4H6XA

Structure of patellamide maturation protease patg
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
342
structure length
289
Chain Sequence
ALHPHDLDERIPGLADLHNQTLGDPQITIVIIDGDPDYTLSCFEGAEVSKVFPYWHEPAEPITPEDYAAFQSIRDQGLKGKEKEEALEAVIPDTKDRIVLNDHACHVTSTIVGQEHSPVFGIAPNCRVINMPQDAVPLNLARAIDLALELGANIIHCAEILVQAIKKCQDNNVLIVSPTGTLAVGAAKVDGTPCHFSNNNTKEGILAPGEEILGAQPCTEEPVRLTGTSMAAPVMTGISALLMSLQVQQGKPVDAEAVRTALLKTCLRGFVNIPGAMKVLFGQPSVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Thiazoline oxidase/subtilisin-like protease
publication title Structures of cyanobactin maturation enzymes define a family of transamidating proteases.
pubmed doi rcsb
source organism Prochloron didemni
molecule tags Hydrolase
total genus 98
structure length 289
sequence length 342
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4h6xA00
1AF4A 3GCXA 5AVKA 5FBZA 2G4VA 4JP8A 1YU6A 3BPSA 1AQNA 1YJAA 2IXTA 2ID4A 1C9NA 3WIVA 3D9QX 1MEEA 1AK9A 1UBNA 1Q5PA 1SIOA 1R0RE 5FFNA 2DP4E 1NDQA 4ZARA 1NDUA 1ZVJA 2WWTA 3SICE 1GTG1 4K8RB 3TECE 4KPGA 2GKOA 3D43A 2DQKA 5ARBA 3EDYA 1TO1E 3VTAA 4WOCA 2XTJA 3F49S 1P7VA 3VYVA 1R6VA 2HPZA 4M1ZA 3DVQX 4LVNA 2Z58A 4AKTA 1WSDA 1SIBE 1BE8A 1SVNA 1BJRE 1T1IA 1R64A 1TMGE 3TI7A 4FONA 1GT91 3L1KA 2PMWB 1OT5A 4GI3A 5ARDA 3QTLA 1KDVA 2WUVA 2WUWE 1Y34E 1A2QA 2PWAA 1SUCA 3DE5X 1YJCA 1TM4E 3BX1A 1SUBA 2X8JA 2PWBA 1VSBA 5B1DA 1Y4AE 1TK2A 4J94A 3DE3X 3A3PA 4ZOQI 1CSEE 1HT3A 1V5IA 1GTL1 1KE2A 1SUPA 2IY9A 1GA4A 1TECE 3DVRX 3DE0X 3VSBA 2SBTA 3DYBA 1SBCA 3I30X 3DE4X 5B1EA 4DJ5X 1WVMA 1TM5E 3I37X 1Y3BE 1GA6A 3AJ9A 3DW3X 1DBIA 3CNQS 2W2OA 5JXGA 1PFGA 3P5BA 3OSZA 1IC6A 3WIUA 4H6WA 4DZTA 1IAVA 3QMPA 4AKSA 4CFZA 3DDZX 1SH7A 1CNMA 1JEAA 1GA1A 4NMXB 3LPCA 1BFKA 1T1GA 1SCDA 2W2PA 1GNSA 2SNIE 2HD4A 4YN3A 3WHIA 2Z56A 4CG0A 3LPAA 3A3OA 3DWEX 2V8BA 3F7MA 3WQBA 2PYZA 2SECE 1Y1KE 2ZWPA 2PQ2A 3DE2X 1Y9ZA 3SQOA 3AJ8A 3DW1X 1SUDA 4HX2A 2X8JB 4KG7A 5AQEA 1DUIA 1ZVKA 5AVJA 1BH6A 1Y3CE 4Z2AA 1V6CA 3T41A 1SCBA 1PTKA 1SN7A 1GTJ1 4OV6B 1PJ8A 2WV7A 1C9MA 1NLUA 4KB5A 1ST2A 3PRKE 1OYOA 1SBNE 5ARCA 5JMOA 3GT4A 1TM1E 4H6VA 2SICE 3ZXYA 1S02A 2ZRQA 3I34X 3HJRA 4C3UA 1SBIA 2QTWB 2Z2YA 1WMDA 3EE6A 3TI9A 4B5LA 3VV3A 1EGQA 3Q40A 2Z2ZA 1P8JA 1SBHA 1GNVA 1OYVA 1TO2E 1Y48E 3I2YX 1GCIA 2E1PA 1SIUA 4I0WB 5SICE 1P7WA 1KDZA 1WMFA 1S01A 1SUEA 1SBTA 4OMDA 1PEKE 1KE1A 5JXJA 4CFYA 3A3NA 3EIFA 1S2NA 3DE1X 2W2QA 4NE7A 1T1EA 5AMXA 3CO0S 2ID8A 4WOBA 2PRKA 1THMA 4BWGA 3GCWA 1SELA 3DE6X 5FAXA 3ZXXA 1LW6E 1AVTA 3VHQA 1BE6A 1SPBS 3GT3A 1Y3DE 4OMCA 2Z30A 2Z2XA 2W2MA 3DVSX 5I9SA 3LPDA 2PKCA 3VV2A 1ST3A 2DUJA 3PTLA 3AFGA 2W2NA 1C3LA 2P4EA 4DWWA 5JXHA 1Y33E 1XF1A 3LXUX 1AV7A 2ZWOA 4NE9A 2TECE 2Z57A 1AH2A 4MZDA 1SUAA 1Y4DE 3UNXA 1TM3E 4LVOA 2ST1A 5JXIA 3BGOS 3Q5GA 1SCAA 3QFHA 1MPTA 2B6NA 3F7OA 1TM7E 1YJBA 4RYDA 1C9JA 3DE7X 1BFUA 1AU9A 4HVLA 4C3VA 1SCNE 1WMEA 5K7SA 4H6XA 2XRMA 1Y3FE 3H42B 1EA7A 1SCJA 5CW1A 1KDYA
chains in the Genus database with same CATH superfamily
4ITUA 3RYHB 5EJGA 2AZTA 4MOWA 4TXMA 4CPDA 3IUYA 3NWPA 4B33A 3UPTA 5IRCD 1L4NA 3PB3A 2PL5A 2IE8A 4NCJA 1W19A 3AKEA 3MTAA 5HGJA 2HMVA 1GZHB 2PEYA 4RAOA 4YHHB 2GS9A 1H2XA 1YE8A 4DWJA 3AERA 5G40A 3TLZA 4H0NA 1K6MA 3NHBA 1ULUA 2BUCA 2B83A 3BPSA 4YJDA 4ZVUA 1ZZGA 4W7HA 3UK1A 5IPFA 3IV7A 4LJ6A 2RH4A 3BXEA 2QL9A 4LV6A 2Q9BA 3I9LA 1ZA2A 4L0CA 3UW3A 4UULA 2E1RA 2XRYA 5FCDA 5EMLA 1V8DA 3AHIA 3KSUA 3LQKA 4TWIA 3D6MA 3WIVA 1GZ4A 4BNLA 4DDVA 1AK9A 4XPIA 2X6QA 1H2ZA 1VI5A 1Z0IA 1M6HA 4DV2B 1W5AA 2Z8YM 4GOOD 2K5UA 1MO2A 3P52A 3D6TB 3RW9A 4J4HA 1B16A 1RM5A 2PU7A 4LXTA 4BEJA 3H5RA 3IMFA 3MMNA 2A1UA 4O6VA 5F33A 4L2IA 4DCCA 3UHAA 1NN5A 3IT0A 4B83A 2WWTA 4J29A 5LBTA 1T0IA 4GQIA 1IRIA 2AX4A 4X24A 2VHZA 1SMKA 1JTEA 1UBTS 1M8JA 4YRBA 2OCLA 2OFWA 3U6KA 2F8TA 3O0DA 3PGJA 4LZWA 4X6XA 3RFXA 3AF3A 4YYEA 4DHEA 2XQJA 3VPXA 5F2KA 2JJ2A 3PA8A 4GM4A 1AUVA 5GV8A 3WGZA 4ODIA 1G20A 1DBVO 5THXA 3EDYA 1TO1E 3L8GA 3DAHA 3VC7A 5LA6B 2O2GA 4CM3A 5K8VA 2JJQA 4HMOA 2RGYA 1PSDA 3K30A 3PT9A 5T4BA 4R6WA 3RSZA 4COKA 4EUFA 4CIYA 2B4RO 4BY9E 1H6DA 1J99A 5LUBA 1P7YA 3KVRA 1P1IA 2VQDA 4G01B 5HE8A 1KP9A 2N47A 3BGIA 3CV3A 3STHA 2QPTA 3NEAA 2AK3A 3W8DA 4Y2UA 4X7MA 2BGJA 2VEOA 3KE9A 3TD6A 5ALYA 1E5XA 5BSVA 3W3AA 1VCMA 3ZHZA 4TWJA 3IE1A 3LUDA 3Q7EA 1IBCA 1LVUA 1BOOA 3BD9A 3EHDA 4PGGA 2WQ7A 1V4BA 3F5QA 4EIWA 1W76A 2BHNA 2XMPA 4EPYA 5SY6A 1J25A 3BREA 3K2QA 3NEPX 2H9AA 4EG6A 1KFEB 1YFZA 2RHHA 3P27A 2GSWA 3ZNNA 2EU8A 4DV4B 1VHQA 2WIJA 3KPYA 4H7JA 1HYBA 3A8TA 4DMMA 3W5VA 1QC5A 2DG2A 2FSVC 3BXOA 4AF6A 2YQZA 5B1SA 4CLOB 3N2YA 1U0LA 4ETMA 4F86A 1RCFA 1OYWA 2WE7A 4L0MA 3L1KA 2WUDA 1W0KA 1TEZA 4RDXA 3JAKA 1DMSA 3A4LA 1I2DA 1ZK0A 3QX8A 1U2EA 1Z4IA 3MK31 4S1NA 5E4FA 4B5KA 1NQAO 5F23A 1W6RA 2MINB 3DEFA 3L04A 4FFBA 5HDQA 4EB6A 4JKYA 1M1UA 5CDUA 1WHSA 4P4GA 4B17A 5JJBA 1JJIA 1SUCA 2X2PA 2BI4A 3DYVA 3ZHTA 3CY6A 3W1VA 2AHOA 4UDXX 3DP7A 1D7AA 1V3TA 4AMGA 1M34A 3W1WA 2DBRA 2FOXA 1XZBA 1Z2EA 3L8MA 3BGVA 5EE3A 1USIA 4MYRA 1RRFA 3GLRA 5KNBD 2DQYA 3FMFA 2HWYA 2H3EA 3OZRA 4DNPA 4DCTA 3A3PA 2YS6A 4AY5A 5BWBA 2P2ZA 2G06A 3R3UA 3AXTA 4MULA 4LOIA 1DNPA 4D8UA 1JR3E 