2RGEA

Crystal structure of h-ras-gppnhp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
166
structure length
158
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oncoprotein
molecule keywords GTPase HRas
publication title Transformation Efficiency of RasQ61 Mutants Linked to Structural Features of the Switch Regions in the Presence of Raf.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 158
sequence length 166
ec nomenclature
pdb deposition date 2007-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2rgeA00
3KUDA 1YRBA 4QOSA 3K53A 2FGJA 4AYWA 2V7QD 1HURA 1S9HA 1VCOA 1UJ2A 4OI4A 2ZEJA 2VF7A 5AJZA 4RD3A 1CBUA 4AWXA 2VEDA 4QBFA 4GOKA 4HZUA 4KXFB 2GDJA 5EXPA 4EDHA 1PUJA 4DLTA 3TVDA 4A92A 3QJYA 1IONA 2OZEA 3WHKA 2A9KA 3CRRA 3H1TA 1ZUNB 3AGQA 4TTQA 3G0HA 1W44A 3W8RA 4AKEA 2O8FA 1GKYA 1V43A 3WMFA 5FPKA 1DAMA 5B64A 1HEIA 5DN6D 1HA3A 2G0NA 3EWSA 3P32A 1ELOA 4M1KA 2XOKA 2HYIC 2C99A 1E2HA 1T0JB 4I99A 4TMZA 1NSFA 1ZRHA 3SZRA 5CM9C 3FOZA 2VYFA 5FTLA 2J87A 5H68A 1OYYA 4V0OA 5IDVA 5L3RA 2Z4SA 3EZ9A 3TNFA 2IYQA 2ZIAA 1F6BA 2Z43A 5JRJA 2AXPA 3BH0A 4MRPA 1NKTA 3RWMB 4D82A 4F92B 1CLUA 4LRWA 1C1YA 1ZNZA 3AF0A 1S3SA 3K0CA 2BWJA 5JCPA 1QHGA 3P27A 3SS8A 4AI6A 4L9SA 3U2QA 5GJBA 4IKEA 2QP9X 2XNDA 1G8PA 2JLSA 2D06A 4M9ZA 1E0AA 1NG1A 1D2NA 1VDZA 1YR8A 2X2FA 2ZJAA 5JJLA 2G3YA 2YWHA 1E6CA 1W49A 3WP1B 1CJKC 4G5OA 4JKYA 4OHWA 2GEUA 1JALA 1KO5A 1IN4A 4C0JA 2WTUA 2B21A 1NF3A 5FTMA 4GRAA 1IXZA 2PL3A 1G8YA 3CBQA 4GL2A 1T5IA 4KV9A 4DLRA 2DB3A 1KSHA 2AX4A 1OFTA 2EFGA 2R8RA 3R7WB 1SXJB 3QKRB 4A8JC 3IIKA 1G6OA 4GP7A 4DCVA 1KSJA 3T1TA 2JIZA 2TMKA 1JAIA 2EVWX 4LWZA 4Q4JA 4DJTA 3K70C 2QMHA 2QE7D 1YZTA 4C3ZA 3ZVLA 3A4NA 3AUYA 1OKKA 2AHOA 2VBCA 1OFIA 3T12A 1SVWA 2P6RA 4BFYA 1YE8A 2ODEA 1UDXA 2FFAA 4LBZA 1YZQA 2NQ2C 1J7KA 3UXMA 5EE3A 1Q0UA 1GKIA 2XSZA 1WP9A 2PLRA 1E4YA 1Q1QA 2OM2A 1E1RD 3KFXA 3KJEA 4KVAA 1MO4A 4M9SA 1G18A 1QG2A 4V02A 4QM6A 1E2GA 3M0EA 3I8XA 2OCPA 2H8KA 1VCIA 2OBNA 3AF4A 2C98A 3A1VA 1NVVQ 4IDHA 1OH7A 1KOFA 4B34A 2ZS9A 1JPNA 2GK7A 5L3QA 1IJFA 3MG9A 4NCKA 1E2NA 1ZCBA 4DT1B 5CIQA 3NG1A 2YVUA 3GLGB 1LF0A 4PO9A 3OEHD 4II7A 3FKSA 5JBQA 2P6NA 2Q9AA 1ZD8A 2JJ1D 1NLZA 3GJXC 3X1DA 4AIIA 721PA 3QBTA 3WNCA 2HF8A 4NYMR 2NTYC 1E98A 3VTKA 5JFGA 3LVRE 1QHSA 2W2VA 2IL1A 2A5DA 1TTTA 2EWWA 2IS4A 3SJZA 3I8SA 2RGCA 3DM5A 1J90A 3UG6A 3Q7PA 4ZI2A 4ZDWA 3SN6A 1Q44A 2KSQA 3GJ0A 3T15A 1CF4A 2ASEA 2OLKA 1ESNA 2LKCA 3ND8A 1FTNA 4L5BA 3FWYA 1OH8A 2XTMA 3RC3A 2Q3HA 1KJYA 4OL0A 4OQLA 4PXAA 3OIUA 3FMIA 1M7GA 2VSFA 4NCHA 1O87A 2FFQA 4IOJA 4Q00A 4ZDKA 2OT3B 3AQ4A 4UNNA 3GLIE 4BPBA 1JNYA 4XIGS 1RRGA 2J1LA 1I4LD 1QHHA 1YQTA 4US1R 3K09A 3K8YA 2GHIA 3GJ7A 4G5SA 5EE5B 2WWIA 3THYB 2ZI6A 3SJBA 3EZ2A 4BFSA 2WJJA 3RRNA 1KI1A 4CEJB 4IDQA 2XXAA 1C4OA 2JDIA 3GQBA 5DI9A 4G3XA 4HLUC 3QF4A 5DIFA 3TW8B 5FOWA 4HUTA 1NVXQ 1LV7A 1Z0DA 1ZUIA 2CLCX 2ZJYA 4C0AC 2Q6TA 3AGPA 4EAQA 1T5LA 4YMTA 3DOEA 2JLRA 4OJQA 3Q9LA 4A2QA 3HP1A 2K5UA 3LX5A 5HZKA 2FWRA 2KWIA 4GNKA 1KSFX 1FP6A 1TMKA 1OIWA 2V1XA 1R5OA 1XJCA 4JL5A 3WRYC 2J0UA 1E2JA 2RMKA 4PAQA 4A0FA 3WHLA 1S3GA 2H16A 4HLDA 1S1CA 2W83A 2MSCB 4P3YA 1OLOA 2Z83A 5DI3B 1E1QA 1KI6B 2XJ4A 3BAFA 2RHMA 2NO9A 3QG1A 4E5UA 3GJ3A 3EPLA 1Z6XA 1E2MA 2C9CA 3GEHA 4P31A 1RJ9A 3MSXA 5FOUA 2ERYA 2PJZA 2ZI5A 4GMXA 2BMDA 1SXJE 2PEYA 4PX9A 1CKEA 1AGRA 1M7BA 4ZDIA 3AKDA 1NVVR 4JL6A 2WOJA 1KGDA 4DRZA 1GUAA 2ECKA 2C96A 3U60B 1NBMA 2QI9C 1G3MA 3D8BA 3C41J 2AWOA 4Q47A 3C4JA 1G3IA 3FMFA 3VFDA 1TQ6A 4TTPA 5AR1A 3RRZA 3WRXC 3SYNA 1ODFA 3ASZA 3U7FB 1SZPA 1E4VA 2GJ9A 4NCIA 1KMQA 2KBFA 2NO6A 1G17A 1DAFA 3GJ6A 3FFBA 3AVQA 2G83A 3A4LA 1XXHA 4F4JA 1NI3A 3R20A 2QAGB 3PXGA 621PA 3AVVA 2ZRFA 1IN7A 1FL9A 1JXMA 1A5TA 1PLJA 2FOLA 3HDTA 4Q1AA 5FL3A 2ONKA 4DZZA 4ASUA 2WIAA 1ZMXA 2GILA 3K0FB 3BFVA 4JLVA 5E95A 4EPXA 4YC7A 2CCKA 3CNLA 4FMDF 3OEED 2GJKA 3KTAB 1I4DD 3G5UA 3QE0A 3B1VA 1Z83A 4TQUS 3QXCA 2JASA 2ZVPX 3Q5DA 1OXTA 1RE0A 2GCNA 1XWIA 2UVQA 2B6HA 1AK2A 5EXSA 2CNWA 3NKVA 1JPJA 1SXJD 3HU1A 4G5RA 4GT1A 4HAZA 3QVUA 2W6JA 2QG6A 2O8EB 4RZ3A 3VR2A 3S1AB 1XJQA 1XEWX 3AF1A 1DPFA 1KDPA 3OAAD 2FEMA 1XEXA 3GEIA 4C0LA 1Z08A 2PZFA 3QPUA 3ZDQA 1E2QA 1T8TA 2EFEB 1ZC4A 3TE6A 1IXSB 4N0DA 1G7RA 2BIFA 2C9YA 3TAUA 3PCRB 1WCV1 2IYYA 2NIPA 4E07A 1M6NA 3A37A 3TW4A 1HTWA 1D8TA 2PCLA 4FN5A 3LXXA 3TQFA 4HLUA 4RY2A 1E2IA 1X6VA 4R9UC 4KODA 1XX6A 1OT3A 2HEIA 2GWHA 4DCNA 3CZQA 3EA0A 1IQPA 3O8DA 2R62A 4QJ4A 2YWGA 2JLQA 2F1RA 5G41A 1YR6A 2WJIA 3NDBB 3WMGA 2A3RA 1JEDA 1FW6A 4K46A 4KLNA 2QT0A 4MDFA 4EJSC 1MO6A 3VR3A 4Q01A 3M4YA 3AP2A 3EARA 5KPDA 1Z29A 2E1RA 2J46A 2OFOA 1Z0JA 5J47A 1R6BX 2GXUA 5KU1A 2CL0X 3AKYA 1NY5A 3ZJYA 2Q3MA 2YC4C 1ZCAA 5KOYA 1VKJA 1E3MA 2Y8EA 3D6TB 1AQUA 5EZ5A 4O25A 3C15C 3N2IA 3IPYA 4GMDA 4WXPA 1RIFA 4LHYA 4JJKA 2GXQA 4FWTA 1XD2B 1U8ZA 1JEEA 3AV0B 4IDNA 5C18A 4FMCF 1XTSA 1KAGA 1ETUA 3MFYA 1L7VC 2G0TA 4YXWA 5L3SB 4BUJA 3U4QA 1LF5A 1QHXA 1TUIA 4MGIR 4Q9JA 2RGXA 4UNQA 1YKSA 3LO5A 5F2EA 1WXQA 2RCNA 3BH7A 4ZIRA 1A2BA 1RYFA 5BN3A 2GJSA 1OPXA 1ZUHA 2GK6A 2F9MA 4G5QA 4LHVA 2ZUDA 1E9DA 2OV2A 1UF9A 1AIPA 2Q9CA 1N6KA 