2ZI7A

C4s dck variant of dck in complex with d-dg+udp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
240
structure length
218
Chain Sequence
IKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSTGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Deoxycytidine kinase
publication title Elucidation of different binding modes of purine nucleosides to human deoxycytidine kinase
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 218
sequence length 240
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zi7A00
2OCBA 2GVDC 2BVNA 4LPKA 1G3RA 3NEYA 3QKSA 4Q02A 1R0ZA 2ZJZA 1DEKA 3MCAA 4A92A 3QG5A 3H1TA 4P4TA 4EJSA 3SDZA 3OEEA 3MWYW 4DDTA 2GILA 4KO8A 1NLFA 4P4UA 4TLCA 5JHHB 3O8RA 1CJMA 1E98A 2HF9A 4NP6A 2F3TA 2VP4A 1JBKA 1XD9A 1ZNXA 4IOMA 4GOKA 4OK3A 4Q00A 4NBSA 1MABA 4TMTA 5E7JA 1FP7A 3OZXA 5JCPA 1OLOA 1A5TA 1NBMD 1I2DA 2XNSA 2VBCA 2BCGY 1DAEA 1GNQA 1KMQA 1KNXA 2P5TB 3SU8A 1F2TB 1ZMXA 2ZRMA 1II8B 2AFIE 5CITA 3MAAC 4RFSA 3IBGA 3UG6A 4BLRA 4TN1A 1LS1A 2BDTA 1Q21A 3K0AB 5KNDA 1A1VA 4UNSA 3DOFA 2BHRA 1IN8A 3U4QB 1ZD8A 2C96A 4LGMA 2GCPA 2QN6A 4G5OA 4BLQA 3T15A 3KDSE 2WWIA 2ZIAA 2C95A 4DHEA 2ZRHA 2LCFA 2O52A 1BO6A 3EA5A 1OXXK 1Q22A 1J90A 2VIIA 3MUFA 5HZKA 1XPOA 1SGWA 3LBIA 2YWGA 2V54A 3V4RA 3BOSA 2O8DB 4PHTA 3PXGA 4PO9A 4DCSA 3QXHA 2CXXA 3PG5A 2ZJBA 4YMWA 5FUYA 3FWYA 3AF1A 3OEHA 1S1CA 5KSOA 4N0EA 3DZ8A 3Q85A 4Q7LA 4JLOA 4B35A 4ZV4A 1E9BA 3GD7A 2GEUA 3B60A 3AVXA 4IOJA 2QQ0A 1QHGA 1YZNA 5HTKA 3C14C 1ZM2A 1UBCA 4NZYA 4BRWA 4Z54A 2ZRFA 1ZUIA 4DLWA 4LBZA 1U9IC 1LB1B 1YZGA 2RGBA 4XVUA 5EXTA 5DNYB 1S8FA 3DHWC 1F2TA 1QRAA 1VYVA 1II8A 1X1SA 4HB0A 2OFOA 1COWD 2L0XA 4BZPA 3ETLA 1ZM7A 3PQCA 5FTLA 2WM9B 2QI9C 2A5GA 2BM0A 3LO5A 4OL0A 3K0AA 1QHYA 4FMCF 1ZNZA 3U7GA 3U4QA 4DKXA 1VKJA 1W47A 1E9SA 2ZRNA 4FCWA 4QBIA 3C5CA 3U3JA 4QRHA 4UNRA 1CR4A 2GF9A 2IUSA 2QROA 2R65A 2W2TA 3T34A 1LF5A 3GEHA 2Z43A 3ECCA 1CRPA 2ZAMA 4Q01A 4F4JA 2J7KA 1U0LA 2OXRA 5BN5A 4OKSA 4AKGA 1Z07A 1W49A 1B23P 2D06A 2O8DA 3X1DA 3I1FA 2QEQA 5JLJA 1UKEA 2FV8A 1VIYA 2JJ1D 3PEWA 4ZKEA 4FMCB 3DEFA 3UWKA 4ASUA 3FHOA 1IXZA 1W48A 2JLZA 3B9QA 1NNEA 1D2NA 1KAOA 4LJ9A 5IDVA 1GOTA 2R2AA 4Q47A 2OEPA 3ZVNA 4PZZA 2ZVPX 3SN6A 1GFIA 1T0HB 1U99A 4AYWA 1XRJA 4N0DA 3ZVMA 4ZDIA 4KBFA 1BYUA 3DO6A 5HR5A 3GMTA 1F3OA 4JBXA 4GFDA 3QI2A 2I1VB 4IHQA 1E2DA 3GJ8A 3W9YA 4D0LB 3RLFA 3BAFA 3R9WA 4V0LA 2WWYA 5E3HA 3B7GA 3OF5A 4HAXA 5BYKA 2PLFA 1W0JA 2VP2A 3LY5A 4EAQA 4OJQA 3MWKA 2HLDA 2FDCA 1YRBA 1AN0A 2WAYA 1OXTA 1T0JB 1MV5A 5F98A 3KB2A 1T5LA 3EAQA 3K0EA 2RGNA 2IW3A 4EPVA 1S96A 5LB2A 1GZSA 4DEXA 1XXHB 1KI6B 4NCKA 3QKUA 4C0KA 4MUAA 2QQEA 2AWNA 1N6IA 4D6PA 2IYTA 1G7SA 1OT3A 3FKSA 2W6JD 3M4YA 4TSFA 5CJPA 5SZKB 3A1TA 3A4MA 1KZ7B 4Z8YA 1YZKA 2G83A 5AJWA 1Z22A 4O25A 5JJIA 3KKNA 1WRBA 4GSYA 3UPUA 1JQLB 1SQ5A 1GL7A 1AZSC 1JEDA 1SVOA 1J99A 1YR6A 2YWEA 4JYBA 2IYUA 2WJIA 4HATA 1G291 1P5ZB 4DSOA 2RAPA 1P4SA 4GP7A 2GZHA 2ZU6A 1YZLA 1KO1A 3CONA 1KO5A 3C5HA 4V0ME 3K9LA 3LBHA 4B3GA 1FPMA 1DOAA 1R6BX 2PBRA 2ZRAA 3DKVA 3F3YA 4GNKA 1KI4A 4PANA 1TNDA 3K8YA 5KSZA 4WVFA 3OE7D 1IBRA 4D82A 5GJVC 3EPLA 5EE0A 3IKJA 5KNCA 3HJNA 2V4ZA 4G0NA 2GCOB 1TPZA 1GP2A 3KB1A 1AZTA 3TQCA 1XXHA 4DLTA 5B64A 4LC1A 4ACBA 1D9XA 1H8HD 2W0SA 3KX2A 221PA 4QBHA 2ZM5A 4LYJA 3CRRA 4Y0AA 2ATXA 2CVHA 1XTKA 3H0KA 5CK4A 1AKEA 2ANCA 3QPWA 1E2KA 2QMEA 2DR3A 1KDRA 4OI4A 4QBGB 4LJ7A 4WZBE 2QG6A 4D4KA 5J5CA 2ZRLA 1FTNA 2CJWB 3RABA 1P2SA 3CIOA 2J7PA 3MJRA 4WIAA 2DFLA 2ZVQX 5KSYA 4PZYA 1EWQA 2FPLA 5B57C 1R5NA 4BZQA 1HURA 1E2IA 2LKDA 1OV4A 4XD7A 5H1YA 2CLCX 2ZITA 1CF4A 2GZDA 1PZNA 1KI9A 1S9HA 1CJTC 1C4OA 3EX7C 1P62B 3K9GA 5FBQB 4CEHB 2PLRA 4WA7A 4D2IA 1NKSA 2C04A 1SHKA 5EP1A 3A37A 2ZYWX 1UADA 2QP4A 2ZUCA 2EFEB 4P0TA 2CCGA 4KVAA 2QT0A 5G3ZA 5HZHA 1RIFA 1Z6XA 2BV3A 2ERYA 3M0EA 4LX0A 3TMKA 1R8QA 1GNRA 2VSFA 4JZKA 3BB4A 5HKKD 1Q0UA 5FTJA 1N6HA 1Z08A 1Z6AA 3EG5A 4NYMQ 3W3ZB 4A8JA 1ZD1A 4O0MA 3QOFA 3ZYCA 1X6VA 1NMZA 5DN6A 4A36A 1KIMA 4R71A 4JJKA 1L2TA 1OYYA 4URZR 3MRSA 2GCOA 4B2LA 3D31A 1N0VC 3K09C 2AR7A 1G4AE 1NVWQ 2P6UA 3QVVA 1AM4D 4NMMA 1QVAA 1W36C 5J4LA 1GTVA 621PA 2WSSD 3LA6A 4DSTA 5CB6A 4P4SB 3EC1A 3SOPA 1H8HA 4NH0A 4QHTA 3BS4A 4XTRA 3T61A 4B71A 4MITA 2Q21A 4ZIRB 3RS5A 2HT1A 1T9HA 4IDNA 3D6TB 1R2QA 3T1QA 3K70C 4UKDA 4KXFB 3SZRA 3W5JA 1CIPA 1XDBA 2VF8A 4CEJA 1KI3A 2BWJA 2EWVA 4JLBA 3B85A 4NCJA 4QFMA 5AJYA 1LVGA 2CL0X 1U94A 1Q20A 1GKUB 1XJQA 1X8JA 1TAGA 4CEHA 1NN1A 4LJ8A 3HU3A 4QHYA 2EWWA 2CHQA 1N6LA 2EFDB 4LYFA 4M53A 5D3MB 4NTZA 3RSLA 4G01B 3GP8A 1ODFA 1HQYE 2C77A 1OHHA 2JJ8A 1U8YA 3EA0A 3LQRA 1I4TD 4PC2A 2ZI4A 2FSFA 2MSCB 2V6IA 2R6GA 4C0HA 3A4NA 4TMWA 4XWAA 4YMVA 5CJ2A 3LRPA 4DB4A 1XMJA 1KK1A 1GRRA 1OE0A 5J4YA 4PAMA 2ZR0A 4JJZA 2JLRA 1E2PA 1R8SA 1ZCAA 5E4FA 3QF4B 3HPQA 2ONKA 4US0R 4EJSC 1FNMA 4DC9A 3U3OA 1P7CA 4WXPA 1ZVQA 2D4HA 1G8GA 2ZRBA 4DLZA 3E1SA 2GBLA 2DBYA 2JDIA 2RCNA 3GJ3A 2OO7A 5SZHB 4M21A 4MKHA 4DDWA 1OH7A 4ZI3A 2ZJ5A 3G0HA 3A1WA 4ZIRA 1W2GA 1BKDR 3GLHA 2ZI7A 3LVRE 5J4KA 5EUQB 2IF0A 2BBOA 1KGDA 3PIRA 1PVOA 1JALA 4OI0A 2AXPA 2GEDA 1TEXA 2ZRCA 1UDXA 1S3GA 3CRQA 