2ZI7A

C4s dck variant of dck in complex with d-dg+udp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
240
structure length
218
Chain Sequence
IKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSTGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elucidation of different binding modes of purine nucleosides to human deoxycytidine kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Deoxycytidine kinase
total genus 85
structure length 218
sequence length 240
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zi7A00
1IQPA 2GRJA 3AB3A 1GG2A 4YLGA 3K0AA 2BEJA 3I5XA 3MLEA 1VCMA 2Z4SA 2CK3D 5FUWA 1G9XA 2IEZA 4JBXA 3UXMA 2AR7A 1G20E 3K0SA 1HY3A 3OESA 3P1JA 1JI0A 3TJZA 2QZ4A 3MRSA 2WSSA 5E7MA 4CZ2A 3BH6A 4QJ5A 4RD0A 3EX7C 3RSLA 3KQHA 3HR7A 4Z54A 4BFSA 3ICQB 2PH1A 4CEIB 3TBKA 1L8QA 4U00A 3GLIA 1MOZA 5A5GA 1OKKA 4Q9JA 5JEDA 4TYQA 3AVXA 2EYUA 4NONA 3AP3A 3LLMA 1SVKA 2WPDD 4JYCA 1HV8A 1ZMXA 4LDJA 4M8NE 3DEFA 1XFAA 4YDHB 1N6NA 2ZRNA 5EP3A 5HCIA 2FV8A 1OFIA 2DFKB 4TZ0A 2B92A 1XXHA 3SC3A 4URVR 1UKVY 1G8GA 4AD8A 4ZDKA 4I81A 5L3QA 2ZRIA 4KBFA 3K70C 1OJLA 2JLXA 1SKYB 3I3SR 4C9BA 3AVOA 1E2FA 2P5TB 4Q19A 4EPXA 1S9HA 1KO1A 1YR6A 4C0AC 5C46F 1KI4A 4O3MA 2HXYA 1DAKA 1Z83A 2ZE7A 3UMFA 3ZDQA 2A5JA 4WBSA 3X1ZA 2G3YA 2VP5A 1GWNA 3AF4A 4RZ2A 3CF2A 2HXSA 3K09C 1G21E 3IPYA 2E9SA 3NHBA 3BB3A 3ECCA 4B3DA 1F3OA 3LLUA 3GJXC 3B5JA 3CWQA 4O2RA 5EZ5A 621PA 421PA 3KQLA 4XTCS 5AJZA 3LRPA 3B60A 2QU8A 2UKDA 3PUWA 3V4RA 5JCZA 2VHQA 3NDPA 4OQNA 2WOOA 1CJMA 4C7OB 5UKDA 4TYNA 4F92B 2WKRA 1XXHE 5HKKA 4JBWA 2AWOA 4JIMA 4MITA 3SHWA 1NNEA 5F2EA 1W36B 2ZSFA 2JLQA 2GJ8A 1WMSA 2QROA 4R7ZA 1M74A 2C04A 1A7JA 5EUQB 1JPJA 2IF0A 4Q9IA 5JZVA 1OB2A 1YZGA 4LUCA 5HR5A 3U3MA 4A6PA 1GTVA 3IDQA 4PPNA 1E9CA 2J59A 2D7DA 2ZEJA 2XZOA 2AL7A 1U81A 5FOUA 1GL6A 3MWJA 4ZDJA 4JLBA 1OFHA 2V7QD 4ZPXA 1E0JA 2CNWD 2ZRHA 3SQXA 5DO9A 1M1YE 2QBYA 3AP1A 2ODBA 5AUPB 4LHYA 3SR0A 1JJ7A 4M22A 4QOSA 3GLFA 1TNDA 1TUIA 2Q0HA 1U90A 4JMPA 1M34E 2ASEA 1HE8B 1LW7A 2W2TA 3Q72A 4HAXA 3QOFA 4ON9A 2GK6A 4M9QA 2HLDD 2OESA 1NJFA 5CDFA 4ARZA 4C0LA 5DH9A 4AYWA 4BFZA 1XRJA 5DE3A 2GF9A 3WRYC 4P4TA 2J7KA 3TR0A 2O52A 3TUJC 4NP6A 1OHHD 2PT5A 2WWWA 5FTNA 5JRJA 3DKVA 5D3MB 4NCHA 4FI3C 3OFNA 3O8RA 2PX3A 4FCVA 2WWFA 3BORA 4HLUA 2XB4A 3W8NA 4C0KA 4AG5A 4MRVA 2PLRA 1VECA 2VP6A 2FU5C 1P72A 5B30A 3TGPA 4DDUA 4P4SA 2EFHB 1AKEA 1E0KA 1JNYA 1RKBA 2CL7X 3KB2A 3MFYA 3RANA 1TF5A 2F1RA 3GJ4A 2ZJ8A 5FL7D 2VHTA 2ZTSA 4A82A 4TQ9A 1TU4A 2A78A 4IDHA 4AG6A 4C0BA 1QHIA 4CF7A 2GVZC 3GEHA 4FMCB 5BYKA 2BBTA 4JSYA 1NN5A 5BYJA 2OEPA 5AUOB 2XXAA 2YJTD 2ZREA 1Z6GA 3KJEA 4W5WA 3OFND 1KZ7B 4Q1BA 4DSOA 3QJYA 1IN7A 4UKDA 3QG1A 1KYIA 4M9ZA 1XZQA 4Q00A 4EAQA 1NG9A 2P2LA 2RGXA 1B0UA 1T5IA 1S3GA 4M53A 3WXMA 2CL0X 5CB6A 4PSVA 3EW9A 3GJ7A 3CF6R 4MUBA 4JSTA 4Y0AA 3RRMA 3LH5A 4XTRA 2W6JD 1SVOA 4FMDB 4K46A 2ATXA 3PITA 1ZCAA 2VBCA 4I4LA 4B3CA 1MRNA 4PAQA 4A0RA 4Q4HA 4HB3A 3Q5EA 1QHHA 4TYYA 1XB2A 2P65A 3LFUA 4PC7A 3RABA 2O8EA 3Q5DA 5FH9A 1UADA 2ZJAA 4EQ6B 1TAGA 4H1VA 3K9GA 3TVTA 3VR3A 3IEVA 1FL9A 1U98A 3ONWA 4LSGA 1Z07A 4BLRA 3W90A 3RVBA 3A37A 4PC2A 2WTUA 4OHXA 3CRVA 1KDRA 2WIBA 3T12A 3QKUA 1UFQA 3TUZC 1Y3AA 3IILA 1AN0A 1R2QA 1WBBA 3GFPA 5KO2A 5FTLA 4E09A 1RYFA 1HUQA 2XJ4A 2IUUA 5JS8A 3K0AB 5A4JA 2HDNB 1IXZA 4V0OA 3P27A 4AC9A 4LOAA 2QMUA 2N46A 4NZYA 2F3TA 3TIFA 1P2UA 4Q1CA 1TEVA 2OZEA 4FN5A 2EWVA 1RRCA 1S0UA 3AKEA 4QRHA 3A4LA 3RLFA 4IOMA 3FMIA 3X1XA 4H1UA 2IUTA 5P21A 2DBYA 2QGNA 1K5GA 2GTPA 4PR0A 3VR2A 2ZM5A 2FPMA 1E2IA 1II0A 2GXQA 2J46A 3QF7A 4JL6A 5C4GB 2IYWA 3SJCA 3NC0C 4DLYA 3OIWA 2W0MA 3VKGA 3UPUA 1F48A 1EWQA 3LQRA 2CDNA 3OF5A 1RZ3A 2GEVA 4LHZA 3PXGA 2GZAA 3Q85A 4QGAA 1JECA 5E95A 2F1IA 1DO2A 1E9BA 1VHLA 1XCMA 3PVSA 3U6BA 2N42A 4ASUD 3AP2A 1C4OA 3EPHA 1S1CA 5FPKA 3CKLA 3WNCA 3WMFA 3NBXX 4G3XA 2D2EA 4M1KA 1LTQA 4TYPA 3LXXA 3EIEA 1EFHA 2BJWA 2QPTA 1GAJA 4MDEA 2P67A 4OK5A 2FJUA 1K8RA 4WAUA 4POAA 1F60A 2C9CA 2GNOA 1IN5A 4M1TA 4L16A 4WXRA 4ZIRB 5G41A 2F9LA 3LX5A 2ODEA 1NMYA 4M1WA 2OLKA 1O87A 1E2LA 2XTNA 3F8TA 4NYMQ 5IF9A 2CJWB 1W4AA 2ZYUX 1H8HA 2HEIA 1HURA 2ZU6A 4G01B 1RJ9B 1S96A 4CEJA 3KQNA 2DFLA 3T1QA 3VTKA 2VP9A 1PLKA 2BM1A 4WW0A 2YOFA 3NHAA 3DM9B 4JS0A 1AZSC 1U8YA 3GEIA 2OBLA 1F6BA 3FHTA 1VYTA 2GXSA 4QKQA 4I1VA 2WWIA 1TEXA 1N5JA 3TR5A 4PZZA 1SXJE 4DKXA 4Q1AA 2DPXA 3J81k 4M1OA 1Q1ZA 4JBYA 1BH2A 1JR3A 1RRPA 4V0MA 3JVUA 2ZQ5A 4BLOA 2IT1A 4JVNA 3S1AA 2HF9A 2NMVA 4P33A 3MCAA 1GOTA 4ACAA 3AM1A 2BBWA 2P6NA 1WCV1 2J45A 1LF5A 1ZU4A 2O0KA 2ZYTX 5EXPA 3JZAA 3GLGB 4TT3D 3DPUA 2ZI3A 3GJ6A 5L3VA 5TY0A 1KKLA 2JDID 3L82B 5HTKA 4MGKR 1GKIA 1W0JA 1G6OA 1DADA 4L8GA 3LBHA 3LV8A 4Q9KA 3ND9A 1RE0A 3EPJA 4N3NA 3RWOA 3DOEA 1GFIA 4MRNA 4ZO4A 2BKEA 4IDPA 1LV7A 2JJ2D 2FSIA 4LBYA 5EE0A 2V6JA 3CUEF 4KCGA 4OI0A 4KFUA 4IJMA 1FQKA 4MUAA 1SXJD 5FTMA 1W0KA 3OIYA 1R8QA 1N6PA 2KI5A 4TLBA 1OKKD 3I5YA 1SHZA 2RCNA 3NBZC 2GJKA 4OI2A 1MRSA 4Q18A 4DSUA 1QG2A 3FKQA 1UJ2A 1AQUA 2G0NA 4Q7JB 1UEIA 1TPZA 1ZVQA 4TQUS 2JEOA 4PQYA 4X8OA 2Z83A 4LX0A 1KI6B 4KLZA 1D5CA 1ZJ6A 2R6DA 5CDFE 1E98A 4LPSA 3VFDA 3UG6A 