3CF2A 4W5WA 4PPFA 1KIMA 1Z3IX 4Q9IA 3EX7C 5LD2C 2WIBA 2ZYVX 4Q1CA 4HZIA 2ZR0A 4QGAA 1DTSA 2ZRHA 1N6PA 2NPIA 2CK3D 2H7VA 1OXUA 3ZIAA 1HE8B 1FNMA 5K8UA 1E2PA 2RB4A 1HE1C 2WWYA 4OHYA 5E7JA 4U02A 3IHLA 5HE9A 3PUXA 2GJAA 4D0GA 1MO5A 3VR6A 1OXSC 4AKIA 1RRPA 1JECA 1VG9B 4A82A 3ZD7A 1NSTA 3RWOA 5KUTA 2BEKA 1II8A 1EWQA 421PA 4DUGA 1Z0IA 4RSGA 4TMTA 4B47A 4GBMA 1LB1B 4JKIA 3TSWA 4V0MA 3TVTA 3VQTA 4B75A 4EPTA 2ZANA 3E2IA 2HYDA 2ZSBA 3C14C 4CT5A 1OJLA 2IUSA 3L43A 2IBMA 5EZ6B 2H5EA 1AA9A 3PVSA 4R98A 2IYTA 1P3JA 1KZ7B 1U98A 4GFDA 2WPDD 4BLSA 2QBYB 4Q1BA 2V7QA 4H9GA 4CW7A 3PFIA 2JJ8A 4PHGA 4ZO4A 3U3RA 1P2VA 1QHIA 3AB3A 1E99A 1CR4A 4G1UC 2IYXA 3CM0A 3DKPA 2V4ZA 2A5FA 3VU9B 5B58C 2OBMA 3T1OA 3PG5A 2YKGA 1BMFA 3AVPA 4U00A 5E7IA 4PAOA 2W2TA 2F1IA 2DFKB 2CHQA 4M21A 2JEOA 2ZYUX 1MO3A 4HAWA 4D2IA 5AUPB 5CITA 5JSZB 1P9RA 1Z07A 4QJ5A 5LB2A 1KZGB 4DB4A 2D74A 1WQ1R 2OCBA 5KSPA 2GJ8A 4TSFA 1H8HA 5FBRB 4CIDA 4JIMA 3EPKA 5DN6A 2XZLA 2ZRLA 2GAAA 5C1BA 2GXAA 3KX2A 4MRSA 1U8YA 1OXVA 3IBGA 1IN8A 8OHMA 1FPMA 3ONWA 3T5DA 4EJSA 2OBLA 3WNDA 3HU3A 4JZKA 2IYLD 2VP0A 1E2EA 2IYZA 4BEBA 3F3YA 1E79D 5DHAA 2DYKA 2RGBA 3L0OA 3GJ5A 3DMNA 3L8ZA 4JLJA 5J4HA 4X8HA 1QHYA 3BS4A 4B2LA 2QMUA 1RRFA 1VYVA 4NMMA 3RDPA 3HPQA 3GLFA 2IS6A 3R8FA 3ND9A 3VR4A 1F3OA 2MMGA 1NIPA 4Q03A 5IHPA 4TT3D 3C8UA 3N2EA 2WSSD 2YOGA 1VG8A 4PTLA 4DSNA 2B92A 4BFZA 1HUQA 4Q4HB 4C0BA 3TGPA 3KQLA 2WJYA 2BEJA 1CJTC 3SFVA 4HB0A 2EU8A 4MYUA 2XZOA 1P2TA 1VYTA 3B7GA 3U44B 4M1YA 3R9WA 1F60A 2FZLA 3K9NA 4GSYA 1RYHA 3T1VA 3LD9A 3THOA 3SEAA 4FCWA 2AL7A 5EP4A 4PQRA 2BCGY 4V03A 2IYSA 1BKDR 1A7JA 3B1ZA 2DFNA 4KJZA 2DWOA 4ZKEA 1Z63A 5TVKA 3EG5A 3K0CC 2CLSA 2OUKA 4QBHA 2ZJ5A 4K8OA 2C95A 2ZYWX 3PUWA 3I62A 1W0JA 1KI3A 3THXB 4KI0A 5F9FA 1NIJA 3EIEA 1XFAA 2VO1A 3QF7A 4DIDA 5CDFE 4Q9KA 1SVKA 4C2UA 1XEFA 3EPHA 3DKVA 4FCVA 3BE4A 1PLLA 2QSYA 3TMKA 3X1XA 5SZKB 2AFHE 3VNUA 3QXSA 4PPGA 2WSMA 1U81A 1Q3TA 4JJZA 2I1QA 3A6PC 1NN1A 2B8WA 1TUEA 1AS3A 5J5CA 3K0SA 1ZNXA 2AK2A 1NG9A 2WVJA 3LFUA 4EQ6B 2JLXA 2JJ1A 2EYQA 3BXZA 1XTKA 2H92A 4OQFA 2J0SA 2C78A 1C9KA 4DEXA 3DO6A 3DOFA 3ZS8A 2WZQA 4OQXA 4BFWA 2IUUA 2GXSA 2WWXA 3F5FA 2NPFA 3AKEA 3O47A 1KSGA 5IRCD 3NEJA 1Z2CA 4DHEA 1NKSA 2IT1A 2VA8A 4KSBA 2Z0MA 2XX3A 2CL7X 3O8RA 2R65A 3PUVA 4GDFA 3MLEA 3P1JA 1W7AA 1P2UA 1IY1A 4HDQB 3FKQA 2ZREA 5DNYB 4P4TA 4LJ5A 1PLKA 2DFTA 1YR9A 5L3VA 3BB3A 3CRMA 4A9AA 3RS5A 3DZDA 3ZZUA 4PSKA 2A78A 4QBIA 2BHRA 1IAQA 2PZEA 3C5HA 4Q48A 4A4DA 3OIVA 1G3UA 3OIWA 3QXJA 2WJVA 2O8BA 1SULA 3BRWD 1AZSC 4HUQA 4JBWA 4LJAA 5CYOA 2J41A 2BC9A 1G8GA 3AF3A 3RS7A 1EESA 3GLHE 3GFPA 3IUYA 1G9XA 3NXSA 5J40A 4CYMA 3D3QA 4URVR 5CB6A 1Z6TA 5FUXA 1G19A 1Z06A 2ZRBA 1TPZA 2YJTD 1XB2A 1AS0A 4HZUB 3B2EA 1E9FA 4ARZA 1GOTA 1F2UA 3MWLA 4NYMQ 4Q19A 3REFA 3CRW1 4MKHA 4NKRA 4US0R 4X8MA 3G82C 4URXR 2FSGA 5EP1A 1KK2A 3KQHA 4PSVA 3PJRA 4GI7A 3GFOA 1UM8A 2RGEA 2VP5A 5FI1B 3MWJA 3X1YA 2WM9B 4PHTA 5TY0A 2RGGA 1IOZA 5FR2A 4A1FA 2J7PD 4B3BA 3DEFA 3EXAA 1G3RA 3PUYA 5TMPA 2IHBA 4NZYA 3ZVMA 4UXJA 4N3NA 2QQ0A 2CJWA 5HTKA 5HKKD 1AQYA 1BYUA 2GZDA 2QQEA 2O0HA 1XCPA 1XU4A 4P4UA 3OE7D 1J8YF 1KJZA 3MWKA 4MKGA 4TYYA 1NVWQ 3LWNA 5DLQC 3RS0A 2VPPA 5KYKA 1OB5A 2IXGA 3K09C 4A6PA 3FTQA 2WWGA 1G1MA 4YMSA 2SHKA 1XMIA 2YINC 5HE8A 4DVGA 2ANCA 3AH8A 2I4IA 4HAUA 4PHHA 2FPMA 2HT1A 5FPHA 3GLIA 1P73A 4NHOA 2LKDA 4H1VA 4WXRA 5DISB 3B78A 3F8TA 4Q1FA 1P9WA 3IIJA 4DDVA 1P60A 4XVQA 1V5WA 4HAXA 4OI0A 2QT1A 3E1SA 3KUCA 4HB4A 1ZD1A 5A0FA 4TL6A 1D9XA 1T8UA 1KTVA 1X8JA 4HB3A 3LBHA 4BE7B 2CVHA 2Q0HA 1Z6GA 1VIAA 1J99A 3KQKA 3ASYA 1ZM7A 3GD7A 2VHCA 1KHTA 4U5XA 4POAA 4QNMA 3EZ6A 3EW9A 2PMDA 2NZJA 1Z47A 4LZZA 4QL3A 4B32A 4XWOA 2VQSA 4RVCA 1II9A 1UFQA 4I81A 1MABA 2A5GA 4LYFA 2R44A 1R8SA 5KPJA 5TB5A 5KSYA 4QGHA 1H65A 1VTKA 4MDEA 3GMTA 2E9SA 3NBZC 1N0WA 1E9BA 2P65A 3QBVA 2NMVA 1Q12A 5FUVA 3BOSA 4L9WA 2WBLC 5FUWA 4QHTA 3TR5A 4LJ6A 3CNOA 3ZQJA 2QTHA 4TZ0A 2XNSA 2ZRNA 1W36B 4NCJA 4KFTA 4UKDA 5GADl 2VP9A 3NWJA 3OEEA 4QRHA 4CEIA 2VH5R 4BLPA 1DS6A 3T34A 4D81A 4P4SB 2P6UA 4Z8YA 1US8B 4TYPA 1TQDA 3RAPR 4GZLA 2PEZA 5IK2D 1XPUA 3OF5A 1NLYA 5FPTA 3SYLA 4XD7D 3ADKA 4FCTA 1DOAA 2J0VA 4MITA 2IK8A 3DZ8A 5FTJA 3W6NA 1SXJA 1EFRD 3CONA 1DAIA 1CJMA 3V4FA 5D3MA 4BRWA 1FMLA 5K8LA 2F3RA 4FMBB 1U9IA 5JHHB 1F2TB 5TV2A 1HQYE 2F9LA 3R9XA 4A0RA 1WE2A 4E09A 3MJRA 3MAAC 1RC8A 2ODNA 2XTZA 3SOPA 3FYHA 2D2FA 3MWYW 2WHXA 1XD9A 2VHJA 4ACBA 1U94A 5KHOC 4B74A 2ZSEA 4KFSA 2VSXA 3ECCA 1VHTA 1OB2A 3B60A 2AWNA 4L16A 4GOJA 4HYYA 4B71A 3H2YA 3W6OA 3I32A 4IVPA 3EAQA 1SVLA 1MOZA 1A4RA 1K5DA 1PUIA 1E9SA 2I3BA 4RCZA 1L4UA 1E2KA 2CE2X 3FMPB 1G5RA 4MA4A 2ZJZA 2ZJ8A 1W4AA 2WKPA 5JEDA 4I1SA 1VIYA 1CP2A 5DE3A 4LBWA 2R6CA 3A1UA 1DBSA 3CB4A 1W5TA 2DCUA 4DDWA 1YZGA 3NH6A 3I72A 3LBIA 1KDRA 2FFBA 3K0AA 2ZRJA 5AJVB 3THWB 3CPJB 1CRPA 2ZRMA 3SJAA 5G3ZA 1OSNA 4P33A 2X8AA 1FFHA 4NPHA 2ORIA 3ZQ6A 1SVOA 1QHHB 1L8QA 1KDOA 4NU0A 4NYIQ 2JGNA 1G4UR 3TLXA 1YRAA 3EIQA 1KAOA 4XJXA 2O8DB 4TL7A 5JJKA 4I4LA 1XBTA 3QY0A 4Q9LA 2ZRAA 4URYR 3R7WA 3W90A 4AYXA 1X8LA 2ZI4A 2XXAB 4CGZA 3AEZA 1VG0B 4WAUA 2C77A 2OFXA 3I4LA 2O0JA 3HYTA 