1IPEA

Tropinone reductase-ii complexed with nadph
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
259
structure length
259
Chain Sequence
AGRWNLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNDCLTQWRSKGFKVEASVCDLSSRSERQELMNTVANHFHGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTIQDPEQKENLNKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGGLMANCGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Capturing Enzyme Structure Prior to Reaction Initiation: Tropinone Reductase-II-Substrate Complexes
pubmed doi rcsb
source organism Datura stramonium
molecule tags Oxidoreductase
molecule keywords TROPINONE REDUCTASE-II
total genus 104
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 1.1.1.236: Tropinone reductase II.
pdb deposition date 2001-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ipeA00
2XOXA 2Q45A 3U4DA 3TZ6A 1JWAB 4IY1A 4BB5A 4MVJE 5FFFA 2RIRA 3UUWA 2YQ5A 3B1JA 1D8AA 2J3IA 4FFMA 3UKOA 2BFPA 4P4LA 2JD1A 2CY0A 5JAMA 2P91A 1LDYA 4M8SA 4ZA2A 3ZV6A 4A26A 2A35A 4TSKA 4WCDA 3WWZA 3AI2A 5A4DA 3QVWA 4RQTA 1NYTA 3PJGA 3SLKA 3MJEA 2Q99A 5HWSA 4N54A 5EERA 3KHUA 3BMOA 5A9TA 4BO2A 3NDRA 4O5OA 3WJ7A 1BHSA 1LDMA 3GZ4A 1XLTA 3JV7A 4OIMA 4IJKA 3JQAD 3T7EA 1YL5A 2IRWA 1N7HA 4MVJP 1R12A 3NDJA 4ALMA 3ZV3A 2E6UX 2IYOA 4PG6A 4EI2A 4HP8A 3VZPA 1RM0A 4CQLB 1CQIA 1R6DA 2GZ2A 1GL3A 3EAGA 4EZBA 1ID1A 1DO8A 4DTIA 1U7HA 2IEDA 2QRKA 4IDBA 4L9RA 4LSWA 4Z9XA 4D3FA 5JYEA 1EE2A 4CL8A 4FJ0A 1HLDA 2GF2A 3SLGA 2HLPA 1E92A 3L07A 3PGXA 3BYZA 3MJ4A 2HK9A 4R9SA 4L4RA 2VRCA 1WLYA 4JJFA 2EP5A 5JS6A 2GUGA 1ZIDA 3Q2KA 4BNNA 1LI4A 4KTTE 4R1UA 3NTQA 4Z0TA 4YR9A 3ETEA 4NH4A 3S8MA 3IAHA 4XWYA 1R16A 4Q39A 5DZSA 1DPGA 3RVDA 2CD9A 4Z6KA 4R9RA 3RU7A 4II3A 5ICSA 4INAA 2PD4A 5JCXA 5HBRA 1B26A 4IBOA 1E7RA 1PTJA 1NNUA 1DFIA 2PKRA 3GH3A 3ZWVA 3BMNB 4PG8A 1A4UA 1XU9A 4AJJA 3TWOA 1WWKA 3PPIA 4OXNA 4XEHA 2FP4A 2OBNA 4JX8A 3RFTA 4ITUA 1FDVA 1H6AA 3GK3A 1MUUA 1V9LA 1NVTA 3DBRA 4D0RA 1ZFNA 2SCUA 1O0SA 2D0IA 1G6KA 3PFWO 1O5IA 1GCOA 1JVBA 2PFGA 1RWBA 4DIFA 1DIHA 3NKLA 5CEJA 2PH3A 4OOEA 3AWDA 5T57A 1PZHA 4BS9A 3WDSA 3ZU4A 1G1AA 3X2EA 4HADA 2X7HA 1W8DA 4DXHA 3ZHBA 3B1KA 5JLAA 2CVOA 4RVSA 4CR7A 1IE3A 4E31A 3ZW9A 1FXSA 4TZTA 1BSVA 3EZYA 5JO9A 3WQRA 1FDUA 4B4WA 1HDOA 1ZXBA 1EVIA 1ZEMA 3RBXA 3OA0A 4U6QA 2X9GA 3H2ZA 4UUPA 3GAZA 2X9NA 5JAZA 3H9EO 3C8MA 4MINA 4TRJA 2OUIA 4KMSA 4AVYA 1SO8A 4JCOA 4R3NA 1SB8A 4CLDA 1Q7BA 4AJ2A 1KERA 1C0IA 2GO1A 3L4SO 4Z3DA 3O8QA 5JPIA 5THKA 4R5MA 2X5KO 2JCXA 5TJ9A 1N9GB 3GEDA 2F00A 1N2SA 4D45A 2ZTLA 2HRZA 4K28A 1LLQA 2VWGA 1Q2XA 5KVCA 3RUHA 3GRPA 3L6DA 3GNSA 2IDZA 4D0SA 1LLUA 3WG9A 4CLHA 2HUNA 1JN0A 4YA6A 1I3MA 3RASA 4XDYA 4YCAA 3CXRA 2X86A 5B37A 4K9DA 4MOWA 2AXQA 4BHTA 2DUUA 4I9UA 3TSCA 4NBVA 2EWMA 4WLNA 1BWSA 2P2SA 4OHUA 2OGUA 3JQ9A 4UREA 4UUNA 4BMSA 2VTEA 1DAPA 3D4NA 4PZEA 1KOLA 3MJVA 5HM8A 2LDXA 4MPDA 1NASA 2P5UA 3H9GA 4L0QA 2PKQO 3LZ6A 2PNFA 2PV7A 1U9JA 4I5EA 5DT9A 2FMUA 3FCOA 5FI5A 4F46A 1M2WA 1NWCA 4J90A 1Y8QA 2FWMX 2OZPA 2Q1UA 3AY3A 4PLZA 4E5KA 4QTZA 4XYGA 4QSMA 5H83A 5KVQA 1DHTA 1EFLA 5F1OA 3I9MA 4RF2A 4CMJA 1ZZEA 2O2YA 2W2KB 3VHRA 1ONNA 4AJ1A 3NV9A 4IPTA 4J1NA 3IUSA 2HJSA 5IF3A 5A04A 4DQXA 2RH8A 4EJ0A 2NTJA 2F1KA 4J7XA 1YBAA 3ONEA 2PH5A 4D79A 4YJFA 2WJPA 2JJYA 2Y1DA 4GPD1 5K6AC 1U3WA 2O3SA 2Y1OA 1VM6A 1ZH8A 1KY5A 2CMDA 3KO8A 3D5QA 4RF4A 3OFSA 3V1UA 4W6ZA 4MVJA 1WP4A 3EVTA 1WDLA 3FNEA 3N74A 2Q2QA 5L3ZA 2GYYA 3FBTA 4W9NA 3PLRA 3DOJA 4ZJUA 2VOJA 3WIEA 1UZLA 1HXHA 3H5NA 2DTEA 2RBEA 4N18A 3WICA 2AE2A 1E1KA 4GL4A 2W8ZA 2AEJA 4E2ZA 1B2LA 3HDQA 4BKPA 5FWNA 1F06A 4I8XA 2CUKA 2VNSA 1ISHA 2E37A 1M67A 3WGTA 4QFCA 3NT4A 4WKGA 5IZ4A 3WWYA 2CVQA 5JDIA 4CQMD 3ZV5A 3GF4A 3NJ4A 4QXMA 1EMDA 3ONDA 1KVQA 4UEJA 3JQ8B 3AU8A 4Q3DA 4YAJA 4KDFA 3CUKA 1PJSA 4O0LA 1WNTA 3TN7A 1FK8A 5KKAA 1EUDA 2IE0A 2ILTA 3I23A 1J49A 3IQDB 3PDJA 1V35A 3BMCB 4M54A 2G76A 1WVGA 4RORA 1AXGA 4PCVA 4NJOA 4KUGA 3DBLB 3Q1LA 4Y6PA 1KIFA 5GZ1A 4B4VA 1UDBA 4CMEA 2VUUA 4IGFA 5IFLA 2E49A 1U2GA 4Y9DA 3WYBA 1I10A 3W8FA 4IJVA 5A3VA 3EZLA 3A14A 4ALLA 2W90A 2HK7A 4PLPA 4Q3EA 4XQ9A 4P8RA 3PHJA 3LU1A 4J49A 3UW3A 4BNIA 2NU7A 4NBTA 4RO0A 1PS0A 3BTOA 1IY8A 4TKMA 4HFNA 5IG2A 1SNYA 1ISFA 3WYCA 4D7AA 1LX6A 4J0EA 3UFXA 5L4NA 1PJ2A 2WYUA 3ZNOA 3DMTC 3FPCA 1H94A 1A5ZA 1I33A 3OM9A 2ZKLA 1SCUA 2NSDA 1T4BA 3W4JA 2A4KA 5ER9A 1XKQA 1GYQA 4M49A 2NLOA 4UVGA 3L6EA 4HUJA 1FDWA 1NWHA 1VKOA 2C5EA 2Q1TA 2DBQA 3ABIA 3IJRA 3JQBA 3M2PA 5C3MA 4E5NA 3G0OA 1NBOA 1MG0A 2B69A 4CM8B 2D4AA 2JHGA 4F45A 4EW6A 2AW5A 1Z6ZA 2EGGA 4BV9A 2WD8A 1OMOA 1O95A 4CMKA 3I9OA 3KV3O 4FOOA 5CP8A 2OP1A 4WOJA 4DREA 5IZCA 1EBUA 3QJ5A 2Q49A 4GSLA 4NPCA 1M66A 3IIEA 4EYEA 5IXYA 1T26A 1Z73A 3PQFA 2Y1CA 3I1JA 3EY4A 4WASA 2Y1EA 1ULSA 3A1NA 4BGEA 2HSDA 3ZWPA 3AI1A 4CMCA 2ZTMA 1R4MA 3VAZA 1ADFA 4N7RA 3I9NA 5I8ZA 3ZV4A 4BNYA 3QQPA 3DZJA 4CQLA 1DFHA 5I9MA 4RVHA 4MVJF 2NVUB 1P1RA 4B3JA 1UXHA 1LTHR 3JQGB 4NBWA 1JWBB 1PGOA 1ZK3A 3DAPA 3EGOA 3GN1A 1N8KA 1UXKA 4PLGA 3O4RA 3C1AA 2NM0A 2WYVA 1XYGA 1K5HA 3LT2A 4FGWA 4AL4A 2VOEA 2I5PO 4Q9NA 4XGIA 2UUPA 2Q1SA 5G4KA 4LRTB 1P44A 2ZK7A 4AJLA 3VPGA 