1IPEA

Tropinone reductase-ii complexed with nadph
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
259
structure length
259
Chain Sequence
AGRWNLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNDCLTQWRSKGFKVEASVCDLSSRSERQELMNTVANHFHGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTIQDPEQKENLNKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGGLMANCGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords TROPINONE REDUCTASE-II
publication title Capturing Enzyme Structure Prior to Reaction Initiation: Tropinone Reductase-II-Substrate Complexes
pubmed doi rcsb
source organism Datura stramonium
total genus 104
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 1.1.1.236: Tropinone reductase II.
pdb deposition date 2001-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ipeA00
2DAPA 4W6ZA 3MWEB 1GU7A 4E2XA 1NWCA 4J9UE 3DTTA 2PA3A 4XDZA 4GSLA 2FSVA 2H1SA 1BXGA 2HO5A 4WUVA 2IZZA 4Y8VA 4YXFA 2EW2A 1JU9A 4XD2A 3RWBA 2Y0DA 4XGKA 4L4XA 4DBVO 5TF4A 2WE8A 1I3MA 2F1KA 4FJ1A 1ZK1A 2D5CA 3OIGA 2PZJA 1A4UA 4XYMA 4J0EA 3TPCA 3TRIA 3PQEA 4S1VA 2Q49A 2O3UA 5DZSA 1P0CA 5AXAA 5L7YA 3D3WA 5L7WA 3QP9A 3OIFA 4DMLA 5A04A 3GF4A 3JD0A 2PZKA 4EJMA 2CFCA 1U7TA 4WLNA 3RVDA 3LT4A 3NEPX 4M8SA 1N92A 1QP8A 4WLEA 1QYDA 1SPXA 1IZ9A 2C82A 4BNTA 3UUWA 2JKVA 2Q1WA 5KVSA 1DHRA 3NYWA 4ZQGA 1T2AA 1DXYA 2FP4A 4WNCA 4CLXA 4E31A 1W73A 3P19A 3WMXA 4LVUA 2DBRA 3CEAA 4ZHSA 4EEXA 4J9VA 2C2YA 2FOIA 2EKPA 3Q9NA 4R54A 1ADGA 2P9CA 4CMCA 4ZRMA 2A4KA 1GV1A 3H9UA 1EUDA 1B15A 5LDHA 3PFWO 4AJHA 1UAYA 1KC3A 2PWZA 3T7CA 4BNJA 4B3JA 1Q7CA 3MZ0A 2WE7A 4E5PA 4FPXA 4RZHA 1ZZEA 3WX0A 4CMAA 5F21A 4E5MA 4A0SA 1IUKA 1HDXA 1X0VA 3WLEA 2D4AA 2EEZA 4JCOA 4J7UA 2D1YA 4J7XA 4JGBA 4I5DA 3DZBA 5HTOA 3WTBA 4GVXA 4B79A 4XYGA 4CR6A 3DDNA 2Q4BA 2OGUA 4CMKA 2YUTA 3OP4A 4NBVA 3VH2A 1DIHA 5H82A 3ASUA 2HJSA 1KY4A 2C07A 5JAMA 5IG2A 1UDCA 3VZRA 1ZSNA 3TL2A 1GD1O 4MIYA 4KQXA 1QXSA 3IS3A 1ZIDA 5T8KA 3VAZA 4TKMA 3HADA 2VWQA 5DNAA 3L77A 4J1QA 1R16A 2X0NA 3ORFA 3I23A 3I9MA 1IHXA 2YFQA 3Q11A 2OBYA 2GCGA 5A9SB 2PZMA 4TMFA 1HTBA 1KEPA 2NADA 1EK6A 1PZGA 3RUEA 3IAHA 3O9ZA 4IDAA 4E30A 2J3IA 3E9MA 4HADA 1EFKA 4IMRA 4ZN6A 2ZYAA 3KSZO 3DZGA 5CDYA 5ENVA 3DQPA 5L45A 1DEHA 4KDEA 3EYWA 1Q2XA 2QYTA 3K92A 1BXGB 1N9GB 3NJ8A 3GFBA 1LQTA 4XGNA 4YQYA 2WM3A 1GZ4A 1K6JA 3INGA 5JYDA 4L0QA 3E1KA 1OC4A 3MJSA 2DTDA 4QO8A 1KVRA 3GK3A 1NFQA 2Y1GA 3FRJA 4KTVE 5KVVA 1E1LA 1T4DA 3RROA 3UKOA 1Y9AA 4B4VA 1GQQA 3D3WB 3HHPA 1M2WA 1RYEA 3L0DA 1XHLA 3WYEA 1V6AA 3DHEA 3GVPA 2I5PO 3LU1A 5K9ZA 4R68A 3BMNA 4YT2A 4IIUA 3ZU4A 1HEUA 4GX0A 2ZB3A 4PFJA 3KYDA 4KQWA 3PK0A 4D41A 1FF9A 3ZWOA 3P2YA 3S2FA 2X8LA 3ROMA 1H5QA 3TNLA 2VZ9A 4UREA 4FFRA 3PZRA 3F3SA 4EYEA 4Z9YA 4YWJA 3KHUA 1FK8A 2ZB8A 8ADHA 2HMWA 4JROA 3G49A 3WQQA 1LDNA 3MJTA 5JDIC 2Y1OA 5IXYA 4LGVA 3A4VA 1LRLA 3EZLA 2IYPA 1LXCA 4BNXA 4OHUA 5B1YA 3ETDA 3FPLA 3NT2A 1E6EA 1H6AA 1F8GA 1PJ3A 1T2FA 1VKOA 1GEEA 3JQDA 4LVCA 4XDYA 1G6KA 1NTOA 5JY6A 1B16A 3U0BA 2QIOA 4QFDA 3R6DA 4U8GA 1M67A 2J5QA 1JVBA 1O94A 1YS4A 4E5KA 4GGOA 2YQ4A 4OXYA 8LDHA 3CZRA 2Y1CA 5A3VA 3MTGA 3PWZA 3JD3A 1JWAB 1GUFA 1F17A 2SCUA 1GDHA 1ZK4A 3DFZA 3WGGA 4IDFA 3G0OA 3Q3CA 1F0YA 4PZCA 1IZ0A 4EJ6A 4R1TA 1WPQA 4D0SA 2VZ0A 4ZQEA 3JQBC 4E3ZA 5TJ9A 4BNHA 4CQLA 4MOWA 1DJQA 2GN8A 2HMSA 4XQ9A 3KYBA 2AXQA 3D1LA 1E3LA 1YB1A 3TF5A 1I2ZA 4DGSA 1S7CA 1H9BA 5DULA 1VLLA 3GNSA 1OFGA 2PH5A 3JQCA 1ID1A 3L9WA 4EJ0A 2YV2A 3M2PA 2PKQO 5L95A 2Y67A 1YL6A 1JTVA 3LZ6A 1JA9A 2AG8A 2O7QA 2FRDA 2X23A 4MKZA 2UDPA 4UVGA 4Y6PA 5EL0A 5HBRA 3ZZNA 4EUFA 4TWRA 1PJLA 4NIMA 1B7GO 1G0NA 2GUGA 2J3JA 2QZZA 3OECA 3U62A 4BGEA 1RM3A 5IZ4A 1GAEO 3O8QA 2GGSA 3BMNB 1B14A 1KVUA 1BDBA 3I83A 4R4JA 5DBIA 2X4GA 3QWIA 4RVUA 4J16A 3KBOA 1G1AA 3KUXA 2GPTA 4PLGA 3KYDB 2JD2A 3BMQA 1EVZA 3JD4A 3ZHBA 2DFDA 1P1JA 3GGGA 4IDEA 4YT4A 4IGFA 1GEGA 1X0XA 4GX1A 4L75A 2PH3A 3H2SA 3V2HA 4DPKA 4P4GA 3X2EA 1I0ZA 3E5RA 1ENZA 1I01A 5F3RA 5ICSA 3GMSA 3PI7A 3RI3A 4XA8A 1E7QA 1DLJA 2DUWA 2P5UA 2W8ZA 1JW9B 3PPIA 1NWHA 4TRMA 3QRWA 4DC1A 1Y6JA 1UZMA 3RU7A 1HXHA 4U6SA 1E92A 1KVTA 4D79A 1ZFNA 2NUAA 4J0FA 4RO0A 5BSFA 2YHIB 2V6GA 2Q2WA 3B70A 2RCYA 4FIZA 3ZWMA 1A4IA 2VHYA 4HY3A 3ZWYA 2VRCD 5ILOA 2RHCA 4FOSA 2HK8A 2NTJA 2PKQP 3OBBA 4B7CA 2CF5A 2VT2A 4H15A 1BG6A 2GLXA 5C7LO 4PLTA 3FSRA 4YT5A 2PV7A 3QVWA 3VDQA 2I66A 1JKJA 4YAGA 2AW5A 1DC6A 2BFPA 3LLSA 2Z1NA 4R69A 4BNGA 1LBEA 2X1HA 3BMOB 3GPIA 3WDSA 2ZB7A 3AOGA 4WJZA 1E5QA 1OC2A 4NU6A 4YRAA 1ZCJA 4BO4A 3N7UA 4D44A 3QLJA 4BMNA 4CQLB 5KNLA 3ROPA 5TQVA 1XLTA 4MP3A 4MJLA 2OMEA 1YKFA 3GVIA 4WEOA 4TZKA 3AM3A 3N58A 1P1HA 1SNYA 4YTEA 2B4TO 1NHWA 4I9UA 5JMWA 1H2HA 3PIIA 1XKQA 1K89A 1YBMA 4DBZA 4J91A 2EP7A 1I30A 2J3KA 3DO5A 1ADFA 4RJTA 3AM5A 2YFHA 2VOEA 3C24A 4UUPA 1K3TA 3R3SA 4U0KA 4ZRNA 3GH3A 1QLHA 1Z82A 3V1UA 4UEKA 3RJ5A 1YB4A 3BTSA 3O8QB 3I9NA 4BS9A 4ALIA 3B6ZA 3ZNPA 2R00C 3E82A 2X22A 5J23A 1Z73A 3HG7A 2VWGA 2E49A 2Q46A 3AM4A 3BHJA 3BMQB 4BNKA 3TJRA 3QHAA 1U8XX 3LSYA 1MX3A 1Y5RA 1RPNA 2V6BA 5G4KA 5JCJA 1XIVA 2R00A 4IJWA 4EDFA 1DRVA 2YZ7A 4CMBA 5IZCC 1BDMA 5HS6A 2EXXA 3T4EA 4L73A 1Y8RA 1LRJA 