4KSBA 3X1WA 4TLCA 1E69A 3O8DA 1RPZA 2IW3A 2UZ3A 3NEYA 2B6HA 1OIWA 3IEUA 2H92A 1DAEA 4IKEA 3ZIAD 1E99A 3KKNA 4B44A 4NCJA 3RHFA 2YVUA 4YMVA 3A1SA 3WRXC 2IHYA 4A4DA 4JLOA 3QF4A 1FZQA 3R20A 4LHVA 1IJEA 5DISB 5KNCA 4YMSA 2IYQA 3AF3A 4HLUC 3AVUA 3K53A 2RAPA 2ZI4A 1U9IC 3MAAC 4NCNA 2WMNB 4AYXA 3GLIB 4BWYA 2HJVA 3JVVA 1KI8A 4DCTA 3QBTA 1ZUHA 5EUMA 1OYWA 3H1TA 4GFDA 3L8ZA 2AD1A 4LHWA 4XD7D 5JSZA 5KSZA 1Z2CA 2NO6A 5KHOC 1Q22A 3PJRA 3VHLB 2RGCA 4NU0A 3CPJB 4B2PA 4WXPA 4PO9A 4LCBA 2REBA 1RVDA 2NO0A 4QJ3A 2R6AA 1E79A 2VHCA 1E1RD 4Q01A 3BB1A 4D0LB 5LD2C 1E9RA 3HYRA 3TMKA 4HB2A 1Z63A 3A6PC 1I2MA 2Q9BA 1NN3A 2J3EA 3H0KA 3IQXA 2D2FA 3BH0A 2DWOA 1NSFA 2QMEA 1SVMA 2ERYA 2H17A 5EXSA 3AQ4A 4HDCA 5GJCA 2F1HA 1NVXQ 4KFTA 3K70D 1I4TD 3A1TA 2GXAA 2JJ1A 2VSFA 5TVKA 4AI6A 2OUKA 3QUSA 1KGDA 1XCPA 3IPXA 4F38A 2QUZA 3ADCA 2FPLA 1ZUNB 3SYLA 1LFDB 2W00A 1YRAA 3KX2A 4Z1MD 3VNVA 2IXFA 3VR6A 2ZRKA 2C77A 1JXMA 3W6OA 5FI0B 1G18A 1XF9A 3BBPA 4LZZA 1U8AA 4L9SA 4LJ4A 1M2OB 4UNPA 4FMBB 3F5FA 5H70A 1SULA 4OK3A 5FPSA 1II8A 4RFVA 2J41A 4FWTA 1JXOA 4RCYA 1CJTC 4IVRA 2IYRA 2ZRJA 4GI7A 1GNQA 3TQCA 5K8IA 3TSZA 3ASYA 1IM2A 2ZI9A 3FB4A 3MWKA 3T61A 3U61B 1W48A 5EZ6B 1G6HA 2BCJQ 4B76A 2RH5A 4URXR 4PAMA 4MYHA 2GKSA 3SZRA 4RKEA 5FPHA 1IAQA 5DIFA 4GPTA 4D4LA 4FXPA 4QBIA 1CJUC 3FMPB 1R8SA 3MG9A 5AJWA 4JLDA 2ZI5A 1W4RA 1QDEA 3X2SA 3CB4A 2QQEA 4G5QA 2HJGA 5KTYA 2BC9A 4YXWA 3RS4A 3WP1B 1PLLA 4AY2A 1CJVC 1G4UR 1CF4A 3TW8B 4BLSA 4EPRA 1KNQA 1P61B 1G291 1FNMA 5AUQA 1RJ9A 3U2QA 1HYQA 3RYTC 1HT2E 3Q7QA 4UXHA 4M9SA 1SHKA 2JAQA 4DUGA 3CWZA 3Q7PA 4HI0E 3LW7A 1Z2AA 2RGAA 1ZNYA 5KOYA 5B58C 4ZCLA 3AVQA 3B8HA 2A2ZA 3B7GA 3B85A 3AF1A 2V55B 1NN1A 1JALA 5D3MA 4B34A 2DFNA 4CEHB 3KKQA 4RZ3A 1U0HC 1XD2A 4A0HA 1XEXB 4L4UA 2PMKA 6Q21A 5HPYB 1GDDA 4DHEA 4TT3A 3W6NA 4RD4A 2NQ2C 3UATA 4PZYA 2QRNA 1CBUA 1NP6A 1QVAA 3GEEA 3PENA 4TTPA 4OL0A 5B57C 1X1RA 2QP4A 2ZJYA 1CRPA 4DT1A 1VTKA 1KI1A 1N5LA 3A58B 2YOGA 5BW8A 1G17A 2WJIA 2IUSA 2SHKA 3OAAA 2O8DB 4W5HA 3AKYA 1VKJA 2OBNA 1M6NA 1OXUA 4BFWA 4B3FX 1F2TA 2WJGA 5AJVB 3QF4B 4QBHA 4CGZA 3QXHA 1LS6A 5KYKA 2JLWA 1J7KA 2O0JA 1WXQA 4BZQA 4B2LA 4GP7A 2BMEA 1OH7A 1E2EA 4LYAA 4NTZA 2ZR9A 4TTRA 4AKGA 1LNZA 4QNRA 2NO1A 4LBWA 1JPNA 2B7BA 2GEUA 3T1TA 4EPTA 1OIXA 1ZM2A 4LJ5A 4Q48A 1FUUA 4Y0VA 1I4LD 4XJXA 2ZS9A 4BEBA 1Q20A 3QSYA 5C1BA 3EWSA 1N6RA 2Z5FA 2Z4RA 5CIQA 3LQQA 4JT2A 2NZJA 4Q1DA 3DOFA 1M7GA 1U0JA 4OQXA 5BN5A 5J4LA 1JQJC 1P9NA 2NGRA 1FP7A 2WMOB 3L2OB 2IXEA 5KDLA 1NVWQ 2XJ9A 1G7CA 3BOSA 5DGXA 2ECKA 1E2MA 2YWEA 2C2HA 1E0SA 2IYYA 5CLQA 2VLIA 4D81A 1AS2A 3E1SA 3EPKA 2ZSDA 4KHZA 1ZINA 3B2EA 1KI3A 3O8BA 1CIPA 2MSEB 1U2RA 2VTKA 2BOVA 1VG0B 4KYIB 3THXA 4B73A 2ORIA 2QGZA 5KNBA 2XSZA 3CF0A 4HUQA 4HZUA 5J4YA 2G6BA 2IC5A 3QXCA 3KJHA 1EFRA 1T3SA 5FBWB 1AZTA 4JLPA 2W6IA 4IHQA 4V02A 1E1QD 2KWIA 3KUCA 1MH1A 4HAZA 4FD2A 4IDQA 2GAAA 4JVLA 5J4KA 4DB4A 2V1UA 1BMFA 4A1FA 2HYIC 3RDPA 1Z0KA 1IONA 1V5WA 1IN4A 2E1RA 1NY6A 2CHGA 5LPNA 4BFUA 4RSGA 2EVWX 1IN8A 1QHNA 3IO5A 2OHFA 3TLXA 2V7QA 2ZJZA 4CDGA 3WBKA 1D2NA 3BXZA 2W2XA 2HV8A 5JEEA 4M1SA 1JQLB 1G64A 1MR3F 3AGQA 3CH4B 1D6JA 5FI1B 1HQCA 1Z29A 1ETUA 4PC6A 4PTLA 4QGHA 5KSPA 3ZLJA 4EPVA 2X77A 1G8FA 1XU4A 1Q12A 1U99A 1KOFA 2D74A 4DB2A 4P4SB 4A92A 2F3RA 1DAGA 4PHHA 1W46A 4JLAA 1OXSC 2CLSA 4ILEA 2JLZA 1CR4A 2PEYA 3TSOA 1FX0A 3EARA 3V4FA 4CEHA 1XX6A 4A36A 2P6RA 2H1LA 4BASA 5IK2D 5KDOA 2J0SA 5IHPA 3R8CA 5JI3E 4HEJA 1Q21A 1HE1C 1X6VA 3N2EA 4D4KA 2QEQA 2ZROA 2HCBA 3LDAA 1IY2A 2AK3A 2RGGA 1KDTA 1TQDA 4X8LA 1TTTA 1UEJA 4N0EA 4GZMA 2QAJA 1T6NA 2IK8A 3FDIA 2C9OA 5TV2A 4DWJA 1IN6A 4HAWA 5J5CA 4BZPA 3DHWC 4NYJQ 5BN3A 3NBFA 2J0QA 3AKDA 1WE2A 2HUPA 2OSBA 1K6MA 2YOHA 2ZRPA 1E9FA 5CJ2A 2ZXUA 4B32A 3CZQA 4EJSA 1WRBA 2VQSA 1KO4A 2AWNA 1OF1A 1ZD9A 2IEYA 4CT5A 1XTRA 4MGIR 1G3MA 2FEOA 5EE9A 3HJNA 2C78A 1SVLA 5CYOA 2FSHA 3TAUA 3GLGE 3SEAA 3LBNA 3N5CA 5CYPA 1F5NA 3C16C 3W3AA 1VYUA 1CR1A 3AVTA 2DR3A 2IYSA 1G3UA 1S3SA 1S8FA 3RWMB 4M1MA 2MSDB 2V54A 4JZKA 2P0EA 5F9HA 1CP2A 1G4AE 4MKIA 1VHTA 3V00A 2ZRCA 3QKRB 1SXJB 2PLFA 3W5IA 4G5SA 3SFZA 1GL7A 1P7CA 4HDQB 5H68A 1E2JA 1SVWA 2EFCB 4AYTA 1U9IA 4G5RA 3R9XA 2GJ9A 4XD7A 4WVFA 1R5NA 4EFNA 5CLLA 4TMKA 2FF7A 1N0WA 4Q1FA 2FSGA 1YZQA 1E2KA 4FMCF 3CRMA 3PUZA 1Z47A 3W6PA 5KSOA 2PZEA 2C03A 3K1JA 2REXB 2FZLA 3ZJYA 4EFLA 2VRWA 1T3HA 1XD2B 2UZIR 5L3QB 1DG1G 4DSNA 5JHGB 1N5IA 4RZXA 3SI7A 1UF9A 2W58A 1YR8A 2CL6X 2MSCB 4GOJA 1T4GA 3KFXA 3KZ1E 3QPWA 3H86A 3U3KA 2CCJA 1IY1A 1F2UA 1PJRA 2AFHE 5KUTA 2OILA 2HYDA 3CR7A 3CRQA 4D6PA 2EQBA 3ND8A 4H9GA 2BVNA 1R5BA 2HLDA 3B1WA 4DLRA 5H1YA 2GDJA 2PBRA 4HAVA 4U5XA 3VMFA 5FOXA 1Z5ZA 1Y63A 4E22A 2FFHA 4ZKDA 3A1VA 4X8HA 1XTKA 1G3RA 2JLVA 1Q1EA 4TMZA 2WSMA 1KNXA 4GP6A 4Z1MA 4B47A 1COWA 4W7SA 3R8FA 3B78A 5KU1A 1ZC3A 1E3MA 2ATVA 2C96A 2OG2A 4Q1EA 3UIEA 2GEDA 4Q4AB 4AWXA 5IT5A 1W2GA 1E9SA 2ONKA 2IYLD 1H65A 5DHAA 4LJYA 4C2UA 1BO6A 1FTNA 3DM5A 2H7VA 3DZDA 4PO8A 1DTSA 4ZDWA 1YQTA 4Q02A 4NCKA 4Q7LA 1XEWY 2YWFA 1G41A 3MUFA 3QVUA 3ZS8A 1P4SA 1XMVA 5FOWA 1KDPA 1T5LA 3IGFA 1TF7A 1QG4A 2CCGA 3CPHA 2W6ID 1GZSA 2KB0A 3WYAA 