1CNFA 1H2AS 2KLHA 2PQMA 4MV8A 3W2HA 4QG3A 4MKZA 2H5LA 2NM0A 1EUZA 2QPAA 2XT0A 3TJMA 4UU0A 4AQ7A 4QULA 2IEAA 1KZ9A 3FZEA 3KR2A 1ZO8A 5DSTA 1UDCA 1ISGA 3IE2A 4CKCB 1HT3A 1KSFX 4MVJM 3T5TA 4C06A 4YHBA 1XV5A 1PR0A 1XWIA 2BLLA 1CRQA 2D59A 3BDVA 5ES3A 4G97A 4QBGB 1U81A 5TPWB 3L5KA 4BDSA 4C14A 4I7EA 4FXOA 5AVSA 3ZJUA 1QX4A 2LW7A 1B0PA 3U7RA 3VXKA 2WINI 5EP4A 1ORTA 4Q24A 2QSYA 2PWYA 3IRUA 4WMLA 4IO1A 1BW9A 4EY7A 4Q9HA 3THXA 4B75A 2VEDA 4YQEA 5TQ2B 3F73A 5IYZB 1SEPA 4W5NA 4QARA 4U7WA 1M1NB 2JIQA 5KU1A 1A95A 2QRQA 2DT8A 1GPNA 2Q8NA 4X95A 1QS0A 3O31A 1RLJA 3JD3A 1ZGZA 2R9VA 5B53A 2FWRA 3U61B 4JEUA 2R8OA 1XUOA 4NZMA 2CV1A 1R66A 1XZMA 3IT1A 3UJNA 1PKEA 5BN3B 2J5KA 1GWNA 2XMRA 4EG5A 4GOJA 4ZAZA 2FQXA 2FGKA 3CIFA 3EC2A 5B1IA 1C7RA 1EUDB 1PT6A 4B74A 1YIOA 1QE0A 4Y1RA 1HC7A 4Z3DA 3QXSA 2XR1A 5JE8A 1O1YA 5FOWA 1QYRA 5AVWA 5KYYB 3C6BA 3QVGA 3OSZA 4F3YA 1WB5A 3ONEA 5BURA 2JFVA 2XOKD 4FS8A 1R8QA 3DUFA 4OGLA 3BDAA 2GJAA 5HW0A 4H6WA 2ORWA 1XEXB 3GG9A 3JQAA 2O50A 5BT9A 5ICEA 1AHPA 2C5SA 4PNZA 1Y1PA 1CZOA 2ZREA 3A31A 4U00A 4YMSA 3MBIA 2R751 5FYDA 4MGHA 2II6A 1BRTA 1V45E 4TWRA 4CFZA 2O8FA 1UWKA 3ENKA 3KQYA 2VHTA 4L0DA 4EPXA 3KZKA 1IXSB 1E69A 3GJ8A 5E6UA 3ZDRA 4LNUA 4TQGA 3WLMA 2G40A 2IUTA 4ZVTA 3RU2A 4YB8A 1GYQA 1SNYA 4WAUA 2ZUTA 5KYVA 2P35A 3LS2A 5I8PA 4CUKA 3Q87B 5D87A 4TUYF 4AG5A 4YFYA 1XCMA 2YHAA 4RJTA 3VU3A 4QDZA 3IEVA 3EXHA 4ZCSA 3AFMA 3JQ8B 1SC3A 3KTOA 5ALOA 1IJEA 3SP1A 4JXJA 4E13A 1OFVA 4DKXA 5LXTF 1YS6A 4RLSA 4UM7A 4ZQEA 2BI7A 3IEMA 1CRLA 4ZAXA 3ETNA 5K0EA 2VTDA 3ZIAA 1LI7A 2Q9CA 5B55A 4WLUA 5U4QA 3ZHOA 1UPCA 3K8ZA 3A9VA 1WZ2A 4MA5A 3WGOA 4NXMB 3AH8A 3ILHA 4EHLA 4EA8A 4DQ0A 1RZRD 3HHPA 3V6MA 3J7TA 3Q2IA 4IR7A 4CZ2A 1KI4A 2EV9A 3I09A 2GTIA 4OAPA 4PO8A 1VIDA 2W8ZA 3H3JA 4QGFA 1UMCB 2X4LA 2XJ9A 4RWZA 1G8SA 2YJZA 4Z0TA 1CJCA 3G2KA 1J21A 2MJLA 5ADVA 3LXRA 1I1HA 1EP9A 3FXAA 3LIIA 5C37A 4TTVA 1XCLA 1KGDA 3U7JA 5JVDB 2G4LA 3RFCA 1BMFD 2RB5A 2AC2A 4CHGA 3ZDCA 1XLUA 3FSGA 3BMCB 2WIDA 3PL1A 1WDWB 4KN5A 5AKEA 1EFRD 1AKRA 2I4MA 1KR5A 3KKLA 2QN7A 4RFVA 3B9RA 4TLAA 2ZM5A 3JW8A 4GXNA 1XAGA 1H65A 1X3LA 2VCYA 2Q1YA 1ULTA 3UUWA 2FEKA 2CXPA 4WA8A 1KO1A 3H9BA 1TQDA 1X42A 4Z51A 1CY1A 4LRXA 4DJDC 1SN7A 2J8ZA 4WDQA 4JCCA 4MIYA 5HFAA 4G24A 3R9XB 4O25A 1BX1A 2VCEA 1NW7A 1VKHA 3JRNA 4PYJA 2L42A 5JVDF 3N2NA 5BQ5A 4AJHA 1DIGA 4KB5A 4UBNA 1GLNA 5LMUB 3G2HA 4YP5A 1K6EA 4NMHA 4WY2A 4DJAA 1E63A 2IPNA 2X0NA 4EYOA 6ADHA 3CUYA 1QFZA 1QHSA 2ZBPA 3LX6A 5IUKC 1F8FA 3BF8A 3OCYA 5JMOA 2FR8C 2IU3A 3D1VA 4UAJA 3PI7A 3DBHA 1R1DA 2QQEA 4GDMA 5TVKA 5F5LA 3UAOA 1T8YA 2JJ1A 3PDIA 3F6EX 3AR9A 4Z7JA 1F38A 1EFCA 5LNK1 1SU6A 2Z1MA 1DTWB 1WLYA 3B3FA 2H9IA 3HDVA 3FJYA 4BZXA 3NWOA 3NMUF 2YJTD 4CM5A 2XW6A 3L7BA 3TW8B 2Z6QA 4MW2A 1FDUA 1WMDA 1W35A 2IV2X 1DC3A 4BLUA 3UGJA 3ASVA 3IELA 3PDUA 3K9BA 4G0YA 4CQMA 5JCOA 3BAFA 1Z5GA 2GVNA 3NKFA 3VR1A 3Q40A 1T2NA 1OX5A 3FHJA 3INTA 4KQXA 1NPTO 4XDHA 3BEDA 2ENWA 2XE4A 3E27A 3K1AB 1DB3A 1OZAA 2H0RA 3OBBA 4PZZA 2OPBA 3D4PA 3TNDA 4B3TB 2MSLA 1ND6A 4WESB 3UAVA 4A82A 3WMRA 2YMQA 1ID1A 5HM6A 2HUNA 3WE7A 4I0WB 3FIUA 2YIMA 4ZZ3A 2D3WA 4NAUA 2P9JA 3SI7A 4I50F 1HFWA 2Q1XA 2QM7A 4LBYA 1QMGA 3OKFA 3QWAA 4ZMRA 2C1ZA 3EOAI 1UC4B 2E55A 4ZU3A 2AQKA 3ML1A 4WK0B 1JA1A 2ZIXB 2R7LA 4PHCA 3R7LA 2A58A 5FV4A 4HUJA 1B23P 2B1QA 2G5TA 4NZZA 4UTZA 1DOAA 2FGJA 2J08A 1ZSVA 4PAGA 1ACMA 3MCWA 3DAFA 1KIAA 4BO9A 3CKYA 1QHIA 1QFSA 1GRCA 1THTA 1C0LA 3L6DA 4JGBA 4V0RA 4CKZA 1UANA 2LIPA 2UZ1B 1CT9A 3E3MA 1YDHA 5EXXA 4B6FA 1JXOA 5JMTA 4JXZA 3MQ4A 1PUXA 1JSXA 4MYDA 4AZ0A 2IHJA 3OLQA 1Y5MA 3NAQA 1YB5A 3SHOA 5IHPA 1DO0A 2L2QA 4X1IA 2C5AA 2R8YA 2GAJA 4G23A 4DIEA 3OO0A 1LBSA 1JBQA 1V1MA 2PUEA 1ZGGA 4XUCA 3I6ZA 3NOVA 4C3ZA 1WDLA 5CVJA 2VWPA 4J4BA 3E9QA 2CVZA 3E9DA 4FC6A 2R68A 3PEFA 4EO7A 3MQ2A 2QDKA 3RRMA 3R2JA 1ODIA 4TVSA 3HYRA 3D64A 5CB4B 1RRVA 3JSXA 4TUYA 4BO8A 2E21A 1BVHA 2WAAA 4H3KB 2AFHB 4GE0A 2XUIA 1BGWA 1C4WA 4PX2A 2CBGA 3CLSD 3THRA 1Y8RA 1J0XO 4BX2A 1HL3A 4J1SA 3PZRA 3I9V1 3ZGYA 2LTAA 3KQQA 4LY9A 5LXTA 3BERA 4W8GA 1US8B 3JZAA 2QVYX 5I9SA 1HXHA 4C6TA 1T8SA 3RIEA 3AR5A 4DAEA 5EN4A 1E2GA 4QWMA 3U3MA 4R8LA 5FA8A 1XNGA 3H9CA 2IYEA 4OLFA 4YQYA 4PNEA 5CB4F 1H0RA 5A3QA 5K0NA 3AFNA 3NORA 1EZ1A 4BV3A 5A0FA 5TPZA 2ADMA 1KEEA 2W93A 1T9BA 2I7DA 3DMHA 3UVEA 3IP3A 3WK6A 5JZOA 3PEWA 3LK6A 1A76A 4B3MB 3S4YA 1TB4A 2Q3MA 1SQGA 4NE9A 2I3BA 2NNLD 3NIDB 4JEIA 3RTCA 5J4VA 2AR0A 2FCRA 3EZXA 4G0ZA 4AUEA 4Z4HA 1GUYA 2PGDA 4KLCA 1N92A 4B7UA 4IWNA 2HSDA 3QU4A 4JODA 4NWIA 3RYFA 4JGGA 4UBIA 4OIFA 4DRXA 5C46F 1PR6A 4KK3A 2R6CA 4M1QA 4DZZA 1KA9H 4TLLB 1Z4LA 1SQFA 1E3QA 3K20A 5JXIA 1LLQA 1I0ZA 3UMGA 3ETCA 5ALXA 2PVSA 1I5OA 4AJPA 3CVYA 5GZ6A 2ORED 3DKKA 5C80A 4JT8A 3GFOA 3C6KA 1S9DA 1KZ7B 1SEVA 5CCBA 4AO6A 2AOUA 4GR4A 4O1HA 5BUZA 4Q4JA 3ZI0A 3VDRA 5CAEA 3GY0A 2QMYA 4LCBA 4YDRA 1CF2O 4PM4A 2X1HA 3F7OA 2I2WA 1K8YB 4Q48A 4TWBA 4Y6PA 1ZBDA 1CQIA 2DR3A 3AF4A 3U17A 3T9CA 1TM7E 1P0FA 5T41A 4S24A 5CG1A 2PR7A 1YUNA 1Y5RA 4ZT5A 2O5CA 4OI4A 4CEJA 3H6HA 4AM8A 3RSGA 1CZNA 1H8HD 3AUJB 4O5AA 2OBBA 4AMZA 1ZIXA 2ECOA 3MCAA 3ZU2A 4WH0A 2WT8A 5AJHA 1POWA 4IS3A 3ZZTA 4Z9XA 2RGNC 4Y6LA 1VIMA 2Y71A 