5ES3A 1GADO 5AYVA 3UN1A 1ISMA 1A27A 1L7EA 3TRIA 3PP8A 5CDGA 2X0NA 5MGBA 4RF5A 1NQAO 4XIYA 4YAIA 1LDBA 1PJ3A 1GUFA 1YH3A 1G0NA 2ZB8A 4YTEA 4RVFA 3I52A 3F5SA 1DC4A 5ILOA 1JA9A 3AUTA 1PQUA 1Z7BA 5JCJA 4CQMB 3E5RA 3VDQA 3DBHA 1MFZA 3RIHA 3GVCA 4LVUA 2FR1A 4DWVA 2NQ8A 4CUJA 4NNJA 4DIBA 5JDCC 3TNLA 3DAFA 3BHMA 3Q9UA 1ZNQO 3KYDB 1J6UA 4OMUA 3HB4X 2WM3A 4IM7A 4ZU3A 2HKIA 4D46A 4UVDA 1F8FA 5I7EA 3B70A 3BA1A 4PVCA 1P1FA 3K6JA 5KKCA 2EHDA 3EK2A 1XG5A 2NACA 4PLWA 1DJNA 1DDOA 3V2GA 4EDFA 2I99A 3JQFA 4CODB 2VHVA 1AUPA 1O6ZA 5DCWA 1JVSA 3QWIA 1PL6A 3HN2A 2CNBA 2PZKA 2BFAA 2JFFA 4WNCA 5EQDA 3P2OA 4OH1A 1HYGA 2B36A 3L0DA 4MVJD 1LLCA 4WLVA 4OL9A 3OQBA 1FF9A 4PZCA 2BLLA 4BO3A 3TQHA 3P2YA 3RBVA 3GC6A 2ZJ0A 1B8UA 3GY0A 3C24A 4YJFB 3S2GA 3FN4A 4RPJA 3ROMA 3TDKA 3LSYA 3WB9A 4FC7A 1ZEJA 1UXGA 1HF3A 1ONPA 2B4QA 3U49A 2G5CA 2GN9A 1NPYA 3JQEA 1AHHA 4WPGA 1B8PA 3JCZA 1DFGA 5TIIA 5I7SA 1Q0LA 4U6SA 5JC8A 4JP2A 4J0FA 1XWFA 2EERA 2BF7A 2Y1GA 4GWGA 3QV1A 3EVNA 4GKVA 5A9SA 3TFOA 1H2HA 2Y0EA 4QEDA 5BNFA 4DBVO 2PY6A 4YYZA 1ZK0A 3PHHA 4IJWA 5GZ6A 3DAGA 3QVTA 3FTPA 1V6AA 5T8KC 2O3QA 2VUTA 4R3WA 4XR4A 3TL2A 5DOVA 4CM4A 1PQWA 1E3LA 3KSZO 4IDFA 4WEOA 3FNGA 1NVGA 5BR7A 1GEGA 4NK5A 1IUKA 3K96A 1LRKA 4E32A 4WLOA 1H93A 1R4NA 1YQGA 3M1LA 3H9JA 2AQ8A 2Q4EA 2Y99A 3GNTA 1JU9A 3KVOA 3TZKA 5KWEA 3NTRA 3R1IA 2CDAA 4ND1A 2FZEA 5C5IA 1E3WA 3BMCA 4ND5A 3WMWA 5DF1A 1AGNA 3OIDA 1T1RA 5I9LA 3DBLA 3E8XA 2X22A 4FS3A 3UCEA 3KTDA 2O3JA 3OJEA 1ML3A 5L95A 1F12A 3H5RA 1NR1A 3H6KA 4CR8A 2RH4A 4O63O 2BMAA 1YE3A 4MIEA 3UICA 3VZSA 4IQ8A 4PLVA 4KWHA 2B35A 3GDOA 5JC1A 2XXBA 4OAQA 3WTBA 4BUCA 2BRUA 3QVXA 1VKNA 1WMAA 2W2LD 1GUYA 3RJ9A 4MDHA 4O59O 1GQYA 4NG5A 1W73A 8LDHA 2O4UX 2DFVA 4IDDA 2FN7A 4FFPA 3JYOA 4BNGA 4Z3KA 1BW9A 1RM4A 1BMDA 1EEHA 3A06A 1E7YA 3VKUA 4BVAA 1T4DA 2DUWA 3AOEC 5DBIA 4E13A 4GSKA 3WGIA 1FJHA 4JK3A 3TJRA 1UZNA 1GDHA 4DMMA 3JQBC 4CMEC 1BGVA 3RC9A 2AEMA 4YT2A 1YVEI 5BSGA 1JKIA 5JDIC 4UEOA 2AQKA 1E5QA 1H0KA 2VHYA 4OKNA 1R37A 1HRDA 1SB9A 3DDNA 2NQTA 1KEVA 3E9NA 1EK6A 1QXSA 3KYBA 3D3WB 3U62A 4J3FA 3DTYA 2VWQA 3DMTA 3OH8A 1JAXA 2D8AA 1IB6A 1EK5A 1LEHA 2ZTUA 3LF2A 1VLLA 1X1EA 2BD0A 5COBA 1LJ8A 1UXJA 4D42A 3GUCA 3V5NA 4W7HA 1XQ1A 1K3TA 1KVRA 2CDBA 3O03A 1R0LA 1ZUD1 4BQPA 4H3VA 3WR5A 1PGPA 1R0SA 2O50A 4II2A 4YWJA 5A5FA 3MTGA 1SC6A 1V3VA 1MG5A 1N1EA 3OHSX 3Q3CA 3ZCXA 1CWUA 1VI2A 2YFHA 1WAMA 2YHIB 3PQDA 4E5MA 2P4HX 3RUFA 1CERA 2Y05A 3Q0EA 4CLRB 2YUTA 3INGA 4BGIA 4OGWA 1P33A 2BHLA 1ZW1A 5CDUA 1E77A 4ALNA 4DC0A 3CMCO 3JQGA 3WGYA 3I4CA 3LYLA 3VOSA 2GZ1A 4UUMA 4NMHA 4ZN6A 5B4VA 1A9ZA 1DRUA 2BELA 2C20A 1GYRA 4BV8A 2P68A 1E1MA 3QWBA 3K30A 3I6QA 3JQ7A 4TQGA 4HY3A 3H9QA 4YPOA 1V0JA 4NIMA 2G82A 3R6DA 4OQYA 1U4SA 4LN1A 4BKUA 1P1JA 1HZZA 4HXYA 4PFJA 1HTBA 4BO7A 2FPPA 5DBGA 2Z1MA 4E2XA 4YRAA 3LT4A 4UUOA 3ZHZA 4CR6A 2J3KA 2VYND 1PSDA 4BMNA 2OOSA 2ZB3A 4UVEA 3EDMA 1UUFA 3AUSA 2A9FA 3N58A 4TVBA 3FD8A 1P9LA 3KYCB 4R1NA 5MDHA 2VN8A 4NDNE 3VC7A 3ZU5A 2VRCD 4BNHA 2ZQZA 4RPGA 3FRJA 5ITWA 5F1KA 3ZW8A 4JROA 5JSFA 2J3JA 3WGOA 3E9QA 1XQ6A 3S2FA 4CMIB 4ZRNA 2DQ4A 2EGHA 4DIOA 3ZWNA 5L53A 4MP8A 5KOIA 1DEHA 4J4HA 1TXGA 1JLLA 1GY8A 1P0FA 3QWFA 1B7GO 1TT5A 2HAEA 2W4QA 2C54A 3QP9A 3ROQA 4I9HA 1MXFA 1B0AA 2JD0A 5JMPA 3R0IA 2H63A 3BMOB 2C7GA 5EQFA 1QKIA 2FOIA 3CE6A 5L7YA 4BO6A 1GPJA 3ORFA 2HRBA 5KJ1A 3PVZA 4MP6A 2HK8A 5C37A 4FB5A 2IZZA 1GCUA 4J7UA 4PG5A 1NQOA 2PD3A 5LCXA 5BNIA 2Y68A 4JN6B 1CDOA 1VL6A 5FYDA 3UH1A 3O26A 3ZHYA 5K9ZA 1X0XA 1HT0A 1QYXA 4TROA 4R01A 4CJXA 2OO5A 3JYLA 1DLIA 4IIUA 2NVUA 3ZDFA 4CM9D 3HB5X 4L4XA 3IOYA 1LC3A 3I9LA 2A92A 1PL8A 2QZ9A 2JFHA 1BXGA 4FOSA 4L4SA 1HDZA 1C1XB 2WTBA 4BKOA 1YQDA 1UH5A 1JDJA 4BO0A 3AI3A 4E2YA 3GG9A 4ZGWA 3OJOA 1LRLA 4BNUA 2YDYA 4YAGA 1NTOA 1U8XX 1YB4A 4CV3A 4EJ6A 4YBZA 4YT8A 2EJVA 4IDGA 1TA4A 3UCFA 5KVVA 1YXMA 4PZDA 3KSDO 4XQEA 4FBGA 3GUYA 4DPKA 4KUHA 1DXYA 3LLVA 1EBFA 4LGVA 1VL0A 5TF4A 4OSPA 4R41A 1GFSA 3BTSA 1A72A 1D1TA 4CMHA 1SPXA 1BDBA 3M1AA 2NNLD 1BG6A 1B15A 4YB8A 4NJMA 3ZWWA 4PLYA 2WD7B 1NFQA 1YL6A 4DUPA 5COQA 4X54A 2EEZA 3A9WA 2GN4A 3KYDA 2CDCA 3RSHA 1A7AA 1YBMA 1PQPA 3MWEB 3VH4A 1B14A 3VZRA 2X58A 3JTMA 4BNWA 2AA3A 3COSA 3LLSA 3Q2IA 3HUDA 3AFNA 1DSSG 1M6WA 1RYEA 3DEYX 1QORA 3PDUA 1WMBA 2HJRA 4GBJA 3ZI0A 3BIOA 1EUCA 3SJUA 1XR3A 1NHWA 1SMKA 1Y8RB 1GUZA 1YOVB 1NR7A 3HN7A 2FZWA 3G17A 4MKZA 1I3NA 5ER6A 1UZMA 3HSKA 1SAYA 1ZBQA 3EHEA 3PTZA 4ALJA 1YB5A 1ONOA 4Q3AA 4BNFA 4CUZA 3C7DB 4A03A 1DIGA 2VYNA 4AJPA 9LDTA 2WYWA 3M2TA 2ZB4A 4FGSA 5CG1A 1O94A 1ISJA 2JAPA 4XDZA 1C0LA 1KVUA 2I3GA 3L4BC 3SXPA 4JNKA 3GVXA 3WNVA 1CF2O 5KJCA 1E6UA 3R3JA 1KYQA 3W4IA 2B37A 1E3EA 4QUKA 4YACA 4FDAA 5JAIA 3HG7A 1WDKA 2O3TA 4WOKA 1BVRA 2E82A 1PS9A 2BH9A 2QZZA 4RLSA 3DFUA 4XQCA 4YQZA 4OKIA 1YL7A 2J8ZA 1ZSVA 2JD2A 5T67A 1QYVA 2HMTA 3SVTA 1J4AA 3ROKA 5DDIP 4PIVA 4W99A 1V3TA 4BO5A 1ZCJA 4JGBA 4RCVA 2B83A 5TJHA 4DLLA 1XELA 1ZKMA 5AXCA 3WFIA 1U3TA 1K6JA 1O9BA 1QV7A 4H15A 3BMNA 2C0CA 1PEDA 1R4NB 3OJ0A 1Q1NA 3Q9NA 5DN9A 3IS3A 1HDGO 1ZJZA 2OORA 2X4GA 3LT1A 4B3IA 3VVCA 3WGZA 5K0ZA 2PWZA 4XYEA 3VPHA 3U09A 5FI3A 4TMFA 4CPDA 4CLRA 4KZPA 1Y8QB 2XPCA 1H5QA 