4PSAA 2A7QA 3ZH9B 2QY9A 3I4LA 1YZLA 3B1ZA 3PQCA 1EFTA 2QP9X 4HB4A 3REGA 1TQ6A 4R71A 2Z0MA 3G82C 1KO5A 3NBYC 3GPLA 5SZIA 5JCPA 3ZGXA 2RGBA 1L2TA 1XBTA 1N6KA 2E87A 4RD6A 3T15A 3KKOA 2L0XA 3WHKA 4DDWA 4I1OA 1NVVQ 4LHXA 1G19A 3GLIE 2LKCA 2GK7A 4BQSA 1ODFA 2NIPA 1X8LA 3O8CA 2IHBA 4QJ4A 1FPMA 5CM8B 3IUYA 4BFXA 3KDSE 3W8RA 2ZI7A 4JLKA 1JR6A 4RVCA 4R9UC 3DKPA 4TL9A 4GBMA 2JA1A 3I72A 5FFMA 3U7HB 2WJVA 3T35A 2GJSA 2YYZA 1XTJA 1R0YA 3KFVA 4NL4H 5EJEA 4HDOB 1R4AA 3Q9LA 1KO8A 1Z6AA 3OZXA 4O25A 1XPUA 1LS1A 1YR7A 2HF8A 1A2KC 4RJLA 2EYQA 1PLJA 3QEOA 3VQTA 4KU4A 1MABB 2Q3HA 3ZZUA 3B13B 4M1YA 5CIWA 1W0JD 2GILA 3ZVMA 4IRUB 3NC1C 2X8AA 5IRCD 4Z8XA 2W6JA 1YR9A 4FWIB 2I3BA 3NH6A 1K5DA 4II7A 5JMTA 5E3HA 1DAMA 2OCPA 2CE2X 2XB2A 3K0CC 2JATA 3VU9B 2OO7A 3A36A 2K5UA 1L4UA 1OH8A 4B75A 4D4JA 3ZD6A 5JS7A 4M0LA 3IHWA 3RS7A 5LD2B 1E2DA 3F0TA 1KK0A 3NH9A 3UWOA 3BFXA 3EASA 1N0VC 4HSEA 4QM6A 2CK3A 1DS6A 1VCNA 2BKUA 2FNAA 2LWIA 3PIRA 2B7CA 4DLXA 4UNRA 5JRZA 1AJEA 4LC0A 2JASA 2ZIAA 2FGJA 2YZ2A 4C4PA 1ZNZA 3WYGA 3T5GA 1N2CE 2WKQA 2BDTA 1Z8FA 2BHRA 2ODWA 2ZETA 1E4YA 5GVSA 2AX4A 4TMXA 1NLFA 2IYXA 4LWZA 2JJ2A 4C0HA 3U4QB 1ZIPA 1ZIOA 3SU8A 2NZ8A 2QMOA 1WQ1R 1Q44A 4QXAA 2P3SA 3I62A 4IEEA 2FFAA 3LAWA 1NLZA 1DEKA 4A15A 1IY0A 1NJGA 1C1YA 2OFXA 3C5CA 1GRNA 1MO6A 1R0ZA 2CNWA 3CBQA 2XNDA 1P9WA 2O8BA 1LF0A 3FTQA 2F9MA 2QN6A 4URYR 3WY9A 4A2PA 3KQKA 3OIVA 1R5OA 2ZRMA 3OE7A 2XITA 4FCTA 2RGNA 4LK2A 3MJHA 4I99A 2IS2A 8OHMA 2F1JA 3CX6A 2FA9A 1UDXA 4YQFA 5J40A 3C41J 1KJWA 4LGMA 1JAHA 3PUXA 4GMDA 3TSWA 1WB9A 3O47A 4EJSC 1E1QA 3LY5A 4A8JC 2BIFA 3TW4A 3UMSA 1ONBA 3NEJA 1HTWA 1ZYUA 5FBQB 2H57A 3IHLA 3U7FB 3IIJA 3U3OA 1ZC4A 3WP0A 2QG6A 1A4RA 5HE8A 2O8FA 2Q6TA 4IXNA 4V0LA 4WIAA 4HUTA 4EJSB 2ZSBA 4A8JA 4CRWB 1XWIA 3QI2A 4MRRA 1Z0FA 4OKSA 4Q4JB 1AM4D 2IS6A 1JB1A 3OEHA 4XSGA 3SDZA 3CZPA 2DB3A 2FZ4A 1YKSA 4ITRC 3KUDA 4UJ5A 4MA4A 4QHTA 3A8TA 3Q3JB 1XJ0A 1OIVA 2W83A 4CYMA 1W1WA 2R6CA 2X1VA 2OE2A 2OXRA 2ZYWX 3NIBA 2FOLA 2H5EA 4JKIA 4EKDA 1UBFA 4V03A 2OAQ1 5BQ5A 2YWHA 3GLGA 2W2VA 4I1SA 4PHGA 2KSQA 1NVUQ 4OHVA 2JLSA 1D9XA 4F7WA 1KK3A 1R7RA 1EK0A 1NF3A 4A9AA 2ZUBA 4MQBA 2HCJB 4RFSA 3TAHA 3K0EA 2VEDA 2CXXA 1IXRC 4ASUA 1TX4B 2J7PD 4KXFB 1QHSA 3U3JA 1GP2A 2BMJA 2XTZA 1IJFA 1KSHA 2X19A 4HYYA 4A6XA 3I1FA 2A5GA 5G40A 3ZVNA 1NY5A 3CNLA 1X8KA 5HZHA 2EU8A 221PA 3I92A 2V3CC 5GJBA 4XSHA 3M6AA 1SXJA 4A0FA 1CJKC 5LB2A 1DE0A 1Z6YA 3IO3A 4D82A 1ZNXA 4QHYA 1QHHB 2BBOA 1XJCA 4BECA 3R7WA 1G7SA 1DPFA 4B3XA 1T3LA 4GMXA 1KAOA 1NIPA 3EWAA 4DBLC 2OBMA 5CK5A 3EIQA 3PEWA 4IDOA 1YZTA 3UG7A 2QPOA 1G7RA 1G8PA 2BBSA 3DMNA 2CEAA 4KI0A 3LWNA 1KDOA 2ZYVX 2PCLA 2BMFA 4G5GA 4A2WA 3HDTA 3AF0A 1PZNA 4EFMA 5IK2A 1KHTA 2YNMA 1KMQA 4NPHA 4G5OA 1CS4C 3VKHA 4RKFA 1ZD1A 4DLWA 1DELA 2ZSEA 2JLRA 2VA8A 1E1RA 2DWPA 2CBZA 2YHSA 4KFSA 2C95A 2HT6A 4KYUA 4LPKA 2OCBA 4EIWA 3FVQA 5JHHB 1OH6A 2GBLC 2Q3FA 4BLTA 1KJZA 1KI9A 4IOKA 2R6GA 4OQFA 2FDCA 1P2SA 1JR3D 1WDTA 4KV9A 1WP9A 1DVRA 1KTVA 4MRSA 4B3BA 4IOLA 4TLEA 2XEXA 1AQYA 3UWKA 2O8EB 2ZJOA 1KY2A 3EZ7A 1BYUA 1J99A 3T5DA 1P9RA 3W9YA 2B8TA 3IQWA 1EX7A 3KJIA 1XD9A 4DCNA 1XPRA 4ERNA 2O5VA 1T0JB 1J2JA 2YWGA 4NCIA 1ANKA 1VPLA 1MO4A 2Q9CA 4CIDA 1NN0A 3I8XA 4OHYA 1E79D 2FG5A 1ZBDA 3SN6A 2TMKA 3ZQ6A 1EWRA 3ICEA 2B21A 2NO7A 2C99A 5AK0A 5FTKA 3FYHA 3TQFA 3KXKA 5JJKA 4TL6A 2IX3A 3EXAA 1GNRA 4OHWA 4R2IA 5C18A 2RHDA 4TQAA 3EA0A 4PX9A 2WM9B 2YINC 3K0FA 3LNCA 4IVQA 4P31A 1XD8A 5SZHB 4DEXA 1BS1A 1XEWX 2PCJA 4QFMA 2H8KA 3DMDA 1EX6A 2PL3A 3KKMA 1G7TA 1T0HB 3BH7A 4TN1A 1OXVA 4YONB 3TE6A 2VPPA 1XMIA 4RY2A 3U44A 1NMZA 2CJWA 3M0EA 2UVQA 3RC3A 1E2QA 2A9KA 3GFOA 3DL0A 4BPBA 1E9DA 2RB4A 3NDBB 2DFTA 1VG9B 4B6EA 2C5LA 4ARZB 1AGPA 4QNMA 1TL7C 5J4HA 4TL7A 3NG1A 2RHMA 2F6RA 2P5SA 2ZRLA 4LJ8A 1M8PA 1ZNWA 2VH5R 4HZUB 5GJWC 1UBGA 1N0UA 3PG5A 5DYIA 1TUEA 4BRUA 2XZPA 4IW3B 3HU2A 4KODA 3LVQE 1OB5A 3CRW1 5DYGA 4NE2A 4AURA 1DG3A 4OYHA 5DNYB 4DT1B 4L9WA 1EFRD 4UNQA 2IWHA 3U6KA 1N25A 5TB5A 1P6XA 2XTMA 1GKYA 5AJYA 3K9LA 2V9PA 2QP3A 4WOPA 1YHNA 4V0ME 2PJZA 1XZPA 2XGJA 2O8BB 3CW2A 4NKRA 4PSKA 3ZVLA 4YXWD 4QM7A 5FL3A 1SXJC 3SYKA 3RAPR 2ZRFA 2O8FB 1ZCBA 1UAAA 5B2ZA 1OYYA 3NXSA 1TF2A 4BUJA 3SBEA 5LDDC 4ESHA 3T34A 5C4MA 1FOEB 3BWDD 2D7CA 3E70C 1U94A 1DOAA 4JL8A 3BK7A 5C2JB 2J9RA 2VHUA 3SJBA 1E4VA 1KJYA 3GD7A 5AR1A 3D8BA 4C7OA 4DLVA 3VNUA 5L8VA 2GCOA 4PPFA 3TUIC 1VG8A 4LJAA 2FMXA 2ZI6A 3U44B 1OPXA 4OQLA 1FMJA 3OHMA 2PT7A 2QAGC 1HH4A 3SQWA 1EESA 3U60B 3CRRA 5ANRB 4FW9A 1CR2A 1RRGA 3A4MA 1UKYA 1ZD8A 2V6IA 4TTQA 2JDIA 4J0QA 4S35A 1SQ5A 1W47A 4A8JB 4V0KA 5DI9A 4E03A 5AWFC 3WBJA 2OLJA 4PC3A 3BD9A 3B6EA 3EG5A 3GFTA 4TLAA 4QHSA 4B3GA 2QNRA 2FEMA 1FTSA 3QPVA 4CT4B 5EE5B 3LA6A 2WJYA 1Q1BA 4DZZA 2J1LA 3SBDA 1KO7A 2NG1A 4F91B 1AS0A 3L43A 3CM0A 4E07A 5GADl 2D06A 2G77B 2VSOA 1IHUA 1TMKA 1XXHB 3GCGA 1OHHA 2AD5A 2QT1A 4LYJA 4DLZA 2A5FA 2ZRGA 3T1VA 1G3IA 2XNDD 4PFSA 4D4MA 3P26A 3OEEA 4URWR 5L3RA 3QXSA 2IYVA 1ZP6A 2XOKA 3CIOA 1PUIA 1R0XA 4IEIA 3L0PA 3OE7D 2EFDB 4PHTA 4EDHA 1AA9A 1R0WA 1D2EA 1RYHA 4B43A 4KVGA 2OAP1 4UNSA 5TARA 4GSYA 4XWOA 1A5TA 3G0HA 3RS2A 1J8MF 2WPDA 