3TQHA 1PL6A 4OYRA 4R1SA 4BNWA 1U3VA 5KCZA 1T24A 2AQKA 4OKIA 3MTJA 3O4RA 2I6TA 4BO9A 5KJ6A 5JMPA 1WNTA 4XYEA 4PZEA 2JJYA 4KUGA 3C7AA 1EQUA 4IINA 4IDBA 4Q3DA 2H63A 1XSEA 1OI7A 2Y93A 1U5AA 3GMDA 2PFGA 3M2TA 1YDEA 1K2WA 2WMDA 2PKRA 1CF2O 2OP0A 3PWKA 5B4TA 3GVCA 5BNIA 5MGBA 5GZ6A 5AQ1A 1U5CA 5GZ3A 1R4MA 4RGBA 5GY7A 5T6BA 2GZ2A 2X5JO 2W2KA 1ZNQO 1PL8A 5FWNA 1MFPA 3ZN2A 3OQ6A 4PG6A 1H9AA 4KUHA 1LDMA 3N74A 4BMSA 3DR3A 4YEDA 4NZ9A 1QRRA 4HV4A 4R01A 3ZCXA 1BMDA 2VHVA 2ZCVA 4ALNA 3VDRA 1XELA 3BYZA 1IY8A 3FPCA 4ALJA 4I08A 1PJTA 2XAAA 5B37A 3DOOA 4LRTB 4GAEA 4WKGA 1L1FA 1E3IA 3PJEA 4MVJD 4DMMA 4R3WA 3TZHA 1NVMB 9LDBA 3JQAA 3U4IA 4IPTA 1X1EA 1G0OA 2VYND 4MDHA 4CM8B 1OOEA 1DC5A 1Q7BA 4A10A 2W98A 4FS3A 3TZ6A 3WTCA 2BI8A 3BMCB 4Y6RA 2BI7A 3KOUA 4Z0PA 5IN5A 1HYHA 2AQ8A 1PEDA 4MVJA 4J2HA 3ROQA 5TT1A 1LA2A 2NTVA 1QV6A 1MXFA 4B3IA 3TZKA 3F6YA 3WMWA 4F46A 5I8ZA 3GZNA 4QECA 3D3EA 1NR1A 4KOAA 4GVLA 2EF1A 1IE3A 1ZK2A 2RIRA 4DTIA 4NBWA 2GZ3A 2Q50A 3WWZA 4A2CA 3DTYA 3GFGA 3GEMA 3I5MA 3BTUA 3DAFA 1HE3A 4MVJM 4BUCA 5G4KB 2GD1O 3HDQA 4OL9A 4UVEA 4AVYA 2PGJA 4IQ0A 4PLCA 2HMVA 4B4OA 4P22A 2D0IA 4NJMA 1ISGA 1T2DA 1U3UA 2D2IA 3D64A 1LSOA 5DP1A 5ICMA 2CVZA 1ZK0A 4M54A 3ANNA 4J7CA 1I24A 2RH8A 2DPGA 1PGPA 1N8KA 4WLOA 1Q7GA 4UVHA 4UVIA 4YJFA 4BKQA 2Q1TA 3I4CA 4O1MA 1HDYA 3GGPA 4DYDA 3K96A 4LMPA 3I9JA 1NR7A 2DLDA 3VVCA 4HFMA 4WCFC 2ZQYA 1O5IA 2FPIA 2I3AA 3HN7A 4JN6B 3WJAA 3TL3A 5A03A 3WFJA 4YYZA 1TA4A 5ADHA 1R4MB 3RBXA 2POQX 2FN7A 3DHYA 3RUAA 1CRWG 3LF1A 3TDKA 1E7RA 2W2KB 3GOHA 3TZCA 2R2GA 1IL0A 4BHTA 2GYYA 4AFNA 4YR9A 3DEYX 4YPOA 3E8XA 1DIBA 2E48A 3ZW9A 1NQ5A 1T26A 4XB2A 3R3JA 1CJCA 3GLQA 3ONFA 1UP6A 3MJVA 4FW8A 1IB6A 5A5FA 5F1KA 4K9DA 4LCJA 2JFFA 2PK3A 3IP1A 4RF5A 3VPSA 5KOIA 4G5HA 2G1UA 3HJAA 3ZWPA 4DYVA 4I5EA 3WBBA 2CDAA 1H2BA 3HUDA 3OQ1A 3GEDA 2HRZA 2BF7A 4TQGA 1UXHA 3IKVA 4W82A 3ZNOA 1P31A 3HSKA 4IXWA 1FXSA 1ZK3A 4AJJA 3JQAB 3MOIA 3A06A 3JQFC 4NU5A 5C37A 1NNUA 3W8FA 1CERA 3GUCA 4PZDA 1GUZA 1JAYA 1Q1NA 3AFMA 4F6LA 4CM4B 1ZXBA 1PJCA 1ZXLA 1BTOA 4CR8A 3JQFA 1M66A 5T64A 1YDWA 4RQUA 1IULA 3GZNB 1UAGA 3EZYA 3TSCA 1GQYA 2ZIZA 3JCZA 2WDZA 3AUSA 4AJKA 4ZGWA 4MP6A 5DP2A 5IDYA 1AUPA 1VKNA 3GRPA 1OAAA 4G81A 2P2SA 3RC2A 5CG2A 5CEEA 2C29D 3DAPA 1GPDG 4GKBA 3C1TA 3AUAA 4KUEA 4NBRA 4J1NA 1GY8A 1PS0A 2D8AA 3H7AA 4HX5A 3FBTA 1GZ3A 2C7VA 5K6AC 4IJUA 2GZ1A 4NJMB 3S2IA 5BNFA 4R41A 2C7GA 4NFSA 1BXZA 4D43A 2DM6A 3A14A 3AFNA 4GMGA 1AN9A 3RIHA 2I9PA 1Q0HA 3LVFO 1YQXA 4FFNA 4CM3A 4UUOA 2AEMA 2AQIA 2BLLA 2IDZA 4NK4A 4DL9A 1PGOA 2XXJA 3K2EA 4YJFB 5JDCC 4CLDA 3JYOA 2HQ1A 2ZJ1A 1LLCA 3W1VA 3FWZA 2IODA 1YO6A 3CXRA 5LCXA 3WYBA 3RKUA 1XR3A 2YQ5A 3GDOA 4D7AA 4XYLA 1KOLA 2YHUA 3FTPA 4YVFA 5G0SA 2YY7A 5CDTA 4RLHA 5GMOA 3SC6A 1SAYA 3DWFA 1JAXA 1R4NB 2Y99A 3COSA 3U4HA 1LDGA 1UP4A 1YGYA 4L4SA 4URFA 4OM8A 3KETA 3DZJA 2XOXA 1B8UA 1DRWA 4YJHA 1B3RA 3ZWNA 4BO3A 4E32A 4WECA 1GTMA 4W4TA 4TRJA 1W8DA 2NTNA 4GBJA 4YJDA 4OQZA 4NFYA 5U4QA 5BSGA 4FSHA 5C3MA 1OBFO 2DT5A 2Q1UA 2BELA 1GYQA 2PTGA 2VHZA 3I6QA 1ULSA 3EC7A 5KWEA 1QORA 4GWKA 1WW8A 1P1RA 1MFZA 2BGKA 3ZH2A 2AQHA 3MCVA 3U4DA 4MKXA 3QSGA 2J6IA 1IOLA 4EI2A 2E6UX 3KZVA 4J2OA 1O8CA 3DZHA 3ZWWA 1C3VA 4GI2A 1YH3A 3QQPA 3H9GA 1E1MA 3DBRA 2OORA 4N7RA 1W4ZA 4CLRA 5JFOA 1GFSA 4TSKA 3NAQA 1YB5A 2VNSA 3OFSA 4G2NA 5CG1A 3M1AA 3G17A 2DTEA 1DC3A 2BD0A 2GR9A 4M86A 2Q45A 4PLPA 1VL6A 2V65A 2PD6A 2O3TA 3DMYA 2V6MA 2OUIA 1XYGA 1BRMA 2J5RA 4Q3AA 2GN9A 4BGUA 4CR7A 5ITWA 3PWSA 3IUSA 3VPFA 2GN6A 4OAQA 1UR5A 3ANMA 3VH4A 1C1DA 3G1TA 4WK6A 2Q3EA 4RQTA 3DHNA 1Y7TA 4XJTA 1O0SA 3FR7A 1I3NA 2D5AA 2WJPA 4Q3CA 3NGXA 2X0IA 4OQYA 3TFOA 4LISA 4YQZA 3PQDA 3PYLA 2EP5A 4CUZA 2Y68A 1DJNA 3GA0A 3HB5X 3HDHA 4PRKA 3LLVA 5DBGA 1A7KA 1LDEA 5T67A 4BNVA 3RUDA 4CLHA 5A06A 4ND2A 4KMSA 1KYQA 3V2UA 2O3SA 1JN0A 3UN1A 1UP7A 2P9GA 1MP0A 5DF1A 2FY8A 1VI2A 5IFLA 3O03A 1EDOA 4N5LA 4A26A 3RFXA 1LEHA 3SJUA 1PTJA 5BSEA 4R9SA 2PLAA 4M55A 2E4AA 4PLZA 4L76A 4J6FA 1ISHA 3LT1A 2I3GA 1ZMOA 4CMHA 1DC4A 1R6DA 4L8VA 4DWVA 4ALLA 4Q39A 4QQRA 5C7OO 1VJ0A 3CSDA 4M49A 4R5MA 1P1KA 3VPGA 4K1LA 2VHXA 3IC5A 1E7YA 5KJ1A 3CKYA 3JQGA 1DO8A 1WDLA 2B0JA 2V7PA 3NV9A 1C1XA 2CVOA 3OICA 3OHSX 1XEAA 4KDFA 2UV8A 3WGTA 1NVGA 5B12A 3LYLA 4B7XA 5EPOA 3UCFA 3FNEA 1SBYA 1UXKA 2CSUA 2O7SA 3FNGA 3JQ9C 1I33A 2CD9A 4QT0A 2WEKA 4OOEA 1EQ2A 1GL3A 3DFUA 1UH5A 2NV6A 2FR8A 1PQPA 3L9XA 4N54A 1FJHA 1VL0A 4HKTA 3PYXA 1SCUA 3DBRB 4LSWA 4CLRB 1BWSA 3E6AA 4JP2A 3Q6IA 1I2CA 1EVJA 4AJPA 4EBFA 5JAZA 1U9JA 3P5SA 2QG4A 5A02A 3HNPA 2Z5LA 4YRBA 2YJZA 4GKVA 4WOKA 3GAZA 4PLHA 4BQPA 3QIVA 4O6VA 3JYPA 4II3A 3HB4X 5JDIA 2EIHA 2EKQA 3WGZA 1I36A 1EVYA 1ZEJA 4DLAA 2AHRA 1H6CA 3F4LA 3PHLA 4ND1A 5A1TA 1C1DB 4E21A 3HZZA 3ZHZA 4PG4A 3WGOA 1GCOA 1D7OA 3OJ0A 3WGYA 5IDWA 1VE9A 4FOOA 4XQEA 4DQUA 1F8FA 4HFRA 3VOSA 1F14A 4YB8A 3T7EA 1RYDA 1V9LA 4R1NA 1KVSA 2PZLA 2PD4A 1LSSA 2AA3A 1EDZA 3PGXA 3AI2A 2C20A 4XZ3A 2G5CA 2J3HA 1KS9A 3JYNA 1YONA 2C2XA 3BZUA 5H81A 3K9QO 1R15A 3QY9A 2JCVA 4OOFA 3JQ8A 5CHEA 4NG5A 2J8ZA 5ILGA 2WSBA 4AL4A 1UZLA 3JQBA 1ONOA 4HNGA 5ES3A 1P74A 1LSJA 1DB3A 2NNLD 1BHSA 3TOZA 4J43A 1DAOA 1HDOA 4F3YA 4CV1A 