3D4NA 3D6VA 3GLVA 5DMXA 4ZCLA 4E2ZA 4F45A 3PICA 5C4GB 3BXHA 3H42B 4YRQA 5AHXA 1NLFA 1RI2A 2V6JA 2XEXA 1VRVA 1OTXA 4HLCA 1VKNA 1N6NA 1U7ZA 4U4AA 4ZO4A 2JS7A 3KXLA 1X2BA 3G8DA 3GUYA 1YR3A 5D00A 2UYQA 4K9OA 1NTRA 2RBEA 4RK0A 1ZXBA 4MWSA 2FPUA 3BFPA 5FBRB 3RNOA 3KT0A 4BP1A 3Q8LA 2QLNA 3OX2A 3EQ7A 4INPA 2ADFA 2DXIA 2IODA 2W37A 1GR1A 3DG9A 4M8KA 4FINA 1DVRA 2PX2A 2XTAA 3O3MB 3ORRA 5FL3A 3T54A 4QLOA 4LF9B 1YU6A 4AJJA 1JECA 1TEHA 2IUSA 4C7OA 1MVLA 4MS3B 1ULHA 3ZLJA 2PO5A 4AYTA 1ORHA 1Z17A 4IY1A 1T2CA 4WUVA 4ZC8A 1L8QA 4FUTA 2YKGA 1IJKA 4I50A 4XOIA 2QRNA 1RJ9B 3I5AA 4LZNA 2V3WA 4RCZA 3IKLA 4L1KA 2W2LD 3ENZA 4K6FA 3WYCA 4LVUA 4C5AA 4F4FA 4DDWA 2B94A 1YCGA 1A1VA 4HZUB 1XD2A 2PUWA 3D2LA 1V37A 3DEZA 4ZQHA 2IYYA 1NULA 3OA2A 5THKA 1UP6A 4IJ6A 3TTXA 3LPNA 1EIZA 2C5EA 2HHAA 2EP5A 4S0XA 4WDRA 4ZO6A 3GMIA 3QXCA 5HKLA 5JCZA 5FHQA 4OXXA 3IDZA 5A4KA 2C0QA 1ZMTA 2P27A 2B92A 3NOXA 1VSVA 5L95A 1G21A 2VWGA 1U90A 3OM8A 1IQUA 1UCFA 1ETUA 4JJGA 4HDKB 5E38A 4F91B 3E8MA 1Q19A 3QEAZ 4XA8A 2EZ9A 4ZN6A 1N9GB 2IYAA 4J0GA 1WXXA 4R2KA 1VDMA 1G55A 2XWJI 3DFMA 4LYAA 5D3MA 1ZQ1A 1Z12A 4Y6OA 1ZSYA 2EC5A 4E1VA 1D1SA 2JEYA 1NXOA 3OF3A 3AESA 2XTJA 4LF8B 4A8JB 5DCLA 5JDCC 4ZHQA 4LX8A 5KS2A 1H5QA 5FPYA 1ANKA 1FJXA 3PIRA 5E1MA 1ZI9A 3QBJA 3RSLA 3H5VA 3ZYCA 3BCRA 2R8ZA 2EL9A 3EJ6A 4MV9A 2NMVA 4LSMA 3T9DA 2HPZA 4DE5A 1RQXA 1LTQA 4V39A 2AN1A 2ERXA 2HDWA 3TVDA 4RHEA 4G0UA 4H7HA 3SXUA 3UXEA 3LY5A 2PUCA 4Y30A 4P92A 4QQRA 4IMRA 4QIHA 2XF8A 2FP4B 1CUYA 5LZ7A 3SK0A 7AT1A 2IGTA 2QN2A 1N5IA 1OZ0A 1ZM4A 2VVTA 1MAUA 1OJLA 5AH0A 4RVNA 4XW2A 4HNAA 4BO3A 1Z25A 3VAZA 3HMKA 3W90A 1OWNA 2BFEB 5L7TA 4ZJPA 2BR3A 4J4TA 5K03A 3DPIA 1D07A 2B3TA 3RT7A 3S2ZA 5AW1A 2P1ZA 2VAPA 1ULSA 1B6RA 1EWKA 2OZKA 1B0AA 3AR4A 3FYUA 3I2JA 1QU2A 3WGYA 1RHUA 4B2PA 4Y67A 1MJFA 2HQ1A 2LGJA 5AW4A 4MDHA 1MB9A 4YK7A 5UKDA 3AG6A 4WT7A 4AY3A 2OORA 2C3MA 4QUIA 2Q62A 2OAP1 3RS8A 4K2AA 1U1EA 1O6ZA 3BG5A 1JS1X 5DX1A 3UWPA 2Q8QA 3COZA 2BZSA 2BFOA 1BYIA 4YEDA 5JWRA 3PDCA 3TPFA 3VDXA 4HDSA 1X7YB 1D5CA 3N53A 3SFZA 1H94A 4YP1A 1OH5A 3KTAA 2VTBA 1H42A 3C48A 4A2CA 5HKBA 3E05A 4L73A 2PWBA 2QQ0A 2C77A 1PLKA 2HMUA 2Z5LA 2OMEA 2P8SA 3GU3A 3Q85A 4FMDF 4YRGA 1LQUA 1TK2A 4W99A 4F5ZA 1GJRA 1LC0A 3KAJA 3ZE7A 4DLTA 1M5RA 3IBFA 2LBPA 2JVKA 4PVDA 2HNKA 1Q7EA 4OLHA 2P6RA 5BYBA 1CB0A 3O7WA 4L74A 3R09A 3THWA 3QSGA 3SWWA 2J7KA 2YWXA 3FDXA 1T3GA 3S70A 3HCEA 3SR0A 1X1DA 2QJFA 4EZIA 2QTLA 3JQPA 3UOAB 1ZRMA 2HADA 2OV2A 2ODBA 2O7RA 4JI1B 2E4AA 3AHEA 3C1TA 1CJKC 1CG6A 3V2IA 3ZDFA 1EQUA 1SJ9A 4OHFA 5DEOA 4A3SA 4ALKA 2YASA 4N01A 3ER8A 4C29A 4LV8B 3ITEA 5B1YA 4M8NE 4D3SA 1FSZA 2G6TA 2RG1A 4B09A 4B43A 2XGSA 4MB0A 5C52B 3A1SA 3I6QA 4YMUA 1X80B 1MJGA 4HRAA 2ZE8A 2FPPB 3KVNA 3MJEA 5DYWA 4EFMA 3NVKI 3JAWA 3GMTA 3UK6A 2FDRA 3DE0X 3H0CA 2Q27A 4OGFA 3IO5A 4KDEA 4WCFA 4YJ3B 3GJ3A 4YLGA 3CSSA 3KUXA 1CY4A 2DY0A 2FW8A 2R8BA 5IT4A 1L8OA 5E7MA 5G4LA 1AURA 1RPZA 4DSAA 1N2CE 2VHUA 1HO3A 3DE4X 2FEOA 3O9MA 5LYJF 3LMKA 5IHXA 4W5WA 4AS2A 2GYVA 4AX4A 1MNQA 3QH4A 1XMOB 1M83A 2EIHA 4TTRA 1IN6A 4Y1EA 3OC0A 4CU2A 1YZUA 3CKKA 3NFYA 4TT3D 2FPXA 5EESA 3TZCA 3AO0B 3DF9A 3VHXB 5I9IA 4YRTA 3AEUA 4GMKA 1JEQA 2DKNA 1M2OB 1PW5A 1ZM7A 4X65B 3BXZA 5AHOA 4NJMB 3OM9A 3IAUA 3VX3A 1NURA 3B1WA 5IJ0B 1A27A 3E35A 4NCBA 1QTIA 3K2IA 1NX6A 1YVEI 2C78A 4ILKA 4O4JF 2D4HA 4YQZA 5ALQA 3WY9A 5JANA 2FUEA 1G5RA 4PCLA 5DN6D 3BIOA 4PX5A 4EKEA 3R5FA 4W5TA 4OBEA 4KN6A 2QGFA 2L17A 4XQGA 4U8HA 3LQ4A 3ZY6A 1SXJC 3MTQA 3TFWA 3SSNA 3WGLA 1GAQA 2HJ9A 4YQFA 4D6YA 1QTQA 3QVWA 3BL8A 1AXRA 2WRZA 2WLTA 1HE5A 2FQQA 3U37A 1UMDA 4OHWA 5F7XA 2A86A 3FGOA 5JZMA 3IVRA 2OGWA 4G4SP 5DI3B 2QTNA 2C2WA 4C0QC 1L6IA 3HY4A 4D9EA 4BMSA 5GY7A 1PHRA 4YRNA 6REQA 1P2VA 1LK0A 1T5LA 3CONA 3HXMA 2EWVA 4L4ZA 3WRYC 3GT7A 1KXJA 2WEKA 3FRJA 2YV5A 1E4OA 1U04A 3I0ZA 4NMXB 3EAGA 1KJQA 4JVNA 4EFDA 4ZZ1A 4AZ3A 2OYSA 1QCYA 3GUZA 3ZUPA 1HH4A 1E3JA 3DFKA 2VYVD 5I6DA 3L0ZA 1YI1A 2NZWA 4YRCA 5EYPB 3WBKA 5KWIA 3HYLA 3DZGA 2X3FA 2V7EA 4BQEA 1QE3A 1ZBQA 4QLAA 3C3KA 1RZVA 1AD2A 2Z2JA 1E2JA 2FPOA 1Y63A 3F4BA 3PFNA 4ZRMA 4LBWA 3DKIA 3WQBA 1XZQA 4QA9A 1NPDA 5DBFA 4BUZA 2OZVA 2PE5A 2BSQA 1HSZA 1I3OA 3L9XA 5AKZA 4L8FA 3UZUA 3HY6A 2OLKA 3OIVA 4MVJP 3VU8A 2CL7X 3DE2X 4D42A 4A6XA 4ZO7A 4YP9A 1ATIA 2Q6KA 3LVBA 1BWRA 3FE2A 4DYHA 1VLQA 2QD3A 4N8EA 4TYYA 4PXSA 3KDAA 1USWA 5A4MS 2HNAA 2JGRA 3ZWYA 3ESQA 1RP7A 3FYDA 4Q12A 1H4TA 4ZREA 3UA4A 5C7LO 4YUAA 1OI3A 2N1BA 3H84A 5AVXA 2ROQA 5KX5F 3T1TA 4O4LF 2H29A 3MOSA 4XWTA 3O84A 1OXBB 5LB4A 3IS3A 5AQEA 5COQA 4QC2A 1VL6A 5B64A 1Y6JA 3RJTA 1SHTX 5CA1A 3PGMA 4EA6A 5LDGA 3D0KA 3LHSA 3KQNA 4OTZA 3TMAA 4OX9B 3RUAA 1QAMA 3ZGZA 4I2NA 2O2ZA 5FTLA 5BN5A 1AB6A 3HUDA 3IQXA 1JKMA 4JELA 3I2GA 1R4ZA 2EHJA 3PR3A 3GLHA 3QP9A 1YNOA 5KDOA 2H2HA 2WMNB 1VE7A 2W0SA 2XKBA 2GFHA 2BFAA 2Z2IA 4RM2A 3WQHA 3U5TA 3PXDA 5SY9A 1P4GA 1O7JA 4MKGA 1D6SA 3O26A 5A4IS 3WNCA 3AI3A 4X90A 1O6FA 3VYTB 4H16A 1FU8A 4JY7A 1II8B 3PYLA 3EHEA 4JBHA 5CPFA 2P78A 5F51A 4KQFA 3BJEA 4GDFA 1F17A 4HDMB 2V03A 3PC7A 2DE0X 1X19A 1RJWA 1YUBA 3C7AA 3WV4A 4JB8A 1N1MA 1YCFA 2VXYA 4Q4AA 5BSUA 4B47A 4DCSA 3IIIA 4DXHA 4MAAA 3BIJA 3KLMX 3WB0A 1LBIA 