2RGNC 1OLOA 4JL5A 5FUYA 1NL3A 4D25A 3EZ2A 2ZPTX 2J87A 4B2IA 1KSFX 4LV5B 3B1VA 3TK1A 4AKEA 4U02A 1Z6XA 3EC2A 4C3ZA 1WF3A 4B48A 3ZYCA 4TLDA 3WYFA 4KBGA 4BEJA 4Z51A 2ODNA 2GF0A 1G8HA 2GETA 4DLSA 5EP1A 4EUNA 1XPOA 1XMSA 5L3SA 3ADKA 1Z0DA 3I61A 3AUYA 1E2NA 1GUAA 4G0NA 4C30A 2N1BA 1NBMA 2VSXA 4KO8A 4LBVA 4UNNA 1CULC 5HE9A 4YC7A 1HEIA 4MGYR 1YZNA 1T91A 2J0UB 4KVAA 2IXGA 2BCGY 1P60A 1QZXA 5JWRA 4DXAA 2VF8A 1NRJB 1MO3A 3K0CA 4RD2A 4HB0A 1OE0A 4PQFA 4TWZA 5EXXA 1G3QA 3HYTA 4CEIA 4CVNA 4LI0A 4ZV4A 3EIHA 1Z3IX 4BZXA 1D8TA 2ZJ2A 4IDNA 1KSJA 2YC4C 4URZR 2AFIE 3N2IA 4FIDA 3GJ0A 4PZLA 3ZD7A 1XNJA 5E7JA 5KPJA 3GJ5A 3WHLA 3A1UA 1DO0A 4DCSA 3AVVA 2C98A 2RGDA 2X2EA 4GDFA 4RFSB 3DVLA 2ZU0C 5SZJA 3EPLA 1E0AA 1LY1A 5FBRB 4BE7B 5JLJA 3U7EB 1NKSA 4ESVA 2QTVB 4DDTA 2ZRBA 2OCYC 2CHVA 2ZITA 3QQ5A 4B35A 2V4ZA 1COWD 2ZRAA 1IOZA 3R7WB 5EE1A 5J47A 1GIAA 4XVRA 3TRFA 2IA5A 5G53C 1II8B 1S1MA 2DHRA 3CNOA 1KMHB 3KXLA 1BOFA 1M7HA 5JJIA 3THWA 4U7DA 1ESNA 5FR1A 2FGKA 4IXMA 5EXTA 2WWXA 3M1IA 3BFVA 4QBGB 3THWB 3HU3A 2R6FA 3ZS9A 4DC9A 4XVUA 5KDDA 5LB4A 2ERXA 1YZKA 1GM5A 4TMTA 1NG1A 121PA 4L5BA 2ZSAA 1N6LA 4IVPA 1AKYA 2ORWA 4N1AA 2JJ8A 4LV6A 1BMFD 2GZHA 4M2LA 4DJTA 4DLUA 3K9HA 3HR8A 1G16A 1NI3A 2C9YA 3P20A 1OH5A 1OFTA 1P73A 1FQJA 5JWOA 2LKDA 2OT3B 2VF7A 3M4YA 1R10A 3R9WA 4F4CA 1W44A 1UDWA 4C0QC 4OBEA 5AJXA 3EA5A 4NBSA 5DI3B 2A5DA 2QENA 1E94E 2IS1A 1EFCA 4D0NA 1GSIA 2GAOA 2QAGA 3PUYA 2YKGA 4TSFA 3V9PA 3QKSB 3ZVRA 1E2GA 5FL7A 4Q9HA 1TU3A 4DCUA 1A82A 5JSZB 5JECA 5EP2A 2I4IA 5GVRA 3W34A 2ANBA 3EZ6A 3LXRA 2QRZA 3SHFA 5BN4A 4RD3A 5SZKB 4QL3A 2O0HA 3PEUA 5G3YA 4QGGA 2JGNA 5CM9C 3QY0A 5K8LA 1XEFA 3QKSA 1P62B 3CLVA 3GQBA 4BFVA 3QKRA 1N6OA 3MGCA 3VU9A 5KNDA 1FW6A 3K09A 1L7VC 4B33A 2W0SA 2IYUA 2WWGA 2ZJ5A 3GLHE 4HLCA 2NOAA 3SFVA 2F43B 4BGDA 4EPWA 3MD0A 1RIFA 2OM2A 1N6IA 1RW4A 2BEKA 3EZ9A 1PVOA 2ZANA 3QKTA 2WZQA 4KLNA 3FPAA 4QBFA 2GA8A 1Q0UA 3A1WA 2ZUCA 2QTFA 3X1YA 5JWHA 2ZE8A 4ZCIA 2QORA 2R62A 4NYIQ 3VR5A 3ADDA 1US8B 3BGWA 4JLVA 2FX3A 3B1XA 2ZAOA 4EPYA 3PV0A 2KJQA 3FFAA 3OEED 3ETLA 1U0LA 2QE7A 5E4FA 1W5TA 1KAGA 1DAHA 2CCKA 5JI2E 2O8CB 1KIMA 4DVGA 1HA3A 2DYKA 2NPFA 4JJZA 3B82A 3F3YA 4JLNA 1N5KA 1NBMD 1DAIA 2FFBA 3AF2A 3BC1A 3U3RA 1JJVA 2H18A 1W0KD 5B64A 3C8UA 1W36D 1KZGB 4YMWA 4ZI3A 2KBFA 3CONA 2JIZA 1AIPA 1Z0IA 2V1XA 1SKYE 2WOJA 2QT0A 2QSZA 2XNSA 4V0NA 3T1OA 3P4XA 3ASZA 1TADA 2A30A 3LW8A 1P75A 4F93B 3TNFA 5FBVB 2ZUDA 3LVRE 1U8ZA 3B1YA 2G1KA 2AXNA 4WZAE 3SJAA 3GJ3A 2VYFA 1VG1A 2JJ1D 1Z06A 3BIFA 5L3SB 3AVWA 4BFTA 4HAYA 1QF9A 2WIAA 2F7SA 1CRQA 4ZIRA 2IS4A 4I1UA 3HPQA 2Z6VA 1E2PA 1KI2A 1W2HA 2QM7A 4Q66C 2EW1A 2G88A 4HUQB 4LYHA 1ESMA 1XTQA 4GOXA 2AHOA 4F4IA 3U7GA 5H8WA 2WJJA 2QI9C 3IKJA 3X1DA 1QVRA 1Q57A 3AGPA 4M9XA 4MH0R 3K0FB 3FHOA 4ZDIA 4AIIA 1G5RA 3I32A 4S2EA 1BIFA 4C0SA 4Q9LA 1Q1QA 3ADBA 3K70B 1Z0JA 1KMHA 4FINA 3FE2A 1E6CA 1JR3E 2D4HA 4GOKA 3THYA 3I8SA 2GJAA 3I73A 4D2IA 1JEDA 1P5ZB 4JLMA 2ZS7A 4ZKEA 3FKSD 4DEYA 2Q21A 1BYIA 1KSGA 1B23P 1E96A 3KB1A 4HZIA 3WNBA 4HAUA 1FX0B 2EFGA 4Q7KA 1VMAA 4PANA 3NKVA 4ZI2A 2AKAB 2PZGA 5F98A 1QHYA 2AN9A 3AH8A 4R98A 2H16A 4LV8B 1SVSA 1KI6A 3BB4A 3RRNA 5FTJA 3GLHB 3THXB 1CKEA 4MDFA 2QE7D 5GJVC 4AKHA 2I1QA 1GKUB 4TZ6A 4JLJA 3L8YA 1YRBA 3FOZA 4YMTA 1WA5A 4XIGS 4O2LA 3QXXA 3QG5A 5J4VA 3BFKA 5TMPA 4UXJA 3GLFE 2CLCX 4TMWA 2B8WA 2P6UA 3THOA 2ZR7A 3VX3A 4EQ6A 1ZM3A 4PXAA 1XCGB 1II9A 3RC8A 3SE0A 4AK9A 1CTQA 2OFWA 3K9NA 1E32A 4TSFD 4BLPA 1V43A 3FFBA 4MGZR 4OHZA 2REOA 4HLQB 1XJQA 1UBCA 4PAOA 3QPUA 1HT1E 1UKZA 1QBKC 2KE5A 1GITA 4X8MA 4Q4HB 4OJKA 1ZAKA 1F2UB 1ZM9A 4DDVA 3KQUA 2OV2A 1C9KA 4QG7A 3AKCA 1YE8A 3U5ZB 2ZAMA 3LBIA 1TQ4A 3L0OA 3RNLA 1N3BA 2XXAB 1G1MA 1X8JA 4Q4AA 3NTUA 1KKMA 5KPDA 3GLFB 4MKHA 3BRWD 1FP6A 1NIJA 2IF2A 4JYBA 2FN4A 3UMRA 3ZZ0A 4BLQA 2O8DA 5DSZA 2BM0A 2BJVA 3R9IA 4QGFA 4RCZA 2FH5B 1J70A 5DHFA 3D6TB 4RD1A 3VX4A 3KKPA 2DCUA 2O8CA 3SOPA 2NTYC 1DARA 1I4DD 3ZQJA 2A5YB 2XSZD 4Z8YA 1S4QA 2GXUA 3C4JA 1NKTA 3C15C 4D26A 1X86B 4RZUA 4Q7MB 1XTSA 3D31A 3BS4A 3IBYA 2YV5A 2ZVQX 1BKDR 3CNNA 3LX8A 4NMMA 2QPAA 1SGWA 4XVQA 4DLTA 2QM8A 1PV4A 5FBLB 2NPIA 4URUR 2WVJA 2ZJBA 2FWRA 5BXQC 1N6HA 4L15A 2YC2C 1EFUA 1R6BX 4DIEA 1I2DA 1OW3B 1NVVR 3HPRA 3QXJA 2XAUA 1CXZA 1L4YA 4FCWA 2EFEB 1NMXA 2Q9AA 3HU1A 2DWQA 3PCRB 1UPTA 1QRAA 4PQRA 3P32A 3KL4A 2JCSA 3A4NA 5HZKA 5FOVA 3AVYA 3RS0A 5E7IA 4TMVA 5K8TA 5DN6D 2QBYB 1H8HD 3L0SA 3ZIAA 2PX0A 2ZE5A 2HT1A 2WWYA 2QL6A 5FUXA 3FHCB 5FUVA 4B74A 2IWRA 3PUVA 1CR0A 1WBDA 2G1JA 2QAGB 1OT3A 4HLDA 2JIZD 1TQ2A 1OV4A 1Z22A 2Q3MA 3CR8A 2J0VA 4P0TA 2DY1A 4P4UA 1YJ5A 3MWLA 3CH5A 1YZUA 4LJ7A 2ZE6A 5JFGA 4DUGD 1X3SA 1E2HA 1F2TB 1T8TA 2AKYA 2GBLA 1MV5A 5F3WB 2JLUA 4GL2A 1G5TA 1FFHA 4F4JA 4MYUA 3RRZA 1QHGA 2C8VA 2QTHA 4B6FA 3IIKA 3UK6A 1OSNA 1HQYE 3C7KA 1YVDA 821PA 3HP1A 4TL8A 1GVNB 4R2HA 3C5HA 2PZFA 2I1VB 4Q4JA 1MT0A 1E9EA 1VCOA 4IFEA 1US8A 3T06B 2R2AA 4OI1A 2VIIA 5CB8A 5KSYA 4P3YA 1YU9A 3WMGA 1J8YF 1XEXA 2R8RA 2RKOA 2FPKA 2R65A 3MMPA 5JBQA 1AGRA 2OXCA 1JEEA 2WBLC 3DDCA 4ABYA 5EP4A 2GESA 2WKPA 3VR1A 3GJ8A 3TKLA 1MO5A 3H2YA 4P32A 3U4QA 2OCAA 3ZZTA 