1YONA 4P4GA 4ESOA 4RDHA 2VWPA 3HE3A 3JSAA 2PA3A 4J7CA 4YT4A 3AJRA 1YKFA 3QIVA 1O8CA 4JJGA 1M75A 4D43A 2BFMA 2W2LA 3QY9A 4ZQGA 3PEFA 1YJ8A 4B4OA 1DB3A 3A4VA 3AOGA 1GQ2A 1PR9A 4BNXA 2C5AA 4BIIA 3C1OA 2B5WA 2VQ3A 3PXXA 4BNLA 4PG7A 1KEWA 1GZ3A 1S7CA 3PIDA 1TEHA 4HNGA 4FIZA 3DZFA 3Q11A 4IGEA 3SC6A 5A9RA 3GRKA 2VZ9A 4ROSA 4NHEA 2V6FA 1HE2A 1OC2A 1VSUA 2Y0CA 3PQEA 4RPKA 1T25A 4IINA 3MCVA 3DFZA 2NU6A 1U1IA 3RWBA 3T4EA 2TMDA 3ON5A 1P1HA 3GGPA 1QV6A 4OM8A 1IOLA 4RLHA 1MFPA 2X8LA 2E48A 2EV9A 8ADHA 4FD3A 3N7UA 5IDYA 3D3WA 4RF3A 1TT7A 4WCFC 5L9AA 2H6EA 1HLPA 2FRDA 3GEMA 4LK3A 1BRMA 4WLUA 3V2UA 4A73A 3DR3A 3RQSA 2OBYA 5JXWA 3NT2A 3BHIA 3DZGA 3U4HA 2IZ1A 4YXFA 4Q3NA 3DZBA 2OXIA 4GMGA 4U5QA 1I3KA 2DTXA 3ENNA 3LF1A 3QHAA 3DO5A 3C85A 3ICPA 4R1TA 2ZCVA 4I5FA 4WCFB 5GMOA 1BVUA 3ZWOA 1BTOA 4M87A 4E6PA 2YHIA 1EVZA 4MIYA 4BB6A 1SEVA 1ZMOA 2D59A 5IAAA 1WZIA 3KUXA 2UYYA 4BKRA 3C3XA 4RJTA 1XIVA 1LBEA 2PR2A 2HO5A 4EBFA 1A9YA 4NI5A 2EKLA 3KSUA 3RROA 1BXGB 1UP4A 1AN9A 1C1XA 1Z45A 3BHJA 3OQ6A 4KOAA 4D3SA 4XZ3A 5U9CA 3AK4A 3JD3A 4E2WA 4XJTA 1OI7A 3BMQA 4R51A 2UV8A 4CUKA 3PHLA 5ADHA 4GI2A 4M55A 5A06A 4ZHSA 4BNJA 3AFMA 4FFLA 4PN3A 1HZJA 4BNTA 3O38A 1SZJG 4BO9A 2PZJA 2VHZA 5L7TA 1UDCA 2JCYA 2ZJ1A 4F3YA 1YBVA 1Y9EA 2IXBA 2ZB7A 3DHEA 2Y0DA 4NFYA 3U4IA 3RC1A 3JD2A 2ZYDA 3RCBA 5I8WA 5BSEA 1T2FA 2WD7A 3HQ4O 5TT1A 3VTFA 4GVXA 3JYPA 1I3LA 4DL9A 5L7WA 2I9PA 4XCVA 2PTGA 1U5CA 4HNHA 3S2IA 3KOUA 4CLEA 5B12A 1LLDA 3PYMA 4ZQEA 3DL2A 3RUDA 1A4IA 3KBOA 3PYXA 1VE9A 5HTOA 1QMGA 2NVWA 3A28A 4UVHA 4CMIA 4KQXA 3P5SA 4J4BA 4Y98A 3FR7A 5AXBA 3V1YA 3KM0A 2FSSA 2WDZA 4WLFA 3WYEA 1TT5B 4I08A 5ILGA 1FDTA 4W9NC 3ZNPA 4GH5A 1LDEA 1H9BA 4RVUA 3VPXA 3JQ8A 4IZHA 3DQPA 1R4MB 3PK0A 4B3HA 3RJ5A 4GWKA 3BZUA 1X15A 1AE1A 3QLJA 2XAAA 3IKVA 5TGDA 3WX0A 1OBFO 4BGUA 4GQAA 5L4LA 1K2WA 3ZZNA 1E6WA 3AUUA 4IS3A 1H6BA 4R4JA 2AMFA 5AXAA 5U4QA 5C7IO 1HEUA 1EFKA 2C82A 3CINA 2DBRA 3NGLA 2ET6A 1GD1O 3I6IA 4BNZA 3IKTA 3Q6IA 4IIVA 2DFDA 4Z0HO 1HYHA 3U0BA 3ADOA 3JD1A 1DC3A 1W6UA 1T2AA 1PS8A 4ALIA 3PZBA 4HFMA 5CDTA 4C4OA 5L4SA 3IDSA 5TS3A 1FMCA 1ENZA 4JJIA 4CM1A 1C14A 3OMLA 2Y1FA 1I2CA 2G0TA 5AXDA 1Q7GA 1M76A 3JQFC 4FC6A 1H2BA 1KVTA 2PD6A 4YEDA 1P74A 3VH3A 3JQ6A 3GHYA 4G65A 4S3MA 1NVMB 5CDYA 5KNLA 1ISIA 4DQVA 1PR3A 5G0VA 3QRWA 4CM7A 1YS4A 4MP3A 2VHWA 3BTVA 3G1UA 4WJZA 5JY1A 3R3SA 1EVJA 2I67A 2DAPA 1MP0A 4N5LA 4PLFA 3GVHA 2UVDA 4CV2A 3GDGA 2DT5A 1EQ2A 1CEQA 2J6IA 3F3SA 2H5LA 5HS6A 3FSRA 2C7VA 3E6AA 1X0VA 1Y8RA 3E03A 3RUIA 5KJ6A 1I0ZA 4XQGA 5U1PA 2Z5LA 3ZNNA 2P4QA 5I9NA 2NWQA 1EVYA 2P5YA 4D44A 1NFFA 2QYSA 3CMMA 3WS7A 5BSFA 4TZKA 4R69A 1N7GA 3DONA 1ZK2A 4WECA 1T1SA 1TI7A 4LW8A 1X7GA 1UP6A 1VJ1A 4ND2A 5C7OO 4PRKA 3RBZA 1I5RA 3DZHA 3OETA 2P9EA 2C2YA 2AG5A 3MJSA 3CEAA 1LQTA 5EPOA 5T64A 5G4KB 4CMAA 2WE7A 2PGJA 4CV0A 1TVEA 4YRDA 2TMGA 3PLNA 3I4FA 3ICCA 4RVDA 2P9CA 3KLMX 2IZ0A 3PJDA 2HMWA 1PZEA 2CF5A 2GCGA 3GT0A 3LVFO 4J16A 2X1HA 4L73A 4RV9A 4CM4B 4D41A 1C1DA 5IN5A 1ARZA 2DC1A 4Q3CA 4CM5A 5ITVA 5TLSA 4P22A 1DC6A 4OOFA 4HFJA 3L77A 3WSWA 2GSDA 1LUAA 1E0DA 1LQUA 3JD0A 3EYWA 2GNAA 3ROPA 1H6CA 3CIFA 4JQCA 4MVJH 4AJHA 3AY6A 3PYLA 2J3HA 3PWZA 3ASVA 3PJFA 4C7KA 4YJGA 4OXKA 2FPGA 1B16A 5LDHA 5BT9A 2YHUA 1C0KA 3FNFA 4KP7A 4E33A 1DIAA 1L1FA 3F1LA 3H8VA 2EP7A 5A3JA 1IZ9A 3C7AA 4DBZA 1ZXLA 3ANLA 3K2EA 1QR6A 4YJHA 4EUHA 4YAEA 2EKQA 2GN6A 5EIOA 3TF5A 4KQWA 2Q3EA 1PJCA 4L76A 5EJ2A 1PJ4A 1H9AA 2R6JA 4AJOA 2HQ1A 5T8KA 4I1IA 5EL0A 4OQZA 4P38A 2G1UA 4PLHA 3NAQA 4AFNA 1CQJA 3GHHA 2OP0A 3LC7O 5GY7A 4IS2A 3WBBA 1Y5RA 2WSBA 3F47A 4BO4A 2I76A 2B0JA 2PK3A 3QWAA 4NR0A 1ZO8A 4M1QA 5TT0A 1VPDA 2GD1O 1LDGA 5BQFA 1WXDA 4WLEA 4K6FA 3MWDB 3IP1A 3GQVA 2V6MA 1IHXA 4TVOA 2I6TA 1AHIA 4I9NA 4AJKA 1DLJA 4FJ2A 3CPSA 2GR9A 4ZQHA 5A03A 1U28A 4MO2A 3I83A 1SOVA 3ASUA 2DBZA 1PJQA 1YDWA 3H2SA 2YJZA 3WQQA 4MVJG 1N1GA 4HX5A 4E4YA 4AJEA 1NAIA 2G17A 1HDCA 2V6GA 1PGNA 2NADA 4J2OA 3D5TA 5EMHA 1PL7A 3W6UA 3CSDA 4GX1A 4Z9YA 1DRVA 4B7UA 2YQ4A 5DNAA 2DTDA 2QW8A 2FSVA 2VYVA 3KZVA 2YYYA 4OO3A 2UUOA 5DP2A 3KETA 4AICA 3HZZA 1J5PA 4CMBA 1B3BA 1EDZA 4DPMA 3E9MA 3NYWA 1E3WB 4PVDA 5CEFA 3P19A 4DC1A 4TRNA 3MOGA 3VVBA 6ADHA 4P4NA 4OJNA 1OZAA 1SOWA 1RM5A 2R2GA 5A05A 3RC2A 2B4TO 1H6DA 1MGOA 1KC3A 4J4TA 5LC1A 4PLTA 3BTUA 1V8BA 1IHYA 1UAGA 4ILKA 1K89A 4FJ1A 4QT0A 3E82A 3K8ZA 4KUEA 4LRSB 5AOVA 1ZSNA 3E1KA 2OMEA 4BKQA 2OHXA 5KVSA 1IL0A 5DULA 1YRLA 3H4VA 3JQ7B 4RGBA 5DCUA 2POQX 1NPDA 4BNKA 2AEFA 2EXXA 1Y6JA 2OFPA 7ADHA 1LSOA 1GV1A 1ADBA 1BDMA 1UDAA 4QX6A 3STHA 4ALKA 5JMWA 4F6CA 2VYVD 1EUZA 4UVIA 4Z9FA 2YFQA 3S1LA 1SBYA 4Z0PA 5FF9A 1F8GA 5HS4A 1MA0A 5CFZA 2EW8A 2Y66A 2QHXA 3W4KA 4GX2A 3F5QA 3HWRA 1XEAA 4WEQA 1LDNA 2LDBA 3PJEA 4YVFA 4NBRA 3O9ZA 4UAGA 4ZQBA 4IXWA 2P9GA 3PHIA 4EEZA 3NJ8A 2V7PA 5L51A 1Z74A 3EW7A 2NVBA 2UAGA 3UAGA 1L7DA 4DRYA 3JYQA 4J2HA 4B4UA 4ID9A 1HYEA 2IEBA 1E7SA 2X0RA 2WWRA 3HNPA 3MJCA 5I7VA 4IXTA 4NK4A 4E0BA 4NFSA 2FHSA 3JQCA 4IDEA 1ADGA 3RUEA 3GG2A 4XGNA 1U7TA 3JQ9C 4E12A 1V3UA 3V1TC 4EUFA 3WLFA 3F4BA 3HFSA 2NU8A 4ONEA 5TX7A 4R68A 3W6ZA 2WMDA 4RL6A 3NGXA 4GLOA 4A10A 1N92A 4CLOB 1HKUA 4LMRA 3HDYA 4N5NA 4RZIA 