1IPEA

Tropinone reductase-ii complexed with nadph
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
259
structure length
259
Chain Sequence
AGRWNLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNDCLTQWRSKGFKVEASVCDLSSRSERQELMNTVANHFHGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTIQDPEQKENLNKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGGLMANCGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPINONE REDUCTASE-II
publication title Capturing Enzyme Structure Prior to Reaction Initiation: Tropinone Reductase-II-Substrate Complexes
pubmed doi rcsb
source organism Datura stramonium
molecule tags Oxidoreductase
total genus 104
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 1.1.1.236: Tropinone reductase II.
pdb deposition date 2001-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ipeA00
4R5HA 1ZCJA 3IIEA 4FIZA 4NFHA 4OHUA 3ICPA 2GYYA 1ORRA 5CDUA 3QVWA 3RUIA 3H9GA 2VHWA 1PL8A 2J8ZA 4LSWA 4EJ6A 3MWEB 3H5RA 3BMQA 4CQMB 4OMUA 2GD1O 3EC7A 3C7DB 3IAHA 1EUDA 1HLPA 3HG7A 3W8FA 1WXDA 1LI4A 4BUCA 2QZZA 5ICSA 4PN3A 3GN1A 5A9RA 2C5AA 2QZ9A 1RKXA 2PKQO 5KWEA 1SCUA 1B26A 5H82A 4J6FA 3G3EA 1AXGA 4QO8A 3MJSA 2OMEA 3EZYA 1E7QA 5DULA 3AK4A 4YB8A 3VHRA 3H3FA 4FPXA 1ONOA 1ZH8A 3DR3A 2PFGA 4WLNA 5TNXA 3DBVO 3F6YA 1EUZA 5ER6A 4CLXA 3C1OA 1IPFA 4NFYA 1XQ6A 4FGWA 3U4IA 3RWBA 3L6OO 2X0JA 4FFNA 1RYEA 4NBWA 4Y6RA 1YL5A 1E7MA 3WXBA 1HYGA 3AW9A 3EVTA 2X9VA 3LF1A 3MTGA 3U5TA 3M6IA 1DRUA 3PK0A 5DZSA 1NFFA 1WZIA 1P3DA 2IZZA 2VRCD 3PFFA 1V8BA 3R3SA 4IIUA 3GUYA 1BXGA 3HDJA 1AHIA 3O26A 2A92A 1R16A 3I4CA 5CDSA 2PLAA 2X1HA 2PZKA 2C07A 2O3SA 2OGUA 4PFJA 4RVFA 4XQEA 5JLAA 2O3UA 4N5NA 1ENPA 5HTOA 2OHXA 2NNLD 4MVJG 3AOGA 4DLLA 5CEEA 1BVRA 1X7GA 3HN2A 3Q2IA 4BO0A 4B7XA 4OQZA 2P9CA 2XPCA 1GUYA 4GKVA 4MJLA 3ZHXA 4EGFA 5HM8A 4RVGA 2ZQYA 1H93A 5C7LO 1DDOA 2EXXA 3RQSA 1Y8QB 2ZJ1A 3LT4A 1ISJA 1NPYA 1E5QA 1EEHA 1P77A 1Q0HA 1IZ0A 5L53A 1DJNA 4R9RA 5U9CA 1HKUA 3FN4A 5TRTA 3AM4A 1GZ3A 4RLHA 4J91A 2PGJA 4KMSA 4CV1A 2Q45A 4AJPA 1EE2A 2YHUA 3V5NA 2CY0A 1EVZA 1XU7A 5F5LA 1U8XX 5JE8A 2AQKA 3L4BA 5BNIA 2YDXA 3ANLA 1JQBA 1I3LA 1Z75A 2H9IA 4CMIB 4YTEA 3LLSA 5LDGA 1X7DA 3QW2A 1LNQA 3FPCA 3JQBC 1P1KA 3WMXA 4WASA 4XRRA 2EWMA 2HK7A 1NHWA 3ZHZA 4KDFA 5A04A 3IL2A 4DPMA 2AHRA 2VYND 4ALNA 5T5QA 4ZQGA 4CL3A 4GWGA 1YE3A 4PLZA 4MP3A 1KIFA 2VRBA 3NV9A 2ZB8A 1E6EA 1LC3A 3W4KA 3WGOA 4AJOA 3SX2A 2PKQP 1HDRA 4TVBA 1VJ0A 4GPD1 3HFGA 4YJDA 1MG5A 3Q6IA 3WWYA 3UGKA 5I7VA 5JNLA 1HDCA 3AY6A 4DIOA 3P19A 4R51A 1D8AA 4E5PA 5K9ZA 4BL5A 2C7VA 1GQQA 3NGLA 1RM0A 3O8QA 4WCFC 1YQXA 3KLPX 1JKJA 3ETGA 3DO5A 3JQ7B 5L7TA 1HSOA 3PWSA 3D3EA 4IDAA 2VHXA 3EMKA 2HDHA 1OZAA 3MJVA 1DIBA 1XYGA 3ROMA 3KRTA 1I5RA 3PJEA 4WOJA 5LC1A 5TGDA 1LLDA 2QG4A 4BHTA 4GQAA 4RF4A 1D7OA 4XWYA 4BIIA 2I99A 4RPHA 1K89A 3JQ9C 3L9WA 4KWIA 3ZNPA 5IZCC 2QX7A 3MTJA 4WCDA 3NRCA 4CM1A 4UVEA 1A9ZA 2QRLA 2OO5A 3OIDA 2ZKLA 3PQEA 3OQ1A 3OA0A 2JKVA 4J90A 1KVSA 1SEVA 2YV2A 1O6ZA 2DM6A 3E1KA 3ZNQA 3QHAA 3GF4A 2FSVA 3TZ6A 1DRVA 5KJFA 4IM7A 3A9WA 4MVJP 3NJ4A 1I33A 3DBLA 3DQPA 4E21A 2NUAA 5KKCA 1P44A 1YJ8A 4YJHA 3W8EA 3CEAA 3D3WA 4K9DA 2EEZA 2Z1MA 1VL6A 2PR2A 3INRA 2EW8A 4RV9A 1H9BA 2EGGA 1P33A 5AVOA 3W6ZA 4PZEA 1S6YA 4U6QA 4XYMA 4XGNA 1IYZA 1AUPA 1HT0A 2C54A 1MXHA 2HMSA 4OSOA 4DBVO 3S1LA 1GPJA 5A3VA 3KYDA 1DPGA 1VLLA 2P4HX 1TLTA 4K1LA 1RM3A 1XA0A 3N58A 3G1UA 4B4UA 3WGHA 4D43A 1H2BA 1E3WA 3DXFA 4RDIA 3U4DA 4GWKA 3E03A 2Q2QA 4RLSA 1C0LA 3JD3A 4AVYA 5KJ1A 3L4SO 1JVSA 4RORA 5L9AA 4KWHA 4OM8A 3PIDA 3K8ZA 4IINA 4YRBA 1ZSVA 3VTFA 1TT5A 2D3TA 3DMTC 1YH3A 1KC3A 4D42A 4YRDA 4DTIA 3E9NA 4GVLA 4IXTA 1PEDA 1SAYA 4J4HA 4J1SA 1ZSNA 4L4SA 4F45A 3LT0A 3RBVA 1PX0A 1W8DA 3DTTA 3GGOA 5EMHA 3DDNA 4QO7A 4NBTA 3I9JA 1ZXLA 3DONA 4IS3A 3GZ4A 2P5UA 1SMKA 2ZB3A 2UV8A 2YHIB 4R1SA 3WGTA 4D46A 3D4PA 4GBJA 3HE3A 1PJ3A 4ZN6A 1PJQA 3TZKA 5IAAA 4BO6A 4WCFB 3ZWPA 2A94A 1B8PA 2YV3A 4K26A 1E0DA 5AYVA 4GVXA 3FHLA 5JDCA 4P4LA 3ZU4A 1CEQA 3FWNA 1LC0A 4O59O 1MXFA 3WG9A 3RD5A 5AXBA 2ET6A 1BG6A 1GAEO 1FF9A 2PH5A 4YCAA 1K2WA 1R37A 5A06A 1P1HA 4DPLA 2BGLA 1U5CA 3H8VA 1WWKA 1DIGA 3R0IA 4TKLA 1RPNA 3PWZA 3E5MA 3O9ZA 3HSKA 3TWOA 1LXCA 1CDOA 2Y67A 4II2A 3NYWA 3EDMA 2EHDA 4IXWA 1H6DA 1ARZA 1GR0A 5MGBA 1UXKA 4RL6A 4BQRA 1IZ9A 2QHXA 2VOEA 3IUPA 1PGJA 3WTBA 2DUWA 1UDCA 1M6WA 3WOHA 1OOEA 5DCWA 3UCFA 3ETEA 1YGYA 1RYDA 2AG5A 2HUNA 5F1PA 4S1VA 4OJNA 1N8KA 2FR1A 2BHLA 3VAZA 5CPFA 3ASVA 2UVDA 2OFPA 4KUEA 1ZK3A 4YACA 3RI3A 3BMCB 1G0NA 4HY3A 3B20A 1V9LA 3ITDA 1QR6A 4DPKA 4J49A 2Q46A 2EIHA 3U9LA 1E7WA 5JY6A 3R6DA 1GD1O 3JQCA 3AY7A 1Y5MA 4YJFA 1K0UA 5L4NA 4EEXA 1H9AA 3NKLA 2VQ3A 3NDIA 3SC4A 2HQ1A 1BHSA 4CLRB 8LDHA 1R15A 1V0JA 1GL3A 3A1NA 3KB6A 4CM8A 4Y98A 5AXAA 3LU1A 4MP8A 5JS6A 4DREA 4CODB 4Z0HO 1O9BA 3JQGB 4BNIA 4E5NA 3I9LA 4GX5A 2WD7A 4D3DA 4GL4A 4KQXA 3RU9A 3X2FA 3UUWA 2PD3A 3T4EA 1W4ZA 3L0DA 2IE0A 4KUHA 4E4YA 2DPGA 1PSDA 5G4KB 1T4DA 2IXBA 3I6IA 1ISFA 1XWFA 4J2HA 1QLJA 1YOVA 3GVCA 2JJYA 4NDNE 3BMOA 4ALJA 2G5CA 2IEBA 1P74A 5BT9A 1GQ2A 3LYLA 3GNSA 4R9SA 1LDYA 1EE9A 4DXHA 4KP7A 4BO2A 4NNJA 1NQ5A 3LQFA 3BXXA 4A73A 2YUTA 3I5MA 