3EK2A 3WG9A 1LRKA 1HSZA 5EN4A 3A28A 5KVCA 4EGFA 1P0FA 3E18A 4I9HA 3ZWXA 3JQGB 4MVJF 4LW8A 1DIAA 1TT7A 1V35A 4CM7A 1I32A 4B4WA 3NT4A 1J6UA 3RUFA 5L53A 3A1NA 2GNAA 3FCOA 5T5QA 4EEZA 3E9QA 5F5LA 3CMCO 3RSHA 1NQTA 3JSAA 2W2LD 3W6ZA 3UICA 3JYLA 4CMEC 5A9RA 3I9KA 1LLDA 3I9LA 4PVCA 1X14A 1LDYA 2ZYDA 1ADBA 1UDAA 3K5PA 1A72A 3CUKA 3OEWA 4IZHA 5DCYA 3VTFA 5KJCA 4YAKA 2HKIA 1C0LA 3GRKA 1BVRA 2GASA 4EITA 1H6DA 4Y98A 2JHGA 2P5YA 2W2LA 3AW9A 3UHAA 1J49A 1YJQA 3ENNA 5BNTA 5BSHA 3LC1O 4J1TA 5KKAA 3GG9A 2IEDA 3WJ7A 4FB5A 1AE1A 3RQSA 4R51A 4RVGA 5JSFA 2NU7A 1GR0A 3WYCA 4FGSA 1V3UA 3PDUA 4H16A 4AJOA 1M76A 1H93A 1OZAA 4E2ZA 1SOWA 4EZBA 4XYBA 4JJGA 4DLLA 4LRSB 2EWMA 6ADHA 4IXTA 3PFFA 3QW2A 4II2A 4CODB 1CYDA 5L51A 1U3WA 3SC4A 5I7SA 1ENOA 3E9NA 3IL2A 2HLPA 1ZH8A 3GN1A 3NRCA 1T1RA 4FJ2A 3H2ZA 1PJSA 3FNFA 2OP1A 1ISJA 3U9LA 5I9MA 3Q0EA 1ZUD1 5LC1A 3HDJA 2GN4A 4DIBA 9LDTA 1GZ6A 1KEUA 3C3XA 3PHJA 1R0KA 2BGMA 4B4UA 1CDOA 4E12A 1TLTA 1GADO 4JX8A 3ETEA 4BKRA 1YOVA 1MG0A 5JXWA 3ZV3A 2B5VA 4IY1A 4CM6A 4XIJA 1RKXA 2IZ1A 3H8VA 1WMAA 3PQFA 2TMDA 3EDMA 1M6WA 2FSSA 2TMGA 4DLBA 3ENKA 3JD1A 4RLSA 3VPHA 1DOHA 3ON5A 3RAJA 1U4OA 4BNMA 4PLFA 1Z45A 1C14A 2HK7A 2JL1A 4XJSA 1VSVA 2EHDA 1P77A 4O59O 3OF2A 3SJ7A 4FC7A 4OKNA 1QKIA 5I7VA 2ZB4A 4GLLA 1XWFA 2ILTA 5A05A 1D1SA 5ER9A 4BNLA 1NP3A 3DMTC 1I2BA 4Q3EA 5COAA 3F4BA 3QVXA 3S55A 1MC4A 2Q99A 3DOCA 3NUGA 1EUZA 1PQUA 5CFZA 3EUWA 4LMRA 1PGJA 5JCJD 4KWIA 1WXDA 2EKLA 5AYVA 1QMGA 4Q3NA 4BMVA 4ROSA 3JQ7A 2Y0CA 3JTMA 4IDCA 4MIOA 2OXIA 3KLMX 3PLNA 3PHIA 2OZPA 1C0PA 5ENDA 4M89A 4U0JA 4FC6A 4ID9A 4BNZA 3NDJA 1NASA 1I10A 5AVOA 5TLSA 2ZTVA 1JDJA 1CIVA 4CM1A 1FDSA 2QW8A 3CMMA 2B37A 5L4LA 4HBGA 2ET6A 3FF4A 5EINA 5TRTA 3EMKA 1P33A 1JKFA 3INRA 1ISMA 5A3JA 5GZ1A 4CL3A 3BTOA 4U6QA 4FBGA 5L9AA 5U1PA 1I3LA 5IZCA 3DBLA 1V8BA 2D3TA 5CP8A 2WD8A 1A9ZA 2BRUA 2HSDA 4IMPA 5JNLA 1VRWA 1NHGA 5FI3A 3VH1A 4Q9NA 2RBEA 4A5OA 3MWDB 2J5KA 4DRYA 3CZMA 2CY0A 3NX4A 1Y5MA 3TOXA 5JYEA 5HRUA 2X9VA 1T4BA 1ARZA 1GYRA 5KVQA 4W99A 1PQWA 4M87A 5DT9A 2F00A 2PY6A 2DTXA 4JK3A 4PG7A 4XGIA 3GN2A 3IMFA 2A9FA 4PG5A 2CNBA 5HS4A 4KZPA 5DCUA 1U7HA 2X5OA 5IDXA 2FHSA 3L4BC 1ONNA 3M6IA 1N1EA 3F46A 5JLAA 3ONDA 4BB6A 3BHIA 4EUHA 4R3NA 1T2CA 2NU6A 1ZJYA 4P4LA 1KEWA 1R0SA 2C5EA 4U7WA 1YOVB 3JQAD 1PWZA 3ZW8A 3I6IA 3AI1A 4KTTE 5I7FA 3L4BA 1KY5A 3MJEA 3RASA 4I8XA 1ZSYA 4XIYA 1D1TA 2NSDA 3RBZA 3I3OA 2JAPA 4S3MA 3C7DB 3RKRA 3KXDA 3WQRA 4IQGA 1WWKA 1JWBB 1YWGO 3UF0A 1ISIA 4ZD6A 4Z3DA 1DFGA 1N7GA 3ICCA 3NT5A 2H6EA 2C59A 4BO1A 3WGIA 1PZEA 2BMAA 1V0JA 1AGNA 3NGLA 4AJNA 2Y1FA 3OQBA 3AOEC 4GX5A 3W4IA 2H5LA 1DFHA 4IJVA 5EMHA 3W4KA 2GF2A 3R0IA 4TRRA 2BHLA 4BKOA 2YV1A 4ILKA 4CLEA 4YAJA 3GT0A 4A03A 4YACA 3JYQA 1HRDA 4MVJI 4D42A 1Z7BA 4Y6SA 3LT0A 3F1KA 4I1IA 2GDZA 3KYCA 1Z7EA 1W6UA 1X7HA 2DUUA 1EZ4A 1AHIA 4BV9A 5HWSA 2VHWA 4KP7A 3QWAA 2YDXA 1ZEMA 3L6EA 5A4DA 2Z1MA 4FQ8A 2O4CA 2YDYA 2VTDA 3FI9A 2FMUA 2VUSA 3MEQA 4W7HA 3D7LA 4BL5A 3IQDB 4E2YA 4DIFA 1K6IA 1Y8RB 4BIIA 3ICPA 5G4LA 1NAIA 2Y66A 3ITKA 1E6WA 4YBZA 4CLOA 2EJWA 2JD1A 3DBLB 2VOJA 4MINA 5JO9A 1O95A 1OMOA 3P7MA 3UFXA 2ZYGA 3LC7O 1KVQA 4A73A 2OO5A 4WE3A 1CETA 2HUNA 4ALMA 1EUCA 4PVDA 3WIEA 5JAIA 1NX6A 1WP4A 3LK7A 4DC0A 2P91A 5L4SA 1L7DA 1PX0A 1WMBA 3O38A 4MO2A 3NTQA 4JNKA 5L40A 1WLYA 2NU9A 3WXBA 1P1IA 3H5AA 1H6BA 5EQDA 1EEHA 3C85A 4MIEA 1C0IA 2B35A 1X7GA 1NM5A 2X58A 3EY4A 1V3TA 1SZJG 4YCAA 4WCFA 4OIMA 1VL8A 3AUUA 3NDRA 1HDRA 1S6YA 3IP3A 3ONEA 4BOYA 1HLDA 4WCDA 4J4BA 2WTBA 4QXMA 3KB6A 5MDHA 3FN4A 5C7IO 2OBNA 5CDGA 5IF3A 3KVOA 5EESA 1E7SA 5JO0A 4FGWA 4Q3BA 2JCXA 4MVJP 3RU9A 2B83A 4IS2A 2Q1SA 2ZCUA 4H7PA 4L9RA 1E3SA 3D4PA 1PR3A 2UVDA 6LDHA 3KEOA 3U5TA 3OSUA 3UAGA 4GL4A 1AXGA 4IQ8A 5TC4A 7MDHA 2A35A 3KLPX 3R1IA 1X1TA 5JW6A 2IRWA 4RPHA 1SB8A 4FCCA 4ALKA 1DBVO 4F6CA 3QE3A 3U4CA 1EVIA 4O5OA 1NYTA 2OOSA 3WLFA 3H9EO 4RPGA 3GDGA 3QA9A 1NAHA 4C7JA 2VTEA 3QVSA 5F5NA 4YT8A 4YJGA 4OH1A 5THQA 1SC6A 1LDBA 2I76A 1WDKA 3OJFA 4HUJA 2B4RO 4CMIA 4R16A 3V1TC 3MJ4A 1DFIA 2RH4A 5A5EA 4AICA 1EBFA 5FFFA 4PCVA 3GPDG 5C5IA 3GG2A 3RC1A 1DIGA 1MG5A 2EG9A 4K6CA 2WYVA 3F5SA 1ZBQA 4OMUA 3CE6A 4CL8A 5FF9A 4ND4A 3ROKA 3EVTA 3ZNQA 5TIIA 2IXBA 1RJWA 1M6HA 3IJRA 3D4OA 1IPFA 1BGVA 3PXXA 4JJFA 2G76A 4DVJA 1H94A 5K6AA 3ULKA 3EHEA 1GV0A 4L74A 2VYVA 1N7HA 5DBFA 3PJFA 5BT9A 5TNXA 3S1LA 1HETA 5A9SA 2PNFA 4JIGA 4JJIA 4AJLA 3Q2IA 1I3KA 4HFJA 1B26A 1QYWA 4PLYA 3DZKA 3NJ4A 5DDIP 1HYGA 2B5WA 2BFMA 3HDYA 3H9QA 4P8RA 1L7EA 2EGGA 2G82A 5JDCA 3WQSB 3F1LA 4I5GA 1U1IA 3UOGA 4ZJUA 4XR9A 5TJHA 1N9GA 1J5PA 2ZTLA 3SBOA 4WCFB 4YRDA 4UUMA 3B1FA 5COQA 4RDIA 1LQUA 1MB4A 1UXJA 2HDHA 3OJLA 4OO3A 3OA2A 1YJ8A 3TWOA 5KIAA 3DB2A 4NQZA 4IM7A 2P4QA 3B20A 5K0ZA 3OMLA 4PLWA 1P9LA 1YRLA 3ABIA 1SEVA 3H6KA 4CMGA 1HF3A 4WLFA 4TROA 5DOVA 2CDBA 2VN8A 3SLKA 1GYPA 1Z75A 4J4HA 1ONPA 3HFSA 3WS7A 3VPXA 5ITVA 1HL3A 4DPLA 2I65A 5TS3A 1EMDA 4PGFA 4RCVA 1YVEI 2O23A 4XCVA 3PYMA 4K6FA 2JAHA 2P4HX 2VRBA 4FD3A 4IZIA 4MVJG 3KM0A 4O0LA 2ZQZA 5THKA 1ZW1A 3DC2A 1N1GA 1LTHR 3PJGA 1NPTO 1VM6A 1HZZA 2FR1A 4ONEA 5IXSA 1QYCA 5JAQA 5KTKA 1MA0A 4NPCA 2X5KO 4ZQFA 4D3SA 2CMDA 4YJGB 3EGOA 