4UQOA 2WKRA 1ZBDA 1TU4A 2J0SA 1OFTA 2D74A 4ESHA 1SVKA 3REFA 3H2YA 3N5CA 2VHTA 1T5IA 1N2CE 3GPLA 2CNWA 3I5YA 1E2GA 4M1OA 4A0FA 2XSZD 3FOZA 3WBJA 3WHKA 3UWOA 1WCV1 1JR3A 1YQTA 1OH8A 3V00A 4PQYA 5D3MA 3GLGB 1IY0A 3HYRA 2JA1A 3TQFA 3ZZTA 2KE5A 4C7OA 1U81A 4KFTA 2OFWA 3CWQA 2KI5A 4TLBA 4QJ4A 4EPYA 2GF0A 1CJKC 2AHOA 4Q9HA 4JVSB 4J0QA 2HT6A 3OHMA 3CNLA 3IPXA 3B9PA 1OSNA 2R62A 1RRFA 4W7SA 1UPTA 4C0JA 1RYHA 3CLVA 2DWPA 2OBMA 3K9HA 4IOLA 2PZEA 4QNMA 4NCNA 1P73A 4BFUA 1NLZA 2X2FA 3NDBB 3CBQA 1VHLA 1UF9A 1GKIA 3CW2A 2ODBA 3SYLA 2TMKA 2JLVA 1IONA 4B34A 5JEDA 5AUQA 1NVUQ 4G5SA 1R5BA 2YZ2A 3A8TA 1PUIA 3ZVRA 2QMHA 1KJWA 2RGXA 1FQKA 3U44B 3AVYA 2Z6VA 2XJ9A 4YXWA 3MG9A 2BEJA 2IXFA 2P0EA 4B3BA 2GA8A 4LHZA 4LHVA 2FZ4A 2GRJA 1VECA 4OI1A 1N6RA 1E9CA 1WF3A 4UNQA 3SYKA 5BN4A 3GLGA 3FFBA 1OXVA 1P72A 2E1RA 4HB4A 2YOHA 2OILA 2X19A 2QBYB 2GEVA 1DS6A 1ZUHA 1ZM4A 4D80A 2QAGB 3B1YA 2YKGA 4YMSA 4GPTA 2BEKA 2OHFA 2BBTA 3PITA 4M1SA 1KDPA 1W4BA 4PC7A 5F9FA 3NBFA 1IN4A 2FSGA 3OIUA 2VLIA 1NY5A 4TMXA 4JLAA 1XWIA 2GVZC 4IOKA 2FE4A 1IY1A 5EE1A 1CRQA 2GAAA 3TLXA 3FMFA 1XEWY 1KSFX 2H17A 4PPGA 3WRYC 4C0SA 3FTQA 3ZQ6A 3B13B 4N1AA 4ABYA 1M7BA 1RYFA 1PLLA 4LWZA 1FL9A 1CKEA 4QGGA 1GVNB 3O47A 1FMJA 421PA 4BRUA 4L15A 3SFVA 4A1FA 2AK2A 2NO0A 3LWNA 2WICA 1ZUNB 1FUKA 3WYAA 1CTQA 2AK3A 3I8XA 3U44A 5HPYB 2IYQA 1DBSA 4PHHA 2EFGA 1AKYA 1E32A 3ZZUA 4V03A 3CR8A 3W8RA 4LYHA 4NU0A 1L4UA 2RGNC 2F1HA 4M4SA 1GL9B 2ZROA 3KQHA 1ZNWA 4C0AC 3EZ9A 1VG0B 3GJ5A 5AR1A 1N3BA 3SHWA 2WMNB 4CDGA 1ZU4A 2YWFA 1YVDA 2J3EA 2R6AA 2A5YB 5C1BA 4R9UC 2HXYA 3TJZA 4TQUS 2QAGA 4D0GA 2UKDA 4IFEA 1XTQA 1E1QD 3RRNA 2HCBA 3ADKA 4PPFA 4PSKA 2WWFA 1Z5ZA 1XX6A 5J47A 3OAAD 2A30A 2NPIA 2OCAA 3H84A 2IC5A 4OK5A 3RHFA 5B30A 1XNJA 1PLJA 1X1RA 2C5LA 2CLDX 1G3MA 2IYSA 4L9WA 1NP6A 4RD0A 4YC7A 4TTPA 3ZS8A 3K0CA 3OFNA 1JAHA 3JZMA 4LHWA 2PT7A 3TGPA 5KDOA 1CBUA 2XTMA 4ZKDA 5J4HA 2ZUBA 1XCPA 2NGRA 2PCJA 3CRVA 5HE9A 3TBKA 1VG8A 5JRZA 4Q5IA 4EPRA 1F48A 4P32A 4M1KA 4RZ3A 1E9AA 5K8LA 2XAUA 4HB2A 4W5JA 4JT4A 1Z83A 3IIJA 3LXRA 1FW6A 3DL0A 1Z0DA 2V3CC 4BPBA 2HYIC 2ZETA 1M7GA 1JR3E 1DARA 1TTTA 4BECA 3K53A 1KSGA 4A9AA 1RJ9B 1FP6A 1KHTA 2XNDD 3T5DA 1IHUA 2O0JA 2F7SA 4IDQA 2QUZA 2X77A 1XF9A 1G21E 1YR7A 2OG2A 3KXIA 2JLSA 3GEEA 2W83A 3AF3A 4ARZB 5ANRB 4CT5A 4PZLA 2ZRIA 2P6RA 1MRSA 3HYTA 3TW4A 1KK3A 4PSVA 1VCNA 5LPNA 3QXCA 1XTRA 3UATA 5FTNA 4BGDA 1II0A 3QKSB 3MJHA 1W4AA 3LBNA 4U5XA 1T6NA 5AUPB 2XOKD 2VL7A 1HV8A 5G3YA 4Q7JB 4B2IA 3S1AB 3B1WA 2ZS9A 1UM8A 1RPZA 5JBQA 2GJSA 2J0QA 1SZPA 3CF6R 5H8WA 3W5IA 1PLKA 4OI2A 8OHMA 1OB5A 2FGKA 4TYYA 4RZUA 1ZD9A 3U3MA 4C30A 5FL7D 4DLVA 4KSCA 1Q1ZA 3TR0A 2JIZA 2AKYA 4KLNA 2BMEA 5FUVA 1Z06A 4C2UA 4EQ6B 3QSYA 2ZJOA 5FH9A 4JBYA 5FOTA 4MDFA 4AKHA 2ZR9A 3VX4A 1NVXQ 2ZRKA 4A0RA 3VNUA 1RJ9A 4OK6A 3KZ1E 5IK2A 2FU5C 2CCJA 2H1LA 2RHMA 2XTZA 3ZZ0A 2XNDA 1SXJD 4BFYA 4QGHA 3VR5A 4ARZA 4Z1MD 3PUZA 4FCTA 2OFXA 1Q3HA 3RVBA 2C2HA 2ODWA 4CYMA 5FPSA 2IHYA 4E5UA 1H8EA 1XEWX 4A2PA 2WKPA 3B2EA 3FVQA 3KQUA 4XJXA 2QGNA 4BUJA 4ESVA 1P2VA 1IM2A 2J41A 3D8BA 3IO5A 1CR2A 4BFZA 5LDDC 3LD9A 2ODEA 2ORWA 4EFLA 2OLKA 2GZAA 4LV5B 2O8CB 4Q7KA 3AP1A 1VIAA 2G3YA 4JBWA 1E9EA 3EWAA 4CRWB 3J81k 3WBKA 3S1AA 2HXSA 4A0HA 2ZE6A 3BERA 4OHZA 821PA 5KU1A 2JGNA 2AFHE 5FPYA 2CLSA 5FOVA 1ANKA 4Q1BA 1WP9A 4V0OA 3KFVA 4X8MA 4MDEA 1AGRA 1WBDA 2A2ZA 1N5KA 4TT3A 5EE9A 4D0NA 2OAQ1 3CRMA 2GHIA 5EP2A 3CRW1 5IT5A 4A82A 3QKTA 2QE7A 1E2FA 2C9CA 1G7TA 2AKAB 1LY1A 2REOA 4OQXA 4EQ6A 2GETA 5FL7A 4BLOA 1A82A 2WHXA 2QMOA 4BASA 1XU4A 1Q12A 5GJBA 2PZFA 4V02A 1EFTA 4FMDF 2HF8A 4TQ9A 2Q0HA 5UKDA 2MMGA 2EFCB 3R8FA 2NPFA 2J9RA 1QBKC 3IILA 1CP2A 1KO8A 1YR8A 4A4DA 3CB4A 1S9DA 2XZLA 2YC2C 1SVWA 1R5OA 1WDTA 3I8SA 3IGFA 5FUXA 3LQQA 3ZLJA 2B21A 3IQXA 3KFXA 4E22A 4DBLC 1SXJA 4XTCS 2FFQA 2O0HA 1VCOA 1RVDA 4Q9JA 5DLQC 1CR1A 2JJ2A 4D81A 2VA8A 3X1ZA 2QPAA 1E2HA 2W2XA 2O8CA 4FMDB 1Z6GA 1R10A 3V9PA 1NL3A 1H65A 2WJHA 3IIMA 5CYOA 1EFHA 2ZS7A 2QTVB 1OFIA 1Z2AA 1NVVR 3SQWA 1Z0FA 3QEOA 2A9KA 3BH7A 4BEBA 4TTRA 5BXQC 3QKRB 3MD0A 2JAQA 3MFYA 2HUPA 3THOA 1DG1G 3CH5A 3AF2A 3B1ZA 3GFOA 2OZEA 4OQFA 4G5QA 2B92A 1NBMA 4HEJA 4TL7A 2ZXUA 4MRVA 2QRNA 4I1UA 3PUXA 2FG5A 1YZTA 1KI2A 2I4IA 1W5TA 1RC8A 4TWZA 4KITB 4A15A 1BS1A 3TUZC 2GKSA 2ZI6A 2N42A 3FYHA 2O8BB 3U7HB 1VCMA 1XTSA 2J45A 1P6XA 1M34E 3L82B 4AC9A 1DO0A 5JWHA 4C0BA 4UNPA 2XTNA 1YHNA 2O8EB 1P9WA 1M1YE 4URXR 3AUXA 3P4XA 4HLCA 4HDOB 1G3IA 4PSAA 4RSGA 1PV4A 2RMKA 5DYGA 4U02A 2J0UB 1QDEA 3CUEF 4MKFA 5SZIA 1RRGA 1J7KA 4RZ2A 3DMDA 1Z29A 4PC1A 1TQDA 1X8LA 1Y63A 3GJ7A 1N25A 1DE0A 3FE2A 3NC1C 4JS0A 4V0NA 4B48A 3QKRA 1UBGA 4IW3B 1KI1A 1N6PA 1OXUA 5JCZA 2FEMA 3P27A 4JKYA 2FJUA 4YDHB 3LAWA 4GZLA 4KBGA 3WMFA 4E07A 5L3QB 4US2R 1S4QA 4EPXA 3M6AA 2RGCA 5C4GB 1KO4A 5SZJA 4FWTA 1DAMA 1K5DA 4ACAA 1JECA 4JVLA 1COWA 1NIJA 2NZ8A 3CWZA 3P32A 5FFMA 4C0QC 5JJLA 2O8BA 4B73A 2VP5A 3RS0A 1LFDB 4R98A 3SS8A 5JWOA 3VR2A 1XTJA 2OBNA 5BW8A 4Q4JB 3CZPA 4EFNA 4BFVA 2O8EA 2H18A 5EP4A 4G5GA 1NG9A 2A7QA 1T3LA 4YLGA 2HJGA 5CDFA 4LZZA 3QY0A 3VR1A 3TUIC 1P60A 1AS2A 2ZI3A 4WZAE 1AQYA 2QPTA 1G6HA 