1L7DA 1KS9A 4D44A 5C37A 1MA0A 3JYQA 4ZQHA 3TF5A 4A03A 4MVJE 4PGFA 3I6QA 4OOFA 4GGOA 4NR0A 2LDXA 5I8ZA 1YS4A 2JD2A 3F4BA 4XB2A 1IL0A 2O2SA 3PJGA 1NXQA 1T4BA 3MJCA 3KXDA 2CUKA 2XAAA 1NNUA 4GSLA 1UZNA 5TT1A 5JO9A 3ZZNA 4OSPA 4CLOB 4NJOA 5A9SB 2Q1UA 2J5RA 5FF9A 2G1UA 1SB8A 2B83A 3M2PA 4XGKA 1LUAA 1LLUA 2EJVA 3BIOA 3FBGA 4LISA 5GY7A 3BHJA 2NACA 2H1SA 3KZVA 4D0RA 3QVTA 2O3TA 5HBRA 2RHRA 4LGVA 5JDIA 2NADA 4IDDA 2B4QA 2ILTA 1BWSA 3PXXA 2Y1FA 3S2EA 3CMMA 2X5JO 3R3JA 2PV7A 4CMKA 1NFQA 2Q1WA 2NQ8A 4F46A 2X8LA 1MV8A 1DB3A 2C0CA 1FMCA 2FPGA 1PJCA 4R4JA 4CR6A 3R1IA 4B8WA 3EK2A 4XIJA 3Q1LA 2ZTUA 4ZHSA 2VOJA 4YT8A 1YVEI 2WDZA 3AFNA 2YDYA 4BOYA 2P5YA 4NJMA 1QSGA 2Y1CA 4D45A 5ILGA 2AQIA 2HRBA 4LMRA 3UW3A 5A4DA 1IULA 1R0KA 3NTQA 1YONA 3AM5A 1EK5A 3WYBA 2X4GA 4XEHA 3JQFA 4IGEA 2Q4EA 3DBRB 4OO3A 1ENYA 2AG8A 1PJBA 2IXAA 4NPCA 3RJ9A 4YXFA 4E33A 2YYYA 1Y5RA 1SBYA 3IOYA 5DP2A 5I9MA 2Q3EA 3HADA 2G0TA 4QQRA 3BHMA 1KEPA 5TS3A 2JFFA 2OL4A 4W99A 4EUEA 3NJ8A 3B70A 2OP0A 2X6TA 3NGXA 1C0IA 2BGKA 1DFGA 1QYVA 1SZJG 1LA2A 4Z3DA 4CUJA 2HMWA 3MJ4A 5TJ9A 3JD2A 4HFMA 2AMFA 3JYLA 1GZ6A 5KJCA 1PS8A 2CFCA 3I52A 1VL8A 3OSUA 4XDYA 1EQUA 3I1JA 5AXCA 5JSFA 4OH1A 4BNYA 1V3UA 2Z5LA 3LK7A 3NT4A 4FC7A 1A72A 4A2CA 1BXKA 3PQFA 1X13A 4UEOA 5ENVA 4EJMA 4BS9A 2R2GA 4CM4B 1Q0LA 1NR7A 1R0SA 1PQPA 2WTBA 4FFOA 2J5QA 1DSSG 1XHLA 2O7QA 3ONFA 1I32A 2Y1OA 4Q39A 3UOGA 4O1MA 4YQYA 3BHIA 3VKUA 2VCYA 3V1YA 1Q7BA 1XG5A 4NIMA 3E6AA 1OMOA 4HBGA 4DIBA 2GGSA 1H5QA 4JIGA 4JBGA 5ENDA 1PR3A 3OMLA 3PJFA 4KTTE 5EN4A 5HRUA 1IY8A 2GPTA 4RVHA 3CSDA 1WDKA 1PGOA 8ADHA 4MKXA 4BGEA 4MPDA 3EUWA 3RSHA 1OC4A 5JY1A 2VHVA 3K30A 3KVOA 2X22A 3UHAA 2Q2VA 3DOJA 4YAGA 2Y0DA 4DMMA 4DRYA 4BB5A 3OECA 4H3VA 1XSEA 2J3KA 2JFGA 3V1TC 1KEUA 2PZMA 2HSDA 1NBOA 3GGGA 4IDCA 5L7WA 1U4OA 2A4KA 1QV6A 2HMUA 4A26A 1ZK2A 4Q3DA 4XR9A 1YXMA 3FTPA 2VZ0A 2GSDA 2EJWA 1CRWG 2AE2A 1NVTA 5BSFA 3I9KA 2BGMA 4TRRA 4J0EA 4U0KA 1DC6A 5KJEA 4WEOA 1QLHA 3DWFA 4KTVE 4NG5A 1L1FA 4E5MA 1J5PA 4RQTA 3ZWMA 4UVGA 4E2XA 4O5OA 1I3KA 2QQ5A 2WE8A 3DZIA 3E18A 4IZIA 1Q7GA 4F3YA 5DNAA 5FFFA 4ZGWA 4Z9FA 5CEFA 1J49A 1U8FO 2V7PA 3GVIA 3DEYX 4GSKA 4BNFA 4CMGA 1ISMA 1F8GA 3IKTA 1T2DA 4CUZA 3L07A 5G0WA 2O50A 3ZHBA 3ZCXA 4YJGB 1QP8A 9LDBA 4IJVA 5I7FA 1Y9AA 2P4QA 4XQ9A 4BNNA 1HTBA 3TDKA 1JA9A 1PQUA 4FFRA 5COQA 2YY7A 4E13A 1A27A 1U28A 4CPDA 5ITVA 3PYLA 1V3VA 3QSGA 2E4AA 2FY8A 4M54A 4J3FA 3T7CA 4UREA 2VRCA 3N7UA 1P0CA 1ZK0A 3ZWNA 4YPOA 3U49A 2CDCA 4HP8A 4Q3AA 1EVIA 3JCZA 3H5NA 3PJDA 1PL7A 3K92A 4XCVA 3PHHA 3WIDA 3QVXA 5TJHA 3OFSA 4FQ8A 2LDBA 2Y05A 1VKNA 2OOSA 4NFSA 4Z9YA 1R0LA 1EK6A 3VPSA 1B3RA 3QWHA 2NM0A 3QWAA 2OORA 4R1UA 2IEDA 4G81A 4BKOA 3RUDA 4OXKA 5JBIA 5L7YA 3TRIA 3JQBA 4PLPA 1SNYA 1MUUA 3JQDA 1MFZA 1YBVA 3TL2A 4BKRA 4E2YA 4YRAA 4QUKA 3ZV6A 4HADA 3K6JA 1PS0A 3MEQA 1EMDA 2O3RA 3JQ8B 1LDGA 1N7HA 2PZLA 3WNQA 2J5KA 3M1LA 1GY8A 4J0FA 4IJKA 4IDBA 1N9GB 5JMWA 4CLEA 3MOIA 4OOEA 3KSZO 3NT2A 4W7IA 4XRGA 4UULA 4UAGA 3VPHA 3QVOA 4GI2A 4MVJH 1QYWA 4RZHA 3IDSA 1ZW1A 4IUYA 1VJTA 1GQYA 4ZQBA 3OP4A 4OYRA 2HK8A 1KEVA 2YW9A 1J4AA 1SB9A 1X0XA 2NU6A 4J7XA 4J7CA 4WCFA 4UUPA 1PWXA 1YBAA 5TSDA 5I7SA 1YQGA 4UVIA 2VYNA 3C7CB 3MZ0A 1E5LA 4FFMA 4MDHA 4W9NC 3ZW9A 3H9UA 4YAKA 1UP7A 1E7YA 1NQOA 1EVYA 3DFUA 3LZ6A 2GN8A 2WJPA 4DMLA 1M75A 5G0VA 3D5QA 5IZCA 1V35A 2ZB7A 4DA9A 2AW5A 1MG0A 3AFMA 5F5NA 1OI7A 5A03A 1GDHA 3I9MA 1JN0A 4M87A 4MO2A 2PWZA 3UCEA 5F3RA 4R01A 4INAA 1HLDA 1A5ZA 5B37A 1NYTA 1O95A 1DC5A 3VPXA 5KNLA 1EBFA 1HDZA 3DZJA 3GC6A 5GZ6A 3ZWBA 5IN4A 3F5SA 2HMTA 1Y6JA 3RROA 3C1TA 1H6CA 4KZPA 4RPGA 1WDLA 1YO6A 4BKUA 1FDSA 1U3WA 1UR5A 4ALIA 2NVBA 1P9LA 2GO1A 4U0JA 4D3FA 1T2EA 3WS7A 3GFGA 3RAJA 4BNTA 3BMCA 1ZUD1 3GVHA 2FZWA 1S7CA 1WVGA 3CTMA 2VTDA 1YB4A 1GCUA 5BSEA 1ISHA 4OIMA 1MC5A 4MIEA 3AUAA 2EKLA 4BB6A 4CL8A 5BNTA 4J16A 2FSSA 1ZBQA 4HKTA 3B1KA 4AICA 1T2AA 4EDFA 4XZ3A 3QWFA 4M89A 4UVDA 2CVOA 5COBA 2QYTA 1G0OA 2FR0A 2DTEA 3AI2A 3SVTA 2Y1EA 3GUCA 4BVAA 4BV8A 2VT3A 1F06A 5KJ6A 4CMBA 2GUGA 3FCOA 4CJXA 1XIVA 1R4NB 1D1SA 2QW8A 1QYXA 1ONPA 1ZEJA 3DC2A 3PDUA 3HDQA 3DMTA 3JQGA 1HF3A 3E82A 3FTNA 1M67A 2EKPA 2B69A 3BTSA 4FS3A 3VOSA 4CLDA 4E0BA 3PRJA 3FR7A 4BKQA 1O89A 1HDOA 2DFVA 4FJ2A 1MLDA 1YB1A 4D3SA 2C59A 1EDZA 2W2KA 3GVPA 1ZZEA 3H5AA 4G65A 4GLLA 4RZIA 1B16A 3VZRA 3ANNA 4L76A 5DT9A 4BGIA 4J1NA 1U9JA 5T8KA 2Y1GA 3L9XA 3CE6A 2FPPA 1Y1PA 3V2UA 3C8MA 1I36A 3ZI0A 5I9LA 2UYYA 4KQWA 3SEFA 4C7JA 4BMVA 1NFRA 2Y99A 2RCYA 3IMFA 4QT0A 1N1GA 3KTDA 4TQGA 4DL9A 2YFHA 1U3TA 5IDWA 5F1OA 4JROA 2JD1A 1NM5A 2BFOA 3G17A 3RC9A 4PLTA 2VUTA 3FNFA 5B12A 3WWZA 4JJFA 2XF8A 4FN4A 2A35A 1ZJYA 2Q2WA 4H15A 2BELA 2UDPA 4PLVA 4EI2A 1UXIA 3LF2A 4I5GA 5I9NA 3JQAB 4EUHA 3UXYA 3BTOA 2D0IA 1ML3A 5CP8A 4XGIA 4EYEA 1GEGA 4FOOA 4ZA2A 1VRWA 2CSUA 1JDJA 1HZJA 5B1YA 3QQPA 1I10A 3RUFA 2PD4A 5JYEA 4TZKA 3AOEC 3MJEA 1ISIA 4J43A 2C82A 1EBUA 2OBYA 1C3VA 1WMAA 3JTMA 3GAZA 2FOIA 1H0KA 3LVFO 3PIIA 4MOWA 2VYVA 3PYXA 4AJ2A 2JAPA 2YQ5A 3DBHB 3H9QA 4WNCA 5LCXA 4CMCA 5CFZA 4L4RA 3Q9NA 3ENKA 5CDGA 3K2BA 3MJTA 4PRLA 1RJWA 4IDFA 4PLHA 1JTVA 5ER9A 3ZH2A 3JV7A 3LSYA 2CVZA 4B4WA 3A14A 4L74A 1TB4A 1Y81A 