4M21A 2JLYA 3QBVA 1S9DA 2ZS8A 3OEHD 521PA 3H4MA 5BWMA 2F55A 4K8OA 4O0MA 4DCVA 2VP2A 3N70A 4OJQA 1OXTA 3FWYA 1SZPA 3GP8A 1GRQA 4XOIA 4NYMR 4JJKA 2EWWA 2ZRDA 1GL9B 4GT1A 4KJZA 4TYWA 5HCNA 3THYB 4Q4LA 2GZDA 5D3QA 4MKFA 3EAQA 5DLQC 2WAYA 3W3ZB 2QMHA 4DRZA 4JKYA 1ZRHA 4MYTA 1FUKA 2FE4A 2VHJA 3MWYW 1ZM7A 3PEYA 1Z28A 5F9FA 1UKEA 1DAFA 3VHXA 2G83A 3RSOA 5K8UA 4IOJA 3W5JA 1KY3A 2GCNA 3VKWA 2KBEA 3RS3A 1ZW6A 3Q8XB 4M4SA 3KTAB 3MJRA 4LYFA 1VIAA 5FPTA 4JVMA 5JJLA 2G0TA 2J0UA 5TDHA 1RFLA 3NWJA 1VYVA 3PEVA 4DSTA 2GCPA 1FMLA 1AS3A 1XDBA 1MABA 4C0JA 1GRRA 1OFUX 3SJZA 1D9ZA 3P4YA 4LY6A 3VR4A 4JVSB 3SYNA 2IBMA 2GVDC 1LVGA 2X2FA 4NYJR 2BMDA 4PC1A 2CHQA 3G5UA 4BRWA 5CK4A 2VL7A 2Y8EA 5FOSA 1T9HA 2IL1A 2ZVPX 4JT4A 2FFQA 4W5JA 1FNNA 1IXSB 1KK2A 3EC1A 5CJPA 4Q5IA 3SS8A 4ZCMA 1W7AA 3KTAA 4XWKA 1CU1A 3CX7A 1GNPA 2XZLA 1Q3TA 2IYZA 2PEZA 1XMJA 4YMUA 2QA5A 1AK2A 3IIMA 3OAAD 1CLUA 3DZ8A 5AUNB 5M04A 4UQOA 2BV3A 4DIDA 4C2TA 3QE0A 3UKDA 1P2TA 1J90A 4LJ6A 2V8OA 1D2MA 4KAXA 1PUJA 1ZU5A 3D3QA 4A0GA 1NLYA 3LO5A 3K8YA 2Z43A 1XP8A 4D80A 3BJIC 1H8ED 5IDVA 1VIYA 3GLHA 4XWAA 2R44A 3AEZA 2J5XA 4LRWA 4PPGA 2ONJA 3EZFA 3VAAA 3BERA 4W9MC 5ELXA 2CVHA 2PJRA 3AV0B 2GHIA 2AXPA 4Q03A 2LCFA 2VO1A 1QHXA 4US0R 1RC8A 4WZBE 2CLDX 3SNHA 5DN6A 3WMEA 3QVVA 4FMDF 2CVFA 1M7BA 3FMOB 2WWHA 1E9AA 3CPEA 2J7PA 4ACBA 1JBKA 2PMDA 4G1UC 4UXIA 4YDSA 3AUXA 3QEJA 1A2BA 3H84A 5FPYA 3UANA 1UM8A 2XX3A 1RRFA 3FMFA 4NHOA 4PPQA 4OI4A 2GWHA 2WHXA 3JZMA 4N0DA 2VP4A 3NVAA 4PHFA 3WNDA 1ELOA 4BFYA 3E5HA 1Q3HA 4MRPA 3L0IB 1SVIA 1IBRA 1NSTA 1P3JA 1Z0AA 4NYIR 3TH5A 2MMCA 2RGEA 5LBIA 2WSSD 3RS5A 1W4CA 1ZUIA 1Z08A 2R9VA 4MYCA 2RMKA 1EG7A 1KK1A 4AKIA 3FKSA 1GILA 5HKKD 4LC1A 1MKYA 2FSFA 4K81B 1OXXK 1P2VA 2WICA 4MKGA 1W36C 2OFOA 2CE7A 2QQ0A 2VP0A 3D7MA 4LJ9A 2ANCA 4PO1A 5FOTA 4D0GA 1KI7A 1S2MA 1SKQA 2WV9A 1A1VA 2NO9A 1JAIA 2A3RA 3S1AB 4E5UA 4OQMA 3PR1A 2ORVA 1T8UA 4WA7A 1LB1B 4GRAA 1X1SA 5TXGA 3RRYA 2WAXA 3C14C 3AVPA 3B9PA 3FGNA 1ZM4A 4OK6A 1NBME 4NH0A 3GMTA 5CITA 3DO6A 1EXMA 1G5PA 3BE4A 4KSCA 3KJGA 5EE3A 3QNUA 2AK2A 2D3WA 1G8YA 1XTIA 1UBEA 3IBGA 4XH9B 4IFBA 4US1R 4A2QA 1CEEA 1W49A 3OIUA 1O3YA 3QENA 5EQTA 3KXIA 1DBSA 2CMKA 2QSYA 1H8EA 4GNKA 2WJHA 3HWSA 4CEJB 3BAFA 4WZ6A 2XOKD 3CO5A 2D62A 5A0FA 721PA 4US2R 4NDZA 3CX8A 2G9NA 4Q47A 2GCOB 4KITB 4QC2A 1EGAA 2IYTA 4HATA 5DI3A 3B9QA 4CW7A 3QIAA 1VDZA 4LBZA 4B71A 1VCIA 1W4BA 2MMGA 1W5SA 2BWJA 5G3ZA 2F43A 3MSXA 5FR2A 3LD9A 4Q21A 4KFRA 2ZR0A 3TVDA 3PFIA 4UJ3A 1Z6TA 3REFA 3E2IA 4GZLA
chains in the Genus database with same CATH superfamily
1PGPA 3T9FA 1GLNA 2XDQB 3GPBA 1JZTA 3K0AA 3MLEA 4GX1A 3KYCA 1G9XA 4G9EA 1O97C 4JBXA 4MX8A 3PA8A 1HY3A 3HG7A 4KGVA 3ZYZA 9GPBA 3TNJA 4FONA 4HGPA 4JBIA 3RVJA 2ETXA 5HIAA 1SCJA 4CMHA 1KYYA 4QJ5A 4RD0A 4WGGA 3EX7C 4Z54A 1FFDA 2ZFUA 4QOHA 3M2TA 2H4JA 3VUFA 1KOGA 2GZMA 4DBLE 2OK7A 2WTEA 3O0TA 1ISSA 1NUAA 3QE4A 1WUIS 2VRCA 5TEVA 3RF7A 1UM9A 3DWGA 5H4GA 5JEDA 1JQBA 4AAYA 1EFVB 3AVXA 1TZ2A 2ATIA 5MF6A 2F62A 3IC5A 4LDJA 3D6UA 5HBGA 3DEFA 3KSAC 2G1PA 5LXTB 5LKAA 4K40A 4HL6A 1ULBA 4PTYA 2ZRNA 3C24A 5ICCA 4ZVNA 2FV8A 1OFIA 4MI6A 1D2GA 1OMOA 5EMJA 1JJFA 4TZ0A 5ECDA 3G2HA 2QMQA 3ICCA 1XXHA 2QK4A 3SC3A 5LOVB 1QF6A 3GFQA 3T3EA 2NACA 3K6KA 4DQXA 2ZRIA 1FFCA 5L3QA 1A8QA 4ND4A 1SUBA 3U7IA 4KPFC 4UPDA 1AQJA 3P0HA 1YBHA 3HDJA 1QFZA 4FILA 4BB0A 4JNCA 1BQ4A 4Q19A 1ZSYA 1RHQA 2GZ3A 1F06A 4KTTE 4FDUA 1OX6A 4OHMA 3P2IA 3DTVB 5A6VA 1DIRA 1CJCA 2Z57A 1JJIA 1VLLA 4B7ZA 1Z83A 2PUDA 1KZ1A 1I6LA 2O0MA 2A5JA 3A9RA 3FOBA 3QFTA 4CLDA 1E92A 1WY5A 3WK8A 2YNMC 3DFKA 2VUIB 3PFWO 3H8SA 3WYBA 1CZOA 3MBOA 4GMGA 1YR2A 2E9SA 3NHBA 2VQEB 3BB3A 5IJ0B 1C9JA 2CB0A 4MA0A 1F3OA 3LLUA 5SV2A 3GJXC 3WRYA 5AVJA 1KVRA 3CWQA 3IE0A 1PX2A 4HXEB 5C5DA 1Y4SA 1RRKA 3UWPA 1TUBA 3DFIA 1HZZA 4OQNA 3P45A 2HL6A 1HOXA 1K66A 3FDXA 2NU8B 2HSJA 3BFPA 3IPAA 1TCVA 4F92B 1P4HA 2YN4A 2WKRA 3ELBA 2VDQB 1WABA 1XXHE 3ZJUA 2Q0SA 3BXGA 1KVUA 4KLAA 1QNFA 3SQOA 4MITA 3SHWA 4OB6A 5F2EA 5ENZA 1W36B 2HNBA 3Q3HA 3CHYA 4NBUA 1OILA 1X1AA 4O8ZA 4C4TA 2C04A 5JZVA 2IF0A 1BN6A 2Y1DA 1GRVA 1YZGA 1ZRNA 5HR5A 3U3MA 4A6PA 3K5PA 1PJZA 3IDQA 1RP7A 3NHMA 3PC3A 4P3KA 4PPNA 1LK5A 2JI9A 1R8JA 4TUYF 1RKVA 1RWVA 1LQ2A 2VS1A 3L0BA 3PQEA 4JLBA 2P91A 2V7QD 4Q37A 4ZPXA 4AFNA 3K6SA 2ZRHA 5IKEA 1NQUA 3QIVA 4NNOA 4PYQA 1QTRA 2B4TO 2Z5GA 1ZGBA 5DFAA 1KQGA 3EDRA 1FSPA 3WKAA 1TNDA 1UQUA 4H7HA 4JI2B 1M34E 2LUOA 1HE8B 1JI3A 2HBQA 1KWKA 1L7RA 2PPLA 4HAXA 4K2AA 3QOFA 4G9GA 2IKQA 2GK6A 3NEPX 4ON9A 4NZZA 4ARZA 5DH9A 4AYWA 4BFZA 4B9EA 4C6RA 2GF9A 3R5JA 3BTOA 4L57A 3WDSA 3WRYC 3WLMA 1T13A 1Z0ZA 4F72A 1JE1A 7ABPA 5L53A 4ESEA 4NP6A 4JELA 1W88A 1GPUA 1M0TA 2PT5A 2NNLD 2WWWA 5CJJA 2XD9A 5JRJA 6YASA 2WHRA 4YR7A 3DF9A 3GMSA 4LXTA 1J07A 1PE0A 2ZBRA 3PE4A 2PX3A 4FCVA 4DMKA 1N2OA 5BW6B 2IQIA 3D8NA 3GP3A 4AG5A 3WLLA 2JVKA 5KOJB 2TRSB 2ZIWB 3CA8A 4RMGA 1LDYA 5HA5A 1OLSA 1VECA 2QRVA 1SU4A 3RUEA 1WIWA 3BEDA 4P2BA 3STWA 4CKCB 3K72B 3OO0A 4DDUA 1A27A 4ZYZA 1Y5NA 1E0KA 2CL7X 1RKBA 3MFYA 1TF5A 2F3SA 3JW8A 4ICIA 4FE3A 4CFZA 1V71A 1R37A 2ZJ8A 3GJ4A 3L7JA 1R6AA 3OBBA 4BVFA 3HY6A 