4A7PA 1YGYA 3K92A 1NAHA 4GX5A 4HKTA 1GQQA 1MC5A 2D5CA 1I2ZA 1IPFA 1ORRA 1Y7TA 2GN8A 3ZNQA 3ZWYA 3AM3A 3OSUA 4FFOA 4XKJA 3IMFA 1PJBA 1Q0QA 3JYNA 4FCCA 1CJCA 2Y67A 5T5QA 5KCZA 3QVOA 2CSUA 2C2XA 2VTDA 3KB6A 4WNIA 4L74A 3WNQA 3RFXA 4J9UE 3OIFA 4WUVA 3UXYA 3GOHA 5JYDA 4ND4A 5A02A 3H65A 3VZQA 2AHRA 4NZ9A 4U0JA 4MVJM 4GGOA 4M89A 4DMLA 4O6VA 1R66A 5GZ3A 5DP1A 3GVPA 1S6YA 3TZHA 4S1VA 1BXZA 4JBGA 5K6AA 3K5PA 5LDGA 5F1PA 1UJMA 2QRJA 3JQAB 4HV4A 1D1SA 2V65A 5F5LA 3IP3A 3PRJA 1X13A 3KYCA 2O7SA 2EW2A 2I65A 4B7XA 1HETA 3GGOA 5JNLA 1QP8A 4XB2A 4MIOA 3GZNB 5JCJD 3PHGA 4YJGB 2C59A 4J1QA 2VCYA 2X5JO 3GGGA 3DHYA 2CZCA 3MOIA 5IXSA 3D1LA 2C07A 1UP7A 4OYRA 1G0OA 4BGVA 1A7KA 3E5MA 3PFFA 2V6BA 5DCYA 1Z7EA 4NU6A 1ENYA 2X0JA 1PX0A 3PIIA 4HFRA 4K1LA 1JW9B 3WIDA 1T2CA 4B79A 4A27A 3OEYA 4BO1A 5ICMA 1QLJA 2O7QA 5BNTA 1B3RA 5EESA 1HL3A 1LRJA 4J43A 3ZWMA 3SC4A 3TFQA 3LDHA 1VL8A 4ZQFA 1ZK1A 3IJPA 2C29D 2B4RO 1X14A 3ZWBA 3ANNA 3L9XA 4FFRA 4PLCA 1Q7CA 1E7WA 5KJFA 1E3JA 4EEXA 4BMVA 2BGKA 1PWZA 4UULA 5EINA 3WOHA 3T4XA 1NQTA 4BNVA 3RUCA 5KJEA 3RFVA 3KEQA 1T2DA 4W4TA 3QVSA 3DOOA 4BQRA 1HE4A 2FY8A 3B20A 1NFRA 5H81A 1YO6A 4ZRMA 3NTOA 4Y67A 3IC5A 4IDCA 4XYLA 1QSGA 1U4OA 1C1DB 1GTMA 1VSVA 3PWSA 1UXIA 2IYPA 4W82A 4EUEA 7MDHA 1ZK4A 3TOXA 3AW9A 3WGQA 3RD5A 3WMXA 3ZU2A 3IL2A 3PGJA 4NJMB 2YV2A 2NUAA 3PWKA 1C0PA 3H7AA 1C3VA 3W8EA 1XSEA 1QG6A 1R0KA 2X23A 4DVJA 1KC1A 1MB4A 3HJAA 1F17A 4IQ0A 1DIBA 2R00C 1I32A 1K6IA 4G2NA 1NM5A 4XYBA 4R54A 2ZATA 1X7DA 1MX3A 3INTA 2J5QA 1E3SA 4J91A 3ZWCA 1TB4A 4QECA 2GPTA 1NX6A 5B1YA 2DM6A 5TC4A 1JTVA 5G0UA 2D1YA 3G1TA 4IMPA 4QFDA 1GEEA 3RAJA 5AQ1A 4FW8A 1P77A 2W2KA 1YOVA 3I9KA 4XJSA 1SEPA 3UCXA 3ZU3A 5BSHA 1KBZA 2YV1A 4NU5A 3S55A 2D2IA 4IDAA 3GMSA 2X5OA 3DBVO 3C7CB 4PRLA 1JQBA 1K6XA 5HA5A 4RPLA 3MEQA 1Y5MA 4CM6A 1MLDA 4CMGA 4JBHA 4KDEA 1GZ4A 1U2DA 3PZRA 1PGQA 2QX7A 3ONFA 2BGMA 2HMUA 1Z82A 2BKAA 3U3XA 3GN2A 2E4AA 2I3AA 3D64A 4QQRA 9LDBA 1HWYA 2Q2VA 3T7CA 2Q4BA 1I01A 2Z95A 4AJ4A 5JBIA 3GPDG 2O48X 1XA0A 2DBVO 1ZSYA 2HMVA 4K26A 5EN4A 2AQHA 2PZLA 3DHNA 3P7MA 2O3RA 4CM8A 1E7MA 4TRRA 1E6EA 4A0SA 1JKFA 4LCJA 4UEKA 5IZCC 2VWHA 1PU2A 2DU8A 3G49A 1VRWA 1ZJYA 3AM4A 3C1TA 3WGGA 2WEKA 3QE3A 1J0XO 1HDYA 2X9VA 2NTNA 3RUAA 4K6CA 4KTVE 2DKNA 3OP4A 4XRRA 3FPLA 1E1LA 3RI3A 4QO8A 1E5LA 3ZH2A 4E30A 3ZGYA 1D3AA 2ZTVA 2VZ0A 1UR5A 3L4BA 2PZMA 5TSDA 3SX2A 3ITDA 1DC5A 4DYVA 5J23A 2DPGA 5H82A 1CYDA 4WGGA 3WSVA 4CLOA 1RJWA 1A71A 1EZ4A 3V8BA 1KEUA 2JL1A 2GASA 3QA9A 2JFGA 3DZIA 3CZRA 2EG9A 4OXYA 3M6IA 1XDWA 5IDWA 4TKLA 4DLBA 2X0IA 4B8WA 2PGDA 1OFGA 3OBBA 1FDSA 2AQIA 2H1SA 3SEFA 3NT5A 3LK7A 6LDHA 3BMQB 1T24A 1DRWA 1TLTA 1QYWA 3D4OA 1KETA 3TPCA 3K9QO 1RPNA 3F9IA 4DQUA 3OICA 4MJLA 4AJNA 2D3TA 4BNMA 4CM9A 3U9LA 4XIJA 3IUPA 4E5PA 1VC2A 3KEOA 4FR5A 1K0UA 4CQMA 1QRRA 4LISA 1RYDA 4JP3A 3JQAA 3QSGA 1QLHA 2UDPA 3LC1O 5JFOA 3OQ1A 2GGSA 2R00A 3FI9A 1HE3A 1F0YA 3ETGA 4Q3BA 2VUSA 2QG4A 4W7IA 1XCBA 1LSJA 1B8VA 5IDXA 1DHRA 1XGKA 4EJMA 3TOZA 5T6BA 1GR0A 1GYPA 1CIVA 4FSHA 4D3DA 2RCYA 5G0SA 3WQSB 3H9UA 3NEPX 2D5AA 2BI7A 5G0WA 5JW6A 4H7PA 1HSOA 1KS9A 4R1SA 1DBVO 1HE5A 1PZGA 4R16A 1P1KA 3CKYA 4YQYA 4XGKA 5JO0A 4DA9A 2CF6A 1PJLA 1DOHA 1RKXA 3FF4A 3GFGA 4WCFA 1DIRA 2QIOA 2AE1A 3G79A 1M6HA 5JDCA 1WW8A 3TL3A 3D3EA 1NQ5A 2Q50A 4Y6SA 2AG8A 1P45A 2EKPA 3D0OA 4ZICA 1I2BA 3OEWA 4B7CA 3DC2A 3AUAA 4YDRA 1X1TA 2X6TA 5AVOA 4YAKA 3MTJA 2GRAA 1I24A 1KEPA 2VT2A 3V2HA 4RPHA 5CPBA 4L8VA 4YT5A 3ADPA 3KRTA 3DMYA 4PGFA 3RC7A 2YZ7A 4XB1A 3GDFA 1HDRA 5TQVA 3VH1A 1ENOA 5L40A 3GVIA 2BI8A 2DPHA 3I9JA 4JLWA 3SJ7A 1X7HA 3VTZA 2OL4A 4RVGA 3KLPX 4GAEA 2HDHA 3GPIA 4Y8VA 4GGPA 1ZVMA 1F14A 4XA8A 4ZD6A 3WGHA 2Z1NA 1LA2A 3WJAA 3UOGA 2Q46A 3AOEA 3DBHB 4BOYA 1ISGA 4L75A 1VJTA 1WPQA 3TZQA 4MVJI 4R5HA 2YW9A 2HMSA 4CM3A 3X2FA 3GZNA 2EF1A 4FFNA 3DBRB 3K73O 3NX4A 3WXBA 1KVSA 3H3JA 3PI7A 1I8TA 3UF0A 4B8ZA 3GFBA 3EC7A 4EGFA 5A5EA 3HFGA 4BO8A 3E48A 1T2EA 4I5GA 2GDZA 4AJIA 2IODA 2NTVA 4QO7A 1PIWA 1DAOA 3INRA 4FQ8A 3VKVA 3DB2A 3W8DA 3ZWAA 1IULA 3AM5A 2CFCA 4O1MA 4LMPA 3RKUA 4A2CA 3OJFA 3HDHA 3EUWA 3GEGA 5CAEA 4U7WA 1W4ZA 5JY6A 3GA0A 1PGJA 4IQGA 4CV1A 1MXHA 3D7LA 1YWGO 4IMRA 4JBIA 4XYMA 5IDQA 2YDXA 3KXDA 4G81A 4RQUA 4HBGA 3GMDA 5F3RA 1NXQA 5CPFA 2J5KA 2GERA 1BW9B 4RDIA 4LVCA 3FWNA 2PLAA 2ZYGA 3UVEA 5I7FA 3O8QB 4E3ZA 4OSOA 3U5TA 1PZFA 1GAEO 2ZYAA 3FBGA 5TRTA 4N5MA 1JKJA 3SBOA 5ENDA 2VT3A 1P31A 2VRBA 3FNHA 4U0KA 3BXXA 1W0CA 3RKRA 4FPXA 5A9SB 2RHRA 3DZKA 3H5AA 2ZQYA 4NFHA 1Y9AA 2BGLA 4RZHA 1JAYA 4G5HA 2Q2WA 4M86A 3WBFA 3L6OO 1LSSA 1UAYA 3CTMA 1KY4A 4DLAA 3NRCA 1VJ0A 3OJLA 2H9IA 3ZHXA 4E21A 3B6ZA 2XXJA 1WDMA 3F6YA 2FR0A 2O4CA 4DGSA 3UHAA 4HWKA 3L9WA 2GLXA 3K31A 3ZN2A 2YY7A 4NBUA 3GNQA 2B5VA 4A5OA 3OF2A 1BXKA 1IYZA 3DWFA 2HCTA 2FR8A 1MV8A 1NP3A 4GX0A 3MZ0A 3S2EA 2GZ3A 4AG3A 2DLDA 1QYCA 4GVLA 4E5YA 3OA2A 4LCEA 5THQA 4KWIA 4WK6A 3H3FA 4TRMA 4GKBA 1O89A 1LC0A 3VPFA 5IN4A 3D4PA 1I30A 1R15A 2J5RA 4JXKA 4NQZA 1XU7A 4YJHB 5JAQA 5G4LA 3NDIA 3ITKA 3LQFA 5CDSA 4XX0A 3VH2A 3DXFA 3HHPA 3U4CA 1ULUA 3ANMA 1YB1A 1OOEA 3WLEA 4J9VA 1PJTA 1WZEA 2QRLA 4XR9A 3VPSA 3K2BA 4CLXA 1YJQA 5C7LO 1U8FO 4FN4A 2PGLA 