4ONEA 2POQX 1TXGA 2C7GA 4WLUA 1JKIA 4IY1A 4JGBA 3VZSA 1LX6A 3G1TA 2B4TO 3CH6A 4FDAA 3GPIA 4ILKA 3STHA 1V6AA 3TZCA 1LTHR 4WGGA 4RJTA 2PTGA 1DAPA 1SO8A 1FK8A 1UDBA 3ICCA 3ZV3A 4YYZA 5IZ4A 5TLSA 5JAZA 1F8FA 4D0SA 4CM7A 1X1TA 3P5SA 4PG4A 4MINA 4ZJUA 4BNXA 1ZFNA 2FMUA 3WYCA 5L40A 1ADFA 4HFNA 4PG7A 4ALKA 1R4MB 3TJRA 2AA3A 4NK5A 3RCBA 1G1AA 1TI7A 3EAGA 3GA0A 2FZEA 3RFTA 4WECA 5BNFA 3GAFA 3OHSX 4BNHA 1RM5A 3HFSA 3RU7A 2DAPA 4PLGA 3JQ6A 2Y1DA 3WICA 2EP7A 3GEMA 3ZNNA 5A05A 3ON5A 5JCJA 3IQDB 2X0NA 4AL4A 5IF3A 3IS3A 3ZU3A 4B8ZA 3GLQA 1GCOA 1GYQA 4U7WA 1X15A 3DZHA 1F14A 2ZYDA 3NT5A 1BW9B 1Y8RB 3H3JA 1QG6A 4MIYA 4TRNA 3RUCA 3BTVA 2V65A 2AEMA 2VT2A 4LW8A 1LLQA 2D5CA 4R3NA 1IPEA 4ND5A 3PHLA 3CKYA 3WIEA 3Q0EA 3I23A 3BMQB 1KEWA 2VUUA 1LSUA 2DFDA 4WOKA 2HRZA 3G79A 2WMDA 1C1XA 1K6JA 2Q99A 4O0LA 5EIOA 2E6UX 4R1TA 2VYVD 3VTZA 4YT5A 4I5EA 3VVBA 1CERA 3C24A 1Q0QA 2Q50A 2NU8A 5ICMA 5B4VA 4BGUA 3KSUA 1P1JA 1XLTA 2G82A 3PGJA 1ZO8A 5IXYA 2ZATA 1FDWA 4MVJM 2VHZA 2D4AA 4HXYA 3ZN2A 1C0PA 4BGVA 1O5IA 1PZGA 1VE9A 2X0IA 4J1TA 5EQFA 4FC6A 1AGNA 2VZ8A 3KYCA 4ALLA 4HV4A 4XQGA 3U3XA 2QRJA 4XB1A 2W2LA 2ZB4A 5JFOA 5IXSA 4WJZA 5G0SA 5I7EA 3RVDA 3F9IA 2JHGA 2Q1TA 1UXGA 1NR1A 1HYEA 4GLOA 1T25A 1TVEA 1Z45A 4FCCA 1BXGB 1E3JA 4I8XA 1NHGA 1JAXA 3UCXA 2TMDA 4JQCA 4DGSA 1HDXA 4RQUA 1GZ4A 3OQBA 3OJLA 4BNZA 4DVJA 2R00C 3QP9A 3EY4A 1I01A 3E5RA 5EERA 1E6WA 4WLEA 1X0VA 1ONNA 1PS9A 4P4GA 5JCJD 4CMHA 1T24A 4NHEA 3AU9A 4L73A 2X0RA 2CF6A 1ZIDA 4ZD6A 4NBVA 4B7CA 2F00A 3WQSB 4B4VA 1DLJA 4I5DA 1XR3A 3QRWA 4W4TA 3ZHYA 1XQ1A 4WKGA 1EUCA 1Y9EA 2W98A 3H6KA 4QTZA 4BO4A 1ULSA 1EFKA 1HL3A 3PQDA 4LK3A 4K6CA 5G0UA 2XXBA 5K6AA 1LDBA 2O3JA 4CM9D 4IZHA 1DLIA 1U5AA 4H7PA 4M1QA 1I2ZA 1LSJA 3DB2A 3WGIA 2NVUB 3W6UA 4MP6A 1C1DB 4JJIA 1OC2A 4WNIA 3A28A 1UXHA 3LT2A 2Q4BA 3VDQA 1DIAA 3JQ8A 4UEKA 1AHHA 1NVGA 3SJUA 1YBMA 5DOVA 4TVOA 1E1LA 4I9HA 4IS2A 5CAEA 4NI5A 2RAFA 1N9GA 1GEEA 3B1JA 4IBOA 4BNWA 3DAFA 3GEDA 3OIFA 2FP4A 1MX3A 4B3JA 2D5AA 3GPDG 4LSMA 4CQMA 1UH5A 4WLFA 1QRRA 1HRDA 4QXMA 2W2LD 1ID1A 3LLVA 1EFLA 4N5LA 1WAMA 4K6FA 4ND3A 1FDVA 2GCGA 2HLPA 3RC7A 4PCVA 2VWGA 4PG6A 3L77A 2NU9A 1AXEA 5JDCC 3GN2A 5A3JA 5GMOA 2IYPA 3BA1A 2HKIA 3CIFA 3B1FA 4PG8A 1MC4A 5TF4A 3UN1A 2PH3A 2E82A 1B14A 1DBVO 3FRJA 4HNHA 2CNBA 3F47A 1HDYA 4JP2A 2ZTMA 2C5EA 5T67A 1IOLA 1UAGA 1PJTA 4XYLA 2PNFA 3OJEA 1QORA 2JCYA 5THKA 1E3IA 4AFNA 1LJ8A 3WFIA 1VPDA 2DVMA 3WTCA 3E9QA 3KSDO 4ZVVA 3ETDA 3VH1A 3GHHA 2P2SA 1ZVMA 1GV0A 3DBLB 4ALMA 1FDUA 3QE3A 4AJ1A 4YDRA 4YJHB 3D3WB 4EZBA 2CMDA 3O03A 1ULUA 3PEFA 1CF2O 3VPGA 1NQAO 1O0SA 2OXIA 3K96A 3NAQA 3KO8A 1NQTA 3A06A 1B15A 4B7UA 5DF1A 3GMDA 3ORFA 1DEHA 3PGXA 5A1TA 4IJWA 3FNGA 3OF2A 2G76A 2JAHA 3G0OA 3UAGA 3W8DA 2X7HA 3ZWAA 5H83A 4CMEC 2WE7A 4K28A 3KYDB 3LC1O 1Y8QA 1DOHA 2GF2A 1BXZA 5DBGA 1CWUA 3D5TA 3V8BA 3HJAA 3OJOA 3SC6A 4AJJA 1U3UA 1W73A 4LVCA 1PIWA 3TPCA 2UAGA 1O94A 1QXSA 4CQLB 3UF0A 4M8SA 1ZEMA 3JD0A 2ZTLA 4Q3NA 1QKIA 3C85A 1E7SA 4UUNA 4CQMD 4DYDA 1C14A 1R4NA 4CMIA 1TT5B 2AEFA 1JVBA 1CIVA 1KC1A 2V6FA 3HHPA 2JCXA 4A7PA 2QRKA 3INTA 1DHRA 1NX6A 6ADHA 3UFXA 5J23A 4BO9A 5JAIA 2B36A 3VH4A 5T57A 5A5FA 2H6EA 3RC1A 7MDHA 2C2YA 4A0SA 3NX4A 2Y68A 2CF5A 3QLJA 4LRTB 4P4NA 4AJKA 4PG5A 5DCYA 1H94A 3ADPA 2GNAA 1E3EA 2DTXA 2PA3A 4S3MA 3FI9A 4NMHA 3VC7A 4BKPA 5TX7A 4YBZA 1L7EA 1QYCA 2B5VA 4HNGA 5JC8A 3GMSA 4J2OA 1CETA 4BNJA 5KOIA 3TNLA 4HFJA 2X9GA 4OQYA 2E49A 5JCXA 1BSVA 3WQRA 1R6DA 1QV7A 1EDOA 4W9NA 5EPOA 5JAMA 3N74A 4RGBA 4JK3A 2ZTVA 4ZRNA 4TRJA 2IODA 1F0YA 3JQ7A 4GX0A 3ABIA 5JXWA 2RH4A 2ZK7A 4JP3A 3DOOA 4WPGA 1EQ2A 2WWRA 2J3IA 1E77A 3GOHA 3P2OA 3HB4X 1UXJA 3ITKA 4XKJA 3GG9A 3RUEA 3ROQA 3GQVA 3CXRA 3DAPA 1U2DA 3D7LA 3E48A 4ZQEA 5B4TA 5CDYA 1WDMA 1A7KA 4PLWA 3RKUA 3I4FA 1LQTA 5HA5A 4EUFA 3JYOA 4QFCA 6LDHA 1TA4A 3ZDFA 4RF3A 5JDIC 3GVXA 2GASA 1JU9A 3KHUA 5GZ1A 1NWHA 1UZLA 4PLFA 4W6ZA 2EKQA 4AJEA 1IE3A 3QWIA 1PGPA 1JLLA 4DC1A 3IJRA 3PYMA 3P7MA 4E5KA 3U09A 2F1KA 1GUZA 3QVSA 4R16A 3ZW8A 3KUXA 2EW2A 4B3IA 3AUSA 4TKMA 3C3XA 3KV3O 2P9GA 1ISGA 1KERA 1N7GA 2BLLA 2HAEA 2J3JA 2NWQA 2WM3A 4WEQA 4B4OA 1LRLA 1YL7A 1MB4A 2BD0A 4KUGA 5ES3A 2C20A 1ENOA 3JYNA 1A7AA 4YJFB 4FJ1A 2BFAA 4Q9NA 4XD2A 3MWDB 3FR8A 3AU8A 2QYSA 3OETA 1X14A 1I0ZA 3WSWA 4AJNA 4CM8B 4CR7A 1JWAB 1U7TA 1JWBB 2VHYA 1UUFA 4JBIA 5DOZA 1E92A 2OP1A 3C1AA 1VJ1A 5L3ZA 2GDZA 5KCZA 4D79A 4DUPA 2WD7B 1Z7EA 1NPDA 3EGOA 3PLRA 1U3VA 5KVSA 4G5HA 5ILOA 1LDMA 4FOSA 3WBFA 3PHGA 4UUOA 1NPTO 3RFVA 1D3AA 2BFPA 4WLVA 5L45A 3W4IA 4MKRA 3HWRA 4X54A 3S8MA 1R66A 3WYEA 1BTOA 3JYPA 3ADOA 3OQ6A 1PJ4A 1WMBA 2WYVA 3ZWXA 1DIRA 5T64A 2W4QA 3BMOB 5DP1A 1Z82A 5THQA 3OEWA 1BGVA 1IUKA 2CDBA 4HFRA 2EV9A 4M86A 4XYEA 3P2YA 5A02A 2EG9A 1CQIA 2Y66A 2YHIA 3PHJA 3GK3A 3Q2KA 2GR9A 2PKRA 2CDAA 4IIVA 3I9NA 1Y8RA 1UP6A 2NTVA 1MP0A 2E37A 1H6BA 3HZZA 3OM9A 5HS6A 5HWSA 2FR8A 1LU9A 4XA8A 3K9QO 1ZKMA 1O8CA 3TOXA 1HE3A 1YB5A 1ZNQO 3ROKA 5H81A 1XELA 2DKNA 3I9OA 1RWBA 4GMFA 2G17A 1U4SA 3F4LA 4D7AA 1M76A 4WE3A 3UVEA 3JQ9A 2HJRA 3FPLA 1ENZA 5FI3A 3E9MA 2NVWA 3GH3A 3RASA 3GZNB 4EEZA 2QIOA 3PZBA 3KYBA 4E30A 1WP4A 3AOEA 4XJTA 4Z0TA 3GHYA 3H4VA 4JN6B 4UVHA 