3DAGA 2AEJA 1SO8A 4JBGA 1XGKA 3ZU2A 2P9EA 2PGDA 2CZCA 4CMIB 2ZTMA 4GPD1 5KKCA 1F06A 2O4UX 4RF3A 1PL7A 4QUKA 1IYZA 4WOJA 2FR0A 2VWPA 5T8KC 3ZWVA 4XQGA 3DBVO 2DBVO 1P45A 3PEFA 1NVTA 3INTA 1P1FA 1DAPA 4AJ4A 1GQ2A 4FFMA 4UAGA 2DKNA 1NQOA 3ADOA 4LK3A 4QFCA 3VTZA 2GRAA 4PN3A 3WGQA 1NBOA 4Z9FA 4UULA 3ZV6A 5CPFA 1X15A 3SEFA 1D3AA 2O2YA 3P2OA 4XR4A 3X2FA 1ISFA 1B2LA 1ENYA 1PS8A 2ZKLA 3AY3A 1QG6A 5I9NA 3UW3A 2PD3A 2X7HA 3Q9UA 3V2GA 4BO6A 1P44A 3WBFA 2BKAA 1FMCA 4RPJA 2QRJA 2B69A 4P4NA 2I67A 1JLLA 1A5ZA 5HM8A 3MOGA 3PHHA 4ZVVA 5EJ2A 1BW9A 1NXQA 5TSDA 3H65A 2NQTA 4NK5A 3F47A 4BO8A 4MKRA 1KBZA 1NPDA 2RHRA 1QV7A 2DU8A 4YJHB 3BTVA 1R12A 2OFPA 4GSKA 4LCEA 5EQFA 5JY1A 1A7AA 3CTMA 4NDNE 5AXBA 4D3DA 1B0AA 1DPGA 3QVOA 1A27A 1ORRA 3LQFA 3ETGA 3AK4A 4R1UA 1QLJA 3S2EA 4XKJA 3IUPA 3FR8A 2BFOA 1EBUA 4W7IA 5CDUA 4GMFA 4DQXA 1B8PA 2E37A 2DBZA 1LJ8A 1T1SA 3FD8A 3FNHA 2NVUA 1KEVA 1WAMA 3I52A 3W4JA 3SX2A 3VHRA 5IAAA 2QHXA 4Z6KA 3JQ9A 4KWHA 3VVBA 2GO1A 1E3JA 5TGDA 3E5MA 2UYYA 5AXCA 4BNYA 4FR5A 5G0VA 2O3QA 2W90A 1Y9EA 3I9OA 5JS6A 3KSDO 3HFGA 1H0KA 3NTRA 1A71A 2IXAA 3H3JA 1HSOA 3RUIA 1DDOA 3H3FA 3L6OO 4RDHA 1E3EA 3UCEA 2NVBA 3U3XA 4IS3A 4R5HA 4RPLA 3PP8A 4BO7A 3FTNA 3V1YA 1SMKA 4NHEA 2Z95A 3G79A 3K6JA 3WFIA 1GCUA 3W8EA 5KJFA 3UCXA 1E7MA 1NFFA 3VZSA 7ADHA 2QZ9A 2WYUA 1XCBA 3AY6A 3W6UA 4BO2A 1HYEA 4AJIA 4RZIA 5AXDA 3DZFA 1C0KA 3STHA 4WEQA 5G0TA 2YYYA 1ZJZA 1LSUA 3GY0A 4ITUA 4E2WA 4WPGA 1HDGO 3WR5A 2X0RA 3RFTA 2HAEA 2HRBA 4E5YA 5FEUA 3OEYA 1MC5A 3OJEA 1HDCA 2YHIA 1UJMA 4NJOA 3ZWBA 2HCTA 4XX0A 1ENPA 3BA1A 4Z0HO 4NI5A 2HMTA 3VKVA 2Q2QA 4CM9D 3CINA 2FWMX 5JPIA 3CIFA 1HZJA 3ADPA 1Y1PA 4QO7A 4JXKA 2IE0A 2C0CA 4ZQBA 1T25A 3ZHXA 2AEFA 1MGOA 2VQ3A 4XWYA 2B4QA 1WVGA 1NFRA 2AG5A 3DXFA 4TVOA 3B1KA 2B36A 1E1KA 4HXYA 3BMOA 2EJVA 4TKLA 5G2OA 4CM9A 3RJ9A 3KRTA 4RF4A 1E7WA 2G0TA 1YE3A 1NQAO 5CEJA 1UXIA 1E1NA 4WLVA 2A94A 3HN2A 1BW9B 1MUUA 4RVHA 1HDZA 1FDTA 2IEBA 4WASA 4D3FA 2EV9A 2WD7A 4RORA 3VZPA 2CDCA 1LX6A 3K8ZA 1A9YA 2PR2A 3ZU3A 3RC7A 1C1XB 1YXMA 1VJ1A 2X86A 2VUTA 1QR6A 4NBTA 2VCYA 4BO5A 4DA9A 1U3TA 3WNQA 2CVQA 4B8ZA 1ML3A 2VZ8A 4CJXA 4JBIA 2DPHA 3GVHA 4DPMA 2BFAA 3PHGA 4WLUA 1PS9A 4BB5A 5BQFA 2Y1DA 4OSOA 1KC1A 2NVUB 4GGPA 3SXPA 4DXHA 1RM5A 1HLPA 2NLOA 1D4FA 1LLUA 4UEJA 1B3BA 1R0LA 1TEHA 4FFLA 1E6UA 4GX2A 4CMEA 1LLQA 3OETA 1Y81A 4D46A 2Y05A 4XEHA 2NM0A 4D0RA 3WNVA 1X7DA 1BSVA 2YW9A 1TT5A 1LC0A 1PIWA 1J0XO 1PSDA 2JFHA 2HMUA 3ZV5A 3PRJA 1WZIA 3RD5A 5JCXA 1W0CA 4GWGA 4ZU3A 2R6JA 2HK9A 3D4NA 3VH3A 5G0UA 3PTZA 1MV8A 1R66A 4LN1A 4CV0A 3H5RA 3PGJA 1X13A 3BIOA 3FHLA 4FJ0A 3V8BA 3NTOA 1R37A 4E4YA 4BQRA 4J4TA 1T2EA 1U4SA 4K26A 5T57A 3M1LA 1PZHA 2VT3A 1N2SA 4PRLA 1TVEA 1PU2A 4EUEA 1YBVA 4IBOA 2UUPA 2DVMA 4E13A 1YQGA 1GPJA 4BKUA 4OGWA 3WSWA 1J4AA 1BVUA 2Y0EA 3C1OA 3TZQA 3L4SO 1PZFA 4UUNA 3RUHA 3I4FA 5B4VA 1VJTA 4RVDA 4D45A 1PJ2A 2X0JA 1O9BA 1XU9A 1U2DA 3E48A 2ZATA 3DZIA 1SOVA 3WOHA 5JC8A 1IHYA 4ZA2A 3EW7A 1E3WA 2V6FA 4INAA 1HT0A 3RC9A 3SLGA 4AJ2A 5FI5A 3H4VA 3DONA 4Z3KA 3S8MA 3JQ8B 2OL4A 4OXKA 3KTDA 4BGIA 1TB4A 1CWUA 4QTZA 2UUOA 2VRCA 2VUUA 4RVFA 5CDSA 3GUYA 4B3HA 2G17A 1EE9A 2DBQA 4CQMD 2HJRA 1PGQA 2Q4EA 4H3VA 2I99A 2PGLA 3DBHA 1P3DA 2C54A 3O26A 3ZU5A 2RAFA 2AE1A 1HKUA 1HE4A 4CUKA 2WD7B 3HWRA 1DLIA 1UZNA 1FDVA 3PLRA 4C7KA 1DIRA 3FBGA 4AJ1A 1ZKMA 1YL7A 3LC2O 4OJNA 3VC7A 1Z6ZA 1E0DA 3IIEA 1CEQA 3TN7A 2QX7A 4CQMA 4CM5A 2QRLA 4IJKA 4Y9DA 3PZBA 2O2SA 4MPDA 3K31A 4CV2A 4UEOA 3F5QA 1TI7A 4J90A 4B8WA 3RCBA 2WWRA 3AWDA 3DMTA 3I1JA 1Y8QA 3AJRA 3K73O 4CM8A 1XG5A 1NPYA 1AHHA 3GHYA 3OA0A 2FZEA 2A92A 2FZWA 1B8VA 3BMCA 3KEQA 4EW6A 4K28A 3ZHYA 4DUPA 1PJBA 4A7PA 1PJ4A 5JBIA 1TXGA 1LC3A 1U8FO 3Q2KA 4MVJH 3UH1A 1HE5A 2LDBA 1SB9A 3QVTA 4GQAA 5CEFA 2JCYA 5HA5A 5F1PA 3NDIA 4AJEA 4NH4A 1TT5B 4O63O 4PIVA 5H83A 3ITDA 2X9NA 3RBVA 4F45A 3EAGA 3KSUA 2O48X 4N5MA 3GR6A 3BXXA 3GVXA 1CQIA 4HP8A 4I5FA 2H9IA 1KIFA 4QX6A 1PJQA 1V3VA 1ZO8A 4LSMA 4TVBA 2CUKA 3JV7A 4R9RA 5BR7A 3TFQA 1PGNA 3ZI0A 4E33A 4RPKA 4OSPA 5G0WA 4DREA 4ZICA 1YQDA 1I5RA 2XF8A 3GEGA 3W8DA 4JQCA 3KO8A 4ND3A 2FPPA 3OJOA 4NMHA 5TX7A 1I8TA 3BHMA 3ZWCA 1QSGA 2AMFA 3WB9A 2AE2A 1HWYA 3IJPA 4G65A 2Q2VA 4NFHA 4YA6A 4C4OA 4E0BA 1K6XA 3UVEA 1XQ6A 4MP8A 1HE2A 4E5NA 3JQ6A 1F12A 4ND5A 3AY7A 1DSSG 4A27A 2NACA 1ADCA 1VPDA 4RVSA 3FWNA 1E3WB 3PDJA 1D8AA 3ZWAA 4DIOA 1MXHA 4N5NA 1YL5A 3RUCA 3LDHA 4XB1A 3AU9A 4RV9A 3ASVA 1XU7A 3ZGYA 3C7CB 1EE2A 2DFVA 4HWKA 4NR0A 2O3JA 5CPBA 3PIDA 2GERA 3DBHB 3DL2A 4CUJA 1UDBA 2O50A 3D5TA 1U2GA 4W9NC 2IZ0A 3AI3A 4OXNA 3HQ4O 4M1QA 2QQ5A 3VZQA 3L07A 1O89A 3A9WA 3SVTA 4U5QA 1XDWA 3OM9A 2UAGA 4UVDA 4CQMB 1JQBA 1FDWA 1O6ZA 5DN9A 1U28A 4YDRA 3NKLA 3U09A 4GH5A 3V5NA 5KJEA 3H9JA 3JQ7B 4I9NA 2W4QA 4W9NA 4J3FA 1QYXA 5B4UA 3WGHA 2LDXA 1Y8QB 3U49A 3GNQA 3QWFA 3AOEA 1K5HA 4J1SA 3UXYA 4YAIA 2P68A 2YV3A 4CM4A 5IJZA 1RWBA 4XRRA 4GLOA 3ZNNA 2QYSA 1ZVMA 1LI4A 3QJ5A 2EGHA 3G3EA 3WWYA 4RF2A 2VYNA 3GZ4A 4PLVA 4BNFA 3MJCA 4WGGA 5AOVA 3GQVA 1N5DA 1LNQA 1ZMTA 3C1AA 3GDFA 5EIOA 4NNJA 5EERA 2FPGA 3ST7A 3GC6A 4PG8A 1EFLA 4BNIA 2EW8A 2BGLA 4TZTA 3KV3O 2Y1EA 1BXKA 2JHFA 3F9IA 4BNNA 4BKPA 5I8WA 3G1UA 