3PXBA

Impact of brca1 brct domain missense substitutions on phospho-peptide recognition: t1700a
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
211
structure length
208
Chain Sequence
b'RMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERALKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Breast cancer type 1 susceptibility protein
publication title Impact of BRCA1 BRCT Domain Missense Substitutions on Phosphopeptide Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 69
structure length 208
sequence length 211
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3pxbA02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3pxbA01
1Y98A 3PXEA 4XPZA 2VXBA 3I0NA 4BU1A 4OFBA 4BMCA 4XQ0A 4IFIA 3PD7A 2WT8A 3QVGB 3T1NA 2COEA 3SHVA 2COKA 2VXCA 3L46A 1L7BA 1T2VA 1JNXX 3L41A 3PXCX 2XNKA 1T29A 2K7FA 3PC7A 2K6GA 3EF1A 3K0KA 3SZMA 3PC6A 3T7IA 1IN1A 1OQAA 3U3ZA 3QVGA 3HUFA 4N40A 3K05A 3K15A 2EBWA 3II6X 3JVEA 3K0HA 2LE0A 4BU0A 2ADOA 1N5OX 3AL2A 3PXBA 3FA2A 3KTFA 4IGKA 4Y18A 2INGX 1T2UA 2DUNA 2AZMA 3SQDA 4ID3A 3OLCX 1L0BA 2R1ZA 3K16A 2E2WA 3HUEA 3PA6A 1CDZA 2EBUA 4Y2GA 1WF6A 1Z56C 2EP8A 4JLUA 3UENA 2JW5A 2COUA 3SHTA 3T7KA 1T15A 4U4AA 2ETXA 5ECGC 2M2IA 1IMOA 3T7JA 3PC8C 3EF0A 3I0MA 2L42A 3AL3A 3PXAA 1KZYC 1GZHB 2D8MA 3PC8A 2HTFA 2XNHA 3UEOA 3L40A 3PXDA 4BMDA 2NTEA 3COJA
chains in the Genus database with same CATH superfamily
3D4IA 1VECA 3QXXA 1KI6B 4JN6B 5HBRA 1KY3A 1SBZA 4PE5B 3CX3A 4KN8A 3DAYA 3EIQA 2C82A 4ARVA 1BD4A 4GOJA 1M72A 2JCVA 4WT7A 4MUYA 5D5QA 1PFKA 3GFQA 3OY7A 1N9GB 3ILYA 4G1EB 5K3CA 5JECA 3ZLJA 3DOOA 4AX4A 1NSTA 3OOSA 4IMIB 1T0HB 1T8UA 2QRUA 2BJWA 1ULTA 3MRSA 4FFMA 3NC1C 1XA4A 3FNFA 4UOZA 2CEKA 4OJTA 3CLKA 3PRKE 1NVXQ 1O6FA 1NJSA 3K35A 3OWHA 3EVBA 3I8XA 4ZO9A 2JAHA 3MIZA 4XSVA 4MR7A 4MHSA 3M4JA 1YVRA 2G9UA 1ACJA 4JLOA 5E95A 2MYUA 1BX1A 1HGXA 3QSYA 4AJIA 4YR7A 1OGJA 1GTVA 1HO3A 2PQ0A 1EBBA 3BICA 3E05A 3EQ7A 3KE8A 1PWZA 2HUNA 1WKVA 4LPSA 4M9UA 4LVCA 2GN0A 2ECFA 1ZN2A 2BFEA 3UCXA 2IYRA 1QE5A 1S8NA 4D9IA 4MAMA 4UE3S 2OWDA 1IHYA 3LBIA 3R6WA 1YBAA 2AN5A 5I9NA 3GDHA 2YN0A 4E22A 1NUHA 1ZUHA 3DBOB 2WYWA 3TNJA 5AKGA 4GMFA 2OAQ1 3GZNA 1VJCA 1MAHA 3C4QA 1Y7HA 2C5GA 3G8YA 3KZCA 4LA4A 5CR9A 3UWSA 3ZNQA 1DRVA 2KBEA 4H7JA 3EZNA 3P2KA 3OZVA 4I36A 4OQ4A 4QUDA 5AM2A 2D0IA 4QRIA 4C6TB 1SPBS 3HSKA 3ZHXA 3AUTA 3CV3A 3KSZO 3WOHA 3N8KA 1OX6A 3LQ1A 1AUQA 1K08A 1WMAA 5EGSA 5AVOA 4QPZA 1Q0UA 5GONB 2CCKA 3SKVA 1XCBA 3WWDA 4Y2TA 3U60B 3F49S 1KSFX 2Y66A 1RFGE 4WESA 2H2IA 4TSRA 3VYRB 2TYSB 4OV6B 4AZ3A 2VYFA 3PS9A 2ZRPA 5H1YA 1ML4A 1PQPA 1RWWA 3U7HB 2GTHA 2YXDA 4G5HA 4WJZA 1NDHA 1OYYA 3UKOA 4B31A 5E7IA 2RH4A 3IKLA 4ZMBA 3GW8A 5G1PA 3FOBA 1RM0A 4B9AA 5H4GA 4I1SA 3FKJA 4QAQA 2QN9A 3DT9A 1JR2A 3OMWA 4FBLA 3GLFE 1RD4A 3HXPA 1OA0A 4D3ZA 5BY2A 1PIWA 3SJUA 2BPOA 1RKVA 1RXIA 1UZMA 3K3PA 4I8DA 4QATA 4RQBA 4E6PA 4U7GA 2ZP1A 4WY2A 1UP4A 4LS3A 2JJ8A 1V37A 1EXVA 4UNNA 3D02A 5EYPB 4ZTUB 2XTZA 4F5WA 4IDEA 2D7DA 3ZHBA 2FPGA 1YJ5A 3U3KA 2JG3A 4U9IS 4HDNB 2KS6A 3JYOA 4MITA 1WXGA 2GRAA 2J09A 2HK7A 4ZOLB 5EZYB 4JQOA 1CW2B 2VZLA 5LP6B 4NFLA 3ORRA 1QUFA 1GPMA 4H7HA 4CMEC 3PHGA 1J0CA 1AQJA 4MVCA 1EM6A 2QMZA 4OGGA 3IT3A 1CJMA 2QVCA 4M8SA 2YVQA 4N3GA 1M5RA 4R3WA 3FGNA 2Q5QA 2F17A 4HQNA 1V25A 4MIOA 2RIRA 1GR0A 2C7RA 1MDFA 3NRBA 5LNK1 1AH2A 1HYQA 2FY8A 4ALNA 1ZNXA 3MBKA 3CVXA 5C46F 2W2PA 1X8JA 3LP5A 1SKQA 1KDRA 1R5BA 2NU6A 3MJSA 4R81A 2VUIB 3INTA 4MWCA 4QREA 4CEHB 3TSZA 4GBED 2IHKA 2OKGA 1MENA 4DDKA 4HVCA 2K2WA 1TTPB 3ZQ4A 4ETMA 3KL2A 1OV4A 4B1FA 2OV1A 2FMKA 2ZJOA 1KFCB 1NVEA 2IVZA 2I4IA 3EQ2A 1B8OA 2I87A 4N49A 4DVGA 1AC5A 4F8YA 2KQUA 3AVVA 4XKJA 3VH1A 3NFRA 4IBOA 1ZUD1 1AF7A 2P9CA 2YTZA 3BWVA 4GP6A 4KQJA 4TSFD 4YAJA 1LDGA 5BQOA 5DM60 3U7GA 4D8TA 4Z4GA 3MAGA 3VGJA 3WLIA 4QEZA 4QA9A 1C2YA 3CUVA 1D4ZA 2I2AA 4OXYA 1YDWA 2AIRA 1TIBA 4FQ7A 2QX4A 3DVRX 5BYBA 3O8QB 2R1VB 2H1SA 1TI7A 4NSNA 5EQTA 4YMSA 1JLLB 2G36A 3DDHA 3ZH2A 3G0BA 3LUGA 2F55A 1XJWA 5KTYA 3J81A 3Q87B 2MCFA 1GLVA 5KYGA 3ZBPA 3VJLA 3QLUA 3WYNA 3ZH9B 1ZQ1A 1YB4A 1OFGA 3G6KA 3GBVA 4RPHA 1J8DA 4V0ME 1YB6A 2QAIA 2CXRA 4Y1RA 3AU9A 1XQVA 3Q6IA 2AHOA 3LX5A 1G0NA 1O8BA 3JQRA 4MS1B 4O4HA 4B3JA 1OX4A 3AFHA 2ZRGA 4B3CA 5KMGB 1JG7A 4HT3B 2PLNA 4H3VA 1DEAA 3FOAA 1QGAA 1JYEA 1OOEA 2PZEA 1K89A 3NXKA 4MQUA 4GNKA 3FFWA 4HH4A 1FVOA 5JE8A 2X5NA 1KO5A 2CUNA 2W0MA 3MUNA 3W34A 3QMMA 4NBTA 3TFOA 1I7NA 2PT5A 4XGQA 2P77A 1U0BB 2I4NA 4CNBA 1Z45A 3NG1A 3IMFA 4HFRA 3V4PB 3SQWA 5BUSA 5JNUA 1JQAA 5ESDA 4RLHA 5J4YA 4ID9A 1QAQA 4G26A 4O2BF 1KDOA 2E1RA 4TMXA 2IEDA 4AY6A 3IUYA 4MB2A 3I83A 4C7JA 2QW8A 4NCNA 2QX8A 4MR8A 2HU8A 3ZK7A 3HBJA 1VA5A 1Y48E 3SOZA 3UXHA 3IQIX 2DY0A 5MDHA 4LUCA 4U1RA 3QYJA 2WWIA 4HAXA 4B84A 4UXHA 4I99A 1ZESA 1EP9A 1RAAA 2IGTA 3AP3A 3P32A 4QO7A 2GNOA 4XZ3A 1H8HA 2HBRA 1G6HA 4IKPA 4IF4A 5TDHA 4WK4B 3H2BA 3W1EA 4A2PA 2GWHA 1BU8A 1Z6PA 1O57A 1YS9A 2W71A 3ADKA 2JGNA 1LNZA 1WF3A 3AERB 3VZPA 1GRVA 4JBXA 3SFZA 1E1YA 3ZOZA 5EUCA 1I6WA 4MQ4A 4E15A 3F9CA 4DSZA 3H19A 1Y7TA 3HN2A 4UDOA 3GJ4A 3MTIA 4A3SA 2R79A 4DADA 2IOFA 3RASA 4P0QB 2NXNA 4K86A 1EFAA 2O8BA 2P5YA 