4AJIA 2Y93A 2X58A 4DLBA 1NVMB 1U1IA 3BMNB 2A9FA 1AN9A 4IMPA 1EZ4A 2EGHA 3CINA 3RFXA 4NJMB 1I8TA 1ZXBA 1VSVA 3GDOA 4L8VA 1E7RA 1IHXA 2Q1SA 1N92A 4CV0A 4YAJA 2JFHA 3GT0A 4XX0A 4Q3BA 3DAGA 4QECA 4IGFA 2HJSA 1OFGA 2D59A 2X86A 4JBHA 3Q3CA 3VH2A 3W4JA 1K5HA 4LCEA 1FJHA 1I3MA 1B2LA 1PQWA 3AUTA 4MIOA 5IG2A 2WYUA 3S2FA 1XDWA 4Y9DA 3HUDA 1N2SA 4GGPA 3UH1A 1PL6A 4EITA 2NV6A 2UUPA 2VNAA 4CLRA 1NTOA 1UAYA 2FRDA 1LDNA 4LVUA 2DBZA 3GNTA 1GUFA 3HB5X 4I5FA 3FBTA 3WSVA 1WW8A 4HWKA 2DBQA 1RM4A 3GR6A 4BNLA 2I76A 3CUKA 3V2HA 4BNUA 1WZEA 3ENNA 1OAAA 2BI7A 5FEUA 4MVJF 2I67A 1CYDA 1LRJA 2AXQA 3EVNA 1A71A 1ZJZA 2GN9A 3D4NA 3PZRA 2I66A 4YQZA 2FPIA 4XIYA 5G4KA 1B7GO 3GDGA 5TIIA 1N1EA 1WNTA 4PRKA 2TMGA 4YWJA 1HZZA 3DHEA 4XQCA 3PP8A 2Q49A 4A5OA 1GTMA 5BQFA 3I83A 3JD4A 2NVUA 1KETA 1NAIA 2FWMX 3D0OA 1DFHA 4QX6A 1WPQA 4W7HA 1C1DA 3RIHA 1P1IA 3TFQA 3VZPA 4MVJI 2YZ7A 4YR9A 2BKAA 4PIVA 3WLFA 5KTKA 2B37A 2AEJA 2V6MA 1PGNA 4Z3KA 1E6UA 1PJSA 3H2ZA 4TWRA 3W1VA 2NTNA 5KVVA 1VSUA 2B4RO 1Z73A 4PVDA 1YRLA 1T1RA 2BMAA 1HETA 4O63O 3G49A 4NBRA 4RO0A 1E1KA 3D64A 5FWNA 2DQ4A 4M49A 4TROA 4FB5A 3WGQA 4CLOA 1I3NA 1HSZA 5IDYA 3OBBA 5A9SA 1UZMA 4BMSA 4RF5A 2BFMA 4B3HA 1E1MA 1VC2A 1JW9B 4XDZA 1P1RA 3DHNA 2HMVA 2DC1A 2H5LA 1PJLA 4ROSA 3OA2A 1NAHA 4R5MA 3PVZA 2VZ9A 4NK4A 1ZK1A 1T2FA 1HXHA 1IHYA 2C2XA 2CD9A 2XXJA 1NP3A 1NWCA 3ZU5A 4ZU3A 1AE1A 3Q11A 1YL6A 4RDHA 3UKOA 3HN7A 1A4IA 2X23A 4FGSA 2DUUA 3H2SA 1BDMA 4DIFA 4FR5A 3HDYA 2HU2A 3A4VA 3WDSA 3ST7A 2V6GA 3F46A 1C0KA 1PWZA 4NQZA 3F1LA 2RHCA 2YQ4A 3ZWOA 4IDEA 4UUMA 4OL9A 5JMPA 4IMRA 3ONDA 4N5MA 4OXNA 3OJ0A 2IZ1A 1ZMOA 2R00A 2UUOA 3DBRA 3KLMX 1HE4A 2EP5A 4MKZA 5F21A 5KIAA 2OZPA 2BI8A 2ZCUA 4ZQFA 2DT5A 3WBBA 5JO0A 1DC4A 3OIGA 4ZICA 4GMGA 5EQDA 2BRUA 1U7HA 2I5PO 3DZKA 5CG2A 2RIRA 1KOLA 1X1EA 3GG2A 2EF1A 4CLHA 2I65A 3PI7A 4B79A 2X5KO 3DZFA 5U1PA 5BSGA 4DBZA 1I2BA 3U4HA 4FSHA 2HCTA 1TEHA 4JXKA 2ZQZA 3LC7O 2NQTA 3BZUA 2J6IA 4PZCA 4JCOA 2J3HA 4EJ0A 1EVJA 5B4UA 1P31A 4LN1A 3K5PA 4Y67A 5T6BA 2OBNA 2O7SA 4N7RA 2I3AA 3MCVA 4OGWA 3ZGYA 4AG3A 3VDRA 2Y0CA 1N5DA 4J9VA 2D1YA 1MGOA 4YVFA 4CQLA 1K6IA 3JD1A 3FNEA 3ULKA 4FBGA 4IQ0A 5BR7A 2FHSA 2B5WA 3L4BC 4ESOA 4R3WA 2E48A 1DHTA 4BO8A 4TMFA 4CM4A 1VL0A 4ZRMA 3GFBA 3PFWO 1YQDA 3IUSA 1QMGA 1BMDA 1YWGO 1HEUA 2X5OA 1ZSYA 2Z95A 3U62A 2P9EA 4AJLA 3ZV5A 4CM5A 3U4CA 4L9RA 1LSSA 3V2GA 1W0CA 3DL2A 1HDGO 3DHYA 2D8AA 3AI3A 4DQXA 2AQHA 4G2NA 4ITUA 4PZDA 4A27A 2VNSA 1B8UA 4CM9A 2VUSA 1NASA 3RBXA 3F3SA 3WQQA 4IJUA 3IP1A 1Q1NA 4BV9A 3LT1A 3F5QA 3NDJA 3HNPA 4L0QA 5EESA 4Q3CA 4FJ0A 5T8KC 2DTDA 2Y0EA 4YT4A 2GN4A 3UICA 3NDRA 5C5IA 4JNKA 4L4XA 4TRMA 5FYDA 1SPXA 1Q7CA 3VVCA 3FNHA 2PGLA 3S55A 4Y6PA 3L6DA 4EW6A 1F12A 4I08A 1J0XO 5LDHA 3KEQA 5L51A 1H2HA 2O23A 3U0BA 4RF2A 3T4XA 3DMYA 5GZ3A 5AQ1A 4ND1A 4DC0A 1YKFA 4IDGA 2JD0A 3LDHA 5COAA 4CV3A 4P38A 4BO3A 2VWQA 1B0AA 3JQEA 4R69A 4BNMA 4C7KA 4ID9A 1M6HA 2IRWA 3FWZA 4P22A 3GRPA 1SOWA 3BAZA 3MOGA 1I30A 5L4LA 5CDTA 4YJGA 3ASUA 1PTJA 2EERA 4J4BA 4DWVA 4FD3A 3COSA 2HK9A 2OUIA 1LQUA 4CMEA 5L95A 5JYDA 3PDJA 5A9TA 1TT7A 3JSAA 4E31A 4GAEA 1UP4A 4IPTA 4PLCA 4BNKA 4XYBA 1DXYA 3AUUA 1LBEA 1BDBA 3NUGA 3TN7A 2PK3A 4GX1A 1GYPA 3WMWA 4GX2A 3ZV4A 4E32A 5C3MA 5ADHA 5AOVA 4M55A 4JLWA 3ZU2A 3VKVA 1HWYA 1PU2A 3RUAA 5DBIA 1FDTA 3QWBA 1LSOA 2I6TA 3DZBA 4UEJA 3ZWVA 5CG1A 4NBUA 4RCVA 4F6LA 3SLGA 4LCJA 4I9NA 4W82A 4WLOA 2P68A 4BMNA 3GDFA 4IQ8A 3PHIA 2O3QA 1YDEA 3EW7A 4FFPA 2PZJA 3PPIA 4TSKA 2R6JA 4BNGA 3VZQA 3K31A 2W2KB 1WLYA 1LEHA 1Z6ZA 3L6EA 3CMCO 2JCVA 1B8VA 3BYZA 5DN9A 4CM6A 4BNVA 1D4FA 5KVCA 2IDZA 4R41A 1PZFA 4OKNA 1SOVA 5KKAA 2WSBA 4LRSB 1KVUA 4JJGA 4J9UE 2D2IA 1E1NA 1SEPA 1T26A 3O8QB 3VH3A 5IDXA 1ZK4A 4CMAA 4KDEA 3O4RA 4H16A 3IJPA 4E2WA 2X9NA 1GV1A 4XYGA 1DIHA 2P91A 1R12A 4MVJA 4XJSA 4Z9XA 3INGA 1K3TA 1Z74A 2HO5A 1VI2A 3KOUA 1CJCA 4U8GA 3ROPA 1M2WA 1Z7BA 1KVQA 4FW8A 2GZ3A 5C7OO 1PR9A 3WNVA 2DBRA 2PD6A 4Y8VA 3WLEA 1Y7TA 4ND2A 3SXPA 3WFJA 3WX0A 4HUJA 4O6VA 4R54A 3NEPX 3TSCA 3HDHA 3GZNA 4YA6A 3CZRA 5K0ZA 3WGYA 4AJ4A 5F1KA 1XGKA 1XU9A 3DOCA 4URFA 4WUVA 1H6AA 5I8WA 4IQGA 1A4UA 5DDIP 5EL0A 4CUKA 4BO7A 2O4CA 4A10A 3BTUA 1G6KA 4EBFA 3BMNA 3KEOA 4FFLA 4I1IA 2GZ2A 4I9UA 4TZTA 2GN6A 3KM0A 3WGGA 1V3TA 2JHFA 7ADHA 3TFOA 4NU5A 3QIVA 4J7UA 1E3SA 1YJQA 3ONEA 4NU6A 2GZ1A 3HQ4O 5AXDA 2WEKA 3VPFA 2V6BA 3PLNA 4Z6KA 3TZQA 3K2EA 5HS4A 1IB6A 3LC2O 3OEYA 1GFSA 5IFLA 1OBFO 2Z1NA 2ZIZA 4F6CA 1VM6A 3C7AA 1BRMA 1E3WB 2GERA 3WR5A 4U5QA 4LMPA 3H65A 5JAQA 1JAYA 2O4UX 3K73O 3EHEA 3RJ5A 4RPLA 1B3BA 3ZWCA 3ZNOA 1ADBA 3E8XA 1J6UA 2IZ0A 2WD8A 4CM3A 5CPBA 4AJHA 4CMJA 3GGPA 3WJ7A 3B6ZA 1Q2XA 2BF7A 2BH9A 4DQVA 3AI1A 2YJZA 3TQHA 4E3ZA 3RUHA 3D1LA 3RC2A 4J4TA 3GY0A 1YDWA 5TT0A 1U2GA 4PVCA 3OJFA 1P45A 3EYWA 4MVJD 3WB9A 1VKOA 3RKRA 5K6AC 2I9PA 2PY6A 2VWPA 4E5YA 3M1AA 4YT2A 1KBZA 4BO5A 4QFDA 3SBOA 3WGZA 2DPHA 1UDAA 1T1SA 4RPJA 1LDEA 3M2TA 4PLYA 2W90A 4RPKA 2O2YA 4U6SA 2W8ZA 1GADO 4L75A 3O38A 2CVQA 3CZMA 2DU8A 5CHEA 2NLOA 4RVUA 1DO8A 2FN7A 4NH4A 3ZWWA 5A5EA 4J1QA 3AJRA 2B0JA 3KETA 1I24A 1UJMA 4Y6SA 4JX8A 1DFIA 1FXSA 3H9JA 2YV1A 4DLAA 1W6UA 1HE2A 5KVQA 4CV2A 1GPDG 3TZHA 4OKIA 