3VKUA 1WDMA 4CMJA 2QRKA 2DC1A 1WZEA 1YBAA 4FFPA 4ZQHA 3EVNA 5COBA 2IYOA 3IKTA 4FDAA 1EK5A 4E6PA 3WICA 2ZJ0A 3K2BA 4J49A 2DQ4A 3HE3A 3LT2A 1E77A 3AUTA 1QYVA 3T4XA 4QSMA 1VSUA 5DOZA 4BO0A 2O3RA 2WYWA 1DHTA 1LU9A 5ER6A 3C8MA 1UXGA 1Q0LA 1K0UA 4IDGA 4Y67A 2GSDA 4JP3A 5JC1A 4WNIA 5I7EA 2X9GA 4X54A 3H5NA 3RFVA 3GAFA 2OHXA 1ULUA 4L4RA 4IDDA 1SEPA 1RM4A 4XQCA 4RL6A 4YAEA 5TT0A 1R4NA 5JE8A 4QEDA 3CPSA 3Q1LA 3ZV4A 2X6TA 4BNUA 3S2GA 2ZTUA 1MLDA 3UGKA 3OIDA 2BH9A 3D0OA 3L6DA 2D59A 3GHHA 1Q0QA 4B7UA 4IUYA 3IDSA 4Z0TA 4P38A 5U9CA 1JVSA 4BVAA 2JFGA 3JD2A 4ESOA 4XRGA 5A9TA 3PVZA 1KETA 3DOJA 1PWXA 1DRUA 2NU8A 4JBHA 4MVJE 2ZK7A 5CAEA 5F1OA 5IN4A 1Z74A 5I9LA 3GGOA 2VNAA 3LF2A 4HFNA 4TRNA 1JKIA 4BGVA 3ANLA 3JQEA 3KYCB 4N18A 5DCWA 2JD0A 4CV3A 2XPCA 1AXEA 1VC2A 1LUAA 3WSVA 5L7TA 3QV1A 3AU8A 3ZDFA 1CQJA 5L4NA 4JLWA 4DQVA 4FFOA 1UUFA 3QWBA 1E5LA 3E03A 5IDQA 1PR9A 3QWHA 2E82A 4FN4A 2NQ8A 2EERA 2HU2A 2CF6A 2VYVD 4IGEA 1FDUA 3CH6A 3BAZA 4NBUA 1M75A 4Z9XA 5FYDA 3WIDA 1RM0A 3PJDA 5LDGA 4AG3A 4CLOB 3K30A 2NWQA 2NVWA 3B1JA 2VWHA 4IIVA 2C5AA 5L3ZA 1ZSVA 3IOYA 3D5QA 2XXBA 1KERA 4HNHA 1XQ1A 1IPEA 1XA0A 3OH8A 4CPDA 3GNTA 4BV8A 1GUYA
chains in the Genus database with same CATH superfamily
3N7TA 4W6ZA 2I3BA 1KOJA 1P5RA 1E4OA 2BW0A 4HOYA 4RMNA 3VI3B 1NWCA 4ZAYA 1ONSA 2AFIA 2HT6A 4TWAA 4XDZA 1B43A 3GLFE 2Q28A 2HJVA 4GSLA 4PBRA 3RYIB 3EXEB 1BXGA 3CZCA 3SSAA 4M22A 2G88A 3WMGA 2F8TA 2HMAA 3CC8A 4QT4A 4XGKA 1YHYA 5BRJA 4L4XA 1W9MA 2JIRA 2WE8A 1YR1A 2NG1A 4FJ1A 4US2R 1KTIA 1WRBA 3CLRC 3FLAA 4HYYA 1R1DA 4I9FA 3OIGA 4YRGA 2CV0A 3QE4A 3RFFA 3DEKA 4KR3A 3HYLA 4J0EA 4M88A 3TPCA 4RTNA 2QU7A 2RBKA 1JX6A 3QF4B 4RX1A 2E4VA 2Q49A 2O3UA 2EWWA 5AXAA 2NZYA 5L7YA 4MUFA 3R75A 4RTQA 5L7WA 1ZUHA 1CJUC 1RJDA 3F6RA 4ETMA 2R1UA 3LHSA 1S4MA 5HIAA 3GF4A 4HGZA 1OIVA 3K1TA 1VTKA 4LZNA 2BCGY 2DEUA 1HYBA 2O0KA 2SECE 4WLNA 3C15C 1R0BA 3NXKA 4JVLA 3LT4A 3NEPX 1TMOA 4WLEA 2CLDX 3ZD7A 1MR3F 2M2IA 2C82A 4BNTA 3UUWA 3HHEA 5AW3A 2UKDA 4RKQA 3RTBA 4OA5A 1T2AA 2FF5A 1TK9A 2MSNA 4S0XA 5KBYA 1M2VB 1XRRA 3TB6A 1VKZA 4QPNA 4FTWA 5B6PA 1AZSC 4ZVNA 2WIAA 5ED4A 1XZNA 2OORC 2V7EA 3K53A 1EZZA 1I2MA 1ZU5A 1CFZA 1FTSA 1N2HA 2DBRA 1A95A 2GETA 3K9NA 4HVTA 3CEAA 4P0TA 5CU7A 4BX9A 4U7GA 5JRZA 3ZXUB 3MUFA 1P7WA 2EKPA 4QU8A 4RV5A 2XMQA 3PXUA 1ADGA 3AB3A 2Y6UA 1Q7RA 3A2NA 2PSFA 2PUEA 1XNQB 4OLJA 1ECJA 1AKEA 3PFWO 2R2AA 3TLGA 5M7EA 3T3NA 1UKBA 4NXMB 4EPXA 3MZ0A 2WE7A 4OD0A 5KMGA 3GIWA 2Q3DA 4RZHA 2ZE6A 5F21A 1IHOA 4HEA6 4Y2JA 3WX0A 4CMAA 1R0ZA 4AKIA 1X0VA 1U8TA 1II0A 3OT1B 4OBBA 3WLEA 2IUFA 4G4GA 5FP0A 1TU4A 4DS3A 2I4TA 4GEGA 4J7UA 2D1YA 4F85A 1EWTA 4C1BA 3DZBA 1A50B 4BBZA 4ZI7F 1Y7LA 1C30A 2OWDA 4X20A 4L5BA 3IPRA 2HA3A 3FLMA 4MI9A 1WD7A 3AESA 4A82A 1BKDR 1QF6A 2K4MA 2V8BA 1FUYB 2CEKA 2PCLA 4ARVA 2OGUA 5IYZB 1CB7A 4NBVA 3BAFA 5H82A 3TCNA 1VCHA 3D7NA 5B2FA 1KQFA 1TO2E 3X1JA 1KY4A 3VC3A 4UEQA 3OLVA 3T41A 2XJ9A 1UDCA 3VZRA 3O2SB 4PTZA 4NCAA 1YZTA 4KQXA 4CIVA 2W42A 2RMKA 4DDWA 1JEJA 1FXUA 1XWIA 3EGXB 4RD3A 5GGYA 1JP7A 3H2BA 4X62B 4MKFA 1GZUA 4MV3A 2VWQA 1CR0A 3HRIA 1Y8ZA 3SCZA 3L77A 3ZY3A 4BQIA 2FFQA 3CNBA 1IJFA 1R16A 4L5IA 2X0NA 3A1VA 4XWKA 1QC5A 3I23A 2JLZA 1CF9A 3I9MA 3DMDA 4RCZA 3HKCA 3NHBA 4M38A 1IN6A 3T0IA 1W48A 4HWGA 4TMFA 3GLGE 1KEPA 3CKLA 4Y9SA 3EH1A 4HNVA 3RUEA 2ZAMA 3ZLUA 3R6WA 5CXUA 3IP9A 4LKOA 5DBOA 4E30A 2QNBA 5DXJA 3R9XA 1L4BA 4IMRA 4YDHB 5CH8A 1UOOA 1Z16A 5AKZA 5EIEA 1T3LA 3AR2A 5HOQA 1DEHA 1KYZA 4KDEA 5ETJA 2B1GA 2GEDA 4TLMB 4Z1OA 3SZMA 3GUVA 3GNLA 1LQTA 4YQYA 2WM3A 4QC2A 3K3PA 3T3OA 2JGEA 4QRDA 4B0OA 1N0WA 3INGA 4RADA 5AM5A 4L0QA 4UHHA 2YVUA 2RHJA 5JT1A 2IPLA 3CRMA 1ZN7A 3KP1A 3DV0B 3GK3A 1NMZA 4IEFB 1RWVA 3QPDA 5KVVA 2G70A 3PC3A 3SYLA 4BKMA 4ZQCB 3RROA 3CCBA 4KBGA 1GQQA 2EVWX 1EG7A 3HHPA 2OLKA 3UK2A 4KXWA 1E2IA 3SKYA 3PC2A 4MWBA 5JSKA 1J8QA 3OFJA 1EB9A 4PAGA 1SUBA 3Q8LA 1M7HA 1H4VB 3SDZA 1XHLA 3WYEA 5FTMA 1GT91 3QY0A 1XNHA 2R66A 4ZPJA 3BMNA 3LAWA 5A71A 4EO7A 3ILSA 1VPWA 1KRWA 2ATCA 3QOFA 4IIUA 4Q48A 3ZU4A 1HEUA 4AC9A 4MYHA 3TE7A 4EF5A 2Q62A 1WHTB 5TR9A 1GL6A 4ZEMA 3KYDA 2X77A 2I8AA 3G9XA 4JAVC 3PK0A 3KLNA 2GCOA 4GMHA 2BM1A 3T12A 5EKUA 3VTKA 2O8DB 3P2YA 3FJYA 3PNBA 3BF7A 3ROMA 5DM60 2XDWA 1XJCA 1ZD5A 1H5QA 1WEKA 2H7CA 2Z5VA 3O9VA 3RO7A 3RU2A 3RTAA 2XNCA 4C0XA 4KBFA 3QXXA 4QULA 4UREA 3HGQA 3PZRA 3U37A 1EUDB 4HK4A 5KS2A 4Z9YA 2Z6UA 3DB1A 4YWJA 4LZWA 5JJCA 1NMSA 8ADHA 4JROA 3G49A 4H9GA 4L27A 3KQOA 3J7AC 1XFDA 2WHXA 2WSMA 2Y1OA 3ZI4A 3ZE7A 2PTHA 3WP0A 1TK3A 2IXGA 3A4VA 4LGVA 1UANA 3PR2B 3TD9A 1Z4IA 4AWXA 2PMDA 1BJKA 3EZLA 3IE0A 1LXCA 4B2IA 5BMVA 1E6EA 4LRWA 1CUFA 3LPCA 3OZIA 4BE4A 1GEEA 1N75A 4BZQA 1MB9A 2FPLA 1NA5A 4I7EA 3W2FA 1G6KA 1NTOA 4LSZA 4ML3A 4JBXA 3U0BA 4JOBA 5JV5A 2F9FA 2J87A 1AK1A 5A4KA 1JHDA 4S04A 2EG5A 2SKCA 2ZP1A 1V37A 5K2OA 3E58A 2FFAA 3B60A 3BJRA 3EZFA 3IEPA 3PQ7A 1PT6A 1DDGA 1WKVA 3O1IC 1IN1A 2IOYA 2I7VA 1XMXA 2H16A 3L1IA 4GR9A 5ES4B 2HGSA 3N0XA 3CF0A 3Q3VA 3QELB 4LTDA 4S1WA 3UWSA 4D92A 2PEYA 3QKIA 1GUFA 3AFHA 5KTSA 1XEXB 1ZK4A 1ZOSA 4G8CA 1QTNA 3VFDA 3G0OA 4HJRA 1S3FA 2HOQA 2WHEA 4AN0A 1F0YA 2PYDA 3O93A 4R1TA 5F3DA 4V1CB 4D0SA 