3PXBA

Impact of brca1 brct domain missense substitutions on phospho-peptide recognition: t1700a
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
211
structure length
208
Chain Sequence
RMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERALKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Breast cancer type 1 susceptibility protein
publication title Impact of BRCA1 BRCT Domain Missense Substitutions on Phosphopeptide Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 69
structure length 208
sequence length 211
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3pxbA02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3pxbA01
3UEOA 2D8MA 3T7JA 3U3ZA 3SHTA 2COKA 3HUEA 2WT8A 3II6X 1IN1A 3L41A 2M2IA 3OLCX 4BMDA 3K0KA 3QVGB 3KTFA 1IMOA 2INGX 2JW5A 3I0NA 4JLUA 2COEA 2R1ZA 1JNXX 4ID3A 2EBWA 1N5OX 1T2UA 4IFIA 3L46A 3COJA 1T29A 3EF1A 3JVEA 3PD7A 3T1NA 3PXEA 2EP8A 1CDZA 1Y98A 2EBUA 3PC7A 2ADOA 2VXCA 3HUFA 3PC8C 4BMCA 2LE0A 3K0HA 3I0MA 3EF0A 2DUNA 2L42A 2VXBA 2AZMA 3K16A 1L7BA 1WF6A 1KZYC 3PC8A 2COUA 2K6GA 2XNHA 2ETXA 4U4AA 1Z56C 3PXAA 1GZHB 4IGKA 3PA6A 3FA2A 3PXBA 1L0BA 4OFBA 3PC6A 3T7KA 1T2VA 4Y2GA 3AL3A 3PXCX 1OQAA 2E2WA 3UENA 3K15A 2NTEA 3PXDA 3K05A 3QVGA 4BU1A 2K7FA 4XQ0A 1T15A 3AL2A 3SHVA 2HTFA 4BU0A 3L40A 4XPZA 4N40A 5ECGC 2XNKA 3T7IA 4Y18A 3SQDA 3SZMA
chains in the Genus database with same CATH superfamily
2AC4A 1AV7A 4EB3A 1Q6YA 4FVTA 1P9WA 2Z9BA 4MR8A 4OB6A 3WRYC 2GN2A 4B1FA 3AHEA 5E2IA 5LD2B 4QXQA 1ZGZA 1DBVO 3E4CA 3SJUA 3I09A 3B85A 4M7OA 2V7XA 5P8WA 3ANTA 1PL6A 1Y8QA 2XT6A 4Y6SA 1DL5A 2HNAA 5FWYB 2L69A 4LZAA 4ZCMA 1RC8A 5LA6B 1HE3A 3G9UA 1NMYA 2WW8A 1FB5A 4J90A 2O9JA 2ZITA 2OHVA 3Q6IA 4FOOA 4PRKA 4AJHA 1EESA 1SKUA 2HSGA 1GNSA 3JQFA 4WHMA 4CKXA 3P8ZA 3DW1X 5B4UA 3DOHA 1U8CB 2DKOA 1PDOA 2ECPA 2QK4A 4RDHA 3MWDA 4N47A 2QUBA 3F73A 5AVVA 1F0NA 4BNZA 1XTTA 1WXFA 1B43A 2EBFX 4BVJA 3PYLA 3U7HB 3E48A 1W59A 3EG9A 3NEPX 1ULBA 3M6WA 4ALIA 2Y3IA 2IODA 4JUIA 2E4VA 4A8JB 4AO6A 4DLNA 2OGUA 3BIXA 1Q5PA 3T4EA 2DE0X 4CKEB 1PNTA 1YFZA 3GLGA 4YBZA 4I3HA 3ZCRA 4Z9FA 1XLUA 3R4VA 4HGOA 5ABPA 3BDAA 3GRYA 3R0IA 4Y30A 3U7EB 1BE0A 4BMCA 4RTKA 1ZD5A 1C9DB 1K8QA 3GMDA 4ZPXA 4ARAA 