3SBEA 4GDFA 3Q8XB 1E2LA 2XB2A 1QG4A 1SKYE 2JLWA 2J0UA 3NXSA 4UJ5A 2R9VA 5BYJA 4PAOA 2H8KA 3ADBA 2JATA 2JJ1A 2VP6A 4GI7A 3SEAA 5JECA 1ESMA 4YMTA 3IO3A 2IF2A 2ZQ5A 4CGZA 1QHNA 1U90A 3ADCA 2P67A 5LB4A 5KO2A 4QXAA 1N0WA 3C41J 3I4LA 4GMDA 5C46F 3K1JA 1U2RA 3FHCB 1E9DA 3O8DA 4LJAA 2WSMA 2QMUA 2QAGC 3HR7A 5L3QA 5G53C 1W44A 5EXXA 2QNRA 3BFKA 4KVGA 3RC3A 3FMPB 3OESA 4OJKA 2BMJA 1UKZA 4A8JB 2P5SA 2EW1A 4PPNA 2FWRA 4Q03A 3MWJA 3EZ7A 2J87A 3IEVA 3FGNA 3K0CC 2YOFA 3KQNA 1L8QA 2V9PA 2H5EA 4Q4JA 5FOXA 3CPHA 3QUSA 3CNOA 1EX7A 4CW7A 3TNFA 2G1JA 3TE6A 1VHTA 2C98A 3QNUA 1OKKD 1OH6A 3EXAA 1E4VA 4ZDKA 2FN4A 2FEOA 2W6JA 1G18A 1FUUA 2QU8A 3KKOA 4JL6A 3IHLA 2GJ8A 2IYYA 2VP9A 3DKPA 3RS3A 3ONWA 2WZQA 4MYTA 3C8UA 4CEJB 5JSZA 4EDHA 1QG2A 3CR7A 3L8ZA 4Q66C 4AY2A 4W9MC 1S3SA 3I5XA 3UMFA 2R6FA 4V0KA 2PH1A 4KCGA 3AVWA 5C18A 1XD8A 2ZREA 3EPKA 2R44A 2BM1A 3RRYA 1OH5A 3PUWA 1LTQA 5HCIA 4TZ6A 4KAXA 1ZM3A 2AWOA 1D2MA 1GDDA 4QKQA 5DYIA 3QVUA 3AVQA 3B82A 2GWHA 4UNNA 4GP6A 1YE8A 1LV7A 1KJYA 1KK2A 2XITA 2ZUDA 4D4JA 5CIQA 2QENA 1DO2A 1DVRA 2BMDA 4NYJR 5FR1A 1Z47A 2F55A 3RNLA 4DIEA 1W1WA 3PFIA 3EPHA 1LNZA 3EWSA 5FBLB 4XSGA 4JL5A 2NO6A 1OB2A 2V7QD 5FOUA 5A5GA 3KQKA 2BCJQ 1MO5A 2WMOB 2V1XA 3OE7A 4NYIR 3JVVA 3SNHA 4DSNA 5A4JA 2XEXA 1E2MA 4LJ6A 5BN3A 4U7DA 1E2NA 2BMFA 3BFXA 1Q44A 2PEZA 3A1VA 3NBZC 1HE1C 3MGCA 4B47A 3THXB 1IAQA 3EARA 4IRUB 2AD5A 3GLHB 3VKGA 5A0FA 2CK3D 3FB4A 2IYWA 3AH8A 5DH9A 2OM2A 4CVNA 2ZSEA 2FSIA 4WOPA 3AVUA 4CT4B 3QQ5A 2QM8A 3Q7QA 4NHOA 2RGAA 4P3YA 4MKIA 4B76A 3VR6A 3VAAA 3SJAA 3SQXA 4QC2A 2IXGA 3A1UA 4BE7B 1Q57A 2VRWA 1F2UB 3KXLA 2ATVA 4DCTA 2BC9A 1E9RA 3MMPA 2J59A 2WV9A 4XOIA 3ZIAD 3TK1A 2VF7A 4RCZA 2B7BA 3ZH9B 3WYFA 2N46A 4JLKA 1IY2A 2A78A 3RSOA 3DZDA 1N6KA 1W5SA 4M9SA 1W7AA 4M8NE 3HPRA 4C7OB 3NKVA 1JR6A 3U6BA 3PJRA 1LS6A 2I3BA 2PMKA 2FGJA 3ZGXA 5E95A 2PJZA 1Z2CA 4L16A 4MUBA 5HKKA 4QGFA 4O2RA 5B58C 1CXZA 3B1VA 4ERNA 1XMSA 3DDCA 4TL8A 3CKLA 1DAKA 1QVRA 3WP1B 5P21A 4JT2A 2ZYVX 3AKDA 5CDFE 1QZXA 3TSZA 3VHLB 5LD2B 3C15C 4GOJA 5L3SB 4DJTA 4JLPA 5TDHA 1Q1QA 4MGIR 5EUMA 2BIFA 4ZDJA 1Z6TA 2OLJA 4KV9A 3I73A 2XX3A 4F38A 4G3XA 3THXA 4IDPA 2AD1A 3A36A 1A2KC 1XCGB 2G6BA 2RHDA 4W5WA 2WSSA 4H9GA 4XVRA 5EZ5A 1XPRA 3B5JA 4E03A 4QNRA 1Z6YA 3CPEA 3WY9A 1MO6A 4NPHA 2KB0A 2IWRA 1K5GA 2KSQA 4QL3A 1F2UA 2DYKA 4NL4H 4ZI2A 5GJWC 2NTYC 2O8FB 5FBWB 2K5UA 2PL3A 1RRPA 4RKFA 1QHIA 4TZ0A 3NVAA 1G17A 2PX3A 5K8IA 1DELA 4D25A 3ZIAA 2ZEJA 3SI7A 4M1MA 3SHFA 3THWB 2DY1A 3UXMA 1I4DD 2GJKA 5JS8A 4OBEA 1BMFD 3QE0A 4HUQB 4NONA 1L4YA 4S2EA 4HAYA 1KSJA 4AI6A 1XXHE 2W6ID 1P9RA 1TQ4A 2HYDA 2B8TA 1T3SA 1XZPA 3AKYA 1XBTA 2ECKA 4AD8A 2ORIA 5L3SA 5JWRA 3EIHA 2IS6A 5KPDA 4QM6A 2GCNA 2RGDA 4FXPA 4PFSA 2ZJ8A 3W90A 5BWMA 4L9SA 1DAGA 1UBEA 2PX0A 5FBVB 2JLUA 2XXAB 4Q4AB 3AF0A 2IEYA 1KOFA 1VG1A 1OFHA 2WPDD 3ICQB 2QPOA 3BH6A 1G3QA 2EYQA 3OIVA 2FH5B 2ZI9A 2O8FA 1FX0B 1ZIPA 3UK6A 1G16A 3WNBA 2GXSA 1EFCA 1XB2A 2GK7A 2IWHA 1NKTA 4E09A 4AYTA 1ZW6A 4JLDA 2XSZA 5K8TA 1XPUA 4LRWA 1G8YA 3PENA 3THWA 2EVWX 3R9IA 4PPQA 3RANA 4BFTA 2ZSFA 1FNNA 1T8TA 1E1RD 1IXSB 2BBSA 3M1IA 4HUQA 3SC3A 3IDQA 3P1JA 1GWNA 5CLQA 1BMFA 1HH4A 2OUKA 1P75A 5CYPA 1RW4A 3DPUA 1E99A 4BLPA 5EQTA 3K0FB 4PQFA 3KL4A 2X2EA 1XMVA 2V8OA 1YJ5A 1G64A 2W6IA 4LY6A 4M1YA 3I62A 2WJJA 1ONBA 5F9HA 3L2OB 5EE3A 2QSZA 1U0HC 4Q4HB 2FPKA 1IQPA 1GRNA 1N6OA 1X3SA 4TLEA 3HWSA 4L8GA 1G8PA 4A6XA 4GMXA 1JJVA 1KDOA 2ORVA 1ZU5A 1ZRHA 4KFUA 3SYNA 5JFGA 1ZC4A 1GG2A 2Z5FA 3W8NA 3X1XA 3BB1A 2XXAA 1E3MA 4Q4AA 3SJCA 2J1LA 4FD2A 5JMTA 2Z4SA 4NDZA 3EC2A 1BH2A 3AVVA 2C78A 1G8HA 4Q9IA 4MGZR 2OCPA 4A2QA 3DMNA 1FX0A 4P33A 3EZ6A 4F91B 2J0VA 1NG1A 1CJVC 3U7FB 1ZM9A 3VR3A 2FFBA 3F8TA 1DG3A 3B8HA 2A3RA 4OHWA 5DI3A 5GVRA 1JPNA 4H1VA 3LX5A 1W4CA 4AKEA 2GK6A 4F7WA 3KJHA 2IYXA 1XTIA 4S35A 2DPXA 2ONJA 4OHVA 3W6PA 3P4YA 5KPJA 5FL3A 2IHBA 4RCYA 4LOAA 3ND9A 6Q21A 1NVVQ 3K9NA 3TW8B 4HAUA 3GEIA 4BLSA 4FIDA 5AWFC 3K0FA 1JEEA 5JI2E 4FINA 1MR3F 3A6PC 5H70A 4MRRA 3TVTA 3U7EB 3GLHE 2IYLD 1CU1A 2G1KA 4JL8A 4Q4HA 1KY3A 2P6NA 5E7IA 1G7RA 4LPSA 4UXIA 1R7RA 4IVPA 4B43A 1SVMA 3EZ2A 2CL7X 1E79D 1XEXB 4I1VA 2WAXA 4JIMA 3K0SA 2EYUA 4Z8XA 2ASEA 4KODA 5GVSA 4AK9A 1NN0A 5J40A 1SULA 1ZINA 3ADDA 3L0SA 3NG1A 721PA 1KZGB 4RD4A 1N5LA 3SBDA 2ZS8A 2FZLA 3X1YA 4LSGA 2FNAA 4A2WA 1MH1A 1OXSC 5KHOC 1NMXA 4BFWA 1W36D 4EPTA 1VPLA 4WAUA 3WHLA 3NDPA 2F6RA 1KK0A 2QL6A 1ZNYA 4JYCA 2A5JA 1XJ0A 4FWIB 1QHXA 3K70D 3B78A 1TF5A 3BB3A 1E94E 1TX4B 3IEUA 1PUJA 4ILEA 5DHFA 1BYIA 1WXQA 1DAHA 4TLAA 4XVQA 3RS4A 1G5TA 4B6EA 1R4AA 2KBFA 5KDDA 2WTUA 2ZPTX 1E1QA 3EIEA 2QSYA 3UIEA 3R7WB 1KKLA 1AS3A 4GOXA 2AL7A 3CF2A 3OAAA 1FFHA 2WIAA 5IF9A 3ICEA 3BGWA 3AEZA 3LH5A 2ODNA 2F3RA 2NMVA 1M8PA 4MYHA 5KNBA 2YV5A 1XEXA 4WW0A 2VH5R 5JJKA 4F4IA 1ZYUA 3BORA 1OIVA 1FTSA 1OJLA 4DEYA 1Y3AA 3CNNA 4PO8A 2KBEA 1E79A 1S2MA 4R2IA 2BKUA 3OEED 2ZJAA 4DB2A 4B32A 3LW8A 4A8JC 3TH5A 3NC0C 4XIGS 4LI0A 4TL6A 3W6NA 3AKCA 3I32A 1KY2A 5FI1B 4HSEA 3GLGE 2IX3A 4BFSA 4UXHA 1IN7A 3QXSA 3OIWA 3IPYA 2WJGA 2IS2A 3BH0A 1G4UR 2SHKA 4QOSA 4KJZA 1YU9A 1CR0A 1SXJB 3AV0B 4M22A 2HV8A 5C4MA 