2ZI7A

C4s dck variant of dck in complex with d-dg+udp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
240
structure length
218
Chain Sequence
IKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSTGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elucidation of different binding modes of purine nucleosides to human deoxycytidine kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Deoxycytidine kinase
total genus 85
structure length 218
sequence length 240
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zi7A00
2Z4SA 1SHKA 2ZQ5A 3PUVA 1WDTA 1A4RA 3WP1B 1GNRA 2AKYA 3B2EA 1US8A 4HI0E 5CJPA 1E2IA 2O8FA 2C77A 5CM8B 4W9MC 4EPWA 2V6IA 4FXPA 3SE0A 5EE3A 4FMDF 3ZH9B 1H8HA 3EASA 5AJVB 3FHOA 1XBTA 3A1SA 3RRMA 5TV2A 1G9XA 2ANBA 3KUCA 3UWKA 4DSNA 1N6RA 4XOIA 1VG1A 4O2LA 5F98A 2GJKA 2ZRHA 1XU4A 1M34E 2ZE7A 1E9AA 5JRJA 4RFVA 1EXMA 4L16A 3TAHA 5IT5A 2EFEB 4AG5A 3UXMA 1K5GA 2FH5B 4GRAA 2R44A 2NGRA 1ZIOA 2ZJ2A 1KI8A 2GETA 1ESMA 3QKRA 1EK0A 3T35A 5AJZA 3AKEA 4BFTA 2MSDB 4BFVA 1FL9A 2GESA 3CB4A 2IUTA 4A1FA 1ZM7A 4HSEA 3OEHD 5SZIA 3MGCA 2WMOB 3QPWA 2HF8A 2QL6A 2ZRLA 4JL8A 2CE7A 2YWHA 1CR1A 4P3YA 3U7EB 4DSUA 1YR7A 1N6PA 1PZNA 2PX3A 3FYHA 4TT3A 1NVUQ 1E2NA 1W5TA 4A8JA 3WMFA 5HZHA 5FPTA 2B7BA 5L3RA 3DHWC 1I4DD 3PUXA 1JNYA 4JSYA 1HT1E 3E1SA 3TUJC 3KTAA 4LCBA 4KITB 2PEYA 1G3UA 2VP6A 4HAWA 4DZZA 4TYYA 1G5TA 4CGZA 2LKDA 4DCVA 3R9XA 3IUYA 2BHRA 4V0LA 4A82A 1ANKA 1KSJA 1N0VC 1ZINA 1IXRC 5KDLA 4PHTA 5BYJA 1YZKA 1Z28A 1MABB 1ONBA 1CIPA 2A5GA 1NF3A 2CE2X 3WXMA 1OFTA 3O8RA 3QBTA 4IDOA 2P65A 2FPLA 1R10A 2P6NA 3HU3A 4FMCB 2ODEA 1VCIA 1RJ9B 1WF3A 1XMVA 2QPAA 2RHDA 3PV0A 4BFWA 4CT5A 2CL0X 1DAHA 5FOTA 3LRPA 3CR8A 2HDNB 5FFMA 4FIDA 4Q4AA 2J45A 1F60A 2CEAA 1QDEA 3IBGA 2GTPA 3QEOA 3MMPA 2KI5A 1XJ0A 2VL7A 4LBVA 3RS3A 1NN1A 2OAQ1 2FE4A 4NMMA 4Z8XA 3CH5A 3PUWA 1KI6A 4WA7A 5FOSA 4G5GA 3CWQA 4IXNA 4KBFA 1KI9A 4Q9JA 5AJYA 1XXHB 1GKIA 3L82B 1RIFA 1OV4A 1OXXK 1XMSA 3C15C 3GD7A 1Z63A 4LJ6A 1V5WA 2BDTA 4JT4A 2QP9X 1AN0A 1NLZA 2D06A 4QJ5A 5E3HA 1YR8A 2WPDD 2Z0MA 1G41A 1PLKA 4M9XA 4BLRA 4DEYA 1A5TA 4K81B 2F43A 1HE8B 2XOKD 4LHZA 1C4OA 2QSYA 3BH0A 3NTUA 3OAAA 1J70A 1U90A 1Z0IA 2CJWA 4QGFA 3RRZA 2J0UB 1OB2A 2IL1A 3AGPA 1HH4A 3Q9LA 3AGQA 1OH7A 5CK5A 4RZ2A 4HUQA 5AJXA 4XTRA 3T61A 1UM8A 3GJ7A 3VX4A 4JS0A 1ZP6A 5LDDC 4MRVA 3EPKA 1NG9A 4G5QA 4P32A 5G40A 1U8AA 2BCJQ 1EFTA 2D62A 2PZGA 3B9QA 3AVOA 4Q7KA 3LWNA 1UADA 1T8UA 1D9XA 2CHVA 2IA5A 1FPMA 2ZTSA 2G3YA 1J8MF 2DWPA 3NHBA 4JT2A 4BPBA 2OCYC 5G3YA 3WNDA 2BBOA 5C4MA 3CX8A 3B7GA 2ZITA 4M1WA 1FFHA 3C4JA 1KSFX 1ZC4A 3KJIA 1KKLA 2NIPA 2NO0A 3TR0A 5EXPA 3K9GA 5GJBA 2WTUA 2CLCX 2AL7A 4TMWA 4KAXA 4M9SA 4B2PA 2ODBA 4C3ZA 521PA 1EFHA 2Q6TA 4P33A 2L0XA 2W00A 2XZOA 4BFZA 5GADl 3KB2A 3NIBA 1NSFA 5CYPA 4ZIRB 3GLIA 3EZ9A 3OHMA 5FTLA 4FI3C 4EAQA 1O87A 2C8VA 2ODNA 1S3GA 4JVMA 2WM9B 3EA5A 3IHWA 3VU9B 2YKGA 4O25A 1F2UA 2OM2A 5FPYA 4HAZA 4RKFA 4YONB 2F1HA 2ZAOA 5F3WB 2J0QA 1G18A 2FFAA 3U3JA 3P4YA 1Z83A 2VP9A 2GXSA 5KPJA 2ZU0C 1U9IC 1MO3A 1X1SA 2QP3A 4RKEA 4YMVA 5FI0B 2JLXA 2WICA 2DFKB 2F9MA 4EUNA 4NE2A 3TGPA 3QKSB 1OH5A 2NO6A 2ZRKA 4WZBE 2MMCA 3RSOA 2UKDA 2EWWA 2FWRA 1BYIA 3R9WA 3Q5DA 2JJ2A 3MUFA 3LQQA 4JKYA 3GLFB 1CR2A 3ADCA 2QBYA 1QHSA 3U3RA 5L3SA 5FUVA 2V6JA 5JS7A 2JIZA 3WRXC 3CONA 3KJGA 2IX3A 2IS6A 1F5NA 1AQUA 3RVBA 4DLRA 2XOKA 2D7CA 1DG1G 4B44A 2ZJZA 1IN4A 3W6OA 1XEXA 4KLZA 1P7CA 3G5UA 1US8B 3WHKA 4Q47A 1G19A 2YWFA 1W4BA 4NDZA 4B6FA 5E7MA 4HB3A 2H17A 4KXFB 2OILA 1WBBA 2Q0HA 5JJLA 1VYVA 1HEIA 3BB4A 1KO4A 4NBSA 2PT5A 2C5LA 1EFRA 3T06B 3QF4B 4AIIA 3CF0A 4E07A 3PJRA 1O3YA 5AK0A 1R8SA 2N42A 3LY5A 1PJRA 3D31A 3K70C 5AUPB 1JEEA 1YE8A 4LJ9A 4PHGA 1IN7A 4AKGA 1SVWA 4AI6A 2BMEA 2O0KA 2I1QA 4E09A 4I81A 4LJ8A 4LV8B 1UJ2A 2IYLD 4Y0VA 3LW7A 5JS8A 3CM0A 3CIOA 4Q21A 4OK5A 4Q19A 4RVCA 3VQTA 4DLVA 1GILA 1KNQA 4CEIA 2WSSA 2MSEB 2J87A 1UBCA 4OQNA 4Z8YA 1ZD1A 4TQ9A 3QG1A 1RJ9A 3OE7D 1R5NA 5F9FA 2ZANA 3A1TA 2ZR9A 4LJAA 3DM5A 3LBHA 1WB9A 2XB2A 3M0EA 4IVRA 4I1OA 3T12A 4MQBA 4WXRA 2W2TA 3KQNA 4PAOA 1ODFA 3SHFA 1U2RA 4B6EA 2GAOA 1XEFA 4NCNA 2YC2C 3K0CC 2BOVA 3FKSD 1RC8A 1DAMA 3VAAA 3KQUA 3ZGXA 1FQKA 4WBSA 4KFUA 1W2GA 2FX3A 1MABA 4HYYA 4R98A 4XJXA 1A2KC 1SZPA 3OEED 3GJ5A 4NTZA 4ZO4A 2WWIA 1OW3B 1KIMA 3CRW1 3EZ2A 2Q9AA 1E6CA 3B8HA 3H86A 3TK1A 2R9VA 1TUIA 2V7QD 3A4NA 3B1VA 1CP2A 1F2TA 2VP5A 3LX5A 3ONWA 1VMAA 2E87A 4Q4LA 4QNMA 3I8SA 1CRQA 1T8TA 2H1LA 3CUEF 2Z83A 1T6NA 2E1RA 1XEXB 3E5HA 4U02A 1E3MA 4N0EA 3EPJA 3SQWA 4OQLA 1G3IA 1L2TA 3IPYA 3E70C 4V02A 3SJBA 4EFLA 3GLGA 2C78A 2R6GA 5D3MA 1KYIA 1OFIA 3BJIC 4AYXA 3KKPA 3TRFA 5JJKA 3N70A 2ZIAA 2XXAB 4IDNA 2ZRNA 4QHYA 3CRMA 1E2LA 4JYCA 2IS2A 1ZNZA 4KVAA 3CWZA 2D7DA 4URVR 4DT1B 2IW3A 3C5CA 3U61B 5DLQC 2BKEA 4XWAA 2HUPA 2LWIA 4LDJA 4JLPA 4PC2A 1VG0B 2P6RA 3IIMA 4N3NA 3EXAA 5CDFE 4LPSA 1DBSA 2KJQA 3BS4A 4KODA 4ZCIA 2I4IA 1KSHA 3HU1A 5KHOC 1Q1EA 5JFGA 4TWZA 2VPPA 4ZCLA 1OXVA 2KBFA 2OHFA 3FMFA 1NVWQ 4A0FA 1OH8A 3N5CA 4PC3A 4V0ME 3C5HA 1JR6A 1NVXQ 3BBPA 4BLPA 1KSGA 4M0LA 1BKDR 2ZUBA 3LA6A 1JXOA 3K9LA 3VR3A 2J7KA 3K0EA 5A0FA 5H8WA 