1C1XB 2I3GA 2H63A 3PWKA 3DFZA 4OXYA 5ITWA 1KVTA 4Q3EA 2XOXA 4BO1A 3AWDA 5C7IO 1PZEA 2NTJA 2NU7A 3FD8A 5TC4A 2ZJ0A 2DBVO 2ZYGA 3EZLA 5TQVA 5FI5A 3V1UA 4D41A 4E6PA 5EINA 3JQAA 1HYHA 4KOAA 4BQPA 3X2EA 1I2CA 5G0TA 3AY3A 1DAOA 3Q9UA 5G2OA 1K6XA 2DLDA 1KYQA 1XEAA 1LRKA 3GNQA 3KYCB 1KY5A 1HE5A 1BVUA 1P0FA 4OAQA 4YAEA 3T7EA 1ADCA 2O48X 5JPIA 4GH5A 4II3A 5IN5A 1JKFA 2SCUA 2CZCA 1M66A 1GYRA 4CR8A 3DBHA 3IC5A 4N54A 1A9YA 2ZYAA 4E12A 4R1NA 3S2GA 3ANMA 5CEJA 3TOZA 2C29D 5IDQA 3OH8A 2PGDA 1ZMTA 9LDTA 4YAIA 3OICA 4RVDA 3I3OA 4C4OA 3FF4A 1CQJA 2RBEA 5DCUA 1F17A 2ZCVA 2YFQA 3D4OA 3JQFC 1XCBA 3PTZA 3IKVA 3GRKA 4DQUA 1GU7A 3QV1A 4HX5A 5DBFA 4DYVA 5MDHA 3S2IA 5G4LA 4GKBA 2GRAA 3H9EO 5U4QA 1LLCA 5IJZA 2RH8A 4Z0PA 3NTRA 4RVSA 1P1FA 5L4SA 4ND4A 4QEDA 2B35A 3GEGA 3RBZA 2AE1A 2WYWA 3DTYA 1X7HA 2GLXA 4R68A 1PGQA 3SJ7A 4YEDA 3QY9A 3SLKA 2JL1A 1XKQA 3NTOA 4NZ9A 5EJ2A 4WK6A 1DJQA 1R4MA 1ADGA 1QYDA 3IP3A 3WJAA 1DRWA 1D1TA 2VN8A 4P8RA 5BSHA 1KY4A 2VWHA 1YOVB 2VTEA 3QA9A 1E3LA 1SC6A 3F1KA 3KBOA 3ZWYA 5JW6A 3TL3A 3FSRA 5JC1A 3H7AA 2IYOA 4E2ZA 1PZHA 2NSDA 1DC3A 4N18A 1T2CA 3CPSA 1PJ2A 3DZGA 2AQ8A 4QSMA 1MFPA 3QJ5A 4XR4A 1KVRA 3JQAD 1BW9A 3AM3A
chains in the Genus database with same CATH superfamily
7AT1A 1UZAA 5F1YA 3OI7A 4HYEA 3AF5A 3BGSA 3KB2A 4Y9SA 2PXAA 1U0GA 1KE1A 2J8ZA 1Y3HA 2AKYA 3BMQA 4O4IA 4RCYA 1GAQA 3QBTA 4CQMB 2O8CA 3ZJVA 2D4HA 2X40A 3EC7A 4BTEA 1SIWA 3C7DB 1JMVA 2F9LA 4HR7A 4KZKA 4D8TA 5ISMA 1WXDA 3MXOA 2QZZA 3PQ5A 4B84A 4ETMA 5ICSA 2HDWA 5HMMA 1G2QA 2XDQB 5A9RA 2D2FA 1RKXA 5K1ZA 4KVZA 1EM8A 2NU9B 4JR2A 4GQBA 4J6FA 1H4SA 1AXGA 4P4SB 2RC6A 3IAM6 3RSLA 3F7TA 4HNTA 4H7JA 2O19A 3VHRA 2Y1LA 2FDRA 2UZAA 1ONOA 1B1AA 5IFKA 1KYWA 4UU7A 5TNXA 4DNQA 2QROA 3DBVO 2H51A 2X8WA 3F6YA 2NZJA 3P9CA 2JGMA 3DLCA 4I1OA 4MHOA 4KQMA 3THSA 3E1GA 1TYAE 3F73A 3K1JA 3W3AA 4FGWA 4A91A 5FTWA 3CUVA 3RWBA 3VZBA 2X0JA 2AG0A 4TLEA 1RYEA 3R0ZA 3WXBA 2B82A 1IJKA 1JKXA 1L3CA 1P81A 4Q1EA 4RMGA 4BQEA 4C76A 1OZHA 1I6WA 4K88A 3L5KA 1AO0A 3WNDA 1A9OA 1NMXA 1P3DA 4QUBA 1A96A 5CJ2A 3VKWA 4ZI7A 1Z6XA 2PYIA 5TPZA 4F72A 1QIMA 3QXJA 4IIUA 1BXGA 1YB7A 2A92A 1R9GA 1CJMA 3C3BA 4PQYA 3S7ZA 1G8HA 4AWBA 2F62A 5LU8A 3FKSD 3LVRE 3VR5D 2AF4C 2OHXA 2XITA 4MVJG 2XRFA 3AOGA 1BRTA 1HRKA 3RRBA 1FUIA 2O54A 4TXNA 1DO0A 1G20E 3IALA 3QZUA 1GUYA 4GKVA 1V4VA 4MJLA 3E3AA 5BVGB 2ZQYA 1EWQA 1H1TA 1TL7C 1QQTA 1R6VA 4NEGA 2YJGA 3R77A 4G25A 1VKZA 2B1GA 2FN9A 3DFIA 4HB3A 4OG2A 1QQ5A 3L8CA 3A6FA 2R11A 4PYIA 4BNDA 1P77A 2PRKA 1IZ0A 1LVHA 1G8AA 4R9RA 2C9DA 2VF8A 3FN4A 3LQRA 1MAAA 1QX3A 3OP1A 1CUYA 2B5OA 4KE6A 1KEEA 3TW0A 4DMHA 3VR4D 4KMSA 3OLQA 1XTUA 3PNMA 3OTOB 3RG8A 3SBDA 2NX2A 3V7NA 2NMVA 2CLSA 4N7MA 1CY8A 4H1UA 4R2JA 4C7MA 1DKUA 2IY9A 3P2EA 4QDJA 1W9HA 3R5SA 1I3LA 1M1XB 4BKMA 4YTEA 1CPYA 2J09A 4XD7A 3QW2A 5AQEA 1LNQA 4PYOA 4DIMA 1P1KA 4FYJA 2FUG6 4HB4A 1XZCA 4WASA 3QK7A 5BN5B 4C78A 1EFRA 3AYZB 2XOEA 3WK4A 1Z0DA 2W2PA 4KDFA 4FUQA 5JCZA 3OPYI 2J3DA 2VYND 4Q1DA 2Z8ZA 5T5QA 1PFYA 3RTCA 2P6PA 1K8YB 3NEJA 4M9ZA 4YUYA 2NXEA 2ZIXB 2C58A 3GLHB 3NV9A 4GYYA 5IH7A 4DUZB 2PLRA 1WUHS 2ZB8A 4F71A 1LC3A 3IEKA 4AJOA 1IXKA 3U39A 5KYWB 1HDRA 3CNEA 1HYBA 3KJXA 3LUDA 3IP8A 2JI9A 4GPD1 4Q03A 3E61A 4AAYA 1A1VA 5DTQA 4KN6A 4YJDA 5E7QA 5K3SA 3H87A 3AIKA 3QNUA 1XVIA 1OXTA 1HDCA 1I4WA 1Y3DE 4KB5A 4KR2A 3Q40A 1A95A 2ZAOA 1D8AA 1EA7A 2I2WA 2NZXA 4WKOA 4E5PA 1ZRHA 2GCEA 3NGLA 4RVNA 2R5FA 3HDTA 2ARKA 5EHXA 4WCFC 4Q1AA 2HZ7A 3KLPX 2PQMA 1JKJA 4JBYA 1VJRA 2K4MA 2HPHA 4RA9A 2IBTA 5I4CA 2HSWA 3EOZA 1MNAA 4B6QA 1HSOA 4IDAA 3EMKA 4HLQB 1OFIA 1OZAA 1DIBA 1P2FA 4EYKA 2H1VA 1QPBA 5FL7A 2QS9A 5TGDA 2QG4A 2YHAA 4B73A 4EAAA 1B41A 1A5SB 2I4OA 3G9XA 1GNLA 4BIIA 5I7RA 4OEHA 1O2DA 4FHZA 3L9WA 5IZCC 5ALIA 2F64A 3MTJA 1N0VC 1T9AA 4CM1A 1V3QE 4DWJA 3GJ7A 3IULA 4ZT3A 3P2IA 1QGYA 3ZGZA 2JF0A 2YV2A 4A3SA 2NO9A 5KOHB 3HU3A 3QHAA 4LZLA 5GM1A 1U0NA 4F21A 3FWKA 3ZHQA 3TINA 3W2HA 2B1JA 2GJSA 3VBEA 1RKVA 3A9WA 4DCVA 4MVJP 2KJQA 3IOBA 2BCGY 4EKGA 4HDRB 1Z6QA 1OIWA 3A1SA 3DQPA 1M7BA 4WN9A 1GSAA 1P44A 2XQJA 4R83A 4K9DA 2EEZA 5I9IA 4D9NA 1VL6A 1GNRA 2BIFA 1OFVA 1IBKB 4LDJA 5KPDA 2QX4A 3INRA 2EW8A 5FOQA 5JS8A 4Q9DA 1P33A 2BM9A 1V25A 1L4LA 1S6YA 2P3SA 2R751 2QW1A 1HT0A 4OFXA 4XGNA 4DBVO 1MXHA 4OSOA 5DHFA 1MN6A 3NCHA 1WKBA 1CHNA 1XPOA 2HADA 3AP1A 1TADA 4FEAA 1DPGA 2D54A 4KH0A 4MS4B 3ITNA 1QVZA 1QR2A 1VLVA 4BMYA 2WAYA 3N58A 2CL7X 4GUAA 4F4DA 1F6WA 1Q3HA 2AS0A 1S2IA 1YZKA 2P9ZA 3FLEA 3G1UA 3WGHA 1COWA 1B6GA 1EWRA 5F5XA 4L08A 3N8HA 3OZDA 2WV7A 5JNSA 1AIPA 1JFLA 4KDRA 5IT5A 3A1TA 3EH2A 2GPNA 1DWOA 4RLSA 2NYUA 1C0LA 4MI6A 4AVYA 2QE7D 3MTEA 5KJ1A 3JR7A 4S1PA 1NE2A 1TX4B 1UBCA 2N47A 4RORA 1KQ3A 6GPBA 5HUJA 3K8ZA 5L9AA 4AXXA 2XCTB 2XB2A 2X3FA 1ZSVA 2C03A 2D2EA 4IHJA 5CK4A 4OQ4A 1U1DA 3OFVA 3WB0A 1LK7A 2I1QA 3ZQ6A 4WSOA 1G9XA 3IDZA 5BSRA 4OSEA 4UOQA 2JFVA 3S1SA 1F2TB 1OPXA 3E9NA 4RV5A 4DTIA 4L4SA 1TCUA 3L4JA 3ZIDA 1USGA 1L8OA 4C06A 4TN5A 4V24A 1LV8A 3EGXB 5A6SA 2NUPB 3L7CA 4L02A 4QO7A 2WM8A 4XSVA 3K35A 1J7JA 1WMFA 1XOIA 2QYOA 4BV2A 3AKYA 5CVEA 3TL6A 1CUAA 1M2EA 2JHCA 3DCIA 2ZB3A 2UV8A 2YHIB 3DJYA 4FZ5A 4C30A 2AJBA 3WGTA 4W63A 4CIWA 