2PANA 5HRCA 2X0JA 3TUJC 2GJ9A 5EPUA 4BVFA 3VR4H 4KDFA 4MROA 4HH3C 4CTJA 5EZSA 1UH5A 1NU8A 2F6RA 1LVHA 4OLJA 1D2RA 2Z2YA 4QTXA 1JQLB 5LVAA 1GSOA 1ISIA 2R85A 1IOWA 1RI3A 2IF2A 2RI6A 2JL1A 2Z0MA 4MDYA 5TR9A 1ADJA 2QYOA 4ZI7B 1ZN9A 1XKXA 4ILEA 3ZDYB 1SXJE 3M70A 1XTBA 3FDZB 2QA5A 3H2KA 3UXHA 1FP4B 1VPEA 1BD4A 2YNMA 3HCDA 4U0JA 2B69A 3BGDA 4YV7A 5LYJA 3AF0A 3ES9A 5BQOA 1PQ4A 2Q9UA 2C5FA 2QM8A 1JG3A 3CLUC 1DWOA 1T2FA 2H4HA 4QPPA 1EWTA 5JS2A 3VR2D 4UOEA 1UXJA 3TXYA 5K5EA 5A0VA 4EBFA 1LTHR 3SY8A 4DGQA 2V3CC 1UKCA 1G4UR 1RAHA 4Q37A 1LH0A 1DKLA 1QFXA 1T2DA 3DMFA 4B3CA 4KHPB 2PRZA 3BH0A 4RY9A 3JARB 4E5DA 2XB9A 1HYGA 3CA8A 3KQUA 5JBNA 4O4JA 2W2TA 4MQEA 4NE7A 4WFJA 3ISTA 4XDGA 3NRJA 1VLMA 1XHLA 1YBFA 1IM2A 4WOPA 3AI7A 3AVVA 2BGTA 4U7HA 3TAHA 1SCUB 4RQTA 3TW0A 1Q0HA 1K7XB 3NEJA 1F2UA 1VG9B 1NBOA 3D02A 4LDZA 2CLKB 4A8HA 2R1TA 1E6UA 4DT1A 1SGWA 3HJTA 2R96A 1CIVA 2PCJA 4DLSA 1UBLS 4PRZA 2GEUA 2O7NA 3TTSA 2OCGA 1NYLA 2GWHA 4KQKA 4A1OA 3U0BA 1UKBA 3S40A 3RABA 3O75A 4BMXA 6ABPA 2IRWA 5EQFA 3L92A 3DHVA 5F3WB 1L7XA 1LU9A 1QTRA 1VTKA 4QRIA 3F67A 3UB3A 1Z7WA 1W93A 4QPDA 1A9OA 1E2MA 2IHKA 3DZKA 3GPLA 1NXPA 1QRRA 1K98A 2BC9A 2WFLA 2YN4A 3K9WA 4HOYA 4NHOA 2FEPA 4FDTA 6PFKA 4BVLA 5JAOA 4ZVSA 2ZWIA 3VDMA 2Z2XA 3IAFA 1AB5A 4ZKDA 3U3DA 3ETHA 4RADA 4Q3NA 2UUAB 3I6IA 3LT0A 1OGYA 1Z8FA 4KTVE 5B3JC 3VNUA 4OXRA 4PBTA 3GEEA 1KEZA 1OI2A 1PK9A 1R4NA 2D06A 1DU4A 4X8OA 5IKOA 4IJKA 1E1KA 3IHKA 3LW8A 3UHFA 3C6ZA 2AN9A 3MCVA 3M82A 4DL9A 3AFGA 1GQSA 1P9WA 1XAHA 1C3LA 2Y27A 3QWIA 4OFBA 1CUEA 5KJ6A 2P77A 5I5GA 4J0FA 1KJ8A 3K8QA 4JBYA 1NOJA 1KETA 3T4UA 4EHJA 1NJ8A 5CNJA 4TKLA 3LHFA 1E1CA 3E82A 3G2JA 2JBAB 1A77A 2H1CA 2WIGA 3LXUX 4BO6A 2BR4A 3DEJA 4M87A 3NRBA 4LSGA 1KERA 4IDHA 1F48A 4OBWA 2PZMA 4NFLA 2XCQA 3VHRA 1NJ2A 4FWBA 5KX5A 3GLTA 4MRMB 3OJXA 4O4LA 4RHUA 2V0GA 5HSGA 1UAGA 4GKVA 5FR2A 2QUBA 3NHKA 4YUZA 2VT7A 1B43A 3UNXA 4QPCA 1N5MA 2GZ1A 3TDNA 2MCFA 1J33A 1FTSA 2BT4A 1T1SA 4OB7A 4WZAA 2HTEA 2VRWA 3JVIA 3SE0A 3NHFA 1R2QA 2EBHX 4URUR 4D46A 4G8DA 3LUBA 1MC1A 1NM5A 1RMTA 1II9A 1PNRA 2BKVA 4PNHA 4RIHA 1IHYA 4A9AA 2V7BA 4RVSA 3B5EA 4DEXA 1BHO1 1CUVA 1U7WA 3I32A 1V8ZA 3A1VA 1FU7A 2CNLA 2BRUA 4KDRA 1VJTA 3GZJA 1LSJA 3ZGXA 4CMCA 3UJ7A 2WHPA 2VAWA 1B73A 1K4KA 1LV8A 2WUFA 4PV7A 1UXOA 1BDHA 2SKDA 4OIMA 1MRSA 4YRAA 2J85A 3M6IA 2ZOSA 1E4EB 5EIOA 5BW5A 2WT9A 1UKEA 4CQLA 1OA0A 6YASA 1GVNB 1XRQA 1Z68A 1OFTA 1U0SY 3N28A 5C51B 3RBAA 4TM8A 4PR0A 1JE0A 1U4SA 2PS3A 3LRXA 3CSUA 2CL5A 2JGDA 2P0YA 3SS7X 1UBHS 2QT1A 3ND7A 5E8RA 1QK5A 1JDVA 5HZHA 3ONVA 1P91A 4CCWA 1BN7A 1FXSA 2DQZA 3EVCA 3HUTA 3QY9A 4LXYA 4NZ9A 1R0YA 4XASA 3UT5A 4BE7B 3G5TA 1KKLA 2F3RA 4I4IA 1W1UA 3IFSA 5AVKA 2Q1TA 3G9UA 2IF0A 5IXJA 3B89A 5A7FA 2PSDA 1PS9A 2DU8A 1QK4A 3I2FA 3NBYC 4M0KA 4B8WA 4BBAA 2I2AA 2J7PA 3NTLA 1G3IA 4CEHA 3Q15C 4EAQA 5BW4A 3UOWA 1HLFA 3FJOA 4Q19A 2TS1A 1XU9A 1GTVA 2PA0A 1A5AB 1ONSA 3W3AD 1K08A 1VKJA 2YWEA 3CB4A 3SVLA 4HNTA 1GV1A 1NMQA 2FSSA 3I9FA 4MO9A 4PLPA 4YAWA 3UUGA 3U44B 1OC4A 1IXRC 2HU5A 4JJIA 4MYUA 4QAQA 1PG5A 5JRDS 1DQRA 1M3SA 3ONNA 3DBRA 1XJ0A 3ZS9A 2YOGA 5TQ0A 4GVPA 1W5SA 2IPOA 1MEEA 3C3MA 4ECAA 3T5PA 1L7AA 3PJGA 4R1LA 5BUSA 3EGDA 4DFDA 1M2FA 1PR5A 3G9ZA 5REQB 3OM1A 2XB6A 1UMBA 1R0RE 1PR4A 3HCAA 4UBKA 3INNA 4EZEA 4M1KA 1KJYA 4NVRA 4RULA 2YFYA 3WV5A 1AT1A 3LT5A 1DZ3A 1JZSA 1YHNA 2UKDA 1W0KD 3IT3A 2ZLBA 3NXKA 4JK3A 4R5MA 4H35A 2Q1SA 4LHYA 4RPGA 4EO9A 4WX2B 1NJ1A 1P4JA 1VPLA 5CU7A 4B80A 2IXGA 1GZVA 5DGHA 5HUHA 4KLAA 4P4UA 4YJHB 1N2XA 2NPOA 4LX0A 3H9GA 3Q1LA 3FHOA 3DQPA 2IITA 1W9HA 3HKCB 3T7IA 1GUZA 3KHTA 4OB6A 3KZCA 2OFOA 1DINA 2H9YA 1K1EA 3VTAA 3OHSX 3K4QA 4BKPA 1X7XA 4QTYA 3M8KA 4I2VA 2VH5R 2EZ8A 1EFKA 2AYXA 2R6ZA 1ZDMA 1EVYA 3E3LA 1W96A 5F21A 4IJUA 3NDIA 1PK8A 2IPLA 4NBNA 4X0EA 4IAOA 1UJNA 3M33A 1I3LA 1PUJA 2JHGA 4L8YA 3KO8A 4LVNA 3K0FA 1FK8A 3IJEB 4ALNA 4Q3OA 4QEKA 1QIMA 3PHIA 3PWTA 1QKKA 1BDMA 1GU7A 1QMPA 3I52A 1SU7A 4K0KB 2FG5A 4J2TA 2I6UA 1BE0A 3A06A 2V9CA 1PZMA 1KI1A 1PJ2A 4MKRA 1JTFA 4DABA 1YE5A 2MHCA 2VHEA 1L7RA 1MIOB 2I1WA 4B6JA 4HBZA 2CB9A 5F1KA 1DAIA 2O6HA 4BMZA 3VO9A 1FUIA 4P34A 3ZG6A 1GUFA 3W2FA 5I7WA 1KO7A 1WSBA 3QLVC 2CUKA 2DWQA 1W36C 4WN9B 1PUIA 2JLYA 3Q2OA 5EQJB 1OLSA 4GT1A 4BO4A 2M98A 1PEAA 1V96A 3AIMA 3P9ZA 3KOYA 4TKZA 4IW3B 1Y3IA 3BBLA 4IVQA 3TI7A 5JMWA 3GDHA 1DAGA 2XA1A 3HFJA 1XPJA 3WWCA 4RTLA 1P1FA 2YVKA 5KJ1A 3VC1A 1DCMA 2P2SA 1DEKA 1MNAA 3PQ3A 3TNLA 1OFIA 2QMHA 2CFOA 2WUVA 3K0HA 3TDMA 4KFTA 4AN0A 1YZFA 4LKRA 4NYIR 2XKKA 1C1DA 3R7BA 3KC2A 2PXAA 1KYQA 2BFDB 4TTSA 1WPRA 3W7VA 5I4CA 2Y1LA 4QFDA 4GZ3A 4N3AA 2GVZC 1OGJA 2CE7A 5FUWA 3ZNQA 2VJKA 3SR3A 1XU7A 2ABWA 2WE8A 1KYTA 1G6OA 1KQOA 3I4LA 4H4DA 2G09A 3WJ2A 2WSMA 4Y2HA 5GONA 3WKEA 1VPVA 1L5NA 3ZGLA 1UZNA 5ALZA 2WPNA 3H9QA 5FTMA 3NH6A 2I6GA 3BRWA 4Q3BA 4IJQA 4DDKA 3QOXA 5B6IA 1GADO 1K6IA 1R5JA 4R1SA 4OKNA 4EVRA 3ZDEA 4IXMA 4L15A 3U4QB 3F4LA 4ZOQI 3JVDA 1CSEE 3NWBA 3ENQA 1HZZA 4GMDA 1MBZA 3NEYA 1L4FA 4TVOA 4UZEA 1GDDA 5HFJA 5KYUA 3TZQA 1PL0A 4TZ6A 1TUBA 2NAFA 3TTVA 1MDBA 1X87A 4MW7A 5L8VA 4R7ZA 1NRWA 3IEPA 3PHGA 1GTL1 2Y3IA 4LNHA 1T5OA 2PXXA 3V5NA 2AKEA 5K3CA 4I9HA 4RPLA 3GUCA 4QDKA 2WG0A 