1FTSA 1KI1A 2ZPTX 3CKLA 4FCVA 5KPDA 3OE7A 1X86B 4CEHB 3WBJA 1JAHA 4C2TA 1VHLA 3FE2A 2JAQA 2ZJOA 3MSXA 1Q1QA 1UF9A 1SVLA 5GJWC 1ESNA 4G5RA 3AP3A 3BH6A 4Q18A 1OF1A 3CR7A 4KCGA 2CDNA 4W5WA 5DO9A 2YJTD 3RWOA 4LYFA 1T5IA 1P9NA 3PEUA 5EXSA 1DPFA 1DAKA 4KLNA 2WWGA 4I4LA 2ZJ8A 4B3CA 1MKYA 3KFXA 3OIVA 3P20A 5AR1A 1R0ZA 3T1OA 3OIWA 721PA 3RLFA 1UDWA 2REXB 2VHUA 4F4CA 2IWRA 2HYDA 2J1LA 1OFHA 1BMFD 2OSBA 1WXQA 1MR3F 3VMFA 1R5OA 2IYUA 1XTRA 1KHTA 3BB3A 2BWJA 2ZE5A 3TR5A 1W0JD 3U3OA 4A6PA 1EWQA 2ZUCA 1K5DA 2WJHA 3BRWD 3RC3A 4DLYA 2XNDA 1J90A 2ANCA 4RD2A 1ZYUA 4PSAA 2HV8A 3PG5A 4D0GA 1M6NA 3OZXA 1M74A 2O8FB 1LVGA 1II8B 2A30A 1ZM4A 5FTJA 4B2IA 4KO8A 5KU1A 4NPHA 1IXSB 1JB1A 5DI3A 5HKKD 2QMUA 1GFIA 4TLAA 2IUUA 2ZREA 2KWIA 4XIGS 1EESA 4QJ3A 4BFSA 3VNVA 3KUDA 4IVQA 1Z0AA 2IXFA 3K0CA 1VYUA 2FGKA 5EXTA 1KO7A 1R6BX 4ZI2A 4I1SA 3TLXA 2GNOA 2ZSAA 4S2EA 1FMJA 5GJVC 5KSPA 2C98A 1MH1A 1YRAA 3P32A 2R8RA 4A2PA 1S0UA 2PLRA 4AG6A 2NPFA 3GLHA 3I61A 1KDTA 2UZ3A 4LY6A 2FGJA 1F48A 4M9QA 1OXTA 1NBMA 1XJCA 2F43B 5JWHA 3M6AA 4OK3A 2H7VA 5HE9A 2GF9A 4X8MA 4TYPA 1XF9A 5JLJA 3VR2A 4EFMA 3QXHA 3EA0A 4H9GA 2AKAB 5KDOA 4IOJA 1KKMA 1GP2A 3J81k 4ZCMA 3B1XA 3EARA 4BFXA 1NL3A 3UIEA 3GPLA 4JBYA 3CPHA 4C4PA 2AN9A 1Z47A 2EW1A 4RD1A 1E2DA 5CK4A 3SJCA 4GP6A 1FTNA 1OLOA 4YMUA 3U60B 1WMSA 1E1QD 4DSTA 2XJ9A 5BQ5A 1P62B 2FEOA 1ZM2A 4M8NE 4V0OA 4LWZA 1SXJA 2R6FA 3OEHA 2F55A 3NEYA 1CRPA 1KO8A 3MRSA 2AFIE 4UQOA 2GVDC 4ZV4A 4U7DA 4D4MA 1BOFA 5K8IA 5TMPA 2HXYA 3Q5EA 1ZJ6A 3Q3JB 5KNCA 2C04A 1S9DA 1GWNA 3IHLA 5HE8A 3SBEA 1YZTA 2CVFA 2Z5FA 4TTRA 4ZDWA 3RRYA 3A1VA 1N5JA 2VSXA 3I1FA 1XD9A 4DWJA 5DSZA 1GM5A 1W4CA 3GEEA 2QY9A 1UFQA 1ETUA 1X8LA 3BOSA 4A0RA 1BS1A 5CM9C 3LAWA 4BZXA 5JWRA 2QT0A 2FPKA 3FOZA 4M1OA 4GP7A 2ZYUX 4Q1DA 1MO6A 4DHEA 1KI6B 5J40A 1G1MA 3LX8A 3L8YA 1Z8FA 3I32A 1XPRA 3NH6A 4B47A 1JPNA 2PZFA 3QENA 3DM9B 4R7ZA 3U7GA 2A5FA 4U5XA 3TNFA 3RRNA 4IOMA 2V8OA 2FU5C 2ZRGA 4M1TA 1C9KA 2IHYA 3BERA 3DKVA 1IJEA 4NYJR 3OIUA 4PFSA 1AJEA 3CNLA 3LQRA 3GQBA 3S1AB 2ZYWX 3K9HA 2ZSBA 2BC9A 1RRCA 4R71A 1B0UA 1S2MA 1HT2E 2FV8A 1NSTA 2G83A 3QI2A 4L9SA 3K09C 1QG2A 1TU3A 2V55B 1E79D 1LS1A 2IBMA 1NBMD 4KFSA 4EPYA 2ATVA 2ZI3A 4LJ7A 3MLEA 4GNKA 4UNPA 1XCPA 3OIYA 4TSFD 3RABA 3SU8A 3THXA 4Q00A 4TL7A 2BJWA 5TY0A 4MDEA 3C8UA 1CU1A 1H8EA 4BFYA 1K8RA 4L15A 4URWR 3IPXA 4B32A 1XTQA 4OK6A 1XPUA 1E2JA 2WZQA 3V4RA 4QBGB 4S35A 1DELA 1YZUA 4P4SB 4FMDB 2W6JD 2QM7A 1NN3A 4IDQA 2GAAA 4MGIR 2ERXA 1SKYB 4K46A 3TQCA 1KAOA 1JQLB 5JSZB 4GT1A 4GDFA 4EIWA 1KMQA 4ARZB 1ZD9A 1J7KA 1Z06A 2D2FA 3EW9A 2ZRJA 3OF5A 4PC6A 2BJVA 5C18A 3PEYA 3ZZTA 3QKTA 2FOLA 3KJEA 1IQPA 4II7A 3DPUA 4P4TA 4BLTA 1G7RA 2WPDA 5FI1B 4M22A 2A9KA 4IFBA 4DIEA 1VDZA 4F4IA 3B60A 1W0JA 3DMNA 3W6PA 4LJ4A 4ABYA 4Q1EA 4QHSA 1YZGA 1KY2A 1XD2A 4MUAA 4PPFA 2R62A 3BORA 4JVSB 1XMIA 4C0HA 5DNYB 3NC1C 1I2MA 1QRAA 1Z6TA 2QTHA 3AF0A 3CW2A 2IS4A 1FW6A 1G21E 1ZAKA 3JZMA 5SZJA 2WJGA 4D25A 1Z2AA 5EP3A 4PAMA 1EFRD 2FEMA 4Q1BA 1DARA 3RNLA 2B21A 3LW8A 1VG9B 4FMBB 4I99A 1IY1A 2AWNA 4JLNA 5GVSA 1HQCA 3B85A 1NLYA 1CR0A 3TUIC 1E9SA 3U44B 2VP4A 5C2JB 3ICQB 3NDPA 1W36C 3IKJA 4JLKA 3QVUA 1IN6A 1TNDA 1T91A 1UDXA 1R0XA 5L3QB 2IYZA 4V0KA 4YXWD 3ZVLA 1GNQA 4CVNA 3O8BA 5FUYA 1UBFA 3GLIB 3NWJA 4NCHA 4LYJA 3ADKA 4CEJA 1ZUIA 1OSNA 4URUR 4WZAE 2Q3HA 1AQYA 4UNRA 4NYIR 4AKIA 5EP4A 1G3QA 5DN6D 5KNDA 3QY0A 1IY2A 2OCBA 1YKSA 3ZS8A 3KQHA 2QP4A 4BZQA 4TLCA 1SHZA 121PA 1FP6A 2QM8A 3M4YA 3SJZA 3JVVA 3L0PA 3LV8A 4PANA 3LDAA 5KNBA 1RVDA 3CF6R 4MA4A 3B9PA 4DT1A 4A0GA 5DISB 2AK2A 1AM4D 3NH9A 3K9NA 2O8CB 2JDID 3GEHA 2QT1A 2GJ8A 1P4SA 4WIAA 1QHIA 4AYWA 1F6BA 2OE2A 3CO5A 3FGNA 3PCRB 4PQYA 5TARA 1DAFA 1XXHA 3ZS9A 4B3FX 1GNPA 1VHTA 4IRUB 3AKDA 2Q9CA 3HR7A 4YMSA 3DVLA 1OKKD 4MITA 1P72A 2HLDA 1D5CA 1W47A 3LD9A 2H18A 4M4SA 1G7CA 4EQ6B 2IYXA 3MFYA 2FA9A 2WOJA 4UNQA 3UG7A 3UKDA 1F2TB 3A36A 3JVUA 1IY0A 3I4LA 1E2KA 2JJ1D 1G20E 1NJGA 3RS0A 4HLUA 2BBSA 5SZKB 4B3BA 5FL3A 1G7TA 2J59A 1OFUX 3L0OA 1U8ZA 3HR8A 4UNNA 4QM7A 2XB4A 4ZDKA 5FBVB 1ZMXA 4L5BA 4PXAA 4L8GA 2V4ZA 1PVOA 3IEUA 2YOHA 4XWKA 2OCPA 4RD3A 1UBEA 3UWOA 3WMEA 2RGCA 3AB3A 3EG5A 2GKSA 1E2EA 1Y3AA 3RSLA 1ZCAA 2VHCA 4HZUB 4R2IA 5DHFA 3B1ZA 2FG5A 2ZSDA 1R8QA 4P31A 4B43A 2JLWA 3O47A 1TQDA 1XXHE 2FFBA 4A92A 2BEKA 2ZE8A 1L8QA 2QU8A 1Q20A 1OKKA 3CPJB 2C03A 5J47A 2NO9A 4WVFA 1YJ5A 3LBIA 4HB2A 5FH9A 1U94A 3MWYW 3QBVA 4CEIB 1R4AA 1T5LA 1N5IA 1R0YA 3GJ3A 4HDQB 4OI0A 4D0NA 4KSBA 5HCNA 1PLLA 2IS1A 2FSFA 5BYKA 1D9ZA 4GZMA 5LB2A 4YMTA 1Q0UA 4TMXA 4AY2A 1N0UA 5FOWA 2I1VB 2N1BA 5C4GB 4A2WA 2IYSA 1GAJA 1XEWY 1NG1A 1A82A 1II8A 2W2VA 3NBZC 3THWB 4DC9A 2WJYA 1W7AA 1VCNA 1DTSA 1P2VA 2WHXA 4GPTA 3L0IB 4HEJA 5J4VA 3HJNA 1E2FA 3LVQE 3A8TA 4Q9KA 3PFIA 2XTZA 4KYIB 4A9AA 4LBWA 4TYNA 3GLIE 3C14C 3KDSE 4IEIA 3ZDQA 1JALA 1SVIA 4LOAA 4URXR 4Q1CA 2P67A 4C9BA 5EP1A 4PSKA 2FSIA 1RRFA 2W6IA 4GMXA 4YLGA 1JPJA 3VNUA 3DEFA 5F9HA 3CZPA 3IQXA 5KO2A 4K8OA 2B7CA 3DDCA 3SFZA 3KFVA 2WIAA 1NRJB 1E99A 1NIPA 4G0NA 1PLJA 2G0NA 3GEIA 3GJXC 4JVNA 4OHWA 3CZQA 1JQJC 3UMFA 5IDVA 4CZ2A 3SDZA 5HPYB 1N5KA 3G82C 4QNRA 2ASEA 