2PD3A 3R5XA 1ZUHA 1DEHA 3P2MA 4RLSA 1XLVA 4ASUD 1MO5A 5JEDA 2I4TA 3LVBA 4Q3DA 3KB8A 3WB9A 4JCOA 3ZGNA 4MW2A 1NYQA 3A3KA 2A58A 2XV1A 3PKIA 3ND7A 4YR9A 3E22B 1GPMA 4MPDA 1JHYA 2GKOA 3KCQA 3HKEB 4DJ5X 1RW4A 1E9EA 2FW8A 4JQYA 2O0KA 4RJJA 2XITA 1HQCA 4A0QA 5BN4A 1TIBA 4EHAA 4R2MA 3I32A 2UZ0A 2NYVA 2P9HA 3T9BA 1A9XA 1EZ4A 1FBNA 2WT4A 3MERA 2HBQA 4PN3A 5CXSA 2BGRA 4IIGA 1MC4A 4OJMX 1X15A 4MQBA 2QLNA 3VKHA 2X8BA 2VZLA 2ZBGA 2BMVA 3TTUA 5G02A 3H2JA 2XGSA 4YRKA 4M1TA 1YTUA 3E6AA 1CD5A 1FFEA 2VKQA 5T64A 3RRBA 4BVFA 1W35A 3GFSA 5B3LA 1R18A 1M67A 3V8QA 1Z5OA 3PHHA 3TLGA 5J2TB 3WB2A 3CUSA 1TEXA 2FP4A 2H7YA 2HKIA 2ZTVA 1GAEO 3IX7A 5ERXA 2CV2A 1G6Q1 2JD2A 3GLRA 4J43A 4XDHA 2XVYA 1NM5A 4DLSA 3ZWDA 2OCPA 3UMMA 5M3BA 4OXXA 4UM9D 3G9XA 1RRMA 2G77B 1H5NA 2CZQA 4QVGA 5DKFA 1RQ7A 5AW6A 1HV8A 3HMQA 4KQHA 5B2FA 1X8JA 2AIRA 2XZTA 4OB8A 3SVTA 2W2XA 1RSZA 4OYRA 3JAMA 1R8YA 4MULA 4RPKA 4WZBA 4GX5A 2Q2NA 3TKAA 2QIOA 3O9MA 3H9JA 1DGQA 4FZRA 1KFKB 3OCJA 2L19A 1Y6QA 5KNBD 4BXOB 2IS4A 4GSYA 4ZEVA 3D7MA 1MBZA 2NU6A 1MEJA 5IT4A 4BLQA 5BOSA 2R1VA 3LZDA 4BMDA 4KRFA 4J3NA 3DEAA 2GCEA 4AMZA 3MUEA 2CCJA 1RAFA 1QCDA 5D51S 1YDGA 1FDSA 1TYAE 1IU9A 2NVWA 1JQBA 2P9JA 4I1SA 4LVNA 3R7DA 1T4MA 4RH3A 1XMOB 4EHIA 2QR2A 3ZGYA 1IZYA 2QPOA 1IG3A 4MP3A 3RU3A 1ODTC 4HDOB 4IV0A 4E0BA 3H1PA 5L7TA 2CJFA 3O4RA 2BEWB 1C3VA 1WQ1R 3LCRA 2YFQA 1FX0B 3AYZB 1SIOA 2CL7X 3C4QA 4LJRA 2Z4SA 3I2JA 1ARZA 1W73A 3SFTA 3BD8A 4H7KA 1LPOA 4GI2A 3ZU4A 1XCPA 3EUFA 2ZWOA 4CIDA 1NXWA 3R0ZA 1RI3A 2C20A 1EINA 2H4HA 3W0LB 5C32A 4M0CA 5HGXA 4V0OA 3K9LA 2MSNA 2JLUA 4NCKA 2XW6A 3U37A 3EXIB 1A2KC 1G9TA 1PTKA 2OFOA 3D2CA 3TB4A 4D3XA 2KW5A 2HA7A 2I22A 4J4TA 5AHOA 3RYCB 4KACA 4PXYA 4KRYA 2C7GA 4R84A 1KAQA 3D4BA 1CWUA 1L7BA 5KQSA 3FOWA 1H42A 1NI5A 1V96A 4M55A 3VUEA 5EKSA 3PDJA 1MGOA 2P9CA 3PQ6A 4INZA 2RGEA 3AHFA 1Z56C 3BQNB 2H1HA 1HT2E 2GPSA 1GDTA 3IAEA 1RP7A 4M1MA 4M9CA 5MF6A 3SVLA 5JYCA 1I6MA 1JXQA 1P1KA 5FULA 2VDVE 3HVIA 4HB3A 1QRRA 4AX4A 4LXGA 4YDQA 4X63A 2IC5A 2OZVA 2ZZMA 4KYIB 1R6DA 4CM8A 2G63A 1ATIA 1J2RA 1GGMA 3TSYA 2L0XA 3P9PA 2R5NA 2F1RA 2XYPA 3SQOA 3GH3A 3N05A 3LCVB 2Z5GA 3BXHA 4ZVOA 1EUYA 5JS7A 1CZHA 1T1GA 1U04A 4RAQA 2G9RA 2AC2A 3DXFA 1LC0A 2E18A 3C3KA 