3NIWA 4CL0A 2O2HA 2DPGA 2RSLA 4EKDA 1AO0A 1AA6A 3UCXA 3KZNA 4G1FA 1SBZA 4KNYA 1YZGA 3B1YA 3FIJA 1SHUX 1RYFA 5E95A 1EUQA 3IX7A 4BAZA 4XI9A 3L2OB 1IUNA 5HCUA 4MKIA 3A14A 1GQYA 1J90A 4M4SA 4YUXA 3DHEA 1KDPA 5J3JA 2JVJA 2B1IA 2DBZA 1RS0A 3GJTA 2BGRA 3H11A 2ODEA 4HVAA 3WK7A 3D4BA 3D7RA 1RIFA 1ZKDA 2C99A 3A28A 3ZIAD 4HH0A 5K3AA 1KH3A 2G4CA 2R66A 3IJPA 3P0FA 5GINE 1GA6A 4PICA 4BMDA 3HB5X 5E7JA 1B3BA 1IHUA 1XR3A 1P0IA 1P73A 2C4HA 3A6LA 3H0EA 4XDYA 3UT6A 3ZY4A 3AF6A 2MR6A 1H1LB 2BBTA 2ZAMA 1FLAA 3Q7SA 3HXLA 4OREX 4US0R 3NNNA 2O1EA 1NL3A 2W2KA 2QORA 1N57A 2ZB2A 3R77A 4PSDA 1KMNA 2DZDA 4P81A 3PFIA 4URWR 1C1YA 2P0AA 5YASA 3HSYA 4W5QA 3OOYA 4C0JA 5IJ9B 4FLEA 1G5TA 4CKEA 1YDGA 4IO0A 4C7BA 4MK4A 5PGMA 1A8PA 4ZQIA 5DISB 1QPBA 2ZTUA 1FQKA 4N5MA 1GAXA 4BZQA 3NS7A 3T9AA 5HK8A 3CX6A 1UUFA 1VZ3A 4IJWA 4DLAA 3FSGD 3H5OA 1FNBA 3OQHA 1RYMA 4DVGA 2ORIA 3NBAA 4MHSA 1XMQB 3L93A 2Y6UA 2LV8A 3SKYA 3SLGA 1JUDA 3ANXA 3OPQA 5LQUA 1Z7BA 2VHJA 3OVMA 2CXQA 1C3OB 2OHOA 3A4TA 4E5PA 1I6MA 5FEMA 3TE7A 3VYWA 2QDXA 3BSYA 4KACA 2QP9X 2VP3A 3N7TA 2CXUA 4OL0A 5GGYA 1G21E 2PTHA 2WAOA 2XBMA 4J0QA 2QU7A 1L5SA 3OF2A 1P5FA 1P3JA 5FBQB 2XH8A 2GEFA 4XQ9A 5M3BA 3HJHA 3U80A 5FLXA 2EARA 2VUTA 4LQ4A 2CHQA 1QGZA 2QTVB 1I1OA 1YIAA 1TVCA 3KJNA 4M83A 3JWEA 2YV3A 3IAM6 4XH9B 3TIFA 1YR2A 5EMKA 2C5GA 3I1FA 2AG0A 3PNQA 1N2HA 2LCQA 2FQWA 4PSAA 4IDEA 3LPAA 4C3OB 1NBAA 5CDYA 2CC2A 2IW1A 3OD1A 1EBUA 4YBRA 5JCPA 4R71A 4RZUA 2JJ1D 3AM3A 1DPFA 1KU0A 1G2QA 1RYBA 2OWEA 3F7NA 4X8LA 1OBOA 3ROGA 3T35A 4QUJA 2RONA 5I7SA 2OLEA 3OX1A 4FSHA 2GF2A 3KKQA 4GG1A 5EE5B 1T9DA 3C8DA 1QXSA 3KYIB 3AJ8A 5HS6A 3RU9A 4PZPA 5I9NA 1U4OA 1H22A 4EI8A 4KPEC 1DC6A 4LF5B 4KQIA 1TYCA 4CQMD 2GBLA 4QRHA 1R9NA 3FOAA 1U7HA 5HXAA 3KZVA 4MUAA 3LKDA 3T3OA 1CYEA 1T29A 1XKTA 2IYNA 2VDWA 4HFRA 4HX2A 5HGXA 1CUFA 1DLJA 2WJVA 3IUQA 1Q1EA 4TXJA 2JC3A 5LQAA 1MXFA 3DXZA 2PD4A 3HJCA 1JLHA 4GMHA 4QPNA 3RYCB 1C8BA 3RR2A 3RSFA 5BRJA 3I64A 3A4IA 3UHOA 2P9ZA 1J56A 3L8FA 2PL9A 3TH5A 1B3RA 4H7EA 4IIJF 3AEQB 4MS4A 5EERA 3G5AA 2HF9A 1OXVA 4IOLA 2QVZX 3D54D 1VG8A 1OAOC 4PYMA 3ZH2A 1A4IA 1SCBA 2H2AA 4N5LA 1QDEA 4B6SA 3HDTA 2R6AA 4L16A 3N3BC 1A5ZA 3OFJA 4TLDA 4FE3A 2F8SA 2EBFX 4HTAA 4PLFA 2WM2A 1T3ZA 2FWJA 4A2QA 1T8TA 1QRSA 3FFBA 4DR5B 4N9QA 3LYLA 2IXFA 4HWSA 4MR7A 4C7MA 4W6QA 4YACA 2XZOA 2F67A 1MRNA 1KHTA 1ZC4A 3MCUA 2D2EA 2PUTA 4R8KA 1UXGA 3BH7A 1MFPA 2KMLA 3GFRA 3N1UA 4RIIA 4U7GA 1U7TA 5CT9A 5IVHA 3MB5A 1PGOA 5DTIA 1O6CA 3F71A 3OJOA 1J0AA 1KMMA 2PLWA 1EQAA 1RXCA 3HJGA 2IU4A 2O3SA 4JQSA 3HHEA 4XIJA 5T4FA 2J9YB 1UEXC 3L7KA 4BO7A 5AICA 1NVBA 2YY6A 2FWBA 3WYGA 2IYTA 4O63O 5E3HA 3NC4A 1HA3A 4L8VA 4WKGA 1M75A 2CB0A 3GUHA 1WUYA 3QENA 4BX9A 1CDZA 3TI9A 3K0BA 2ORVA 1Z88A 1C3VA 5DNEA 1YJXA 3FLMA 3IP9A 1W1IA 2HK8A 2YL2A 3MJTA 4C6HA 1D2HA 3LCMA 2W6NA 2OHHA 4GL2A 2VF5X 2XLBA 2AE2A 2K4MA 3EBLA 3V7NA 4BQFA 1DQYA 1LDMA 2LWIA 2XQGA 3V34A 3UANA 1C30A 4Q15A 5F76A 4YCSA 2GMWA 4WNIA 4RD4A 1Y8CA 4MP8A 1XZHA 3SE7A 3A6FA 1RQ2A 3I58A 4I55F 4N0PA 1Y8QA 4Q1AA 2B4AA 1K92A 2KQUA 3PITA 2XXBA 1E32A 3T1OA 3ED5A 5TPZD 4JI4B 4QYIA 3OSUA 2QN3A 1XX6A 2NO6A 1GGVA 2HK6A 1U8XX 1NSTA 3EIFA 3L6RA 2ZPTX 1RM0A 4KH1A 3DFZA 4LW8A 3RUFA 4XX0B 4BVEA 4MV5A 5U9CA 3KR0A 4JZYA 3CS3A 1D5WA 1UR5A 2C2YA 4KJXA 3AY6A 2ID8A 1UFVA 2ZSIA 1WMSA 1SRRA 5HIMA 3T6KA 3MCTA 4JJKA 3HJBA 2J5BA 4CGZA 2C7QA 3TIIA 1RU3A 1SOUA 4DGSA 1OH6A 2ES4A 2YV2A 2I2XB 4WLNA 3PXCX 4CM6A 2QVXX 3THYB 3VR4A 1ESCA 1LJLA 3ANMA 3KEFA 1LW6E 2AZDA 3IMCA 4WOKA 3QUAA 1GG9A 1ZGAA 1L3BA 3I5YA 5F3DA 2G25A 2Q4EA 4DMUB 2E87A 4YECA 4PSCA 5CDFE 4DB4A 4FR5A 2BN4A 2OCBA 4EA9A 4L72A 2EP8A 1IN4A 2VDJA 4G4IA 3GCZA 4GZLA 4HTFA 2V74B 1XMJA 3KB6A 3BQMB 1O0SA 1MAHA 5LM3A 2IBSA 1IZ0A 3ZDXB 4ER3A 5L51A 5AI0A 4RVCA 5L3SB 4PC1A 4A27A 3W9BA 4CV3A 2W2MA 1JNXX 4DPMA 1EHCA 4BASA 2ZRIA 3EGOA 1HE4A 5FO1A 4F3RA 4JLPA 3RAEC 3RAPR 5CXUA 3G7NA 3T1QA 4O59O 3T7KA 1KVRA 3L79A 2QM3A 3WIBA 3IXLA 4IDCA 3RLIA 3ZHYA 2CD9A 5IWAB 2ZIWB 4FBGA 3RTDA 4YMTA 1SC6A 3MRVA 3OFSA 2PX5A 1LPNA 4HADA 1W48A 1EBBA 2B3DA 2CVHA 3V6LA 5IN4A 5IT0A 2Y9MB 3ACCA 4QFBA 1PBNA 4Q9NA 4POOA 1UBUS 3CVUA 3TDKA 4HWOA 1AV7A 1Z2OX 3BE4A 4ESEA 5HTOA 2NO5A 3NG1A 3M83A 3REOA 2WJAA 3SEFA 3TW6A 1L5GB 4KBFA 1CJMA 1DG1G 2BFWA 2CDAA 3O8OB 4MZDA 5ALFA 4FD3A 4OG2A 1SUAA 4JMPA 3W2IA 2FN9A 1LDEA 1KU6A 2XZTA 2NU6B 3P9XA 2ZS9A 1BAPA 4A0RA 4RVHA 3C3EA 5FOUA 3W9UA 3AW9A 3R0XA 4L9AA 1J09A 4GXTA 3SHVA 3E7XA 2DFVA 1U2SA 1GPBA 2HXGA 2XE8A 3OTIA 4IYJA 2ZSHA 1XP5A 3QKIA 1PNQA 4FYXA 3P45A 3RARA 2X2EA 1FRZA 3JVVA 4CKWA 4RTJA 2BHTA 3LUHA 3MRSA 4O3MA 2YRXA 4KW7A 2V8OA 3NV7A 5CYFA 3UJCA 3CW9A 2V6BA 3IXMA 2B6NA 2VUUA 4ZK6A 5BVHB 1Z4OA 1PX2A 3TR5A 3PX7A 5HF6A 5A5DA 3DO5A 1HDOA 3TSZA 3S1SA 2PMDA 4UHJA 1JFLA 3KQLA 4RS4A 2WQZA 4RGVA 2G8LA 1WD5A 3FOWA 1FFDA 3TGWA 1MABA 4NRDA 3KKKA 3PHCA 3M4JA 2IPXA 3DOFA 2OHGA 4FOPA 1NMYA 4JUAA 4EY3A 3L7LA 4P0TA 1ABEA 1SCNE 3UICA 2BP7B 2QAGB 3LKZA 3LZ6A 2VC2B 2VH1A 2WHXA 3PX3A 1LNSA 2C2BA 2QZJA 2WJIA 3I2HA 3OZCA 4O2BB 3ICCA 1OZHA 1Y98A 1IXKA 3GZ4A 4QGHA 5E7QA 1ZJWA 4QQFA 1IL0A 1Z4JA 5IARA 4LCEA 4WFKA 2JI9A 1FFSA 2BAGA 2OC9A 2CF5A 1ZU5A 1E6MA 4E5NA 1GTMA 1ESEA 