3GAFA 5TNXA 4XD2A 2FPIA 3UGKA 5FEUA 3ETDA 2O2SA 5G0TA 4XRGA 5F21A 3HADA 1U3UA 4IJUA 1N5DA 3FR8A 4DPLA 2A94A 4ZVVA 1Z75A 3I3OA 5B4TA 5CG2A 5KIAA 2BFOA 5A1TA 3FTNA 1YDEA 4MKRA 3ZWXA 1CETA 2RHCA 1N9GA 3AU9A 5B4UA 4JIGA 4J1TA 1E1NA 2ZIZA 4WE3A 2HU2A 4PG4A 4BL5A 1NPTO 2QQ5A 4GLLA 3F1KA 1IPEA 1HDXA 3B1FA 3GLQA 1DJQA 1GZ6A 3CH6A 5HRUA 5CEEA 3W1VA 3JQDA 1RM3A 3CZMA 4ND3A 2PKQP 3BAZA 2IXAA 4F6LA 2DVMA 3AY7A 1YQXA 2VNAA 1GV0A 1I36A 1U3VA 1ZMTA 3OIGA 4J6FA 5G2OA 1OC4A 2RAFA 3RU9A 5CHEA 2O23A 4Y6RA 3ENKA 5DOZA 2EJWA 1QYDA 1ADCA 1IZ0A 3QW2A 3FWZA 3MJTA 2O3UA 1D4FA 5DBFA 1P3DA 3HDJA 4J1SA 1E3IA 2XF8A 1LXCA 3EMKA 2EIHA 4URFA 3OECA 2JAHA 4MKXA 5ENVA 3DOCA 5F5NA 1LNQA 1XHLA 3F4LA 5KTKA 3DTTA 3E18A 3G3EA 2JCVA 3QWHA 3ULKA 4YJDA 2JHFA 1GU7A 1Y1PA 3GR6A 4DYDA 3F46A 3WFJA 4EITA 5IJZA 1OAAA 1MC4A 1NHGA 1P0CA 1LSUA 3LT0A 4YRBA 4CL3A 2NV6A 2Y93A 1EDOA 1GPDG 1EQUA 1Q0HA 4H16A 3JD4A 4U8GA 4TWRA 1CRWG 2CVZA 3LC2O 1LU9A 4I5DA 4IZIA 1ENPA 2VZ8A 4GMFA 1EE9A 5JE8A 3FHLA 3I5MA 5L45A 1D7OA 2I66A 5COAA 1U5AA 3TZCA 2W98A 1HSZA 4LSMA 3NUGA 3ST7A 2ZCUA 1AXEA 1P1IA 2QYTA 3VDRA 3WTCA 1Y81A 2Q1WA 2YV3A 1PWXA 2NU9A 2VHXA 4IUYA 2JKVA 2WE8A 4C7JA 1E7QA
chains in the Genus database with same CATH superfamily
2XOXA 4BB5A 5FFFA 2YQ5A 3QLVA 4KYUA 3CVXA 1UKVY 2J3IA 3KJGA 4FFMA 1U3GA 4OJMX 4DA8A 4LC1A 3ES9A 4P4LA 5E1OA 1ND6A 1X19A 2BFBB 1TPYA 1NLYA 3A26A 2I8AA 4TSKA 4C7OA 2A30A 3E7WA 2V4MA 4OX9Y 1EXMA 2LNDA 4MUKA 1WXWA 5C8YA 5A4DA 3QVWA 5C0OE 4RQTA 1DVRA 1NYTA 1XVIA 1OWLA 3HDGA 3MJEA 4Q82A 5F35A 4N54A 5GGYA 3SLKA 2CZGA 1JR3D 3NDRA 3M4ZA 1K8XB 4BX9A 5DVZA 1CE8A 2IGTA 3GZ4A 5EUMA 2G09A 1XLTA 3SMQA 4MV3A 4IF4A 3WJ7A 2ZLBA 3UAXA 1C41A 3MGBA 1Z2DA 3JQAD 3GFFA 1JQAA 1P29A 4MVJP 3KPYA 4RJ2A 5ALQA 1GPYA 2C4MA 4ZTBA 4H1TA 4UXJA 4L7VA 5EKDA 3VZBA 2B1IA 2ILVA 4Y2TA 2NUBA 1E8MA 3EAGA 4YMUA 1RCFA 1ID1A 2QT9A 5BSUA 4C14A 1KYYA 1GLGA 3D1JA 1Q6YA 2O0JA 1ZHHA 4C2UA 4L9RA 1EVKA 2G08A 3ZCRA 1WB9A 1EE2A 1HLDA 3DNMA 3NOVA 4QBGB 2UZ1A 4EGQA 4FOTA 2PPVA 1ZUNA 4DBLC 3PGXA 1G6OA 3LUDA 2Y92A 2RI1A 2IYWA 1ZOSA 2VRCA 4NG4A 1JHDA 1WLYA 4JJFA 1XV5A 3WY9A 3SKYA 2HEIA 5CXQA 5JS6A 5EWMA 4FN5A 1Q7RA 3COZA 3DZDA 3FMOB 1HC7A 3H2HA 3DF9A 4I4TF 4KGXA 4E1VA 2DPMA 4NNOA 4R1UA 4AZ0A 4DCNA 2UVPA 3ETEA 4YR9A 2W8BB 3LYAA 5BMVB 2CV0A 4MR7B 5TF0A 4XWYA 1R16A 5FBZA 1MX1A 2F3QA 2Q6TA 4ZMBA 1OAOC 1U2GC 3AJEA 4MX8A 2QMHA 1JQ5A 5FEMA 1TVMA 2COUA 1O4VA 1BVYF 2JIQA 3UMGA 5JCXA 4E46A 2PQ6A 2D2VA 3TLBA 1ADYA 4ER6A 1KTIA 1E2NA 2FSVC 1X7WB 1YRQA 1NNUA 2XYHA 4ZMSA 3F71A 1QG0A 4FHEA 5HFNA 5JQGB 3IT3A 3ETCA 2KW5A 1LB1B 2WBLC 5DPMA 1SZCA 2IDMA 1HY3A 3HABA 4HSGA 1R8YA 4KSBA 4XEHA 1ZUIA 2RGDA 3GLIA 3RFTA 1EX6A 3KJZA 3L6UA 1FDVA 1MUUA 2EFGA 1QUFA 3SYMA 4QU8A 1ZFNA 1O0SA 3PITA 1FSGA 5LOVB 3OQOA 1WXQA 5REQB 2PFGA 1CR0A 4WERA 1RFGE 4Z1MD 5JRJA 1DIHA 2GBLA 1SG0A 2WMOB 3BFXA 4CIYA 5T57A 1PZHA 4BS9A 4GBED 2FEPA 5F2EA 3TJZA 1W8DA 2DB3A 1H2XA 1QP0A 5IXJA 1H8HA 2CVOA 2G83A 3GT4A 4FMBB 4CKWB 4CR7A 4CIBA 1OZ0A 4ZANA 1FXSA 1SBTA 1BSVA 1A9RA 3EZYA 4R2IA 4TZTA 1DNPA 1FDUA 1J2RA 3ZDXB 3MBIA 2QJFA 2FKNA 1CRZA 1P0IA 3WSTA 3OA0A 1G2IA 4N7MA 4U6QA 4DGQA 2RJOA 2X9NA 4HT3B 1XVTA 2WNHA 1R50A 2OG1A 2X15A 3KPUA 4TRJA 3WL4A 4JUFA 1F6WA 1WL8A 1SO8A 5ESDA 1F0NA 4R3NA 3D7NA 4BX0A 4DSUA 3R7BA 1POXA 2C8LA 2GNOA 1WF6A 4CLDA 4AZ3B 2A5FA 1ZRNA 1RWOA 2GO1A 3K3PA 3L4SO 1U2EA 3KJQA 3ND9A 4Z3DA 5TVKA 4H3KB 3VNSA 5DNVA 4DMHA 3NUZA 4PC6A 4RE6A 3MNFA 2JCXA 1NATA 3O8BA 5TJ9A 3T8YA 4YMTA 2ZTLA 4GPIB 4BLUA 1LLQA 1MNAA 1OFUX 1Q2XA 4XWWA 5FL7D 3AY0A 3BZBA 3KQSA 2QG6A 3GNSA 2XOKA 2IDZA 2LWIA 3V33A 4B7AA 4RJKA 1RJGA 4MNTA 3IFSA 3L0IB 3WG9A 4F4CA 3CW2A 2HUNA 3RVQA 3P9RA 5CB8A 1OIXA 2PE5A 3CXRA 1XZKA 2QR3A 2WJGA 2CXQA 3PEEA 2V74B 1RKBA 2AXQA 2YYZA 3F49S 4RL4A 4AWBA 2P2GA 2XYVA 4I9UA 3TSCA 5KWVA 3MTQA 4P3PA 1JXMA 4WLNA 5A62A 4FLFA 1O5OA 3TGWA 1WY5A 2H2DA 4UREA 4UU7A 2AG0A 5K8JB 4I6EA 2JK0A 2B99A 5J59A 3KP1A 1TYCA 2QJOA 5KI6A 2RHWA 1RQLA 4K9MA 2QP3A 3UB3A 1OZHA 1DV1A 2HHJA 1I7QB 2X42A 3M0EA 3DVQX 2H1CA 4I5EA 4UNIA 2FMUA 2R8OA 3HCNA 4EO7A 2FWMX 1RI4A 2PR7A 2EWVA 1PNRA 4D26A 3E9RA 5TPZA 4QSMA 1NULA 4MYHA 2C9OA 4DDWA 3DLHA 4JITA 3MIZA 1ZZEA 1WBDA 2J9FB 1ZGCA 3BB3A 4RBNA 4I4TA 1TK2A 1ONNA 4DDHA 2GBCA 2BONA 3W2GA 1T5HX 4GE0A 3FOBA 4IPTA 4J1NA 3IUSA 5AR1A 4F8EA 3A3YA 5IF3A 1JHXA 4IR7A 4QNNA 1ICIA 1Q15A 2VLBA 3CJTA 3O1IC 5ALRA 4UHCA 4AB1A 4EJ0A 6GPBA 3GV0A 1AQYA 2Q6OA 1UKZA 1XLTC 3IAXA 3Q10A 2CB0A 1U0HC 3AF5A 1PO7A 4YJFA 3R7WB 4OKSA 4CXMA 1NI4A 1T8SA 1E63A 5ESXA 4CTNA 4KIUA 3G23A 5AKEA 1M2VB 1U3WA 3EXIA 2O1EA 3CYFA 2R48A 1FVFA 5ALXA 5FUVA 1KO4A 4DRXB 3JXEA 4JLPA 3H0KA 2ZG6A 1M34A 3D5QA 3IQWA 3JVUA 3WAGA 3EFHA 3HKDA 4W6ZA 4LXGA 3MUFA 3UQZA 3FNEA 3HUTA 3HB9A 4ZEOA 3CLTD 2AJTA 2GYYA 2H2HA 2XUHA 2GFIA 2OQ2A 4XAQA 1Z4OA 2DFNA 3PLRA 5HKKA 5IVPA 3DOJA 3M6WA 3ZQUA 1EFPB 2FXVA 3N76A 2PRJA 1HXHA 4NE2A 2DTEA 5KYUB 4N18A 1QFMA 3T3DA 1P2VA 2AE2A 2YXBA 1XZAA 1I1NA 4NCNA 2EFHB 2POCA 1CY7A 2P6PA 2FPUA 1GARA 4P58A 3V4SA 2YN2A 1JS1X 4BKPA 4POOA 2BMFA 1TAQA 2E37A 3IHWA 4FK8A 4RTQA 4QFCA 1WLSA 1QYRA 3MWJA 2XXAA 3DDZX 3EJ6A 1TUGA 3GJ6A 2CVQA 1Z88A 2FEXA 