1H8ED 2X1VA 4MRRA 4PO8A 4DBLC 3NBXX 2GA8A 3SBDA 4DLWA 2JLZA 1MKYA 1M8PA 4L4UA 3OFND 2FMXA 4MYCA 3L82B 4IXNA 5JLJA 4Q21A 3A1SA 4Q5IA 4F7WA 4U7DA 2CEAA 5AJYA 3RANA 2REOA 1DE0A 3PV0A 2F3TA 1XZPA 2EQBA 2XITA 4NBSA 4Z8XA 4R7ZA 4A8JB 5EQTA 2CHGA 2EW1A 4JT4A 1CTQA 3RSOA 3THYA 2E87A 3K70B 4HB2A 1TNDA 4B2IA 4A15A 1G4AE 3WYFA 1MV5A 4Q7MB 4D6PA 1JR6A 4B76A 2IS2A 1U8AA 1FZQA 3A1TA 5CYPA 5D3QA 3IO3A 4BZQA 1R0WA 5BW8A 4NCNA 3X1ZA 1Y63A 1FQJA 2HJVA 1RKBA 2J7KA 3OHMA 4JLDA 4LC1A 4Q4LA 4QG7A 5AWFC 4OKSA 1DARA 4HDCA 5BWMA 4UXHA 2Z4RA 3CR8A 4BEJA 1EX7A 2QZ4A 1Z0KA 2H1LA 4ESVA 2ZE8A 2XOKD 5FBVB 2AR7A 2HLDD 3CH5A 4D80A 4JS0A 2WWWA 3ZZ0A 1GWNA 4KFUA 3DMDA 3LV8A 2BBSA 2RHDA 3SJCA 2F1JA 1KKLA 3L0PA 4LX0A 3U3JA 1EFHA 3WYAA 3T61A 1G6HA 5CB8A 2OCAA 2VP2A 4AURA 2X77A 1Z6AA 4TQAA 2FSIA 1OV4A 4DCTA 3JVVA 4G0NA 2XEXA 4YDHB 1UAAA 1KI2A 3AM1A 4TMVA 1G20E 4F93B 4MH0R 2V1UA 1DELA 2OSBA 2CCGA 4EPWA 1E32A 1Z0AA 2J59A 5JJIA 5TXGA 2REXB 1FUKA 3JVUA 2Q21A 4OHVA 3I5YA 3SR0A 1Q20A 1OH5A 4CZ2A 1Q3HA 4ITRC 4M53A 5EUMA 5A5GA 2YHSA 3GLGE 2QA5A 3B1XA 3IQWA 1GFIA 1N0VC 2A30A 4RKEA 1F48A 4B3CA 3FVQA 3CX7A 4X8LA 4DIEA 4W5JA 1CJVC 1G41A 3W5JA 5A4JA 1SHZA 1T9HA 2LCFA 4D4JA 5JWRA 4NYIR 3BFXA 3QEJA 4OI1A 2QAGA 2Z5FA 2WAYA 2DWPA 3LNCA 1X3SA 3GPLA 1Q1ZA 5KDDA 3PEWA 5E3HA 5FFMA 2CVFA 4GP6A 1E79A 5JWHA 3CF0A 1O3YA 1W36D 1W0KD 2GNOA 2FF7A 2XSZD 3AVOA 4QNRA 1NMYA 2A7QA 5SZJA 3KTAA 3AF2A 4ZI3A 1E2FA 2O52A 2W0SA 2G1JA 1UKYA 4HDOB 4R71A 1LS6A 3U61B 4QC2A 4TLEA 1FP7A 3LX8A 1RPZA 1U90A 2ZM5A 4C7OA 2QY9A 2BM1A 4TLAA 4B35A 2ZXUA 5HR5A 1QVRA 2WSSA 1QF9A 4GPTA 1WBDA 2A5JA 3FKSD 2QM8A 1NL3A 4OBEA 2G1KA 3LRPA 1TU4A 1ZU5A 5CJPA 2NZ8A 1NRJB 4B6EA 1BH2A 3MGCA 4RD1A 1R4AA 3JZMA 2BCJQ 4Y0AA 4WW0A 5HCNA 1GKUB 5CLQA 1GRNA 1ZIOA 4Q1EA 5H70A 4ACAA 2H57A 1E9AA 4M2LA 3RYTC 4Z51A 3AP3A 1SVMA 2AD5A 2D3WA 5FPSA 4O2LA 5C4MA 2CMKA 2RGAA 1J70A 4IW3B 5ELXA 3SDZA 1GL6A 4CEHB 2FN4A 2QEQA 2XJ9A 2HUPA 2PX3A 4C4PA 5B30A 4TL8A 4W7SA 2MSEB 2RKOA 1ZNYA 3IQXA 2AXNA 3N70A 3UPUA 3GJ8A 4PPNA 1VG1A 4ILEA 2O8CA 2FSHA 2WKRA 4XOIA 2IWRA 1U0LA 1EFTA 3FPAA 3B82A 4V0KA 2ANBA 4BFUA 5DH9A 3PEYA 4EFNA 4IHQA 2GTPA 4I1VA 4KYUA 2PH1A 1ZW6A 2CBZA 2P5TB 4M1WA 2WAXA 4IDOA 2ZUCA 5C2JB 1XCMA 5G40A 5KNBA 1X8KA 2Q3FA 1I4TD 4LHZA 2UKDA 4Q4AB 3TUIC 3DHWC 4B2PA 3KB1A 3A1WA 3A58B 2YWEA 4K81B 4QHSA 1A2KC 1JQJC 3PEVA 5BN4A 4TZ6A 2VTKA 1M1YE 2ZI9A 2V3CC 5J4LA 1E0JA 1PZNA 4KITB 3L8YA 2JDID 3WYGA 4ON9A 2GBLA 4TLDA 3VX4A 4Q1DA 1D2EA 4FI3C 3PITA 5DSZA 5FOVA 4DXAA 1OFHA 3BWDD 4PQYA 4DCSA 2B7CA 2FU5C 3LY5A 4IFBA 1SQ5A 4Q7KA 2WMOB 4DWJA 1IHUA 2ZQ5A 3CR7A 1GRRA 4I1OA 2G9NA 2FNAA 3TUJC 4NDZA 1OHHD 1SGWA 3EWAA 3T5GA 2IF2A 4HAVA 1IXRC 1TEXA 1ZNWA 4N0EA 1W4CA 5KDOA 3M1IA 4TMXA 1R8QA 1GTVA 2N1BA 1X1RA 4LJ8A 2ZSAA 1ZC3A 1CU1A 3AVUA 2DR3A 4C9BA 2RGNC 4GOXA 1E1QD 1G291 4BWYA 2QGNA 3K70D 4EKDA 1ZM3A 1D2MA 2WOOA 2MSDB 2ZU6A 4ZV4A 1SVSA 1UBEA 2W6ID 1HH4A 5J4VA 4XWKA 1X86B 1KMHB 2EFDB 5EE1A 2ATVA 2FE4A 3LLUA 4D0NA 4AYTA 1OE0A 1XNJA 2P2LA 1R2QA 4D4LA 2ZROA 1Q22A 2QL6A 4IFEA 5GJWC 1E9RA 1COWD 4YMWA 3C5CA 1R7RA 1UEJA 3K9HA 1HQCA 4TN1A 2OXRA 4OK5A 1AJEA 2FZ4A 3CUEF 1GNPA 1GZSA 2NO0A 2BOVA 2ZI7A 1GL9B 1WF3A 4HI0E 5BYJA 4LYJA 2HCJB 2QENA 3EZ7A 1UEIA 3FB4A 4L8GA 5JS8A 3T1QA 5F3WB 2ZS7A 4A2PA 5HKKA 4FXPA 4EJSB 2F55A 2QMOA 4IJMA 4EPRA 1OW3B 1XMJA 2OE2A 4B6FA 1FOEB 2GAOA 3AUXA 3N5CA 4HLQB 3OE7A 4BLOA 1BS1A 1VHLA 3UATA 5FI0B 2VF8A 5KTYA 2ZPTX 1YZNA 1IBRA 2PLFA 3TKLA 1E96A 2W0MA 2JCSA 3VHXA 3NC0C 4Q18A 3A4MA 4LHWA 3HR8A 3QENA 4V0NA 5BQ5A 2IUTA 1KI7A 2H18A 4LK2A 3LVQE 3SBEA 4F4CA 4HEJA 1E9CA 1OYWA 2D62A 3W3AA 1I2MA 1U99A 4F38A 5JSZA 3EASA 1XPOA 1IN6A 4F4IA 2PT7A 4JLBA 3GLHA 4PZZA 5JEEA 4RFSA 3DM9B 3PQCA 2W6JD 3WY9A 1ZVQA 3CWZA 4P32A 4M1SA 4DEYA 1JXOA 1N5KA 4GZMA 4EFLA 5DYIA 3B9QA 2FH5B 4X8OA 1P75A 2OILA 2UZ3A 4YDSA 1FNNA 3P20A 5AK0A 1JAHA 4QKQA 2HXYA 4AD8A 3TBKA 4OHXA 1HYQA 4XTCS 3EIHA 4QHYA 4TYNA 1QVAA 2V55B 2J9RA 3E5HA 4PO1A 2IYRA 5CIWA 3LQQA 4YONB 5LD2B 2FPLA 4KYIB 4MKFA 4UNSA 4Y0VA 3GJ4A 2QE7A 3SQWA 3ICEA 1XEWY 1ZU4A 2IEZA 4NL4H 1NLFA 5DGXA 4PC3A 3PEUA 3U7GA 3E70C 3OESA 3D7MA 3KKQA 4M0LA 4IXMA 2OLJA 3BB4A 1ZD9A 1FX0A 3B1WA 3PUZA 4HSEA 2BM0A 2XB4A 2C2HA 221PA 5IK2A 3U3MA 1KK1A 1E1RA 3QKSB 2ZJOA 3FHCB 1BYIA 2FDCA 1G8FA 4KO8A 1W4RA 2ZETA 3IKJA 3ZVRA 4RCYA 5FBLB 4NYJQ 4KU4A 1XP8A 2GCOA 4LV5B 2RGNA 4OK3A 3BIFA 1Z22A 4BGDA 2DY1A 2KB0A 1FMJA 2G77B 3QI2A 3FMOB 1AKEA 3OEHA 1EWRA 2ZI3A 4RD0A 3DDCA 4RKFA 4URUR 3SI7A 1JR3E 1RZ3A 2HCBA 1W48A 3KXKA 5FBWB 1G7SA 1Q1BA 4PR0A 4TLCA 4LCBA 1J8MF 5FTNA 1W47A 1KO4A 2F43A 3SFZA 5KNDA 4FD2A 1G64A 1U0HC 4YXWD 1A82A 1PJRA 4EIWA 3B1YA 3LW7A 1DAHA 4HATA 3FHTA 1DO0A 4YMUA 3WXMA 2QU8A 1NJGA 1SVIA 2GZHA 3Q8XB 3R9IA 4B3DA 1XTJA 1N6LA 2J5XA 2QRZA 4RZUA 1DG3A 1WA5A 4D25A 4MRNA 1ZJ6A 4C0KA 3FHOA 3RS4A 4LYHA 2AN9A 2ZRDA 1SXJC 5EXTA 3WBKA 1DAEA 2ZR9A 3ETLA 3U5ZB 1M74A 2R6DA 1EFCA 5CJ2A 1AKYA 2ZJBA 2V54A 2O8BB 2BV3A 4HUQB 5FL7D 2V6JA 1U9IC 1IJEA 2DPXA 4XTRA 1NN0A 4LYAA 4DLUA 1LNZA 3CIOA 4Z1MD 3KL4A 1KO8A 4UXIA 3L2OB 4MGKR 1D9ZA 1L2TA 2C8VA 2JJ2D 5B57C 4KVGA 1GSIA 4S2EA 