4AY2A 1EDDA 4MW4A 5KTTA 3NYQA 4HL6A 4DANA 3HE3A 1YA6A 4ZN6A 1M72A 4LFBB 4QQKA 1M34E 1PJQA 5IAAA 4BO6A 3IBTA 3MTAA 3LXMA 3ZWPA 3ZVMA 2CK3A 2CLKB 2YV3A 1L0BA 4K26A 5E0KB 1E0DA 3AJ9A 1JVNA 3Q7IA 4QUIA 3ESBA 5JDCA 1GRQA 4RZUA 4V0ME 4N3BA 1QF6A 4TGLA 1EKXA 4NNOA 2QTHA 1JR6A 1Q50A 2QR3A 4D1YA 4EFMA 4MVWA 1GAEO 2I6SA 2ISCA 1O0BA 2G36A 2C3PA 4LYHA 4YCAA 1P8AA 5JJIA 3VSBA 3F3MA 1GFIA 2FGJA 3C3KA 3FDZA 4NCNA 3P0EA 2J0VA 3C6ZA 3H8VA 5I7WA 4JWKA 4UBKA 1CQZA 1O6FA 1Z5GA 2EBFX 3FYSA 3DVLA 4TKLA 3E5MA 3QVLA 3O9ZA 3RVSA 5FLKA 5JH7A 1W7AA 2CXXA 2FQQA 3DBOB 1NG9A 3R9XB 1GUAA 4FR0A 4PQGA 2C2WA 3K8OE 5DGHA 1I5EA 4XUDA 5D2CA 3TKAA 2EHDA 2G67A 5TF0A 1H6DA 3P5BA 4BX3A 3V3KA 3AZQA 3WLAA 5MGBA 1UXKA 1IZ9A 1NI3A 3SK0A 1PGJA 2FFRA 3H1AA 4MGHA 1SQFA 4Y1FA 3WTBA 1QHSA 4D4JA 5JT1A 2VT6A 1KJQA 3PDCA 4MS3A 1K8RA 2HDOA 4HNAB 4WY5A 1LK5A 3NOQA 3ETEA 4JLMA 1YGYA 5F1PA 3E22A 1YJBA 3MWFA 4YI3A 1R4AA 4XUEA 4XGRA 3WY9A 2BKXA 5EFOA 4RMIA 3PD7A 3RI3A 4CFSA 4J2TA 3LPNA 3P9IA 3BMCB 1D6JA 4TTSA 1K4MA 4HY3A 4TYQA 1ZD2P 2I2CA 3ORHA 3B20A 4G4IA 3OEEA 5L6MB 1WDTA 4B3RB 2IYEA 3BG5A 3HB7A 4DF3A 1SVLA 5JVDB 2C9MA 1AKWA 4IX9A 1T4GA 1L8QA 3AG5A 3EVBA 2Z2JA 3G5TA 3MINB 2JGJA 4L5YA 1JEOA 1GD1O 3C8DA 1IUOA 4GP9A 2JS7A 1RP7A 1YZFA 1UMDA 3TBKA 3G9TA 1NOIA 1RHRA 1JE1A 1JFRA 1SVWA 4N5DA 2F4VB 2BMEA 1FRNA 2J3LA 3NKLA 4QGSA 1QS0B 1VA5A 3X44A 3HBAA 3PXGA 4RK6A 8LDHA 1P7WA 4EI8A 3KLOA 1GL3A 3RVNA 1JG7A 4GEGA 3I04M 5AXAA 2YWXA 4MP8A 3F5MA 1WNFA 3O2SB 1G8MA 1QH9A 4RETA 1NBHA 1I0LA 3OF3A 2A5JA 4G9GA 1HFWA 5TVKA 2HJVA 2GPSA 4TTTS 4K81B 5TGTA 1NQUA 4NOLA 4BNIA 4FKZA 3VNUA 4P2BA 3X1YA 4KFSA 1JYSA 4X8OA 3KYJB 2AKEA 4NONA 5SV2A 1CIJA 1CJKC 3T4EA 3V6MA 3ZCUA 1XJWA 1WBJB 4NARA 4FR2A 4BATA 4KXUA 3PR2B 1ATIA 5AVXA 4N03A 3EWNA 4JEHA 1ADJA 5FA5A 2ONZA 2JJYA 3J81k 4OQMA 3W7BA 3AVXA 3NW9A 4RJ2A 1M2VB 3E8MA 2FOXA 2G5CA 2IEBA 2C2MA 1H1DA 2O0KA 3ODGA 2WJ4A 5BT9A 4C21A 3ZHCA 3BXZA 3GNSA 3WGJA 1QRSA 1T5TA 1MU0A 3ICOA 2DQKA 3E9YA 3PTAA 1LDYA 3IQFA 2FPPB 4KP7A 1AQNA 4MKFA 5AVJA 3O31A 1SIOA 3T0GA 1KYXA 1MA0A 4EEZA 2WF9A 4RYDA 2P2YA 4X95A 3GFSA 3LYHA 4CVNA 1WXGA 4MLCA 4FSXA 5I8ZA 1SOUA 1EAMA 4ZEMA 4DR6B 1DEKA 3C3MA 4LBYA 4IAOA 2JD2A 4YCSA 2H4HA 5DXJA 1MOQA 2PMWB 2RBKA 1NXQA 3MJCA 1CUDA 1Y6ZA 2XAAA 1NNUA 1HL7A 4ZDKA 2XCOA 1UZNA 1MO4A 5TT1A 3J7AC 1VP9A 4JNCA 3UHFA 4MPPA 1QNLA 4D3YA 4ER6A 1YDGA 5EC8A 4A9AA 1LGYA 2HWWA 1LLUA 4EK9A 2XQIA 1PFGA 1QC5B 2QP3A 5EEHA 3AUFA 5GY7A 5HEKA 3Q0IA 5HE8A 1EVQA 3AQIA 3OLWA 2OLEA 1Q0SA 4NBSA 3UUGA 1JFSA 3H11A 1IWOA 4U7JA 5A7HA 2AX3A 4LGVA 4MSUA 2NADA 4F92B 2B4QA 5JVDF 2XKAA 4A15A 3S2EA 4M7PA 4BRWA 2YL2A 4P4SA 4M9XA 5E4TA 1NFQA 2RAUA 2Q1WA 2NQ8A 3UK0A 2FWNA 4L5AA 1CEXA 5KYVA 2FV8A 2DPXA 2NZ2A 3GJZA 3L41A 4JSTA 3VYRB 1PJCA 3NBQA 4R4JA 5AR1A 4CR6A 3R1IA 2Q41A 5T7BA 10MHA 5I48A 1ZGHA 4XIJA 5B6PA 3KALA 4GM0A 3DWEX 1RPTA 2ES4A 1ES9A 5DTIA 1K8QA 2XGMA 4Q66C 3T5GA 3CRNA 2AFIB 4BE4A 4QUHA 5I9TA 5BRNA 2JIRA 2M2IA 2WIDA 2WDZA 3AFNA 1YRYE 2YDYA 4EENA 4IW3B 1ABBA 4MB2A 4EHIA 3K0EA 2ZI4A 1H2ZA 2AQIA 2IXDA 2V9PA 4UZSA 1OXXK 3HCPA 2XVXA 3NTQA 5C3UA 3AM5A 1EK5A 1KHTA 5AW9A 2ZT8A 4Z4CA 1T9KA 4RXTA 3LVBA 4UHBA 4AF8A 1URPA 3JQFA 5B30A 2QJTA 4N1AA 4MWTA 2WIKA 4IGEA 2Q4EA 5BUCA 4F5YA 3T7SA 1ENYA 1SC9A 1JJFA 1GAWA 2IXAA 2XEDA 3A9UA 4NPCA 3UK7A 1XL1A 4HI0E 4IG4A 3RRFA 3NLLA 1LZKA 3IOYA 5ALTA 4O2AA 2EFDB 3KJQA 3W04A 2WQZA 3D5EA 3FPJA 1U2PA 1U9IC 1JIIA 2G0TA 3Q3VA 2KLHA 4QUEA 4QQRA 1CX9B 4EZEA 4UHEA 1D5CA 2FZVA 5AM1A 3NP9A 3WLLA 4MRSA 2GXQA 1YC5A 1IAVA 1WSAA 2X6TA 3DEFA 2R8PA 3NGXA 3U17A 1DFGA 1JECA 3K09C 1CYEA 2HLDD 1LA2A 1PR4A 4BFUA 2UYHA 3M9LA 4CUJA 1U11A 3MJ4A 4ZYZA 1CULC 3RT7A 2FPKA 2J41A 5HW0A 5EFZA 3JYLA 1OZFA 5AM0A 3SM3A 3T9AA 4YRSA 5K3EA 2DKOA 1PKXA 1TM3E 1VL8A 2G28A 3I52A 3OSUA 5D3QA 1PJAA 3LQYA 4I4TB 5ANRB 1A3CA 4BNYA 1HT2E 2VF7A 1C7FA 3LK7A 1RWNA 4LVOA 1A72A 4UCQA 1U1FA 4YCJA 5DFAA 1FTNA 4A2CA 5B5SA 3TW4A 1BXKA 3B13B 3PQ7A 4K3UA 4BS9A 3H2IA 1N3LA 5H4HA 5CB4B 1PQPA 1ZICA 3JALB 4UDOA 5AWFC 1W4LA 3SJAA 2VTBA 4AQYB 2IS6A 2IYRA 4PPGA 1I32A 3UOGA 4Q39A 2Y9PB 2QBYA 1XTZA 2ZM5A 4F12A 1YIAA 4LRYA 2VCYA 3FBWA 3V1YA 4YV2A 4JXXA 5DHQA 4LG1A 5P8WA 5CLHA 1OMOA 1O6BA 1G55A 2HD4A 2X3UA 3P8ZA 1H5QA 3QUQA 4MV8A 4DIBA 4X8LA 5C8YB 5JS1A 1QGDA 4BUZA 1PR3A 2F43B 2ZIXA 3G7SA 3MB5A 3OMLA 5I4KA 5HRUA 4AS1A 1IY8A 1J33A 1ORWA 5EVJA 3TLAA 3FWPA 1O9GA 5KX5B 1GZVA 3D3JA 3R6WA 5KYWA 1FX1A 1MTZA 1VB5A 4PRYA 4KHZA 5CLLA 4OYLA 3FCXA 4KGXA 3LFHA 3BAFA 3EUWA 4MPDA 3M6MD 1TA0A 2G5PA 2VHVA 3K30A 2O1SA 2JJ2D 2N46A 2Q2VA 1RAHA 3KVOA 3PX3A 4RE6A 3EJ6A 4WBSA 3S5UA 2I4RA 3D3KA 4GI1A 2COUA 1CDEA 1XSEA 1IWBB 3PBKA 4WNYA 3KB8A 4RHEA 4UNIA 3KJGA 2PZMA 1II8A 4H3HB 1TOAA 4NZZA 4WCVA 4UMVA 4YY3B 1NBOA 3GGGA 1NIJA 1QGED 1U4OA 2FG7C 5EJAA 2HMUA 5E3HA 2EL7A 3GEPA 1ZK2A 1JHYA 1CUXA 1ZUIA 3COWA 4Q3DA 4XR9A 2VSXA 3FTPA 5AJVB 1Z6TA 1DDIA 2GSDA 1KWGA 2P8SA 1JKMA 1DBSA 1GTZA 1VL2A 1CRWG 2IC5A 3HCFA 1C3EA 5E6SA 3FY4A 4AURA 2J32A 1N3BA 3EEQA 2JCBA 3MGBA 4Q4LA 4TRRA 1JDSA 4BAGA 1DC6A 1WU8A 5JCOC 3OTQA 4NG5A 2C84A 3PQCA 3GEEA 1J5PA 4F5WA 4RQTA 3FMPB 4XCXA 4N0PA 4E2XA 3T1TA 1ZI6A 2QQ5A 5IHPA 