2YZKA 4C03A 4M0EA 3I6YA 3TO5A 2B94A 5K8CA 4B6OA 3E7PA 1SVWA 2A9RA 1WDMA 2CLSA 2KHZA 3PRHA 1M7GA 3O4HA 3RF7A 3CLSC 4AJKA 1KERA 1QQ6A 2JL1A 3QU5A 4O5OA 5L3QB 5LPNA 1FVXA 4BL5A 4TQUS 4MZXA 5HHTA 4IIBA 3H8SA 2VDPB 3RHSA 4YRNA 1XU7A 4U00A 1PTJA 4RKEA 4YYZA 4AIIA 3ND9A 4DUPA 3OTHA 2IBMA 4HYYA 1Z5NA 4QJ5A 1YMQA 2JKYA 3FYSA 1GA6A 3AB7A 1V5GA 2C8LA 4PZDA 2FW1A 4AY3A 3QXSA 5CUQA 2IOFK 1DKMA 2RAFA 3H1TA 3L7NA 3THOA 2DYKA 3LJKA 1N75A 1WR8A 1K5GA 3I58A 2X2OA 3L7MA 3ZJVA 3AEXA 3T52A 2WJ6A 5HIJA 2H06A 4LXTA 1R4NA 2OKCA 4NU8X 3RTBA 3CRRA 3KTDA 1DOZA 1RJWA 5E38A 1AKQA 2VSOA 2P4HX 1JHDA 4LE2A 4XPIB 4JVMA 1II8A 1QGUB 3FDZA 3NT5A 1QLWA 3X1JA 5LB2A 4YUWA 3LUBA 1C7JA 2Q2QA 2XE4A 4JP1A 3SDBA 2ZU0C 4POOA 2QK4A 3W8EA 5EIBD 4G07A 3P2OA 4ZEWA 1S6YA 2ECOA 4JLBA 1YBVA 1E98A 2PYIA 2V7WA 2FR8A 1JEQB 2HHJA 2MT9A 1YBFA 2ZRLA 4C2BA 3EDOA 4BU0A 4CTJA 5FPSA 1Q7GA 2GAOA 3MXTA 4ONEA 3OZGA 1KK2A 3TOZA 3HDGA 4HWKA 4Q7EA 5AHOA 5JSUA 1YFLA 3ME5A 3SG0A 4Z1MA 1E7WA 1GTG1 2ZXEA 4REOA 1VP3A 4OQDA 3LCMA 4MUXA 5FFMA 3ZKAA 1WZ2A 4AN1A 5BN3A 1TM7E 1DUIA 5AI8A 1JIUA 1MA3A 1R74A 2P2YA 3ZTTA 1E8MA 3RS9A 2YV1A 3STHA 3SXUA 1B16A 3JAKB 3ZD9A 4KQGA 5H3CA 3BB3A 3FGOA 3PE3A 4IG9A 4JJ8A 4TKMA 4B3BA 2J3HA 4KO1S 2W70A 5IMSA 4O59O 3H11B 1I7PA 3ND7A 1K2VN 3I72A 4FUQA 1NVDA 1EDZA 2XQIA 2M6LA 3Q7RA 3QKRA 2YWCA 1UT5A 3GJ5A 3I01A 4RD6A 2EKQA 1AHIA 2HMVA 3GRKA 3GT0A 2AQHA 4LHSA 4JUIA 4IRXA 1ZAYA 5BN4B 3VDXA 3B1KA 2BTOA 4ZU6X 1P74A 1XKXA 1ZIOA 2P90A 2XUDA 3L6UA 5CDSA 1GFWA 3E2IA 3K9WA 4ZVVA 2PX2A 2VRNA 2ZYUX 1FNMA 4RJ2A 3RC3A 3RYCB 3RFXA 3ZE7A 2CV2A 1OBHA 1X38A 2W2NA 3A3KA 4HAOA 3M6VA 3P9RA 5HE8A 4P7GA 4DLXA 1SG0A 2WJZB 3PDIB 2JANA 2RE8A 2HHHB 2OMEA 1XPJA 3LUFA 1C3EA 1Q1QA 2QSUA 4D4KA 1L7VC 2AEFA 4V38A 3SC6A 2DT5A 3U7IA 1QMGA 3TQOA 3GGDA 3K2BA 5C1BA 1QR6A 1P5ZB 3LGAA 1KJYA 4GWKA 2I9PA 4TV8F 5GONF 5T64A 1HNNA 3GJXC 4XYEA 3EULA 2Q3MA 3EZ9A 4YRGA 1YDFA 4JODA 1JJAA 1V47A 5KDDA 2CHGA 3WHLA 2PRSA 3I9MA 5GM1A 1GGJA 2ZDHA 3L79A 5IK2A 2V1XA 2VYCA 3MSXA 3GLIB 3DM9B 4WA8A 1FFHA 1UBCA 1HOXA 2GAFA 3QOWA 1AGPA 1G1MA 1TRHA 1H4TA 3KZXA 4WQMA 4UZSA 5B6IA 4PSAA 4RWEA 1I4DD 5K09A 1EFPA 1UOEA 3WYBA 2AFHB 1FA9A 1RYZA 3NM4A 2NYVA 1XF9A 1YS7A 1QO0A 5TPWA 2VKQA 1J2EA 3OOYA 3QU2A 5CGZA 5J63A 2ZRDA 1KDVA 5JZOA 3PUWA 2GJ9A 3DMTA 1QZXA 1KO7A 1YZNA 3OI7A 4FDLA 1SNYA 2L69A 5FUQA 5DTMA 4HLUA 3DWEX 1CJUC 1UANA 4RPCA 5AT1A 3EGVA 4YLGA 4ZOLF 4GOXA 1RHRA 5EZYF 3WFJA 1K6MA 5LP6F 2WK1A 3BN3A 4MROA 4ZALA 3WFZA 5MGBA 2MINB 3V7UA 4RFSB 3V5NA 1RBMA 1ZAKA 3IP9A 3FCAA 3LI2A 4KQXA 3JD2A 1PFYA 5DIZA 5H82A 4EVRA 4G09A 3JW8A 4DQDA 2OILA 4HNHA 1LTHR 3GUCA 1CQIA 3A32A 2IS2A 2NN3C 3AONB 2POQX 3PX3A 5KTSA 1H8HD 5EJ9A 4J1TC 4IDFA 2OHIA 4BRZA 5FPTA 1KOFA 2SNIE 4OQXA 1NW4A 3RVMA 2F2TA 1DZIA 1U3DA 2GUWA 2BGRA 4N3CA 3NBQA 3RHTA 3BMCB 3LC2O 1H2WA 3B8HA 3IQZA 1CUVA 3R6TA 5JATA 2WVGA 4KQ1A 4MUFA 4O2BA 1HQKA 4QOEA 1GILA 5DYYA 1U63A 1RYBA 1XNQB 2ZJ7A 1NXVA 4YMHA 2WF9A 2AS0A 3IGFA 1M2KA 3Q12A 3QUCA 3MAJA 3R3JA 1E2MA 3OZTA 5EA2A 4BRWA 3TZKA 2I4MA 3HRIA 1FFBA 4JGGA 3IDZA 1LW6E 3DM5A 4B8YA 1P2DA 4BWFB 4F2DA 3FETA 3G5AA 1QG0A 1ZG3A 2EERA 3KOOA 3IOEA 2R84A 2W6CX 4KVAA 2OV3A 3R7FA 3STUA 2DR2A 2G5PA 4NBLA 4YQZA 2FDCA 3D54D 2QNRA 5LNK6 5SZIA 4S1OA 5IT4A 4CM7A 5SYAA 1N5IA 1LVGA 4LNUA 4TKLA 3I01M 3F96A 4L76A 5ALYA 4AU1A 2C2YA 5JCZA 1C8LA 3ZCUA 3HVRA 2P2ZA 2D6FA 3ZGLA 4O08A 2PMEA 4ZQCB 2ODQA 3WADA 3ZUPA 1XV5A 1MG5A 1U5AA 4ARZB 4FHZA 5JY1A 1B42A 3WWZA 1RZUA 4LQLA 3IUJA 5E4TA 4BGDA 1FYEA 2F59A 1MQ8B 4D25A 3R8CA 5F98A 1PJSA 3MAAC 1UKZA 3I6ZA 1TZBA 1KETA 1NJ2A 5CBPB 1SC3A 1TZJA 2F1RA 3HRHA 1ZJYA 1RP1A 3NHRA 3NWJA 4BQPA 3CINA 3P9SA 4MQ5A 4FYWA 3NDIA 1WUYA 3WA6A 1AZLA 1X14A 3QTTA 1T5HX 3VR3D 4YRIA 3FOFC 3E22B 4H27A 1OY1A 5L6MB 2H5LA 3R4CA 4BEVA 2R0QC 1ZK2A 1LS1A 4ETNA 3K9FC 4YRRA 5M34A 1L4YA 2FWBA 3E82A 3EXAA 3MMXA 4BO6A 1G3MA 3GLHB 4RCVA 1XAJA 3C1AA 4YMGA 2II6A 3KLOA 3HFGA 3PFNA 5DGHA 2H1IA 1T3HA 3Q7TA 3JD3A 3UTDA 4EA9A 1IU9A 1QGED 4K6GA 4KODA 1NVWQ 5BW8A 3B60A 3GMSA 5TQVA 4R05A 1P5FA 4NU6A 4GI2A 5T3YA 4TVBA 4GYJA 4FFOA 4UHHA 2HNKA 2WM2A 3H7IA 5TGTA 1S2GA 1Z39A 4HWOA 5C3MA 5TC4A 1YBMA 2APJA 3I9FA 4S0ZA 5SZKB 4BNHA 4RENA 3KQSA 4MKHA 2Q5LA 1P5JA 2MU1A 3LW7A 1OAOA 4X20B 1VA4A 4B76A 2GXAA 3NONA 4GT1A 5HIMA 2G63A 1CRLA 3F6SA 2BGWA 1H0SA 3BWCA 1OD6A 1YHYA 2PUWA 4GKBA 1IY8A 1B73A 1Y3DE 1DRUA 4JITA 4YUVA 1U3UA 5LZ2A 1L5HB 1N9GA 1X7ZB 5HA5A 3KIPA 3TLYA 2Y8EA 4RAQA 2YRWA 1TFRA 5I47A 3TINA 3KQMA 4DT1A 3TG8A 2YJGA 2ZYDA 3CKKA 3ICCA 4BX0A 4HQLA 3RKUA 3QEMA 4RYDA 3WQBA 3Q2KA 4BE4A 2I80A 4QG3A 1N8NA 2RGNA 2WUDA 4XJXA 4EWLA 3FCYA 1YJ8A 4RE6A 3T9BA 4PAGA 2EKLA 3NYIA 3GLVA 4BZXA 2V7EA 4YJKA 5CJPA 4BLSA 1W4LA 1ZO8A 3V4ZA 1H4QA 3L02A 3IPXA 4FC7A 3KJNA 4Q21A 4GMDA 5F9FA 4N5NA 2ZTVA 2FXIA 1ILWA 2O0KA 3C48A 3N75A 4GU5A 1FSGA 1XAGA 3QOXA 4R5HA 1EVYA 1ZH8A 4S2EA 3V2IA 3GMDA 4YT2A 3QPUA 4CUKA 5A03A 1UFKA 5I6DA 4KFUA 1KMMA 1AS3A 4LAFA 3FSRA 1SXIA 3L49A 5SICE 1SHTX 2YWHA 3COPA 3PGKA 4XEHA 4C05A 2AQKA 4JP2A 4AY5A 2Y1XA 2H4WA 1R9GA 3DTYA 1L5YA 2W6MA 5KVCA 1AA6A 3ZI4A 1ZR2A 3EA5A 1C4XA 4NTZA 3IT2A 2B7LA 4U2EA 4GR5A 1ORWA 1FRZA 