FPLA 1VRWA 2C5EA 2VSNA 4JI6B 3W9SA 4BNHA 1ZJ5A 2A5JA 2BMJA 2IYTA 5E6RA 2FW8A 4I14A 1JPNA 2OEPA 1YMQA 3JWEA 3KYJB 4CV1A 1TYAE 2VP2A 4PLPA 3DTYA 3AU9A 3H5IA 1CY7A 4EMUA 3AEZA 2R3SA 4L3WA 1JSRA 9GPBA 1BDIA 1RJFA 2E1RA 2TMGA 5ER9A 3LX4A 1RQ2A 1DO2A 2R84A 1N9ZA 1WY7A 3GLKA 2QSJA 4NOLA 1N2GA 1Z7EA 3GLHA 3D3NA 3KLBA 2Z5LA 3PUHA 1Z4JA 3UYLA 2ZB4A 2QTBA 2G8NA 1JJVA 1OI3A 1L7XA 3ANMA 3QVWA 5K0NA 1U7HA 3CGWA 3DL4A 3WJ7A 4EECA 4FZRA 3NZEA 1QHEA 2VC2B 2GWHA 1CS4C 3ZJ5A 4E07A 2ODWA 2ZVPX 4NL4H 1IN1A 3DBVO 4B2IA 2QL9A 1QU3A 3EIFA 5DP2A 4DV7B 1II0A 1PFYA 3OETA 9ABPA 5HIKA 2L82A 4DLAA 2PRKA 4Z4QA 1KEKA 4V3BA 4D92A 4RGQA 2XNCA 1VJRA 1M5UA 1NJ8A 3TR0A 2PLRA 4HUQA 5CFQA 4EH1A 4FWTA 2BGTA 3KLPX 2V6IA 4N3GA 3DTVA 4A36A 2MDTA 3L8CA 2CVHA 3BRSA 3KZMA 1OTYA 4M0CA 5ALOA 1B1CA 1WXXA 3G8YA 5PGMA 5JADA 1MT3A 1CHDA 1EZZA 4M1YA 3QU2A 5EE1A 1DKMA 3WE7A 1UDWA 3A2NA 4ER6A 4Y6OA 2I2XB 2HEGA 2HD4A 2LPMA 1YZKA 5AUQA 3KUUA 3IKJA 1J33A 4BFSA 4BUJA 1CR4A 1XT6A 3B13B 3KT3A 4Q3LA 1AY0A 4F04A 4ZVUA 3FCUB 3DHWC 3V97A 3U3XA 3N8IA 3LLCA 4B0PA 3G49A 1G8HA 4O2AA 5JVDB 3ZDBA 5E0OA 2YJTD 1HLGA 2ZB2A 3MGKA 3IJPA 4MEAA 3RJ5A 1CY2A 1N5IA 2XDWA 4A6PA 4G0NA 4FSXA 5CFRA 4HQKA 3ZHVA 1B00A 1M0TA 1RBMA 3A7DA 1JSCA 2K87A 1JBEA 4IZOA 4U3JB 1R6DA 2XV1A 3CMMA 1ZMRA 3P45A 4WCFA 2F2TA 2O4UX 1QGDA 3G9TA 2B1RA 4QM7A 4P58A 1JIUA 3DFFA 4ZXPA 1DJMA 1EQ2A 2CFIA 3O83A 2GFQA 2IL1A 3O3NB 1YJQA 3RUAA 1VKOA 1ZJWA 2O8FB 1PO7A 2UYYA 4OY3A 1N2SA 3G79A 3IUBA 5AMXA 4ZYXA 2OA0A 4DRXB 1HE4A 3EIXA 4OQPA 3ZKWA 2JAPA 2AJDA 10MHA 1TZMA 2RIPA 4UAUA 3AFIA 2Y0DA 4DY6A 3EIOA 4MVYA 4D3YA 3ENQA 1EMDA 1Z6GA 5LZ7A 7GPBA 1EGVB 2YCLA 4XFKA 1I0IA 3FPJA 3AERA 3D4LA 4MR9B 3JR7A 3GD7A 2LIPA 1DBPA 3LIIA 3DZDA 3KQUA 2E48A 2RGGA 3HP7A 5HK8A 3SIRA 1LLQA 4N5HX 1SHJA 1US8B 1XZPA 2QNRA 3C3WA 2QD4A 3SQDA 4E32A 4MVJH 3PPVA 4JQYA 1LRKA 3ILSA 1FQKA 2CE7A 4NBRA 4RKWA 3IEXA 4PXYA 4ZT3A 3UYKA 1EVEA 1Y3HA 3C3YA 4MHTA 1OJLA 4IMPA 2DBZA 4F6CA 1G5TA 3SG0A 2ZATA 3O8CA 3BCHA 3T61A 4Q1FA 3ZTYA 2ZIVB 1J7JA 1T9GS 1XQ6A 1YQWA 