3T9CA 3WWYA 4EJSA 1XEXA 2BP7A 5HF8A 3GF4A 3LFTA 3R3XA 1QGUB 5EKTA 4CQMD 5LU8A 1EMDA 3IBTA 5U4XA 5IYZF 5T4FA 1Y7HA 4EB0A 4X41A 1EVLA 3JZMA 1KMMA 4QXPA 1EEXB 4GMXA 4L5IA 3ZHCA 4O0LA 1M6VB 1Y8CA 1WNTA 4I5IA 1VGQA 1E64A 3O1JC 1AS2A 1H0RA 1OJLA 2JGKA 2ZUFA 1KE2A 4MVWA 3DAHA 3M4NA 4M54A 3VJMA 2YH2A 4EA7A 1WVGA 2FN3A 1II8B 4IJQA 3I5UA 4PCVA 5F7JA 5AUQA 4PYKA 5GZ1A 4BVBA 1UBTS 2VUUA 1ZGAA 3CE9A 1ZNYA 2E49A 2EBWA 4FZ5A 2XQKA 4IVNA 4Y9DA 2WFAA 5JG7A 1I10A 3WYBA 5T7BA 1YFLA 4IJVA 4MDYA 4EELA 1FUEA 2P8JA 1CZHA 3IDOA 5IH3A 3EEOA 4LFCB 4MV8A 4EIWA 1QRAA 4Q3EA 2FH5B 3A2MA 4FMCF 3ZBTA 2RH9B 3SHVA 2PJRA 3PHJA 3TBFA 4RULA 2RGAA 3B9PA 4PPYA 3LCVB 5IVIA 2Q7DA 4PINA 5ALYA 1A2OA 2RHTA 1WPXA 1NQWA 3BTOA 2D2EA 3FCEA 4RO0A 1IY8A 4D9BA 2MSLA 4EVIA 2NXNA 2FXIA 3PDCA 1NSFA 4HFNA 5B1DA 5EXDA 2FWBA 5DXFA 1H4TA 2K2WA 3LBFA 3S29A 4J0EA 1PD1A 3KZMA 1N3LA 5CW1A 3UFXA 3CRRA 4TKVA 1BX1A 5FOWA 1X9IA 1A5ZA 1I33A 4KQKA 1J8YF 2JVJA 3NNDA 2OD2A 4RFLA 6Q21A 1TTPB 2ERYA 2NSDA 3SR0A 1ZA2A 3VKFA 3LM8A 1OASA 2IEIA 2A4KA 3CEMA 4OIFA 1I3CA 3QEMB 2NLOA 3QOFA 5LLSA 3L6EA 1VKOA 1M0TA 2Q1TA 2DBQA 3ZLVA 3I61A 2QVLA 3IJRA 2YYAA 2MT9A 3AEUB 4RIFA 3EFEA 4A9AA 2ID7A 1WB5A 4E5NA 2A5JA 1MG0A 1MCZA 2GCPA 2JHGA 3BICA 5I8PA 5ELXA 1L4UA 4RZQA 4JR1A 4JA0A 2VH1A 1G8AA 4RYLA 5KWIA 2UYHA 4FYMA 1I4WA 1RWWA 4BV9A 2H1LA 3EIEA 4AKHA 3I9OA 2YVKA 4WJKB 2DR0A 3PUYA 2H4WA 1GKLA 3BWVA 3IPYA 1ZU5A 3NHUA 4O1HA 4YBRA 2OA0A 4X66B 4MV4A 5IZCA 3RG2A 3STVA 1GZ5A 2Q49A 1YI8A 3IIEA 3EF3A 1CB7A 3JR3A 5EIHA 3U4QA 1T26A 4QICA 3PQFA 2Y1CA 2GI4A 2H18A 3EY4A 1QQ6A 3HS3A 3QUTA 3UV7A 1ULSA 4O3MA 5AJVB 3GWGA 4BGEA 3W9UA 3G9QA 2HSDA 3K32A 5EJEA 1MOZA 3AI1A 4J75A 2ZTMA 5BYBA 1GG9A 2W5UA 4XARA 2QTVA 3FGPA 3ANYB 5DFAA 1L1EA 5I8ZA 3ZV4A 1Q6ZA 1AF4A 4BNYA 4LDPA 1OCEA 5IWCA 3IR6A 3EN0A 4OQXA 2XCOA 1CQIB 4M7PA 1SHJA 4OHPA 4Y2SA 5I9MA 3UJ8A 4CQLA 2ZWMA 2ZI4A 3PDHA 4RVHA 3K6SB 2BH2A 1UBOS 5FTWA 1JB9A 2O1XA 4B3JA 4RAOA 1QH1B 2JPDA 3HR8A 3GN1A 4A6EA 2PPLA 2LCQA 1N8KA 1OKKD 4PLGA 2X19A 1G20B 5DU2A 4KWTA 5HKBA 1KQFA 1U1GA 3DE5X 1K5HA 1XCMA 4PZZA 4AL4A 1FPMA 3I32A 4XGIA 2UUPA 4M0CA 2DXIA 4BN0A 3HJFA 4LRTB 5B6IA 2FZ4A 2IXEA 4EY5A 4YRSA 1SVOA 4II7A 2BFCA 5AYVA 5CA0B 4I99A 3S7ZA 3QUAA 4MVYA 1XZQA 5CVUA 1E1CA 3PP8A 3ROXA 4R7ZA 3ZY5A 3HV2A 4XIYA 1GA1A 2GBPA 2CK3A 1PJ3A 4TYPA 1GUFA 3NP9A 2ZBVA 3WAKA 5CBKA 7GPBA 2ZB8A 2AFRA 2XLCA 4CTOA 2R11A 3PR2B 3QU2A 2OO7A 4IUBS 2A78A 5ILOA 4J6EA 1OXSC 2YN0A 1PQUA 1WA5A 2V58A 2XMCA 3LX6A 1FDIA 1IXKA 1ZN8A 4IICA 5IJXA 3VDQA 3LPMA 3RYFB 2H1VA 4ECEA 4BECA 2VQEB 3AR2A 4LVUA 4DWVA 3Q9SA 5IAJA 2NQ8A 2A58A 2M32A 3S1AB 2B94A 1UBGA 4NNJA 3L4EA 4D9KA 4DIBA 1J7JA 2MYNA 2RB4A 3KYDB 3BXOA 4HQ6A 1P7WA 2HM7A 2WJVA 5EXEA 4DIDA 2IH2A 1XZEA 3AF2A 2WM3A 3K9GA 4IM7A 1OT5A 2HKIA 3QXHA 5HE9A 5I7EA 3QVGA 3L7DA 4HUQB 5HCUA 3RTEA 2PAFA 2E4UA 2VYFA 3K6JA 1UFQA 4MWOA 3U7QA 1ORTA 4EDFA 1L4KA 2I7VA 2XH8A 2H3EA 1OBHA 4CODB 1AUPA 4E08A 1J0BA 1O6ZA 4LECA 4JKIA 2EBFX 1DUIA 1JVSA 4GOJA 1G5PA 1H42A 1GWNA 1V37A 1TNDA 4M0KA 1U3FA 2P3OA 2Q21A 2HHLA 2X1MA 1A3CA 2PZKA 3TSAA 4DRZA 4MKGA 3L1HA 3EIUA 2AWOA 4OH1A 4WLVA 4WZAE 3GBPA 4BVKA 3TDNA 4OL9A 3CISA 4Q48A 4H1VA 4PZCA 4WVLA 5J2TA 3MD9A 1GQSA 4BO3A 5ICCA 3TQHA 3P2YA 4WN9A 3PNVA 4GZ3A 3FJYA 3WYNA 2IS2A 2JA2A 4GVPA 4ABYA 2XCTB 4J0IA 5C34B 2X8WA 3ROMA 1XAJA 4B2PA 2IHYA 1FJGB 3DWEX 4OHFA 5EMJA 3TLGA 5CDHA 1M8JA 4D8VA 1FXWA 1U0LA 3WRXC 3U49A 1AS0A 2BPOA 3IIKA 2CVFA 2AZDA 2GN9A 3GT3A 1BGXT 3KQWA 2JZNA 4WPGA 3ECAA 3L8ZA 1FLAA 4L0DA 5AJZA 4A8JB 4BQNA 5JSZB 2IS1A 4NLLA 4EP1A 4U6SA 3E8SA 2VJQA 2Q5LA 3C3WA 4G0VA 4GU5A 3TJMA 3IJ5A 1KMHA 1XWFA 4MQEB 1OGJA 2BF7A 5DEIA 5A9SA 3EVNA 1KAQA 3P20A 2ZUBA 5EIBD 4HVAA 1H2HA 1H8EA 1YJ5A 4QEDA 4MYDA 5LD2C 3COJA 4RXUA 2V98A 3RRFA 3PHHA 4YYZA 1DKPA 4QA9A 2WUVA 1QWSA 5LQSA 3DAGA 3SIXA 2QVCA 3THYB 2CEAA 2HK6A 3T4PA 1YU9A 3HU3A 3WAJA 3PG5A 2O3QA 3UJNA 1P72A 4R3WA 4XR4A 5DN6A 5I6DA 1E3LA 5LVAA 4QG3A 4EGSA 5MFZA 2GWHA 3DAOA 1VTKA 1F48A 1V8OA 4E5DA 2WJZB 2YJ3A 1V5GA 3ORRA 3LPDA 2V4ZA 3HNRA 2WVGA 3QENA 4WLOA 2M6SA 2ZYVX 3LA8A 2B8NA 3JARA 3QQ5A 4RD2A 3EGEA 3NBKA 4WBXC 1MJ5A 1PP4A 1VKHA 2C61A 2O2XA 2W6JA 4JOSA 1XCLA 5D5HA 3H9JA 1ATIA 5EXXA 2O8EB 2C3OA 5C4MA 3RYCB 2Y99A 3AIOA 1DIOB 1Q7EA 1X1RA 3GNTA 2Q7XA 3NTRA 3R1IA 4MS1B 1JR2A 2OUKA 2YTZA 3UENA 3WMWA 3VR1A 3FYDA 3DMPA 4TQ9A 1F0KA 1S0UA 1Y6RA 3TBKA 1T1RA 3TDMA 1FP4B 2WAYA 3FOAA 3DBLA 3E8XA 3K9CA 3STUA 1SA0B 4FS3A 5E95A 3KTDA 4NOJA 3R6TA 1A8SA 1MMFB 4RZ2A 3ZWDA 3Q5EA 2ZETA 1TJ4A 5E0KB 1YQEA 2DJIA 1M5RA 3C6YA 1KYXA 2OV6A 2QUAA 1GNQA 3D4BA 4KWHA 2B35A 1V11B 3UMCA 1TRKA 1V2HE 4PO3X 2GK3A 4R2MA 3UOAB 4BFVA 4US0R 5JC1A 5JPCA 2B8WA 3FTEA 4GM0A 3N8NA 3E2IA 3DQQA 3KFLA 3LPCA 4WNYA 4MDHA 3A3KA 4TUYA 2A7XA 1GQYA 1BS2A 1SWVA 4NG5A 1W73A 8LDHA 1CQJB 2CXUA 2O4UX 3BX1A 3HJNA 3ZIDA 5C1OA 2OB1A 3I8SA 3JYOA 3IIIA 4FFPA 2O8FB 2JAQA 3IBFA 4J03A 5JCZA 4HAIA 1EEHA 1O95C 1E7YA 2J7PA 3I72A 1GKUB 1T4DA 2CD7A 2DUWA 3KL2A 4BVAA 4RSRA 2BGWA 1FJHA 1ZAKA 3MWDA 2IC5A 2FUEA 2NPOA 4MPJA 4CMEC 3ENVA 4Q24A 4YT2A 1J23A 5AKZA 2W2OA 3EE6A 2J3DA 2WV7A 1WUTA 1PYOA 5EHIA 5BSGA 1C1YA 1TK9A 3BD6A 1H0KA 