3WE7A 3OQOA 3BC1A 1Y1KE 3MS7A 3QKSA 4OQEA 5C8XA 1JYFA 1UBTS 4TTAA 3W0LB 4F1KA 5GONA 3KLPX 4TV8A 2XQGA 1E9EA 4ZYVA 4TZ0A 3BREA 4LRXA 1OMOA 4MW9A 4Q82A 4UCWA 4GI5A 5CLLA 5DIFA 3KPUA 3PRJA 3WYAA 3HVIA 4R3NA 4WD3A 5ER9A 5HILA 1E61A 3U3MA 4XQGA 4HVAA 4OSOA 2R68A 3A6HA 3MMZA 3NYRA 3NBXX 2XOKD 5A3JA 4BRSA 1I14A 4E12A 4L0DA 4D92A 4DDWA 5T6MA 5KQMA 3H5NA 2C0QA 1LBHA 3AUUA 4LTMA 4UVDA 2QQEA 3NEJA 4J4TA 3F3MA 1Y5IA 4WOCA 4URZR 3DHEA 4IJWA 2FN3A 2GEBA 1IOZA 1N5JA 1J21A 1SUBA 4R9NA 2BDTA 4REMA 4XFDA 2XW6A 4XD2A 3VVBA 5FJJA 2FWIA 1J09A 3H6HA 1YWGO 4HDNA 4NG4A 4OSEA 3ZQKA 4ZOLA 2GBFA 3AY6A 3K96A 5EZYA 5LP6A 2ZWVA 3EIUA 4LHEA 1AHHA 4RDCA 4MQ6A 2RD2A 4AKGA 3RM3A 4A6XA 3ILXA 4RXTA 1AT1A 1NMZA 4LZOA 1N6KA 1EWKA 4M99A 2O0MA 4TGLA 3F3SA 4MWSA 2D2IA 4ZANA 1GPBA 3VR1A 3UHAA 2Q7DA 4P08A 3P5BA 5D3MA 2HWWA 3IXLA 3L46A 2JDID 2PUJA 3AY0A 2IP2A 2J6HA 5CT4A 2BRUA 3DQQA 5D85A 3A27A 3DFFA 2PGDA 3G88A 3Q3HA 4RM2A 4BO5A 4NU0A 1X1SA 4NFHA 3M5DA 3HYRA 4Q19A 2HCFA 4GECA 4MDFA 1TTQB 2C99A 3DZKA 4IHKA 4QPJC 4PN3A 4P1ZA 1SWVA 1TVKB 1UMCA 4JLMA 5DM1A 1K4KA 1SXJB 1B76A 1I3MA 3Q1LA 3DMRA 3FXAA 4KDEA 4OHMA 4US1R 3S2YA 4KKVA 7GPBA 2GDZA 4YCJA 3H3XA 5DEIA 3OCYA 1VFPA 2EF1A 4DJTA 5J47A 1DAKA 2AI1A 2MSWA 2P6NA 3FMOB 4FBGA 2Z2XA 3E9MA 4URHA 3RABA 1N5RA 3JRNA 4AJ1A 3NANA 1E1LA 1T8YA 1X2BA 1N2OA 2QN8A 2MIIA 1V35A 2QT0A 2WUWE 1UM9B 2X0RA 4EF5A 1TCCA 3B1FA 4H7KA 1M74A 2JLAA 3RT9A 1FLAA 1S0UA 1A7UA 5TIIA 2R1VA 1DXYA 4QUEA 5UKDA 1W88A 4JMPA 4N8EA 3WISA 2O6HA 2FWJA 5K8LA 2JHFA 2EKPA 2INGX 3Q5DA 3OP4A 3LXXA 2QR5A 4QICA 3DEKA 1Y1SA 2PEZA 4DIDA 2XF8A 4YO8A 4D0RA 4AP5A 2V8OA 1UIMA 3D43A 4DR1B 1HZZC 5JTUA 3ZE9A 3GJQA 1UT8A 2V4UA 3COSA 1XZFA 2PSFA 2W6JD 1J7JA 3L6OO 3W3AA 1XSEA 2ZUDA 4MRMA 3OD1A 2PO5A 2NUTB 4I1OA 4CV3A 1GDTA 4MS1A 4XYGA 1N32B 1EIWA 2D7CA 2PL1A 3LMKA 1GNSA 4LHXA 4JBLA 3GGCA 4TTTS 1SURA 1LC3A 3IERA 4WI1A 2XDQB 1KORA 3MCTA 1YJCA 5KEIA 1N4AA 4RXMA 4ZV4A 4YMIA 1X3LA 1MOZA 2OLKA 2UV8A 4N8DA 3VKWA 1W2WB 2R6HA 3AINA 2XPCA 1AK2A 3HJAA 3EH2A 3HA2A 3B12A 1QANA 2B2NA 4DLZA 3H2GA 1UBMS 3OSZA 1ZC4A 4QBKA 4RF4A 4UOEA 1RC8A 1E2DA 2G8LA 4MKRA 2V7QA 4GPAA 3NORA 1TEVA 2JJMA 2EFGA 4KNWA 4G5GA 2GCIA 4DM3A 3OX4A 2KM1A 4FDUA 5AW0A 4M9RA 1DC3A 1OXSC 4WVLA 1XELA 4H77A 1YACA 3ENQA 4AP6A 3K8ZA 5LB4A 2BONA 2R6GA 5J5CA 3UH1A 3QVKA 1ZIDA 1DUSA 3TM4A 4C0BA 2VT3A 4LHZA 3A70A 4BNZA 3Q8XB 8ADHA 1B3BA 3T9FA 3KE9A 3ANNA 3GGJA 4GE3A 4RJTA 3IODA 2E48A 2EATA 1R8YA 2PS9A 3OTGA 1RAEA 4AZSA 4KZPA 3D7MA 5D1NA 4CMJA 4MVYA 1XXHE 5HZHA 2GYVA 1Z4KA 4EKIA 3EVEA 5J5VA 4PYQA 2OZPA 1RAHA 1U90A 4NOJA 1XMSA 2PZMA 2VDVE 2ZUVA 2EFJA 1Z62A 2P4UA 3QF4B 2C5LA 2NO5A 1C4WA 2Q5CA 4OA5A 1MX1A 4XIGS 1GUDA 4C4RA 4DXDA 2VH2A 3QYFA 5IC5A 1NR7A 4TWJA 1CF4A 1VCOA 5H5JA 1ID8A 3U48A 5KVAA 1TF7A 1XLTA 1QKIA 1W4AA 2FZ4A 4HKTA 2J59A 4M0LA 4R8SA 1B0PA 5L3QA 4G4SO 5IVHA 5B1IA 5AJUA 3AIMA 4E2ZA 2I62A 4OBWA 3SMQA 3OP1A 5F78A 1JQ3A 1IBCA 4MRNA 5JS6A 1YFJA 4G0YA 4B6SA 3QEAZ 1IXYA 4HX9A 5H81A 4N40A 2N47A 2HT6A 3NP9A 3B52X 1SC6A 2MSNA 3H9BA 4KR2A 4XDZA 1NXOA 1FTYA 3CLVA 1M54A 1PNQA 2PMCA 2WMOB 3SQLA 1RWBA 1JAXA 4F8JA 3JYNA 1P8JA 1DC4A 2QTNA 2QZZA 2QTZA 1BE8A 1Q17A 1QHSA 2E85A 2RIPA 3RU7A 1G2QA 5EE0A 5LXTB 3T12A 1RPAA 4L9AA 2H4YA 3ZW7A 1NAIA 5IJ0B 4KRGA 4A82A 3ZVMA 2WICA 3TD9A 3GT3A 1R6AA 4XPIA 1QHGA 4ASUA 4RF3A 1QGUA 4HEA6 1U3VA 2RBGA 4U5XA 5C5DA 1P72A 1G7TA 2I2FA 2PFSA 3KB6A 4ZDWA 4BTLA 5A62A 2J67A 2OD9A 2EIHA 3QBDA 1V6SA 2QKYA 1Y5NA 4HAVA 1KZ9A 3T38A 5FPQA 3K70C 3KD2A 4BP9A 4ALLA 1PGQA 5C34B 1KFJB 1N2XA 2P1DA 1F0KA 1J99A 1LQ2A 1JEQA 1Z7EA 1KPGA 4EENA 2VJYA 4RSRA 2FEWB 2OORA 3ACCA 3TPFA 1P0PA 5J43A 1OYVA 1VI6A 4L28A 3KQKA 4MWOA 3DZDA 3E5NA 4UTOA 1GTMA 3QFHA 1N34B 4U4AA 3IJEB 1X9HA 3H9CA 2BZSA 3UVEA 3OVMA 3AKCA 1MCZA 5GZ1A 4OK3A 5C51B 4EF4A 1BOOA 2G07A 2IA5A 5ALZA 2HRCA 1JHZA 4YAFA 4F3TA 1NUAA 1D3AA 1GYPA 1RAFA 2YOHA 8LDHA 5KKCA 1N7GA 3MLBA 3RTAA 4IVNA 4A0SA 1G8MA 1H1TA 2QZSA 2JLVA 5AVWA 1KYYA 4AIRA 3E3OA 3LLSA 2QTRA 1T9CA 2Z9CA 4ZYWA 5FPYA 1PFQA 3QENA 2PR7A 4ZXPA 1UXJA 1OVMA 5F1YA 5BO5A 4U2DA 4EB8A 3AL0C 4BQNA 4DG9A 5I45A 1E9CA 4MDEA 2ECQA 4ZOEA 1JLSA 2A35A 4B0OA 3PQCA 2VDWA 4HYQA 1U2GC 1Q3HA 2GPBA 5DYIA 3ZZUA 5FT9A 3K71B 5DBHX 2HZBA 3V33A 1L5MA 4LI3X 1J2RA 1H2ZA 3PXEA 3RBVA 2R00A 5C1IA 4G37A 1SHLA 1KK1A 2C88A 3G9TA 4PWYA 4KC0A 3CPJB 3PD7A 3F6PA 3WIEA 4JJZA 1PG2A 3GEIA 2EAUA 3OPYB 3X2FA 5JNRA 1M34A 4M8IA 4N7MA 2C84A 3VPSA 1ADFA 3S3TA 3KWMA 1I7SB 1NTRA 1O58A 3NATA 1U9ZA 1MVLA 3VOBA 2XZOA 1JFSA 3JALB 1YAJA 1ND5A 3ZS9A 2TECE 1U9JA 5E6SA 1TK9A 4FHCA 3VO8A 1KJZA 1KDPA 1YZUA 2PNFA 3V7WA 1K9VF 3ASYA 2IXTA 1QHHA 3DMNA 3MWGA 2XUIA 1E5TA 2CDNA 3L3BA 3D59A 3K05A 4CQMA 3EY4A 2G0TA 2GARA 1XWIA 2GZDA 2BZ0A 1Y37A 3KCQA 3N7UA 4YCCA 4GRIA 2MSKA 1QVVA 1E5XA 1E6MA 2IYOA 1PGOA 3GH3A 4I5EA 3TRFA 4XVCA 4GM0A 1PNVA 5KYUA 5C7IO 2D1SA 2PKWA 3PFFA 5BOSB 2ADOA 2XB9A 3P8ZA 3WA7A 2VQ6A 4GLOA 4DCJA 3W8RA 4WW0A 3NGMA 1IQUA 1QV7A 1T8PA 3GG2A 2WTBA 3I5AA 1L8XA 2QLNA 2R6ZA 3WAKA 3HVUA 4F45A 5AFSA 5AKIA 1I36A 3BWYA 1Q1ZA 2FLWA 1XK6A 4A9AA 4AO6A 2P7IA 4OP1A 1V6CA 1YIDA 1JXQA 2IOYA 4DLBA 3ZWXA 4ES6A 4XWOA 