2GYWA 4BMNA 3QW4B 5IARA 2CNWA 5KNBH 1JHMA 3T7DA 3FZQA 2B7BA 4XCXA 2XVZA 4N6NA 3CY6A 4KR9A 5K6TA 5ISMA 5M3BA 3ZIUA 3BL8A 2QVLA 2PSHA 3VPXA 1VKJA 4B35A 4M9XA 2JBAB 4AAYA 4UATA 3U7HB 1GTVA 4UOZA 1ZHOA 3EDOA 5ALGA 4XX1A 2QZJA 3KR9A 4XGKA 3KQSA 1FX0B 4IH4A 1T9HA 3SZGA 2YUIA 1LDEA 1V3TA 3L43A 1FJGB 4X66B 1J0XO 3LHFA 4F5YA 2WLTA 3OZEA 4J94A 2UYQA 1QHXA 4O4LF 3ZOZA 2JRLA 2Q3JA 1JIXA 2EDCA 5FJIA 2OBYA 3QTBA 2XYGA 4LZZA 4QVIA 4MW2A 3OTOB 3WKEA 2H1CA 4M6WB 2QUIA 2RGUA 5HIIA 1YJCA 1HUQA 3VU9A 1F7UA 3PSHA 4LYFA 3DZBA 3P94A 2Y1FA 4I2NA 3CSDA 1YFZA 2O3QA 3LPAA 4I8IA 1LUAA 3TKAA 3GJ6A 4J8PA 2GS9A 1OR8A 4MRMB 4EY6A 4ZAVA 5IWCA 1SCUB 2H2AA 2VFAA 3BERA 1CDOA 3Q9LA 4G0YA 4US1R 3WDMA 5HUJA 3L40A 2Q62A 3TVTA 4PQEA 3RCBA 2NVOA 4RTOA 2CXUA 1OSNA 1L8AA 5DWVA 5ADWA 1RRCA 1CY8A 2NNLD 3I9MA 1SO8A 1J20A 1GZ7A 3OOYA 3SBXA 3BXGA 5TPZD 1WABA 1BS2A 1VJ5A 2DU8A 1ST3A 2H9YA 4ZFNA 3KCNA 1PGOA 1KMIY 4KN8A 1QIDA 2RBGA 4DV1B 4NICA 1G5QA 2IHVA 3CG4A 4YC7A 4YBZA 3HVUA 3MMNA 5JJBA 2R6FA 2FFJA 3I37X 4IVRA 1XTKA 2P8SA 1EVKA 3T9DA 2YVLA 3CE6A 3HSKA 4UE2A 4EGSA 4PLYA 3KELA 2O2XA 4GRDA 3NASA 4HLDA 4OU5A 1CZUA 1AXGA 2KYRA 1XNJA 5EXEA 3ZJUA 1OXMA 4V1CI 3RVMA 3EVZA 3MMZA 4GSYA 1G21B 5FI1B 1G6HA 3D31A 2PGXA 1I9CA 3OE7D 1GR0A 4GG1A 2DPYA 4GBGA 4D45A 3T7IA 1D07A 2L19A 3MJSA 3CT4A 1S1MA 1VHWA 4GPTA 2HQ1A 2QX9A 1YKGA 5ICFA 4ZAYA 4M88A 4EA6A 5FPYA 1MB4A 3QE9Y 3VR4H 2PKYX 2G0TA 2IXAA 4G5GA 4XCQA 1K5DA 3KAPA 1ID1A 1CC1S 1DX4A 2HLDD 2VUIB 2WP8J 4TYPA 2PKXA 1VIDA 4CKWA 2D4AA 2UZIR 3KSUA 4R16A 5KOIA 1N77A 4LNUB 3UAGA 3K92A 3GEIA 3CO0S 4JXJA 1DV1A 1DRWA 2V1XA 1L6IA 2XKJE 2JK1A 2Y71A 1ECBA 1LBSA 4RCZA 1OAOA 1OE0A 2PK3A 3KBOA 3GEMA 4US2R 2VHVA 1TJ4A 1E92A 5EWLB 5CXUA 1QTRA 4G25A 2R60A 1Z16A 3LZDA 1QLWA 1SOUA 4ZALA 4ZTUB 4G23A 2H29A 3VYWA 2C9OA 2PV7A 4PZYA 9LDTA 3FFAA 4XOIA 2VNSA 4I6EA 5M2QA 1UBKS 2N42A 3DMFA 5GV7A 3W78A 4O29A 3STWA 3NWJA 1Z5ZA 2HF7A 4WT7A 3CUYA 2BI7A 1QAQA 2HSJA 2I1WA 1N5MA 1J2JA 3TFOA 4PPGA 3LFHA 2ZR0A 1XCBA 3DDNA 4P7GA 1EHIA 4D0SA 4DCUA 5BRJA 4J2HA