4MYTA 1FS6A 4M1EA 4N54A 2G9NA 3AIKA 4FFWA 2E37A 2CK3D 2KE5A 3RM3A 1QXSA 4B6PA 4XWWA 1FYXA 1L3BA 1J8YF 4YRTA 3D3NA 4DGQA 5I8ZA 5DIFA 1X13A 4GM4A 1Z2CA 4WXMA 3D2LA 2ZI5A 4QOJA 4J0FA 1M72A 2BSQA 4A6DA 4GX1A 3DDNA 5CP8A 2HRCA 2Y0BA 1QX4A 5JC8A 1E3TA 1ECFA 2BSAA 4IVPA 2Q4EA 5K20A 4NP6A 5LQUA 3WLFA 1HR0B 3FYTA 2PWAA 2QM3A 4DG9A 1NXXA 8ABPA 2XCOA 4L5YA 1PUJA 2I3BA 1DRWA 1O2DA 3K0EA 3MYYA 4HDSA 4E5PA 1NBAA 3ADCA 4J03A 3A0RB 1QHIA 1O77A 1OXMA 3RC2A 4ETWA 2BSXA 5CJ2A 4MS3B 5ALQA 3Q9UA 3CLUC 3T0IA 3PGKA 2IK8A 4ZAXA 1DAIA 1X2BA 1PT9A 4NBWA 1KVTA 1EWTA 2WRZA 4DTIA 4UMEA 1SEVA 3JR7A 3MYRA 1V1MA 2O7SA 2AV6A 2GO7A 1P60A 3R6GA 3ESDA 1RHJA 4B8WA 3T34A 4R0VA 1SUDA 3QXHA 3ZU6A 4M46A 1I36A 4PYLA 3M3PA 4LUCA 4YLEA 1P77A 3U81A 5EUBA 1JG2A 2B2XA 2JI9A 1A5ZA 3WSWA 5AM1A 5JZMA 5EMKA 1Z74A 2B1JA 2W37A 4R7TA 3ZVMA 2D3TA 4PX2A 2GPNA 4J7XA 1Q3HA 5F76A 1H8ED 3VXKA 3KD2A 2GOYA 3CN9A 5FV7A 3T3GA 3VV2A 1ZI9A 2R7MA 3OA2A 1RM4A 3KPVA 4J7UA 1X38A 3KLBA 3F6YA 1Q0UA 4LOLA 2EJUA 2WWHA 3FMFA 2C88A 1PW5A 4X66B 1ZOIA 4GAEA 3O4IA 2DFLA 1BW9B 2YN4A 3O7MA 4E03A 3IJEB 4FDUA 1Y1QA 2Z1MA 2E7ZA 4B85A 1AC5A 3N8IA 4M8SA 4ZU6X 5H4HA 4B5LA 1ZC3A 4CG1A 3FLEA 3VNUA 3R2JA 1FF9A 1MF7A 3GJRA 2Q62A 3E18A 5A1TA 1NXQA 1E9SA 5A7FA 2PKRA 4CQLA 4Z9XA 3EQ7A 4YCJA 3BD6A 4R8KA 4NXNB 4M1SA 3RE1A 2WJZB 4QWWA 2BC9A 3ZNOA 5I7SA 1IJBA 1ODSA 4XIYA 4R8LA 1D0SA 2ZUDA 2K6GA 3WP1B 3EZFA 4TWAA 4MI1A 4U1RA 2AK3A 5IJ0A 2GERA 4L4UA 4TMZA 1SM4A 4TS1A 4AIRA 1XWWA 4BFZA 4MWDA 1FEZA 1M83A 1Z5VA 2LP4Y 2H1CA 4ZGBA 2W5UA 2ZJFA 3EMBA 1F6WA 2HJWA 4DLTA 1T5HX 3OFSA 1ZD2P 5JDCC 2FETA 1N0UA 2I7DA 2YV3A 1N5LA 3IT0A 5HR5A 1P7VA 1QG6A 2C5SA 4HWGA 3RVBA 1A1SA 5KVVA 4HAZA 3EVCA 3CMMA 2BTQA 2PUEA 3D6HA 2H92A 4V2UA 1EMDA 1PEYA 1SUSA 1FDRA 3ZWOA 3GEEA 1FVHA 3FOZA 2LKDA 1JTVA 4LMRA 2GVDC 2QAGC 1LFDB 4CDNA 2WWYA 4P7BA 1TUBA 4JLDA 3CVJA 3KSAC 5HZHA 5CNKA 1ACJA 4PX9A 4FMDB 1IVYA 4JLNA 4L02A 3A4MA 2ZBVA 4LZWA 1LJ8A 1Z28A 1MUUA 2QRMA 1NR1A 1XD8A 3AF2A 3KJNA 5CDYA 3L7DA 2I6SA 3U4AA 4TWIA 4DBLC 2NPOA 3MTQA 2CYCA 3LF1A 3OY7A 4CI9A 4IXWA 3CSSA 4A8PA 3WNDA 4BLWA 2HEIA 4O4LF 3R5KA 5IM5A 4WXPA 3T7RA 2JFGA 2XZDA 4LXIA 4RYDA 4BEWA 3FHOA 4Q7MB 1J0BA 4CFYA 1YE3A 2YHIB 5A3SA 2AEJA 3EGXB 