4KBGA 2B9EA 2VBGA 3O6VA 3BVPA 4G1MB 1FDRA 2GTIA 2P6UA 4J16A 4CN9A 5I7OA 4UAJA 2IL1A 2CD7A 1SCIA 3DFIA 3BMCA 2FPMA 3KV3O 3L1IA 3NIDB 4MVJF 4NBKA 5EWMB 1XVAA 3OMLA 4JWTA 1U2RA 2OYSA 5P21A 2QX9A 5LLDA 1EVKA 1QH9A 3ILVA 4HGNA 2WM3A 5ECYA 4PBSA 1HSOA 3NHMA 4BFUA 2CYBA 3RUDA 2H7YA 3EVFA 4QX6A 1JDSA 1M6EX 3JATA 5JCOC 2QP3A 3PPYA 1NASA 3NCTA 4Q34A 4MRPA 4AROA 2JAPA 3KJEA 1I2BA 2QD3A 2EKZA 2G9ZA 2HPHA 2HCJB 3GPDG 3O4GA 4JUFA 4NRDA 4LGYA 1N77A 4NDNE 3WNZA 4H4DA 4CKZA 3D6NB 4KH1A 2DUMA 2VK8A 2AG5A 4NHEA 4DDVA 3O9MA 3DDNA 3BF8A 1O3YA 1EHYA 1QRDA 3BERA 1I4OA 1L5OA 1NYQA 1IJFA 1POWA 2QTCA 3E81A 4WZBA 5H02A 1CRWG 1Z73A 2VF8A 4Q0MA 5C4MA 3D7LA 4MRSA 3L8MA 2NQ8A 4BZQA 3CZ5A 1DG1G 4OHVA 1UAAA 1ATIA 4DN6A 3IBYA 4ARZA 3A6FA 5H9VA 1T2DA 4AN4A 1LRKA 3VYSB 4ATNA 1QGZA 2QXYA 4O0LA 1EWTA 1DWOA 1HDOA 1FP1D 4N1AA 1T26A 3DYVA 5CBPA 1S9HA 3M9LA 2ZWPA 3HJCA 4FHDA 3TW0A 3DMPA 1M8KA 9MHTA 1EESA 1NQ5A 4HNSA 1JR4A 5KOJB 4MYSA 2V4ZA 2IBTA 1G2OA 3AKEA 3SHOA 2AVNA 4ASUD 2IZ7A 1Z5WA 2W37A 1H1LB 1Q22A 1L5VA 1N9KA 1PZHA 2KWIA 4LYYA 4N6GA 1SBHA 2GPYA 4KK3A 4ZREA 4B32A 4EJ2A 2JGEA 2Z1DA 4X6YA 4X8MA 4UFNA 4Z0HO 3U37A 1YVUA 5KYXB 3ML1A 1OT3A 4MKGA 4Q4AA 5JCXA 4R9RA 4IFBA 3K9LA 3GLHA 5DHRA 1LVHA 4JJ7A 3W05A 3OTIA 4YUXA 4ZZIA 5FUMA 5C7LO 2FHPA 3IE0A 2NSDA 2PZAA 3WMWA 4ZI2A 3H5IA 1JZSA 3NGXA 5L7TA 2A5GA 2WDPA 4CF7A 1YU9A 2W22A 4IYJA 4IVPA 4EBBA 4GXRA 5A7GA 3W90A 3WYEA 4RFVA 2BD0A 2PUTA 2E4ZA 1FQWA 2HDNB 2UYYA 3TOVA 2FR0A 3BMOA 1ESDA 3CTPA 1WHSA 3V55A 4B35A 5CFPA 4D9HA 1MQAA 3L8YA 4FGWA 4GM1A 1P3JA 1FRNA 2IHZA 2P9JA 2FMIA 3ADCA 1N36B 5JRDS 2ZRKA 4L6CA 2XMDA 3H5TA 2BN4A 3HCRA 4C30A 2R6CA 4KN5A 5JNLA 3DVSX 3MGCA 4X20A 5ED0A 3LQQA 3OG9A 5I8PA 1X1CA 3ABIA 2C5AA 2GF0A 4MUEA 2H3EA 4GQBA 4PX3A 5AKKA 2JVJA 5ENZA 3THXB 1SVIA 3PXXA 4AJJA 1XTSA 4JI2B 2WM9B 1CP3A 2IV7A 1TF2A 4Y6SA 3KQUA 3OJFA 4RU1A 5BMOA 2GJ8A 3G79A 3O4RA 1JVNA 2BMVA 5DLQC 2CNNA 1XVIA 2PCJA 3I2KA 1TUBB 3ESXA 5B2EA 1UFQA 5E2AA 1XZAA 3CVYA 1WOYA 1IZ8A 4WZAB 1WD7A 1WCYA 4FIDA 2ZUTA 4BBZA 1QIIA 2WJVA 3CLUD 3RTCA 4FR5A 4L5AA 4MPPA 5DF1A 3VNSA 3BE4A 4Q9LA 4N01A 2EP8A 4CCAA 4F21A 1M33A 3SIRA 2QE6A 1U04A 3HP4A 4LTDA 5FAKA 3RAJA 1SOAA 5AI4A 5HCIA 4UCFA 3HO1A 3JWHA 3LUAA 3IOMA 3PENA 1Y3IA 2OCPA 3THYB 3DTVB 2P78A 4DDTA 4P7BA 4LJKA 3FYUA 1MRSA 2OV2A 1M2OB 4INPA 4YRZA 5IN5A 4N8SA 1KA9H 3WLQA 3BPSA 2PL5A 3KVOA 4JU9A 3JR3A 5JZBA 4JH0A 1JDBC 4FXOA 4B7AA 3FM9A 2VRWA 4MVJH 1AD2A 2FZLA 1D0SA 1MOQA 2HA3A 2PG3A 1DKPA 1NJGA 3CPSA 3HCFA 3HV2A 2E87A 1TCUA 1U8FO 4C0XA 4MIYA 1Y4ZA 2C4TA 3DMDA 1DBSA 1M6HA 4Y98A 1N0UA 4CQMD 1ULHA 1D0VA 3GP5A 2UXDB 4AQDA 5KWVA 2LIPA 5D5HA 5BVGB 5ED4A 1TLLA 4JC8A 3CCCA 3M5CA 1FZTA 2GQ0A 5L95A 4NS1A 4MX8A 1RC1A 1VCNA 2GCPA 4UE2A 2IV3A 1FJ2A 3ZY2A 1YVEI 5AH0A 1YL5A 3E8MA 4NH4A 5L7YA 2ATIA 1IHPA 2RGUA 3W6UA 1AS0A 1CJKC 1I1QB 3IP1A 3QBEA 4DLYA 5AI6A 3AETA 4YRSA 1QOPB 2CDAA 4J1NA 4Z9AA 4X95A 1AKMA 1WO8A 3I4LA 4R0NA 1ISJA 2EZTA 5C81A 3OCUA 4HWPA 4YJFB 2CVFA 4DA8A 2G3YA 2G1JA 3TRJA 2IXDA 4N0PA 2ZS7A 3PU6A 2YZ2A 5HJ5A 2WWXA 3PDCA 1UP7A 2WSSA 2C98A 1U1EA 2V7XA 5EJ2A 5DK4A 3W2FA 3RSFA 2WSYB 4UXJA 3OT1A 4AZTA 4UNPA 1T4DA 4RY2A 1R0ZA 4O4JB 2XITA 3QG5A 2BFPA 4EB0A 1H94A 4PAQA 4Z5XA 3O75A 1T9KA 2PPLA 4JT9A 4UATA 2REQB 1I4LD 1R16A 4BV3A 2EFEB 4FZRA 3TNLA 2QTVA 3FSJX 1V8ZA 2PFKA 2JIZA 4Q3AA 4LYAA 5B6JA 4QNNA 4U9UA 4HDSA 4RLQA 2VDUE 3AJEA 3BGDA 3SZRA 4MTLA 3QUTA 4A5OA 4DABA 4DIKA 3L4JA 4KITB 4WXYB 3WKDA 4LZLA 4B3MB 4B5KA 3SGLA 1I30A 2AJLI 5AHXA 1E7YA 3T5CA 5EMJA 1Y42X 3TTTA 3BF7A 3F7OA 1GJRA 1XCJA 1OI4A 4M55A 4BLOA 1H69A 1T3SA 1TZ2A 3ZU5A 4CI9A 4YX9A 1MABB 4MVJA 5FAXA 1YQUA 3TRIA 2YHIB 3KAJA 1YQQA 2P9YA 2A0WA 3PKJA 3H4IA 5DWQA 1L4HA 4DR3B 1SXJA 2ZJAA 3GV0A 3THWA 4OHBA 1OV6A 3A1NA 4YRQA 3ZCPA 5CCXA 1C9KA 3T8YA 2D3TA 3JCZA 5JCPA 1WQ4A 2A1IA 4QDUA 1CUBA 3AMVA 4H16A 4QXAA 1LDMA 3Q98A 4EEKA 3HQ4O 3O94A 2ZS8A 3IV9A 4KJXA 3SSNA 3QVLA 2PH1A 3SDZA 1XCOA 1LW7A 3JAWA 2IPNA 2WW8A 4Y9DA 3NKLA 3B3FA 4MCAA 1P60A 4OI2A 1DFHA 2ID8A 1QZ3A 3OU2A 2XVYA 4WNAA 4YDSA 3AEKB 3UUWA 2JI7A 4IIJB 4PRKA 4RD0A 5EI5A 3M6IA 4NH0A 3OZFA 4XLTA 3OE7A 4LPKA 4YLEA 2ZRNA 5SY6A 3TTWA 4CL0A 1WG8A 4IUBS 5JD6A 2XMPA 4CDRA 2DY1A 3A1UA 1HWYA 1X1EA 2VS1A 5HUHA 4M1TA 3HADA 1OZAA 3UJPA 2C5SA 4PPNA 3EGIA 3WNBA 1M1ZA 4HFNA 1XKQA 1K3UB 1E1KA 2ISSD 1S2DA 3OCZA 5F2EA 3SE0A 1ONBA 4OXKA 4JI8B 2P4QA 3HXMA 1DIAA 3ROQA 3FH0A 2G77B 3I3OA 4WLVA 4ZZ1A 2QQ5A 3KQTA 1RBQA 1VJ5A 4XXHA 5AK4A 2IYZA 1WKBA 2E4WA 2QHXA 4M3NA 2BUAA 1G5TA 2C2HA 3VPXA 3ODPA 3LO5A 1BHSA 1U8ZA 3BWBA 1E60A 1THTA 3JYHA 3F78A 4ZO7A 4PX2A 4AKIA 1LVUA 2PUHA 2REOA 2J3LA 1JDVA 1U6KA 2H52A 4A92A 4EO7A 1T0IA 1L4LA 3H2JA 3I2FA 1LPPA 2PT7A 5K0LA 3N58A 4M60A 2QV7A 1E6WA 3HNOA 3PICA 4PYOA 1UOOA 4Y9UA 3ROXA 4EPWA 4RVCA 1KI7A 1Z5VA 2DCMA 3DF7A 2V6IA 1YQGA 2IC5A 1I6KA 1Y8RB 2WLSA 4OQLA 5ALPA 4KG7A 3HWX1 3WWCA 3OUTA 5KKNB 2E5WA 2GRJA 2GK6A 3NU1A 3QJGA 4GX5A 4CMAA 1JHPA 2O1WA 4PYNA 3T0GA 1OWNA 4D79A 2GHRA 4RSGA 1HNZB 4MXDA 1QYVA 2WFLB 2XCUA 1UPFA 4IVRA 2I3BA 3B7WA 4WADA 3WBBA 1T29A 3WRYC 3ZLUA 4MAAA 1E7SA 4M89A 2QRVB 4X0EA 1FFSA 3ZC3A 3V7YA 3ZZMA 1OFUA 1RIIA 1XZPA 