4OYHA 3P26A 2BDTA 1S9DA 2B8TA 5AUNB 5J4KA 1JR3D 2KI5A 5F98A 3W9YA 1GITA 1VYUA 1Z6YA 2YOHA 3OFNA 1D5CA 2O8FB 5IT5A 1TF7A 3I61A 1YR7A 4LSGA 1XZQA 2P67A 2FEOA 4TL9A 1JJ7A 1NN5A 2H17A 2NGRA 4LPSA 5GVRA 3SHFA 3TSZA 4F91B 5JZVA 3KB2A 3EPJA 5FPYA 3W5IA 4LJ9A 2CJWB 2X19A 4FW9A 2C03A 3NH9A 1MR3F 3FE2A 3SYKA 2QMEA 2PBRA 4M1OA 6Q21A 1S2MA 3A8TA 3H4MA 1KO1A 2W2XA 4PSAA 4JBXA 4XSGA 5EP3A 1KI4A 5FTKA 1VCNA 4TMKA 1P4SA 5AJXA 5DYGA 4A0GA 3V4RA 3IILA 4JVLA 1NY6A 1EFUA 2BBOA 1BMFD 1BIFA 2IC5A 3QPWA 5E4FA 3GLIB 2VIIA 2HV8A 1II0A 3NHBA 4M9QA 2CXXA 4CDGA 1KK3A 3UK6A 2XB2A 5KNCA 1W2HA 3KDSE 4PAMA 2OEPA 1H8HD 1X1SA 4Q7LA 1W46A 4TSFD 3BERA 3SE0A 5BYKA 4FINA 3ZZTA 1P61B 2CE7A 2HLDA 2ZRKA 4NYJR 2WMNB 3UWOA 3KXLA 3ZS9A 3IHWA 4QM7A 1IY0A 1N25A 3B6EA 3KKNA 4ZCIA 2F6RA 1YZLA 4ABYA 4DDUA 1PV4A 5G53C 4MRVA 3KQNA 4KHZA 5JRZA 2DWQA 1CRQA 2QPTA 3Q72A 1KY2A 1HV8A 4B3GA 2QPOA 4TTRA 2YYZA 1U2RA 2GESA 3HWSA 4MUAA 3EC1A 1MABB 3GCGA 4DSOA 1P7CA 3K9GA 1TQ4A 1FQKA 4QFMA 4Q4JB 2NOAA 1XRJA 3RC8A 2ORVA 2BJVA 4Q7JB 2P3SA 5TARA 1WDTA 3WBJA 3HR7A 2I1VB 1XF9A 4PHFA 3L0IB 4M1MA 5EP2A 3WNBA 3IO5A 1TX4B 2O5VA 4CEIB 1XD8A 1GAJA 1W4BA 2QTVB 2GEVA 2G88A 1ANKA 4M4SA 2WJHA 2RGDA 5EE9A 2ZYTX 4WOPA 4C30A 2N46A 4KFRA 4B73A 2IX3A 4LV6A 3KKPA 1DO2A 1NVUQ 3I3SR 2QTFA 4I1UA 4MYHA 4NP6A 3U6BA 3O8CA 4M9XA 5L3QB 4JT2A 2WKQA 5D3MB 2C04A 2ZITA 2QN6A 2CDNA 1LW7A 1D6JA 3H84A 2NO1A 3QKRA 1Q1EA 4DLXA 4BLRA 2A2ZA 5IF9A 1R0ZA 4QGGA 2FX3A 5JHGB 4AKGA 1E9EA 2QNRA 2B7BA 1Z5ZA 1T3SA 3LDAA 2OG2A 3OAAA 1XJ0A 1T4GA 2CCJA 3ZGXA 4D26A 2ORWA 1T91A 1W0JD 2QSZA 1ZM4A 1G7CA 1W0KA 3BH6A 3MRSA 2VHQA 3UIEA 5SZIA 1OH6A 3Q5EA 1M34E 4P4SA 4O0MA 3QKUA 1US8A 1ZIPA 3CPHA 4PZYA 4RJLA 4XVRA 4UQOA 5GJVC 4DLVA 2FG5A 3TK1A 2KJQA 4M8NE 1ZM9A 3BC1A 1SKQA 3QPVA 3SU8A 3WMEA 3UG7A 1YZKA 5K8IA 3C16C 3SHWA 4US2R 4J0QA 4FWIB 4WBSA 3JZAA 1ZP6A 2YNMA 3V9PA 4DLZA 2OXCA 3K0AB 4DT1A 1UBGA 3P4YA 3GLGA 2VSOA 4KLZA 4C0QC 1F5NA 1F2TA 1MRNA 3KJGA 4QJ3A 4ESHA 2MMCA 3SQXA 2QGZA 1FUUA 2QAGC 3AP1A 3BJIC 3AKCA 4AG6A 3BFKA 4B48A 4KSCA 1UKVY 4LDJA 1QZXA 1N6NA 1ZINA 5FH9A 3ADCA 4A36A 2OO7A 3VX3A 4YMVA 5TDHA 3UKDA 2FV8A 3U3OA 3VR5A 4EPYA 1G8HA 4B3XA 1BO6A 3RABA 3TAHA 5FUYA 4JSTA 5EUQB 4TWZA 1N5JA 1G3QA 3C7KA 3DL0A 1DG1G 3K0EA 3KKOA 4O3MA 1TEVA 1MRSA 3UMSA 3BD9A 2AD1A 3CO5A 2IW3A 3NC1C 3QF4B 4PPQA 3NDPA 3U6KA 4IEIA 3REGA 2V6IA 1Q57A 2QP3A 2OHFA 3GFTA 4FIDA 3THWA 2C9OA 2HT6A 1W5SA 3T06B 2AKYA 1Z2AA 2OAQ1 4LJYA 1XMSA 4E03A 4LHXA 5SZHB 1VPLA 4WZ6A 2PT5A 4JLPA 521PA 1N6RA 2O8DA 2J0UB 1CEEA 2AFIE 2WWHA 2XZPA 2Z6VA 5CM8B 1N3BA 1N6HA 3PR1A 1JQLB 4NTZA 5P21A 1UKEA 2YWFA 2GCPA 4EFMA 4JL8A 1SKYB 5KSZA 3ADBA 2BMEA 3NIBA 4LBVA 4EUNA 3QXHA 4CEJA 2EWVA 3LXRA 2GF0A 2BMFA 1RJ9B 2CK3A 4KBGA 2IS1A 3QEOA 3O8BA 2RAPA 2ZSDA 3EZFA 1GP2A 4BFVA 1GIAA 2CLDX 5DHFA 4XVUA 4RFVA 4IDPA 3MJHA 4OQMA 2IEYA 3A36A 3T35A 1ZYUA 1OHHA 5HZHA 2WWFA 2VHTA 1EK0A 4ZDJA 2QRNA 3QQ5A 2XAUA 4UJ3A 5ANRB 3BGWA 1KNQA 3CX8A 3VKWA 1OF1A 3VMFA 4A8JA 3EC2A 3ZH9B 2C5LA 2BBWA 3QIAA 5LPNA 2ZRCA 3ICQB 4B43A 5AUOB 1AM4D 2REBA 1XDBA 1AN0A 1XXHB 5DI3A 2ONJA 1KI6A 2P5SA 2W6IA 4XWAA 4DLSA 2YV5A 3VKHA 4LPKA 5LDDC 3IDQA 4C0HA 1GDDA 1M7HA 4AKHA 2XNDD 5LBIA 2WPDA 2ZE5A 3FGNA 3B85A 1NN3A 2GBLC 4QGFA 2JLVA 1DVRA 1K8RA 4URZR 2ZE6A 3AVXA 3RSLA 2PCJA 1I2DA 821PA 1KI8A 1COWA 4AY2A 1UKZA 4N1AA 1KKMA 2GVDC 3KFVA 4TYQA 5J4YA 3TR0A 4BECA 4WZAE 3RS3A 4JVNA 3BBPA 3QKTA 4M22A 1RRCA 3BB1A 3X1WA 3J81k 4IOLA 1N5IA 4AK9A 4TYWA 1YJ5A 4RD2A 1GNQA 4RD6A 1HT1E 2JIZD 5L8VA 1YU9A 1CS4C 4PC7A 1XEXB 4TMWA 4AG5A 4BASA 4LC0A 1OKKD 5JI3E 5H1YA 2NO7A 4XH9B 4V0LA 3SNHA 4NH0A 3K0FA 2HJGA 2BJWA 4L15A 1S1MA 2DFLA 1GNRA 2OFWA 4OK6A 2FGKA 4DB2A 3LQRA 1CULC 3IIMA 2IWHA 5BN5A 3V00A 5FOTA 3KJHA 4JLKA 4HLCA 4LJ4A 4C7OB 3EA5A 3FDIA 2ATXA 2O0KA 1KI9A 2VP4A 4RD4A 5GJCA 4P0TA 4JBYA 2N42A 4BRUA 3K1JA 2ZRPA 4Q02A 4TT3A 2LWIA 3PENA 2D2EA 2F1HA 2ZU0C 4OJKA 2O8EA 4BLTA 1OXXK 5GVSA 3RLFA 3S1AA 1IN5A 1EX6A 3U7HB 4JVMA 3RHFA 3QG5A 5AUQA 1KO7A 3UWKA 1KJWA 4Q66C 3UMRA 2G6BA 5C46F 1VMAA 2BBTA 1DAGA 1Z8FA 2EYUA 3Q7QA 2R6GA 3ADDA 5B2ZA 4A0HA 4HAYA 1KDTA 3B13B 4H1UA 4LY6A 2JLYA 3AVWA 1N6IA 4PQFA 2FA9A 3TUZC 5CK4A 4RZ2A 2NG1A 3H0KA 1VCMA 4PANA 4BZPA 4TQ9A 3KXIA 3W3ZB 3AVTA 2VL7A 4BFTA 3CF6R 3KJIA 1UADA 2CL6X 3LLMA 1QRAA 2O8CB 1G21E 3QOFA 5JS7A 2IHYA 2ZAMA 3GP8A 1CXZA 1A1VA 3ZLJA 3WP0A 1W1WA 4A6XA 3HU2A 3M6AA 2OCYC 2PJRA 1E94E 2YOFA 3SC3A 1P62B 2FJUA 4PC6A 3U4QB 4UNPA 3CLVA 4FMDB 4LI0A 4IVQA 3HYRA 5G3YA 1SKYE 2EFHB 5KO2A 4ZIRB 3CRQA 1ZBDA 3NVAA 5H8WA 2GEDA 4B44A 4DKXA 4S35A 4EPVA 1P9NA 4JYCA 4QBGB 4DSTA 4LUCA 1S8FA 1XCGB 2GETA 1BOFA 4ZKDA 1NMXA 3VR1A 3KQUA 1B0UA 1S4QA 4CRWB 1NBME 1KK0A 4LOAA 1JB1A 1YHNA 2QUZA 2XTNA 4CEHA 3ZVNA 3TIFA 1XPRA 1T3HA 1E2LA 2QORA 2GRJA 4WZBE 4MGZR 1NJFA 2V8OA 3ZD6A 3VHLB 2WJGA 1T6NA 3IPXA 1XD2A 4JLMA 121PA 2YZ2A 4O2RA 3QXXA 1XXHE 2ZRGA 2HF9A 2GKSA 1QHNA 1MT0A 1SHKA 5L3SA 1Z0FA 2FSFA 2ZSFA 3W8NA 1U0JA 4ZCMA 3FFAA 2IXEA 3LBNA 1CJUC 3CNNA 4G5GA 3LA6A 3OZXA 4IVRA 2ZS8A 1II8B 1XTIA 4JYBA 4MQBA 3AVYA 2JAQA 1OIXA 4Q4AA 2JATA 2ZUBA 5M04A 3MMPA 1TF2A 2ODWA 5AJWA 