4DDUA 1ZCBA 3BE4A 3T35A 1T3HA 4DLYA 1OIWA 2XB4A 2Z4RA 4KSBA 4AG5A 4DLXA 4OQMA 5KDLA 4OHXA 3R7WA 2ZI5A 3TRFA 4MRSA 1HUQA 2VSXA 3V4FA 1R0XA 3PUYA 4NCHA 2FOLA 4HLDA 1OPXA 2C9YA 1J8YF 1US8A 1NJFA 2GESA 4URYR 4B3CA 1AK2A 2XOKA 3EPJA 1F5NA 4CIDA 3C7KA 4Q1FA 1G6OA 3NH9A 1J2JA 1HT1E 4AIIA 3N70A 4L5BA 4URVR 2YVUA 2KJQA 1GM5A 3RWOA 4BEJA 1KAGA 1LW7A 2VHQA 4M1TA 2IK8A 1P61B 4TL9A 1D9ZA 2IYZA 5DGXA 3TKLA 1XFAA 1R0YA 2YYZA 4C2TA 1YR9A 2RB4A 2KWIA 4BFXA 1E6CA 3TSOA 2GBLC 3EASA 1Z0KA 4YONB 1XP8A 3CO5A 2FFHA 2ZU0C 1KDTA 2IYRA 2LWIA 2W58A 3I3SR 1E2JA 2BJVA 4QHSA 1CS4C 1HE8B 3BWDD 3GQBA 1E0JA 1BIFA 1OYWA 1ZJ6A 2CEAA 4JKIA 1NJGA 3G82C 5CLLA 2CMKA 3EZFA 3LVQE 4HDCA 4Z1MA 1C9KA 4V0MA 3VNVA 1KJZA 2ZYTX 3BRWD 4D26A 1Z8FA 1II9A 2GTPA 2REXB 3QBTA 4HLUA 1UEJA 4DIDA 4C0LA 2I1QA 5AJXA 4FCVA 1SVIA 3LV8A 4GZMA 2UVQA 4II7A 1Z0AA 2AX4A 3CPJB 1W4RA 2OSBA 3E70C 2BBWA 4NYJQ 2IS4A 5JEEA 2V55B 4QJ5A 5F3WB 1G41A 4I4LA 3P26A 4EKDA 5FPKA 4XWKA 2D3WA 4LUCA 4OQLA 4R7ZA 4D4LA 1JQJC 3TAUA 4ASUD 1GL6A 1KNQA 4Q1EA 4PO1A 2C03A 4RD2A 4NYIQ 2CDNA 1NY6A 1G5PA 1NLYA 3D7MA 4Y0VA 4Q7MB 3DVLA 1G19A 5EXPA 1J8MF 1WE2A 1PJRA 1RKBA 2MSDB 2PEYA 2VTKA 5CIWA 2G0NA 4PTLA 5LD2C 1QHSA 1WMSA 2CL6X 4DLSA 1S1MA 1VYUA 1M6NA 4Q1AA 4HI0E 4JLMA 4TYWA 2IL1A 4DUGD 1W0JD 4C3ZA 5BQ5A 4MRNA 4EPWA 2BJWA 2HLDD 1GSIA 2CE2X 2IA5A 1A7JA 1U8ZA 3N2EA 2A5DA 2MMCA 1EX6A 2X8AA 3UKDA 4AG6A 4ZCMA 3FKSD 3GJXC 4RY2A 4TSFD 4JMPA 3R20A 3A1SA 2W00A 2RKOA 3RC8A 4G5RA 1FQJA 2G0TA 1AGPA 1ESNA 2H57A 1UJ2A 3L8YA 4UXJA 3WXMA 3SE0A 4RD3A 1N5JA 4MA4A 2F1RA 1EESA 4LJ4A 3R9XA 3QF7A 5TXGA 4O3MA 1TQ6A 4MQBA 1UBFA 1N6NA 5EXSA 1ELOA 4AKIA 1K8RA 1ZIOA 4B75A 2P3SA 1NIPA 5FOSA 3ZJYA 4KU4A 1HTWA 3IIKA 3LDAA 1UFQA 2OESA 5TY0A 4MRPA 4Q1CA 4C4PA 3BC1A 3HU2A 3IHWA 3PCRB 1E0AA 4BZXA 5AK0A 5EP3A 3T12A 4DLRA 4TMKA 4A0GA 2CVFA 2AN9A 1NN3A 5G41A 4DUGA 3ZD6A 5K8UA 4FI3C 4YMUA 121PA 2Q3FA 1A2BA 4OHYA 3WP0A 1HQCA 4W5HA 4R2HA 4F4CA 1R0WA 1U98A 4X8OA 4G1UC 4I1SA 3KKPA 5JSZB 4B3XA 3CX7A 1V43A 1KO7A 3VTKA 1WBBA 3PV0A 3L43A 4UJ3A 3VKHA 3NEJA 1VYTA 2OXCA 4PC6A 1UDWA 1XMIA 3GJ4A 1CEEA 1RFLA 1JAIA 3U3RA 2C99A 2N1BA 2NO7A 3VQTA 3GJ6A 2IUTA 2QTHA 4QG7A 2J7PD 3T1VA 5EE5B 4PC3A 4LHXA 1E2QA 2GAOA 2VHCA 4DXAA 1XJCA 2PCLA 3H86A 1TQ2A 1EFUA 5J4VA 1N0UA 1MOZA 3ND8A 4LK2A 4RJLA 3VMFA 3WNCA 1NMYA 3HDTA 2P2LA 4IVRA 4XD7D 5GADl 1OIXA 1VDZA 1M2OB 4X8HA 3JZAA 4EIWA 2F1JA 2HEIA 3QBVA 5D3QA 4Q21A 3U61B 3MLEA 2XJ4A 2D62A 3AVPA 2H92A 1KTVA 1SXJE 2WJVA 2W2VA 2Q9CA 5B2ZA 4RVCA 2DFNA 1WA5A 3Q72A 3QG1A 4JSTA 3LFUA 3AB3A 3BJIC 5JZVA 2WOJA 3GFTA 5H68A 4QGAA 3KJEA 1E0KA 3UMSA 2OCYC 5DN6D 5KSPA 4HAZA 3HP1A 2OV2A 2Q3MA 3BBPA 3RYTC 2WBLC 2FX3A 2ZE7A 1G7CA 1BOFA 1B0UA 3NHAA 1KI6A 2Q9BA 4LJ5A 3UG7A 1KKMA 1NN5A 4KFRA 1JNYA 4POAA 2ZSDA 2OAP1 1GIAA 3WYGA 4PR0A 3NBXX 1NBME 3P20A 4DCNA 2JASA 3O8BA 3I61A 2PJRA 3BIFA 3GFPA 4L4UA 4ZO4A 3RAPR 3GJ0A 1YZQA 1X86B 3X2SA 2OT3B 2Z83A 2QTFA 3I72A 3RWMB 4I81A 2EFHB 5DIFA 3VR4A 4AURA 4ZPXA 2NG1A 3RS7A 4F93B 1N5IA 2WWGA 5EZ6B 3FMIA 3Q9LA 3A4LA 3NTUA 4GBMA 1IOZA 2VHJA 2MSEB 1CLUA 1Z0IA 4PHFA 1OHHD 2YOGA 3PEVA 5CK5A 4QJ3A 1EGAA 4A6PA 1AA9A 1G9XA 2RH5A 2A5FA 2VQSA 2WKQA 2FPMA 4NKRA 4B74A 2GDJA 2CCKA 1G20E 1U0JA 3L0PA 4TTQA 5FTKA 4QM7A 2J5XA 5FI0B 2ZSBA 2GJ9A 1OKKA 2O0KA 2QA5A 3KXKA 2QP9X 5G40A 3TAHA 2BOVA 2GXUA 2YHSA 4PQRA 1UKYA 3O8CA 3FPAA 4K8OA 1FOEB 2JDID 2JLQA 1TUEA 3A58B 2CHGA 4GT1A 2HJVA 3KUCA 1G5RA 1O87A 4JLVA 4OQNA 3MSXA 4BQSA 4DCVA 521PA 1MO4A 1V5WA 1KSHA 3CF0A 2ZE5A 4EFMA 3T5GA 3NIBA 2V6JA 4MGYR 4Q4LA 4TMZA 3KKQA 5JS7A 1L7VC 4LYAA 2G9NA 4M2LA 2FSHA 2D2EA 1T91A 2CJWA 2ZRJA 2F43B 4LJYA 2CNWD 1IJEA 1ZP6A 5TARA 2ZANA 3AP2A 4IDOA 4PXAA 1TADA 1KI7A 1W2HA 3PEYA 5TB5A 4Z51A 3GLFB 4HAVA 1XD2B 1JR3D 2C9OA 2ZAOA 4QBFA 4HAWA 1EK0A 2CBZA 5IRCD 2VPPA 2V7QA 5CM9C 1GILA 1M7HA 2EU8A 2H7VA 2NO9A 1Z0JA 5FTMA 4H1UA 1QF9A 3RS2A 3GLIB 3U5ZB 1GUAA 1P3JA 2ZTSA 3EIQA 5HE8A 3Q3JB 3W6OA 3HU1A 4IJMA 3KTAB 4TYNA 1Z3IX 2CK3A 1TF2A 4DCUA 1TMKA 2QGZA 3AKEA 3KUDA 5FBRB 4Q18A 2VYFA 5KOYA 4CF7A 2WOOA 2NIPA 2GJAA 1M74A 2VEDA 4IFBA 3KJIA 4P4SA 4CZ2A 4Q19A 1E96A 2E87A 4B6FA 2ZRPA 4TMVA 2JCSA 3QIAA 1SXJC 3PUVA 2WJYA 4DDVA 4PAQA 3AVTA 5TVKA 4B2PA 4YXWD 2V1UA 2QRZA 2YNMA 4HYYA 2F43A 1NI3A 3QPUA 3X1WA 4URUR 5F2EA 2HDNB 4WZ6A 4M9XA 1UAAA 1HT2E 2G88A 3FFAA 4ITRC 1KYIA 3AUYA 1EWRA 3F5FA 4HLUC 3PVSA 4AYXA 3GLFA 4IKEA 1XD2A 2XZOA 3T1TA 2IS1A 2IUUA 4US1R 2H16A 2QT1A 3WRXC 2CHVA 3SJZA 1XZQA 4KHZA 1E4YA 2LKCA 3AP3A 4TYQA 1J70A 4TYPA 1KI8A 1QHHB 1NRJB 1D2EA 2FFAA 5M04A 1KMHB 5DSZA 5FUWA 3B6EA 2ZYUX 4CEIB 1U9IA 1XCMA 2RGGA 5JI3E 3GLIA 2DFKB 3AQ4A 2QM7A 2RGEA 3U60B 1OW3B 3OIYA 2XGJA 4IDHA 2JLYA 3TUJC 3QF4A 3KTAA 4HUTA 1HEIA 5KTYA 3AGQA 1AS0A 2NOAA 4KYIB 1RZ3A 4KI0A 5GJCA 4JVNA 3RDPA 3ZQJA 3GCGA 2YC4C 1K6MA 3QENA 2WWXA 2EQBA 4PHGA 2ZRGA 2GXAA 4LHYA 2ZSAA 5KUTA 2QY9A 3BXZA 4KFSA 3WMGA 4NE2A 1G8FA 3T1OA 4B44A 2DCUA 2DFTA 1EXMA 2D7CA 2Z0MA 3THYB 5DI3B 3D3QA 1JXMA 4RZXA 4FW9A 3AF4A 4M9ZA 2JLXA 2Q3HA 1YRAA 3AVOA 4I99A 3NBYC 1GKYA 1HYQA 1FMLA 3I92A 2J46A 4P31A 2XZPA 1I2MA 2PMDA 2QAJA 2ANBA 4HLQB 3TSWA 5LBIA 