4B34A 2O8BB 2JLVA 2ECKA 1R5BA 1IXZA 3CRVA 2REBA 5EJEA 5DE3A 2D74A 4MH0R 4C0KA 1YZQA 3IIKA 2IC5A 2DB3A 3UATA 5LBIA 3EC2A 3LH5A 1W36D 2C9OA 5BW8A 1XFAA 1VG8A 3N2IA 3U2QA 1TTTA 3QXXA 5FUXA 1CS4C 3RS7A 5DHAA 2C96A 1CF4A 1OIVA 2H8KA 4MRRA 2AR7A 4EQ6A 3BAFA 1SKYE 5LD2B 3W34A 3ZD7A 3X1DA 2RGBA 2XITA 2IYTA 1ZU4A 3CRRA 2QMHA 4CEJB 1VCMA 5P21A 4C0AC 4X8OA 5FOVA 4YXWA 1TPZA 1EFCA 4RZ3A 4BWYA 2NO7A 4HLQB 1VECA 1T3HA 4TLBA 5B57C 1GL7A 3FFAA 2F1JA 2FZ4A 1FZQA 3TSWA 2F7SA 1W2HA 3QUSA 3GLGE 4AURA 4MYHA 4QXAA 4HDCA 4PQFA 4WAUA 1DVRA 5IRCD 1BIFA 3GLGB 4HAUA 2B6HA 4IVPA 2QNRA 421PA 3QE0A 2EFCB 3I8XA 2OAP1 4NH0A 2CLDX 2Q9BA 2KB0A 4D2IA 2IYRA 5IF9A 1H65A 1M7GA 4BLQA 1DEKA 2ZR0A 1T0HB 2AHOA 3UPUA 3WYFA 2BEJA 1JJVA 5CIWA 1TQ6A 2ORWA 4OBEA 2CK3D 4XD7D 2VHQA 3NHAA 2PMDA 4UJ5A 3EZ6A 3I73A 4EPVA 1NKSA 3AP2A 2PJRA 3AVXA 4XVUA 1RPZA 1CJTC 2D4HA 3B1WA 4E03A 4NZYA 4JSTA 2CLSA 2Z6VA 3QF7A 4ILEA 3SYNA 1JXMA 1AK2A 1Q1BA 1JEDA 4TT3D 3TVTA 3X1XA 1CR4A 1Z29A 2KE5A 5AUNB 5L8VA 2F1RA 1E2QA 3RWMB 4ZI3A 4BRUA 1UKYA 4J0QA 4TMKA 3VR6A 1KMHB 4OJQA 5GVRA 4C0BA 4ZKDA 2JLYA 1KJYA 1RW4A 4QBHA 3DOEA 6Q21A 4Q4HB 3F0TA 1T0JB 1X6VA 2VSOA 3FVQA 3A37A 4OQXA 3AF1A 4XVQA 2JEOA 2OLJA 4IOLA 4GI7A 2RGNC 4P4UA 1AIPA 5ANRB 1FNMA 2ZXUA 3AF4A 2VYFA 3K1JA 4LGMA 5KSYA 4BASA 4JLJA 3CH4B 3UG6A 3ZVMA 2W58A 4M1YA 2RH5A 1D6JA 2O8EB 2RKOA 3QF4A 1CXZA 4QRHA 3TQFA 2X77A 3GLFA 3THYB 3EPHA 1W49A 5JSZA 1ZUHA 4JYBA 3L2OB 5E95A 1Z6XA 3SZRA 1GTVA 1GL9B 4MDFA 4JJKA 1E9EA 2OXRA 5H68A 4F7WA 3KJHA 1Q12A 4PZZA 5K8UA 1CLUA 2FPMA 3ASYA 4E5UA 4NP6A 3QSYA 1HUQA 2QN6A 2DFTA 1G5RA 4Z54A 1G3MA 1ZRHA 1YVDA 2QI9C 2HT1A 4RD0A 3PEVA 1EX7A 4BE7B 2XZPA 2XTNA 4QGHA 2P5SA 1NBME 2AX4A 3AH8A 1XMJA 1TEVA 2GHIA 3KQLA 4FN5A 2KSQA 2GRJA 1EFUA 1G64A 1JI0A 1P3JA 4HATA 2RMKA 2ONJA 5KYKA 3U44A 4RCYA 3SEAA 4JL6A 3SQXA 1CJMA 3DMDA 2O8DB 1GITA 4DXAA 3KZ1E 2ZRBA 3I72A 4AKEA 4EJSB 1S9HA 1X1RA 2JJ1A 1M7BA 2VIIA 1NI3A 1W46A 3U4QA 1G8FA 1II0A 1R7RA 3VHXA 3R20A 4B3XA 2JIZD 3P1JA 3A4LA 3D6TB 2VEDA 4JZKA 4DCTA 3K0AB 3W9YA 3HYTA 8OHMA 1UKVY 1YZNA 4C30A 2J9RA 2QPTA 2F9LA 2CNWD 3RS2A 3IIJA 2XJ4A 4R9UC 4F4JA 3EZ7A 2A7QA 1W48A 3ZVRA 4FD2A 4KVGA 4NKRA 3FKSA 4OHVA 1Z6AA 1N5LA 3X1ZA 1AKEA 3P27A 2UZIR 2QUZA 4GOJA 4LHXA 4URYR 3DKPA 1OPXA 1CEEA 1AZTA 1DG3A 2DWOA 1S1CA 1V43A 2X19A 1E1RA 4AKHA 3QNUA 4RFSA 1RRPA 3U7FB 5FR2A 4FCTA 2XEXA 1E96A 1QHYA 2CCGA 2ZJBA 5KUTA 4D0LB 1ZW6A 2Z4RA 4OL0A 4HZIA 1RYFA 2NPIA 4DSOA 2EWVA 1KTVA 2WWYA 3LLUA 5JI3E 3R7WA 5AUQA 3WYGA 4D26A 4H1UA 3BIFA 2J3EA 1TF5A 2O0JA 4ZPXA 1R2QA 3BFKA 3L0SA 3IILA 3VR4A 1RRGA 5TDHA 3CBQA 1HQYE 4CT4B 1WE2A 1MT0A 2GCPA 3WBKA 4TSFA 4C7OA 3A58B 1TAGA 3DO6A 3FDIA 2G1JA 1NY6A 4JL5A 4W7SA 2JCSA 4Q4AB 1ZBDA 1DOAA 2GJ9A 3IGFA 3NXSA 1EGAA 2C99A 1ZNWA 2CXXA 2VBCA 4UJ3A 1N25A 4C0JA 3U3MA 1C1YA 4DDVA 2E9SA 4DUGA 4LV5B 2NZ8A 4BFUA 1KJZA 3CX7A 5JHGB 4PZYA 1Q57A 1GRQA 2G9NA 4HLCA 3A1UA 3BGWA 1QHHA 2GCOB 4Q03A 1S8FA 4RJLA 1NP6A 1N6OA 1FX0B 4PAQA 1GG2A 1X8KA 1TADA 2P2LA 1LW7A 4BQSA 2NZJA 4RZUA 3MCAA 2EVWX 5DH9A 1S1MA 2V1XA 1U8YA 3PIRA 1Y63A 4NU0A 1KK0A 1RZ3A 5G41A 1S96A 2RHMA 2BIFA 3HYRA 4EFNA 4F38A 1YR9A 2OO7A 4DBLC 1E9DA 2W83A 1FNNA 4LX0A 1LY1A 1ZU5A 2AWOA 1OT3A 4UXIA 2JJ2D 2OBLA 1VCOA 1PUJA 3D3QA 3WP0A 3SYKA 1E1RD 1XCGB 1XX6A 2YWEA 3GLHE 1ZD8A 3T5DA 2ZETA 3FB4A 5EXXA 3Q8XB 5EQTA 3NEJA 1PUIA 2DHRA 3IO3A 2QAGA 3QPUA 2QE7D 3EC1A 2RCNA 2YYZA 2P5TB 3TH5A 2GXUA 2JDIA 5FPSA 4JJZA 1QHGA 3BXZA 5JJIA 2NQ2C 1DAEA 4JBWA 2HYIC 1KK2A 2RGEA 5JHHB 3NG1A 2QBYB 1IN5A 1KNXA 4QGGA 5E7IA 4OYHA 4BLSA 2RAPA 1JR3D 1YR6A 1Z2CA 1OIWA 5C1BA 1YHNA 4P0TA 3RDPA 3SI7A 4QOSA 4I1UA 3AV0B 1IJFA 2BMDA 3UANA 4ZIRA 3I3SR 1E9BA 2GWHA 2B8WA 5FPKA 2YNMA 4CEHA 2FDCA 1W5SA 5J4LA 4ASUA 1QG4A 2F3RA 3NVAA 3AVWA 3HPQA 2QTFA 1LTQA 4MYCA 4M1SA 1F2UB 1T3SA 3B78A 4C2UA 1AGPA 1XEWX 3C16C 3OFND 4Q1AA 5JMTA 4FWIB 2W0SA 2WAYA 2GK7A 2DYKA 2YV5A 2SHKA 1COWA 1CJUC 3QG5A 2ONKA 4ACAA 1I2DA 3SBDA 1I4TD 3ZYCA 1W0KD 4DIDA 1D2NA 1NMZA 2O5VA 3TW8B 1QHHB 5EUMA 1DAGA 4F92B 2WJIA 2ORIA 5DYIA 1CKEA 1GRNA 1SVSA 2ZEJA 1KZGB 1GDDA 2QRNA 5CYOA 5JECA 3AEZA 1LNZA 2ZJYA 2ZVPX 2WV9A 4LPKA 1KI3A 4ACBA 3R8FA 1VIYA 2OLKA 2GF0A 2ATXA 3F8TA 3FFBA 4XH9B 2OG2A 1UPTA 2YC4C 2XNDD 5AJWA 2J0UA 2DR3A 1KK1A 4IXMA 3GJ4A 1NVVR 3FMIA 5EE0A 3R8CA 4HUQB 3T34A 2HCJB 1JBKA 2QG6A 2JASA 3IO5A 4ZDJA 2WWFA 1XP8A 1G16A 2JLRA 1DO2A 1DAIA 1YZLA 4GOXA 1K6MA 4OI4A 1NVVQ 5F2EA 4B73A 4O3MA 1WA5A 2GA8A 3AVTA 4HAXA 2P0EA 3QXJA 1XTSA 3T1TA 1E0JA 1P61B 2J5XA 4Q48A 3U3KA 4W5HA 3I5XA 1J2JA 2ZI5A 1UEJA 2IF0A 1ZUNB 4DDTA 4B3DA 3U6BA 5EUQB 4WXPA 2VO1A 2C2HA 4IEEA 3DZ8A 3AKYA 5B58C 4EPRA 3K09A 5FTNA 2PMKA 3MWKA 4A6XA 3GFTA 1R0WA 3BD9A 4Q7JB 1NY5A 2GEVA 1S3SA 4N0DA 821PA 2F1IA 3GJ0A 4MKFA 3Q72A 1UAAA 4HAYA 4QBIA 1WBDA 2ZUDA 4CF7A 4PHFA 1AZSC 5LB4A 4TL6A 2V1UA 1XWIA 2K5UA 3AVUA 2R65A 2YINC 3F5FA 1OHHD 4OHYA 2CJWB 2OV2A 3GFOA 1FOEB 1E69A 4JLDA 1TQ2A 3ASZA 1P6XA 5FOUA 4O2RA 1OE0A 2UVQA 4IKEA 4M53A 1KDPA 1L4UA 1UKZA 3HPRA 4MYTA 3SJAA 4ZDIA 3LXXA 4M1MA 3I62A 4B74A 3WHLA 5JI2E 2QAGC 2BBWA 5DIFA 1Z6YA 5IK2D 3L43A 3KKQA 2WSMA 1LB1B 3ZIAD 