3TRFA 1P72A 3CRVA 1CIPA 2GZAA 2VHUA 5JCZA 5CDFA 5FL7A 5HCIA 4DLYA 1R0YA 1T0HB 4PFSA 1J2JA 4Z1MA 1LVGA 1S96A 5C4GB 2ERXA 1UDWA 4CF7A 2IXFA 3Q85A 1R10A 1TAGA 2JJ2A 3X2SA 1WMSA 4PZLA 3VNVA 5JWOA 1E0SA 3CW2A 1Y3AA 2OESA 1QBKC 1JR3A 3NHAA 4KAXA 2GF9A 1IY2A 1NBMD 2J0QA 1E0KA 2L0XA 2PX0A 3W34A 5KDLA 1CR0A 1ZM2A 2FFHA 3ZYCA 3R8CA 5JI2E 2ZJ2A 3TSOA 3CWQA 3HJNA 3CH4B 4QXAA 3QSYA 4FMCB 4JSYA 2QM7A 3CZPA 4R2IA 4RZXA 2ZRIA 1CR2A 4OI2A 3W6PA 3UMFA 2J7PA 2F7SA 5LB4A 2DBYA 3UANA 3CKLA 2J3EA 4IOMA 4JMPA 4ZPXA 1RW4A 5JECA 3RRMA 3LW8A 2UZIR 1WBBA 1KMHA 2BKUA 3MUFA 3DPUA 1NP6A 1T3LA 4DC9A 1E69A 3IEUA 2QBYA 2A5YB 4ASUD 5K8TA 2IYWA 5DO9A 1KY3A 1M2OB 4WVFA 3K9LA 2RH5A 5UKDA 3RS2A 3B5JA 4M1TA 1ONBA 3TQCA 1LY1A 1P2SA 3VU9A 4A2WA 2R6FA 3GLFB 3CX6A 2ZAOA 3L0SA 3GLHB 4D4KA 1QG4A 1GG2A 2WICA 4RFSB 3U3KA 3RNLA 4JVSB 1S0UA 1AS2A 5EE0A 3KKMA 3F0TA 2CNWD 3NBFA 2BKEA 1LS1A 1Z28A 4ERNA 3NBYC 4NE2A 4CVNA 1QDEA 1GM5A 2VLIA 1JBKA 5FR1A 2Q9BA 1TU3A 3VAAA 1WRBA 1XTRA 4BLQA 4MKIA 4MYTA 2D4HA 1GL7A 1ESMA 1OIVA 2WV9A 4ZCLA 1ZAKA 2ZTSA 3DVLA 2D7DA 4JLNA 3I5XA 1LFDB 5CLLA 1RFLA 2BVNA 3OIYA 3CPEA 1TF5A 1XTQA 2QROA 3VKGA 5F9HA 5BXQC 4TLBA 2KBEA 2X2EA 2DHRA 4LGMA 2ZE7A 2ZVQX 2PMKA 3I73A 4AC9A 1W2GA 3B9PA 1FX0B 1WB9A 3MD0A 1CR1A 1AZTA 3QVVA 3D31A 2IYUA 2VRWA 1YVDA 4WA7A 5JMTA 2JLUA 4MUBA 4Q4HA 4G01B 2IA5A 4C2TA 4IEEA 4XD7A 5EJEA 1E2DA 2FPKA 1XMVA 3IGFA 5E7MA 1EGAA 2JA1A 4JLOA 1JJVA 3U44A 2GCOB 2AK3A 3I1FA 1EFRA 1AGPA 1JI0A 5FBQB 1TADA 3Q3JB 3QUSA 4IOKA 3P4XA 1HY3A 4OQNA 1N2CE 1RVDA 1HT2E 2QPAA 5EXXA 1MH1A 2CHVA 1Q21A 2EFCB 4DSUA 3QNUA 4UJ5A 1G5TA 2KE5A 2BMJA 2F43B 2YC2C 1GVNB 2IYVA 1IM2A 4V0ME 1K5GA 4D0LB 4WIAA 1NMZA 3THXA 4B33A 3NEYA 2V9PA 3QKSA 2OAP1 1TQ2A 3BORA 4LV8B 3IEVA 2J45A 1G7TA 1TL7C 1K6MA 4XSHA 1KNXA 3B8HA 1LTQA 2QAJA 2HDNB 4YQFA 4BQSA 1R5BA 2P0EA 2GVZC 1GILA 4YLGA 1R5NA 3U7EB 1FTSA 5FOXA 1N5LA 4W5HA 3RVBA 1EG7A 5KSOA 2QP4A 2XGJA 1G16A 3H86A 4KCGA 4PC2A 1UBCA 2AKAB 4DCUA 1GRQA 1N6OA 1PVOA 4OHZA 3LAWA 5HPYB 2VP6A 1P6XA 3BK7A 4C0SA 1G5PA 4BFXA 1P5ZB 1B23P 4EQ6A 2D7CA 4W9MC 1N0UA 2W00A 4LBYA 4PC1A 3LH5A 1DADA 1R0XA 4JLAA 4LJ7A 4E22A 1L4YA 4B3FX 5FOSA 1UPTA 3ZIAD 1YZUA 1NNEA 1UBFA 2JLWA 1KYIA 1W36C 3HPRA 4R2HA 1OFUX 4Q9HA 4IRUB 4KBFA 4UNRA 3TJZA 4CT4B 4ARZB 2HXSA 3MCAA 3TH5A 1F2UB 2PZGA 4DDTA 2R6AA 4BZXA 3PIRA 1H8EA 4URWR 5CK5A 3RRYA 4DUGD 2IF0A 2ODBA 2W58A 3GEEA 4NONA 3KZ1E 1DAKA 4Z54A 3NTUA 2R9VA 1EXMA 4MGYR 3GLFE 2ZR7A 1DEKA 4D4MA 3IBYA 1VECA 2R2AA 3I92A
chains in the Genus database with same CATH superfamily
5FADA 5B53A 1UBUS 3DMFA 1OAKA 2IH2A 2IYOA 3EYWA 2XQKA 2VG8A 4GUDA 4QNNA 5ALYA 3ICWA 3M1AA 4BV2A 1HURA 4WXEA 2O2GA 3IMCA 3A4TA 3HB0A 4UHKA 5BMOA 2ZEJA 2FYTA 2VF7A 1V41E 3BMQA 4CUJA 1L5KA 2WF8A 3H9GA 4K6HA 3F9IA 2A86A 5AM3A 1I3OA 1BJRE 1TMGE 4EDHA 5E6SB 2JIBA 3E7FA 4FBLA 3TVDA 1HYEA 1O9GA 3KEGA 3QJYA 3UOWA 3S8EA 5DEIA 4YK7A 5L95A 2A9KA 4QQ8A 4AKEA 2CFSA 2LVBA 3D02A 2HLNA 1F0PA 4QPJC 2BLLA 1CJSA 1ZXXA 3ZDYB 1DAMA 5FWXA 1VLHA 3RPEA 3FTEA 1HEIA 5DN6D 1HA3A 1WCIB 2NO4A 2PSSA 3K35A 4IYJA 1ECCA 3P32A 4YJFA 1P0CA 2NXJA 1T0JB 5ENDA 4C2AA 5CM9C 5EHQA 3HCRA 1KZ1A 3UHFA 3H5RA 2OQVA 2VT2A 5FTLA 5H68A 1OYYA 2Q8QA 3A05A 4H7KA 2Y93A 5L3RA 1VZ2A 2IIPA 3EZ9A 3ZN2A 3QFFA 2Z43A 5IJAA 2AXPA 2XCLA 3BH0A 1NKTA 3JW8A 4MRPA 4M0PA 4MRAA 5CR9A 3GEMA 3RWMB 4D82A 5KNCH 3COJA 2JK0A 4AN1A 5B36A 1ZNZA 3GDGA 4Y6GB 1YB6A 1NTOA 3C70A 4G23A 5AOCA 1CNEA 1O57A 2NW6A 2WYOA 4AI6A 4CM1A 4L9SA 3U2QA 2XNDA 1L5NA 1OLXA 2JLSA 4LSMA 4C14A 2X41A 1A9XA 1G8SA 2D06A 2G1PA 1D2NA 1VDZA 4PN3A 3TDNA 4TV8F 5IARA 1E6CA 5BVHB 1EFVB 2B0CA 4G5OA 3SR3A 1NRXA 2YQ4A 1BVHA 5K3CA 4CKWB 3CKYA 3ZH2A 2AF4C 1SCUA 4MARA 2PKQP 5T41A 4B85A 1CUIA 4KOAA 5ILGA 2X4DA 3DAPA 4DZRA 4KV9A 2LR0A 4HX5A 4AECA 2CNNA 2EFGA 1RI1A 3K6KA 1M54A 1P80A 3MJEA 4O4LF 5G02A 5BSUA 5IN4A 1SURA 2RK4A 3KBOA 4TRNA 2I4LA 3QKRB 4A8JC 4A6DA 1CUAA 1F1JA 1P33A 5TEVA 1L5ZA 3R76A 1CD5A 4IDGA 1M5UA 3T9AA 5LKRA 2EVWX 4LWZA 4ML3A 4Q4JA 1VA5A 2F8TA 5DP1A 4N18A 2R87A 4C3ZA 1YZTA 3CXUA 2P79A 1B6SA 1C9JA 1OKKA 3E0QA 1SVWA 1ULBA 4K05A 4DTIA 1JHUA 1N7GA 1NW5A 2ODEA 3R9XB 2V59A 2C4NA 2FFAA 1N57A 9GPBA 1YJBA 4HWRA 4WK6A 2ZULA 3B1FA 1Q0UA 2CJPA 5K2OA 2R85A 4XGNA 3R7LA 3KFXA 1I5EA 1E4YA 1R0SA 2G72A 1E1RD 1U1CA 1KFJB 2R7MA 1MO4A 2VNJA 3FUTA 3MYRA 2XF2A 1QGED 4N0QA 2Z2ZA 3VYTB 3I8XA 4ER0A 5A9SA 3GPCA 4FZ5A 2H8KA 8ABPA 2DC1A 4YWJA 4EI7A 2OBYA 3AF4A 4LTMA 4RS3A 4BNIA 1KOFA 3V33A 3IESA 4B34A 4LF6B 1JPNA 4ARCA 1IJFA 3H5AA 2WLTA 5E6RA 1Z13A 3MG9A 3JWJA 1ZCBA 4QLAA 2W4IA 2IXTA 3CZCA 3ORRA 2O8VA 4C1BA 4K6OA 1A88A 4PO9A 1EJBA 2B8NA 4B80A 2DCMA 3JQ9A 4B79A 4KSYA 3X1DA 5HRCA 1Y9ZA 1K6XA 1WG8A 2PH5A 2MCFA 2EIHA 2WFLA 3WNCA 4EBFA 5HYVA 1JI3A 2HBRA 5J3JA 3LY9A 4FFRA 1GV1A 1LBHA 1T13A 1V11B 2HF8A 1KJQA 2NTYC 1SY7A 3RVRA 2IL1A 3KT8A 1TTTA 2M6KA 1BW9A 2AC7A 2EWWA 2UV8A 3LQFA 4RW0A 3WADA 3WLEA 4KQCA 3KEMA 3DNMA 3DM5A 4I3HA 1H1LB 1P74A 1PSZA 2Y77A 4ZDWA 1EK5A 1ML4A 1KVQA 1NUSA 3T15A 4D3DA 2ASEA 1NJ1A 2GTHA 1PX0A 4YVFA 5GZ6A 3WKBA 3JAMA 2WQ7A 2QTMA 3ND8A 1GJRA 1FTNA 3RHZA 1HBJA 1FUYB 5AQ1A 3MCTA 3G7SA 