4AZWA 2W5UA 3AQIA 1GM5A 4RGQA 1VYTA 1T5LA 1R9JA 2XIQA 3BIOA 1Q6ZA 1U7PA 4ZJYA 2X58A 3QGMA 3H3FA 2PGJA 1GZSA 5EERA 3FVWA 4L16A 2VA8A 1NVBA 2W2XA 3ZGNA 1YUNA 3EVDA 4YWJA 3CGWA 4D6YA 2H2HA 1CVIA 1DV2A 1N2GA 1MU0A 4G67A 1WA5A 2QRPA 4DNPA 3RC2A 3ZDYB 4MGIR 1X3SA 1R1DA 2UUOA 3D0OA 4B5LA 5BSKA 4ZVKA 4CCWA 4ZCIA 2PWAA 2A9QA 2PCLA 3P9QA 5GGXA 4R8RA 4DMHA 4RVFA 3PFWO 1DWUA 3LF2A 5ARCA 4JSYA 3HA3A 4CCSA 1X70A 2R6JA 3WJ7A 2PD4A 5FQOA 2BHNA 2A1TS 3DEIA 3T61A 4ER6A 2JAOA 1JEAA 1PT6A 2F8MA 2NTYC 3RREA 1ZYUA 1IQ0A 3L0YA 3IKTA 1Z47A 2ZXFA 3F90A 1IM8A 4QDZA 4ZVMA 5EIEA 2OXFA 2WD7B 1HDYA 1A97A 5KHOC 3F6EX 5A4DA 1N5DA 2EP5A 3OHPA 5FTJA 1G41A 2B98A 4QGSA 4RVHA 4J94A 4X84A 5G4KB 1JFLA 1JL3A 4LXIA 4ZYYA 1DGQA 1INLA 3ZY5A 2C95A 3C6BA 4UU0A 3E2MA 2ZR7A 3GNLA 3H97A 4Z3DA 4EAQA 5BXYA 2JCGA 4U6QA 5IPFA 3QQPA 5ESRA 5HF8A 1R6DA 4R1SA 4LFCB 3H8VA 1RWMA 5IZCC 1BWRA 2QRHA 2GPWA 1PR3A 2DFKB 1QQ5A 5ECGC 1PKEA 2WSSD 3AIIA 4H6WA 1PDVA 2IU6A 5AO9A 4LXGA 5LP1A 4IDPA 5AW1A 1TD9A 3B6IA 5KNBD 4BMSA 1TUIA 4J3NA 1R4MB 3KTOA 3TR5A 1V11B 1GEGA 3DCJA 1TQ2A 3K9BA 3LBNA 4KEAA 2BYTA 5IVIA 1TA0A 4Q47A 2JIZD 5CFMA 4PG4A 2BC9A 1G7CA 1LLFA 3CG4A 2J8ZA 3CSSA 3GLTA 1Q84A 5B3JA 1EX1A 3M6UA 1AQ6A 4UUNA 1M5TA 1V1RB 1YR6A 2W6QA 5DU2A 4NYJQ 4JUBA 1U3GA 2XYRA 3PX7A 1EFRD 3RRFA 2Z8ZA 2FAXA 1ZR4A 1U2EA 2FFBA 3M70A 3M4NA 1RHUA 1O8CA 2FGJA 3LT2A 3G1UA 4UTXA 2QSJA 4HDRA 3C8UA 3VOTA 2X40A 3MWDA 1C8BA 3MUEA 3LL4A 2WG1A 4RMGA 4EW6A 3VHXA 5BV1A 4M9CA 4E2XA 3VJKA 4X6UA 5EFOA 3F71A 3GJRA 3MB5A 2W43A 2WAOA 3GJZA 2G70A 2YZMA 3TSCA 2IS4A 1VLLA 5JMPA 1NXWA 4UTZA 1IZZA 3ASVA 2F1HA 3PPWA 5BRAA 1ZA1A 1SIBE 3S68A 4FDAA 4X60A 4OFWA 2BFCB 3WWOA 4ND7A 4KIWA 3IHKA 1TDJA 2I5PO 1X92A 2PMDA 3AHEA 3HFJA 3I2YX 3OH8A 3ORQA 4NPHA 4QDXA 5KVQA 1IHDA 3CX4A 1KZHA 3TFQA 2F00A 5BWNA 5CB8A 3TGLA 3T99A 2H9AA 2K6GA 3LFHA 4IH4A 2V7BA 1H22A 1SD2A 4PF1A 3H2YA 2FCAA 4WZZA 1KKLA 4XWYA 5CA0B 1PVOA 1BS1A 3EMVA 3V8MA 5JSYA 5IWAB 1ZVVA 2ZZNA 2YXBA 2DZDA 3UPTA 1P75A 4M54A 1ANKA 3MWKA 4EB6B 1EDBA 2QGFA 2RKWA 3TGPA 2VT6A 3MRTA 4QJBA 3OPYA 4BQRA 1GCOA 2QEQA 7ABPA 4RMIA 2ANBA 3WK6A 2WRZA 2HA0A 4BO1A 2ZBQA 3T7RA 4DR7B 3DG9A 3OU7A 1DKRA 2H4JA 1RKXA 5IARA 4MI6A 1L2TA 3CUEF 3W7BA 5I7UA 2DR3A 5HM6A 7MHTA 2H4ZA 1QYXA 2AKAB 5F4BA 3L7KA 3INNA 3FNBA 3M5WA 2POCA 1TMKA 4YJGB 4B09A 4TLCA 3GELA 5CXSA 3GRZA 3NRCA 3WP1B 4ZVNA 1G38A 1Q57A 3QWBA 1J9EA 4YCAA 1SCJA 2B6HA 2HM7A 1JAYA 3ER6A 2P1RA 3H5OA 4XVRA 3IKMB 1BHQ1 2R8YA 4YRKA 1HMYA 3HEMA 3LQ4A 5AUNB 4L4YA 2B5VA 3OLVA 4OX9B 5ILQA 5F2NA 3RRJA 3C3YA 2LR0A 3LXUX 2FDRA 3I04A 4BNFA 4FE7A 3QE4A 3UJAA 2A0XA 2DX7A 1RLTA 3DVAB 4JMLA 3EVZA 3HSYA 4JI6B 3VYVA 5I4KA 1A4XA 2B2CA 3EGXB 3VNQA 3NNSA 4AJNA 1C9MA 2J48A 5CDYA 2QQGA 5JLJA 3JPWA 4UW9A 3H8JA 1NZFA 2DKFA 1ZD5A 3SF0A 3N3AC 2NZVG 1KMCA 4M37A 2HSJA 2AE1A 1JXOA 1PAUA 4AMBA 2B7BA 1G9TA 3I1FA 3S5JA 1N2SA 1NKTA 1J2TA 2E1PA 2PKXA 2VF7A 5IAEA 4BN4A 1DOHA 3IR6A 4F5DA 5K01A 2PV0A 4BB5A 3TQTA 2W2KB 1C1XA 4AJPA 2H65A 1OR8A 1RPNA 1Y6JA 2PLRA 2WIBA 2C29D 2YMQA 4KW7A 3CIOA 4XIYA 5AM5A 5EWMA 4BX9A 1IHOA 3R8FA 2IW1A 3B85A 4P22A 1K9SA 3QTLA 5JYCA 2OFFA 4DY6A 3E48A 4QYMA 2XAAA 1ODKA 1PZNA 3FBTA 1HURA 3PUJA 3F2VA 4L5JA 1USWA 1EWRA 4NQZA 4AP9A 4FB4A 2CVHA 2YXEA 1MO3A 1BOFA 2RAPA 4S1PA 2O2CA 3IUPA 2RB5A 2ZIXB 4CT5A 2FG6C 3B89A 4FMDB 4AJ4A 5JYDA 4Q4DA 1B6TA 1RZVA 2AI3A 4FCTA 4F92B 2FPXA 5JFOA 4GKJB 5FXMA 3T5DA 3WIDA 3BIWA 3CVVA 2R7MA 3COJA 4WKOA 3WLTA 1P4SA 2VR1A 1HBJA 3OCJA 4TN5A 5LA6B 4NK4A 2CVZA 3NFYA 4F4JA 5CXUA 3PUXA 1NY6A 1E2IA 4OBEA 3A1VA 3ZCXA 4Q12A 5JSFA 3VNUA 5KB3A 4QXMA 3S8EA 3T0IA 5JT1A 4G8BA 4Q03A 1WW8A 1O0CA 4L4ZA 1DNPA 2CJXA 3MJRA 1VMKA 5IMBA 1UEXC 3ZU3A 2MSDB 2CNOA 3S7ZA 4AUNA 4YGYA 1J07A 2BE9A 4Q7LA 3E3LA 1P9NA 2FEOA 4MP8A 2F48A 1JDZA 3EWAA 1DIBA 1M6WA 3FDIA 1SKYE 1FMTA 3MRVA 1R3DA 1E66A 3QX9A 3R74A 3QKUA 1RRCA 1H1LA 2ZT7A 1GNTA 3AVWA 1HTBA 2AMJA 3CLTD 3Q7QA 4JYBA 5HGJA 5A9TA 5CBKA 2F1KA 1UBOS 4M86A 5KYXA 3GPLA 1EK2A 2ZSAA 4ZYTA 3AU8A 3LNCA 1FSPA 1IY1A 2EJUA 2HPZA 3EZFA 1DP4A 1T43A 4X62B 3E1KA 3AJAA 2DBRA 1ODTC 2YQZA 3AK4A 3I6MA 4F71A 2CLOB 1ECBA 2XQVA 1W59A 4AURA 1H5QA 2FE1A 2JIQA 3CLHA 4ZOCA 4JCOA 2R62A 3HCNA 3WV5A 4Z2AA 4ZQHA 1QAMA 1SKAA 1WUTA 2X0NA 3SMVA 3FLEA 5H70A 1PL8A 3MOGA 2M1ZA 4FFSA 3ZOKA 3HXOA 2WHYA 4P32A 4OYHA 4TPKA 1N5KA 1UAGA 2QNIA 4CIXA 3QVWA 1HDCA 4P4SB 2ABWA 4ND4A 2CXHA 2A86A 1QYWA 2KI5A 4FX2A 3ZW8A 1IC6A 4NZNA 4TL6A 1BE0A 5FLEX 4PPFA 3WTCA 4EGFA 1TK2A 3GRAA 1YZVA 2HIHA 1S2MA 1PGPA 2YBEA 4JX9A 4QUAA 5JU6A 4US0R 1SIOA 3LIIA 2GBPA 3PQ5A 6AT1A 3THXA 4N3BA 4ML3A 4S2UA 4ZU3A 5BQXA 2XNSA 1L1RA 2AF3C 4LBWA 4FI3F 4MIKA 4N47A 5LQNA 2H54A 1V39A 3OBIA 4R2MA 5LZ4A 2QY6A 1D2CA 5JSKA 3WO1A 1KPIA 1SA0A 3MYYA 4ND5A 3H83A 2BTEA 2HUPA 4CM3A 3VA7A 3IAXA 1TUBA 4HRAA 4J2TA 3NAZA 2O7SA 4G56A 3ROGA 4UAVA 2FEKA 2OHHA 4FKZA 4Y2YA 5C35A 1Q11A 1XZJA 2XX3A 4YCDA 2YWJA 2JZNA 3GJSA 5KOHB 1EQUA 4KWHA 4TS4A 3KCNA 2IUFA 2C57A 4YUAA 1P19A 5DN6D 5MHTA 1WZEA 1E3DA 2OCBA 1X1DA 4NMXB 4Q00A 4CI0B 4JROA 4NMWA 3MTEA 4TOIA 1JKJA 1ZMRA 2OHOA 5MF6A 1IG0A 1UJMA 3THYA 5F9HA 1DEKA 3QF7A 4G81A 5E3JA 1C7ZA 1M2OA 4C21A 1U8UA 