1S4QA 4DB2A 2P3SA 1XTKA 2Z43A 2QAGB 5DYGA 1E0AA 2IYVA 1SXJD 3REGA 2YHSA 1E32A 3TKLA 2R2AA 3A6PC 2VQSA 2ZU6A 1MRNA 3QJYA 4HB0A 3NKVA 2DY1A 2QE7A 3ETLA 4AD8A 2VH5R 4D4LA 4D4JA 3LBNA 1N6IA 3Q7QA 5FBQB 1EG7A 5HCIA 5TB5A 3QEJA 2VTKA 5CLQA 4JKIA 4PO1A 3IDQA 3GP8A 1F3OA 2GK6A 4AYTA 3H1TA 1E94E 4PPQA 2A5YB 2WMNB 3H2YA 4DB4A 2RGGA 3PQCA 3B13B 3MWLA 4A8JB 2DFLA 1Z22A 4LYAA 1XD2B 4BLOA 1KI4A 5FL7A 1N3BA 4C7OB 4TTPA 4CRWB 3KKMA 5K8LA 3VKHA 3K0FB 2PCJA 3KTAB 2PCLA 3Q7PA 3KX2A 1D2MA 1WQ1R 3PVSA 4A8JC 4ESVA 4QC2A 4TQAA 5FUWA 3AUXA 5EE1A 4AWXA 5ELXA 3LLMA 4NYIQ 4QJ4A 3B1YA 1L7VC 2HT6A 3TSZA 4B76A 1G4UR 2FN4A 3QOFA 1KI7A 3W8RA 4XD7A 5A5GA 4NCIA 4KHZA 4JLOA 1OJLA 1CJKC 3D8BA 3QKSA 1Z5ZA 2X1VA 5L3QA 2ODWA 4OQMA 4B48A 3VKGA 4X8HA 3NC0C 1ZNXA 4Q7LA 2VP2A 2IXEA 3W3ZB 3FHTA 1IOZA 5D3QA 3QVVA 4KU4A 5B2ZA 5KSOA 1N6LA 3ECCA 3E2IA 1GUAA 5DI9A 3UMSA 1G17A 3OEEA 4XTCS 3QXSA 3F3YA 4G1UC 2O8BA 2WWXA 5IHPA 1KDOA 2ZRDA 1NN5A 2ZI7A 1XNJA 1E0KA 4GMDA 4M21A 4OHXA 5KTYA 4JIMA 2OEPA 2NTYC 5IK2A 1NJFA 221PA 2AK3A 3VR1A 2A78A 4P4SA 4KFTA 3GFPA 4M1KA 4B3GA 4HB4A 1G6OA 2HJGA 2LKCA 2ORVA 1LV7A 2OXCA 2ZRPA 4HDOB 4OI1A 3TW4A 2PLFA 4LI0A 1W1WA 3GLFE 1HY3A 1Z0KA 1OYWA 1WCV1 2HLDD 4RCZA 4HZUA 3DL0A 2H57A 3MD0A 4AK9A 4BECA 4GSYA 2JA1A 1FUKA 2N46A 2AD1A 4JVLA 2GEUA 3ICEA 2JATA 2J7PD 2A3RA 3K53A 3W8NA 5UKDA 3MJRA 1CJVC 1E2MA 5EZ6B 4DCSA 4JLMA 1KGDA 2D3WA 1ZC3A 4LJYA 2OFWA 1ZVQA 2GJAA 3W5IA 1Q1ZA 4CIDA 2DFNA 4ASUD 5BN5A 2F6RA 1XJQA 4TZ6A 2OCAA 4Q4HA 4DDUA 2ZSFA 1SGWA 3RC8A 1E4VA 2ZI6A 2P6UA 1MO5A 2EFDB 4YQFA 1NLFA 4GBMA 4G5SA 1KDRA 3SOPA 2ZYTX 2NMVA 1OB5A 2O52A 2HXSA 4EDHA 1GZSA 4US2R 4R2HA 5J4KA 3K70D 2XX3A 2EYUA 2X8AA 4HLUC 1ZNYA 4D4KA 3ZZUA 4X8LA 4NYJQ 2BMJA 5K8TA 2CBZA 2XSZD 3T15A 2FSGA 3T1VA 4WZ6A 4MUBA 3AF2A 4UKDA 4GZLA 4PTLA 3W90A 3KXKA 2AFHE 4MRPA 3MG9A 3GMTA 5FR1A 2ZI9A 4QM6A 2IYYA 4TL9A 1OH6A 2OT3B 1Z07A 3P4XA 4OKSA 2CCKA 4HAVA 3EIEA 1UBGA 2Q3MA 2ZS8A 2JLSA 1NMXA 3SFVA 1XTIA 3FKQA 2JGNA 5J4HA 4KI0A 2GVZC 2QMOA 2XZLA 1J8YF 3B82A 4QHTA 1KMHA 3KB1A 3G0HA 3SC3A 3UK6A 2O8CA 3A4MA 4KJZA 1A2BA 4JBXA 1XZQA 4DLXA 3I92A 1COWD 4LJ5A 2C95A 1DS6A 1NN0A 1SVOA 2ZRMA 4HLDA 3CRQA 5EZ5A 1ZM9A 4TTQA 4DLTA 5JBQA 4BUJA 2V7QA 1G6HA 2G77B 4B71A 3RANA 1E79A 2FFQA 1Q21A 1TL7C 2VRWA 3K0FA 4YMWA 5DGXA 1T3LA 1RFLA 2WBLC 2IYQA 4FW9A 1OYYA 2CNWA 1AS3A 5JRZA 1VIAA 1M7HA 2YZ2A 2HCBA 3AUYA 5AWFC 3PEWA 3FTQA 2YVUA 2Y8EA 4Q4JA 5EP2A 4PC1A 3WYAA 2J7PA 1E4YA 5J4YA 2WIBA 4G5OA 1BYUA 2QZ4A 1VPLA 1IONA 1BO6A 4Q4JB 5FTKA 2GCNA 1XRJA 3CNNA 3AKCA 4PZLA 4Q5IA 3C41J 3EZFA 4TMZA 4DLUA 2CHGA 5LD2C 4IDHA 4QGAA 4XSGA 3BFXA 1Z08A 1SVKA 1N0WA 2H92A 1KK3A 4Q9LA 3TBKA 3L8ZA 4MRNA 1AKYA 1E1QA 4MGYR 4Q66C 4DCNA 3ZIAA 2QA5A 2ZRIA 2A5DA 2QORA 3THWA 2V3CC 4TYWA 3HP1A 1VTKA 3TSOA 1LF0A 1M8PA 4IW3B 3SS8A 1E9CA 1OXUA 4ARZA 2CK3A 1UKEA 3LNCA 1B23P 1SKQA 3D7MA 3BC1A 1Q3HA 1KJWA 1G291 2WWWA 1SXJE 2ZROA 4PX9A 5L3VA 5H70A 3KKOA 4UXHA 5EE9A 2PX0A 2WOOA 4DRZA 1JR3A 2JLUA 5TVKA 4Q1FA 2GEDA 3QQ5A 2FSHA 1JECA 1Q44A 2BCGY 1VYTA 1SXJC 2PZEA 4BZPA 2QPOA 3ND9A 1H8ED 2IYWA 1IM2A 4JLBA 4PC7A 1KOFA 4D6PA 5FL7D 2ZS9A 5BN4A 2OESA 1U98A 2W6ID 1G8YA 4L4UA 1G5PA 4U00A 1E2HA 1P75A 4PQRA 5G3ZA 2NOAA 1XCMA 2VP0A 4JLAA 1G7SA 4WW0A 2GDJA 5E4FA 4JMPA 3WRYC 5CLLA 1WRBA 1XPOA 4XSHA 1IAQA 2CVHA 1J99A 2QROA 3U5ZB 4JLVA 2WVJA 4MGKR 4LC0A 3VX3A 4DLSA 2O8DA 1G8GA 4QKQA 1FMLA 1TUEA 1FUUA 1N6KA 3EWSA 1HYQA 2V9PA 2PBRA 4EJSC 2X2EA 3T1QA 2GZDA 2X2FA 2DBYA 2KBEA 3ADDA 3W6NA 5FOXA 2AXNA 3RYTC 4ZKEA 1LFDB 3FMPB 2JJ8A 3THOA 4EJSA 2HEIA 2IWHA 4RY2A 3JZAA 3OFNA 1CTQA 4BGDA 1X8JA 1G8HA 2RGAA 3DZDA 2ZM5A 3PR1A 5AUOB 2H5EA 4POAA 2FMXA 4I1VA 5KSZA 4QL3A 3BB1A 4NYMR 3CLVA 1U9IA 3UMRA 3LO5A 5HKKA 1T4GA 5EE5B 3WNCA 2OZEA 4OQFA 3KL4A 5M04A 3NDBB 2PT7A 3WNBA 1P9RA 3GCGA 2V54A 2ZRCA 4BEJA 2DWQA 3K70B 3GJ6A 3Q85A 1ZM3A 3I5YA 3MWJA 4N1AA 2IXGA 4KV9A 1M1YE 3FPAA 4IJMA 2O8EA 2WWHA 3ZQJA 1N6NA 4BRWA 2J46A 1XDBA 2HJVA 1RE0A 5JEDA 2XGJA 2OBMA 3THYA 4PSVA 2O0HA 1PV4A 1ZIPA 2VLIA 4IHQA 3EPLA 1Z3IX 2CL7X 2R6CA 4NCKA 5B64A 3FMOB 3ZD6A 4DDWA 1NKTA 2ZRAA 4LYHA 5GJCA 3GLHB 4OI2A 1WP9A 3ADBA 3S1AA 2G0TA 2IT1A 3RS5A 3KQKA 5JWOA 3OESA 1G3RA 1H8HD 3PITA 4UXJA 2EU8A 2ZVQX 4IFEA 2QGZA 3BE4A 3WY9A 3O8DA 2IEZA 4LHWA 2VF7A 1XZPA 1U81A 4FCWA 4DKXA 1Z0FA 4MRSA 2QQ0A 2BM0A 3NBYC 2ZR7A 3PUYA 3QXCA 3LFUA 4QBFA 1QZXA 2XNSA 4DLZA 1ELOA 2AD5A 2QSZA 4PO8A 2PJZA 2G1KA 2WSSD 2BV3A 4CDGA 1TEXA 4B75A 3RAPR 3AVYA 4IDPA 5B30A 2QGNA 4TL8A 1U0JA 4LSGA 5BN3A 4LUCA 3X2SA 5A4JA 2IHBA 5TXGA 2DCUA 1X3SA 3VHLB 3P26A 3PENA 4G01B 1CBUA 4MYUA 4MGZR 3A1WA 1U0LA 3O8CA 3ZZ0A 2ZI4A 4LZZA 2WKQA 3QKUA 1TU4A 1HURA 1W4RA 1W0KA 3H84A 4B33A 2R6AA 4MKGA 4LBZA 5FBRB 621PA 5DN6A 3T5GA 2FF7A 1A1VA 1XTJA 1YRBA 1G4AE 1VKJA 4US0R 5L3SB 3EIQA 4LHYA 4TMTA 1Q3TA 2RB4A 1SQ5A 4O0MA 4W5JA 3CNOA 2G6BA 2OBNA 2CHQA 5FPHA 1KAGA 1N2CE 3ZLJA 3TAUA 2MMGA 3AVPA 1HTWA 4RZXA 2IK8A 1D2EA 3W3AA 2PH1A 2H16A 4L9WA 4UNSA 1Z0DA 2FZLA 2OFOA 1W36B 3X1YA 1FP7A 4D81A 2XTMA 4Q02A 4LBYA 4DUGD 5HR5A 1II9A 3QIAA 5FTMA 4IOKA 1MRSA 1XD8A 3SHWA 3NBXX 5BXQC 3LXRA 4V0MA 1LF5A 