1GITA 3F0TA 3FKQA 1E0SA 4KLZA 3SR0A 3L0OA 4I1OA 4RFVA 3NHBA 2WWWA 3KKMA 1D5CA 4ZDWA 3FMOB 1QHHA 2R6DA 3VKWA 4DVGA 2ZR7A 4WXRA 5TV2A 1OF1A 2DB3A 4X8LA 2X1VA 1E2EA 1D6JA 1KMHA 3Q7PA 2E9SA 1W46A 2NZJA 2PZGA 4GRAA 1MO3A 4CEIA 5JHGB 3QJYA 4Q1DA 4Q9LA 4YQFA 3U6KA 1ETUA 2DHRA 3C16C 3CZQA 3KQLA 1JXOA 2YWHA 1FZQA 1UEIA 5DE3A 3ZDQA 1SVSA 2ZJYA 1TUIA 1XEFA 3OFND 1GAJA 4DRZA 2Y8EA 5CB8A 4M9QA 4MYCA 4LCBA 2WPDA 4U00A 4NYMR 4HDQB 2AXNA 3SFZA 2Q6TA 1NSFA 1RRCA 4LV8B 4M0LA 4EUNA 3THYA 2WVJA 1YZUA 1SHZA 4DWJA 4XSHA 3JVUA 2WWHA 1T4GA 3B1XA 3QXJA 5DISB 2WIBA 4RKEA 5ELXA 1Q1BA 4FN5A 3E2IA 4MH0R 4RD1A 2G77B 3E5HA 4KYUA 5DI9A 4PX9A 1X8KA 3UMRA 1E1RA 1WQ1R 4HB3A 4TLDA 4DT1B 3ZD7A 3AGPA 1JPJA 1LF0A 2GNOA 3TVDA 4WBSA 3C4JA 1TF7A 4LBYA 1HA3A 1IN6A 4B3DA 1VMAA 1G3UA 4GL2A 4D4MA 4JSYA 1W0KD 1Z63A 1EFRD 4FMBB 1I4LD 3LLMA 5AJVB 3W34A 4DZZA 4OYHA 2QBYA 4XWOA 2ERXA 3DM5A 3REGA 5EJEA 2B6HA 4F92B 1MRNA 1E9FA 1P9NA 3VHXA 3LX8A 1VCIA 2P65A 1SVLA 2IT1A 3LNCA 2NO1A 3NH6A 4MKGA 3ZVLA 4B33A 4LC0A 1OFUX 1Q3TA 3L0IB 1ZC3A 5HCNA 4C9BA 1P2UA 4YDSA 3U3KA 1HY3A 2D7DA 4NCIA 5FPHA 2YJTD 3Q5EA 2YINC 2FA9A 3BD9A 3G5UA 3UANA 5CM8B 2NQ2C 1AQUA 2FF7A 3DM9B 4DLUA 1EG7A 2C8VA 3Q5DA 1W36B 3FHTA 1DAFA 1RE0A 3FDIA 4HZUB 4XH9B 2JIZD 2IXEA 5KYKA 2D2FA 4AWXA 1TEVA 1TU3A 1C1YA 1MKYA 3GLFE 1VTKA 1F60A 1UKVY 3VX3A 3K70B 4IXNA 3BFVA 3TIFA 5TMPA 1DPFA 3ASYA 4DT1A 2UZ3A 1S0UA 5IK2D 4TQAA 4JLNA 1NSTA 1NF3A 4LBWA 2BKEA 1Z28A 1ZAKA 1YKSA 4JVMA 5AUNB 2DWOA 3PR1A 4IVQA 2IYVA 3GLIE 3T06B 2W0MA 3RRZA 3WNDA 3HR8A 1US8B 3IQWA 1H8ED 2R8RA 4LBVA 1TL7C 2PT5A 1CULC 5DHAA 5L3RA 3VU9B 3IUYA 1W0KA 2DWQA 4DSUA 1EFRA 5AUOB 4LV6A 3R8CA 4ON9A 3N2IA 5L3VA 1JI0A 1G1MA 3DOEA 2ZE8A 3KJGA 5FR2A 2HCJB 4K81B 4BLTA 1SKQA 1CJUC 4IEIA 3BK7A 3LLUA 4Q48A 5FOWA 5C2JB 2R6CA 3LW7A 4EJSB 5IHPA 1SKYB 2B7CA 1Q1EA 4RD6A 1IJFA 2GXQA 3MWLA 2QP3A 3K09A 1F6BA 1GNPA 2F9LA 3QPVA 1AJEA 5AJZA 1GRQA 4IXMA 3CX6A 3LXXA 1JJ7A 1DAIA 4LDJA 4TT3D 1D8TA 1MABB 3CM0A 4MYUA 1A4RA 3QEJA 2IBMA 3QXXA 4HZUA 3NWJA 5DO9A 1IN5A 3VFDA 4N3NA 2QE7D 3CH4B 3IBYA 2VSOA 2ZRDA 3AM1A 3RRMA 1U8AA 1P2TA 3W3AA 2IEZA 1JB1A 4HZIA 4MGKR 4RFSB 1AIPA 1WB9A 3ASZA 1VG9B 4Q9KA 3H4MA 2UZIR 2OBLA 3U2QA 4BWYA 1O3YA 4M1WA 2O5VA 1T8UA 2QORA 3WMEA 3ZS9A 5JRJA 4K46A 2F9MA 2VO1A 5L8VA 4O2LA 2JEOA 2CE7A 5FPTA 3CX8A 2F1IA 4IEEA 1MT0A 2OE2A 3PEUA 5E7MA 3SJBA 1DADA 4B3FX 2QZ4A 4ZCIA 4ZCLA 2ZJ2A 2VHUA 1DTSA 2VP0A 2Q9AA 2JJ2D 2FMXA 2REBA 3VU9A 3EW9A 1IXRC 4URWR 3TR5A 3OEHD 1E69A 2B8WA 4JLJA
chains in the Genus database with same CATH superfamily
2OCBA 1FIUA 2GVDC 5JXJA 3N2GB 1WVMA 3N8HA 1RBYA 1VRVA 4Q02A 3MCAA 3RJTA 4XW2A 3HKDB 3QG5A 1RNLA 2JBWA 3H1TA 5I4KA 3A3KA 3ABZA 2CD9A 4D79A 2P6PA 2GILA 4P4UA 3KEOA 1N1EA 3R1IA 5JHHB 4R3UC 1SUIA 3ZJVA 1ZZEA 1C3EA 4JNKA 4LG1A 3UFXA 4KZPA 4R1QA 1ZNXA 3JU3A 1I51A 4LI3X 3DE1X 4OK3A 3QPDA 4HDNB 4KKXB 4CF4A 4TMTA 2B5WA 5E7JA 5JCPA 1GPJA 3I2GA 2JAPA 4NMWA 2PPVA 2XNSA 3H8SA 4V0QA 1LU9A 1NULA 2ONYA 2BCGY 2VBCA 3HEAA 4PLZA 1GNQA 4ZVPA 4P80A 2RHWA 3TCKA 2AR9A 4KE9A 2HWUA 3VC7A 5JD5A 4IIYA 3UG6A 2C5GA 4OB7A 1PGPA 3H04A 1LS1A 2BDTA 2JK1A 2V7VA 1A1VA 5C3UA 4UNSA 2NACA 5AKZA 2BHRA 1KEEB 2PGDA 4WSOA 3RYIA 3WL7A 5I3ZA 3U4QB 4M8IA 4D9NA 5EFOA 5LXTA 3ODGA 4RL4A 5JCJA 1IBCA 2GCPA 1YB5A 2E7ZA 2Y76A 3D0QA 1FE8A 4G5OA 3IT1A 4YJ3B 3KDSE 4ZICA 2XVZA 1HI9A 2C95A 3GFFA 2LR0A 3L6UA 2FXVA 2O2YA 2DPLA 2O52A 1IJKA 2QTCA 4K9MA 3BCSA 1P7WA 2XH8A 4OA8A 2O23A 3M7IA 1GN9A 4IX1A 2YNMC 4JP5A 4M89A 4H7DA 1SGWA 2BFFA 3LBIA 3WICA 1XPOA 2V54A 3V7UA 3W4KA 4M36A 3GNTA 4PY2A 3F7TA 4DCSA 1Z26A 2QN7A 1TZMA 3ZHTA 3NVDA 2ZJBA 3PG5A 2B2CA 4G4GA 3FWYA 3OEHA 4OHRA 5FUYA 4F3CA 3FSEA 1WXFA 3K9CA 2HMSA 1YKGA 3DZ8A 3LJKA 4FSDA 1F4LA 2JJQA 4IJUA 4GZ6A 4JLOA 1JKIA 2XT9A 4UMFA 4ENVA 5BV8A 1GZ3A 1RI3A 2Q8QA 4D9EA 4PNEA 1CUBA 1M6VA 3A6KA 4IOJA 5HTKA 3QZUA 4EJ0A 3ANXA 2IHKA 4MWTA 2QRQA 1LLFA 1K27A 1M83A 4N3GA 4NZYA 2GKGA 3EX7C 1GGKA 1LB1B 2RGBA 1OILA 5EXTA 4XVUA 3LTNC 1WDKA 3AHIA 1Z18A 2P62A 1JL3A 4TWIA 5ES3A 1II8A 4CKXA 4F21A 5DNYB 2L0XA 1ZIYA 2RDMA 2I3AA 3LL7A 4BE4A 5IVHA 1D0IA 1ZM7A 2NQTA 2PSEA 3AJDA 3PQCA 4PO3X 2HGSA 3TIIA 1Z2DA 2HR1A 3UH1A 2CLMB 1VCHA 2DUWA 5FPKA 4FMCF 4TSRA 3BRWA 1W1IA 2PJDA 3IAUA 2B4TO 3OZDA 1MRZA 3TLAA 3VKVA 3OLVA 4ZT7A 2A5LA 2ZRNA 1OGIA 4LSZA 3C5CA 1SU7A 3TYXA 1Q2UA 1O5OA 3T34A 4AZVA 2A59A 3DVRX 3L04A 1IZ7A 2CNLA 2ZB4A 2ZAMA 5DTIA 1U0LA 1V7QA 2OXRA 4A8TA 4WECA 4EGAA 1NVGA 1XP5A 1DL5A 4JFAA 4BV8A 2D06A 3I1FA 3CNQS 3ZGNA 1YQXA 3UMMA 5LMCA 2FV8A 3TOXA 4ZKEA 2DCMA 3ZWKA 3GB9A 4FC7A 1FJXA 1L8LA 3FHOA 1IXZA 4AJHA 2G6TA 3S2EA 4MOWA 1NNEA 4HWTA 4LXYA 5IDVA 3RFXA 2G5PA 2BUCA 2QTVA 3K8OE 3W4JA 5LL6P 3MRVA 1IJBA 1T1IA 1SG9A 2J4CA 5KWIA 3B3FA 1T0HB 1U99A 2VHWA 5FA5A 1XRJA 4TUYB 3WRYA 1ISSA 3F47A 1J0AA 1N2CB 1HO3A 3GCWA 3IEXA 3QIVA 3OZVA 4JFRA 4RHCA 2NUTA 4RTSA 1F3OA 2EKZA 5NULA 2C00A 2I1VB 4IHQA 5L4NA 1QR2A 1VLVA 4HQRA 1LPOA 3ND7A 1VIDA 3BAFA 1V71A 3BX1A 3DHVA 4L8FA 3DOOA 3LUHA 1PJTA 3U1TA 4P35A 4F46A 1FRZA 2PLFA 5KNCD 2VP2A 4OJQA 4PLTA 1BDHA 1LBEA 4B7CA 3MWDB 3TG2A 1LK7A 2HNAA 3U7QA 2WAYA 4AJ2A 