3QWFA 4FGWA 2MJLA 2PSFA 3AQ4A 3FGZA 2WUDA 3I72A 1C3XA 3LAWA 4RW0A 4RJTA 1Z9BA 1ZJ4A 3MTGA 3L1UA 1Y37A 3E7PA 2CUZA 2AUTA 5JAPA 1FP7A 3DTNA 2JAHA 4DA6A 3CW8X 4G0YA 2ZSEA 3F67A 2IYEA 4PW0A 3ROQA 1QIIA 1O1YA 2JH3A 3ED1A 3CGWA 2AKEA 1EP1B 2C2KA 1M34E 1XTSA 3EH1A 2PGNA 1VB3A 4KWEA 4NE2A 1MX3A 4AFNA 4BZPA 5B7NA 1SBHA 3GA0A 3SQLA 5JAIA 4W63A 1IC6A 1GUYA 4IPTA 1S1MA 5FADA 5F7OA 5K0FA 1ESMA 4PGGA 2EIHA 1R9NA 4ZI5A 1Q7CA 3I9NA 1HC7A 1L8OA 3BD7A 4RCYA 1B0ZA 2INGX 4E5NA 1Z0SA 4QJ3A 3SX2A 1N6LA 4LCEA 1VXOA 4CCWA 3FYUA 4MW9A 4H3KB 3RB8A 3LM8A 5C8YF 2AWNA 3LPDA 5CBPA 4PLVA 7REQB 1HDCA 4PSVA 4J76A 1TT5A 1NONA 2C9MA 4A6PA 1T2UA 4PYMA 4IEEA 1OF1A 2FUEA 2OCLA 2ZSJA 1C8BA 1VPLA 2XE8A 3PFBA 4NS1A 1OA0A 1CU1A 2WFAA 1E3JA 1JIQA 1M9NA 2ZI6A 1PYGA 1KI3A 1O4WA 1VPEA 3JQ6A 3RU9A 3V32A 2C7OA 3GPDG 5EZYA 4OYYA 1PBTA 4HX5A 1B73A 2GRAA 2ZPTX 1KZ7B 3LRXA 2IZ0A 4LE1A 4GMHA 4XVQA 3UGJA 1TMOA 3P9IA 5L51A 5DRTA 3GUVA 4Q47A 3DR5A 5FOUA 5KYWB 4FCWA 3SSMA 2WU4A 1W36B 3R0VA 4RVFA 4KNYA 5EY5B 2O2DA 4B2IA 4ZAZA 1BXZA 1CVRA 2B21A 3ZXUB 1JLKA 3KSRA 4XM2A 2EQ5A 3QWHA 1U8YA 3N2EA 1H0KA 3KAQA 2ZUCA 2VXBA 1SXIA 2QS9A 3ZDYB 4BQFA 1SR8A 5AM5A 4PZZA 4KO1S 3I45A 3HJAA 2HPZA 2ALJA 3N0VA 3WAJA 2YR0A 2OHOA 2PZMA 3SC4A 3VAZA 2V96A 3B3QA 4HNVA 2PY6A 3RF7A 4WMLA 1XOIA 1I6LA 2FPXA 2R1TA 4ZVSA 3W8EA 5ALVA 3N2GA 1QANA 1UOEA 1TECE 3CHYA 1HKHA 2G06A 3BTOA 3OLXA 3W3ZB 2A1TS 2ZUTA 2VK8A 3VHLB 4BX0A 2IZ7A 4PNEA 1K06A 4C21A 1CUYA 1DI0A 2CMKA 1NQAO 2BMFA 3H8VA 4IWYA 1DQSA 1BXRA 3B36A 3PIIA 4QXRA 4D0RA 5GJBA 1OILA 4YAJA 3ZYCA 4G4GA 4PF1A 1Y33E 1LFAA 1A3CA 4XQEA 2VI5A 2VSFA 3MIIA 1KZGB 1Z2AA 2NPFA 3SSOA 2PVSA 3DNPA 1ZYUA 4MVXA 4DS3A 2O19A 4I66A 1EA7A 3UXMA 1DG9A 4JU9A 1SRRA 1Q1NA 3OJLA 4MGHA 2IPMA 1GM5A 1NVAA 1J9GA 1A7AA 5FTWA 3RYHA 4RA6A 3RADC 2BUBA 2V0GA 2IW3A 2JC3A 3BK1A 1KNQA 2JJMA 3MB8A 1HOTA 4R1TA 4JJ6A 5F2OA 3G1UA 5FPPA 5G1PA 3OU2A 3R0XA 3I9V1 1SK9A 5GQSA 5SYAA 3OBBA 2MSDB 1N7JA 2XCTB 4JX8A 3IJPA 1I7NA 4CEHA 4II7A 2XRZA 4FJ0A 4KH1A 4O2RA 3WL6A 3L0SA 5A71A 4E94A 1XTUA 2VDJA 1VE5A 2IYLD 3BKWA 4MGIR 1KJIA 3Q9NA 5JS6A 2G1AA 3NDPA 4ILEA 3KELA 1T3ZA 3ST7A 2FR8A 3C8UA 4MS1B 2X86A 3BMOA 2BFDB 2GJ4A 3CS3A 3MJ4A 1VIMA 3HM2A 4QDXA 3GVXA 3WYGA 