2I3BA 2ZJ5A 4NCJA 1KI2A 3TIFA 1U99A 1DE0A 1P2TA 3KXIA 1CULC 1OHHA 2GBLA 3K8YA 2GXAA 5KDDA 4PHHA 2OUKA 2ZS7A 4QFMA 5CDFA 3VTKA 1GKYA 2QRZA 3VFDA 1GSIA 3AQ4A 2WKRA 1HE1C 1MO4A 2A5JA 3V9PA 2VA8A 4LV6A 3IQWA 4MKHA 4KYUA 4A15A 3K0AA 2NO1A 2FJUA 2QAJA 2C9YA 2XSZA 2G88A 3CX6A 4MKIA 2J0SA 4Q9IA 5CIQA 3K0SA 2EFHB 2VSFA 4TQUS 4US1R 5BWMA 1EWRA 2ZJAA 2J0VA 4ITRC 1E9RA 4OJKA 3SN6A 3HDTA 4EKDA 4LHVA 4E22A 3OAAD 3H4MA 2GBLC 3EIHA 3TVDA 3WMGA 1TF7A 3LVRE 4CW7A 3EX7C 1P9WA 2EQBA 2NG1A 2YOGA 4B35A 2BVNA 4Z1MD 2Q21A 1P2UA 4DLWA 4A0HA 4GOKA 1KY3A 3HU2A 3QPVA 3TE6A 2A2ZA 3U4QB 4TMVA 4TZ0A 4EPTA 2VHJA 3AP1A 4KSCA 3RS4A 3MJHA 4TN1A 1AA9A 2RGXA 4PPNA 2RGDA 4XVRA 3KKNA 1TF2A 1JJ7A 1QVRA 5SZHB 4Q01A 3THXB 2XAUA 4GFDA 1MOZA 5E7JA 2QTVB 1E0SA 2EYQA 4C0QC 4YC7A 1BH2A 1RYHA 3CF2A 1TMKA 3CPEA 4WOPA 2ERYA 2CCJA 1U0HC 4ESHA 2XXAA 2GXQA 1OIXA 3NBFA 1LS6A 1UEIA 2YWGA 3BK7A 3M1IA 3IBYA 1HV8A 4DEXA 3V4FA 4D80A 1GVNB 1GL6A 2WJVA 3VU9A 2BMFA 3ZVNA 2J41A 1QBKC 1TX4B 4V03A 3EAQA 3VR5A 5CITA 5JCPA 3BWDD 4D82A 1P5ZB 2GILA 3SNHA 5G53C 1P2SA 2ZRFA 4Q7MB 4F93B 1E98A 1QVAA 2WJJA 1JAIA 1SXJB 3PXGA 1TQ4A 4M9ZA 2VHTA 1L4YA 1ZCBA 3KXLA 5CB6A 3AM1A 1P60A 1W44A 4KFRA 4TLDA 3ZQ6A 2PL3A 1I4LD 1RKBA 1E9FA 3B6EA 2RGNA 4RD6A 3DOFA 2PEZA 1Z6GA 3MAAC 4ERNA 1GIAA 2OFXA 1KO5A 3R9IA 4DJTA 2DPXA 2LCFA 4XWOA 2EFGA 4LC1A 1GOTA 5JEEA 5HZKA 1OXSC 2TMKA 1SVMA 5FBLB 4Q9HA 3U6KA 2GZAA 2B92A 2C9CA 4KBGA 1A7JA 4M2LA 2BBTA 3GJ8A 1JR3E 4Y0AA 4Z1MA 4A4DA 3AF3A 5J5CA 1MV5A 3C7KA 5D3MB 3TMKA 4DCUA 4FWTA 4A36A 1N6HA 4YDHB 3BH7A 3W5JA 1DADA 3AVQA 1Q22A 2ZSEA 2FFHA 2IF2A 2YOFA 2W6JA 3B5JA 3EWAA 2BKUA 3PUZA 3U7HB 3V00A 1BMFA 4FMCF 3TJZA 1QHNA 4QG7A 5H1YA 2MSCB 3IEVA 1FX0A 3ND8A 2AXPA 3VKWA 2CL6X 1D8TA 3ZJYA 4C0LA 2ZYVX 2GCOA 1T9HA 5JCZA 2BM1A 4EPXA 1Z0JA 4H1VA 2JLZA 4DVGA 1NIJA 4AC9A 1GKUB 1IHUA 1AS0A 4F91B 4YDSA 2QENA 4PR0A 4OHZA 5KOYA 3QKRB 2W2XA 1HA3A 3N2EA 3FHCB 2IEYA 2QEQA 2VF8A 2QMEA 1GRRA 1E2PA 4URZR 4HUTA 5FBWB 1M2OB 2QQEA 1QHXA 4FINA 2ZE6A 3R7WB 3TUZC 1QF9A 1NMYA 4TLEA 5DI3B 2REOA 1NNEA 4NL4H 2JLQA 2W0MA 2GJSA 2D2EA 4B2LA 2F3TA 2WKPA 5CB8A 4TYQA 5JZVA 3RHFA 4PPGA 3X1WA 4NYMQ 4CYMA 1YQTA 2WAXA 1YU9A 1E2GA 1G8PA 5HTKA 4G3XA 3AVVA 3SR0A 2GZHA 4Z51A 1AGRA 2R6DA 1EX6A 4C0SA 3FWYA 5LPNA 4V0NA 3REFA 2HF9A 4LRWA 1XB2A 2FNAA 4RD4A 1KZ7B 4RFSB 4ON9A 2CMKA 4BEBA 4GL2A 3H0KA 2Q3FA 1DO0A 5C46F 1IN8A 1AS2A 4LK2A 2ZAMA 2B8TA 3BFVA 4A2QA 1W4AA 1KO1A 4NONA 4NHOA 4PO9A 3SYLA 1FQJA 5CJ2A 4RSGA 3HWSA 1IBRA 2IUSA 1P73A 1SULA
chains in the Genus database with same CATH superfamily
1T9GS 1KVSA 1N9ZA 2LTAA 2Y1FA 2ZQ5A 5ENVA 1PFKA 4DMUB 4DADA 3WKBA 1QUEA 3B2EA 1L7NA 1QDUA 1QRTA 5BYBA 3MT9A 3F47A 4W9MC 4MW7A 5ALXA 3TLJA 2WB2A 2D4AA 2ZJ3A 5SYMA 3SNKA 4HEHA 1Q14A 1H8HA 4DV7B 2XE4A 4N5HX 5L40A 2WD8A 5BV7A 2MJLA 3A1SA 2VK4A 1YB6A 3D2LA 3IH5A 3UPDA 3ZTTA 1JQKA 4G97A 5DX0A 1I0IA 3JW8A 1B00A 4Y1GA 5EIHA 5HF5A 1ESDA 1TJPB 1B8NA 1R5JA 4N6GA 3DWFA 2JLCA 1C7JA 3RQSA 3CXUA 4NPCA 5J1SB 3OZGA 1RAHA 4RFVA 3RYHA 2EGGA 5ICEA 3OU7A 1G0OA 4L16A 2Y1XA 5AHKA 1YZVA 2OHOA 3TAHA 4K2HA 3PEFA 3M5CA 1EGMB 2HAEA 3G8YA 1DJPA 1K5GA 4EFDA 2E5LB 2R44A 3IE0A 1AU9A 1CPYA 4U6NA 4F3CA 4WKCA 2AHRA 1GT91 4LG1A 4XFJA 2WAOA 4Z9XA 1YDHA 4OP1A 3HUUA 3AHDA 3T35A 2D0OB 2QB5A 3AKEA 3RAEC 2Z6AA 2QJOA 1FL9A 1RLJA 5DP1A 1YK1A 3V7WA 3DOHA 5E4TA 4A1FA 2H1OA 3A3KA 3BRSA 1WF6A 2WMOB 3D3WA 3FCAA 4WADA 2ZRLA 4JL8A 5TT0A 5IWCA 1YJCA 3U7EB 4P3YA 4DSUA 1YR7A 5FRDA 1QZZA 1SMKA 5DBGA 3C6XA 4OHFA 4RFLA 3RCBA 5DRTA 3SKYA 4A8JA 5KWIA 3SQOA 2OGTA 3WMFA 1AMUA 5E9AA 1U2PA 4G37A 1QFZA 4QD3A 3PUXA 4R8RA 3TZBA 1JNYA 2QL5A 3E1SA 4JSYA 2DKNA 5HTOA 4OD0A 5K01A 1Z4PX 2NWQA 3VU1A 3JQAA 3SC4A 1ZOOA 1JVSA 2Q3EA 2YIDA 1SURA 5FWNA 3D8RA 1MC1A 4GO1A 4DA7A 2CLEB 4TWBA 1ZINA 2H1SA 2QRUA 5HJ5A 1YZKA 1ONBA 5B1DA 4R1QA 2ZSUA 4QDTA 2C1EA 4X7BA 4MINA 1NNSA 3I04M 4ZAVA 1MCZA 7YASA 1M2JA 5IG2A 2ZYAA 4GMGA 2P6NA 3NONA 4B7UA 3HU3A 5I7AA 3ME5A 1C0EA 2R00C 2C2GA 2D00A 3AFHA 3PHGA 5BN4B 1C8LA 4IDDA 3PV0A 5CX1A 2AC4A 2RHDA 1LK5A 4TRMA 2O8NA 4LRXA 5EQJB 4X62B 2DBZA 1L5VA 4GPBA 4XWWA 2NV6A 1V25A 3GUUA 3H87A 3IQFA 5DLEA 2CJXA 1RQNA 3JTMA 4DARA 4N5MA 4OPMA 5CX1B 3A3YA 1ECLA 3LRPA 3CR8A 3R6LA 5DYWA 4Q4AA 1XRPA 3OZVA 1QS0A 2R86A 5COBA 3E8MA 4IJ5A 1E7RA 3SHOA 1DIHA 3CLKA 1OREA 5BVGA 2OHGA 3P9YA 1XJ0A 3RS3A 4RHTA 3DEYX 1XAGA 1ZK3A 3ZE6A 1ABFA 5JSKA 1WKBA 1NN1A 2C7QA 4Z8XA 1D3AA 2DFVA 3CWQA 3KV3O 2M6LA 5B6JA 4Q9JA 4IMJB 3L82B 2IV2X 1XMSA 1OXXK 2DUUA 2Q3LA 2RFLA 3GD7A 4RVFA 3T7KA 2YVQA 4QDXA 2AJ8A 1V5WA 2BDTA 4CKEB 1FFCA 2OKCA 2V74B 3WDSA 4PN7A 4JHLA 1KE1A 4KRFA 1AN0A 4QJ5A 2WPDD 5T3YA 4BLRA 2O6LA 1OAAA 1HDGO 5FBZA 4M60A 3RBZA 2XOKD 4BNVA 5A5VA 1C4OA 2C88A 2QSYA 3BH0A 3DBRA 3LRXA 2IIBA 1FJ2A 4H7FA 1Z0IA 3EDQA 1JLKA 1PQYA 1U6KA 1JT2A 3C3WA 2Z08A 3HVHA 4L22A 3JYNA 4U0JA 3U17A 3UB3A 4QGFA 1LQUA 2TECE 3RRZA 2J0UB 3H97A 1OB2A 1SIUA 1Y3IA 3DAFA 2JGAA 1HH4A 3AGPA 3LQ4A 3A9TA 1K63A 3Q9LA 3EXIA 1U02A 4RVGA 3T4UA 3CLRC 3JZFA 1FYWA 1UM8A 3GPIA 3T61A 4FXOA 2XA2A 4R7TA 3VX4A 4BJHB 4COOA 1QRRA 1SO8A 3C3AA 2AF4C 3L01A 5G0SA 2GI4A 1NG9A 