4AYTA 1RU3A 1SB9A 4IIXA 4LV6A 3SXJA 1QXSA 3KYBA 5JBNA 3L8CA 3IQHX 3N3BC 3MTBA 4HXEB 1EPUA 2DSNA 4J3FA 3U62A 2VJMB 3X3HA 4TLLB 4DT1B 2ZTUA 3LBAA 1VG9B 1VLLA 2BD0A 3LF2A 3QI2A 5COBA 3VOAA 1UXJA 3VR3D 1QQ7A 1E6LA 1SG6A 2DKFA 3MMZA 1OU0A 5FUMA 3NHMA 1R18A 1WHSA 1DJOA 2AXPA 1KVRA 4YIKA 4F1KA 1OXBB 1L5SA 1XAHA 3CS3A 3HNOA 1NF2A 4U7JA 2WUGA 1OFIA 4XJVA 3HDTA 4WKPA 2P2YA 1P5FA 1V3VA 3D54D 1N1EA 6AT1A 3OHSX 3ZCXA 2EQAA 1CWUA 2YFHA 1H66A 1T13A 5C1BA 4QFBA 3DWGA 2XBMA 3RUFA 3U2QA 3KJIA 4GP9A 3FYUA 4RGVA 3A1WA 4A91A 4CLRB 3EFOB 3DW3X 2OCIA 1ZW1A 1CSEE 2HEGA 5AOBA 5HKLA 4ALNA 3OOHA 4M1YA 1WXFA 3WGYA 4TL6A 3QKIA 3AUXA 1WB6A 4EUNA 3UHOA 5LDDC 4NMHA 4I1SA 5JD4A 1A9ZA 1XFDA 3ZD7A 1OX6A 1W35A 2D1RA 3DV9A 4B3CA 4XD7D 3KXPA 3OT1B 3OIWA 5DNYB 4CI9A 3H9QA 1FFCA 2B7LA 4TQAA 3T7JA 4DDMA 4RV4A 1IJKA 2WMYA 2Z6AA 4LN1A 4OB7A 2FPPA 3QPWA 2Z1MA 3RR2A 2AF4C 3IESA 3ZHZA 4FC7A 2W2MA 2DETA 1EVEA 1KO5A 4JT9A 3MFYA 5M29A 4HH4A 4KXYA 2FSIA 4EATA 1NBWB 4UVEA 1O4WA 1PJZA 5B3AA 3UWKA 3WBJA 2C88A 4TTPA 4DLXA 5KHLB 1GPWB 4WBSA 3EGDB 1RBMA 4MGYR 1LK5A 4CGYA 3AP3A 3IDZA 1B74A 1KI1A 1RRGA 2VJKA 1UF9A 2XDYA 2XCQA 3EG9A 1FTYA 4I0WB 5MDHA 1OIVA 3S2ZA 3ZU5A 2CNWD 3I9FA 2VRCD 1Z35A 4BNHA 4PC1A 4G4GA 5A4FS 5AVVA 4P98A 4F9FA 2ESRA 4D4LA 1KI9A 3ESAA 3ZW8A 2BDEA 3SSNA 1UODA 2J6BA 1ONBA 3CJQA 3QFTA 4DLPA 3CONA 4AM8A 4DIOA 2BFBA 5L53A 5KOIA 4QYTA 3KQUA 2AKEA 3FI0A 4JI8B 2M1XA 3TD2A 1W5SA 1TT5A 3NRJA 3P96A 5TDHA 1EIZA 2ZAIA 3N0VA 4B0PA 2C54A 4BMOB 2BRUC 1QRSA 5EQTA 2BTEA 3P97A 4UE2A 3VNVA 5EQFA 4WFJA 1QKIA 1JJAA 4UMEA 3PVZA 2BR3A 4MHSA 2FV8A 1GCUA 2I4TA 3JZIA 1KKLA 3QG1A 2HA2A 2PD3A 4J7UA 4QDOA 2B1JA 3L2OB 3Q5DA 4MCIA 1M7BA 3LRPA 4QJBA 3O8OB 5IDVA 2Q0QA 1HRKA 3FNQA 4ER3A 5FYDA 5KYVA 2FEMA 3ZDDA 3FPHA 2CE7A 1MTZA 4G9BA 3FIJA 4YFVA 1R0RE 1HT0A 3ZHYA 1XTZA 3DTVD 3QX3A 1KOGA 3ESXA 4PR3A 1G5HA 2OWDA 5LYJA 2HMYB 1GRCA 2OO5A 3JYLA 1SUSA 5DHUA 2NVUA 3KQVA 4FUQA 4CM9D 1A9XA 4L4XA 2G77B 3IOYA 1LC3A 3M9LA 4KQ1A 2O54A 2A92A 4ENPA 3C4JA 4YP6A 3MT0A 2X41A 1BXGA 3U19A 3BUSA 3Q3EA 3LUAA 3GQBA 3HMQA 1JDJA 2E5WA 1Y4DE 4DN6A 4FZRA 4GECA 4Q9KA 1BJKA 5KO2A 1LRLA 3LV8A 3D6AA 3H83A 2O2EA 2IYVA 4MS3A 1XEFA 3B2NA 3FCAA 4QU5A 4YAGA 1NTOA 4C4PA 1FEZA 4CV3A 5IKPA 1K86A 4B2YA 4ZPJA 2EJVA 3WLSA 5GINE 4MUHA 2ONKA 1YXMA 4FBGA 4CG2A 3I37X 3PRHA 2Q3JA 2R1ZA 4KUHA 2GBGA 1ZGHA 3KFVA 2IXTA 5TF4A 2NUPB 3QJYA 4YJ2F 1TYAE 3F2VA 4R41A 1X7WA 1D1TA 1QC5B 2XNJA 4KZKA 3EGVA 2C92A 1BDBA 2FJPA 2Q0SA 3M1AA 2GPSA 2NNLD 3HWWA 4JHLA 1BG6A 4KC0A 4V0RA 4L5JA 2UUBB 4NJMA 5E9JA 4BFWA 3ZWWA 2REOA 4OX9B 2V8OA 2WD7B 2JARA 2FLWA 1NFQA 4D3ZA 2WUEA 3ORQA 4DJAA 4X54A 2EEZA 5TPZD 1RXWA 1A69A 1KQ3A 2CDCA 2QTGA 3TZLA 4M3NA 1A7AA 1OYWA 1Z4MA 2IGBA 1DWUA 3DLCA 1IAVA 3N2KB 1AT1A 3CPHA 3SYTA 3VH4A 4GI1A 4HJXA 2J30A 2X58A 4LZPA 4MQFB 4NV1A 2GEUA 3JTMA 4W5HA 3PFCA 3X1ZA 5DNCA 1HOXA 2AA3A 3HJHA 3EAFA 3Q2IA 1G21B 1Q22A 3HUDA 2CLMB 1RYEA 3DEYX 4WQMA 4ZAYA 1PWEA 1QORA 3PDUA 2HJRA 4GBJA 3ZI0A 5CVTA 2XADA 4YQEA 4C0XA 1T9GS 1XR3A 4BQQA 3PENA 4BP3A 1Q0SA 1Y8RB 1GUZA 1D6JA 4MKZA 2FZWA 5F5XA 1I3NA 1YB6A 1P0QA 4KXVA 1HV8A 4YP0A 5IM5A 4KGVA 4A03A 3AHJA 4ON9A 4AJPA 4JEMA 1J0AA 2ZIEA 2WYWA 4I66A 2ZVDA 3BB4A 4M76B 4P4SB 1JJFA 1OYYA 1O94A 2JAPA 1CR1A 3PUHA 1N3IA 2AFHB 3FVRA 2XEDA 3THRA 3EZ9A 3HUFA 3L4BC 3QMPA 5DI9A 4ZAFA 4QASA 2EJCA 3VGPA 3WNVA 3D0RA 1QG2A 2II6A 3FA2A 1U0SY 2A8YA 2AYXA 4PC3A 4TLDA 5C5DA 2NPFA 1OAOA 1FLVA 1X86B 1KYQA 1YZQA 4BFZA 2GFQA 4FDAA 4AD8A 5JAIA 4DR7B 3HG7A 4UOQA 2FN8A 1T34A 4BATA 1J2UA 2O3TA 4XSGA 3BB1A 1I13A 1HFKA 3OE7D 1D7AA 1TKRA 2F90A 2J4CA 2V6IA 3CX4A 2VO1A 3DFUA 1YL7A 4OKIA 2FCRA 1K4YA 2WFLB 2XE6A 1XZ8A 3FLMA 1Q7TA 1CUWA 1MH1A 3T5AA 2AXEA 2HMTA 1XZLA 2GOYA 2QJRA 1J4AA 2P9QA 1TL7C 3C15C 3HHEA 4BZZA 1VXOA 4TVSA 4W99A 1V3TA 3J7TA 3OP1A 1QAMA 1MZVA 4NCJA 1VGVA 4JGBA 4DV4B 2B83A 1Y82A 3PS9A 5ITZB 2A1UA 2ZXFA 1R4AA 1XELA 2IPXA 1C29B 1VGRA 2BM1A 2DHDA 4Q00A 2ODNA 3E9EA 2XCUA 5AXCA 1LFAA 2PH7A 2VXYA 1K6JA 1O9BA 1QV7A 3Q1KA 1EXNA 1ZD3A 2C0CA 3CLRC 4PX5A 4IRUB 2B2NA 2P67A 4N6NA 1ZJZA 2FSHA 4C4AA 4LPKA 3DXYA 4Z4FA 3ELYA 4L8LA 4G09A 3ND6A 5K0ZA 3RKSA 4XYEA 1E9FA 4K9KA 4MRPA 1CX9B 1OLXA 3T4UA 4H77A 4LZWA 1ODFA 3ZC3A 5AK3A 1TEZA 3QFFA 1GKIA 1YONA 2YIVX 1D1QA 3D8HA 4G8JA 4P4GA 1P73A 2Q5IA 1GT6A 4ZOCA 1FJXA 5ICEA 2JIMA 1CZOA 2ABWA 3C74A 2I9KA 5LP6F 2C1EA 1QKKA 3EUAA 4B45A 3FMVA 3NYRA 1YKFA 2PRYA 3RSLA 2Q5HA 2JDIA 2FWNA 4D43A 3OCUA 4ZVRA 2WQ7A 2Z98A 3JPWA 3C4QA 5K8UA 4B4OA 1QF7A 3ZXXA 4U5XA 3A4VA 3VNBA 1GQ2A 4GXRA 1BJRE 1TZ2A 3OCCA 5M3BA 3D3NA 5IMBA 3HO1A 3RYIB 2W71A 1XCPA 1Z4LA 4ZK6A 1SHTX 1TUBB 2OFFA 3MS2A 3NKFA 1S7CA 1XDGA 3PIDA 3P5BA 2JFOA 3FZEA 1WKVA 1WOMA 4BAGA 1DUSA 3K0AA 3WHPA 621PA 3O8RA 1D6NA 3SC6A 1H2ZA 3GRKA 3AR6A 3LO5A 2IYFA 2GYWA 3ACBA 3CR3C 4ROSA 3SHTA 3Q8LA 2VPQA 3LOUA 3PC4A 3F8TA 3UYKA 1OV4A 3E81A 3DFZA 3K94A 3MCVA 4JZKA 4U39A 4EAAA 4NZYA 1U1IA 3RWBA 3FPJA 2B8JA 2ACEA 1N5LA 5AVUA 4EO4A 2NAFA 3ON5A 2R6R1 2QM0A 3E22A 4IXMA 3BHNA 3EA0A 3TD6A 3UJ6A 4CL0A 1VHWA 4Q4DA 4MRRA 1IOLA 5THXA 1CF4A 4DLTA 3SHWA 1XYVA 1NW9B 4J0JA 1FRQA 2E48A 1FFBA 2RI6A 4X1KB 5JH7B 5IDYA 4JI3B 4RF3A 5ESWA 