3S99A 4MICA 1P2SA 3GT3A 5AT1A 1LLUA 3QSYA 3U7QA 2FEAA 4AUMA 1QG2A 4B5KA 2BZ1A 3FHTA 1M1XB 3SDSA 1JEEA 1KORA 1TL7C 3HBNA 2NVOA 3DP9A 4K0KB 1ZCFA 5ALLA 5CH5A 2QX6A 2WF6A 2CHEA 1OGIA 3N8GA 4FN4A 4LDJA 5F1PA 1USIA 4HNGA 4IHJB 2JFNA 4NJMA 4FCCA 5KVSA 5CFRA 1GNTA 3QBJA 4JU8A 4AURA 5TT1A 4RD1A 2W43A 1KRWA 3JAKB 4F60A 2DFPA 2GEKA 4ZV9A 2F4VB 1CYEA 4C7OB 3D6FA 3WDLA 4BMPB 1UJ5A 1ZXXA 2NXNA 4QDJA 4UFNA 2XRMA 2BHTA 4IX1A 3CRQA 3W8FA 3SBDA 3W6NA 5EYPA 1E2UA 3BK2A 4HNAB 3RR2A 1HT0A 5CM9C 4EY7A 1HTTA 1X94A 3I4LA 5CT5A 3NNSA 4YRRA 1WULS 2PIDA 3IBTA 1KOJA 2JIMA 2VYCA 3RC1A 3PEWA 1QVZA 3P2KA 1STOA 1A5SB 4NY1A 4X90A 4OYHA 1QYRA 3VU0A 3G5MA 4WOJA 1Z3CA 3TIFA 3I8SA 2VQEB 2FFJA 2AN3A 3B52X 1NOIA 3NANA 5F7XA 3NTOA 1J8DA 1EFVA 1TJ4A 3EJWA 1JEOA 4G1MB 4I14A 4YGXB 1U7UA 4RY9A 5KTTA 2QRGA 3ITKA 3ZE8A 3RVKA 5KWVA 2DJIA 2HZBA 4EUEA 5K8CA 1A69A 1LTHR 3BGVA 3H11B 1G7SA 1C5KA 5M2QA 1JHMA 3MQ2A 1N7GA 4CYMA 4Q7KA 1ORVA 4LJSA 1WW8A 3JQQA 1P2GA 1HRKA 4ML3A 4ZEOA 3L0CA 1QVVA 2G7ZA 3Q10A 4J0IA 3G0DA 4IQ0A 2AC7A 3TTVA 3K72B 1EVIA 1XDGA 2W2OA 3HQ4O 2NO0A 1C9KA 3MJHA 3TZHA 3FUTA 4JKOA 3KETA 4N9WA 2IOFA 2N42A 1GRVA 2BHRA 2I99A 2FPSA 1YRAA 1IOZA 3D0OA 1QGZA 4EUNA 3EGDA 5LLTA 1XZEA 4RLHA 1U9IA 5EA2A 1NI4B 2OG1A 3N75A 1X7ZB 5BY2A 4EGFA 4H7EA 3SICE 4DHWA 2L18A 3IIMA 3MCVA 1E2MA 5DV9A 5EHGA 3VA7A 1ESEA 4RFVA 1SC3A 1BCRA 4JH0A 4ZWNA 5DBEX 2LPMA 3UAOA 5C5DA 3OETA 4Q1BA 3ZHTA 1X1QA 1V0JA 2RGAA 3KOUA 4DT1B 4CIYA 2C1EA 2BJVA 1UWKA 1HT1E 1WV1A 1KK3A 2FUG1 2IY7A 3MFQA 4FBGA 4PIMA 4WL0A 5DI9A 4L7VA 1SXQA 1CUBA 1ICIA 3EIOA 4D3DA 4DJAA 2TMKA 3IP1A 3ZVKA 1T5OA 1KEEB 1QYCA 2C7BA 3ACBA 3FE2A 4MUHA 1M2VB 2TMYA 4GWLA 4BMSA 5TARA 1COZA 1ILEA 3SQDA 4A23A 2BZ0A 1A9TA 3LRTA 2P4HX 1EQUA 2APJA 2M32A 2IDMA 4DRZA 3DBRB 2I2BA 4PS0A 1J7JA 3CPEA 2W4IA 4JJIA 3VZSA 3C6XA 2GLUA 2Z2YA 1YHNA 1BCSB 5FUBA 1O4VA 2CB0A 3L7BA 5C8ZA 2H2GA 4C2BA 2SCUB 3AIOA 1OIWA 1RWOA 4BO6A 2F3RA 5CH3A 2PRYA 4ZVQA 1AE1A 5SV2A 4EABA 3LK7A 1CQJB 3WV5A 2GUWA 3U2QA 1NNUA 1PZNA 3AVOA 1GFIA 2VT2A 1OFGA 4ZARA 3I5XA 3RT9A 1CRPA 1JHZA 4CKBA 3LI2A 3OT1A 1C4OA 1KAOA 2GNOA 3DWFA 3GY0A 5EWMA 4DA4A 1HA3A 1T24A 3L4BC 4U7DA 3ZIDA 5HKLA 4B2PA 3OJCA 1K75A 1GQFA 1P2UA 4L9RA 4O2AF 3RWMB 5EG5A 