3GEHA 3RO7A 3RVQA 2BBTA 5BYKA 3HSYA 2C2WA 2C9ZA 1DOZA 1NN5A 4FBLA 3FYSA 2OEPA 4OQYA 4MPDA 2XXAA 2HWYA 1CB0A 1FS5A 2Q3JA 3MT7A 4W5WA 4XW2A 1N1GA 1DXQA 1KZ7B 3HCOA 4Q1BA 3RBZA 3QJYA 4DSOA 2X1HA 2DUNA 1DV2A 1KYIA 2DX7A 4GIBA 2ZUVA 3D6AA 3T52A 4AZ3A 1QPGA 1BN7A 1X7YB 2OCIA 2OM6A 4GP9A 4YJ3F 1UK9A 2BFFA 2Q2VA 2VATA 4GGOA 3A06A 4PGMA 4EAQA 2X9LA 1RC0A 4B81A 1A4UA 2GBGA 3OU7A 4XD2A 4BV3A 5AESA 4Y0AA 3PQ3A 1EFPB 3LH5A 3O73A 3GHYA 1ORHA 3QK7A 1EU1A 4GZ5A 4HHEA 3CW8X 4NESA 1E0DA 2H7XA 4FMDB 4PG6A 3PITA 2VBCA 1T9DA 4B3CA 1MRNA 2R5FA 1PHRA 3RKUA 3UFXA 2C2BA 4A0RA 4BMDA 4WOBA 4EVSA 3W7AA 2XCTB 2VJAA 4IX9A 4TYYA 1XB2A 3TLGA 4LA4A 1WCXA 3QUCA 5TT1A 1EUCA 3Q5DA 3MJFA 3VOSA 5I7RA 5TQ2B 4ND7A 3UB3A 1TAGA 2N3ZA 1P5JA 3SICE 4JGGA 5DT2A 4AZWA 1NBWB 2GAFA 2WU8A 3KSZO 3VR3A 1YHZA 4IQ8A 4UCXA 5JD4A 3BCRA 1E1KA 2A3NA 1Z07A 2OAEA 5LA6B 3UOGA 3TXYA 4ZHSA 1IEQA 5CXSA 4OHXA 1OC4A 3O7MA 4E1VA 5L95A 1SIUA 4IF6A 1KDRA 5KNLA 2OXFA 3EFBA 2WJ4A 3QKUA 4J2TA 1ES9A 2G4CA 3S2FA 4XX1A 1Y3AA 3SLGA 4AY4A 1AN0A 1R2QA 3AW9A 3DE1X 3MGGA 3GFPA 2PUBA 2WINI 5FTLA 2YMPA 5P8WA 4BV2A 1RYFA 4E09A 1WEHA 1O9GA 2XGMA 1KS9A 4DAEA 5A4JA 1KH2A 3B1JA 1V39A 4QWMA 1FPQA 1JLSA 4LOLA 3SC2B 3I9LA 2Y4OA 3ZHQA 1EXDA 3NC4A 4KQXA 3WR5A 2DLDA 4ARIA 1HDIA 5ENDA 1LGYA 4E4TA 2ZKIA 1S0UA 2VFAA 3VC7A 3CB2A 3N28A 3RLFA 4F5WA 3RUHA 3OPYA 2QYOA 1NVFA 3KLOA 4H1UA 2IUTA 5P21A 3ZE2B 2XUKA 4G67A 1FYFA 3OUZA 1G6Q1 2QGNA 5ALSA 5M5BA 1V26A 2P9YA 2HQOA 1B73A 3VR2A 4BQOA 2W2KA 1II0A 3BWEA 3NVDA 1GARA 1TUBB 2D1SA 3NC0C 2WF7A 2XWQA 4BQQA 4FEEA 3MHTA 4J4BA 3JYLA 1F48A 4DNFA 3NPAA 3LYHA 1MNAA 1XV5A 4M8LA 5CD1A 4P86A 4DMCA 5BRNA 2PD6A 4JI4B 4HT3B 1TA0A 3IBSA 5DYYA 4BNJA 3CLSD 4MMZB 3MTBA 4H18A 1VGRA 3ENWA 5E3IA 2WZDA 1NBAA 1WHSB 2VOJA 3R0VA 2FEWB 2RH9B 3TZEA 2YV3A 4N5MA 4XWTA 5DBGA 4G89A 3OP1A 5BWNA 3OIFA 4HXFB 4TYPA 3LXXA 1IHXA 4QNNA 3U17A 4JK3A 3MM4A 1PVVA 1U5AA 3QW2A 4TROA 3VHQA 4EJ0A 3QPDA 1YMQA 2WYOA 3F8WA 2FJUA 2DRIA 4WAUA 4IHJF 4POAA 4RY9A 4I2NA 5L6LB 4G85A 2WHYA 2I71A 2J9FA 3DMTA 2ECOA 4AT1A 1IN5A 2EV9A 1CRWG 3DBIA 3PYLA 4FT4A 1A9SA 4IIGA 4M1TA 3HA2A 3PYXA 5G41A 2JIMA 4QYSA 2NTNA 2NZ2A 4WINA 3LX5A 4LNUA 3PNVA 1VIMA 3ZV6A 3TOVA 4AO7A 1KZYC 4K9NA 3FYTA 3Q40A 3VR0A 5IF9A 3FCUB 3BMNB 1NVBA 1YXMA 3G9UA 1N2EA 2XNKA 4G01B 4MQUA 2CUKA 1C3EA 3HBMA 4URFA 2RHHA 8ATCA 4TMYA 5G0TA 1DEHA 3UJ6A 2VT2A 4Z49A 1EX1A 4PRYA 3VTKA 2HNKA 1RM5A 4U7TB 2OYRA 4CMGA 1PLKA 3E3NA 2H9IA 4GMFA 4FHDA 2P9QA 4WW0A 1OFGA 3V7YA 5JCOA 3HGMA 3KSDO 2PUEA 4ZXPA 3WRWA 5C51B 3NHAA 1UOPA 2JBWA 4I4NA 2HFKA 1O7JA 3T95A 5KYXB 1KRWA 1AZSC 4NLLA 4E51A 3GEIA 2LVBA 1F6BA 4P5DA 1G59A 3FHTA 1VYTA 1W59A 3KCQA 4LXQA 1P74A 2GAJA 4JSRA 5J9FA 3OSUA 3SJ7A 4I1VA 3WGMA 3I23A 4YRTA 5H5JA 1JSCA 1TEXA 3MW8A 3T0FA 1X1TA 4FYWA 5TT0A 5JBNA 4MOWA 3IEIA 5TMEA 4BVKA 3EVAA 1NAHA 5JATA 1H23A 1VLJA 1QTQA 2CDAA 3V8QA 2AZXA 1BH2A 1N2CB 4V0MA 4K6FA 3K71B 4BLOA 4K03A 1K08A 1QKIA 2HF9A 5GWXA 4KQGA 1GOTA 1U7ZA 3L6CA 5FD8A 1ZOSA 3DNMA 3ESYA 3NBUA 4ZHQA 3NAZA 2CSUA 1ZU4A 2P6NA 2H51A 2O0KA 5EXPA 1MOPA 4XLTA 4EHAA 3EGCA 1TGVA 3W1VA 2ZI3A 5L3VA 5TY0A 4LJSA 1KKLA 1EUDA 2PUJA 4AUNA 3LBHA 5C8VA 2Y6UA 1CZKA 1VKOA 3EPJA 4JXJA 1K8XB 1HDEA 1V9LA 1NE2A 3CIFA 3GMDA 2DCMA 2BKEA 4Y7DA 4ZO4A 5ESWA 3HACA 3TKYA 3IOEA 3ZDXB 2JJ2D 4WDRA 4LBYA 5EE0A 2V6JA 3D3WB 2WJ3A 2X2PA 3W2GA 4FSDA 5FTMA 5AI9A 4A10A 4WK4B 2MU1A 1N6PA 1GZ7A 2I67A 4G8JA 4TLBA 4X45A 4M60A 5HILA 5C8XA 3FCYA 3KM0A 4KYTA 2GJKA 1HL7A 1MRSA 1QYWA 2F1KA 4OI2A 4V3BA 4X0EA 4GRDA 4EA9A 3IV7A 3FUUA 5J5AA 1AQUA 2HMAA 1UEIA 1ZVQA 1ZWKA 1X1BA 3RJZA 3LKDA 4PQYA 2Q4DA 3AFGA 3RAJA 4RBNA 2HM7A 3E58A 4K9QA 5FIUA 3SHVA 5K3AA 3H9JA 1SRRA 5FNVA 2R6DA 2QRUA 3I0ZA 3UG6A 4WY8A 3CZ5A 5K8CA 3FBGA 2ZATA 4RA6A 3KPYA 4Q9DA 1VHWA 3KJNA 1O8CA 4EKEA 3ZIAD 5TVGA 2I2FA 4XGIA 4H08A 4NCJA 1Z74A 1BXGA 1NF2A 2PE5A 2IHYA 2XRZA 4JLOA 3ZE8A 3QF4A 2WU3A 3R20A 1VI5A 4LHVA 1IJEA 1T8YA 3I53A 3RKRA 1PZMA 1EP3B 2QD1A 3SVLA 2IYQA 1FNBA 3QITA 1EKXA 1V41E 3A28A 3GLIB 2XH8A 3H2JA 4NCNA 2WMNB 4JEIA 3KZOA 4HG2A 4JJEA 5DYTA 1WSDA 2RHGB 1GNLA 1X38A 2G80A 1CYDA 1FLNA 1SQ6A 2Y0EA 3MS7A 4GC9A 4GOOD 1KXJA 3W2EA 3DLAA 3QBTA 4QPDA 3SHOA 4MZXA 1ECJA 3C3BA 3HJCA 3IVMA 1ESCA 5KU1A 2FFRA 2JFHA 4HDMB 3SLKA 3ZXIA 5JZSA 3H1TA 4GFDA 2VF2A 1NF8A 3B6KA 4KMSA 4MS3A 4LHWA 4XD7D 1DQPA 3FNRA 3HL4A 1TZCA 4I5EA 3OOHA 1Q22A 4IHAA 2OUIA 5ALTA 4NICA 1JSRA 3K5HA 1FRNA 3CPJB 3EDCA 4WJLA 1TAUA 2XVAA 4H1WA 4PIPA 3GBPA 1ULUA 3A2NA 3UCXA 1P39A 4R5HA 3MUEA 3G7UA 4D9JA 1E1RD 4Q01A 1P29A 2BFOA 4ADSG 4D0LB 3HYRA 4ZJYA 1UXKA 4RK1A 3D59A 3AI2A 2NSJA 3SXJA 1KJIA 1UJ6A 2WE7A 4QBKA 3U49A 5FB3A 3H0KA 5EPEA 1OWLA 4F7DA 1Y80A 1NW3A 3TQRA 3AEUB 3KVRA 1P5HA 3LUKA 1SVMA 1CIJA 2ERYA 2H17A 5EXSA 4HDCA 4MUEA 5GJCA 4Y67A 1G2IA 1NVXQ 3JWGA 3K70D 1I4TD 2ZCUA 1S3IA 5ELLA 4YY3B 2OXIA 2AW3A 2NXCA 3GG9A 5JPCA 2VSFA 1C9YA 1UFVA 4TV9B 3T7JA 4C1NA 5HZMA 2AMLA 3U31A 4KZKA 3PXAA 1QGUB 2QUZA 3S81A 3T6KA 1P17A 1V3VA 1I4OA 2IE8A 4QAQA 3SYLA 4JITA 2IHJA 2R7MA 1YRAA 2ZULA 3FR8A 2QQGA 2ZRQA 2JC3A 3E9CA 2IXFA 3GYBA 3G2KA 4NOJA 3S2UA 1DWUA 3SEQA 2GCGA 1PFGA 2C77A 