2WVHA 1OJLA 3ETHA 3QLUC 3WSVA 5BSFA 2XCRB 5ALSA 2HHLA 1GN8A 2Q4TA 3DDOA 2QVLA 5FWYB 4TV9B 2JA1A 1R12A 4HRXA 2Q3FA 2XVMA 2FP4A 3WL4A 5FTMA 2QYHA 2ZUSA 3UPUA 2DGDA 2ZI7A 1ECGA 5CFZA 2XMCA 3G6WA 4WXRA 1V7ZA 3HYSA 2JI4A 2P9HA 2XYPA 3BA6A 3NBKA 3Q3EA 3H86A 1HTWA 3DCIA 4JNCA 4R2KA 3FTQA 5CLHA 2VUSA 4I4TF 2R7NA 3ZCSA 5IHXA 3U4QA 1RU3A 1CCWA 3FWYA 4V0SA 1E5LA 4BLWA 2VCEA 2C42A 3LUJA 2PUVA 1WMDA 2ZYTX 4F7DA 3DE6X 3C70A 4G2NA 5U4QA 4DC9A 3CRMA 1T6YA 2PRZA 4F5YA 1ZKMA 2FQQA 1PFVA 4E1AA 3LK7A 3V2UA 1AV7A 1OFHA 2GN2A 3Q3IA 4KQHA 4WJKB 4ZYUA 4G23A 2QJFA 1XRRA 4HWTA 4WEOA 4P8RA 1JJ7A 3MGKA 3SJZA 1WXWA 1E3IA 2NLOA 3UHFA 4LNHA 3AZPA 4L75A 2O23A 4INZA 4R54A 1A8IA 4CCYB 4ZEXA 3A7EA 3UN1A 4CF4A 1JP7A 2QPAA 5KX5F 5C8YF 2FSGA 2XA1A 1G8JA 3EARA 1RWNA 2EX0A 3R0VA 1NF8A 3MWEB 2BI4A 3UZUA 4LFBB 1PEDA 3ZY6A 3BE6A 4DA6A 1JEEA 1O4VA 4D0LB 3NALA 4GLLA 2AXQA 3II6X 2WTMA 1YZLA 4YRLA 4LHYA 3WLLA 2XUHA 4ZVLA 5B2ZA 3K1AB 4H1TA 4JQYA 3MJFA 3A9VA 3PPIA 4D42A 4DBZA 2YIJA 3AF2A 4JU8A 1UJNA 4NCKA 3VUFA 2I1LA 4LF7B 1A9XB 3PNYA 1LV7A 5JLAA 4DR2B 3PGJA 1Q1BA 2REQA 1Y4SA 2FUCA 3KWJA 4Z1OA 4AKHA 3ZYCA 3IIJA 5EHNA 3V6LA 1I32A 4EUEA 1LC0A 2PWZA 2WZQA 4TTQA 4X1OA 4ZQFA 2FSHA 3T7TA 1LX7A 3DP7A 1JDTA 2XTAA 5AVJA 4I66A 3GFBA 2VEDA 5KYTA 1N3BA 1WB5A 4NAUA 2BVNA 3RS2A 1K3FA 4W5JA 3CHYA 1HYBA 4PGHA 1U81A 4P4NA 2VPTA 4NOLA 3QLVA 4BNNA 3QEKA 4MI9A 3M83A 1RYYA 5CA0F 2AKYA 2C2WA 3GXBA 3F73A 4IW3B 3FTNA 2YHIA 4KO8A 3U56A 3NCHA 3QXCA 4OLFA 4A2QA 2C9BA 2ZRFA 3VDNB 2B6NA 1Y6FA 1DFGA 1U6IA 2JBWA 3OQIB 5AW6A 1PTJC 2IHTA 4PXAA 4RY8A 1USVA 1HDZA 4HHEA 4DAEA 3W6NA 1VXRA 1GXSB 3RTDA 2XGGA 3T35A 1UIRA 4NEQA 4A7PA 2Y27A 4Y2SA 3H2HA 1CVLA 2JS7A 2HV8A 4GGPA 1X7HA 4MPRA 4IDOA 5AXBA 4RULA 1PV1A 2FW0A 2Q0HA 1WZUA 2UZ1A 4RJLA 1V4VA 3V8BA 1OB2A 1WCIA 1V0JA 5I48A 1Z0FA 5KOIA 1E9DA 4K9OA 2WB4A 1ZJ5A 1NSYA 4C20A 2QLLA 1PFUA 1JFRA 3IE1A 2C54A 3EZLA 3WLEA 1OXBB 4Z53A 1S3FA 3AEKA 4OBBA 2OCKA 5DXAA 2ZBPA 2C7GA 5EXTA 1XRPA 4LJ8A 1CEEA 1RP7A 1PHRA 1XQYA 2W4IA 4KB5A 1DO0A 3PE6A 4OOFA 3BRSA 2I65A 3N05A 3TEMA 3EAFA 1NBIA 2BEKA 2VSXA 3ZBQA 1EXDA 1WX1A 4LY6A 2ECKA 2WVAA 2H5JA 5FWXA 2ZJ6A 3CVJA 4TLAA 1PP4A 4IOLA 4EW1A 1M1YA 1WXDA 1BN6A 4JEHA 1HFEL 1IOVA 1ZN7A 2FR8C 1D7AA 4QOJA 1F14A 2XKAA 2YICA 3B1XA 4LDRA 3ASUA 3G3EA 2PGOA 5JZ9A 4DSNA 4FU0A 1JHUA 2PH7A 1W581 3DR3A 3E84A 3F98A 4MUKA 1MT0A 3MJTA 3LY8A 4RORA 2P3SA 1N9ZA 2REBA 2P5TB 4ZZ2A 4C29A 4ECEA 1OBFO 1BEZA 3KJGA 2CMKA 2ZYIA 5EZ6B 1QLJA 3CRQA 1T2VA 4FYVA 5CIYA 4N54A 3VTKA 1VE9A 3MS2A 2YR0A 3MTJA 1V8DA 1Z28A 1DPGA 2I03A 3ZVNA 4DIUA 4BKUA 1JQKA 3LFTA 5E1OA 3ZE2B 5DK6A 1QTQA 1SM4A 1Y8RA 2OZVA 3ZD7A 4K8RB 4LJ4A 3MWJA 1MORA 2HW8A 3CS3A 2DQYA 4P93A 2LGJA 3KHSA 1BO6A 1DMRA 1OIWA 3ZR4B 5CFQA 2XF2A 4G1FA 3ZTYA 5MN6A 1V45E 2XZPA 1YRQA 1UQRA 5FBVB 2WFLA 3HKCB 3P97A 4FMDF 5D1HA 3DTNA 4HC4A 2LNDA 5HQJA 1UMBB 1DT3A 2QRVA 2O2GA 4AKSA 4NZ9A 1P18A 1QMPA 3DAOA 1BSVA 1HFWA 1WDKA 5K0NA 5D86A 3IHWA 5LA6F 3NTUA 3RR2A 5JRZA 1PEYA 3LKDA 1N5OX 5KU7A 3RNOA 3AL2A 1YB5A 2O7NA 4EYEA 5CEJA 4QGAA 4Q4CA 1RI5A 2LZ0A 2HI0A 2PBFA 5BWMA 1ISIA 4KR7A 1R66A 1YONA 3BRWD 2G8NA 1RQ7A 1LTKA 1P6QA 2O57A 1UPBA 3BWXA 2HRDA 4NDAA 5FWNA 5HTOA 3D7SA 1ZIXA 3Q9SA 4IG4A 1NA5A 3ELBA 5F1PA 5LZ8A 1FEZA 1Z4QA 2FJUA 1E3WB 2B5WA 2OCLA 3AV3A 4UHCA 2XR1A 3INGA 4N7BA 3ZPXA 3AHIA 4U3JA 1QVZA 3A1FA 4Q1CA 1N2EA 1EHIA 5FTWA 5CG1A 1R6UA 4JYCA 1ORTA 5IUNC 4KCGA 4PYLA 2BELA 3D6AA 4QTUB 3WLPA 1OXTA 1Q20A 2EZ9A 2A9VA 3RAEC 1NIJA 4QT4A 3LLMA 5JAPA 5LKRA 3VMFA 1OGIA 2HWXA 2JCXA 3EVGA 4QQRA 3TZEA 2M2IA 2Y92A 3DMTC 2KE5A 3AP1A 1RPJA 1OI2A 1STOA 4NAHA 3ZHOA 2D8AA 4NC9A 2AJCA 3PXAA 4K03A 4FM9A 3IIIA 3ETLA 3QUAA 1MZPA 3EQ8A 4OHOA 4NK5A 1PWHA 1WNTA 2Y9PB 1EJ6A 1H3FA 2HSWA 3HP7A 3KJIA 3LV8A 5DH9A 3OC6A 4TUYB 1W36D 1ABBA 4GX2A 3VTAA 3LX8A 4I4TA 2B34A 3N8HA 1FS5A 2JI6A 1GNVA 1CUCA 2I1WA 3AFNA 3FZEA 3TLKA 3ECSA 3I2IA 2OBYA 5DHUA 1A9TA 3AT1A 2AJDA 3HJGA 4P4UA 1GNPA 1I3CA 2BFAA 2PGAA 9LDBA 2G4LA 1L5FA 3I8SA 5T8KA 1R37A 5EJ7A 4KQKA 1H5UA 4XTCS 2BFDB 1QV9A 4Q3LA 1R4MA 1G4UR 2V7TA 3N8IA 1FU4A 4QRDA 3GRFA 5CITA 1MEEA 3IUSA 5FEMA 3R9WA 1NQWA 3CJRA 5JXWA 3IQXA 1Q2UA 5I7HA 4HMQA 1J25A 5C8YA 1GSAA 4NE7A 5KX5A 1QWSA 1LDBA 2D13A 1T6BY 2CHUA 4NE2A 4JK3A 3J81k 3EXG1 3C74A 4XX0B 1V1RA 2AN3A 5JPIA 3UG6A 2O3UA 1Q16A 4EG6A 4EFMA 4D4HA 3RAFC 2CC2A 3T3HA 6ABPA 2VK1A 4NS4A 3RS3A 3FTEA 3PG5A 3U19A 3AGQA 3VO1A 4C43A 3UK2A 1P2GA 1SBNE 1G2IA 2YWGA 2ZE8A 4OHRA 1JHYA 5IM4A 1Z4PX 5HYVA 3RSCA 3S2UA 2GD0A 3MK31 4X00A 1RQLA 3HY4A 3GRYA 3DJYA 1Y6ZA 5K3BA 2QLMA 3EY9A 2FTKE 3KLNA 4FFLA 4E31A 3N6VA 1CEYA 3GQVA 3RSLA 5K4GA 2X23A 721PA 3PHLA 3D6MA 3KOMA 4BNTA 1L9XA 1QVRA 2X3FA 3BCSA 5SYNA 5BV7A 3T1NA 4CEIB 3SSMA 3H9GA 1JLKA 2JGDB 3NIBA 5HR5A 1W1UA 2HSGA 1DIRA 2BGUA 4HAZA 4BC1A 4TV9F 3PUYA 3TX2A 3IQWA 3K31A 4J0FA 5L4NA 3TE7A 1AZSC 4JHXA 1PDOA 3KS9A 4JHLA 1EB8A 4YRFA 2CE2X 3UW3A 4UFPA 2QTLA 1HX7A 3UXYA 3U1BA 1U4OA 3N76A 3D3NA 5GINE 4DZTA 4IWNA 1IRXA 1O6GA 3Q8WA 3GJ7A 4GGMX 3ZUGA 4ZJUA 3I12A 3RFUA 1AJEA 4H6VA 5CYGA 2AZMA 3LX6A 3RSHA 3HDTA 2LUOA 4TMFA 2OCXA 1BE6A 3B7PA 1NWHA 4B7ZA 1G42A 2VXYA 1SBQA 1Z16A 