3E18A 4XLTA 1Q0TA 1C50A 2R8EA 4G01B 5F77A 4ZGWA 4H6XA 2B9EA 4Z9FA 1VMEA 3JPWA 1J49A 4TYMA 4X3OA 1E2KA 1U8FO 2XNDA 3GVIA 3DEYX 1IN6A 1B0ZA 1OBCA 2QRMA 3QUBA 4JJ4A 1GTRA 4HGZA 5ALSA 4RM2A 3DE0X 4CUZA 3IMCA 3DOUA 5G0WA 4K5QA 3AEQA 1GZDA 3MRVA 1QP8A 1NY6A 3U4MA 1B6RA 1Y9AA 4HDRA 4I4TF 1XCPA 4YJ2B 1P1BA 3EFOA 1SGWA 1HTBA 1O94D 2VJAA 3HCCA 3VR6A 1KZ9A 4BNNA 4CEIB 1FYFA 1DAMA 5DNCA 1KFEB 1WKVA 4B46A 1SPBS 4IR7A 1BWQA 3VYUB 3O8DA 2UVQA 2PMEA 4Q4AB 1XVUA 4URXR 3O1IC 3PYLA 5CB4F 1V3VA 5LWQA 2Z5FA 4EPRA 3WRVA 4EDHA 5ALMA 2Q4TA 1HY3A 3QBEA 3ETCA 4AKIA 1SUCA 4ZRDA 3TSOA 1P0CA 2DPLA 1PD1A 2WKQA 5CXSA 1VGVA 2UYGA 2CDCA 3WIDA 3PJDA 4XCVA 3U44B 1Q0UA 5YASA 3QVXA 3GRZA 4QGBA 3OFSA 4R0VA 5C8YF 3UPTA 1Z5UA 1JL3A 1VKNA 2Y05A 2OOSA 4DZZA 1FNMA 1EK6A 3VPSA 2Q4OA 3WC4A 3ZE8A 5I5GA 3UATA 3OZXA 4R1UA 3LDAA 5KX5F 2IEDA 4G81A 4BKOA 1JSLA 2OXCA 1MX9A 2O8EB 4BB0A 3TRIA 1IDN1 3FCYA 4E2YA 1F4VA 1XLUA 2MU1A 3IMGA 3IPXA 4K2AA 4QUKA 4YRAA 3BWVA 3IMEA 3CVWA 3K6JA 5E38A 2DUJA 2PX6A 1KI7A 3PXEA 3GIDA 5JWHA 4OQDA 1NF9A 1XAHA 1U9CA 2CN1A 3GMTA 2JLBA 5EIFA 1ZOOA 2G9ZA 4IDBA 3L6UA 1GGVA 5EWLB 2C3YA 2CEAA 2H1RA 1F2DA 2FP4B 1MJFA 1DQSA 4WZAB 3NT2A 4AG5A 5JAPA 1GN9A 2Q8QA 2IEIA 4M60A 4OUKX 4UULA 4AK9A 2ECQA 1E6MA 1M7GA 1LFDB 3ZI4A 4CQJA 1QYWA 4RZHA 3W5SA 1ZW1A 6REQA 2CLFB 2DUNA 4EKIA 1QOZA 4AO8A 4H08A 4ZPXA 3OP4A 1TEVA 2JI8A 3DT9A 4J7XA 3ML1A 1XMSA 3C45A 4WT7A 3ZPXA 2UKDA 4NZOA 1PWXA 1MO5A 5HKKD 1FVXA 5K8VA 2GX6A 2IYYA 4MV5A 3C7CB 3MZ0A 4P80A 3F6EX 3EVAA 5E4JA 3FOFC 1P60A 5LIRA 1Y3AA 1LJLA 2H1WA 2QAJA 2Q27A 2O7VA 4L0CA 1NBMD 5FWXB 5KTPA 1VCNA 1FNDA 4NVRA 1RLUA 1UP7A 2F9FA 1UOEA 2VFAA 3DFUA 1Q1ZA 4YP9A 4LJ6A 4ENPA 1RBMA 1M75A 4YJ2F 4TM7A 1N2BA 4RL4A 2PLFA 4C7XA 4I1RA 3HV2A 5AUOB 2EJTA 2PVCA 5BN4A 1UKEA 3I01M 3ZQJA 1M1YB 1Y0BA 7GPBA 1GDHA 3KVNA 1ZNWA 5LUBA 2JFPA 4HGPA 4AY4A 5WRFA 2LPMA 2G71A 2NSYA 3FH0A 4RKWA 4R01A 5F3RA 1VXRA 4OFWA 5EJ6A 4XPIB 1K86A 3K1TA 1E94E 1SKQA 1NYTA 4S2UA 2ZJ3A 1DC5A 2R6CA 4P3PA 1VE5A 3CPHA 5IJXA 5KNLA 1N8TA 1J00A 5DYGA 2HMTA 3DYBA 5CLQA 4Q9JA 1J8VA 3EEYA 2HFKA 2HNBA 3RHSA 4QXAA 2BGWA 4PBRA 3G2KA 2IUSA 5AH0A 2NVBA 1P9LA 2DE0X 3VNRA 1M0WA 4QA9A 2DFTA 4KVFA 4Z2AA 2DQSA 1U0JA 1EJBA 1YZNA 2EVWX 3WS7A 3MQ2A 5JFTA 2AF3C 3RAJA 2RE8A 1UMCB 3QY0A 3HWX1 1MKYA 3BMCA 1S7CA 4XW2A 1EX6A 3Q3IA 1SG6A 4HDKB 2G9RA 3HFJA 1YB4A 1GCUA 3RYHB 2WNHA 1VHQA 3EY9A 4BB6A 5BNTA 2OWDA 5KU1A 3MINA 5K2OA 2O1EA 5F2KA 1G16A 4HKTA 4LC1A 1W52X 2IP1A 4E14A 2VL7A 4YP6A 1C8KA 4ER0A 1XNRB 3KUDA 3QWFA 4M89A 4RLQA 1CR6A 3WHKA 1NUUA 1RWWA 2AWOA 1Q0ZA 1G0OA 2CVOA 2IKQA 2FXVA 2QYTA 4FI3C 1QS0A 4FMDB 1JRLA 1ZM3A 2PN1A 3IAAA 3LCUA 3M70A 4HF7A 4ZV7A 2VT3A 4PHHA 1F06A 2YXNA 3HO6A 1XEFA 3W5JA 5HPYB 3FCOA 5HDQA 5C46F 1SHUX 2AB0A 3MF4A 3E2MA 1XRLA 2VZLA 4IKOA 1YFJA 2HPZA 2CVFA 2QN8A 2SKCA 3LPAA 2JZNA 2YQZA 2CHVA 1CE8B 1VB3A 1HF3A 3C3WA 3EBPA 4ZAXA 2BKEA 2GETA 3E82A 2CMKA 2EKPA 2ZYTX 5TQ2B 5AW4A 2F8TA 1FRFS 1GP2A 1SCDA 2Y8EA 5ALUA 3AKZA 3TUZC 1XZEA 3C5VA 4BKQA 1O89A 2OB1A 3PEYA 1EG7A 4UNQA 1PW5A 2DFVA 3TSAA 1PAUA 1MEEA 3MILA 2C59A 4PEVA 2XVMA 1C30A 3HJNA 2L42A 3H5AA 4Z53A 3Q3JB 4EUSA 4RZIA 4ENWA 2YX1A 3VZRA 2BGRA 5MN4A 2H2FA 3CUSA 3WDMA 4QD3A 1NUAA 2PSSA 4XM2A 4BY9E 2ZUSA 3OU2A 1Q84A 2Y1GA 1KP3A 1ILWA 1JJIA 1QIJA 3L9XA 2HYIC 1N2OA 2B0CA 4Y2TA 1OE0A 2FPPA 2GM9A 4Z7JA 2YIJA 1MGPA 1QZTA 4ECAA 3U40A 4BFYA 3B82A 6YASA 3KLBA 1GL7A 1QHNA 3TS1A 1KR2A 2W6ID 2V45A 4BMXA 3IMFA 2GEVA 3KTDA 4QT0A 5AHKA 4GXRA 4Z9BA 4NECA 4CT0A 2Y92A 3VFDA 3BGVA 1L5SA 1BHJA 2PL3A 1W87A 5EZYF 4JGGA 3RHTA 4CTMA 3OIUA 1M5RA 2PUAA 3HBFA 1SBIA 3RC9A 3VVMA 2VUTA 1WUTA 3FUCA 5JWRA 3I2FA 2XF8A 3EGCA 4HMOA 1E2JA 1LF5A 4HWRA 4V0NA 1Y9DA 2ECKA 2IOQA 3KQWA 3OZCA 3I0MA 2R1VB 3NYIA 3Q4GA 4EUHA 5FPYA 1AQLA 3S70A 2AN1A 4B35A 1IJEA 3BEDA 1W36D 5CP8A 1Q2UA 4V02A 1Z15A 1TMYA 4OHWA 1GEGA 4FOOA 4ZJPA 3G0CA 1PYGA 1JDJA 1A0OA 1QUEA 3CVOA 3LCRA 3VX4A 3HR8A 2ZETA 4UUQA 3TKYA 4P31A 5AK3A 4ZJYA 3AVYA 3DDOA 4NY1A 1ISIA 2QG6A 4OHYA 4HX9A 4AP5A 4C4YA 1G2IA 1EBUA 3JTMA 13PKA 1H0KA 2FOIA 5JJBA 3RYIB 4MWEA 4QRIA 2AFIA 5SY9A 1XZBA 1CR4A 2YQ5A 1Z6GA 3DBHB 4K46A 5LCXA 1WMDA 4GMHA 4PM4A 5CFZA 4RTOA 5K03A 4RK4A 5CDGA 4IQ4A 1IUPA 2P3QA 3K2BA 3EE6A 3EISA 5IASA 2AR7A 1P7PA 1XFAA 1MOPA 2XCLA 4C0KA 1I51A 4IDFA 3LUGA 1P4SA 3IXLA 4MX8A 4ECEA 1I5OA 1XN4A 1W6RA 3LSYA 3HZOA 4DDWA 2XUIA 1XEWY 3A14A 1W0JD 3DFKA 3CO5A 3GMIA 5FNVA 1G7SA 1Y81A 3EUAA 4ONEA 7REQB 1RRPA 3T1YB 4IY1A 1THZA 5ELMA 5EE3A 1YR6A 3G1TA 2MSNA 1R00A 3CH6A 3LPMA 5A7FA 3GWGA 5B57C 5E3JA 1H22A 3UENA 1DAPA 1NQVA 1SO8A 5IZ4A 4MICA 3AEYA 1LBHA 2BY4A 5FXMA 4YRLA 2QXTA 2IKSA 2QN3A 3DBIA 5D00A 3U3DA 5EJEA 4MYCA 3ABZA 3CY6A 3RB8A 4CWAA 2QTVB 1E8DA 3EOBI 2HN9A 2VUIB 5HRCA 1GAXA 5LQCA 4PG7A 4ALKA 1R4MB 2L17A 3WLJA 4IRUB 3TJRA 2AA3A 4BP8A 1G1AA 2I4IA 3HLYA 3GA0A 2OOKA 1YV9A 3G8BA 1KU6A 5LXTB 5BNFA 3GAFA 1PEKE 3V8EA 4BNHA 2CL5A 1GHTA 1TE2A 5L3SA 4ZO6A 3ZD6A 2NPOA 4H3KB 4KN9S 2ZWIA 1L6IA 1MB2A 1YK0A 2XY4A 1S9HA 3OG9A 4Q24A 4Y30A 3GU3A 3JQ6A 3LCVB 2ZIVB 4YXWA 3WICA 1NI5A 4CIXA 5JHGB 3GEMA 4URHA 3ON5A 5A05A 4LF8B 1EINA 2X0NA 3ZLTA 3ZU3A 2PHZA 5AVSA 3QEMB 3FCCA 3GLQA 