3OY7A 1K8ZB 4WKGA 1XF9A 1ULAA 1NQVA 1YE3A 2NTEA 3OQ1A 5BSGA 2FQYA 4IIUA 1FJHA 1N9KA 2AN4A 4LRQA 2HRDA 1P4JA 3F5FA 3UAYA 4UVHA 2H52A 4V38A 1MAWA 5ADHA 3ZBTA 4DQDA 5AVUA 4W5TA 2J9YB 1CJTC 5E6UB 3TQCA 1GNQA 3FJOA 2JFZA 3S2EA 5BMOA 3NAGA 4UBKA 3ASYA 3CG4A 3E1KA 3FB4A 4NU6A 4FBGA 4M83A 1HKHA 2KQUA 1G6HA 4B3IA 2ADFA 2K7FA 1H2FA 2XWJI 4TXJA 1IAQA 2A9PA 3AJDA 3NBMA 4Z0HO 3EE6A 1V8FA 3E7WA 1R8SA 1D4OA 4JLDA 2XZOA 2WK1A 2QQEA 4G5QA 4MXDA 4E4YA 3FPJA 3D2BA 3T5MA 1YB7A 4EENA 3KWLA 5A1JA 3EBOA 3KIPA 4LVNA 5EYPB 5DHQA 4EYEA 4Y9TA 3RROA 4AY3A 2FZVA 2FZ5A 3DV0A 2A58A 4NS4A 2UDPA 4BTLA 1RJFA 1AK9A 5HF9A 1LJ8A 2GOYA 3T9DA 2WU1A 5AUQA 1Q92A 5KJEA 3U2QA 4ALLA 1AQ6A 1DXYA 3KJQA 1HYQA 4QUJA 4RGBA 1HT2E 1VC2A 2B3DA 4S1VA 3ZE0B 1NNLA 4UXHA 1Y3DE 1SHKA 2JAQA 2LIPA 1IATA 4Q3CA 3CWZA 2PVPA 4DCJA 5CFQA 3DZIA 4HI0E 1X2BA 3IP7A 4RAOA 4RTNA 2XLCA 5BOSB 1VLQA 3K2IA 4YT5A 5KOYA 1D7OA 3A6FA 4KRYA 2JGFA 3DXZA 3KU4A 3E5RA 3B8HA 3M4ZA 4YAGA 2DERA 1A9QA 2A2ZA 3B85A 4CLRA 3NTXA 3UY4A 2FPGB 4MAMA 3VR6H 1HETA 4CEHB 1V5EA 4MQMA 4RZ3A 3EOBI 1RPNA 3FDZB 2MYNA 2GCIA 1U0HC 1M10A 1XEXB 2P1RA 1Z34A 2I7TA 2X7JA 4A0QA 1S2NA 5FV4A 1B7GO 2UVPB 1YZVA 3HHEA 5ALLA 1A3CA 1G5FA 3MELA 4D9CA 4L72A 2NQ2C 4R2JA 3EVGA 3QVSA 4PZYA 2IZ6A 1SBYA 2QRNA 1CBUA 4H77A 1JHVA 1XCBA 2KLBA 5T64A 2QVCA 2EATA 5E4TA 2NP6A 1UPUA 2QP4A 1N7GA 1YHYA 2BZGA 2BRUA 2ZJYA 1MXHA 1KI1A 3RODA 3IDZA 4DT1A 4EF6A 4F0JA 2F4NA 5AW3A 2YOGA 4FFMA 3CLKA 3EEBA 3T4PA 2ARKA 2WJIA 3KPUA 4L27A 2PSEA 3DB1A 1TJNA 3OAAA 4FGZA 4HWRA 2O8DB 4WN3A 1XKTA 1AZWA 1VKJA 3K4QA 2OBNA 1M6NA 4C2BA 3WISA 5IEJA 5CXUA 4BMNA 1SM4A 2QQFA 4JKOA 5EWLB 3G0GA 3QF4B 2O9JA 1YZ3A 1EA7A 3BGOS 3QXHA 5KWSA 1ECLA 1J7KA 2VTDA 3O0DA 3RCBA 4BZQA 4I9HA 3I1JA 3QSGA 4GP7A 3WGVA 5C1OA 1OH7A 3N2KB 2ZR9A 2MSLA 3TR6A 2HCFA 5DYWA 4F86A 1SIOA 3K35A 2MR5A 2ZBFA 4H31A 2XUIA 3QVWA 3WLNA 3ZJ5A 1K98A 1KVQA 1J2UA 2I4OA 1RQRA 4Q48A 5CLJA 2P9BA 2IEBA 4Y0VA 1TK2A 1MIHA 1FVFA 3MC1A 4HYQA 1QV9A 2ZS9A 3UJAA 4A91A 4Z7OB 4DR5B 3UMGA 3ZHZA 1SOAA 5CIQA 3LQQA 4JT2A 1BQ3A 4NWIA 3WIVA 1SO8A 2CXUA 4PM4A 3OU6A 3UJCA 3DOFA 5BN5A 3PXDA 2QTNA 1F4LA 1W29A 1QG0A 4KPUA 4TVSA 2NGRA 2R97A 2WMOB 4PG5A 1SA0A 3L2OB 3V3KA 2JHFA 2ZIGA 1A97A 2EC5A 3GNSA 2AEJA 4L4XA 3GEPA 3OWXA 3A1DA 5B1EA 1LJLA 1I6WA 2HRZA 3GLKA 5KDLA 2XJ9A 1N77A 1AB5A 3T3IA 1GFZA 3LOPA 4FUQA 5DGXA 1ZXXA 2C2HA 2IYYA 5EJAA 2DBRA 3W6ZA 4ZT4A 1E7YA 2HQSA 3PSAA 3N76A 3E1SA 5LR6A 4P4GA 2ZSDA 3SJUA 4C22A 3EPKA 1O94A 3B2EA 4NSNA 5LA6A 4X94A 1VG0B 5K03A 3MGBA 3NU1A 5GAJA 1C81A 3WC4A 4MV7A 2GX6A 2IC5A 4BNWA 4DSZA 1LLDA 1J20A 2W4MA 5JVDF 3KJHA 4O1MA 3FHJA 1IBSA 2FOIA 3WMXA 1DC6A 4NIMA 4QQKA 2I9KA 5BUZA 3MAJA 5BSEA 4MWBA 2NUAB 1MH1A 4FD2A 1EBFA 4B4KA 4QLOA 2FW6A 3K2BA 4YAIA 4DB4A 2V1UA 3RDPA 1P80A 1IONA 1DUSA 1V5WA 2TYSB 3SNKA 3WK4A 1NY6A 1YFZA 1QCCA 2HK9A 2OGZA 3WLIA 5LPNA 2DR0A 5K0ZA 2ZXEA 5IMBA 3E84A 1TA9A 2NV0A 3BG5A 1IZYA 2EHDA 3H7IA 4OIFA 1X19A 2V7QA 2ZJZA 3TFOA 1OI7A 2XTAA 5JTUA 2SKDA 3BXZA 2JW5A 1H42A 2PGNA 3ESBA 4LQLA 4MV3A 4Y2PA 4KR9A 5AP9A 2UXDB 3Q2KA 3EQ9A 3CH4B 1X80B 1F8GA 1HQCA 2VJPA 2M6SA 1ZQ9A 1WCIB 4PTLA 5KSPA 4EL0A 5DHPA 4O4IB 3DV2A 4EBFA 1GSAA 4N01A 3WLOA 4MWGA 2WDPA 2V7UA 2Q0XA 1L4EA 3CLSC 4P4SB 3JZFA 3SS7X 5AW5A 1QRSA 3QV1A 4XM2A 3GH3A 4XYBA 1DAGA 5BV7A 3EXEB 3YASA 5IYZA 2Q9UA 2XV1A 2E0IA 4EB3A 2JFBA 1OXSC 4YVFA 4LDNA 3M6VA 1HFEL 2AEMA 2PEYA 1SCBA 2QMYA 3IR5A 3QFRA 4IQ4A 4U6NA 1WD7A 1UBJS 4A5SA 4QG3A 1N9GA 1XX6A 3TQQA 4Z3KA 2RD2A 3WOHA 2WQZA 2J0SA 4RF2A 5BMVB 1SUPA 3MPOA 5LXTA 3FNFA 3HLKA 3ABSB 3FWZA 3L9WA 3O1JC 1UWVA 4H3KB 1YB1A 1Q15A 1IY2A 1L5VA 8LDHA 3QBJA 1KZ6A 2JAWA 1V9SA 1UEJA 1R3UA 2EJUA 1H4QA 1ZJ4A 2XLBA 1G8AA 1JYSA 4H1TA 4Z7QB 2IK8A 1EWTA 2NSYA 3FNEA 4ID3A 4ZVPA 3RSCA 2WD7B 5EIWA 1IZ0A 2R96A 4H2DA 5TV2A 4HEA6 4DWJA 1IN6A 4HAWA 4ZEMA 4JN6B 3BZWA 4ARBA 4BZPA 2EXXA 1WW8A 1G4HA 2H00A 1WE2A 3AKDA 3LHFA 1K6MA 4TKUB 5FORA 1Z5PA 1O1YA 4HX2A 1OYVA 1LCIA 4JGIA 3VR5D 2A9QA 3ORFA 3CZQA 4Y2JA 5I7AA 4B32A 3GL9A 4NDAA 2QXUA 4KR0A 1WRBA 3DE4X 5LQDA 2XGSA 1OF1A 1QV7A 1V2GA 3D6FA 3EVZA 1R8XA 4MGIR 1NVAA 2FEOA 5EE9A 1B8PA 2I8AA 4F6RA 5B2FA 3WNQA 2FSHA 3K0BA 4OEHA 3NMUF 2IODA 5FT9A 4PYKA 2BSXA 3LBNA 1QB7A 4RVSA 3ZDBA 4D56A 2EFYA 1F5NA 1V2HE 3WSTA 3T9CA 1WZCA 2IYSA 1G3UA 1L1QA 1VPVA 5EJIA 1YVRA 4PG4A 4NOLA 4C0AC 4JZKA 2P0EA 4XYEA 3NFYA 1FF9A 5K6AA 1V47A 9MHTA 4AZ3B 4DBZA 1VHTA 3A9TA 5K45A 4R8SA 2FWJA 3LU1A 3QKRB 3V00A 3V7WA 1UCFA 2IU6A 1VJTA 1IDN1 1PW7A 1PO7A 4ZYLA 3AIMA 1HLPA 4O8CA 1EJ2A 2HHJA 1V3UA 2Q5HA 1U9IA 3R1IA 1L5RA 3CUYA 4JJ6A 2UVDA 3QP9A 4Y9UA 3DLCA 3UV3A 2B4QA 4YMHA 5KQRA 4J1TC 3GCWA 4PZEA 2AB0A 5IX8A 4WVFA 1PNRA 1BTOA 4HS9A 4AMYA 4PCUA 3PI7A 3SXPA 3W3AH 1PKEA 4Q1FA 1E2KA 3PLAE 3CRMA 2JKZA 4BNLA 2GEFA 2PZEA 4G8DA 3BQNB 2GA9A 2REXB 3TTYA 2Q27A 3QA9A 2RONA 1T3HA 1B6RA 4WMLA 5IAAA 3PYMA 2Z2YA 1HE5A 3OZ7A 3DV9A 2P9HA 5JDCC 1XSEA 1WSWA 3ZQ4A 4GOJA 5C8YB 3QPWA 2CCJA 1XQ6A 1B8OA 4CM8A 4TX1A 4FNAA 3IV6A 4GPD1 3L8FA 1ZCJA 1RP1A 2OILA 1RE1A 4D4HA 1E1CA 3ISVA 2EQBA 3OM1A 3QY9A 3DAHA 1R5BA 2B9EA 1YKFA 3VMFA 3DQPA 3T1NA 4OM7A 3VSAA 1VKRA 