2V7VA 1NQUA 3RC3A 4CMHA 4YAWA 4QXQA 3SS7X 3ZGLA 5FWYA 3UMYA 4JWKA 3BCHA 1W96A 3P2YA 3QA3E 3W1EA 3BHMA 1GZDA 1QAQA 2VSFA 4NCHA 1O87A 1F4VA 1PEKE 4IOJA 5YASA 2BYTA 1R15A 1E3EA 3QLTA 3GY0A 4JI5B 3DUFA 4H6XA 5JSYA 1P2GA 4UNNA 5CXQA 2G4VA 4AY4A 4H3HB 4BPBA 1A5ZA 3QUCA 1E1DA 4XIGS 2J1LA 1HL7A 4Y9RA 2ERCA 1JE0A 4NDAA 1KH1A 3GRFA 4US1R 2GHIA 2I2DA 3GJ7A 3H0CA 5EI5A 4BUZA 1YRLA 4Z7NB 5EE5B 3C6YA 5JANA 4AZ0B 3THYB 2WKSA 4PX3A 3ZKAA 1RR6A 1T0BA 2I66A 1FXSA 4J2OA 1S2OA 3C0KA 4W9RA 3RRNA 4TKUA 4CEJB 3HBJA 4V1CI 2P41A 5A4MS 3JQGB 1C4OA 3IHTA 4KUGA 3WRVA 1RZRD 3RFTA 2WG0A 1UODA 3U4HA 2VDJA 5I48A 3F2IA 2GHTA 5J5AA 1LV7A 1ZUIA 3DOHA 4RKWA 2W8BA 3EEOA 1Y6FA 5IBQA 5ERYA 1WDKA 2PO7A 5AKLA 1L3IA 1ZRMA 2SKDA 3C6XA 4A2QA 1KS9A 3HP1A 4IIGA 5FF9A 4B7UA 1H6AA 2GEFA 1OY1A 2P9GA 3E8XA 3PUHA 5HZKA 1RI3A 1KSFX 1QOPB 3UA3A 1EVLA 1FP6A 2IE8A 2NZXA 4MHSA 2ZR8A 3RU2A 1OIWA 1ZI9A 1R5OA 2V1XA 4R84A 3CCBA 4PAQA 2H4XA 4P35A 3UXYA 4YJ2B 1S3GA 5HSGA 2W83A 3RFVA 1Y7PA 2JHAA 4KPFC 3K6RA 3BAFA 2ZSHA 1OV6A 4MMXB 4OUDB 3AI7A 3RYFB 2NO9A 4BX3A 4E5UA 2QTWB 1YBHA 1SEVA 2B82A 4X45A 3W7BA 2WVAA 4N47A 4DE5A 3GEHA 4P31A 3M5WA 5PGMA 4ARIA 4NH4A 4XJVA 4DQLA 5FOUA 2ZI5A 3EGIA 3CKKA 1SXJE 4PX9A 5FRDA 3NS7A 3BZWA 5KHAA 4J4TA 1L7RA 4Z4GA 3I9MA 4AMVA 2PL1A 4FYJA 1NVVR 1UOEA 2WOJA 3QX8A 2VTDA 4WXHA 4FB5A 2WABA 1GUAA 2V3VA 2QL7A 1DXOA 2DSTA 4NY1A 3UQZA 2QI9C 1E5DA 1G3MA 3D8BA 3FPSA 4R69A 1P7VA 5ITZA 1C8LA 2AWOA 1GKKA 7ADHA 4K6GA 4L76A 3SYTA 2IOHA 2IYAA 2JRLA 3FJ1A 5FWDA 4FX5A 2RD2A 4ND3A 1GLVA 3P9KA 4QUIA 1EE9A 3URKA 1AURA 1B2RA 3FZEA 2HV9A 3S55A 1E4VA 4ALLA 1G17A 4LRTB 2QRUA 1SQFA 1SCKA 1PR1A 1NPYA 3C6BA 5HJEA 3D7NA 3OLCX 4F4JA 2VTEA 3RCBA 1KVTA 3UH0A 4M0EA 4ALIA 3R20A 4XYBA 1FFSA 1YGPA 3O2JA 4JLUA 1C0IA 1BEZA 3AY3A 3I37X 3PXAA 4JX9A 4LZJA 5FNVB 3VO1A 4Q39A 5DNUA 3DLAA 1Y4ZA 1JQEA 1FL9A 1QWSA 2OGSA 4F21A 1ORVA 4F4HA 3D59A 2BFCB 5FL3A 5FV4A 5HM6A 1JMYA 2OHXA 1KC3A 4PBRA 2W90A 3ZKWB 1ZMXA 3FSJX 4N65A 5ALSA 1K7YA 2PS9A 1L9KA 4PBSA 2DT8A 5DGTA 3ROGA 3FPHA 3NOOA 3CNLA 1DWOA 4KNVA 5GV7A 1N4DA 4F4FA 2C2XA 4N7MA 3HO1A 3CW9A 3B1VA 1F4LA 1L7DA 1Z83A 3VPCA 4DRXA 2FRDC 4HQFA 3QXCA 3WYCA 4E31A 3TTXA 5B2FA 1XLTC 1RE0A 1RQ7A 1FXUA 3IYLW 3VPGA 4Y3UA 4AUKA 2B6HA 2GUGA 2GYWA 1Z0ZA 4MDHA 4PLPA 4CLHA 2UU9B 5IAEA 1JPJA 5MN4A 1QGZA 4GT1A 3QVUA 4ZCTA 1HNWB 3CT6A 3RJ9A 4TXJA 2PY6A 3IXMA 5B3JA 1YO6A 1DJQA 1XRQA 1XEWX 2XEDA 3IMFA 3COZA 1KDPA 3JWGA 4UAUA 5JRDS 4J0KA 4WJLA 5G0TA 5JAIA 3I1IA 3AJRA 4G0VA 1KHHA 2PZFA 2JGEA 4L5JA 3ZDQA 4FLFA 1Q0LA 1T8TA 4JXXA 3EIXA 3LCJA 3DHEA 4U7PB 1IXSB 5CX1B 2R8ZA 4AICA 5F33A 3PT9A 1EZ1A 1NYLA 4DUYB 1A9QA 1XVVA 2VAMA 5AW6A 2ZAYA 4ZVKA 3DZGA 2RKWA 5IYZB 2PCLA 5KYXA 1ZBQA 2HDHA 1X6VA 4YT2A 1O0CA 1OT3A 3ASUA 2GWHA 3GFVA 3AR2A 2R62A 1RHRA 2HQ1A 1XZGA 3ZWYA 2YVKA 3WLKX 2COUA 5A06A 4WCFC 1OD6A 2VQDA 2B2XA 1YR6A 4HC4A 3RQIA 1N7IA 3V1KA 3C5VA 2WJIA 4RZQA 4Z4IA 1T5HX 1JEDA 2RGUA 3T3MB 1XSEA 1CDDA 3AUAA 4KLNA 4LFAB 2RONA 4LG1A 5F64A 1DJNA 1MO6A 3UN1A 3WIEA 5IABA 1MNQA 3M4YA 1ZONA 3N39C 3A1EA 2E1RA 1Q7BA 2AQIA 3FYUB 1ECFA 2OFOA 4CFYA 2WT4A 3ANYB 1Z0JA 5J47A 4X1YB 3AFHA 3RV4A 1H5QA 3QTLA 2R7AA 2FXIA 2CL0X 1P29A 5LLTA 2RARA 3KKZA 2Q3MA 2YC4C 1ZCAA 3NYIA 5ECGC 5H4GA 5HK8A 1XNHA 3NBAA 4JT8A 3TI7A 5BN4B 1Y9EA 3HVIA 4QFBA 5EZ5A 3C15C 4YRPA 4CMKA 3N2IA 3IPYA 4GMDA 4DXDA 1ZN7A 3ZZNA 1WABA 2VDRB 4WNIA 3ZNPA 1XQ6A 2GXQA 3K4QA 1WULS 3HCEA 3KR9A 1JEEA 5JFOA 1C1XB 3PFWO 4L5CA 3U4DA 2PXHA 5JC8A 3MFYA 4NBKA 2ROQA 4QYIA 2CGEA 4LMBA 2PA0A 4RVGA 3TQRA 1QHXA 4BVEA 4J0DA 4Q9JA 3W5HA 3C24A 3EVZA 3OPMA 4UNQA 1YKSA 4E11A 5D00A 3OKPA 1Z5GA 3DFIA 3LO5A 4GMHA 4XSVA 5F2EA 1WXQA 1PK8A 3F5MA 4ZIRA 1SJ9A 4GWLA 5BN3A 1VLVA 5JSUA 3AL2A 3E7PA 5TF4A 3K15A 3ZDXB 1PR9A 1K8QA 4PLYA 1KQFA 1IUNA 1E9DA 1USGA 4M3NA 4RSRA 4Y2YA 1N2JA 5JDIC 3F7OA 4L8YA 5DDIP 3CF2A 1SUCA 2HX1A 2O5RA 1DJLA 3AEKA 4OQ4A 4W5WA 5HG0A 2G4LA 3QELA 1X70A 1G0OA 1BKSB 1B76A 1QDUA 5IVDA 1PSWA 4O4IB 2ZYVX 4YNBA 4H27A 4QGAA 5CFQA 3SF0A 1EA7A 3F5QA 4JI1B 2WWYA 1FNMA 1E2PA 2VQEB 3TZEA 3I5UA 3STTA 1YTLA 3TL2A 5CFLA 1C0LA 2X40A 4U02A 1PZMA 1DLJA 2MINB 3GLQA 4LHEA 4YJ3F 3PUXA 2GJAA 3NUGA 1T1SA 3CTPA 1DOZA 1MZVA 3CB2A 4BBJA 1N2CA 1OXSC 1VG9B 3FCUB 4QUJA 5D5PA 2QGFA 3N5KA 4R5HA 3ZD7A 3KB8A 4PNPA 3EVBA 5DHQA 5KUTA 1GA4A 3HA2A 4A26A 1IEXA 4UU7A 3TTYA 3AV3A 2NAPA 1NMQA 4J7CA 4TMTA 4B47A 3TSWA 1N92A 1BG6A 4UM5A 4F5YA 2VXBA 4EG5A 3O4GA 4RO0A 2HYDA 3ZI0A 1OJLA 4DV4B 4B3IA 2IBMA 4PG7A 3L01A 5EZ6B 1UAGA 1AA9A 3RIEA 2COKA 1NYTA 3KEFA 2PS1A 2XWPA 4R98A 3U7QA 1XZNA 1P3JA 2Z8YM 1BE1A 5LCXA 1H4QA 3BWXA 3IQHX 2X7JA 3QZUA 5B7QA 5L6LB 2QBYB 5DBEX 5T7BA 3DMTC 4H9GA 1A50B 4DBLE 4IZOA 4ZO4A 2VHVA 3ECAA 1M2WA 3IIIA 2D6FA 1N5MA 1WMBA 1QO0A 3OKFA 2X1LA 4OIMA 3QLEA 3D6MA 4NU6A 3T7IA 1JDVA 2CFOA 3CM0A 3DKPA 3O1IC 1TVEA 3O8OA 4R3NA 3T1OA 1I7SB 1L8AA 4F71A 4QSMA 1WZ2A 4U00A 1Z73A 2F1IA 3AXTA 1J8FA 2JEOA 1XRRA 3IC5A 3QMWA 2DG2A 5AUPB 3LUAA 4DB4A 1Z07A 5LB2A 7REQB 4JGGA 3IKTA 2H06A 4HTFB 2OCBA 2YFYA 5KSPA 1LRJA 2YASA 3OX2A 5A4AA 4TSFA 5DN6A 1NW7A 4BU1A 2XZLA 1N2IA 5L3ZA 3IV7A 3AFIA 3AC0A 1EEXB 1VSUA 