3RIHA 1X7DA 2ZBUA 1RBMA 3QX9A 3R3JA 4N39A 2HPVA 4WY5A 2DBYA 1JHAA 3QJYA 1KEPA 4WNCA 1W5BA 1IM5A 2OZEA 4ER7A 1TF2A 1YKSA 3DV9A 1QGYA 1VIVA 2BF7A 3F5DA 4PFJA 2J9XB 3AP1A 3GJ0A 3CG0A 2HPAA 5ED0A 1I7PA 3ORFA 4EYQA 3FOEC 5EZYB 3D3WA 1KJJA 3WB9A 4KFSA 1E0KA 2P6UA 2WWXA 3BK1A 3A6GA 3PIIA 2QXUA 4RK6A 4G81A 1GD1O 3AP2A 2B25A 1E2FA 4HWPA 4AP6A 3EQ9A 4O1MA 5AYVA 4I55A 1PKXA 1MKYA 4JC4A 2WT4A 3GQBB 3NONA 3M6LA 3IVCA 5FPPA 1RKXA 1RHMA 1F6DA 4BNHA 4IGEA 4EB8A 2EGUA 3OIFA 4PIMA 5AK5A 5ALKA 4OQDA 3M9WA 5KYKA 2G77B 3AR3A 2YWDA 3H1PA 5AKHA 4C7JA 3H16A 4M38A 1BROA 4L7VA 4OX9Y 4ONEA 1TCCA 3ET5A 4I8XA 1KYZA 1XELA 1V3QE 2Q3EA 3OKPA 4GI7A 5BNFA 3U4DA 3VR5H 4DIMA 1T9ZA 2XUDA 3CCFA 3PUHA 2XT9A 4EHFA 2O9JA 1NDUA 5EZ5A 1JG6A 3GCGA 1R4AA 3SICE 5IUNC 3DCYA 1AF7A 2GZMA 4UDOA 5K3EA 4CMHA 1EP3B 1A2BA 2J48A 4UTPA 2P6NA 3EVZA 4IIUA 2WB4A 3GHYA 3MXTA 4YROA 2HQOA 2FJ0A 4Q02A 4TMWA 5L3ZA 4Z4EA 2C9ZA 4CN9A 3FNRA 1B42A 2GBIA 3WXMA 3PQEA 2WA1A 3GMSA 1NOIA 1NIJA 1SCQA 4RVOA 2PLFA 4HFMA 5U1PA 2IH5A 2NUBA 3EYAA 1JFTA 1CR2A 3H5NA 3IKTA 1G5PA 1GG8A 3ZQ4A 1K27A 4PTZA 5ICMA 3Q9LA 4II2A 1XVAA 4MW1A 1IIRA 3Q72A 4QDOA 5AKJA 1T2AA 5ITSA 3ZU3A 3IAEA 3KQHA 1O2DA 3T3NA 2A5YB 1E0AA 2B20A 2GM9A 1UFKA 3SYMA 3OCVA 5EJIA 2ZSEA 3R7SA 2BFNA 1GSIA 1PJRA 3LLVA 1ZWKA 3MOIA 3MT9A 2GXSA 3OZTA 1DDOA 4FIDA 3M81A 3TCXB 2A3RA 1I4WA 2I7VA 1HKHA 3LNTA 2JCVA 2EZ4A 3R4CA 4FGKA 3UF0A 4EHIA 3U7IA 6GPBA 2Z9CA 1H0SA 2J0UB 2JFUA 4MRPA 4BP9A 4GRAA 1QR6A 5ECYA 2HT6A 2GBGA 4PBRA 4BNGA 5HS4A 1C7JA 4N5DA 5JJIA 2Q3CA 1DRKA 1NNSA 3QKUA 3M3DA 2G88A 2ZYHA 4HUQB 3BD6A 1J97A 2AC7A 4KUHA 4LHXA 5EKDA 5J5CA 3RNLA 4BBZA 1EG2A 2OZLA 1VLVA 2W6PA 2ZG6A 1Z39A 1IATA 1X0VA 2GNOA 3FUWA 2ZYVX 5DHPA 2CF6A 2HIMA 3DH0A 3HKBB 3PS9A 3CF6R 1OY1A 2PMWB 3ZE1B 4AJOA 4CLOA 3CUTA 5KJCA 1L2TA 3H19A 2BE9A 3EDQA 1RXUA 5D1NA 2YY5A 5T8KA 5JFOA 4PW0A 1N4AA 5JXWA 1C7ZA 3OJEA 5ALLA 1DXQA 2B4QA 2J3LA 4WKPA 3PQFA 4CTKA 2FLVA 2WKSA 2XMCA 4TWAA 4C1NA 4GW3A 3GP8A 5A5FA 5HR5A 1RYHA 3GO4A 4PAOA 5EJAA 1WXWA 3LFTA 1GDTA 4Z9BA 2OKGA 1NE2A 1Y4AE 3V3TA 1TAGA 3STXA 4YCDA 3K0SA 3KUDA 3RVDA 4ETWA 5LB2A 3OCJA 3GLGE 1Z5NA 4JEHA 1C7EA 4GMFA 1U2PA 1GGHA 3NBMA 4MVWA 4RO0A 2ZI9A 3UBMA 4U2GA 4J0KA 2ATXA 1H2YA 2P9BA 3TMYA 1FTGA 2GJKA 1T1RA 4Z0HO 5LFAA 1HOXA 5DBEX 2FPRA 1X92A 3SYKA 4PANA 3ZDDA 1SWVA 1Y1LA 2LD4A 3KK0A 4H3HB 4RZQA 2A9RA 3F8TA 4XB2A 3ZD7A 1LCIA 5JZSA 1KF0A 2XNHA 1UQUA 4TQAA 1VBMA 1G8HA 1RYYA 1T6BY 2V7VA 2RHGB 1BHJA 3KJGA 1GPUA 4BNFA 3CRRA 1PEYA 3ZOKA 4JITA 2A7QA 1XVIA 1J5PA 2INGX 1DXYA 4KAAA 2BGNA 1WUJS 2Y1OA 1II0A 3FCAA 3MUOA 3G0CA 4PLTA 1L4GA 3ICWA 5CB8A 5HG0A 3L4KA 2CE2X 1P5ZB 3TIGA 2O2XA 3G7SA 3MILA 5EPOA 2J3DA 3DWFA 2RD2A 3JD2A 3LY7A 1WSWA 3IIJA 3GN2A 4NQRA 4NZPA 4QFMA 5CLIA 5FFMA 3HEBA 5B5SA 3TTUA 3CUVA 4GYYA 5BQXA 4NC9A 1AQLA 13PKA 2Z9DA 1U0TA 1FSGA 1FRFS 2GHQA 1J9ZA 1HLPA 5AHRA 2VP0A 3KM0A 3L8DA 1JSZA 1OVMA 5GVRA 1O87A 3B1KA 3VOTA 3CT4A 5ADWA 2ZTHA 4P31A 1DHTA 1GAWA 2H1WA 3AFIA 2O3JA 3G7UA 3ICOA 2PCLA 5DXAA 4ZAYA 3ZWWA 1ZK1A 3WIDA 3L49A 3P4YA 4LGMA 5E3IA 4EF4A 5I4BA 2C4VA 3NHZA 4BPBA 5CEFA 2LKCA 2YZ2A 1DMRA 4FZRA 4ATNA 2DWCA 3VJLA 3P5BA 2DPXA 3CGWA 4NH0A 5B4VA 2FN3A 1C8KA 3D8SA 3HDHA 3DL0A 3GAAA 5E6SA 3CT6A 3R75A 2H06A 3N2ZB 5AW6A 1JQ3A 3DA8A 4GX5A 4JKOA 4D0LB 1N33B 1YDWA 1A82A 4FGSA 1FFYA 3SZ3A 5BWCA 4F72A 1SKUA 1V4VA 2A59A 2BKEA 2D2FA 3K1ZA 4Q05A 4HMPA 3TIVA 1HFEL 5A62A 5JH7F 1X1CA 2QR3A 1DKMA 1UK8A 1IAVA 2FX5A 3PEVA 4JP3A 4OUDA 4R2MA 4X54A 4ZV4A 1XDWA 1EFAA 1AZTA 2Z4RA 2MSNA 3ICPA 4L27A 5A3VA 2XE6A 4WXEA 2UUCB 3MRTA 4OL9A 3OOSA 5HYVA 3N74A 3KWMA 3E2MA 2DKOA 2HHJA 4H18A 3ZI4A 4QEZA 2ONJA 1UK7A 5KI6A 5JEEA 2G17A 3B1XA 1F14A 1CNMA 3EFOA 4J2OA 1H2RS 1AHNA 1JEAA 1UXIA 1K7FB 3JPWA 3VPAA 1YI8A 3ANTA 4CMIA 3UAGA 2DFNA 2VKTA 1Q95A 4MPTA 4DBVO 3H99A 1PJ4A 2EFHB 3IC5A 4M8IA 5EIBC 1SC9A 1VJ1A 2RCNA 1CDDA 4GUAA 2OD2A 1IPEA 1TDJA 3GN1A 3L43A 2OT3B 2XITA 4D41A 1KSJA 2X2FA 4QBTA 1SBQA 1Z4NA 4QJ4A 1WUTA 5EHZA 4BNMA 1EFPB 4GSYA 3SBEA 4G2NA 1O95A 4QOJA 1WMAA 2YOHA 2WJGA 4QDJA 1NBIA 3QNMA 1S8FA 2IUUA 5K0JA 4J1TA 4LBZA 4XGKA 5GTDA 2C2XA 4DV5B 5CGZA 1MJGM 4AULA 4UU8A 3FLBA 3Q7PA 5P21A 3U7QB 2NVUA 1UPTA 1LNQA 4MX8A 1EFLA 2Q28A 4LUCA 3TSAA 5LZ9A 2ZTMA 1VFNA 3VMMA 3BAZA 4OSPA 4KO3S 2YY7A 4F21A 2X9VA 3OPYA 4B79A 2GGSA 1VZ2A 4JB0A 3FR7A 4M0FA 2WUEA 3MWEB 4JVLA 5AJZA 3SJUA 1GTRA 1E3DA 2FPGA 1Q3HA 4C7VA 2I4IA 3OEWA 1WXQA 1O77A 3BHNA 3ZW8A 4ZOLF 4B4OA 2Y1CA 2W6ZA 3GOQA 5ADHA 2N0SA 5F2NA 2PT5A 1BQ4A 4OHRA 3H2JA 1T26A 5KVQA 1U2GC 3WRXA 4UEQA 4Q7QA 3AB3A 4XVCA 5K9ZA 3FMGA 1NMXA 3PZBA 3I28A 1GGNA 3CE6A 3QG5A 3BMCA 3DLTA 3BFJA 4CM4A 2BFBB 2IYUA 4R3UC 1V6CA 3LK7A 4FFDA 2MSDB 3Q8KA 4N6OA 1AE1A 2WMYA 4D4KA 4IH4A 5LP6F 2VYFA 2BEUB 4LGYA 4QDTA 4ZOCA 1PJ8A 2BBOA 4MDFA 3K53A 1UDWA 4A6EA 2PZFA 3CTPA 4NJOA 5CK4A 1UK9A 4IXWA 4BFUA 3KUCA 5K6AA 4GBJA 4ESVA 2GZSA 3SHQA 3ELUA 4AJEA 1CYDA 4IQGA 1SQ0A 1E9CA 2YH2A 3LLUA 3PRJA 4GRDA 4LNAA 4QYXA 3I3SR 5EAIA 4JDPA 4Y2TA 3CC8A 4N47A 3ULKA 1EGHA 4DOMA 1FTWA 4Y0AA 4BQNA 1OTYA 3V8PA 5CX1B 4Q34A 4A2WA 3NHRA 2O8CA 1XYYA 4KPUB 1I4EB 1Z08A 3U5ZB 2YW2A 3O8QA 2HDHA 1TCVA 1T6ZA 3QKSA 1QTNA 4JBGA 1FFEA 2AOXA 