4RH3A 1DAPA 2YS7A 4BNZA 3L7BA 1ZK2A 3KJZA 1L5WA 3KNZA 3AUUA 2PSJA 3FM9A 1XTKA 1NQOA 1MAUA 1E3TA 3SVTA 2B83A 1KNXA 2KLHA 4UMFA 4QFCA 4B47A 1COWA 3R8FA 3FRHA 1J0AA 5ALVA 3OZUA 2MYPA 5CCEA 3JASB 1E3MA 1UC4B 2M6LA 3M7IA 1SUCA 4F3NA 3MQFA 1E1DA 1GUYA 2PUTA 4JI8B 3LYLA 3DAYA 2OBBA 4HH3C 4AWXA 1RWQA 4YP5A 4P3PA 3T3OA 1E9SA 2L19A 1G0NA 4AS3A 1H65A 1L5GB 4EHBA 5KJFA 4BQIA 1USKA 1WZ2A 4C2UA 1Q11A 3DM5A 3N3AC 1T0UA 4MW6A 5LDHA 1DTSA 5KC9A 3DDOA 5CDGA 4ZDWA 4NCKA 1F6WA 3GPCA 4FR2A 3P71T 3B52X 4E30A 1OXKB 2A84A 2YWDA 1DOHA 3PGXA 3NOVA 3BWVA 1NQ5A 4O4LB 2AQIA 2WYIA 2Z95A 3S8YA 3F6RA 3DAOA 4CQMD 3I4LA 1VDMA 5ECYA 1J6UA 2EP8A 4DLLA 2KMLA 1TQ6A 2Z8YM 3G82C 2R84A 3JQ9A 2XUJA 3ZGXA 1XBTA 2E87A 1N6KA 3T15A 3OMWA 2ON6A 5TQ0A 3OJLA 1ZK1A 1M8JA 4DDWA 3WHKA 5KYTA 4WUTA 5LQRA 2X14A 3H8JA 4LHXA 3EOAI 1F1BA 2LKCA 3GFGA 3WO0A 4DR6B 3L0ZA 2BUCA 2JI7A 2VLBA 1FPMA 4MJ7A 5H7XA 2O3UA 3DMRA 3IUYA 1ZONA 4BZWA 4L78A 2ZI7A 4HSGA 1JR6A 1N75A 2KM1A 1EI9A 3DKPA 1W4LA 3FMGA 4UU1A 5CFOA 4PZCA 4ECAA 3W7BA 1L7MA 1ZDMA 4MI3A 3K05A 1CP3A 1EK1A 1R0YA 1XTJA 2YYZA 2QG4A 3KFVA 1UFRA 3NRCA 4NL4H 4DLSA 5KREA 1MH9A 2H4FA 2ZIUB 4O25A 3A2KA 3QVJA 1YR7A 3CLRC 4ZT2A 3BQMB 1A2KC 1JKJB 3PDIB 1KORA 2EYQA 1XMOB 3MMXA 4QXRA 4UM9B 1MABB 5FWDA 3NEAA 1DNPA 3O2NA 4PVCA 2M98A 2P8JA 4QTZA 4ZP1A 3V9AA 3P2OA 2XEDA 5BN1A 3Q3CA 2X8AA 4Z8XA 5HHTA 4K3UA 2W6OA 2WV7A 2XVXA 5FDFA 4II7A 1K5DA 3DTTA 4P7JA 1U0OC 1L4HA 2OCPA 2CE2X 4IZIA 4BFLA 4JC4A 4KPEC 2QZSA 4HY3A 1KMCA 4DE5A 2VUUA 4ZZ2A 2YJNA 4D4JA 1T8SA 1A2QA 5IP5A 1ZVVA 4IWYA 5LD2B 1EJ0A 4MB2A 3EGOA 3KXPA 4A7PA 4QD3A 4PNZA 4B6QA 5IBPA 3RF6A 1RR6A 1Y33E 1F38A 4GXRA 4EG5A 2H1SA 4V0SA 3S8EA 2I34A 3U16A 1O2DA 2BKUA 4DLXA 4FQ7A 3W05A 1IC6A 3KYIB 4PSDA 5JRZA 1T5BA 2ISCA 2QVYX 3NQ41 3PT5A 4LC0A 4AU1A 2JASA 4EB8A 2ZIAA 2YZ2A 5CNMA 1ZNZA 2BTOA 3B3FA 2XE7A 1E4YA 4KW7A 2Q8NA 4KKXB 1C80A 3DKKA 1CK4A 2ZTUA 2WQ6A 2EIXA 2ZSUA 3LSTA 4BU1A 2XCOA 3FLMA 4HRXA 4D9GA 4S3MA 1ZIPA 2EJWA 4CFSA 5A2QA 1T36A 4QOFA 2H3HA 5T4HA 2QMOA 3WA6A 4QXAA 1C4WA 2PXAA 2P3SA 4QZVA 4F12A 5CEFA 1T8RA 3INTA 4EY6A 3IPLA 1TZKA 4K9MA 4RXUA 4ZMSA 2VRBA 1NJGA 1H2YA 1I1NA 4WFQA 2OFXA 3IX7A 4HR7A 4KR6A 2XVYA 1LDMA 3BF8A 1G9TA 4FZVA 2BFDB 1KEPA 2EX4A 4MR8A 2O8BA 4B80A 4QQFA 4QSHA 1JH8A 2F9MA 4KPYA 2EZUA 5GOZA 1RLJA 4C78A 3DE3X 3P9ZA 4DYDA 2PO5A 3WQHA 4F45A 3ELYA 1PHPA 2RDMA 2ZRMA 1QVVA 3JS5A 2XITA 2DPMA 2F3UA 3IJEB 4KMRA 3AWIA 4HDKB 3V6LA 4DKJA 2F1JA 4P54A 3CLRD 3BX1A 5J1TB 2W11A 4MUNA 2QN1A 3GZTB 4U7PB 5AHWA 1OX4B 2FWPA 3C97A 4I55B 3ZI0A 3PUXA 2G0AA 1D07A 3M3DA 4WFIA 3M6WA 4EY7A 3DL7A 4MJ3A 1ONBA 3NEJA 1HTWA 4ZU6X 1SU8A 1MW9X 4PLTA 3NP9A 3TBHA 3RHZA 2QN9A 5ALKA 3IIJA 1NW8A 2GN1A 3B38A 3G88A 4O4JF 4UDYX 2JCGA 1KJ9A 3WP0A 1G2OA 1M66A 2PT9A 4TKLA 5EXEA 5J5VA 3DDUA 3HWRA 1TB4A 4HGYA 1SCKA 2Q6TA 3MJ4A 2YXEA 4ZOLF 5HE8A 2MINA 4KDEA 4V0LA 1R6XA 4MUXA 3CZRA 1KETA 4MVXA 4A8JA 2AV6A 1H0RA 4WE3A 3CKMA 4OKSA 1K3TA 3EB9A 1AM4D 1Z7WA 2B61A 1JB1A 2Y1OA 3OEHA 4GOMD 1E20A 2VHVA 4KQ6A 4MWSA 2Q49A 4N5NA 4XSGA 4D02A 1DWPA 3LRTA 3CZPA 4DLKA 2DB3A 5F2OA 2LTAA 3KUDA 2OWDA 4H7PA 4QHTA 4TVBA 5GZ1A 3C1AA 3E0XA 5CDUA 5IASA 3I6IA 3OEYA 3Q3JB 3E9QA 4XIJA 1OIVA 3H2IA 1E5XA 2AZDA 3V8MA 1M0EA 2VCHA 1YONA 1J21A 1Q50A 1UKCA 3C0KA 2X1VA 4OH1A 1NI4B 4PRZA 5IAGA 4A5OA 1QX4A 2FOLA 3F47A 5CGZA 1U5BA 3AY7A 3NWEA 3QLUC 2YWHA 5JC8A 4IXTA 4QUKA 4MEAA 2W2VA 1LBTA 4I1SA 3J80A 2KSQA 3SZLA 5BYBA 1PK7A 1R7RA 1I13A 3C1OA 4F7WA 5KWEA 3WGKA 1SUWA 2EP5A 1PBTA 2HCJB 4RZQA 4MIKA 1HYHA 3WGTA 4X84A 3GFRA 1TX4B 2FMIA 2J7PD 3CJQA 1XTTA 4MVYA 3C6XA 3GZNA 1NUTA 3IAS1 1NVEA 3NKFA 4MS1B 3FTCA 3ZWMA 2HDHA 3HNOA 3ZVNA 1J1IA 2ZGVA 2XZTA 1H4VB 2WA1A 3DT9A 4C6HA 1E2UA 1X8KA 3NO4A 1U0FA 5HZHA 1RQLA 5JZOA 2EU8A 2HJSA 1VOTA 2R5NA 3WLFA 2PAFA 3D0QA 1WDMA 1SC3A 1P2DA 3IB3A 1BMDA 2LBPA 1KR2A 1Z6YA 3ONEA 5BPHA 3ACCA 1YAJA 2IYNA 1E9VA 4R2LA 1XZBA 2D59A 3CLTC 5B1IA 3RGGA 4D82A 1E2BA 4KXXA 1E5TA 4H6VA 1TIBA 3Q3GE 4B3XA 4ZMBA 1F0PA 1F4VA 1KAOA 2W22A 4F3KA 4UUPA 3EWAA 2O6LA 3QE3A 2OBMA 3NIWA 4S05A 1QR2A 3D9QX 1RYMA 4A8TA 4IHJB 3WGIA 1G7RA 1U3UA 2QTVA 4KGDA 1Y1SA 5EHIA 5EHGA 5ILGA 5TJHA 3T9EA 4E46A 3E53A 2ZYVX 1OBOA 2BMFA 1U1DA 4G5GA 3HDTA 1URPA 2ZYSA 4EFMA 5AW6A 3KPJA 2XB8A 1H6CA 2BT4A 3GVCA 1KMQA 2JI6A 4G5OA 1A4IA 3MJTA 4NPHA 3WKDA 3RAGA 1SC9A 1DELA 1YTUA 3OQPA 1JJBA 3FLAA 1ESZA 2ZSEA 1P7WA 1ENYA 5ICGA 5LQNA 3Q15C 1JTVA 1LI4A 2DWPA 5AJZA 3L1JA 3V4OA 2HT6A 5A03A 2OCBA 4EIWA 4NJMB 4Y3UA 3Q3EA 1NXXA 1ILEA 1K86A 3NKLA 2GBLC 4D45A 5JO9A 3D0OA 1KJZA 4OQFA 3WGOA 2FDCA 1P2SA 4KIUA 4TKUA 1DVRA 3IMFA 4IOLA 3I9KA 4FXOA 4TLEA 4HJXA 5T8KC 5IKPA 1J22A 1BEEA 1ZA1A 4HVLA 3HJGA 3LUFA 4YNBA 4G97A 1WDKA 2OHGA 1PT6A 1VB3A 1H85A 1FJXA 1MOSA 4RH1A 4CTJA 3EZ7A 4HQKA 3OTGA 2ILVA 1YD7A 1MHPA 2IEAA 2WR8A 2YDYA 4HQ6A 3T5DA 3S27A 1XD9A 1XF1A 3DP7A 4GGMX 4P3OA 2DHDA 2O5VA 1F14A 3H1PA 5IAJA 5PGMA 3EYAA 1WOMA 1J2EA 1U1GA 5KKAA 3AR9A 4FFBB 5JAOA 1GAQA 2HO4A 3B6IA 4ZO6A 4QEKA 4CODB 4IIDA 2FG5A 3RR2A 1MJ5A 3CVXA 2H07A 1XP5A 3TL6A 1LPMA 1Z5VA 2B98A 2FMHA 2VNHA 3I30X 4CKXA 5EQJB 1MGPA 4NHEA 2HN9A 2AOXA 2EWMA 1LPAB