3FPAA 1QWSA 2CSXA 1RPJA 1K3TA 3DF7A 5AHKA 1OZAA 1B93A 3IAHA 4A5SA 1KY4A 3PXEA 5CNMA 5K03A 1M76A 4WH0A 1CEXA 3A4VA 4ZRMA 1QP8A 1U1CA 2MYUA 3NP9A 4MWCA 3GLKA 2D5LA 2VL7A 2ZUUA 3MLBA 5IRCD 2JLVA 3SEAA 1NYLA 1TMYA 5ICFA 1C2TA 4IH1A 4NIMA 1YRHA 5EZ5A 4QUIA 4BO8A 2J9GA 1ECPA 4J6FA 4V39A 2VR1A 1NQXA 1QOZA 1L4MA 3L6CA 4NV3A 4G89A 4GKKB 1DWUA 3KQLA 1F4VA 4TS4A 4Z51A 1P0FA 1YS1X 3BHIA 4TL8A 3O4GA 1FOEB 1ULAA 1TGYA 4I2NA 4QBTA 1VL5A 2EGUA 2RKOA 5A5EA 2V7EA 4G86A 1J23A 3U0BA 3TGPA 4X61A 3R3HA 1C3LA 3JVUA 3AVYA 1PQPA 1QH1A 5J40A 1V3TA 3ECSA 3EHEA 4Q02A 2I3GA 2EFEB 3RODA 2IH5A 5FUYA 2AYZA 4HEJA 1L0BA 1E4YA 1NXPA 5ALGA 3UJNA 4P22A 1ZK3A 1ESDA 2X2FA 3PXUA 4GMKA 4TTPA 4UE3S 3T1VA 3X1YA 3KQMA 5TSDA 4E70A 2XCIA 3WIUA 3ZJYA 5GP1A 5DGHA 3HWWA 3KDSE 5TPWA 3DV2A 4N49A 4XDYA 4HV4A 1ECLA 2FPUA 4MI6A 4QX6A 3GZJA 1Y6RA 1HNXB 2B8NA 3KWJA 2HQRA 4X95A 2RAPA 3PZRA 2AOVA 1UBEA 3HKDB 5EIEA 1XRJA 3QMWA 4I50F 3ZZ1A 1IHPA 4M76B 2FEMA 1HTWA 3GA5A 4Y2UA 3TDMA 4QDOA 1V5EA 2WNHA 3BL6A 2YS6A 3AR7A 4Q24A 3RUPA 4B3XA 1LC3A 1AQNA 4PAMA 3OIYA 2O1WA 3I9FA 2ZKLA 3EFEA 3Q7RA 3VJRA 2JFPA 2JIDA 3HY3A 1CK4A 3GW8A 3R24A 5IVHA 4PNPA 1X8LA 3EXFB 3QU4A 5GOZA 4EY3A 4RTPA 2ZCVA 4ZK6A 5GTDA 1DP4A 2W6CX 2XNSA 4H60A 4HB2A 1HYBA 1VB5A 1X42A 3TYXA 2IEIA 3K0CA 3AZQA 3A6GA 4XVUA 8MHTA 3RABA 1DSSG 1GLGA 1YMVA 2XE6A 2YV4A 5JWOA 1Z6PA 1XQVA 5A2GA 5LYYA 5DXAA 3HA3A 5KMGB 3NALA 5B1IA 3W6UA 1KZHA 3D8UA 4Q39A 5JBIA 2O2JA 3OBIA 3A0UA 1VE3A 4BNFA 2FX5A 1NNLA 4MQFA 2EL9A 3P94A 3T3MB 3EVNA 3DFIA 4MB2A 5IKEA 3AGQA 1H0HA 2HK8A 3LYLA 3P2IA 5HJ2A 1TLLA 3D4PA 4OU4A 5BW5A 4N7JA 3L4JA 1UWCA 3FNHA 4XR9A 5EWJA 5ARDA 8LDHA 4EPVA 1MJFA 4IVQA 4ZRDA 4EF4A 3SXUA 5IPFA 4JKYA 5KU1A 1DV2A 3TBKA 4ARZA 5CHYA 4HD8A 2C3PA 3W7AA 5EXXA 1J21A 4E1AA 4WLNA 3OPVA 2JLWA 2O1EA 2NUPA 1S3IA 3HI4A 4E11A 4G1FA 1JB1A 5IU6A 5SZJA 5U1PA 3WJ7A 2N3ZA 2RGWA 4YJ3F 4YWHA 4RE5A 3PD7A 5DPMA 2D6FA 1IRIA 2QD3A 5LP6B 2GCIA 1YAHA 4XUGB 5FUWA 1CJTC 1M1YA 4ALKA 4YRGA 1E59A 1GGNA 3LWZA 4HLDA 5EPOA 4HFNA 3OO1A 1Y63A 4NDZA 3SM3A 3CVYA 2CLCX 2PYDA 5IH3A 1C7FA 1AIPA 1EP3B 3OF3A 2HBYA 3Q7IA 1B0AA 4AMVA 3ABQB 4ZMBA 3EPJA 1QQBA 1A9RA 5HTOA 3M6MD 3WO1A 5BYJA 1YZFA 3IIJA 3ND8A 3OE7A 1G0OA 1X80B 4KE8A 