4CR8A 4IIBA 4UVHA 1W85A 3IBCA 3NLLA 1NQTA 1X1CA 3M1YA 3LCRA 1SXGA 1P1BA 2XODA 1JF8A 1RQXA 1TUBA 3BXPA 3SSOA 1D9XA 2IA5A 3KAKA 1FPMA 4GBED 1GT6A 4EMSA 4Q7QA 1QONA 2EP7A 4ZOLB 2PGXA 3WGMA 2OCYC 3CZ5A 1S02A 4I55F 5G3YA 4AKTA 1DZ3A 2ZITA 4M1WA 3KE9A 3ESYA 1NW7A 2EX1A 2J3HA 3B3QA 3HJCA 5K4AA 2NU9B 4YRMA 5LYJF 3PFWO 5EXPA 3TLGB 4YYZA 1N32B 2Q5CA 1J2YA 1S4MA 1C80A 1YULA 2P8SA 1SBTA 1SHTX 4M9SA 4TMWA 4RGQA 1SCBA 1SC9A 4BNYA 4C3ZA 4EYEA 3ZBUA 2VA9A 3PXAA 4ZT6A 4KLAA 4XGIA 4I46A 4P33A 3ASVA 2L0XA 3V32A 1WUYA 1G4HA 2JFHA 4BFZA 2QTZA 3LT0A 5GADl 1JHZA 3TPFA 3GLIA 4KR6A 3HFRA 4D99A 1A8IA 4UCXA 1P2GA 1AXGA 3UGQA 3KOWA 3NYWA 3EXEA 2C8VA 2ODNA 1VL0A 2RE8A 3QI7A 3OC0A 3GX1A 3IHWA 2HBYA 3VU9B 2H1VA 3AYZB 1F2UA 2OM2A 3QLVA 2G8NA 3HVKA 4HAZA 5FPYA 3QVJA 2VKTA 3OWHA 1BWRA 5AI5A 4YONB 2FRDA 5AW9A 2F1HA 4IXTA 3MM4A 4CUJA 1G18A 3D0KA 3U3JA 5EESA 2JGDB 4B87A 4AT1A 1U7TA 2HD4A 4ILKA 2FHSA 2WLSA 1MO3A 4XCQA 3EFOA 1NRIA 3K92A 1Y3DE 5FI0B 3WGNA 5DTEA 2F9MA 4EUNA 4JR0A 3QKSB 2ZRKA 3R9WA 4DA6A 3EQZA 3PXCX 3Q5DA 4AF7A 2QM0A 3LPLA 3D2BA 1OBOA 5HCUA 4BN4A 3LQQA 4UPEA 4ROSA 2VPIA 4UUOA 1ID1A 2PX4A 2OZKA 4E2WA 3JQRA 1E4EA 3RUEA 1QK3A 1P45A 2QBYA 2RAVA 4AJIA 4MSUA 2IHZA 4PZUA 2V6JA 1QFSA 3JQFA 3OKCA 3P2IA 3S2IA 1CK4A 1VRCA 1PR2A 3CONA 2CVZA 3GXBA 4X1OA 2CMGA 1AQUA 3SC2B 2XOKA 4DLRA 3B8EA 1DG1G 4R0VA 4B44A 2H0AA 2G4CA 3TN7A 3LZ6A 4QYXA 1P5RA 1QIHA 2JHCA 5EVCA 4RYLA 2QVZX 4KLZA 1N7IA 4Y18A 3G5UA 3EG9B 4NAHA 3FVVA 5ALJA 1XMOB 1K7XB 3WHKA 2WZBA 3ROTA 2CD9A 4Q47A 5I7VA 1G19A 3AOEC 1NYLA 1SKMA 3K5WA 3COYA 3PRKE 1EZ1A 5E7MA 1HDEA 2H17A 1WBBA 1ZL2A 4R01A 3R6GA 2AOUB 5TF0A 2R4TA 1FP1D 2OHIA 4UCFA 3VYTB 4EY4A 2Z8ZA 3B7PA 2GUWA 1VYVA 1E3SA 4Y2YA 4NBSA 4OU5A 1EFRA 2XNCA 1NVGA 4QU5A 5PNTA 2I7DA 3CMMA 3QF4B 1BCSA 4Z99A 2W4QA 5KOIA 3BCSA 5AK0A 1L5ZA 1JDTA 2W2LD 2N75A 4HMOA 1TAUA 3UTCA 2IBTA 1Y8AA 1YE8A 2HTEA 6REQA 2INGX 3ANSA 4LRYA 1TW2A 2BR3A 3MUNA 2O7VA 2PVPA 4C7KA 2HO5A 3EQ8A 1P1KA 3KJFA 4AI6A 4B79A 4GL4A 5TPZA 3NV9A 1AUXA 3LVBA 4LV8B 4X7PA 4OXIA 1UJ2A 4C4YA 3LW7A 1X77A 5JS8A 3CIOA 2FVYA 3HB4X 4QQ8A 1UOQA 1BE0A 4UUMA 3VQTA 1GILA 2FPSA 5BXYA 3CQ9A 4UW9A 1ZD1A 5CJJA 2E4VA 2FQYA 3O8OA 3Q0TA 1L8AA 4DQKA 4MR9B 5B36A 2NYUA 1GL3A 3QVGA 1TFRA 5FNVA 1CUCA 2DWCA 4EG1A 4DF3A 2P9EA 3S68A 3VJRA 4W99A 2AEFA 5A2QA 4KL8S 2VT7A 4IVRA 3DDOA 5JC8A 4PIMA 4QQRA 3WGZA 2EBWA 4BLWA 3B51X 2W2TA 4KTVE 3U7QB 3KQNA 3I53A 2XVMA 3SHFA 1ODFA 2NXNA 3S3TA 3EXFA 3TTVA 3OX3A 1VGVA 1EJ0A 4BZWA 3K0CC 4R1LA 2VH2A 4ZOQI 1XVTA 1DAMA 2V03A 1RM3A 1VM6A 1Z63A 2QN9A 1FQKA 2P5YA 4I50A 3T4XA 4HYYA 1FFYA 1A2KC 3D8TA 4XIFA 5JNLA 3OEED 3RVOA 1V8ZA 3SXJA 3E9DA 1VDMA 1T8SA 1KIMA 2QVGA 4TLMB 1JEYA 1SNYA 3DC7A 3LIIA 1KR2A 4QUBA 4D45A 1N2OA 4N48A 2PGOA 3CLTD 4J07A 3HFGA 1D1SA 4P8RA 1HLFA 4D79A 1Z2NX 1Y1LA 3B1VA 1F2TA 2VP5A 3EOAI 3LX5A 3QWHA 1VMAA 2AMVA 2PZJA 3BUSA 3I8SA 1CRQA 4LCEA 4DA4A 4RMJA 1G98A 1AXEA 1MX9A 1PNTA 2JCGA 3IMFA 4U02A 4TVOA 3R4VA 3CV3A 4EA7A 2PKQO 1KZ9A 1YB1A 4YQZA 2IPXA 5TPWA 3SQWA 5JANA 4GYKA 3WL6A 4B0OA 2XQKA 4YP9A 3SJBA 4ZJZA 4BDSA 2WT8A 2R6GA 2HZBA 1KYIA 4IIGA 1AH2A 2A0KA 2JK1A 2NTEA 1TT5B 3ER6A 5JJKA 2XYGA 2IQ5A 3W5BA 2ZIAA 3CG4A 3HJHA 4M1EA 1GGJA 3SIXA 1Z6PA 1JQ5A 4RA9B 4JYCA 5JO9A 3PVCA 3CWZA 4C7JA 4YRNA 3U61B 1XMXA 3JQAB 2AEJA 5JATA 1J0AA 1QGUB 2HUPA 2LWIA 1QB7A 2DPGA 1VG0B 1K68A 3F78A 3QHPA 4FYXA 4HHEA 3V1YA 2P6RA 3EXAA 4LPSA 1YT5A 4AP9A 3BS4A 1JHPA 1GTZA 1WSWA 4WJLA 3ZK8A 2QUJA 3GQBB 5JFGA 2DHCA 2WHQA 4MKZA 1YBFA 1YI8A 3KYCA 1WPGA 3PS9A 1OH8A 2W2PA 3C5HA 8ATCA 1P4JA 4MUEA 3JQ7A 2XLBA 1RHKA 1KSGA 1TK9A 4M0LA 4KR0A 3C1UA 4TN5A 2HK9A 4NNOA 1PSZA 1A76A 2E55A 1I8TA 4N6OA 2XUDA 3RVKA 4QU8A 3UXEA 2PHZA 2UVPA 4IH1A 1X86B 1N2IA 3BMNB 2ZJOA 5GJWC 3AP3A 1J7JA 3TLBA 1IEQA 1OF1A 3T0GA 4BX3A 3WYEA 2VBFA 2XE7A 3GCWA 2EBUA 5DN9A 1T5IA 5EXSA 1DPFA 3NHKA 1DAKA 1Y8QB 2ZBQA 1D1TA 3CEMA 1PRYA 1R4NB 2BTQA 3KEFA 1REQA 4HO1X 4J4HA 4QYIB 4XB2A 5E2BA 2QUAA 1D03A 5AR1A 4JODA 1XU7A 2PIAA 3WI7A 4E14A 1GTG1 2XUHA 3PR2B 4HDMB 5ICMA 1AVTA 2Y68A 4JB0A 5DNDA 5LQMA 2Z04A 4I4TA 5FULA 4Y6SA 1UJCA 4F4CA 2IWRA 1DQZA 3F4KA 1WXQA 5L4LA 3VMFA 2IYUA 3G2IA 1XTRA 1KHTA 3K94A 4BQPA 5E2AA 2BWJA 1CR6A 3VZQA 3WNQA 3MQ2A 5BR7A 3ISTA 2GM3A 4EYKA 4FLFA 1H93A 1FDOA 3L4BA 4DLYA 4S0ZA 2XNDA 4F9FA 5ADUS 4C6SA 1ABEA 2DHEA 5IBQA 2ZJFA 4PSAA 1S2LA 3ZUPA 2ZBRA 5L95A 2WUEA 3PG5A 4D0GA 4RTSA 1EVLA 3OZXA 1M74A 4MARA 2ZBEA 1N9GA 2R3SA 2UZ1B 1TO2E 4FGJA 4RF5A 5FTJA 4BMZA 2WD7B 1PGNA 3CNEA 3K1AB 3ZU2A 5IC5A 2FX5A 1XROA 1X38A 3BWEA 2PX6A 3UJHA 4B9EA 2C3OA 5K9ZA 2NP7A 2IUUA 3NHWA 3WWYA 2WHRA 4XIGS 3SJUA 3D8UA 3O7WA 4B4UA 4OX9B 5KOJB 1E1MA 5F5XA 4RK4A 3A6KA 2DQYA 3E1GA 1HC7A 5HQJA 1I3NA 1GZUA 5DK6A 4S1OA 1VYUA 4MWZA 3N0RA 3UZUA 1KO7A 5A1TA 5K3BA 4I1SA 5D3ZA 2GNOA 2ZSAA 2X0DA 3CN7A 3OX4A 2C98A 4ZAFA 5TSDA 1W75A 2Q6OA 3HGTA 3U16A 1CQJA 3D43A 5AIAA 4ZXFA 2WYUA 5BW5A 2IP1A 3PX2A 2E4AA 2J48A 1CRLA 2LXNA 2OQ2A 1U2GA 4XUDA 5T6BA 5DXFA 1KDTA 3I61A 2G82A 3W78A 5A4FS 4LY6A 4MQFB 4M9QA 1OAKA 1XELA 2FR8C 2R87A 1YKFA 4R8SA 5F5NA 8LDHA 1XJCA 4ICIA 2F43B 2LNDA 2UZ0A 3E3NA 1F4PA 3M6AA 