3DPSA 3RNOA 2AA3A 1MV5A 4FOPA 2JFQA 5HF6A 4QGSA 1CE8B 1E7RA 1XNHA 3FR8A 4DPLA 3NHWA 4EPVA 4HS9A 2UYHA 2I2WA 3OZRA 2NSJA 4UFPA 2ETVA 3H2BA 1HZZC 4PYNA 3TB4A 4MUAA 2QQEA 2IYTA 1GV0A 1G7SA 5AVKA 2IP2A 3R7NA 1DT5A 3LLVA 3M4YA 3NOQA 4TSFA 1XLTC 5SZKB 4CKBA 4IXDA 1QV9A 2IPMA 3A4MA 3OSUA 4MVJP 4Z8YA 3IV7A 4K1LA 4UVEA 4E5VA 3KLNA 3KSRA 4RLQA 1Z3CA 2YV1A 4DMKA 1JQLB 2PA0A 2WTAA 3G7NA 1SQ5A 1GL7A 1FMTA 1H22A 2C5FA 2HGZA 1VSTA 3FRIA 1MC5A 1QXSA 2XLBA 4JYBA 2O2EA 2NXJA 4KWHA 3A06A 5HBGA 4ER5A 5I4IA 1YV9A 3GT7A 3RJMA 1U0EA 5KSWB 1QZZA 2CZQA 1CUUA 4KLRA 1P4SA 1T1SA 3F73A 2AOXA 4GP7A 4RWZA 2GZHA 3M6XA 5BVGA 3PE3A 4QSHA 1XNRB 4GC5A 1YZLA 2EEPA 3EEBA 3CONA 1KO5A 3JYOA 3N53A 4MPDA 3DB1A 4N8SA 4ND7A 3O1JC 3C5HA 3LBHA 2PX6A 5DW0A 2P4EA 3RIMA 2OCXA 1EZ4A 1R6BX 1PP4A 1XOIA 1GZHB 2MR5A 2QX9A 1KI4A 2DLNA 1S2DA 3PF8A 4FNOA 2IY9A 1KE2A 3IAS1 1TNDA 4N03A 3K8YA 5ER9A 3ESBA 4JJAA 3V4ZA 2GUGA 1Q5PA 1E89A 1G2PA 3ZEAA 1D2CA 1KFEB 5EHZA 5EE0A 3IKJA 5KNCA 3HJNA 3F8SA 2YXPX 2PX2A 1IXYA 5C1IA 1PX0A 1AZTA 5EZSA 2OZPA 2BH9A 3A2MA 3GLSA 3KLBA 3ZC3A 2OK7A 2WC1A 4BVKA 1H8HD 3KX2A 221PA 4QBHA 2WILA 3DBRB 3IPLA 4LYJA 5IU6A 1XTKA 1AKEA 1ZNQO 2NV0A 2XD9A 1E2KA 1FMCA 4M9CA 4U1RA 2HIMA 3A6JA 3CNEA 3L3BA 5H81A 1UZAA 3GYBA 5JTUA 1U02A 3FWNA 5ISMA 4E6EA 5JQWA 5IT0A 2F8MA 4F7DA 1FTNA 3VR6D 3KSZO 2J7PA 4N47A 3OD5A 4EB6B 4DQXA 2DFLA 3UMJA 5KSYA 4H3KB 2V5UA 4U6QA 1AHPA 1EWQA 2H1WA 1HDXA 4EA9A 2WMYA 5KKNB 3M3DA 4EW1A 1V47A 5ALLA 1E2IA 1CF4A 1PHPA 2ZITA 5HW0A 3OE4A 1Z5NA 2A57A 4IO1A 1U7UA 5AW2A 1U5BA 2O6LA 1P62B 3HCWA 1CDOA 5FBQB 2EWMA 1SU8A 1Q1GA 3AZPA 3EVCA 3CSSA 2Z2YA 4EJ2A 3ADBA 3A37A 1UADA 2ZUCA 4P0TA 3B5EA 2VH2A 4GC9A 1M66A 1HQKA 3I9LA 2BV3A 3M0EA 3Q3VA 3P5BA 4JZKA 2SCUA 3BB4A 5KTSA 1TGYA 2IYNA 3UHJA 3MN1A 3Q2OA 4MS3A 1N6HA 1Z08A 4GSLA 4NYMQ 4MUJA 3UEOA 4A8JA 7REQA 3E48A 3FFXA 1X6VA 2CN1A 1NMZA 5MGNA 2JLBA 3FR7A 4S2UA 4K86A 2XGSA 1X94A 4R71A 5KTKA 4WLFA 1RIIA 3MRSA 2B3TA 3MFQA 5F21A 1D1SA 3KELA 5TGTA 3O31A 3K09C 2VDNB 3TMAA 1SKUA 4X7RA 4HTFA 1G4AE 1QF7A 3T9DA 2XE8A 3G1UA 4NMMA 5K4HA 1GTVA 1RM4A 1VI5A 2WSSD 3DZKA 3NTRA 5EUBA 3OH8A 3SOPA 1H8HA 5LOVA 3QX9A 3T61A 4B71A 5I9IA 4MITA 2Q21A 1M75A 2FZCA 3D6TB 5IM4F 1M0WA 3GPBA 3QLEA 2HQOA 3R9KA 4UKDA 1PGNA 1KEKA 4L3WA 4PZUA 3ZPXA 5JNUA 4YRJA 4DA4A 1CIPA 1D3AA 4L75A 1KI3A 1PJZA 1Y9EA 2A1IA 2WTMA 1B2RA 3NAGA 4NCJA 1QU2A 2CL0X 1I5EA 1XWFA 3CQ9A 3TEMA 4N39A 5JW6A 4AZTA 1X8JA 1OVGA 3ZV4A 4B6QA 3A27A 2HK9A 4BGVA 1NN1A 1C9MA 1SUSA 4O5OA 4LNHA 3HU3A 5DSXA 1G8JA 2EFDB 6YASA 4HNQA 1NWCA 3RSLA 2F8LA 1ODFA 2V6MA 3GAFA 4X00A 1U8YA 3EA0A 1I4TD 2FSFA 2VXBA 1L5VA 3C7TA 1G21B 2HK8A 4YMVA 3UB3A 4QIHA 1RI1A 1SUCA 3FVVA 3G9UA 3KYBA 4PAMA 4F97A 1Z62A 1C3VA 2G67A 2W11A 1R8SA 3QVWA 2C2GA 3QF4B 3UNXA 5C9ZA 1U63A 4A27A 1K3UB 4L1KA 2PANA 3MINB 4UPDA 4GXRA 1QC5A 3OIGA 4HPWA 2D4HA 3KC2A 4JR1A 1W35A 1S7GA 1QZTA 3I3OA 2R1UA 5KJCA 4FFSA 1BWPA 4OF4A 1W6RA 1VPEA 2GX6A 3G3EA 3H3FA 4FFLA 4MKHA 4O4IB 3DXFA 4QGBA 4DDWA 1MVNA 5TJHA 4YUAA 1GTMA 4HH1A 3OMWA 3PGKA 1BEEA 4YWJA 3Q0TA 5KTNA 1Q7CA 1RQLA 2FPGA 3NPAA 4IYRA 3E81A 4CHTA 2PNFA 1PVOA 1CUXA 2ZRCA 1CLEA 2ZXEA 2FP3A 1PWHA 2XHEA 2BMVA 2J0SA 1G98A 4QQRA 5E6UB 3U81A 4RBNA 3N5CA 4Z7OB 1G63A 4U6SA 3GPLA 2Y4NA 1DJNA 5IASA 2OBYA 5TPWB 4X60A 1MW9X 2DC1A 4M1OA 4B87A 1QKKA 4U7TB 3SC6A 1EVYA 1RMYA 1PL8A 3Q4GA 3WBJA 2BTOA 2PKWA 2INGX 2IPXA 3PSAA 4GVPA 3FTDA 3EUWA 3GG2A 3L8DA 1VL0A 2FXIA 3LWDA 2AJTA 2P0YA 3H9BA 4PQYA 5D3MA 4H08A 5LJIA 5IM4A 3SBOA 4MS4A 2JA1A 3I8OA 1VLJA 3TQFA 3AC0A 3TG8A 2C3YA 1I1HA 1U81A 2VJMA 3N58A 4M8KA 4M49A 3CWQA 3RTDA 3WZ2A 2H06A 2F00A 4KYTA 3U16A 1QTIA 1HEUA 4YCBA 2YL2A 4UHDA 1GAEO 2HT6A 1IRIA 2Q6VA 2FYTA 1WL8A 3B9PA 3D5TA 3EXIA 2H5LA 3IPXA 4L78A 2R62A 3GJTA 1RRFA 4H1HA 3UXHA 1W34A 4DCOA 3CLVA 3PPIA 3F6CA 4LKRA 1JSXA 3K9HA 3UMYA 1JQEA 1P45A 2PZEA 4N3BA 1XRSB 2NQ8A 1KMNA 2N75A 1NLZA 4BFUA 3ROTA 1U6JA 1IHXA 3R23A 1D2RA 3ZBTA 3FVTA 3WIDA 4EX6A 3CW2A 2ODBA 1JAZA 4M0FA 2E21A 3G5MA 5ALZA 5AUQA 2VDWA 2Z2KA 2CSXA 1U9YA 3EPRA 5IC5A 5DM70 1VSUA 1PUIA 3A8TA 2QMHA 4X63A 3EBPA 4V1CI 1WZNA 2BM8A 2VYQA 1C0IA 2Z6VA 5DCUA 2XJ9A 3JQFC 2Q8PA 3Q88A 1K5PA 1L3CA 2GAJA 3DAYA 3M3PA 3MG9A 3TX2A 3QU2A 1NDHA 1FK8A 1WUYA 3QLVA 4B3BA 3IV9A 3EMVA 3LMKA 5SY6A 2GA8A 1VGQA 4LHZA 4AJPA 4JJ7A 4B4UA 4G8BA 1JDJA 2D1YA 4A2CA 2XRYA 3P2IA 3F6RA 2GRJA 3E3LA 5HIIA 1QRTA 2JANA 3FCOA 5TQ2A 1N6RA 4OQPA 1RM0A 2Q7DA 1KFCB 1X42A 2DETA 3HEMA 1IUPA 1U04A 3GEGA 3HYLA 2E2WA 1P72A 3PXXA 4QLAA 4DLPA 1DAOA 5IC6A 1LK0A 4KFCA 3OOWA 1ECPA 4K9PA 1SD5A 4ZRMA 3UAOA 2YKGA 3CZCA 1AKTA 2BEKA 1XRLA 3COYA 4RDXA 4KR2A 4M1SA 2VOEA 1KDPA 1NW5A 1WB6A 1IN4A 3VHXB 2FSGA 2UYGA 3AUJB 3OIUA 4NNJA 1NY5A 2PTHA 4F2DA 2C4MA 3G89A 3V97A 2XTAA 2WF8A 2GVZC 4TYMA 3OHSX 1ZLXA 3TLXA 2GAAA 3ZJ5A 3FMFA 1XEWY 3IPAA 2IXBA 4L5YA 4II3A 4C0SA 1I30A 4AECA 2H51A 2SKDA 3B13B 3FAZA 3KEGA 3T1YB 3BDAA 4D1YA 3C2QA 3HDQA 1FLNA 4QECA 2D0OB 1J09A 4EY6A 3SICE 4L15A 3SFVA 3CLKA 3LWNA 2WICA 1ZUNB 3KS9A 3LBAA 3OETA 1GQSA 1AHIA 1YR1A 4KB5A 4NJMA 2WDZA 3ZN2A 4QPZA 2PR2A 4EGSA 3N2KB 3WGNA 3T3HA 1CY7A 2IYQA 1NVBA 