4UBIA 2YZ7A 1QIGA 2QBYB 4XB1A 4X20A 2OLEA 2R6ZA 4R3UC 1H0RA 3FMVA 3ERCA 2NNWB 3AHCA 1FA9A 3SXJA 3V7UA 2ONCA 4FGJA 2PSHA 3V8RA 1T91A 5C7LO 1JAZA 1OT3A 2ID8A 2BHLA 4OUKX 3WNQA 3U19A 3IMEA 5HE9A 1JHRA 1MVOA 3FSEA 1YB1A 2Q0XA 1ZI8A 3PC8A 1IOVA 3QW4B 1VHLA 2QM8A 4QNRA 4DPMA 3NBZC 5MN4A 2WD9A 5FLXA 4D8VA 4QRIA 2YMQA 4QJIA 3EFBA 5AHWA 1E3LA 4A7PA 3T9EA 4EOGA 1ZQ1A 3TNFA 4BB5A 2O5RA 4QNMA 1QIHA 1JDSA 2JBAB 1Q0QA 1PGOA 3HDHA 2PL5A 1NF8A 1LA2A 3HVKA 3L0PA 1DQRA 3I1FA 3PV0A 1F1JA 3ZV3A 1T5SA 1KWGA 3WLQA 1P5FA 3SMVA 3ZE7A 1PGPA 3CLTD 1FYFA 1FK8A 2B4AA 2FPGA 4V02A 3FVRA 2IS6A 3LBIA 2GWRA 4EGJA 2G1PA 4WA7A 1QGED 1NWHA 1XQYA 2FKNA 2KHZA 4RORA 4ESVA 1YZGA 2WKQA 5TXGA 1RI5A 3IJ5A 3OIUA 4YN3A 3SS7X 2JGJA 1Y5IA 4ZTUB 1VLJA 5FV4A 3WAGA 1KPGA 3LPCA 4ZJUA 1AT1A 1R0YA 4Y9DA 3V2UA 3C39A 1H3EA 1XDDA 4ARUA 2I55A 4A03A 3TVYA 1B7GO 4BQSA 2Y1CA 4DW8A 3L04A 4WDRA 1YBAA 2WVGA 4LDZA 4YX9A 4BTEA 2I6GA 3O38A 1ISFA 4D9FA 4TS9A 1ABBA 5HIMA 1XDZA 2GWHA 3WR5A 3O1HB 1JJAA 2WJAA 3W4KA 1NW6A 2FPPA 2HWKA 3H8SA 4NARA 4EYGA 3KLMX 1AUVA 5T6BA 2R6GA 5AWFC 1KO5A 1NQVA 3H87A 1VPVA 3QOYA 5T8KA 5A3QA 1D2EA 3FI0A 1YDFA 3E15A 2Q9BA 4N0QA 5BR7A 1XAJA 3QE2A 3FUXA 4UDXX 2IBTA 2L82A 1RHMA 1ENZA 4AJLA 4HH1A 2JD0A 4TV9B 4UXIA 4JJAA 1MJGM 5T6MA 2CL0X 4MVJI 3WHIA 3KTAB 4H1VA 3PL1A 4DSAA 1MHTA 3ZDAA 1HDIA 2PRKA 5C31A 3HCRA 2J0SA 5AK6A 1OI2A 1MH1A 2YBEA 2GLXA 3DDHA 4KV9A 2AG5A 3D59A 2VQDA 2XADA 3GNTA 5GAJA 2B82A 4AJ9A 4BZWA 4C78A 5HMMA 3ZZMA 5IG2A 3IOCA 4LRUA 2P3QA 2D8AA 3UFBA 2HO4A 2FW9A 4HL6A 1FUYB 1SELA 2R9VA 4KAJA 4QYIA 3ZUGA 4AB1A 1TTHA 4C05A 5ICMA 1XCGB 2HI0A 1GQ2A 1IG0A 1A5AB 1UFQA 2VDUE 4MLZA 3L7KA 5EJ9A 1EBFA 2I4LA 2XXAA 3HBFA 4ZAGA 2AN9A 2FZ5A 4G5XA 1M2HA 1P33A 3UJCA 3VC2A 2QPAA 5BWBA 1N3BA 3BAFA 2VTBB 4LJKA 1DFGA 3LXXA 4KXVA 1GG2A 3QFRA 4S0XA 1UBJS 4O4HF 4UU0A 4I50A 1X1TA 1T1RA 2WP0A 7MDHA 2WF5A 3KYIB 1O8BA 1E9BA 1F4LA 5E7QA 5BSHA 1RYZA 3ESXA 3MEQA 5CT4A 5EQDA 2IY8A 2LE0A 2AOUA 1PNQA 1JIJA 1SQGA 4HF7A 2PXXA 4Y8VA 4JT9A 2A8YA 1PEKE 1FW6A 4JOQA 4WDQA 3LVFO 4KXLA 4X65B 4L6AA 4LQDA 9LDTA 5JJIA 3BIJA 2WU1A 1FL9A 3U4HA 4BO3A 2BCEA 1KYZA 4LDQA 1CY8A 1SVKA 3LTEA 3E05A 3IR6A 3WGQA 2HSWA 5NLLA 3ICOA 1DC6A 3GHHA 3TJMA 5LQDA 3PL5A 