4TMZA 1JVNA 2PYIA 3DKIA 3VHLB 4R8SA 3EXHC 3FTCA 2AFHA 2IELA 2VSYA 2C3YA 4JR2A 3L41A 1XVVA 4JLNA 4YP6A 1DJQA 1GUAA 3P0FA 3PDWA 3KCQA 1DMRA 3D1LA 2WVAA 1YRBA 3N2GA 4Q9KA 3QI2A 1I2ZA 2YCBA 3G9UA 4PQRA 4DGSA 1S7CA 3LBHA 3OP1A 3JQCA 4KQ1A 1OFGA 4ZI5A 3E1GA 3TQSA 2OKGA 3ZGOA 3A2LA 3L9WA 3JVEA 2FJUA 4EJ0A 4RUKA 2QX8A 1PHPA 4IIFA 2VNHA 2GEUA 2YV2A 3I53A 1HR0B 4QM6A 1FFWA 5HF9A 1EFPA 1GN9A 2YL2A 2JVKA 2VJMB 4YDSA 3RIGA 3E8MA 1FXWA 2BZ0A 3EULA 2FRDA 3ZV7A 1WW2A 5EL0A 2UDPA 3AZQA 3DE4X 1IHDA 3PNLA 1J22A 1PJLA 4V24A 3WMRA 2Q7OE 3OECA 3U62A 1ZNXA 4BGEA 2D3WA 1ORTA 3FOEC 4HLQB 3PI6A 3H4IA 2GGSA 1KVUA 2GA9A 3WRWA 4JT2A 2RHGB 3B1ZA 5BWOA 1YDHA 3QWIA 1DC7A 3UZUA 4J16A 1RSZA 3KBOA 1TM5E 3EGIA 1O54A 3IAM1 4LWZA 2BBWA 4YH1A 4MTCA 3BJEA 3TLYA 1P1JA 4R71A 1YZGA 2Q5QA 4GLJA 4IGFA 3R7NA 3D7KA 3W3AH 1XJWA 2QTHA 2C4VA 4QARA 3H2SA 4YQEA 3RH0A 3T6KA 5AVXA 3GJ6A 1W85A 1I0ZA 1WO8A 2EOAA 2GJ9A 2Y1LA 1ENZA 1I01A 2FB9A 2QM0A 5F3RA 3R9IA 3K05A 4IIEA 1V5GA 4A91A 4C04A 4D8TA 3THWA 3RI3A 1C8BA 1E7QA 1VHLA 1EH5A 1NUQA 3QFSA 4INZA 1DLJA 1KFJB 4J75A 4MGYR 3RRJA 5FAXA 5YASA 4IDOA 1QHGA 3IVGA 3F67A 4FK8A 4YCBA 1RJGA 3DYIA 1P39A 1SA0A 3OZUA 3SHQA 3V48A 3QRWA 4DC1A 3SYNA 4KVAA 1FFGA 1Y3HA 3ZCUA 4ENTA 1UZMA 4I5IA 3RU7A 5AJUA 1HXHA 1KR5A 4DM7A 2IZ6A 5M2QA 1AY0A 2F3UA 2A5LA 3FDIA 5A0FA 2A9PA 3NIWA 4YJ2B 4J0FA 5K3OA 2YIVX 3P9NA 3Q8KA 5JSHA 2YHIB 3B70A 2Q2WA 5JVDB 4OTZA 2FPMA 1IVSA 4DCSA 2JBWA 3G6WA 1JLHA 3U5ZB 1TEZA 4ARAA 3NI2A 3LGXA 1J1ZA 4BMPB 1BS1A 4MV8A 4OIFA 4CFZA 5FTLA 2X19A 1ZD9A 1BN6A 1KL7A 1GTZA 1S7GA 2G9UA 4JDUA 4JB0A 2CF5A 5DHQA 4H15A 5C7LO 5FR2A 2PS0A 5JH7A 2WC1A 8ATCA 2WKRA 4MAFA 1Z36A 5F7XA 1JKJA 2NXCA 5EZQA 5FUBA 1ID8A 2Z1NA 1QO0D 1FFBA 3STXA 3F8TA 2X1HA 4LKRA 2WLTA 2AC4A 4Q1EA 5KYGA 1D6SA 2OZLA 1B6SA 4PEVA 2AMJA 1AJEA 1V4BA 4GRAA 3M3HA 3UY4A 5KX5F 1UKEA 2FZ4A 1HFEL 4MP3A 3UJCA 1MQ8B 1HK7A 3LKZA 4EA9A 3FTDA 2XGGA 5KQLA 4YP9A 4DG8A 4HGQA 1WD5A 2AJ8A 2ZT5A 1YHNA 2AOWA 3LIIA 4G2TA 8AT1A 3C7KA 3LUKA 3V4FA 4WEOA 1YVRA 5CGZA 4HWPA 3TYXA 1I5OA 3N58A 4UBLA 2YJ3A 2VQFB 3PR1A 3RFUA 2XWBF 4PGGA 2X6QA 4H6VA 3ZLBA 1YBMA 1HT2E 4JEIA 2FEAA 4TT3A 1RAAA 2ZSIA 4PC1A 3VYVA 1EWVA 4FZRA 2YFHA 1VIDA 4UUPA 5TEVA 3SYRA 3G5AA 5LQAA 3SC3A 1WNFA 2H08A 2ZJ3A 3D6TB 4JGGA 3PPVA 4KQIA 5HTKA 1KO4A 3V1UA 4UBIA 5DHUA 3RJ5A 3PLAE 4JC8A 3O8QB 1ZIOA 5E9JA 3TIIA 3B5JA 4U9HS 3NKVA 1IG3A 5BWLA 1KF0A 3TNFA 3OAAA 5IJ0A 2PE5A 1UC4B 2PEZA 4GNRA 3WQHA 3BHJA 1LPMA 4NZOA 3H13A 4P54A 5LOVB 1NVKA 1MAWA 4MICA 3TJRA 3W34A 3DLHA 4PIPA 1ZM3A 2BTQB 5CH5A 1RWOA 4L9WA 2ALJA 1BS2A 3NEJA 5IAEA 2OM6A 1XIVA 2R00A 2VPYA 3QGMA 1EYZA 3RRMA 4EDFA 2J6BA 1SU6A 3BT7A 2YZ7A 1V5EA 2EXXA 2BRUC 2CHGA 3CBQA 2VG8A 1YCGA 4GM0A 2QPLA 4U2KA 1T5DX 2RGYA 3SVLA 1FMJA 1OY1A 2HRQA 5JD4A 1U3VA 2B98A 2JFOA 1T24A 4TYMA 5KCZA 4RWEA 1AKNA 1KKLA 1YDFA 4A1OA 4CBVA 2I6TA 2PHZA 5AH0A 3F90A 3ILYA 3UMFA 3C5VA 3G0DA 3WK7A 4EHKA 5F7OA 4JI2B 2MHCA 3GLHB 1N77A 3K2QA 3NO4A 4M8NE 5HMLA 1VBMA 5EJIA 3DE7X 1J8DA 2JJYA 2ODNA 5AKGA 1HOTA 1CZNA 3IOMA 4OHXA 3V7WA 4AN4A 4IDBA 4Q3DA 2H63A 4R9VA 2H92A 4IJ5A 3KSAC 2RCNA 1OI7A 4CIWA 1U5AA 1GCIA 2ZIUB 3GLVA 3GMDA 3FPKA 1K2WA 1SCQA 4RA6B 2OT3B 5AMXA 5GZ6A 4RIEA 1IXKA 2I0FA 5LZ8A 3PCRB 3VM6A 5GZ3A 4PANA 2IUYA 1NMQA 3VR2A 1H1DA 3STUA 2CWWA 3DE5X 2QRGA 5K20A 3WNDA 5K4GA 2IS2A 3SF8B 3E8SA 3ZN2A 3WB1A 1ZN9A 3OQ6A 2Q2NA 4UARA 4D82A 5E1MA 1LTQA 4NENB 4OUKX 1GG9A 4D8VA 4N47A 3JRXA 3TMKA 1ANKA 1HFJA 3NYQA 4L95C 1JIIA 1NP6A 3EARA 4TV9F 4DKJA 1ZUNA 2BDTA 1DQRA 2CNWD 3A6PC 3FYTA 1KH3A 3CZQA 4C2TA 3H6HA 2CLFB 1XELA 2V45A 3STWA 4RQBA 3BYZA 1N5JA 1GA6A 1SVMA 1Y6RA 3L3BA 4ALJA 1YQQA 1S2IA 4DXAA 5B37A 3DOOA 4BVEA 4CCYA 4MUNA 4GAEA 1L1FA 1JS1X 2H06A 1E3IA 2R6R1 3AB8A 2EW1A 3BE5A 3PJEA 4R3WA 3RRZA 5A0VA 9LDBA 3DEAA 3FHJA 2PWBA 1UBTS 2HWYA 4M1EA 1XX6A 1DC5A 1Q7BA 3T0FA 1UT6A 3TZ6A 5KWSA 1NVVR 1OH8A 2Z9CA 4M1YA 1QQ5A 3KOUA 4OUDA 1HYHA 1PEDA 2WTUA 4LNUB 1T9CA 3OURA 4UDXX 3QU4A 3PQ4A 2FFHA 3RC8A 1JJIA 1ZHFA 2PT6A 6REQA 1QZ3A 1CRPA 3R3WA 2HD4A 3RT1A 5JJ5A 1KHTA 3VRHA 3UT5B 1NKSA 1RXSA 3WMWA 4QECA 4F56A 1NR1A 4X1KB 4HH1A 3TTTA 2Q6KA 5L3QB 1NW7A 2EF1A 4I66A 3RVOA 3N5CA 4L9SA 2G7MC 3OIUA 5AVYA 1UBSB 1H4QA 4UM8B 3I5MA 3MCUA 3DAFA 4MVJM 3JWEA 5TVGA 1Q0TA 5FL7A 1KQNA 4I46A 1RS0A 2EBFX 1OXMA 2UZ4A 4B46A 1E9FA 3SBEA 4DJDC 1JYEA 2HMVA 4PLCA 4XGRA 1UBEA 5EIHA 4RBNA 4A36A 3IH5A 4EM6A 5BV7A 2NZUG 3I01M 2OO5C 1MOZA 3IQHX 4FGUA 3B52X 1T2DA 2OV3A 3SVZA 1MRNA 1U3UA 1X7XB 2HBZA 2D2IA 4LWQA 1JR6A 2FLKA 5DP1A 4JJEA 1J0DA 2JBHA 4ZTZB 1ZK0A 3ANNA 3GUHA 4S1NA 4AS1A 1UMBB 4F12A 3GYBA 1M6VB 1Q7GA 4NCJA 4UVHA 4UVIA 5IJAA 4BKQA 3GT3A 4BQOA 1U3GA 2Q1TA 3D6FA 1F2TA 3DEFA 3SZUA 4O1HA 2R87A 3UQZA 1AKQA 3H97A 4KDCA 5ECYA 2J1LA 4ECEA 4LMPA 3FKJA 3ESQA 3V1NA 1JECA 2EQ5A 1STOA 2FPIA 2I3AA 3ETHA 3K2IA 4JN6B 1ZWLA 5HIKA 2ZIGA 3OPYA 4ZI3A 1R4MB 3O82A 3VZDA 2FN7A 3DHYA 3LDUA 4TKUB 3LF1A 4TMYA 3SXJA 3PITA 4P5PA 1FYWA 1Z37A 2WRZA 5MN4A 2UZ3A 1PYOA 4BHTA 1C0EA 2YQZA 3OBIA 4TN5A 2GYYA 3D6NB 4AFNA 2AI3A 1MO6A 1EM8B 1YCDA 3F74A 4LTMA 5ESWA 3C8ZA 4YR9A 1Q1GA 4QDOA 4DA0A 1U65A 3ZW9A 2J9FB 4MPPA 1NQ5A 4JNCA 3NBZC 3JWPA 