2WV9A 4HWRA 2R0QC 2FPKA 1X7WA 2WU8A 1NVEA 1DTWA 5EJ6A 4L9WA 3BXPA 1XTPA 1JEJA 2OBNA 4CN8A 2C9CA 2HA2A 4QWWA 1SD5A 3RTEA 1S9HA 1WQ1R 3NBZC 4PZDA 1EVZA 2F1IA 3EFEA 1I3MA 4O4HB 4KWIA 1VRWA 4OQPA 1E5LA 4P36A 3G9TA 4ZYLA 4NZOA 2JDIA 3MJ4A 4K9DA 3DT9A 4MA0A 4N8SA 3WHKA 1MMFB 2ZAGA 4RSMA 4Q9AA 1H5NA 3OUZA 1Z2AA 2ZJ8A 3AI2A 4ZODA 3OMXA 1YR6A 3ITNA 1ZRHA 3VNRA 1HLDA 4HNVA 2ONYA 1JWAB 4JJ8A 4JXXA 2FPIA 1OD6A 1P5JA 3MJRA 4HN9A 1HZJA 5DM0A 1P7WA 4PLGA 4Q16A 2GN2A 4PZYA 2FA9A 4CTMA 4F0JA 1X0XA 3DUWA 3SYTA 1U0GA 1PEKE 4MO2A 5L45A 4GWLA 3K70C 1XTKA 1Z26A 5FBVB 1XXHB 3BORA 3UGQA 1WY7A 3RC3A 2CMKA 2C8LA 4X44A 4RV9A 2V0NA 4K6GA 4R01A 3EIOA 4PY2A 4FFRA 3QIVA 2HF2A 1YA6A 1N1DA 1MAAA 5C8YB 3K15A 5AM4A 2P11A 3FAKA 5DNAA 3KKMA 3TRHA 1Z83A 4DJTA 1FA9A 4NULA 5JH7A 2I7XA 3P19A 4C5BA 4IG4A 4ARUA 2IHBA 5FF9A 2Z8XA 5AOVA 1GKUB 2Z4TA 1X15A 2H57A 2YFKA 3HSSA 4GRIA 4RHYA 2N3ZA 5CP8A 3RFUA 4JLKA 1OXSC 4PPQA 2O7SA 4OHKA 4PHTA 4F2PA 2OM2A 1FRNA 1XZEA 3BJRA 3C5HA 3MMZA 4RVDA 2WIBA 3HFSA 1BE6A 3GT3A 3T3DA 2VDNB 5LNK6 5BSGA 3LBIA 1NBME 3COYA 4GBGA 5JNRA 3LYHA 1QG0A 4JLUA 2YIVX 4OUKX 1RCUA 2Y0BA 4LE2A 4CU5A 1K7EB 1O96A 3QZUA 2YVLA 3S2EA 3WNQA 4JQZA 5HX7A 3OZWA 3UIEA 4TYMA 4LISA 2V1XA 2F9FA 3L0IB 4IIBA 4H7DA 1EHIA 4UUMA 3EXG2 1JHRA 2OGUA 3I12A 1EXVA 3ZCSA 1QHEA 2J5QA 4ACBA 3LSYA 2J31A 1N1GA 2C7OA 1KAHA 2PLAA 4M9SA 3HMQA 1U0NA 2WFZA 4IG9A 4OMFG 2R3SA 1TO6A 4N5NA 4REMA 2VHVA 4FI3C 4HN4B 4N0EA 4UVIA 4F5WA 2GA8A 1KVQA 2PN1A 2WTMA 3K0AA 2A35A 3PNOA 2ODWA 4J6EA 3UMBA 1K88A 1I01A 1VHDA 4ZT4A 3U26A 5A2GA 3WYBA 4M54A 1QP7A 3SFTA 2J3JA 1NHGA 1VP9A 1INLA 1N2SA 2OV8A 2SCUA 4IEEA 1T9HA 4KOEC 3UBTA 1FYXA 3HM2A 4NYJQ 5ALVA 1E3IA 1A72A 1L4UA 4TTQA 2FEXA 4UM9D 2K2WA 2Z57A 4XRRA 2F4VB 3A04A 2QXTA 2JG3A 3JYNA 3VKVA 2JD0A 3QE0A 4FC7A 4JWTA 1PTJC 3QOFA 4IKPA 2J7PD 1XWWA 4M2LA 1U6JA 3FNEA 3PFKA 4RGYA 4WXMA 5F2EA 4CCYB 4B3GA 4TRMA 5AKXA 1UEJA 2RH5A 2C2MA 2QE6A 3FSEA 3LA8A 4RIFA 3RFFA 3UJ8A 3ZVLA 1X8XA 5B7NA 4IFTA 1V7CA 2GD0A 4ZYXA 1OX4A 1RSZA 3OF5A 3E18A 3WDLA 1KDOA 2VZ8A 4NTZA 3T9EA 1SCAA 5AM1A 3INYA 3T4XA 1K3UB 1X13A 2YWHA 1IWPB 3HG7A 4UVEA 4JR2A 2CL6X 2C2KA 4RLQA 5B4UA 1SXIA 2FG7C 4U6NA 2AZXA 3DYIA 4QUDA 3GGGA 3B36A 3RK4A 3DDCA 2XDWA 2UV8A 5ALEA 1E5QA 2YHSA 3WLKX 4DIOA 1DV2A 1I14A 2V6GA 5IX8A 1QZTA 1H6AA 1VE9A 2HHHB 3EZ9A 1XAJA 1BFUA 1DAKA 3KVYA 2E18A 4G84A 1WHTA 5LOVF 1PGNA 3JASA 3EW7A 4OQFA 1A71A 4MARA 3HO1A 1OV4A 1U7DA 1QIIA 1QPZA 4LMAA 4AD8A 1BXRA 1GYRA 1QGED 3E15A 4X85A 4AICA 2I78A 3DV2A 3M4XA 2WWFA 2HU8A 4QQNA 1PZGA 5D51S 3KETA 1F2TB 2JFOA 1FS6A 2XRMA 3A1EA 3QMMA 1KBOA 3V33A 1HRKA 2PNJA 1NJSA 3WHLA 2J09A 4PAWA 2AMJA 3AHHA 3R6TA 3FUCA 1GG5A 4OQQA 1BKDR 5FV7A 1KK1A 3IR6A 4FGWA 4M49A 2HA5A 1FMCA 2VP6A 1U5BB 2H1FA 1MRZA 1S2IA 1XIVA 3B2EA 4AB1A 3RAGA 2DYKA 3BFXA 3JQDA 5AM0A 2FWMX 2Z6AA 4WKNA 3QE3A 1T0PA 5FBZA 5AOBA 2BEWB 2ZI7A 3JCZA 4YLEA 3V97A 2BUBA 4AO8A 5DLEA 3HPQA 2OXTA 2XE7A 3N5KA 1TEXA 3H05A 1AUOA 1TU4A 1AQYA 1ZH0A 3AMVA 1XQ6A 2O5EA 1DL5A 2AKYA 2C9MA 2ZPUA 1V6SA 1E6WA 1GKLA 1KYWA 3VX4A 3DJYA 4AIRA 2I3ZA 3PR2B 1NW8A 1SVSA 2QENA 4KL8S 5DSZA 1Q83A 1FPQA 1FFGA 4GP9A 1M2EA 1SM4A 5AVOA 1K7SN 1N2JA 3FMIA 5H59A 4QXPA 2XUAA 2AMVA 4HAVA 1FDVA 1N5KA 4X63A 4D4JA 2JLWA 3ICQB 2VNKA 4BU1A 1ILWA 4PYOA 2NU7A 2F3QA 3F9IA 4QYTA 3N3AC 3LBAA 5F77A 5KTOA 1ZQ9A 1ZVMA 1IZYA 2GEVA 1ZVJA 3SGLA 2I67A 4MMZB 4BX3A 2ATIA 1V2HE 2VUSA 3D6JA 5ANRB 1BKYA 1OXUA 3ZWKA 4BQSA 4N3NA 1Y6FA 1XN1A 4K6MA 2B5OA 5KWEA 2QG9A 3T1HB 1IZ7A 2H2FA 1NVUQ 1RHQA 3AZOA 3OEEA 5BOVA 4J3NA 3HU5A 4Z0PA 2QG4A 3P9SA 4HDKA 3CHYA 1NVMB 1HL7A 1OLXB 2C82A 3LYUA 4PHHA 4WOCA 3PRHA 5IP5A 5IXYA 1YKGA 4QTTB 1GOTA 2AXPA 2VDVE 3OY7A 3P0HA 1E9RA 3EXIB 3HP1A 1MCZA 1TJ4A 2BM0A 3UMVA 1B8OA 4UQLA 3D8HA 3MWJA 3F6CA 3GRKA 4BNYA 3BRWD 1F8UA 2FETA 1R6VA 1YS4A 3ZLVA 4JUDX 1F6WA 4XAQA 4BB9A 4NFYA 2HU2A 3LKBA 1ICEA 2WSLA 4U6QA 3CCCA 3G0DA 3RS5A 2FWAA 1E7RA 1JDZA 2Z58A 2PKWA 4JXKA 3I1YA 3HC7A 4JVSB 4ND8B 1Y9DA 4OFWA 4FLFA 3I05A 1GCOA 1JPJA 1OWPA 1M67A 1NYRA 1Q92A 2YJ5A 4YJFA 1RZ3A 5FTWA 4BQRA 1TJYA 2XDYA 3AWIA 1BJRE 1D2MA 1IRXA 1K06A 1DI0A 2CJFA 4N40A 5JALA 3NASA 1N0IA 4P7GA 3IEUA 3RSOA 3AKCA 3F74A 3BN3A 4ZQBA 1ZY2A 3EZ6A 2WC1A 3MTDA 4CMBA 3VR5A 2VBGA 5LYYA 4JA2A 3OFNA 2F1JA 2Q29A 3HR8A 2WPDA 1KZGB 1PQWA 1CDEA 1JTVA 4GF5A 5TV2A 5I7EA 4KE7A 5JDIC 4I1IA 1RWKA 1T35A 1NG9A 2OBFA 4Z6KA 2XXAB 3NOQA 4P7KA 3LSTA 4RW0A 1CRZA 4LE1A 3VPGA 3M6AA 4B9EA 2R6DA 1IZ8A 2VUHB 2XNSA 2QNBA 3QEJA 2WUWE 4FW8A 2RGGA 3MN1A 1XE3A 4D56A 4DV7B 1UDRA 1XRSB 2WD9A 1A9SA 3EXFA 3MJDA 4IQ0A 4MCHA 4MUBA 4CKBA 3AZQA 2HL6A 3MG9A 3IPAA 3GFGA 1PQPA 3U7FB 3UTCA 1YJCA 3PGA1 2K6GA 3T5MA 2LNDA 1Z47A 3BX1A 3I73A 5HA5A 3WNBA 2X8JA 4AN4A 2ZUEA 1V43A 1XZJA 4UD2A 3VPHA 2RC6A 1WOYA 3JAMA 3EMKA 1ITZA 1FX0B 1TK3A 2FE1A 2H5JA 2OVFA 3AQIA 3KSZO 1K6XA 3SEQA 3DAOA 4ZV9A 4NOJA 1Z37A 2DUMA 2EDAA 3GDOA 3HKDA 1CHNA 3K73O 2ESRA 4XJVA 5HZMA 5LOVA 4JLAA 3PWZA 4GX1A 3U4AA 2EFEB 5ALDA 5CD9A 3KJHA 1UFRA 3B85A 3NBXX 4B3DA 4B4VA 4ZIRB 1JPUA 2NN3C 2ZSDA 4ARSA 4DV1B 2BIFA 1XKLA 2LUOA 4G0VA 4JT4A 2JAQA 1GUBA 1HTTA 2A5JA 2Z5GA 2A9VA 2FWPA 1ZKMA 3CLRD 4TWZA 3DZBA 3AM1A 2ZRAA 3HRIA 1QLJA 