3IT0A 4K3VA 1A5BB 2OYSA 1O8BA 5TPZD 5KYGA 1RM0A 1Y6FA 4X8MA 4PZPA 2H2FA 3HFSA 1Y81A 1C9NA 1J1IA 2IXAA 2H5JA 4WXHA 5E6SA 5ABPA 3V3TA 3HCBA 2VNKA 3HZZA 2I7CA 1ZO8A 4RHCA 4E5VA 3H19A 1WO8A 3PX3A 4JYMA 5A71A 1GP2A 4Z2AA 3GGDA 3PDUA 3OO0A 3ZCTA 2Q8PA 3B1XA 2DJ5A 3OOWA 1NL3A 4BFXA 3WBBA 5MN6A 2FEAA 4YJGA 2VUHB 1HRDA 1Z47A 3OURA 1IE3A 5JQWA 1R27A 3SJCA 5K4GA 4RTKA 3U60B 1K92A 2YWBA 3DD1A 2G63A 2PAAA 5K4HA 4Y6OA 2FEOA 4KPYA 1A9PA 4NBLA 1E6LA 1GO2A 1EDBA 2YV1A 4W6ZA 3NUZA 4M8NE 4V0OA 3B70A 4DR2B 1SXJA 1QQ5A 4HPJB 1DQYA 3W5CA 4EHLA 2F55A 1CRPA 3FOCA 4FR2A 1NBAA 4UQOA 3A6LA 1IM8A 3A3OA 1DNPA 4GR5A 2NVOA 1FPQA 3RFTA 2COUA 4ZV4A 3COWA 4AJJA 4C08A 2B82A 4H1TA 1XALA 4M87A 1TZCA 5GGXA 5TMPA 1DBQA 3CUYA 1G2QA 3FSJX 1Z5NA 4E33A 4FBGA 1G5IA 2A9VA 4JQYA 3RVJA 4JI8B 2CNDA 2CVFA 2G04A 4TTRA 5A6SA 3TTUA 3GVXA 1N5JA 4QXMA 3UQZA 2PBZA 3AUAA 3U7RA 5H59A 3MB8A 3QFRA 1XD9A 2QVCA 5LCXA 4ZOCA 4O1MA 1W4CA 2NXJA 3KC2A 1JU9A 1HEUA 1S5PA 1X13A 2KPOA 2YJNA 1M5UA 3B3AA 3QTTA 3LAWA 5CM9C 2WKWA 4IMPA 4JA0A 3ZW8A 3DOIA 1MO6A 5DCYA 3KEMA 4DHEA 3DXZA 2H7XA 3HEBA 6AT1A 3CCFA 3L8YA 1HZZA 1XPRA 1VSQA 4CWAA 2H31A 3M9WA 4Y9UA 3VNQA 4QVKA 2PZFA 1XTTA 3DM9B 4Y1FA 3WGOA 5JSUA 2A5FA 3OOHA 4NBUA 2V8OA 2DUNA 2P9JA 4IX9A 3FTCA 1Z4KA 5EJ4A 1C9KA 4ZHQF 5I8WA 4D3YA 1XZEA 16PKA 4N4AA 4PBRA 1AJEA 3CNLA 2JBAB 2FPGB 3LQRA 4HBZA 3IAFA 4QYSA 1SVUA 2PT6A 1U0BB 3K9HA 2ZSBA 1KVUA 4Z0HO 1SZJG 4F04A 3Q6IA 5JZSA 4YVFA 2YDXA 1QG2A 2B4TO 5SYAA 4E7PA 1E79D 3QWFA 1NBMD 1SBNE 4CI0B 3O9MA 5IZCC 1MJGM 1Y4AE 4TSFD 3OSUA 3RABA 4TL7A 4HDKA 3RSHA 4HRXA 5I4IA 5TY0A 3DBHB 2VRCD 4FOOA 1ONPA 2Q07A 5KNBD 1CU1A 5KAPA 3AIKA 1UCFA 2D0PB 4URWR 4WINA 1QIGA 4OK6A 4ZZ0A 1VJCA 1QB8A 3LT1A 3N76A 1O5OA 4QBGB 4S35A 1B3RA 3QIVA 2GAAA 3R7DA 5SY4A 1KJIA 2AI3A 3LP8A 4K0RA 4X84A 3QLEA 1RWVA 3L1HA 1P19A 4UE3S 1PTKA 4O1IA 5L6LB 3I1JA 1NTOA 4FNMA 5LQKA 1KMQA 3NJRA 2H07A 1TO6A 4UQPA 3OCVA 1IPEA 1KXJA 1ZGJA 4V2IA 4ARZB 4AQYB 3SF0A 1ZD9A 1J7KA 1Z06A 2BFNA 4PC6A 5KYVA 1EEXB 5C18A 2Q5JA 4YS6A 2YJZA 3LIPA 4PLFA 3KJEA 1IQPA 3GD5A 1KY4A 5F78A 3VJLA 4J1NA 4P4TA 4U2KA 4YWHA 2NUAA 4M22A 1THGA 3Q1KA 2A9KA 2VOEA 1N2XA 4IFBA 4P1ZA 2WF5A 3B60A 4P7GA 3ORSA 3RC2A 3X2EA 4F4IA 5MFPA 2XT0A 3GARA 4HWOA 1DXYA 3HY3A 4Q1EA 4ABYA 5DSXA 1U1IA 3N7AA 5IW8A 3MNFA 4QPDA 3JX9A 2R62A 2X23A 1XMIA 3NU1A 3KVVA 2PRZA 1Z6TA 3JQBC 3LF1A 3SMQA 3HXPA 2J6IA 4BX0A 2I6FA 2FB9A 1ZAKA 2BTEA 1KYXA 1LLCA 2ENWA 4NK4A 4D25A 4UDYX 3GJRA 2HUNA 4UM8B 2FEMA 3ADPA 3PKZA 5JCJD 2E4ZA 2GO1A 2R6HA 4FMBB 3ZGLA 2JAPA 1VL6A 3QLUC 5E9JA 3RV3A 3LFHA 1HQCA 4JLSA 1Y7PA 2L17A 3E3MA 3FTNA 3TUIC 1JMVA 1QO7A 3ADOA 4CV1A 3O91A 4ZAGA 1E9SA 3A27A 2FEXA 4LXQA 2Q6LA 4JC4A 1W36C 3L4BC 2DECA 4LTDA 3FNRA 1OI3A 4GH5A 4J2TA 1IN6A 1T91A 4XM1A 4TVKA 3V46A 1XTUA 4WKOA 3ZVLA 1GNQA 3LFTA 3O8BA 5FUYA 5ILGA 2YZMA 4K05A 2X0NA 3UMGA 4BV9A 4C6TB 3OU2A 5THKA 1ZUIA 1OSNA 4UNRA 3FROA 5F33A 3EEBA 5EP4A 1G3QA 1YDFA 3GEBA 1PR0A 3QY0A 2OCBA 1YKSA 3KQHA 5HX7A 2QP4A 2FWPA 4EUSA 4GI5A 5I7SA 3M4YA 3P9CA 2VDKB 3HJAA 3SHQA 2P91A 3SJZA 5A9SA 1IBMB 1GCAA 3L0PA 3LV8A 5EHQA 3RKSA 2ZUWA 1RVDA 2YBDA 2G1UA 2CZQA 3Q2IA 2D5AA 5KNBA 3ZVKA 4DT1A 1V1MB 2Z3WA 4IBOA 2C5GA 3TQSA 1AM4D 2O8CB 1Z8HA 2SBTA 3GEHA 4DV6B 1Y3HA 2OE2A 2LIPA 3PL1A 4KR2A 1H3NA 5LLDA 4PQYA 5TARA 3ZS9A 4ALIA 1R9GA 2DAPA 4J7AA 4HXEB 5HBRA 4A5OA 4GVXA 4FQ7A 3U9LA 2YCBA 2ZRQA 1INLA 3HRIA 5C8VA 2I87A 1MZVA 1TECE 2UXDB 3LD9A 2EARA 3TLYA 4X0EA 2CF5A 4Q24A 2DQSA 4ZCTA 3SX4A 1G7CA 4EQ6B 1I6KA 1YC5A 3PNKA 2AE1A 5F7XA 1HQKA 3A36A 4CMIA 2OL4A 1GCUA 1WY7A 4IWXA 5H3LA 1FP4A 4Z0PA 2JJ1D 5TMBA 3M6FA 2DRIA 2DT8A 3RC7A 3U49A 1WZEA 3F1KA 3VDRA 5SZKB 5B6PA 4B3BA 5FL3A 3L0OA 2NVWA 3HM2A 2L82A 1GDTA 3DP9A 1IWPB 1JSZA 1ZEJA 3VVCA 3TZLA 1S2IA 3LKDA 1H9CA 1D4AA 1TQ8A 4IJWA 4ZDKA 2OC9A 3URKA 1FXWF 4QFCA 4D9BA 4N40A 3GDWA 1CVLA 4IYJA 5JNTA 2ISCA 2QD1A 4EGAA 1UBTS 5EXEA 1YS1X 4RD3A 3LYUA 5IEBA 5KAMA 2IQIA 3CG0A 3H5IA 2GKSA 1WZNA 3VI4B 3CUSA 5HIMA 1U7ZA 3B1ZA 1L5NA 4C78A 1SFRA 4TWAA 2FG5A 3AFGA 1P7ZA 1RFGE 4PG6A 1HF3A 3WGHA 4XFKA 2H85A 4B43A 2CHEA 4NEGA 1TQDA 2X9VA 4CMBA 5ESRA 3SVTA 3LS2A 3UC5A 2A86A 1DGQA 2QU8A 4DMRA 1Q20A 3CPJB 4MQFA 1K8XB 3G88A 3D6JA 1WY5A 2BP7B 2V4UA 3RROA 3FLEA 2IHNA 2XT6A 3QBVA 4HQRA 4GBGA 4KQ1A 2Y2UA 2H1RA 5HCNA 1ONOA 4ZZ1A 1PLLA 2G36A 4W63A 2FSFA 4EYGA 5IJZA 1OT5A 2CFSA 2VS1A 1PJZA 2ZPAA 4KDCA 4RO0A 5FI5A 4YMTA 1IIRA 1O9GA 1SCUB 3QOXA 4L8FA 4BO5A 2RGWA 3GN2A 1EZZA 3ETEA 4NV3A 4ECAA 2W6CX 1GAJA 1XEWY 1H66A 5BURA 3B9RA 4DNXA 1SU4A 3ESCA 2W2VA 1EB9A 4BMXA 4R69A 2XPCA 1W7AA 2GBGA 2WHXA 1P2VA 1FLVA 2MSKA 4GPTA 3R3HA 2VJPA 4MWSA 4OSOA 4RPLA 1FVFA 4RX1A 5J4VA 1DCTA 1P4GA 1DCKA 4M9CA 4RABA 2XTZA 4ACBA 4TV8F 2DQZA 4KYIB 5JNSA 4OB7A 2PWAA 3M7IA 5DXJA 2BISA 2BD0A 3KDSE 3S2GA 4IEIA 5LQAA 1FFGA 1OXBB 1PNOA 1WS6A 2H0RA 3LG2A 4OYYA 3UQYS 3PLRA 1SVIA 3A1EA 4Q05A 4URXR 4EHHA 1BXRA 2P67A 3IRVA 1F8GA 4MIYA 5EP1A 4E94A 1T2EA 2W6IA 3EEIA 3U13A 4MPJA 4HEQA 2IV3A 4DQXA 1FU4A 4YUXA 3ZHYA 5DCWA 5EVJA 1DC8A 4KKXB 5KIAA 4JXKA 1A9ZA 2B7CA 3AT1A 3CB2A 3SFZA 3IUPA 1SK9A 4TSRA 1NRJB 3MTQA 1HTTA 4IV8A 