3CFYA 3FPSA 3MXOA 5ALTA 5B64A 1M1YA 1R5JA 1J2TA 2BDUA 2LR0A 1M9NA 1L4YA 4JU8A 3WRXA 1KZGB 1V16A 3QF7A 1VB5A 2RGCA 1SU8A 2AJDA 2JFFA 3P26A 4GMKA 4I19A 4RZSA 4G5HA 2Q9CA 4NXNB 2O7NA 3K94A 3ZWPA 3K6SA 1KGDA 2H29A 4B6OA 2W22A 5J40A 2RHDA 1NXVA 1YC2A 1DC8A 2P2LA 4HN2A 4S12A 4ZAGA 5TPWB 2HRZA 3ABOB 1RADA 1Z4LA 1L5VA 1MC8A 1WCXA 1RXVA 4ZO7A 1DKMA 4AJJA 1KPHA 3FBWA 5ENZA 2MCFA 1QB7A 1ZGAA 3JQAB 1VMIA 3A06A 4AKHA 2X3FA 3OD5A 5C37A 5AIAA 2ZUEA 4DA8A 3OX1A 4HB4A 1QU3A 3NBMA 2OV6A 1YQEA 3AFMA 1JQ5A 1P1CA 3L6RA 4DLYA 1XZBA 2CNDA 3MTIA 5JMOA 1F4LA 1OFIA 4CETA 1IZZA 2PRYA 3LQYA 4G01B 5JADA 1IBMB 4XDGA 3NM4A 1BTOA 5FIUA 2CMHA 3T5PA 4UUAA 3JQFA 2YXNA 2F48A 2Y6VA 1Z4JA 4KWEA 3LXXA 4EY7A 1AQUA 4A23A 2QGNA 1IULA 2DCUA 3EY9A 1UAGA 4HMQA 1O77A 1EAYA 4E88A 2MYTA 4EVIA 2LXNA 3AUSA 1T4MA 4X90A 2CNLA 4FXOA 4MP6A 4C0JA 2VSOA 4DARA 3BRSA 1CUZA 5IEBA 4UC0A 4F4DA 5L3RA 4R9NA 4L85A 3O8BA 5CEEA 2ZXFA 4G97A 2DH6A 1GPDG 1L4FA 3C1TA 1VP9A 2PVSA 2ZUDA 3I6BA 3KR1A 3OKFA 2FMKA 4OBEA 4P3NA 3T5BA 4E1BA 1Y3BE 5GWXA 4ZVQA 1I6MA 3HJGA 1GZ3A 3KDSE 2HHLA 4X66B 3B1VA 2GZ1A 3FCCA 4NJMB 1GU0A 5EVJA 1BAPA 5BNFA 4TL6A 3IB6A 1YVPA 1XVLA 2WU0A 2PLRA 5LP6B 3JWGA 4KLCA 3RIHA 2I9PA 3WZ2A 2WFLA 1YQXA 4FFNA 3FWPA 4UUOA 5HCNA 2AQIA 1IVNA 2BLLA 2C92A 3D8UA 4U1RA 4X1IB 4XTRA 1FL9A 1OFTA 1XV5A 5FPTA 1SKYB 2HA4A 4ZOBA 5I4KA 4YJFB 5JDCC 3L79A 1CE8B 1OXKB 4CLDA 1H3FA 3JYOA 2HQ1A 2HCFA 1LLCA 2ZJ1A 2OHGA 3FWZA 3HCBA 4I1UA 2BGTA 3M6UA 1YO6A 2YWFA 4GGMX 2VBFA 2CHEA 4M0LA 4W9RA 3WYBA 3GDOA 2IYZA 4F3CA 1V1RA 5EUMA 1RMTA 4C6TA 2YHUA 4XYLA 2NUPB 2CJPA 4ZOCA 1ZQ1A 4RLHA 3I28A 1Q5PA 2OCYC 3F97A 3ZVMA 3JZFA 1TYDE 10MHA 3C4JA 3RR2A 3ZX4A 5AVRA 4KLNA 3QV2A 5IJXA 3U4HA 1UP4A 4URFA 3KETA 1E9EA 5LQCA 1OLUA 1B3RA 2BZSA 5JNTA 4KYUA 4WECA 4B7AA 2PJRA 1W8DA 2NTNA 3N9IA 4GBJA 4LZPA 4YJDA 2XOKD 3QVMA 5EKSA 2CXUA 4CCWA 4HXEB 3UJ6A 1DAIA 3L0OA 2CLOB 1KDZA 4ZDJA 2C61A 1F1JA 2DT5A 1E2LA 4EY4A 2CMKA 1T9GR 3QU9A 2XH8A 2IHZA 4A0GA 4P3XA 5KWEA 4YRLA 4HWOA 1S02A 2FU5C 1MFZA 3CX6A 3U4DA 4MKXA 2J6IA 1IOLA 1D0IA 3IMGA 4EI2A 3TI7A 2C9CA 4YPVA 2QLJA 3L7YA 3T15A 1M5RA 1E8NA 2MYPA 1O8CA 1SCJA 3ZWWA 1FUUA 2PZBA 2W8BA 3HSYA 4MSUA 1E1MA 1UPCA 2HJ9A 3AUKA 2F3SA 3JW8A 4KGXA 4N39A 4XCQA 3UIEA 3EUAA 1VIAA 5J2TB 3N0TA 4I81A 4N7RA 3T3IA 5BNWA 2KWIA 5JFOA 2DRIA 3GH1A 3NAQA 5CG1A 4X41A 2V58A 2PRKA 1QGAA 2IWRA 1KQ3A 5DBEX 2P69A 4EX7A 2BD0A 2GR9A 2R68A 4M86A 4PLPA 4MW7A 1Z5PA 4BLVA 4OXXA 4YRCA 2IHTA 1SXHA 3WWOA 2XHZA 1DPFA 4MR8A 4JA0A 1LBIA 5CCDA 2O3TA 5LYYA 4FOPA 4HGNA 1TO6A 3YASA 4AY3A 1I4TD 3VPFA 1ZRHA 2R85A 3EXG2 1JXAA 1G7TA 3FETA 5J2UF 1U90A 2BZGA 3G1TA 3ZHTA 3KV1A 4KE7A 3PGKA 4RQTA 3T1YB 1VJCA 2PUJA 3I12A 1DAHA 3O0TA 6GPBA 2D5AA 2E0IA 2PJDA 2FK8A 4OQYA 2PL3A 5TXGA 3TQRA 4V0MA 4YQZA 4CUZA 1YQWA 1FPMA 1Q0PA 4WTOA 1L5GB 4AI6A 1VYUA 3HDHA 1XVUA 1A7KA 1J8YF 1CPYA 1TM4E 1ZD2P 3A6KA 3IKMB 3M3PA 4XVHA 1T9ZA 2NT4A 2NUBA 2QN9A 5DSTA 3RV4A 3V2UA 2ZANA 4MUBA 1QQ6A 5GM2A 4N0QA 4DZZA 3CN7A 2YWDA 1XCJA 1NNEA 2QROA 2C7OA 1PTJC 4NV1A 3K0AA 1CJBA 2P9GA 2ECPA 1D6JA 1KYIA 3HCDA 1MP0A 2GPYA 2G83A 3HUEA 3OZRA 3QNWA 4HDSB 4HUQA 4GC9A 4BFTA 4TKVA 4LQDA 3TO5A 1KDVA 1K63A 1L3CA 3DBOB 3GLTA 4N5LA 5TF0A 3FWKA 3NIDB 2E55A 2Q0XA 1NY5A 5BORA 4JB8A 1WM1A 1M8JA 4FE3A 4OHMA 3RFXA 3UWMA 4BB0A 1N3LA 1LEHA 4ZAWA 3SJUA 4G26A 1NOKA 1E4EA 4UOZA 1Y5IA 4OH7A 4R9SA 5BSEA 2X1VA 3K9GA 4E3WA 1FX0A 3AVVA 1C80A 5JSUA 2MT9A 1FYFA 4PLZA 3UMCA 3VX4A 2QPAA 1TU0A 1R9MA 2I3GA 2KM1A 1AXRA 4HAOA 1X6VA 2X7JA 4PAMA 3RYHA 5EJ4A 4XUCA 5EJ8A 4ZO8A 3U3MA 4IX1A 3W5DA 4M49A 2W2MA 5LXTA 3VPGA 2XUJA 4K1LA 4XD7A 1SXJC 1E7YA 1U98A 4JR0A 3U9TA 2AYYA 4GUAA 3EGCA 3SQOA 4F4IA 3NV9A 3JRWA 2P4EA 3VU8A 2I91A 1D04A 1T8PA 2QW0X 3GEHA 3GXBA 5FI1B 1NVGA 1PWEA 5DASA 2QXUA 2EKZA 3R09A 3ORQA 3EC2A 2KJQA 3UCFA 5HKOA 4IIJA 5FA6A 1IM8A 5CA1B 2WMYA 4KPUA 2ZJ5A 4Y6QA 5BUSA 3D2CA 3OUTA 3QMWA 4EHHA 2H51A 2MSEB 2ZG6A 3E3NA 4JUIA 3K8OE 4LJ4A 2Z6VA 3FY4A 4GF5A 2DMRA 4M0UA 3E22A 4N7MA 1CUSA 1IFXA 2NV6A 4DNQA 1XALA 1C9NA 3HP4A 5SY6A 2JI9A 4LY9A 3C5HA 3DMHA 3M6AA 4AULA 1T9KA 2AYXA 5BR4A 1E1RD 1GGNA 2ADMA 3WLPA 1GARA 2XQVA 3C8UA 2LKDA 4HKTA 3LFUA 2NPFA 3PYXA 2QGFA 1DRJA 2BBSA 3R7WA 2A4MA 2CJFA 4OY3A 2FOXA 4CLRB 3HYCA 2NXJA 3FSEA 3Q6IA 2O2HA 2G3YA 2FCAA 2ZWAA 3EIHA 1QH1A 2LP4Y 3M9LA 3OEHA 1EVJA 1IAQA 1UKCA 4EBFA 1U9JA 3P5SA 1WPXA 2Z5LA 4N5DA 4GKVA 4WOKA 121PA 1X8XA 1XKXA 4FDUA 2CLSA 1GFIA 3JYPA 3BSFA 4II3A 5JDIA 4AUMA 2QRUA 2EKQA 3CUWA 4OQNA 1ZEJA 1BH6A 5ALMA 2JJ1A 2AHRA 3ZKWB 1OFUA 4MMZB 4PHCA 2XKKA 1SD5A 5I9TA 1KZ4A 3FHOA 1OKKD 5A1TA 4E21A 4IG9A 5I7UA 4YIHA 3KXPA 5CDHA 3G0HA 3CF4G 5FA5A 2BGGA 3KOOA 3QXGA 2YIMA 5D85A 1UOQA 1CYEA 1VE9A 4XQEA 5E6UA 2YUIA 3AEKB 1BGWA 1HL7A 1F14A 2DQYA 3LNCA 1IJEA 1UXOA 2CDRA 1XPRA 3DXYA 3G59A 1W29A 1TDJA 1XVIA 1F38A 1DBIA 4R1NA 3HABA 5ALIA 4PX2A 4WXYB 2YTZA 2EZUA 1QJ4A 4XZ3A 4GECA 3PQ6A 4RULA 2G5CA 5TB5A 2J3HA 1UADA 3ZDCA 3LM8A 4XIGS 5BN3A 3SHFA 1SXPA 2V4MA 4DUGA 4KAXA 1YONA 1ZGGA 1K8RA 2JFQA 3H86A 3IUNA 5DO9A 4K81B 1IBLB 3H5LA 5JZOA 2NO5A 3GWZA 3G2PA 4MR7A 3NNSA 1RLIA 3R2JA 4ER6A 5ECWA 4PHGA 3JQBA 1ONOA 5IWAB 1U0SY 5ES3A 1UCFA 5DVZA 