1EUCB 2XECA 4LDPA 4PC6A 1FJHA 2YRWA 4X7BA 1MGPA 2DLNA 1TYAE 3G5LA 2DPYA 1E6EA 1HYEA 2LZ0A 2QP4A 2ZJ5A 1PQYA 5E8JA 3A2NA 4AZWA 5L6LB 3CF2A 4XQCA 1V41E 3NH9A 5JG7A 3LECA 4YJ3A 1VE3A 2LCIA 4KWEA 3TRDA 1IY1A 2CFRA 2PNFA 3D1LA 5BR4A 2NP7A 1SKQA 4IUBS 5ITZB 1U8TA 1P4HA 4UDNA 1R6TA 5KYTA 2O2DA 2FJUA 3A3YA 1B00A 2WM9B 2XTMA 2YV1A 3E4DA 3BMNA 2KE5A 2O05A 3OLYA 1HDXA 1E6KA 5I9BA 1DAEA 1P1RA 2XY4A 2D2VA 3EZLA 1PF7E 1EEHA 2QMEA 4PYKA 4HWTA 3KFLA 2C7BA 4V03A 1W4LA 1XOIA 3OPXA 4NMWA 2FSIA 4LF4B 1FMFA 4YNBA 3FWKA 4XUEA 2PA3A 3IR7A 3IA7A 3HTXA 2HZBA 1LPPA 1BZYA 3AG5A 2JIRA 3P9PA 2Q2OA 4Z7QB 4JC0A 1AN0A 4OU4A 3SNHA 4EYKA 3K09A 1GGJA 4F97A 5JCOC 5ENVA 2ID9A 4E4TA 5JASA 2OWDA 2VSYA 4R1NA 2D5BA 1XTSA 4JUCA 3HJFA 2ZJFA 4MI9A 2O8EA 3TTWA 5A6VA 2O2EA 3JQFA 1YRAA 5GP1A 1WBJB 5KHAA 3WP1B 3FROA 3MM4A 5KWVA 4RELA 1NXWA 2FFAA 3LBHA 4DBZA 5A04A 3L1UA 3MSCA 4A16A 4KXVA 5JWHA 2RAPA 3KV1A 4QM7A 4KXLA 1KQGA 2JAXA 2GRAA 1TE2A 2IYLD 1XRNA 2Y1FA 2FXIA 4BX8A 4RSGA 4JHXA 2Q21A 3PNSA 3L7JA 2O59A 3BXFA 1FSSA 1UBGA 1V16B 3TLXA 4HL6A 3AF2A 1PG0A 3HE3A 3I6YA 3OTGA 4BGUA 4MCIA 5FD8A 2V4UA 3FYCA 3UPDA 3SQWA 3PE4A 4G0NA 4UUNA 2ZUCA 3NHSA 4C4ZA 1O5OA 2C5LA 1KP2A 5JD5A 5MGBA 5BSRA 2X8BA 3AL2A 4L78A 1BG6A 5LLSA 3A3OA 2DSTA 1Y4ZA 3NHMA 4H3VA 3CZ9A 2NVWA 4YH1A 1GQQA 1OFHA 4CIWA 3TRFA 3WMWA 3PHHA 1LBHA 1MQ8B 1R88A 2H2WA 4O2AA 4RFSA 3SBXA 2BMEA 1R5NA 2ZJ3A 3Q6IA 3ZIUA 1RVDA 1BA2A 1ZIPA 5G0VA 4N5IX 1Y9ZA 5IWCA 3A6EA 1JB1A 2Q2NA 3IBYA 4F8EA 4X5OA 1PFWA 1UKVY 1OBFO 4KV7A 2XYHA 3LBFA 5BRAA 2C0PA 5HUJA 2R97A 1SVMA 3VVCA 3BMOA 3PHJA 3RS2A 4AJNA 4NL4H 5LWHA 1NVWQ 4X1OA 4J7UA 5KOJB 4P7JA 1Y80A 4W8OA 3IMEA 3WLRA 1BU8A 1TYEB 2G07A 1SK9A 2WHRA 1WD7A 3KT8A 3WLQA 1EDBA 1T4GA 1O97C 2RCYA 2C2OA 2WWVD 3GX1A 1ISJA 1FLDA 1T3LA 3E53A 3R6DA 2EXXA 2I6TA 4BLVA 5CDHA 5KOHB 2QUHA 2V97A 1S5PA 5C1BA 4KAXA 1OGIA 5IT9A 1WO8A 3V4FA 1LDBA 1JH9A 3LNCA 1C7FA 5AI8A 3VC2A 4IUCS 3T41A 2GHIA 1WMBA 3C7DB 4IFEA 3NBUA 5CCEA 1DEAA 1MTOA 5J4YA 5JSZB 5BSMA 4W1QA 1IY9A 4IDGA 5DTMA 3OT4A 4G89A 4H7FA 1ZNYA 3IDAA 3BRCA 4WJKB 4ER6A 1T36B 1NLUA 2EKQA 1A4UA 3AWDA 3C5VA 1R18A 2OQRA 3LFHA 1X74A 2WNHA 3AOEA 1RR6A 1OZGA 4MZXA 3RK0A 3WLEA 1RM4A 2WDZA 2ZRLA 3SX4A 4IJVA 5EIAA 1MO5A 5F73A 4IH9A 1XZCA 2B6HA 2NYAA 5TGDA 2R00A 1O6BA 1P39A 2VJOA 3ND9A 2P2NA 4XYBA 5CM9C 5ARCA 3RUCA 4BV2A 3GT4A 5CFZA 1RHKA 3VR4D 4CKXA 3JALB 3FOCA 1WXGA 3CEAA 4X9XA 1BXKA 3RSHA 4X8MA 1T0UA 2ONCA 3IQEA 3L77A 5EP2A 2X5XA 3C6YA 1DBRA 4IQ4A 5T5QA 3VU0A 1YHYA 3DHYA 1DQSA 1GTSA 1AK1A 2VAXA 2HXSA 2KX7A 4LYFA 2I0FA 1Z4PX 1FS5A 5IH3A 4FSXA 3IV6A 4XJXA 2V5VA 2FMFA 1BCSB 1FDWA 2QNRA 3GJSA 2WVGA 3KD2A 4KN9S 3T94A 3H3XA 3O1JC 3VM6A 2ZBFA 2R7AA 3P9YA 3ROEA 1YZYA 1PYGA 3I83A 3OQVA 2BM8A 4EGQA 3MGCA 3GJ6A 2W90A 1E8DA 2D1QA 2JFYA 3ZLTA 3TMKA 3L84A 2C92A 3RVMA 1QBGA 1JFFA 1VE6A 2M6LA 1ZH2A 4I81A 3HVUA 1ZCAA 2H0AA 4CT0A 3FDZA 1QQTA 2OAQ1 1MO4A 3OE5A 4YAEA 1T9AA 1L5FA 5DCUA 3W5SA 3ZLBA 5KWJA 2YIDA 3NIFB 4LRTB 4YFVA 3FCYA 3WL4A 1F4LA 4MUXA 1LBTA 1GQOA 2ZU6A 4R9UC 4B9AA 4FSDA 4CG3A 2HY7A 1IMJA 4J16C 4WZBB 1ADBA 2RAVA 2I8AA 2ILTA 1T5SA 4XPIB 1KE1A 4K28A 1ZGHA 2AFIA 3B20A 5JS7A 1JHXA 1N6IA 4MKHA 2EZTA 1ADCA 1D2CA 4HAXA 2CDNA 3STTA 1J49A 2YHIB 1ZHOA 1KC3A 1F12A 1OF1A 3HU3A 3ZKWB 2F8MA 5J1SB 5DGCA 4B32A 3C5CA 4PO1A 4CG1A 4EQZA 2UXBB 1EDZA 1OROA 2M6SA 1KR2A 3K5PA 4KIJA 2CHFA 1KRWA 1RPNA 5IAKA 4BNDA 3KYDA 2Z6UA 4AG6A 3V4SA 3BCUA 4EF5A 3EF0A 2QLBA 1VJDA 2D54A 2D8MA 3ZXXA 1NI4B 3NYQA 1N2OA 4PYNA 1CFJA 1I2MA 4UXJA 3RJ5A 1JLSA 1WP4A 2QY9A 2L69A 5JSFA 2FMHA 4PZLA 4OI0A 2GZ3A 3PC8A 4GFDA 3WMXA 1DIHA 1FFAA 1FNMA 3KSDO 4D9MA 2E7ZA 5BN1A 2JHAA 3NT5A 5K8TA 1TYBE 4FMBB 3KAQA 5DH9A 1C9EA 2QG6A 1WCWA 3RUHA 1FMLA 2YJNA 3DXYA 4LTDA 2KB0A 3A26A 3PQ4A 5EIHA 2A9FA 1Q0QA 1V6AA 2IEYA 2ZXEA 2C3UA 1KYVA 4WJLA 1DOHA 3HXKA 4QNMA 3LVRE 3PNKA 1G0OA 3AVUA 3S1AA 5TB5A 1NQWA 3HCBA 3REFA 2QJOA 1IM8A 3DEIA 3TX2A 1RRPA 5JZVA 4IMIB 3E48A 3R5KA 4KMRA 2LR0A 3TEMA 3HYCA 3O74A 4AIIA 2ZYGA 2D0IA 4ZWNA 1YB1A 3IPCA 5AOAA 4JU9A 1ST3A 2DUJA 1A7UA 1X8JA 5BN4B 1JU3A 2FOIA 2H1LA 2WP8J 1A9TA 3TLYA 3OQNA 1NVVQ 2QE7A 3LYAA 3VGJA 2C84A 1NW4A 5MDHA 5B7PA 1MORA 2ISQA 3EG5A 4MQFA 4LRUA 3BA1A 3WJ1A 2C96A 2WILA 4QVGA 1XF1A 2J3IA 2ZS7A 1QSGA 4M76B 1VLLA 3RHZA 4XJTA 3UPUA 5GZ1A 2OILA 2OP1A 3NIGB 4NICA 1Y9EA 1O0BA 1EGAA 4UFNA 1D04A 2PKYX 2HBYA 5A7GA 4AJ4A 3DMNA 1RC1A 2OD7A 4G5RA 2OK8A 2FX3A 2OGZA 3SQMA 3C87A 3DQQA 1ISFA 4FFOA 2FY8A 4PRLA 4J3JA 4KRXA 3L1JA 3L4BC 1WE2A 3F1KA 4F5YA 5AXBA 1MT3A 3CLVA 4J91A 4KXMA 1I7NA 4TT8A 4EG3A 1U8EA 4OP1A 4DWOA 4HWKA 2K87A 5LZ5A 1H4VB 3SEAA 4DBLC 4TL7A 3NUQA 4MR9A 3R7FA 1R27A 2E6KA 3CKLA 1C9YA 4C0LA 3DMPA 2NU8B 1GPH1 3GJYA 4DLYA 2POQX 4DQVA 3V2UA 3RYIA 2AFRA 2EKBA 4DC1A 4YUYA 1FC0A 4LK2A 3H4VA 3N2KB 3PD0A 5JCJA 3QPCA 3RRNA 3EBOA 1AOXA 1I5RA 2ZW9A 5A3SA 3RKUA 4LMBA 2PK3A 1SCIA 1LRLA 5LIPA 3BB3A 3Q3HA 5ECDA 1XYVA 3WMGA 1M0WA 1QGUA 3O90A 3FYUC 1UC5B 3P94A 5JS1A 4G3XA 1EGVB 2IVFA 4IKOA 2ZDHA 4RESA 1XRLA 1W88A 4MKXA 3E5HA 4F8JA 4BQIA 5BT8A 2Q49A 1FMJA 5BRNA 5A2QA 1UBEA 1RLMA 2PXHA 2X7XA 4QXMA 3IBTA 1U0EA 2IJGX 4P53A 3V7FA 4EKGA 1YR7A 2ZITA 2CLCX 2CVQA 3FJ1A 3O2QB