3PT5A 2DUWA 4AY5A 1OXVA 4L3WA 1IN8A 4AIRA 2G63A 1FPMA 3AG5A 4R1SA 4AU1A 3ONWA 3VZQA 5LNK6 3T9EA 4ZU6X 4NRDA 2GBFA 2OBLA 2YZGA 1QAOA 5D3ZA 3VRHA 3WNDA 3PDIA 4CKXA 2IYLD 3I9V6 1P6UA 4BEBA 1E79D 5CTJA 5EPUA 4MLDA 3INTA 1FSZA 2JAWA 1O96A 3HUEA 4JLJA 1B1CA 4XFDA 3LX6A 4MJ7A 3INGA 3HPQA 3GLFA 5LMNB 3R8FA 2ZUEA 1ISJA 4WGGA 3AZOA 2G1AA 3E8SA 1V16B 1Y1QA 4M9UA 2QK4A 1QXSA 4GH5A 1OR8A 4ARUA 1LSOA 1YNSA 3AO0B 3HA5A 4KBYA 3RT7A 5T57A 1NIPA 2EATA 2QE6A 3EGXA 4TT3D 4PYJA 4YP6A 3OOSA 2GAFA 4JR1A 4AP9A 1RWWA 3VC2A 1VG8A 1FTQA 4GMKA 1C9EA 1PVDA 3EUAA 4F3KA 4E30A 3UB2A 3KL2A 4DNOA 4WKBA 1DKQA 1WL8A 2WE7A 4Z4QA 4OLBA 5DNAA 5JNLA 3B7GA 3NAMA 4M1YA 3DOCA 3R9WA 1JHXA 3QE4A 2IPAB 1TMOA 4C0WA 1PGNA 4B2YA 4CF3A 1DCKA 2YWCA 3LL4A 2FFJA 4W7HA 4R9RA 2V4MA 2I3DA 4LVNA 4ZHQF 1B8PA 5B4TA 4P3XA 3I04M 4IJ6A 1T1GA 3R41A 3DDSA 3RYIA 3VU1A 2CNDA 1B6GA 3VOTA 3SZOA 4DA8A 2OUKA 1FDOA 2GD1O 2ZJ5A 4Z3KA 2WD7A 2C95A 2Y2UA 3I62A 3KE8A 3EVEA 3EIWA 2AJDA 5TQJA 1GQSA 2HPHA 2WQ6A 3EIEA 4K26A 5F5XA 3VO9A 4FCCA 4MEBA 4WI1A 3QUTA 1OU4A 4G0QA 3RIYA 1CUBA 1RQGA 2PWYA 3EW7A 3S1LA 3EMBA 4C2UA 2VJMA 3VBCA 4HDMA 2IOFK 2WUGA 3E03A 4G09A 2Z04A 5SZKB 2AFHE 1K2VN 1BSVA 3TX2A 4FDUA 4P0PB 4XARA 4UZFA 2PRSA 4YJHA 3TZBA 2ZZMA 1A27A 2RHTA 1X94A 2BM8A 5I3CA 5EOVA 4I9UA 4PS1A 3KZCA 5CAEB 4DN6A 5CDTA 5DT2A 3HSYA 1TUEA 3GEBA 2COEA 4G1CA 4WSOA 3VTFA 3ZHCA 3WWDA 2AK2A 3K0SA 2C2WA 2WVJA 2SKCA 3LFUA 5EZQA 3HY6A 2QMZA 3DYBA 4XFJA 2EYQA 4AULA 3FBGA 2H92A 3SZLA 3UAWA 2HGSA 1C9KA 2YMMA 3B53X 4I4TB 4MPJA 1ZR2A 4NBVA 2UUPA 3TLCA 1POWA 4LZNA 4QUAA 3U9SA 5FAKA 3KJXA 1R00A 3F5FA 3M5PA 4MS4B 1H94A 4RAOA 4L0CA 5AVVA 3N2LA 3NEJA 2A6PA 2AXQA 1EFDN 4U0KA 3LIIA 1PFVA 2W11A 4GVXA 3E4DA 4U7HA 2NVUA 3FRIA 3JZFA 3A9SA 3NIWA 4I19A 2R65A 4MZXA 3O8RA 4GDFA 4HFNA 1W7AA 3E18A 3O82A 3H9QA 1RFGE 1Y1LA 2FWAA 2H7YA 2GRAA 1VGVA 2PD6A 3CBGA 3FKQA 4LNUB 3V1UA 1DV1A 1F0KA 1WV1A 2XMZA 3E9ZA 1XUOA 3FAZA 4E0BA 2WU3A 1HX7A 1QK3A 3Q7EA 3BB3A 2EBHX 3CRMA 4UTPA 4X84A 1SD2A 2R1TA 3T9FA 1UXJA 4UUQA 3R5SA 2Q2QA 4W9NA 4CM9D 3DLCA 4V2UA 4ZXPA 3WLRA 3EJWA 2XWQA 3C7DB 4COKA 4X6UA 1J20A 1M34A 2BR4A 2OZLA 3JQ8B 1E3JA 2JRCA 1R6AA 4A4DA 1R0KA 1JDBC 4RMGA 3QKWA 3QXJA 4WY5A 2O8BA 4RHTA 3JQ9C 4M37A 4KQ9A 4MV0A 2H9YA 3BRWD 1WQ4A 1LWOA 3N0RA 1YFKA 4ZAFA 3WIVA 4CTJA 2J41A 3RS7A 3ISTA 1XGKA 1O95D 4D3FA 1QS0A 1T6BY 3HNPA 4FYIA 4HDSA 4CYMA 2PGXA 3KOZA 4O4JA 1G19A 5CG2A 2PKYX 2BGWA 4EJ2A 3VAYA 1WETA 2C5BA 3MQFA 1BDBA 1E9FA 1H2BA 1AV6A 4QPCA 2D1TA 4UEOA 1RZRA 1GOTA 4H7PA 4Q19A 2X13A 3WK8A 1Z8NA 3OFKA 5I5GA 2AN5A 4MKHA 4X8MA 1HK7A 4ZTBA 2WHPB 4YGYA 4IJQA 2BFPA 2QN8A 1A4XA 4PSVA 2OFFA 3G5MA 5B7NA 1H66A 3C6ZA 2EIXA 1LPPA 2RGEA 5FI1B 2VUHB 2PIDA 2BZ1A 2RGGA 2WM9B 3QWAA 1I80A 3VYRB 5TS2A 3CY6A 5F76A 1Z37A 2KQUA 2VUSA 1D1QA 1NAHA 4HQKA 1EVZA 4NZYA 1LZKA 1YIAA 4Q82A 1FP4B 4N3NA 3CTMA 4A0QA 3OICA 1XNQB 2QQEA 3GDFA 3PRJA 4M0FA 2WU0A 5IJZA 5HA5A 1V6CA 1XU4A 3G2NA 3NRBA 3GGGA 4P4UA 4BTEA 1W85B 3DD1A 2WG2A 3MBOA 1TM1E 3R0IA 1DZ3A 4P7KA 1BU8A 1KJZA 2DQKA 3LWNA 3P2IA 5JQGB 2JCXA 2VPPA 5KYKA 2BSQA 1OB5A 1RD4A 2C2ZA 4A6PA 5THXA 4YMSA 5HE8A 3OIGA 5CVCA 3QEMA 4IS2A 4HAUA 2CLOB 4PHHA 3W8DA 5BV1A 4YRAA 2HT1A 4HJXA 2GM5A 3GLIA 4E5VA 1W59A 2LKDA 3TR6A 5EIAA 1JLMA 4DNFA 3I9NA 3O4HA 3IAAA 1T9ZA 4NBNA 4Q1FA 3E5MA 1LJUA 3R5FA 2PO5A 3ESZA 1I6WA 1VMIA 3GVXA 3OP1A 4HQ6A 4NC9A 3OE5A 1JG7A 2OCLA 1ZA2A 4FEEA 2IZ1A 3SKYA 4HNSA 3CZAA 3LKBA 2E4WA 4OI0A 3CLSD 3E1SA 3B89A 4HCJA 4MVJE 4TRMA 4A8TA 4B4VA 4KR2A 5E2IA 1LPAB 2O2DA 2FMTA 1QFMA 1CSEE 5ARDA 1DXYA 3O92A 2QD3A 2CVHA 3H4TA 3P9CA 1Z6GA 4R9NA 1J99A 4MV9A 3EQZA 4WJZA 4BMZA 4F60A 5CPFA 2YJ6A 3AW8A 5BR7A 1FDIA 3GD7A 3WGIA 3F71A 1A1SA 3ZLUA 1KHTA 2Y9MB 1XN4A 2ZLBA 3ACBA 4POAA 2ZJFA 3CX4A 4QNMA 4MUGA 1XDWA 2JI9A 2PMDA 2V6GA 5H3CA 4B32A 1TD1A 1YB5A 1RWQA 1UOOA 2JAUA 2X9QA 1II9A 1NNUA 4QDOA 4XWOA 2F4VB 2G70A 3HFSA 3ICOA 1NA5A 2R44A 5KPJA 2X9NA 4MCHA 4RETA 5TB5A 4HNRA 5KSYA 4MDEA 3A2NA 1E9BA 1EM8B 1VP9A 5FV7A 1Q12A 3H4IA 4DMLA 5FUWA 3H0EA 4QHTA 3P52A 4LJ6A 1FQOA 2GAJA 2XNSA 2ZRNA 4PSUA 5K51A 4NCJA 4GM4A 5K4GA 2VP9A 4MAFA 2VH5R 4K5QA 3DHYA 3P9NA 3T34A 4BLPA 4P4SB 4B31A 2BKLA 1QFSA 1US8B 4R51A 1TQDA 3LYLA 5DTEA 1T8RA 5BOVA 3IL2A 2PEZA 3Q2OA 4ESOA 2E5LB 5JY1A 3ADKA 1JG6A 4BJHB 1TA0A 2D0OB 4M8SA 2JHFA 4UPEA 4KXNA 1C0KA 4LECA 3DZ8A 2WYWA 3URMA 3W6NA 4GS5A 5GONB 1EFRD 2Z09A 1TJ5A 3CONA 5KYUA 2VAVA 4V0RA 4OA8A 1VC2A 4KR0A 3R7SA 4LIPD 4LOKA 3ZIUA 3V42A 3U1TA 1S7CA 1M2GA 4OY3A 3EH1A 1CEXA 5TV2A 1O58A 2HFJA 1WMFA 3H9BA 4BS9A 4XPZA 4F5ZA 3MJRA 1T0UA 5GWXA 4FK8A 1VL2A 1ZEMA 3FYHA 2D2FA 1U8UA 1YCGA 3JQFC 4OSOA 3V2GA 3O75A 3LGXA 1XF1A 5KHOC 4I8XA 1SUDA 4GGMX 2D5BA 1JYFA 2X9LA 4BV3A 3B60A 2XQGA 1WB4A 3DV0A 4RUKA 4L16A 4B71A 5K0SA 4LRXA 5IPFA 2J9FB 3KP1A 3EAQA 1MOZA 4CTKA 3E3OA 4KE9A 1R64A 1CR6A 4PAGA 4ZAZA 1K5DA 2I3BA 2DLDA 1YB7A 5LN1A 3E2PA 3FMPB 3QQPA 2R6R1 1Y1KE 3OU7A 2W2NA 5AFSA 4OH1A 4ERXA 4YJ2F 2ORED 5E9QA 4DADA 3RUHA 1VIYA 1X8XA 3PNBA 2QTRA 1I6LA 3OQBA 4GBJA 4K3VA 1PL0A 3A1UA 5D5HA 3UHPA 1ZQ9A 2DUMA 2C7OA 2XMQA 2ZG6A 4ZO8A 1KDRA 1ONNA 3R3JA 4CKEB 4RTQA 3THWB 