4WCFC 4L57A 2XITA 3ADKA 1Z39A 2YXDA 2H6EA 5KU7A 1FJ2A 2FRDA 5JD5A 1QKJA 1P7YA 4LK3A 4X7RA 1E8DA 4PU0A 3PGLA 2Q07A 2OESA 3DR3A 1XMSA 5ALUA 3WL6A 3TLMA 2OBYA 1MC1A 4C9BA 4PXSA 2C83A 2C78A 1AV6A 4O2LA 4WXEA 1TO1E 3DZGA 4P3XA 3U4HA 4US2R 5L3RA 4MLDA 2IZ1A 5IF9A 4V2UA 3PCRB 421PA 1R9GA 3R5KA 4U5QA 5CJ2A 1I3KA 3CLKA 4B32A 5EE3A 3BULA 1KWKA 5KTMA 5IJ0A 4WKNA 1J2YA 1MABB 4JENA 1PLJA 1EK0A 2EARA 4I5FA 4XVQA 2VP0A 2E1RA 1SUBA 4CF5A 5CDFA 3WQBA 4RHUA 2ZJZA 4MIYA 4UATA 3T5DA 1UCFA 3F74A 3KUXA 3IURA 2WAOA 1X7XB 1QDUA 4G8CA 1LBTA 4HDNA 3MAGA 4A8JC 4BKRA 2G07A 1G8KA 3KG2A 2ZBUA 3O21A 4C3ZA 2WJIA 4YRIA 2HO5A 4H35A 3BRWD 1CIPA 4BJHB 3LO8A 2CMFA 2EKLA 4PIMA 4OHZA 2I4NA 1C1XA 1Z45A 5LD2B 3NVAA 3SYLA 4YCSA 1V8ZA 1MQAA 5CXXA 2HF9A 2AX4A 2QUZA 1KH1A 5U9CA 3NM4A 4QIHA 3JD3A 4TYQA 4XJTA 3RT7A 3ZIAA 3BMQA 3CZCA 1GSIA 2FW8A 4M83A 1HFEL 3CR8A 3A0UA 4CUKA 3E3AA 3CUWA 4KREA 4QVKA 3AFMA 1HX7A 4J76A 5JYBA 1FA9A 4TKVB 5E1MA 1V1MB 3DMHA 3GIWA 3TNYA 1Z15A 2CXOA 1FFDA 3ZWQA 3N39C 2IKQA 3DKIA 4LY9A 4UCQA 3S6JA 1DAGA 4LRWA 1SD1A 2AR0A 4IXNA 5SYNA 5G3ZA 4NFYA 3RHTA 2X7JA 3U40A 1XBTA 3OOJA 3DTVB 2CW5A 3GRUA 3FDJA 5CH8A 3NBUA 1T3SA 5TT1A 3G8BA 1A2QA 3H9BA 3JYPA 1I3LA 4GVXA 2GXQA 3TXXA 5L7WA 1Z8NA 4KEAA 1ZZGA 4GIBA 2PTGA 3DL4A 1OB5A 1Z06A 3KOUA 3S2IA 5B12A 5DYIA 4ERXA 1A4IA 3DA8A 1XX6A 1TEXA 4AF7A 1QHGA 2NVWA 2KLHA 4M0FA 3A28A 4OG2A 4FHZA 3HBJA 2IV7A 3RSFA 2XQIA 4H1HA 4CMIA 2XJ4A 1IEWA 1AGRA 2WHRA 5AXBA 4JA2A 2ZREA 2OHOA 3FR7A 3KM0A 1JX6A 4LRYA 4WH0A 3CWCA 4KYIB 1RWQA 4N8EA 1PR6A 3VDMA 1KKUA 3HTXA 3L7MA 2SKCA 1A04A 2KBEA 2WHXA 1JJIA 1PHPA 5DM4A 1LDEA 2H06A 4DNQA 3CX3A 1I94B 3JQ8A 2H52A 3BG5A 2ZROA 4JYCA 5CAEB 2RC5A 3DQPA 1OSNA 3EC2A 3ZPXA 4R1PA 4DQLA 4QDXA 1FX0B 2PV0A 4WY8A 5ILQA 4ZU1X 4GWKA 5TPWA 4BY9E 4GWLA 3AKDA 3R77A 4KE7A 1X15A 1GZ7A 3JRNA 2G4VA 1MD9A 1Q20A 4PNPA 3HR4A 4TL8A 1K7EB 4RKFA 1C30A 4N12A 2VRWA 1SVSA 2JEOA 3NATA 1OBFO 2JIRA 2ZWOA 1JDSA 3HCPA 3LL4A 4GQAA 1K2WA 5CLQA 3KKEA 1N3BA 4R8MA 2GPNA 3GJ7A 4IS3A 3AUUA 1WE2A 3DHWC 3I0NA 3R4CA 4ZOEA 1GGKA 2AMFA 1G16A 4WBNB 3OPVA 4AXBA 2JFPA 4JNCA 2WSMA 3PQ4A 2P9ZA 2OC4A 1F38A 4JUIA 5GQSA 2DBRA 3JASA 1JHMA 2W2TA 3F7MA 3KOWA 1C9NA 3I6IA 3KZKA 3EWIA 4H6WA 2IUTA 3UWDA 5G3YA 4IIVA 2VBCA 5CA0A 2IELA 3N8HA 5TXGA 3U0BA 5I4BA 3FVVA 1T0PA 4JKYA 3SX0A 1T2AA 1PS8A 4ALIA 2F1JA 2IA5A 4ZZIA 5L4SA 1VDZA 2GTHA 1SUFA 3UT0A 2WSLA 3ET5A 4LJLA 4BFSA 1C14A 1FNNA 3OMLA 3AEYA 2FUG6 3GFRA 2CDRA 2G0TA 3DPSA 1M76A 1VYTA 4A0HA 3JALA 2QTAA 1JDNA 4IUDS 5FORA 2F55A 1CVRA 1G3RA 3BORA 3KKPA 4YEDA 1FMJA 2E6KA 5EUCA 3JQ6A 4RY9A 4G65A 4WA8A 3ELBA 4AKIA 3W5AA 5CJJA 4RSGA 4B6JA 5D00A 1QP7A 2FZKA 5J2UF 4MR8A 3G1UA 4HZUA 3R3SA 3SX4A 1KK1A 5H1YA 3RIGA 1EX7A 2XY4A 2Q8NA 4RTLA 3UWSA 4RK6A 3THSA 4CEJB 1U2PA 1SQ5A 3BWCA 4GO1A 1EQ2A 2NAPA 3K0CA 4JJ8A 5FNVF 2XECA 3F3SA 2XQVA 3Q7QA 4NU8X 3E6AA 3EYAA 5J2UB 3GPLA 2AR9A 2GO7A 4IIHA 5HK9A 5A0VA 4WNAA 4MMXB 4FSXA 1A2BA 3QPVA 1E2EA 4DEXA 3ORSA 5J2TB 2Z5LA 1H65A 1TMKA 3IR5A 3ZNNA 1Y8AA 2XZLA 2Q5CA 1QHFA 5I9NA 5IT5A 4ML3A 4GM1A 1XLVA 4OATA 4N41A 1GR1A 1ZD1A 4H4CA 1AC5A 1Z83A 1XTJA 2OFXA 1WBJB 1NOKA 1G3QA 2I8LA 3CMMA 1V4NA 3GEEA 3NONA 3WS7A 2JLXA 2H54A 3EEQA 3RK0A 3NWOA 4R69A 3T06B 2KPOA 1N7GA 1ZK2A 4WECA 2QX6A 1G7TA 1X7GA 1FDOA 2RHHA 1RYMA 4RYDA 4F96A 3HUUA 4BZWA 1I5RA 1GU0A 3RRJA 4BMCA 1A1SA 4P5EA 3Q87B 5HTKA 1I51A 4YJ3A 2QD1A 1E5DA 1O6BA 3H8JA 2F3TA 5K4AA 3AHDA 3ZS8A 1H4QA 1PT6A 4Q02A 2PVSA 3VR3A 4PC7A 2PGJA 3OKFA 4CV0A 5JSYA 1TVEA 3VYRB 3PF9A 4P84A 5D87A 4FR2A 2OGTA 3ICCA 4TN5A 4OEHA 3KLMX 2OAP1 2HNBA 2V55B 1QCYA 2WF8A 2IZ0A 3GT0A 1YJXA 5B36A 5DM70 5FLXA 3ANTA 4PZLA 3ZCPA 2GZAA 2DC1A 5ITVA 4OMDA 2MINA 4DZRA 1P17A 4LZJA 3ZY3A 5JSUA 4ZVKA 1HDEA 3T3HA 2I62A 4MROA 3KVVA 1WD5A 3A3NA 4HFJA 4OOFA 5EZYF 5FP0A 1NOJA 4QYMA 4PZ0A 2BWJA 1PNOA 4KDRA 4N82A 3LWBA 3EYWA 2CMGA 2B0CA 2GNAA 2H4YA 3R23A 3ROPA 4Z3OA 3RYCA 4C5CA 3PYLA 4QPPA 3WWEA 4R2KA 2PBFA 2D1FA 2VQ6A 1Z0AA 1Z3IX 2B7CA 4OXKA 4TYYA 1D2RA 2FPGA 3A4MA 3D8SA 1B16A 3LYHA 5BT9A 1TKAA 2FWPA 3FNFA 4JL6A 3D3JA 1KHTA 4FX5A 4Y6OA 3WE7A 1NTRA 3T5GA 4UFNA 4KFRA 3KSBC 4R9UC 1C3EA 4JOBA 3CUSA 1KEEA 2WM8A 4Y1RA 3UUFA 4KE8A 4AJ9A 1CS0A 2DP4E 3TLEA 5LR6A 2Y0BA 3L7KA 3TW0A 5I9IA 3TF5A 3B12A 1M1NB 1PJCA 3GLHE 3ZI7A 1PJ4A 1YK0A 2EKZA 2HFJA 1QZ3A 3JTEA 2HQ1A 2ISQA 4JD5A 2XTNA 4H7IA 4J2TA 1WPGA 5T8KA 1V6SA 5AVTA 2G1UA 3LC0A 4MUJA 4S04A 4DG8A 3K05A 1CQJA 5F9MA 3LC7O 5AW9A 2IU4A 4IS2A 1L5LA 4CG3A 4BLVA 2WSBA 1JH8A 5CVVA 3EZXA 3TUIC 1EFUA 1UJCA 2MIIA 5BSMA 3SG0A 4QHTA 5DLDA 3TO5A 1OI4A 1U1EA 5TT0A 4F93B 4QELA 2GHTA 5K3DA 4WLEA 1YU6A 5EI5A 3CRQA 3P9ZA 3MWDB 4EKDA 1NYLA 3TB4A 5M5BA 3H13A 2G1PA 1B0UA 1DAFA 5D6OA 1S2DA 1THMA 4NX2A 4UD6A 3QW4B 4I9NA 1DLJA 4FJ2A 4EX7A 4DUZB 1PLKA 1NW6A 1UC4B 4JR2A 4EK9A 1BWQA 1H22A 2VP3A 3GXOA 1N0UA 1MENA 1SXJD 2ZVJA 3K1YA 3KR9A 4O2AF 4QSHA 5IJ9B 1XRRA 2F8SA 4ZT6A 1YDWA 3ZCSA 3K1AA 1V8PA 3WQQA 3GPCA 4G6ZA 2GVDC 1SXIA 5I7RA 4UTVA 2FF7A 2RK4A 2O2GA 3HFRA 4MZDA 1JDBC 1HDCA 4QARA 4JT2A 4OLAA 2Q9BA 4LK2A 5JTTA 3AWIA 1C7JA 3ZKAA 2D7JA 3NNNA 3CLUC 3CZAA 1LZKA 2YVLA 5EJFA 4GX1A 4XIIA 4PQEA 2CL6X 1Q83A 2ATIA 2YQ4A