3K5IA 4RKYA 3H1PA 4IFTA 3GJ3A 4RWZA 1AO3A 2YYYA 4W8OA 5L4LA 3NHWA 4DNXA 2QL9A 4DZRA 2H1LA 1WE2A 5KO2A 1AG9A 4YJGA 2AG6A 3F8WA 4IO1A 1IBRA 1NW7A 2E0IA 3UGKA 5B12A 3BMXA 4A16A 2REXB 4EHBA 2RHWA 3H3JA 3PC2A 5I51A 2COUA 3LTEA 4OHWA 3V46A 1SOUA 3EIOA 2YC4C 1NC1A 1XP5A 2HJSA 4G0XA 1N2HA 4R6WA 3MZ0A 4HUQA 4YT5A 1ZGCA 1K6EA 2SBTA 1JS1X 1K8XB 3VVMA 5A7HA 2UYCA 5A0TA 3T3OA 3BFXA 3C98A 1UBLS 5LFAA 1FQKA 4KV7A 1OAOC 4FJ0A 1MHPA 2W6ZA 1KZYC 4KUHA 4QTYA 3SC2B 4CMIB 1EX7A 2ZYAA 2NSLA 2H51A 3AUJB 1DL5A 4PRZA 4WLOA 4K9PA 3AESB 3RH0A 3RJMA 3VR5H 3ABRB 2PLAA 4NCJA 2DFVA 4NYIQ 2FKAA 1DCMA 3EBLA 2I4TA 1PD0A 2QUAA 4WASA 3QVXA 1CIVA 3MG9A 4GYKA 4K46A 5CW2A 1EE2A 5HDBB 1QRSA 2ZAMA 4U7WA 4UU8A 1V3TA 2WE8A 3TI7A 4CMEA 5C5IA 4W6ZA 3HJHA 4YP0A 2OGZA 4NIMA 2AH5A 2BIFA 2WJGA 2W2KA 2P2DA 2Q4BA 1MJFA 3IS3A 2R1TB 3OZ7A 4P3YA 2EGHA 2RARA 2PXHA 2WPDA 1E89A 4V39A 4WXHA 2RGNC 3RJTA 3AXSA 3WQRA 5IJZA 1R5NA 2OBMA 3S29A 4QPNA 4CM5A 3O38A 4TMWA 4YQEA 5BUQA 4X63A 3P4YA 1ZLXA 1L3IA 1LBIA 1UXGA 2VBCA 4YRJA 3FVTA 3KVNA 3SR0A 1BEEA 4URXR 5LM3A 2Q99A 3DLAA 1LCIA 2DWCA 1MRNA 1A9SA 3NHSA 1LLDA 4HQFA 4AFNA 1U9IA 1VL5A 3L0OA 4Y7DA 2P4SA 3EEOA 1KZGB 4Q3CA 5F64A 5K2MA 1WCXA 3GP8A 3VYUB 3RRZA 5HUQA 3M33A 2WYOA 1T1JA 2XUZA 2ZI5A 3DHYA 1GTL1 1HYEA 3E15A 4JEMA 2YIVX 1M2EA 1I1HA 3BL8A 3HSSA 4G1BA 4QU8A 5LA6A 3UTCA 1BKSB 1CULC 1RRGA 2OPBA 3HVKA 4PLWA 3SZGA 2JARA 1B00A 4EFLA 1QTIA 1WOMA 3EQ6A 3WKCA 1U2PA 3HCBA 1Z0KA 4BO4A 2OV8A 4DRXA 4W5OA 5FBRB 3LUHA 1EXWA 4NATA 2EBWA 4PSVA 4DWJA 2WWYA 2IIQA 2FSPA 2PZBA 4B3DA 5I9IA 4J3JA 1QE0A 3ET5A 3UMVA 3EIHA 4N7RA 3AC0A 1IATA 2GLUA 4MS4B 4WE3A 4B48A 3CH6A 1F7UA 3T7EA 2ACEA 1IB6A 2JZCA 2YNMA 1YE3A 2A67A 4S12A 3SX2A 3LWNA 4F38A 3WL6A 5MFZA 3D64A 3VR5A 3ZHZA 1V8FA 2OQIA 3QYAA 5K6AC 1U8CB 2KSQA 3DKIA 1YQWA 2RGAA 1LPAB 1FP6A 3ACDA 2O8DA 4UZEA 3LAWA 5KYKA 1SZCA 4UNRA 2NSYA 4YJ2F 1THGA 1KBOA 2AYXA 1O5TA 1IXKA 1TVEA 3KSUA 3PYLA 3USCS 3R24A 1HT2E 4MV8A 4BLTA 1RI1A 2ZWIA 1IL0A 4B4UA 4NDZA 1UADA 2JHPA 4LK3A 5J4HA 4YJ3F 4B4OA 3WKBA 2Q5EA 3ZJYA 4F6CA 6CHYA 3Q2IA 2DHQA 1SO8A 4PINA 3NEPX 1QK5A 2ZYVX 3B48A 4WKPA 1T1GA 1UF9A 4LY9A 3C3BA 1QU3A 3E9RA 2O8EA 4EEXA 1NI4B 1C80A 5LP6C 1T6XA 4WBXC 5DCUA 2IX9A 4MS3A 1JIVA 4P4LA 5HS6A 2FVYA 4OJMX 4RKQA 2X41A 2JW5A 2OC9A 3BHIA 1SOMA 3ZWDA 2QT9A 2O9JA 3DEHA 3GUUA 2ZAIA 3IMKA 2GEVA 4P4SA 1Z38A 2JGKA 4B2IA 4C4ZA 3UMYA 2ZTSA 3NBMA 2VZ0A 5ERXA 3W5VA 2Y1FA 1XLVA 4YAEA 1VPLA 3IV6A 4DARA 3M4YA 2BFBB 5JTTA 1IAQA 2H3HA 2OM2A 1EI9A 3LBFA 5HGXA 1WSAA 3BSFA 3K0FB 1OC4A 2YX1A 2EQBA 3U40A 3LY7A 4EQZA 2CE7A 3CF2A 1Q74A 3VX3A 3WNQA 1KEUA 1UJCA 2WVJA 4M1SA 1FS4A 5HJ2A 3WVNA 4L8VA 3T5BA 5K0EA 2B1QA 2YWBA 1JFVA 5FKJA 4FD2A 4P5EA 4LOKA 3TWOA 3OQNA 2Z6QA 1U0EA 2RGGA 3E7DA 1HT3A 2JA2A 3V4VB 3G5UA 1SCUB 1SUSA 1U4NA 1D2RA 4F72A 4BJHB 2G7MC 3BGOS 1YJBA 3OWOA 1FC0A 4X45A 2LIVA 2R8BA 3BZBA 3BL5A 5DCYA 3FKSA 4Z2YA 1JQBA 1M2HA 5LN1A 1UZLA 2ZATA 2VI5A 2CL5A 4ZC8A 1D1QA 1ODJA 1EU1A 4WHMA 5F73A 1VG9B 1HR0B 2HK9A 1NM5A 1CE8B 1ULSA 2QN1A 4OMUA 3GJYA 1IY0A 5BMVA 4TZ6A 1GCAA 5F2OA 3JZIA 2Q6LA 5BNFA 1U0TA 5TF0A 1ZJJA 2XQFA 2I7DA 5G0WA 3SS7X 4U8GA 5GMOA 3Q8KA 3TZ6A 4JXKA 1U7XA 4FS8A 3LCRA 3TLAA 4ZCPA 2C00A 1KXJA 1Y3HA 1RM4A 2ZRCA 3DL7A 4B17A 3OQBA 2ZUUA 2OP0A 4DNQA 1T2FA 2ZRQA 3HU2A 4LKOA 5DSZA 4A2CA 4B4KA 4DCPA 4TV9A 5FWYA 3W4KA 4IX1A 2PXXA 1IXRC 3CJQA 3DAPA 3BTUA 2Q9CA 1OBVA 3BA1A 4OFXA 3U16A 2CNWA 1QF6A 1TZKA 4I1YA 1SMKA 2BJHA 1KAHA 4AS3A 5T41A 1WABA 3SBXA 2JHAA 3KWLA 1WUKS 5DTRA 4LCBA 2G5CA 1T0JB 2LD4A 3LT5A 4IH9A 4R2IA 4V2IA 3G2KA 3V42A 5HQ3B 4G0ZA 4E6EA 4YHHB 1M34E 4TT3A 4E5MA 4MKFA 3TI9A 2C8VA 2BR5A 3VAAA 3LT1A 3G2MA 4RABA 2IEGA 2OXIA 3TQHA 3KHTA 2V6FA 4D4MA 2RHBA 5HKKD 2V0GA 4LF8B 4LWQA 4BO9A 3W6ZA 1YR9A 3UO8B 1TTHA 1ODSA 1XNGA 4UEWA 2YV3A 4Q1BA 3U4GA 4E11A 1EXMA 3AEUA 4I9NA 3IV7A 4HUTA 3CBQA 4P5DA 4CCYA 1L3CA 1Z2NX 5DW0A 3UB3A 3K70B 4E5SA 4Q6WA 1T4GA 2QOEA 2ZSDA 3AF3A 4YH1A 1YGPA 1SXQA 4BTVA 4KL8S 4PNHA 3MWEA 2FKNA 3IOCA 2DKNA 3KFXA 3C8DA 4AB1A 4N0MA 4C7XA 2GKOA 5F3DA 4ID3A 2X8WA 1Z13A 3G8CA 1YNSA 5FPHA 1DKLA 2BL4A 4HLQB 4QOGA 1MQ9A 3DEFA 3K1AA 1KAOA 5LOVB 3IPRA 1YI1A 3HUEA 3CONA 3EXFB 3LKBA 4G9BA 4XYBA 4JKIA 3S1LA 1QV6A 3S2SA 3TDMA 4U5QA 1MA0A 3UB2A 1NI5A 1XZNA 4RL6A 4RHXA 5K3AA 4G63A 2JFBA 2FEMA 4O1MA 1QKJA 1WLSA 3FNIA 3G9UA 3Q4GA 2GYUA 4KWTA 4L9SA 4OHKA 4ZGWA 2NACA 3KSAC 4IR7A 3HNPA 2F3PA 1C7RA 1V9LA 1TM2A 3GRVA 4QODA 1OU0A 3NDPA 5LIPA 1HF3A 4LSGA 5GOZA 1YJXA 1GTSA 4CEJB 1RCFA 3F8TA 5I3ZA 4UVHA 3F9IA 4HGOA 3QM1A 4G5OA 3U13A 1XLTC 1SCKA 3QE3A 2VAVA 2DSNA 4LC0A 3D5EA 1WDTA 2ZB3A 4P98A 2VHWA 16PKA 1X42A 2XIJA 2YOFA 4JYPA 4ND2A 2WEKA 3EFBA 3V8RA 5TX7A 5JZSA 3K92A 2FPIA 5TV2A 2N1MA 1QGDA 2WSIA 5A1TA 4GYYA 1WLYA 3OQIA 4V0MA 2CDBA 1BAPA 2WLTA 3FNRA 5HCUA 2BH2A 3K0AA 5J2UF 4K0KB 4C4OA 3ABZA 2G09A 1GXSA 4ITUA 4PANA 4D7AA 3WRWA 5KSZA 4JI3B 5K0BA 3PIDA 4HQ0A 2HIMA 4HBGA 3IEMA 1WUHS 2BGKA 4HXGA 2YNMD 4KO3S 2BKLA 1UEJA 3VR5D 2Z1NA 4DV3B 1EGHA 2X5XA 2Q6OA 5AVSA 1UOQA 2QD2A 2QP4A 3RKRA 3DWGA 5D5PA 3LIPA 4M0UA 2VP9A 1IPEA 1IVYA 1DI0A 4WZBE 4ENVA 4A6PA 3CEPB 2WFMA 3OAAA 1MC5A 1YTUA 3GNSA 4NENB 