4M7RA 3FDJA 4M46A 2ZRMA 1Y6ZA 3A9RA 3SJAA 4QLBA 5B3JC 1OSNA 1PT6A 1S4MA 5DHRA 5E3IA 1B41A 5AW3A 2HSZA 2VDVE 4Z7QB 2GPAA 3MILA 1OFGA 2QG4A 1SVOA 4ZVMA 3ZQ6A 4Q7EA 2O0MA 4NU0A 5EVJA 5CGZA 2I03A 2QJFA 3CINA 5BNZA 1V6SA 3K6JA 3PLAE 3EIQA 5I7EA 1AK1A 1GT91 4O4LA 2MSLA 5F2OA 2H63A 4I4LA 3WRWA 1NR1A 5AESA 4XASA 2H1IA 2PAAA 1GFSA 1YSCA 4AYXA 1C9NA 2XXAB 1UANA 3UXHA 1Z6PA 3G2JA 4CHTA 3J80A 4AAYA 1KPHA 3I4LA 1UPXA 3HYTA 4G85A 1ZICA 3KETA 2CNBA 4AZTA 2L19A 4EARA 4G0WA 5A02A 1OLUB 4DLWA 2DF8A 4HNAA 4BMDA 2JLZA 1MKYA 1Z9BA 1NXSA 3CSSA 3MS2A 3DQQA 1SUFA 2WU1A 4L4UA 3ZGYA 5LUAA 1P1FA 1TM7E 2VBIA 3NDIA 5FNVF 3ZNNA 1D09A 4KC0A 2G7ZA 4Q21A 4ZOAA 2PHZA 3C74A 4F7WA 1QZUA 4PVCA 4S1WA 5AJYA 1FRNA 1T3ZA 1Z62A 3PV0A 4Z8XA 4XX0A 4NBSA 5C7IO 3ZXYA 3ZV7A 2E5WA 1CUWA 4R7ZA 1BJTA 3I53A 4ZZ0A 1T4CA 1DIAA 4KWHA 1KORA 3GP3A 1A76A 1U0TA 2E87A 3K70B 2GYVA 4HB2A 4K9LA 4IGKA 3WYFA 1MV5A 4B76A 2IS2A 3G89A 4EY4A 9MHTA 4EY5A 3A27A 3CFYA 4M1EA 2H85A 1RQRA 3KO8A 4F3NA 4Q6WA 2KLBA 4BZQA 5BW8A 2ZB3A 4DCCA 2Z3ZA 1ULHA 3FDXA 2SCUB 3D81A 3GNSA 3RRXA 3I64A 3K6SA 5BWMA 2WB4A 4AX8A 1WX1A 3MMNA 3K71B 3BL5A 5JOQA 1C7EA 2H1CA 4ESVA 3AEQB 3KVYA 4R3UC 1ZRNA 1ZCJA 3VM6A 3K73O 4D41A 1GUZA 1KEUA 1PYGA 2JIQA 4MQEA 5EPOA 2WUDA 3F9RA 1M1YB 4D80A 4QG3A 2V74B 4JR2A 4MWOA 1BXRA 2EJCA 2PD4A 2F1JA 3L0PA 4FE3A 5KQGA 4E13A 2G07A 3AY0A 2H1VA 2I99A 4B09A 1ORRA 4C04A 2OCAA 3LRTA 1Z6AA 2XMDA 3W79A 2NZUG 3N9IA 4LNAA 1JLRA 5F35A 4R2KA 3ZCUA 2ZZNA 4BWFB 2K2WA 1C14A 2JB9A 4HYQA 4TMVA 3WLHA 4F93B 1VPEA 1XCLA 4MNTA 1Z0AA 4IH9A 4GKVA 1KYZA 3WQSB 5EJ9A 3GBPA 3KTFA 5TXGA 3KOUA 3JVUA 1VKNA 3RVJA 2Q21A 2R86A 4OF4A 4OHVA 1VDMA 3SR0A 1BX3A 2ZTVA 5NLLA 1HDZA 1Q3HA 5BV2P 4LOLA 2PNFA 1Y8AA 4TRJA 1U9CA 3GAAA 1KZYC 4GQBA 5ALIA 3RFXA 2QVZX 3OZWA 1R9GA 2FEPA 1QKIA 1L7QA 1EFPB 2G9VA 4OFWA 5BN5B 1TOAA 2XODA 3TEJA 1L5SA 1OWPA 3CA8A 1MQSA 2EGUA 5COQA 1F48A 1YF3A 4XIFA 2YYSA 3H13A 5JAUA 3FVQA 3H3JA 5L7YA 4W5JA 2O3SA 3WLMA 4BX0A 1XHEA 4CU2A 4OO3A 2FW9A 2UYCA 1PHPA 1W88B 2YHIA 4J1QA 4UNIA 4D4JA 1SKMA 3PK0A 4NYIR 3ZTTA 2PKCA 4N7BA 2ZYDA 3L7AA 2DWPA 1Z74A 1F2DA 1OAOA 1UC5B 3GCWA 3KZOA 4CLOB 5IZ4A 1H6CA 3E58A 4GU5A 4FEGA 5KDDA 5E3HA 2CVFA 3OSZA 3JQAD 1E79A 5DF1A 3LP8A 4FIZA 4IUCS 3JASA 5K9ZA 3GH3A 4EK9A 2JFQA 4DCMA 2A7QA 1QQBA 3DP9A 3PXXA 2Q1XA 4ZI3A 3K2IA 5BMVA 1E2FA 2W0SA 2REQB 3K1AB 5GIPE 5EWJA 4HDOB 3LCUA 3P94A 3U61B 4TLEA 2YWJA 5I9TA 2ZXUA 4PLVA 1UJBA 3H6GA 5EJFA 4H1WA 1TTPB 1RMYA 3K31A 4PINA 1NBHA 2HA5A 1QF9A 3TBHA 2QYSA 3B3GA 5IBPA 2B4KA 3DOUA 1H0RA 3PGMA 1JFFA 4ZMRA 3HI4A 3FKSD 5DCWA 5G1PA 1E2BA 4OBEA 1Q19A 5IASA 3KUXA 1ZU5A 2H5JA 3OX4A 4O4IF 1NRJB 2FPGA 1JA0A 4IFTA 5KWJA 1BH2A 1VJDA 4JYPA 2OCKA 2HUNA 3TOSA 3WLQA 3WIBA 3ZWWA 4RL6A 2Q4RA 5A62A 3K1YA 5HCNA 1ZAYA 1B8NA 4KRFA 3ZEAA 3KJNA 2GYUA 4YPVA 1JHPA 3WJ7A 4JJIA 1MJGM 4OP1A 1UOQA 5DHUA 1U63A 3M6UA 2AD5A 4N03A 2JG3A 1XA4A 2EP8A 4MWEA 3FUWA 5C4MA 2CMKA 1CCWA 2FN9A 2RGAA 3T94A 1WNTA 2C59A 2ZIFA 1GL6A 1GAQA 4CEHB 2FN4A 1Z4OA 5TJ9A 1XAHA 2HMTA 2PX3A 2ZWMA 4IQGA 4C4PA 4TL8A 4Y2VA 2RKOA 4AQ7A 1ZNYA 1R74A 1WLYA 3BHJA 3PX3A 4AJ1A 4KO3S 2WKWA 3QMPA 3OQPA 3P5BA 3FTDA 1Y9DA 4EB8A 5A4DA 3UAZA 1EFTA 3E82A 3H5OA 4IMPA 5ES3A 3B82A 1ACMA 1U8XX 1FQWA 3ZR4B 4BFUA 2Y66A 4ZI7B 3OCCA 3QX3A 4DLLA 4Z9XA 2VFAA 5ILOA 3EUEA 4KYUA 1ODSA 3U31A 1SPXA 2P5TB 4I5DA 1TZ2A 2CLHB 5HOQA 5JTUA 1MENA 4CTOA 4YP9A 4Y2TA 2UZAA 1X8KA 3S3TA 1L7AA 1M2NA 1YJ8A 1VE5A 1LK0A 4I50B 1YRQA 4OXRA 4Q4AB 3TUIC 5DX8A 3DZBA 2FJPA 3A58B 3D3KA 3KQQA 4OQQA 3EAGA 3RU3A 4DUPA 1JQJC 2YVLA 3I09A 3W0LB 4ZYYA 2F90A 4ZEVA 2MYPA 1YZYA 4KITB 3WYGA 4D3YA 1T29A 4LRUA 3UYLA 5JARA 3CEJA 3HZHA 3EG9A 4OHPA 3UV3A 2IZ7A 4GYKA 3VX4A 4YRZA 4E5DA 1OFHA 4JUCA 3DEKA 5J2UA 4BP8A 1C41A 5EZYA 2VJCA 4R3WA 4AFNA 5GQSA 1OI3A 2W2QA 2ZQ5A 2FQWA 2MHCA 3CR7A 3PUJA 4GMFA 4KVZA 4P80A 4V3BA 2G9NA 3TUJC 4NDZA 3E9EA 4FDMA 4ZYLA 3U0BA 2IF2A 3IA7A 4D0SA 1BHSA 1TEXA 1BWPA 5KDOA 1W4CA 2QZZA 1T6YA 1GTVA 2ILTA 5A7GA 1X1RA 2H5IA 2VDMB 4PRKA 1H5UA 3ONEA 2R25B 2JGAA 4LJ8A 1ZC3A 3HSKA 1NNSA 4ZYVA 4MS3B 4MVXA 4GOXA 1G98A 1E1QD 1G291 2AZTA 3A0RB 2AOVA 1A77A 4EKDA 1K98A 1S02A 4JP3A 1IL0A 3IAM6 2ZU6A 3ZWVA 1XTUA 4ZV4A 2XKKA 5GGXA 1U7HA 1FPQA 2FPXA 1IVNA 3BRWA 3MCWA 4GL4A 3OPYB 1N2OA 3IAS6 3JQ7A 4ZAWA 1YVEI 3VR6H 5J4VA 1COZA 3R23A 1O95A 1Q16A 1X86B 1SG9A 2EFDB 2ATVA 2FE4A 3QVWA 1MJHA 3B6JA 4G0YA 2Y0EA 4D0NA 5MF6A 3KWFA 4AYTA 4X7BA 3ACCA 4WFKA 3ZCTA 1MX5A 1OE0A 1TVKB 1HLPA 4XWGA 1QPZA 5L45A 2Q2VA 3H11B 5U9CA 1GTRA 5AVJA 1BROA 1Y5IA 4JQCA 3I76A 1JGTA 3K9HA 1RAGA 1UXIA 1HQCA 4KAAA 2OXTA 4FYHA 4IGFA 1KRWA 3S0JA 3FSGA 3PNOA 4GRIA 1U9ZA 1YB4A 1AJEA 1Q7GA 3TSCA 4KGXA 1GZSA 5FLKA 2IZOA 3FSEA 3H17A 4JBHA 3RVDA 3WSVA 3B8EA 5HJ5A 5K0ZA 2P6MA 2P9ZA 5BYJA 1GL9B 1LD3A 4HI0E 2R6HA 3IV6A 4LYJA 4PEVA 2QENA 3QU2A 3LDGA 3UHAA 5IUNC 3CWCA 3TTUA 2PUAA 4L8GA 1SBQA 4JX8A 3DEHA 1R8XA 4PLFA 4W9NC 3T1QA 3ZU3A 4DV1B 1XJWA 5C3UA 4ZJUA 1XQVA 1E3SA 4FNGA 4EG7A 3LP5A 2FVXA 3M9LA 4RHEA 1W5AA 2QMOA 3VOAA 4EPRA 5K8CA 4KHPB 1FOEB 4BLOA 1IUKA 3WDLA 3BWVA 3PWKA 4O8ZA 3VNAA 4YREA 5FI0B 2EL7A 2AI1A 4OXYA 2G9QA 5KTYA