3JAWB 3PQ2A 2HF8A 3IHKA 2PDAA 5JZSA 1XAIA 3TOZA 1H2XA 4J43A 1V6SA 1TTQB 3FFXA 4F3YA 3UPUA 4CV1A 3EDRA 3EK2A 1A0OA 2VATA 1L2TA 2VBGA 1NIPA 3NH9A 5EN4A 4C07A 3BUSA 4EGFA 4YALA 2GAFA 1QDLB 3SFVA 4I9HA 5EI5A 3ZWXA 2FN8A 3FCEA 3CWQA 3GGCA 2ANCA 3TTSA 5EMJA 2C98A 5LD2B 4B4WA 1J6UA 3RUFA 2WQ7A 4DLVA 1SVLA 2GNAA 5I4BA 1U8EA 4QGFA 1MMFB 4EEZA 1QBKC 4GWLA 2IPAB 4FLFA 4QDXA 3RSHA 4ZMBA 2C9YA 2CBZA 2I33A 2Z58A 3BDVA 3Q7QA 3UICA 3E84A 3W6ZA 3R7BA 3ZUGA 5A9RA 4HYEA 5L6LB 3QBDA 4PVCA 2QLLA 1LDYA 2ZYDA 2QPOA 1ADBA 1X39A 3C3AA 4IVPA 2DY0A 3OEWA 3UHOA 2FG6C 4ENSA 1IC6A 1J8MF 3GOQA 4R2LA 1MW9X 3BQNB 3JVVA 4J0QA 4H08A 4WBXC 4B6SA 3HJNA 1P4GA 2EZ8A 4Y98A 4EG1A 3H5IA 4PC6A 2P5YA 1G21A 2OO7A 1SCUB 1Q1BA 4FMCB 3RYCB 1TA9A 2A0XA 1PUJA 2QMHA 1JZSA 3GG9A 3EIEA 1V1JA 5CYFA 1XRNA 3R0JA 1HTWA 2D0DA 5DGDA 2OK8A 3SS7X 3WJ7A 1BVHA 3PUZA 2NU7A 1FJGB 1C8VB 4IZOA 3OG9A 4UEWA 5LQSA 4D3XA 4RTKA 4MDYA 1CB0A 1G19A 2A84A 3EC1A 4M21A 4MYUA 1IG0A 1M76A 3NIGB 1CSEE 3CUVA 1NULA 4P7GA 3EN0A 4QUAA 1QK3A 3OZ7A 2JATA 3JZMA 2IK8A 3HH8A 3MWDA 3O8NA 3R5JA 4JJGA 1CQXA 1RRKA 4II2A 3KPYA 3VUEA 2O0HA 1CYDA 5D2CA 2QD4A 1UOEA 3QOXA 4U9IS 3T4UA 3IXMA 3TINA 4AURA 4B4KA 2NV0A 5I7SA 3FYUA 5HKAA 2HLPA 1ZH8A 3V8MA 1TD1A 1T1RA 1HX7A 2QN8A 1ZYUA 4CDNA 2XB6A 1CUDA 3FNFA 5I7AA 5DYGA 5I9MA 3QJYA 4UDNA 4D3YA 3K0KA 2CCJA 1SC9A 3AZOA 3VKWA 3OF3A 4EB6B 3MW8A 4NULA 1GZ6A 3PHJA 1R0KA 5HWSA 4YMIA 2JFYA 4E12A 1AGPA 2GWHA 3A32A 5CYOA 2JIQA 4B34A 2YMPA 1TRKA 4JX8A 3ETEA 1MT0A 1PFVA 1RAHA 2D4HA 1MG0A 2VPZA 3Q6MA 4HMOA 1USKA 4M7WA 5JXWA 3ZV3A 1RQNA 1P4AA 3JZDA 4BBPA 4CM6A 2H2AA 1RKXA 2JFPA 5LMUB 2COUA 1DUIA 4WINA 3PEEA 2CFRA 1BJRE 4PICA 5DWVA 2COKA 1M6WA 1JI3A 4ZC1A 1XTVA 1ESDA 3AJAA 3F2VA 3PE3A 1US8A 4RLSA 1ZI6A 3U26A 3ON5A 5BV1A 5KNBA 1BFKA 2ZJ8A 3I9V1 3MYRA 4EQ6B 1PRYA 4QIHA 2Q4RA 3KT0A 3SSOA 4ZKEA 3VO1A 5C53B 621PA 2ZS9A 1VG9B 4A8TA 1VSVA 4CEHB 1MO4A 3SJ7A 4HZUA 4FC7A 1GXSB 1UQTA 4DR6B 4Q4LA 4CDRA 3DKRA 4HH4A 2QX6A 3OAAD 2RI6A 4O2LA 2F3QA 3GEBA 4BAUA 1W1UA 4EI8A 3OZXA 5I7VA 3NBQA 4IIHA 1FEZA 2QTNA 3P4YA 5KTRA 4BNLA 4F9GA 3O8CA 1DQNA 3S55A 1H1LB 1MC4A 2HF2A 3ENWA 2Q99A 3DOCA 5IYZF 1D03A 2CUTA 1PGJA 3VO9A 1CQZA 1WXDA 3F78A 3FGOA 3W7BA 1T5SA 4ROSA 1T0PA 4IOMA 1VSQA 1S89A 4MUAA 2XWJI 2OCBA 5KNDH 1JHZA 1RI4A 3TMAA 1C41A 4DAOA 2OZPA 3WKBA 3JXEA 4UMEA 4U0JA 4G84A 2CJWA 3CRNA 4U7HA 4G1VA 3QXHA 2JNWA 2WG2A 3G2IA 3L7MA 5FHRA 3ZQKA 2ZTVA 3B38A 1JDJA 1CIVA 4RD4A 2ZR9A 5CEFA 2C31A 1ZN2A 4TYQA 5CFLA 3CMMA 2HIHA 1FTWA 2JPDA 4B71A 1QHXA 2UU9B 4P81A 2R1VA 1DQSA 1O3YA 3D8BA 4ZT3A 3IOEA 4UJ3A 1JKFA 4GE3A 2QL5A 4CI9A 5GZ1A 3HTXA 5D7BA 3SSMA 2IWHA 1P2SA 3WNCA 3ZS8A 2H07A 3KZNA 5U1PA 1R3UA 1JE0A 1PYGA 1I3LA 4PCUA 4HB0A 2R7NA 4XJVA 3K1JA 1GKLA 2WD8A 1CUWA 3CVUA 3ZDQA 3I2FA 2HSDA 2P35A 2HX1A 3LTEA 4Q9NA 1XKLA 1KI6A 4NG4A 3VR2D 5I8PA 3V32A 4R1OA 2X41A 1L6IA 4KJZA 1IY9A 3CZMA 4F38A 2H4WA 1HNNA 2CY0A 4G5YA 3F6EX 4LYGA 4YAOA 3V6LA 1RE0A 3ZQ6A 5JYEA 1GYRA 5JAUA 3TNDA 2IFTA 5KVQA 2AXNA 4IVQA 5FBVB 4LOJA 1CUYA 5GOTA 4LFAB 3WRYC 2P78A 1KI9A 2IZOA 1FX1A 4CKCB 4JK3A 4PG7A 4XGIA 2BFWA 3CZ9A 5DIFA 2A9FA 4WMLA 1GAQA 5HS4A 2QNIA 6AT1A 3UYKA 4U7JA 4HN9A 1G66A 3URKA 3ZTTA 5I51A 4P0PB 2WBLC 2IKQA 3KQPA 1XAHA 4R2HA 2VZEA 3W7VA 5A4AA 2E9SA 2YN2A 4M3NA 3M6IA 3OUUA 2FW7A 3ZCRA 1DTWB 3IUQA 4ZOEA 1T2CA 3SYTA 4I3GA 4P4LA 3W78A 3MERA 4FLMA 2ZI3A 4LY0A 3UW1A 4DC9A 3OQOA 4Y0NA 2B9EA 3KAQA 3I6IA 4DSNA 4KTTE 3ZDAA 1S3SA 2QM7A 3W77A 3L4BA 3DD5A 1G2OA 1KYXA 3EVZA 3TRDA 4TUYA 2ZPAA 3R8FA 2XUKA 3KSRA 3TLAA 1MRSA 1CF4A 3FOCA 1MX9A 3I3OA 1TF5A 5FWAA 4JV5B 4TVKA 3L43A 3LX5A 3OC6A 4UKDA 3HCEA 1Y37A 3LBIA 5EJMA 1YIDA 4P5DA 4MW2A 4TMXA 1OZFA 3T7DA 5DLPA 1U28C 5KSYA 2AN3A 2QL9A 2HRRA 2ZBQA 3WIUA 1QYRA 2FX2A 2GRJA 3NT5A 5DW0A 2C59A 3EGVA 4UBMA 3T34A 1N0VC 3MXTA 1C4XA 1RKBA 4NZPA 1IZ8A 1GKUB 1PZEA 5EZYB 2BT4A 3SC2B 3NGLA 2IU0A 2MWMA 3R6TA 2IC5A 1IXYA 3AOEC 4JH0A 3W4IA 1K97A 2H5LA 1MV5A 3CH7A 4IJVA 3A4LA 5EMHA 3RIXA 1M0WA 2GF2A 2IY9A 5FL7D 3ZZUA 3EIUA 4ZCMA 4ZVRA 5AKYA 1E2HA 3QI7A 1W4LA 1J24A 3OX4A 4EHFA 3JYQA 2NSYA 1JYFA 1HTTA 4Y6SA 2FSHA 2JKZA 3LT0A 3HU1A 2IU4A 1A82A 3OZAA 1S8OA 1X7HA 2JKYA 2GJAA 3KX2A 2MINB 4RTMA 3KQLA 2GBLA 4XGQA 3WBJA 2Z1MA 2DHQA 3N8IA 3I05A 2HNAA 1TUIA 3IT3A 2JI6A 3CH4B 2YDYA 3EAFA 2IH2A 2VUSA 3MEQA 1M5TA 1GO2A 2AOTA 5JPDA 4L2IB 3UG6A 4HYTA 1WUJS 5K6RA 4F0JA 5F9MA 1Y8RB 4MHOA 4BIIA 1I6KA 1SCDA 3AKDA 4MGEA 2A88A 2PRSA 3BD8A 4KX3A 3ITKA 1UBUS 2B7LA 2ECOA 1QCYA 1RYBA 1RKUA 2XW6A 2VTBB 2DF8A 3DBLB 1PQYA 4FYXA 4KI0A 4P82A 2ZYGA 4ASUA 3AF3A 1VLJA 4TV8A 3HJFA 3TTYA 4A73A 3I6ZA 3MA0A 3T35A 2GHTA 1N2JA 3OF5A 4PSKA 4TWIA 4Q1VA 4QYIB 3B13B 1NX6A 4DC0A 3AKCA 1V26A 3OFKA 5HUQA 3BS4A 2AZMA 4KW7A 4NQRA 1VGRA 1RI3A 2EWVA 5EZ5A 4PNZA 4N48A 5L40A 5LZ2A 4ZCQA 3LOUA 3ODGA 3HEBA 1FFYA 1RQXA 2W6PA 3LL4A 2WM8A 1EEHA 1JMVA 1UC8A 4QJIA 1YB6A 2BFBA 3U7QA 2X58A 4BMCA 1HBJA 3FDFA 3OQVA 1SZJG 1XPJA 4QBFA 1VL8A 3ONEA 3B9RA 4D8UA 1SZCA 4Q6BA 2IYQA 3DDSA 3HO8A 3O94A 4WCDA 4J4BA 5DHPA 1PR1A 2NU6B 4FFWA 4HGOA 3B6JA 1V1MA 4M0MA 5A2GA 5AKIA 5MDHA 5JU6A 3ZJTA 4DLZA 5CMLA 3VR6H 1M10A 1JLRA 1JIVA 5EESA 3I5UA 1EESA