4K9KA 2Q49A 3T6KA 5HSGA 1KK3A 2CWWA 3GPIA 4Q9HA 5JDCA 1T91A 1ZC3A 5IKXA 4UUPA 1H2YA 5M5BA 1PJBA 1CZKA 2P4EA 2VBIA 2VH1A 3R7NA 2ZRHA 4TYYA 5EMNA 1QKKA 4Y1FA 5EY5B 2N9UA 5AM0A 2W7TA 4PQGA 3O74A 2OORC 2KJQA 1R10A 4HNGA 4TMZA 3GVPA 4IEFB 1ZH4A 4JQCA 3PIRA 1H0RA 1UWCA 1XXHB 2NZUG 3QP9A 4QL3A 4UREA 4CZ2A 4EY4A 1XPUA 1NNUA 2ZE6A 4YJ2A 3EUAA 3PHHA 2EZUA 3BQ9A 3KZ1E 2HF8A 4Z4IA 2RHRA 1OLUA 1PX0A 4YJ3A 4AS2A 4EX7A 1BCSA 3WGQA 1E1QA 2CMDA 2HMYB 2DPGA 1KS2A 1K5DA 3A2LA 5BUCA 2FSSA 3JWEA 1VHDA 2X0IA 1TGVA 1X86B 3EHEA 3GYGA 4J1TA 3IIMA 3L7BA 3V3TA 3DSRA 5CB6A 2F64A 2CNKA 1QH0A 4ENPA 4GG1A 4I19A 3BGIA 1GZ5A 1F4PA 1HZJA 3IVGA 3QK7A 2GNAA 5FUXA 4ND6A 1TGYA 1ZW1A 4BNWA 4D80A 1A8SA 1PHPA 1SGWA 1E2QA 1L4EA 4MSUA 3HKCA 3TZCA 1E2PA 3FD8A 2DXIA 4GLBA 3TSWA 4H0CA 5IW8A 1MHTA 1PUJA 1V41E 1K7SN 4JCCA 2C1ZA 5EESA 1WZNA 1ZSYA 3L7YA 4MW2A 1CJBA 3JSAA 1DAMA 4L15A 4MMZB 3M2PA 4OQPA 4U63A 1SHKA 3CLUC 1E2FA 1KDZA 4DQ0A 3MSCA 2O3SA 1TK3A 3E23A 2EG5A 4RZIA 1JKMA 3HGQA 5COBA 1AKUA 1YS6A 2IV2X 1LJ8A 1A9QA 4LRQA 5CJJA 4HDOB 2QD4A 3FUCA 3H17A 5FUBA 3WK7A 4BEWA 5DSXA 1JIIA 1ZRMA 4I81A 3V1TC 2PGNA 3PGA1 5K0JA 5DCWA 2CUZA 3LW8A 3NOQA 3FHLA 4LXQA 2F43A 4G5RA 4AY4A 4IOJA 2O0HA 4ND8B 2CHVA 4LDNA 2F9LA 5KNDD 3ROMA 2CNWD 3ZG6A 3SQNA 4KE7A 4QPDA 3SYNA 2VNKA 1KC1A 1SXGA 2JAWA 2J9ZB 2XB6A 2CJFA 1SU8A 2Y1OA 3B2EA 1XO1A 4N4AA 4C6SA 3EOBI 3DFUA 1SVMA 3DA8A 3CNHA 5AVRA 2FN7A 1VJ1A 2NUPB 4TT3D 4MUBA 2I33A 3T5GA 1Z0IA 5CM8B 5LYJB 2PUGA 1AA9A 3GO4A 1DJPA 3WB2A 4YRCA 3H0EA 5KHLB 4LV6A 4V2UA 1A5TA 3EZYA 1PNRA 3EFOB 5ER6A 5DLDA 4KXLA 1TYZA 4XPZA 4JS0A 1W52X 1UINA 2FN4A 4I55B 1ZM3A 3SVZA 3WDMA 3WG9A 4FLMA 4M87A 1ICIA 1HLPA 2WF7A 4BTEA 2IZ5A 3EGWA 3E7WA 5FTKA 2GZ1A 5JQGB 3DBLB 3KQYA 1TQDA 2QQFA 4L7VA 3L1VA 5JO9A 2O20A 3TLJA 5TJHA 2ZEJA 3A9TA 4TLEA 4RHFA 3OJEA 3AWDA 3TL6A 1DAFA 3D81A 1G7SA 2P41A 1UBFA 3LA8A 3KKOA 2CW5A 4J16C 3PJDA 3T41A 3DYBA 1DWPA 1FRVA 3H9EO 4RX1A 2G83A 3OA0A 1ZEJA 3SOPA 2H7XA 4KPEC 1MW8X 3KYCA 3BAZA 3UWPA 3T7IA 4G84A 2SKCA 2ZI3A 3F3YA 1JJBA 5DWVA 3A6PC 3BK1A 1NHWA 4OK6A 4IXMA 1F17A 3FMVA 4JVSB 5BWLA 2F1IA 2FX3A 1YR2A 4MQLA 2XCLA 4X5OA 3MD9A 4C4AA 3AX6A 4XARA 4EECA 4LCEA 4NCAA 3GZTB 5E4YA 2Z30A 1QO9A 1U0OC 3MIIA 5DT9A 1L5RA 3WMEA 4D9KA 4QZVA 1KRXA 2Y05A 3TSYA 4F97A 4FIZA 3FTPA 3IAFA 3H05A 3AVOA 3PJEA 2JFYA 4R3UC 2OXRA 4Z8XA 2VP6A 3NMUF 5D6NA 1NBHA 1S1MA 1NUUA 1O94A 2ZSKA 3IAM1 3OT5A 1EUYA 5C5EA 1GR1A 3E35A 4O8ZA 4BQIA 1ZGGA 1F9AA 2YQ4A 2Z5GA 3GVXA 4QYXA 1Q6YA 1QIMA 4IUYA 3U0VA 5DNAA 2AZXA 1GQRA 3R20A 1SZDA 4DV2B 4C06A 4Q4JB 1EK1A 2Q8PA 3CX8A 3IMEA 2GRUA 1JQJC 4Y6RA 1UK7A 2YDXA 3C39A 4YJDA 4CEIA 4IDGA 2FSIA 7MDHA 5CVCA 5I4IA 2P65A 4KVGA 1HEYA 4GSYA 3N0XA 5LUBA 5E0OA 5GPBA 1Z68A 5FA6A 5AUPB 1A27A 4MVJE 2QX7A 4O4LF 4OAQA 4BLVA 3GEDA 3GARA 2HXSA 5K2OA 2XYHA 1JDBB 4V24A 1CNMA 4N6OA 2C3MA 3A58B 1JB1A 3D8UA 1FFDA 1EUQA 5CX4A 5BW6B 3VHLB 3PWKA 2NXJA 3EOAI 4CG3A 5J2UA 3DW1X 1YAHA 2CB0A 3TUJC 3QLTA 3KJFA 2ZSBA 3R0QA 5CLJA 1K6XA 4RMHA 3FF4A 2YWEA 1TJ3A 1VKRA 3TF5A 1EP1B 2PH5A 4WNAB 3NRJA 1J0XO 1A5BB 1GPJA 5CNMA 4NJEB 1I5OA 2QLBA 3MOIA 3PZRA 3A6EA 2P69A 4EUFA 1HC7A 4TVOA 5GV8A 5CYOA 2YVLA 3ETJA 5IX8A 1F8UA 2E4YA 4R9UC 4HWGA 2J0UA 3ZV7A 1UWKA 2PAFA 1NYLA 3IA7A 4UM5A 1NQOA 3HP1A 4I4IA 3P0JA 3S7TA 2GVZC 1PWXA 2XODA 3C3CA 1YZGA 3AQ4A 2NNLD 4W9MC 1EWQA 2WJPA 4I4LA 2NW6A 4RVOA 1GPDG 1A95A 2QQ0A 1LF5A 2JFXA 1BMQA 1TM4E 5CTAA 1FUYB 4R8VA 3L0SA 2ILTA 2W8ZA 1A7JA 2BFFA 4FN4A 1EIZA 4F12A 1PL0A 3AESA 3TUZC 2JBAA 2R96A 4GL4A 3CKLA 4INOA 5FYQA 4L8YA 2KBFA 2WJHA 4DE5A 1FBNA 4PZCA 5CEEA 2YHAA 4R1MA 4EPXA 3CRZA 5JSZB 1PKXA 3TUIC 2AG8A 5HF9A 3RVLA 3D31A 4E30A 3Q2OA 2D00A 2YJZA 5EE1A 5DSTA 1JPUA 3ICOA 5F2KA 4QOFA 4H4CA 3DJFA 1YF3A 5HZGA 5DNDA 4EM6A 4DJAA 4EGJA 4W5NA 1EFLA 3B3QA 5JZVA 2H11A 1GDDA 1BGVA 2UVPB 1NMXA 3FY4A 2RAUA 1YVPA 1DIHA 3IESA 2PTHA 2RB4A 3AUAA 3X1XA 3DLIA 3KP1A 3EWIA 1ZCBA 3G82C 2PT6A 5ESWA 5AXAA 4R41A 1QRUA 2ZYSA 4UARA 4OA8A 4EPRA 4KIGA 4AMYA 3AIKA 3GOHA 1GPWB 4HR7A 4IH1A 3OT4A 3FYUC 3R77A 2QMUA 1WHTB 1MO6A 1C1HA 1TC1A 4IM7A 4MVJP 5AQ1A 2QM0A 2HJGA 3Q11A 2XWPA 4J0DA 4AVYA 3HU5A 5M3BA 1Q14A 2VUHB 5FCDA 4QQFA 1N1MA 2P0EA 3OO0A 1ZK0A 4H35A 3O2JA 1ZJ6A 1ZK1A 3B82A 4X6LA 5B3LA 1FX0B 2WKQA 3KALA 3A6LA 3FI0A 3OX2A 2ERCA 3HACA 4J0GA 1Z0UA 3JQ6A 4ZV9A 2G28A 3AF1A 4WINA 3C6KA 1YD7A 3Q5EA 4F11A 1OTXA 2GKGA 2FQ1A 4K9QA 2Y1WA 4ZT6A 5DNWA 3T3NA 1FMFA 3NTRA 4RV4A 3I9LA 4BAGA 3VKHA 3KKLA 1G8GA 1M9NA 1RJEA 3BTSA 4R2LA 1HE4A 1AGXA 4NBVA 3K4QA 4LF5B 4D82A 2ZSJA 5B1EA 1K06A 2VCHA 4YB8A 3OX1A 2DBYA 2FX2A 4HGPA 5BW4A 1RQXA 2WU0A 4S1NA 1CS0B 2Y68A 4RZQA 3O8BA 5I4CA 3SX4A 2P35A 3ESZA 4JY7A 1VDZA 4ZPXA 3VZDA 5ALJA 4DMCA 1JZTA 3NNDA 5F7ZA 5JPCA 5LQKA 5IUJC 3P96A 1G6OA 2IUSA 3K9CA 4LMPA 3R09A 4FSXA 5EZSA 3ZEAA 4AJOA 1NONA 1X7GA 2LXNA 2A7XA 3RFTA 1QIFA 1KYTA 2XT0A 3KZMA 4BNDB 1YCFA 1ZGZA 5H8WA 3GLSA 1FLVA 3D7KA 4MNTA 5EJ8A 3K9GA 1FNCA 4OMFG 3EZXA 1I2CA 3RVDA 4TMVA 5ILOA 3M3HA 4NEGA 3PGVA 3AZQA 2QL5A 2D1QA 3C6QA 3C6ZA 4AICA 2OGSA 5K8IA 3P9XA 4MINA 2G1AA 3WGYA 1T24A 1FTQA 4ZK2A 3HB7A 4BGUA 1YOBA 3H4MA 1AVTA 3OETA 3JQ8B 3ORFA 2WHRA 4FJ1A