4Z4FA 1HMPA 3HZRA 3JALA 3OMWA 2BGIA 1BW9B 1Y8RB 4CG2A 4NPHA 4TRNA 2G5TA 5ED4A 2VT2A 2ZRLA 3HP1A 1CUEA 1LF0A 5DGDA 1SBHA 1RR6A 4IDQA 4QUAA 1ZC4A 2OHVA 1IATA 3CKYA 3Q0EA 4YRZA 2W6NA 2IW3A 2PVSA 3N8IA 2WFZA 1N2CB 2F43A 4M6WA 4L9SA 1KJZA 2AN3A 2V98A 1OLXB 2VUUA 4MB0A 3DE4X 5ARDA 4TS4A 4DNFA 1BYUA 1HC7A 3G79A 2WMDA 4NBKA 2PRZA 5CK5A 1QUFA 3ELBA 5EKTA 2E6UX 4R1TA 5CT9A 4IEEA 2IHZA 5D87A 3VTZA 2JIZA 2VP9A 2WK1A 4I5EA 3RRMA 2OG2A 3I0ZA 2C7PA 2DEUA 1TRHA 3RV4A 2Q9AA 1WULS 2WMOB 3LWZA 2CCKA 3F6RA 3JX9A 4AS3A 5B4VA 1CJVC 2ZZNA 4OGGA 4FZRA 2G82A 3MHPA 2WIFA 2Z04A 5IXYA 2GCNA 2ROQA 4MVJM 4PO3X 5ALGA 5B6IA 3WYFA 2QRQA 1CRLA 2G9VA 5CUQA 3AC0A 4BGVA 2QVBA 2QRPA 2WJVA 4ETNA 4LQ4A 1I13A 1CUUA 1WMEA 2VZ8A 3KYCA 4ALLA 3ZWDA 2F1IA 2O06A 2K6GA 2QTBA 3B60A 1L3BA 1P4GA 4RA6B 3ZS9A 2OPBA 4CKBB 5KDOA 4M22A 1MBZA 2QGNA 3H1BA 3OPXA 5JFOA 1PL0A 3IUJA 2P9HA 4WJZA 5ERXA 3VPAA 1N6PA 2PVPA 2Q1TA 2RGCA 3ABQB 1HYEA 2JK0A 1FY2A 5A62A 1TVEA 3O74A 4H60A 4EYGA 3HJRA 3N8DA 1NHGA 1C2YA 1P2VA 2CHGA 1K7XB 4TXJA 4KSCA 2TMDA 3BH6A 1VI5A 4CBVA 1E1RD 2I4NA 2Z8YM 3KEGA 4OAOA 1MHPA 5ECDA 3RYTC 4RK0A 1NG1A 2CXUA 4P7FA 1NMZA 2YJ6A 4XARA 3BRQA 1IOZA 4Q6BA 1PDVA 3IPLA 4LJ9A 4YJ2A 3BKWA 3OFNA 3EY4A 1ONNA 4LTDA 2DKFA 3HACA 1KSFX 2EGUA 2H1OA 5JCJD 2FA9A 1KU0A 4CMHA 4L73A 5IKPA 2P5TB 2HZBA 1YAJA 1ZIDA 3EIEA 4ZD6A 4M76B 3WO0A 5C80A 2F00A 3WQSB 3I1FA 3UJAA 3PFKA 4J29A 5BW8A 3QPCA 4RV4A 1RABA 5G1NA 1Y6QA 3QRWA 4J94A 5JECA 3W6NA 5LN1A 1JDUA 2B4YA 1ML4A 3WLSA 4B09A 1XQ1A 4WKGA 4PQRA 3EGVA 1COZA 3TQTA 1ECPA 3P2MA 4L22A 3PQDA 4LK3A 5EXTA 4Q1FA 4QDZA 2XXBA 2BHSA 2GAIA 5BSUA 4BMCA 1LDBA 1E2LA 2O3JA 2H54A 3SD7A 2H1FA 3K0BA 4OHVA 3I2IA 1DLIA 3R6TA 3IAM1 4U7HA 3TTXA 2A58A 3MJDA 2A78A 4MQ4A 3WGIA 1JG1A 1Z62A 1Y4SA 3LGSA 1Y5LA 4MP6A 3L7BA 4JJIA 3W6UA 2R9VA 3OC6A 4O5AA 3LX6A 1OC2A 5KSPA 3EGWA 5ALWA 1NF2A 5EJ4A 3Q72A 4QYXA 1SCQA 3OZEA 3C3YA 4INPA 3SFZA 4CIVA 1X77A 3SJUA 5G1OA 4ZK2A 3FJYA 4TVOA 4IS2A 4KIUA 4A0RA 2AG1A 3NWPA 1GTG1 2PUJA 4CIDA 3QX8A 3AHIA 5EWLA 2ZT7A 4IBOA 2YWJA 1L7QA 2FP4A 3UUFA 3G5AA 4AUMA 5LQKA 1B73A 4MW9A 5F3DA 4LF5B 1TJ3A 2PPLA 3I73A 3OPYA 3PGA1 4LSMA 4X66B 1OLOA 2X76A 3EZFA 3H8SA 4WLFA 1A8HA 4BWFB 4YT4A 4BYMA 5HYVA 4RTPA 2HR1A 2W2LD 1ID1A 1DKQA 3UV3A 1HNZB 4U2CA 3K4PA 3LLVA 1NN3A 2QVYX 3WL4A 1TMKA 1WAMA 3H99A 4ND3A 4CKEA 4K0KB 1FDVA 2GCGA 1KPHA 2HLPA 2MSEB 2E1RA 3O2JA 5K3BA 4C4PA 4KIJA 4KQ6A 1ZYUA 3I62A 5LM3A 3FZYA 5JDCC 3L79A 5LA6B 1KI4A 4KCGA 4QXOA 2HKIA 1IJFA 2L69A 4JT9A 4G84A 4PG8A 1MC4A 2CKMA 2XWBF 5A3SA 3UO8B 2PH3A 4G89A 2E82A 2PJRA 4NCJA 4UMEA 3V4SA 1FNNA 2AUMA 2PX4A 3D6UA 4M9RA 4JI7B 4A2QA 1L5RA 3NBFA 2C5EA 3EASA 1PJTA 1BKSB 1JDBC 4FE3A 4IJQA 4B9AA 4D8XA 4XYLA 5K99A 1M1YA 2GNOA 2PNFA 3LHKA 2F3SA 4N01A 4YRQA 1RLTA 1TZMA 3OZIA 1E3IA 1XVVA 1KDPA 2QVCA 5HF9A 2I54A 3K6RA 3WFIA 3DDSA 1HTTA 2HOQA 1HFEL 1MQ9A 4ZYLA 2QMOA 1BFUA 1KPIA 3E9QA 4F3TA 5CW2A 3HYTA 5ALYA 1A1SA 2OD7A 5DSXA 1EHIA 5HIJA 3NOXA 3G0BA 1V5FA 4XUGB 1GNPA 3DBLB 1NV8A 4AJ1A 3PCRB 3EF1A 4JB0A 4YJHB 4MWSA 3T1QA 2XYHA 1NI4B 3PEFA 3PI6A 1GPYA 4NE2A 1NQAO 3THXB 1E2UA 4X64B 1JXAA 1W88B 3CT4A 1FB5A 1SKYE 3T95A 4B7UA 1L2TA 5T4BA 1KZ1A 2AJTA 3R5KA 3VU1A 5JASA 2IUFA 1OPRA 3BE5A 3PGXA 2O2EA 1SVNA 1NULA 2PT7A 3E4CA 3FNGA 3L7IA 3T4UA 1X1DA 4NICA 4F06A 3UAGA 3RQIA 3RS7A 2Q3JA 1UMCA 3I04A 3E9ZA 3UJCA 3TB4A 2K5UA 5K3CA 2Z57A 4HDKA 1EFUA 4FYYA 3NDBB 1L5MA 4HUQB 3RYHA 5DBGA 4QTYA 3U56A 3EIWA 3NM4A 1MW8X 2W11A 2BCJQ 4C6TB 1YBHA 2P6MA 3FZNA 3M4YA 4CCSA 4AJJA 3SC6A 1SURA 3TGLA 3KZCA 2R5NA 5DV9A 4LVCA 1Y5IA 2ECPA 1PIWA 1U5BB 3IBFA 3DMFA 3OZUA 2PX8A 5IJ0B 4KYIB 4OP1A 4JT2A 4Y2RA 1KDTA 5EIBC 3DT8A 1DAHA 1UBOS 4M8SA 3JD0A 4NQRA 3D8BA 2VNKA 1Y42X 3GBVA 4Q3NA 4R84A 2ORWA 1FE8A 2MSDB 4O2BB 4B6PA 5F7JA 3BB1A 3ZK7A 1TT5B 2VBCA 3KPUA 2AEFA 1TYCA 1SC3A 1CE8A 3OTGA 1CIVA 3NU1A 1MORA 1CUBA 2V6FA 5AUPB 2QRKA 3INTA 4HCJA 4P32A 3UFXA 2BEWB 5HUQA 3GLHE 3H05A 2JFWA 3FGPA 3EXHC 4LDRA 4J76A 5LA6F 4HPWA 3T52A 2G7ZA 5BYKA 4BQFA 5A5FA 4I2VA 3LPCA 2H6EA 1A8IA 1OYWA 1N0HA 3NX4A 3BRWD 2GK4A 1IEQA 4A0SA 4LRTB 4P4NA 3SKXA 2V1UA 4BLWA 2JVKA 4IUDS 4AJKA 4J0QA 3VDXA 1N6OA 3GLTA 4BQOA 4ODIA 5DCYA 2FZLA 3ADPA 3DOFA 2GNAA 4A82A 1E3EA 1Y3IA 1QWSA 1FYDA 4HC4A 4NMHA 1X94A 2IDKA 1QO0D 2V7TA 1ZWLA 1E1QA 4Y18A 5KC8A 1IY1A 1QYCA 3E9RA 1CJUC 3D9QX 4HNGA 3RV3A 3WKBA 4G8DA 5JC8A 4JI6B 3ETJA 1PHRA 3TNLA 2I8CA 2B99A 3LY7A 2P6OA 2E49A 3NQ41 4HFJA 4N3NA 1GNSA 4OQYA 4QBGB 1P2DA 1EDOA 4PO8A 3BZBA 1JF8A 3DVAB 4W9NA 5P21A 4RGBA 1OWMA 4JK3A 1E79D 1P2TA 1W4AA 4GX0A 3JQ7A 1WHSB 3QVGA 3OZGA 2WTMA 2PUFA 2WA2A 2XX3A 4Q19A 4L51A 1EQ2A 4I1VA 1SR8A 2XBUA 2BTEA 1V5WA 3VU9A 3HB4X 3M6WA 3GQVA 3KU4A 4ZQEA 3IKLA 2D3WA 1U6JA 1U1EA 1NXVA 3Q3HA 4Y2HA 2VDLB 3NRBA 3COYA 4RPCA 3SN6A 3KE8A 2HIGA 5HA5A 4FZJA 2ZE7A 4QFCA 1C2TA 3LHDA 3P4YA 5JSZA 1TA4A 3ELYA 3G0HA 4DT1B 5FLYA 4DVGA 3D2AA 2Y0PA 1LPBB 5M5BA 3DXYA 1YU9A 2JGNA 1JU9A 4MV1A 4ZZ3A 6PFKA 1UFOA 4EG4A 5DRYA 1NWHA 4ZVNA 3FYUB 4HT3B 5AT1A 4PZ0A 1T5BA 1H65A 5TE9A 3PCTA 1HQKA 3RVJA 3L8ZA 4J03A 4Y3UA 3PXCX 2F1KA 3RYIA 2WKRA 3DE3X 4R16A 3WDKA 4GG1A 3KUXA 1UWKA 3O8LA 3RRJA 1EX1A 4B3IA 5CCDA 3SX0A