3GCZA 4PHHA 2EFGA 4QYIB 2Q5FA 4CM9D 5I9LA 4EKEA 3TKYA 3ZZUA 1B15A 1H69A 3OFKA 3W8RA 4LYHA 3B5IA 4QYSA 2YDYA 1BXZA 3TZLA 2F1HA 1IZ9A 4UZEA 4M4SA 2PUTA 5SV2A 3EZ9A 5T3UA 4WLOA 2PU7A 4F9GA 5AR1A 1JIUA 3H7AA 3GJYA 1O6CA 3ZKWB 2NU9B 3BGOS 1X1AA 4ZVLA 4CDGA 5HBRA 1YVDA 3P9CA 2H48A 3D59A 4EO7A 2BMWA 2HF2A 4TQUS 1D09A 3OE5A 3S2GA 3JRXA 3QX8A 3GEDA 1Z4OA 5JDIA 5C7LO 5FNVA 2C4TA 5FTWA 5IBPA 1Z5ZA 5L3ZA 3PBKA 1JTVA 4QELA 5ALJA 3BDVA 3PHGA 3OAAD 4JSRA 5JSKA 2OCAA 4FX5A 1T8SA 4J1QA 3WK6A 2VZEA 2GASA 4YA6A 2VN8A 4BLVA 1JDVA 7GPBA 3R3ZA 4L9WA 4RD0A 3AK4A 4TTPA 2ZIWB 3NKLA 3IX7A 2XCTB 4QX6A 4RHEA 1MF7A 2F4NA 5EMMA 3AETA 3HDGA 3CIFA 1F6WA 3OFJA 5CFZA 2JGLA 3TGLA 2NGRA 2QTGA 1V8ZA 3JQBA 4Q9DA 1XQ6A 3CRVA 3CLSC 3TBKA 2HPZA 5JRZA 1LEHA 2OMKA 4HWPA 3AG5A 1LDMA 5K8LA 1EBUA 3AEUA 5F4BA 2WU3A 1Z83A 1MQAA 3IIJA 5EA2A 5HNKA 3ZGLA 5MN5A 1W2WB 1DJPA 2HYIC 1G5HA 1BWSA 1JR3E 1T3GA 1YS7A 1TTTA 1RKUA 2GN6A 3CT4A 1C7EA 1UMCB 2D5IA 3K53A 3TSYA 4ZZIA 1FP6A 1QIEA 4RWEA 3AJ8A 4DMUB 3C8ZA 4B3SB 3JQAA 4PW0A 2F7SA 4KUGA 2WAAA 3MZ0A 5H9WA 5KU7A 1XF9A 4QQNA 2OG2A 1NGSA 4RSHA 2VZ8A 3W04A 1O4VA 2YV2A 1H5NA 1L5SA 4MK4A 4JOSA 4CV0A 4NDAA 1M34A 3F6PA 2P6RA 2I3ZA 1Z5VA 1MX1A 4CLEA 1RYDA 2B83A 1MRSA 4FWBA 4LX8A 1ZK4A 3H5LA 4AX4A 4ZYWA 2R8OA 3M6FA 4P4LA 3UJDA 3TLZA 2FVXA 4BBJA 3UATA 1E5QA 2R68A 3NHSA 5JANA 1A9ZA 1VLZA 4U7HA 3SZOA 4BNFA 2B5VA 2YIMA 4YRSA 3LBNA 3PTLA 1FDVA 4G1MB 2G40A 4U5XA 1T6NA 3IVCA 3KOMA 5BRNA 3A0UA 1UPFA 2P8SA 3B1WA 1VLQA 1X38A 2ZS9A 3GDWA 3CF6R 4H7KA 1ZS9A 3W5IA 4DABA 4TV9F 3G7SA 5I51A 1H4TA 2TYSB 4H0CA 4N5HX 2OXIA 3AHGA 3EIOA 4LMAA 1OB5A 3O1IC 1K8ZB 4GRDA 3SGLA 2XRFA 1XDGA 3L8FA 5DBFA 4C30A 2QNIA 4FFVA 1ZAYA 1TM7E 1Q1ZA 4KSCA 3TD2A 3UJ6A 2J9YB 5JSHA 4W5OA 1IVNA 2GERA 4EQ6B 3QSYA 4JBYA 1E6KA 2GM9A 2ZR9A 2D54A 3LG2A 5HFJA 3O8RA 4N48A 1AK9A 4A0RA 2A58A 4G0ZA 4CCYA 2B6NA 1WU8A 4I36A 5EMJA 4U2DA 1HE4A 4HPJB 3N05A 1LFAA 2FU5C 2PKQO 4QLBA 3IL2A 2RHMA 2J5KA 1VKOA 3N9IA 1SXJD 1ZSNA 4KN8A 3C1TA 1JDPA 2W5UA 1JQKA 1GGJA 2HY7A 2YXBA 4QNNA 4D02A 1K7XB 1FSZA 5LDHA 4H1TA 4FCTA 1QGUB 1T5SA 4Z3OA 3AZQA 2OFXA 3RYCA 1SPBS 4Z4IA 2AG5A 2PSJA 2ODWA 4CYMA 2DTXA 1H8EA 1XEWX 2XE6A 3IVGA 4XJXA 3SLRA 2DTDA 3DHEA 3GFQA 1PEYA 4M0KA 4RIHA 3PPXA 2NUAB 3ZHCA 4BFZA 4DADA 2QR2A 2YJ3A 4GI5A 1GXSB 2CFSA 4WZAA 4EFLA 5K0FA 1OBOA 2QSJA 1JXQA 3G0DA 3BF7A 3CINA 4RY9A 5ED4A 4B3JA 4EDFA 4G0VA 4DLKA 2Y0PA 3S1AA 1M6VB 4AJEA 2JGNA 2AFHE 3KE8A 3FYDA 3VUFA 4BCCA 1UP4A 1E1YA 5J43A 4BNNA 1FDOA 3FY4A 5DGTA 1QX4A 1WP9A 3IXLA 4PZ9A 1M5TA 3KFVA 1QQ5A 4RH1A 5K3CA 3IURA 1WBDA 4FGUA 3R3HA 2VCHA 4D0NA 1V5EA 2GHIA 2JFNA 5EP2A 4IDCA 3KVNA 2PSHA 1F1BA 3LUJA 4PVDA 4HKTA 4BLOA 1A82A 4P38A 2WHXA 2QMOA 4IHJF 4BASA 4DE5A 5K20A 1Z5UA 3AEKA 4AY5A 4IH9A 3L1VA 1GJRA 4KQ2A 3COPA 4M60A 5EJAA 5I3CA 2EFCB 2UUPA 4TV9A 2NPFA 2GZ3A 2JFVA 3FA2A 1JW9B 5KYTA 3T7JA 1OLXA 4MPPA 4EY7A 4AUNA 4GMHA 1TMYA 3GCXA 3IGFA 5FUXA 4EI7A 4K2HA 4A73A 2B21A 1V1JA 3KFXA 1CUHA 4EM6A 4DBLC 1SXJA 5JAMA 1K63A 4M1QA 4ITVA 3UUWA 3AV3A 3ZX5A 2JJ2A 5KTOA 1OCEA 2H1VA 2O57A 4DTCA 3ZDDA 5SY4A 5KQRA 4WDQA 2O8CA 3AL0C 3L7OA 3WSVA 1H65A 2QZJA 2VTEA 3ECSA 4GM4A 1C0EA 3WRXA 4BB9A 2QTVB 1OFIA 2OG1A 1Q19A 1VKHA 3IUQA 2O2SA 2A9KA 3NJRA 2WU1A 4L6CA 3BH7A 4DLNA 4QATA 4YRGA 5FADA 4TTRA 3TMYA 2BPOA 3HVUA 4W8GA 1I5OA 2OGWA 3MLAA 3IP9A 3KTFA 2HUPA 2VZ9A 3MFYA 3N39C 1ZONA 4P1ZA 4QU0A 4R8VA 4DIMA 1KXJA 4RQBA 4I4TB 4L5CA 4AF6A 3OZTA 1BVUA 3B1ZA 1AE1A 4OQFA 3GOHA 1NBMA 1CERA 4L8YA 4RHFA 3WGYA 1JT9A 2R6HA 2ZXUA 3L5KA 2QRNA 4MRVA 4F9TA 4LMBA 1IPFA 2I4IA 1W5TA 5KNBH 2NXEA 3EDYA 4EX7A 1P5RA 4TWZA 1LJLA 1NQAO 1VGVA 3N6VA 5K05A 1BS1A 2GKSA 2WM8A 3U7QB 1EKXA 3AJEA 1WTAA 2CFTA 3M9WA 1MW8X 3JARA 2HTFA 5ELMA 1E0DA 1T9DA 1XYYA 2H2FA 2J45A 3IOCA 4IVNA 4N82A 4QUHA 4XYMA 4AMYA 5KOHB 5EWJA 3WK4A 3GR6A 1RKQA 3KO8A 1GZDA 1I2CA 3BL8A 2W4IA 3QTTA 4TRJA 1PYDA 5JWHA 4IIJB 2YHUA 5TMBA 4C0BA 1AV6A 3HUDA 4O0LA 2XTJA 1M1YE 4URXR 1EVZA 1QIGA 4BTVA 1QFSA 2O1WA 1Y7IA 4GVXA 4OGLA 2Z5VA 5IH7A 2I0FA 1G3IA 5HVNA 2IPOA 4KXNA 1YDHA 4ZOBA 1Q1NA 4MIKA 1LSSA 4IHJA 3IDFA 1NMSA 2QD5A 3V4SA 3M5DA 4MQ4A 4HQ0A 4YBZA 1KFBB 4XGIA 5B3JC 4NZ9A 4J7XA 1R5JA 3F4KA 4IIEA 1PT9A 3U60B 1TQDA 5IDQA 1TRHA 3TRDA 4AKSA 4X6YA 3LE8A 4JS0A 4G5HA 4V0NA 4XB6B 2XUGA 4B48A 3QKRA 4YR9A 1NW8A 4BBPA 4C7MA 1QU3A 3GMDA 1UBSB 3R3SA 4BE9A 4XE5A 2H8GA 4A8HA 4YDHB 4BMVA 3S7TA 3LAWA 4KBGA 3TOVA 1X19A 3EFEA 4X61A 2V7UA 1S4QA 2CKDA 3M6AA 2RGCA 1W94A 3RVPA 5SZJA 4FWTA 1T2FA 2O2IA 1IB6A 3M81A 1C9YA 2V98A 3H5IA 3HNRA 3WO1A 2K87A 1COWA 4BNMA 4TKVA 4C0QC 1LPPA 5AICA 5JJLA 2EFYA 3T9AA 2O8BA 2XNJA 4JROA 4CM5A 2RK4A 3WGUA 1TUBA 5EYPA 2A9RA 3A3NA 1RMTA 1ZD3A 3DE2X 2GFHA 2OBNA 4LW8A 4JI8B 1OPRA 2B4QA 3DR5A 5BW8A 3DMGA 5D00A 3T1HB 2BFOA 5CA0F 2WD7A 4DV4B 2AX3A 1YVPA 4INJA 4ZODA 1N2SA 3LT0A 2X8BA 4BN5A 2HJGA 4IILA 4NG4A 4OH1A 2ZUFA 4KQFA 3VR1A 4TXJA 1P60A 2FZ5A 2J3DA 2W7TA 3GRFA 1G6HA 3BMCB 4E2XA 2QOEA 3Q8XB 4QOEA 4GDFA 4MWCA 4X3CA 1YK0A 2AUTA 3GYGA 1RPNA 1QM5A 4Z7JA 5BQXA 2JLWA 5HMMA 2HQ1A 5TS3A 1T9CA 2B9EA 4DY4A 4BNUA 1YRWA 5I7AA 5BSRA 1A50B 2JATA 4AZ0A 5HGXA 