3TQOA 1VJ1A 3IVRA 4G0NA 3GEIA 4MCIA 4OHWA 4ZOEA 3CZQA 5I9NA 3USCS 3IS3A 4RS4A 5CM2Z 5IDVA 3T7CA 4CZ2A 4CN8A 4I7EA 3SDZA 2GEKA 1U63A 2EGHA 3PDHA 4F8YA 4S05A 1N8SA 3E3LA 2ASEA 4LOKA 4B34A 2MR6A 3VOAA 4YT2A 4KXNA 4Z3KA 3VM6A 1R5BA 5A7HA 1XQ1A 4HNTA 3USZA 1YVPA 1U3GA 3FAZA 2DSTA 1QWOA 4L76A 3D4BA 2BGNA 4Y3UA 4MH0R 2QW0X 3SMVA 5CXUA 2VVTA 1RAFA 5CA1A 3RE1A 2QTCA 5LBTA 2WYIA 4EA6A 3PNOA 4JZYA 5LBIA 5LOVF 1SUBA 1PZXA 1JKJA 3LH5A 1IUKA 1YQXA 2JGFA 3TIVA 1UJ6A 4BPRA 2IHVA 5BMVA 1X92A 3LQ1A 4TKVA 3DFFA 4TRRA 2JBWA 4X71A 4DV2B 1MAAA 1JIIA 3U4AA 4IIJF 4JXJA 5DHAA 5AXAA 4KVZA 2JCBA 4YJ3B 1CF4A 2PNFA 4E5YA 2H8KA 2B35A 3QU2A 1UT8A 2XDWA 2PUCA 1OASA 4HRYA 4MOWA 3BAFA 1SKYE 1ZL0A 4YK7A 3RSQA 3W34A 5EC8A 4TKUB 3KT0A 3ANMA 3SQLA 1VL2A 2XITA 1ZU4A 5DNAA 5CYGA 4C0AC 2VDPB 3BDVA 1M6VA 1UC8A 4R3WA 2D1TA 5AKXA 4F5YA 2EBFX 2PGIA 2FLKA 4HLQB 1SPBS 3PRHA 3QRWA 1P39A 3T1NA 3ROMA 3ZG6A 4G0ZA 2EJBA 3TSWA 1W2HA 3QUSA 4UHDA 3V7UA 3GLGE 1HNNA 2LVBA 1CUAA 3A4YA 2YVAA 4QXAA 1A8SA 4X1IB 4PQFA 4WAUA 2VT6A 3AZQA 3RIEA 3SBOA 2XRZA 4N5IX 2ZSJA 2WD9A 4EO7A 1NRWA 2H4FA 3SM9A 1UBOS 4IVPA 2QNRA 4L5YA 4MW5A 5G4KB 3VV2A 2CLIB 3G8BA 1C7IA 2ONCA 4ID3A 1LJ8A 3BIJA 4FYKA 1RP1A 5ALLA 2CLDX 1G9SA 3RUIA 3ROQA 3CR3C 5KC9A 3K9FC 2ISSD 5IF9A 1H6AA 1H65A 1T5DX 4BLQA 5DLDA 3EDOA 3GNLA 3RVMA 5HF8A 2Q4OA 4HFRA 1JJVA 1K06A 3QEBZ 1K6JA 4H4CA 4GR4A 4OHMA 4FHGA 1I2ZA 4HRVA 4OBEA 3ZC3A 1N1EA 2B4KA 4YCBA 5LZ8A 1U3DA 3E81A 4Z9AA 3WJ7A 4YCLA 4ONEA 4YRCA 3OBIA 1PJLA 2D4HA 1X87A 2ZYDA 4UM9B 3N6XA 1PR9A 4MNTA 1GPJA 4J7CA 1KH2A 1AK2A 4WOBA 1RWQA 4UUNA 4YA6A 2BF7A 4RVDA 1UOEA 2FPPA 1RLOA 2F1RA 2ECOA 3AR3A 2XCQA 1YDMA 4BRUA 4MUIA 4J0QA 5IM4A 4L5JA 4ND8B 1VHQA 2PFGA 3JZDA 3P2MA 3GFRA 4C0BA 4MPPA 4QBHA 4ZKDA 2C9MA 5FQNA 3FSRA 4Q4HB 5CG2A 4PG5A 3OCXA 4CMCA 4Z6KA 1UINA 2D1RA 3X44A 2PM8A 1SQGA 2EW2A 1X80B 2ZGVA 2JEOA 3WADA 2EG5A 5ANRB 4RXMA 2X8JB 1Y3CE 3JRNA 4FMPA 4LGMA 2H5IA 5KSYA 4JLJA 5KWEA 2J85A 3BZWA 3ZVMA 1U1EA 4A10A 5BMVB 5EMNA 2O8EB 4KXVA 3M2TA 3I3OA 5LFAA 1YUBA 3ZH2A 1D1QA 1C41A 3GLFA 2FWNA 4MVCA 3EPHA 5AESA 1NRXA 5E95A 1J49A 4GRIA 2FPXA 1GTVA 1KAQA 1RPNA 1VGRA 3OC6A 3VSEA 4H3KB 2R7LA 1E9EA 2WIFA 3FWZA 3G2QA 3O8QB 4TPKA 4MR8B 3S2FA 4KR9A 1Q12A 2VNJA 2ZUVA 8GPBA 4KR3A 3C3YA 4BNNA 4TWIA 1P7VA 2CVPA 2PWPA 3ASYA 4NABA 3RGWS 4WBNB 3KSAC 3I6QA 4G0OA 1POXA 4NV1A 1Y89A 4UAJA 5B1IA 2G08A 1S2GA 1D09A 2QI9C 3C43A 3BD8A 5F7JA 4GC5A 5BP7A 4CKZA 1UMDA 1QRUA 1XQVA 4IIFA 4WCFC 1EX7A 5BWBA 1RKUA 2XZPA 3OQ1A 2XTNA 4BE7B 4CKWA 4B3IA 3ZD8A 5HKLA 2VWHA 5CT9A 1U28C 3HJBA 3DLIA 4G5YA 1JN0A 3KQLA 1JSLA 4LA4A 5DNUA 3S2YA 1FC0A 4EKIA 2BFDB 1EFUA 3ZCQA 3O83A 3VVLA 1JI0A 2O3UA 4PS0A 3CGGA 2RMKA 4HP8A 3U44A 1AK9A 1U8CB 1ZCFA 2RHHA 3G0OA 3ITKA 2IIQA 5FWAA 4RCYA 2GUGA 5TQJA 4ENWA 4ZPJA 4NZOA 7ABPA 1GD1O 1TTQB 4QFBA 5A02A 1DJNA 1UZNA 2O8DB 4BNKA 4WXEA 4D3FA 4OFWA 3KBOA 5DULA 3D59A 4LWOA 5DXAA 4QUDA 1LPSA 3VZPA 3AEKA 1KEPA 3QPAA 4RK6A 1TIBA 2J5BA 3IT2A 3LX6A 1KEKA 1L3CA 2VIIA 3KVYA 3LUBA 3GRYA 3AUUA 3PKIA 1LC0A 1PJAA 2NZVG 4WZBA 4Z9YA 1II0A 1R7RA 1PDOA 3MCZA 4FFDA 4HDSA 2A14A 3BQ9A 3R20A 3P1JA 5C81A 1IB0A 1YL7A 1JS1X 4BLUA 3W9YA 3HYTA 2OK7A 1UKVY 2CUKA 2XF2A 4RENA 1R15A 1CQPA 1KP9A 3THSA 1Q77A 2QPTA 2VC2B 2F9LA 3VU3A 2AQ8A 3CW8X 5C8ZA 5FO0A 3PTLA 5C46F 4JC0A 3H5LA 2Q3BA 3IIJA 5COQA 2HGZA 3HCOA 4L8WB 4R9UC 2JI9A 4BMPB 2A7QA 1W48A 1U8FO 3S8MA 3ZVRA 4OXXA 4UBMA 2P40A 3AHJA 4M37A 1Z73A 4OHVA 1L5HA 1Z6AA 1N5LA 4KDFA 2H1HA 1JHUA 4F60A 2QUZA 2HC9A 3NZEA 3PJFA 3H83A 2FMTA 1OC4A 1MAWA 1E20A 3FSGD 1XZMA 1OPXA 4KIWA 4BVGA 1O89A 4E11A 3U5TA 4TTIA 2LPMA 4L51A 2X7XA 4HNSA 3UAZA 3P9PA 3VTFA 1T9BA 2X19A 4MHTA 4QTUB 3OQNA 1RRPA 3ASUA 4HGRA 2GCEA 5U4QA 3BGOS 2XEXA 5CCBA 2J3DA 2ZJBA 3QW2A 4C01A 3TL6A 1J39A 4JHXA 2WJ6A 4D0LB 2YRXA 4HZIA 1RYFA 3IR5A 4HUJA 4BOYA 1LV8A 2F17A 1UZMA 2GPWA 3GJZA 3IA7A 4IHKA 1Q7CA 3EJ6A 4H1UA 3VNSA 1UKAA 2IIVA 1KETA 3KV1A 3BFKA 3OQPA 4OQQA 2XUIA 2HNBA 5GZ3A 4PLZA 3R3YA 3CBQA 2IZ6A 3WGUA 4CT4B 1KH3A 4C7OA 1TAGA 5CA0F 4MUJA 1YQQA 3RIYA 3EZXA 1YJAA 4YRQA 4GAEA 4W7SA 2P78A 3NXSA 2VDUE 2CMFA 1TRKA 2EIXA 2CXXA 3KQQA 3MJTA 4UJ3A 1GUBA 1N25A 3WMWA 1XNQB 4C0JA 1W8IA 4F84A 3MERA 2D5IA 2P9BA 1B74A 3MWGA 4XYLA 1ZITA 5EI5A 5BOSB 2ZT8A 3DLAA 3ZYZA 4E5PA 4E32A 3M70A 4LDQA 3UOAB 3WLAA 3ZWDA 1LDBA 3GRCA 4PZYA 4H0NA 4ZT7A 1IFXA 1R37A 1CUGA 2Q4RA 4HLCA 4MLPA 5CT6A 3TMAA 4CM8B 3A1UA 4YUAA 3KL2A 2GCOB 1OU0A 2PA0A 4V0SA 1DDOA 2G17A 5BSGA 4LF4B 1PS9A 1T9CA 4IIYA 5ALNA 2P2LA 1H4TA 1O9HA 5TT1A 1A77A 1L1QA 2OG1A 2EVWX 2QIOA 3IUNA 3NHSA 3GUHA 4AMBA 4D8TA 3K71B 1AQJA 5EWMA 4R0MA 2MYNA 2WSYB 1GR0A 2BZGA 4QA9A 1DKMA 1Q74A 1UANA 1DXHA 1ES9A 1RZ3A 2IDZA 3ICOA 2CBXA 4G1BA 4JK3A 1AKNA 4WJKB 1L4MA 4F38A 2PY6A 2X5OA 4IXWA 4N12A 4OXQA 1W76A 1E9DA 4HPWA 2W83A 2HNAA 4IJUA 4N54A 2DPHA 2YNMD 2Q2VA 5F1KA 5LDHA 1EDEA 5FNZA 1J8VA 1N9GB 2UZ1A 4NMLA 4E08A 1OT3A 1JH9A 1N7HA 2COEA 1FDSA 1JYSA 2XRYA 3FNEA 4Q4CA 4L08A 1TM1E 3EF3A 3SM3A 4AJHA 4HL6A 1U7DA 3SYKA 3ZOKA 1ZHFA 1XCGB 3EZGA 3GG9A 2FZVA 2QR3A 3P2JA 2C3YA 2J3IA 4R1NA 4RL6A 1ZD8A 5FO1A 2ZETA 1VFPA 3Q8XB 5EQTA 5EXXA