1Y6RA 1ULZA 3LWZA 4GDMA 1Z0SA 3RIYA 4YMTA 2C83A 3QRWA 1Z4QA 5ECGC 2GZ2A 1N0IA 3W9BA 3UYLA 3J81A 3HKEA 4CGZA 1KJNA 3L79A 1ILEA 2PYZA 3X1MA 1U5BB 5ARCA 4DNPA 5B1SA 3FOWA 5C46F 3LF1A 4PYLA 1E9DA 2PVCA 2WSMA 2QMUA 4GPAA 4JP3A 2PH7A 3N8GA 3EG9A 4K87A 5LBUA 1WDLA 1KJJA 2HPVA 2QZ9A 1W87A 2WSIA 3HR7A 4I6EA 5L3QA 3CGWA 4LNUA 4WK0B 4DUYB 3RT9A 5K03A 1OXBB 3BFKA 1TT5B 1MMFB 3SX0A 4A6EA 3HYSA 4MZDA 3GV0A 3LDHA 2C3PA 4A8JB 2AFRA 2EW1A 4ENPA 2FWRA 4Q03A 3RHZA 4C5BA 3EZ7A 3IEVA 3FGNA 1ZPDA 1JZTA 3B36A 2DQZA 2OZLA 1VL8A 3VPBA 1YAHA 5HQ3A 3UBTA 1Y7HA 4PNZA 2I4OA 3E9ZA 3N76A 4Z4HA 4Q4JA 1UWVA 4ENUA 5JT1A 4HTFB 3CNOA 1EX7A 2UZAA 4Q3LA 3WBFA 1M6EX 3TNFA 3Q9SA 1ZVJA 3EF0A 3QA3E 5FJJA 2G1JA 2ZTLA 3GC6A 3PX7A 1L7BA 1VE5A 1XZMA 4ZDKA 4TRMA 5GM2A 10MHA 2W6JA 5AOAA 3OA0A 5ICSA 4JB3A 3KUUA 1P6QA 1JG2A 1OTYA 1YU6A 2AMVA 4JL6A 4R69A 3OTIA 3IHLA 4Y2YA 5EIAA 2WF5A 4YRIA 1AO3A 3K3PA 1QH1B 1O6BA 4GM1A 1M8FA 4X5OA 5EFZA 3C8UA 1QG2A 3CR7A 1KWKA 3UMFA 2R6FA 5AP9A 5IUJC 3G8YA 2PH1A 1K9VF 5CA0A 3LBYA 3AVWA 3QTLA 3KTDA 3RLIA 2AF4C 4DOMA 4UE6A 2R44A 3G9ZA 3WKCA 1OH5A 1YR2A 4DG8A 5HCIA 3EGXB 3M5PA 4KAXA 4Z3KA 1GAXA 4YQZA 4UOEA 5A2GA 2XRZA 4TTVA 4QKQA 1VP3A 2CFOA 2IBTA 4UVHA 5EKTA 4ARIA 3NW9A 1LV7A 1KK2A 2I1LA 1CK4A 2BONA 1O95D 2GBCA 2P4HX 1AQNA 3WGKA 1DO2A 4KXQA 2A86A 1Z47A 5IDYA 3TXAA 4MPJA 5HA5A 3TRHA 4QJIA 4DIEA 1H94A 1XZCA 3EXG2 4E1BA 1GPYA 1Z7WA 1LNZA 1V3QE 3D7KA 3EWSA 1E1NA 1D1QA 3MS4A 1DIHA 1C2YA 3U3DA 5EINA 4YMHA 1QC5B 1MO5A 2MSWA 2V1XA 2G1UA 4ZVSA 5KJ6A 5BNWA 2KYRA 4HWOA 4NENB 2O2DA 1X9GA 4X91A 3ABRB 1DRJA 3AUSA 4DSNA 2KM1A 5BN3A 1U7DA 2RK6A 3BFXA 2VTVA 4FQ7A 3PTAA 3IPRA 1PT7A 2A94A 3NBZC 4WN9B 4FFDA 1HC7A 1ZI6A 2LBPA 3EARA 4H7PA 3RYFA 1XZNA 2AD5A 5A0FA 2VC2B 3JPWA 1AF7A 8AT1A 8ABPA 1P4GA 1QO9A 2Z56A 4LZPA 3ZCTA 3H6GA 3AH8A 3IIIA 2HA5A 3EMDA 5EMHA 2OM2A 3SIPA 4WOPA 2ZYGA 5TEVA 1SA0B 3QQ5A 4ZT4A 3WZMA 4E5PA 4P3YA 4F72A 2I62A 2JKVA 4PWYA 3RG8A 3WMXA 5JATA 3RW9A 2FN7A 1Z4PX 1M2VB 2V5VA 2VHVA 1EWYA 2IXGA 1MB9A 1I3CA 1SD1A 3A1UA 3TZCA 4BE7B 4PN7A 1MG5A 2CDBA 4OU4A 5C5EA 6LDHA 2YN4A 3RSHA 4F5WA 3PD1A 3GGGA 5CCBA 2J59A 3GPCA 3ZIAD 2R8XA 4XUCA 3U4HA 4OHMA 1VHJA 4RCZA 5IZCC 4BWGA 2CYBA 3SVLA 3WYFA 2N46A 3HCPA 5AK3A 3Q41A 2A78A 2R751 4MS4B 4PIPA 3LXUX 4HH4A 2JFYA 1NF2A 3G5LA 4W9NC 3HPRA 2WD8A 3R0JA 2HWXA 2VJMB 4XVHA 4IIXA 1M1XB 3DVAB 3HKCA 5JISA 3U6BA 3PJRA 3W79A 2PMKA 4KW7A 4Q4CA 1KZYC 1UBLS 5BW4A 3ZGXA 4UQLA 3DO8A 3O3CA 4FZRA 2E6UX 2Q1SA 4FXOA 5HRUA 5HKKA 2QN8A 3EAGA 1DZIA 4QGFA 5GOTA 3CUWA 1CXZA 4OXYA 3HCCA 3MQ4A 3O03A 1ZOOA 2QVLA 4GMKA 5AKHA 3GZ4A 4R9VA 3MYRA 4UTRA 1BKSB 5BNIA 3THSA 1KEZA 4ALKA 1NR5A 4BNDB 1R9NA 3MS2A 1MNAA 2KX7A 1Q1QA 4ZAWA 4MGIR 1T2EA 2C8JA 3NNSA 3SSOA 2OXEA 1F12A 5EZ5A 1A2KC 1XEAA 2RHDA 4MICA 3SDBA 4Z4FA 2HMYB 1JR4A 3QH4A 4J07A 3B5JA 3CPSA 4KMOA 1C9NA 1E3EA 4E03A 4QNRA 3CPEA 4P7KA 5CDUA 1NSYA 3EH1A 3DO5A 4GHWA 3FZEA 1LVUA 2J67A 4GMGA 2RHBA 4QL3A 3I58A 4TOIA 5JAZA 1LJ8A 4EKYA 3ZG6A 1F2UA 3EVNA 4NL4H 2GD1O 4JQSA 4ZI2A 1X1QA 5ULLA 2PZMA 5FBWB 2R84A 1T5DX 3DMRA 3BZWA 4RKFA 1QHIA 1YIDA 5B2FA 1G17A 5TQ2B 4JI1B 1AGXA 1XZGA 5E2AA 1RXSA 1SN7A 3ZIAA 2XKJE 2X5KO 3SI7A 1GYRA 4D5GA 1IL0A 3ROGA 3AINA 1RM3A 4FBMA 1QTNA 4AM8A 2ES4A 4DKJA 1BMFD 1ORTA 3AR6A 3JYPA 2OC9A 2FWNA 1U3UA 2YWJA 2IPNA 2Q5LA 4NX2A 1E6EA 5EPEA 1XXHE 4N0PA 2OCKA 3NTVA 3RVMA 1FJ2A 2B7LA 2ZIUB 4AS1A 3GZNB 4FI3F 1T3SA 1XZPA 3LO8A 4JC0A 4QTUB 4QOFA 1UBTS 1XBTA 2FJ0A 3EIUA 3JR3A 1Z75A 4AD8A 1ADCA 3NHYA 1SG0A 4DRXA 4EARA 1GZ4A 2IS6A 3RI3A 3VR4H 1RTTA 2RGDA 4FXPA 4S1OA 1ENYA 2P9CA 3C3DA 3GAAA 3HSKA 1C81A 1DAGA 2PX0A 2R87A 2RAFA 3HA7A 1N9KA 4IDGA 3U1VA 2R5WA 5HQJA 3EDMA 1FXSA 1L5YA 1AF4A 4NJMB 2IEYA 1X7YA 4Q4AB 1HYGA 5A7GA 2WHPA 5T6MA 4IUBS 4YP6A 3HE3A 5TS2A 3CVOA 1Z4NA 4EG3A 3ICQB 4W9RA 2JARA 2QPOA 1H66A 4RM2A 1KARA 2C3MA 1EUYA 1SWWA 4WRRA 3PLAE 2O8FA 3L40A 5H16A 5CT6A 4Y2VA 1ZIPA 1G16A 4CM4A 2GK7A 2FZKA 2C7OA 5KOJA 1LBQA 3IELA 4E09A 1TEHA 3FFWA 3AUAA 5DASA 1DSSG 4WL0A 4OSPA 4DQ0A 5JROA 2P68A 3THWA 3R9IA 4PPQA 4Y6SA 5T67A 1O03A 3C7CB 3RIGA 3OP1A 4BZZA 1YT5A 3LYUA 4MZXA 1IXSB 2BBSA 3M1IA 2OCIA 4HUQA 2OBFA 2HCFA 5FNVB 2MSLA 1GWNA 1RWKA 1BMFA 1HH4A 2OUKA 3O8QB 1M72A 1RW4A 1A8UA 2P5UA 2H07A 1NJ2A 4FGKA 3ROXA 3VRHA 4BLPA 1QQTA 3UQYS 1DRWA 1PKEA 3MBIA 4E2FA 1XMVA 2X4GA 1JEQA 1G64A 1L4FA 4P98A 4HAIA 2WJJA 1ONBA 4RH3A 2WI8A 3KJFA 1TLTA 3L2OB 5EE3A 2QSZA 1WM1A 3UUFA 3IPCA 4FB4A 3KEFA 1ZG3A 3IKMB 1SBZA 2FPKA 2P4UA 1N6OA 2XWJI 3AETB 1NURA 2YS6A 4Q4HB 1G8PA 4KDFA 3LF2A 3SYNA 1KDOA 2B8JA 2ORVA 5KAMA 2PK3A 3WLOA 2IITA 3TQSA 1FYXA 2VA9A 3FNEA 4C4RA 4O08A 3IMEA 3DFZA 3HRKA 4ALIA 1CWUA 4M0MA 1PX2A 3MOGA 2WF7A 1T5HX 2Z4SA 1OI3A 3HJUA 4GL4A 2VQDA 4B3RB 4CU5A 1POXA 2G70A 4LRUA 1RMQA 4Y2UA 3RREA 3AVVA 1G9SA 3KSMA 2W43A 4MGEA 4A91A 5AQ1A 1OU0A 3O21A 5AOBA 3EZ6A 2NXWA 4JUAA 3P9RA 2J0VA 5EZYB 1CCWA 1LK5A 1WY5A 3U7FB 4IG4A 1YL7A 3RK4A 3IAXA 4UPEA 1LTKA 4MHTA 1BHSA 3FPLA 3RH0A 1DG3A 1N7JA 1PFUA 2FW0A 4NU8X 3OLXA 4M0EA 4RTMA 1YVRA 2EZ8A 4V38A 1M5UA 2IYXA 1XTIA 4XX0A 2ONJA 5IULC 4C76A 2XQGA 2WTBA 2YXNA 5AW0A 3T9FA 2IHBA 5EQDA