3JW8A 1W88A 4CFSA 3ZYZA 3PA6A 3IHWA 3O94A 4J3FA 5FFNA 4CG2A 2EZTA 1DXHA 3BD9A 4CLEA 3ZGZA 3ZW9A 1KR2A 2JRCA 4ICIA 5FF9A 3WGTA 4E6EA 1VKZA 3FPGA 3UWOA 4M8IA 1UFOA 2ODPA 3BJMA 4LY0A 1JHUA 3W3AH 3KYJB 4OF4A 3AB7A 2O2GA 1CZNA 4X92A 4FGLA 2I6FA 2J8ZA 2XUAA 3ORYA 4LXHA 4HLCA 3TXYA 3Q98A 2O7QA 4FJ2A 3AFGA 1T1IA 3FZEA 3HJGA 1RJWA 5FTMA 3ROXA 3RTBA 1PHRA 3LDFA 3A4TA 4MMXB 4N5LA 4CEJB 3VYUB 2CMDA 1HDEA 2I87A 4QU0A 1ANKA 2VUSA 5I9TA 1OE0A 4L76A 2XNDA 2YWBA 1KQNA 2ONKA 1UKCA 2CXHA 3AINA 3LQKA 2QJOA 1U2DC 2NUTB 4CRWB 1DKQA 3NRJA 1QS0A 2ZYWX 4B3JA 5JT1A 1SURA 2PGAA 3ZLVA 4P0PB 2FLVA 1GN9A 1Z4KA 1CX9B 3Q6MA 3UA4A 4NC9A 2HB6A 1D0IA 4MJ7A 2ILVA 4WVFA 3VC3A 1AUOA 1MR3F 3LLVA 4BB0A 2XNKA 5BURA 4JB2A 3O83A 3EQ9A 3EVEA 4P34A 3SN6A 4C20A 5JHHB 1UH5A 1OWPA 3FYHA 4F2DA 3MZ0A 1GEGA 3IQGX 3DMTA 2PSJA 3I3SR 5A4FS 3G7SA 3CUKA 1T3GA 2FZWA 1M6VB 2X7XA 3DM9B 4D5EA 2K7ZA 2AQKA 4YRIA 5I6DA 3N2LA 2GK4A 5J59A 1HX7A 1A97A 1USKA 5DXFA 1IHOA 1YUNA 3UYLA 5CX1B 1Z38A 2EV9A 2PLWA 2Z5VA 3LBHA 3OFVA 1A5TA 3O4FA 5JWHA 5LB4A 3VDRA 3R7LA 3RKSA 1UZNA 1Z08A 4LWPA 3ZY6A 1ZH6A 4AZ3A 4LYFA 3ZD7A 3JALB 3GPBA 3MFYA 2R7NA 3H2IA 3LMKA 1YGYA 1HO3A 4F9EA 3B60A 2XKKA 5HXAA 4JODA 4A92A 4LOIA 3TS1A 4MIKA 1PFYA 1JPNA 2VP9A 3JQEA 1KBZA 3KJHA 3ZN2A 4OLAA 4MQEA 1RQXA 4FFLA 1II9A 4U2KA 3MGKA 4D9BA 4Q00A 4MEAA 1VDZA 1KSFX 1PJLA 1EQAA 2JJ8A 1W581 2A1UA 4RENA 1ESZA 6LDHA 1M7HA 1PDWA 1OVGA 4QYTA 4AJ4A 3TAHA 3DE5X 2WA1A 2QAGB 2IX3A 1US8A 2CUNA 4OKNA 2ABWA 1CG6A 1MABB 3PEYA 2RFLA 3TLXA 5FOWA 4MKGA 1IVNA 3O31A 3WLJA 1QAOA 2B1IA 4MO9A 4P32A 3F3YA 4O8CA 5FB3A 5J2UF 1AGRA 4X91A 1JE1A 4QUBA 3UC5A 3ZLJA 1ZGCA 4LBVA 3WLMA 1DAMA 2JH9A 3VO8A 1TVKB 5AHXA 4KHZA 1ZO8A 2FZGA 1QHFA 2O4CA 2E55A 5B4TA 1FTNA 3QTBA 4W5OA 1BS9A 4XE5A 1KYIA 5CFQA 2DPGA 2GN6A 3LF2A 1ZUWA 1LVGA 4GP9A 1K92A 1P9RA 3N9IA 5FO0A 1FFYA 1J8MF 4HWTA 4RD4A 1U4OA 5DYTA 5AVSA 1AX9A 1ZNZA 2VNKA 1RADA 2UXBB 3ZJ5A 2O23A 2YWGA 3C3XA 3N6XA 3R0JA 4HNHA 1FDTA 2QJRA 1G59A 3BRWA 2G9ZA 5JXJA 1P2FA 2I4RA 2J6HA 3R6DA 3AJRA 4FFVA 4ZVTA 1TW3A 2OBMA 2R00C 3I2IA 4W5TA 3LUJA 5DYNA 3NHSA 7AT1A 3BXGA 2NZJA 4TUYA 2DBZA 4FSHA 4CIBA 3KAPA 4YQZA 2J5RA 1RVDA 1QYDA 1SCAA 2H17A 3V80A 4Y0AA 5B3JC 3OZTA 3E3OA 1IN5A 2BMEA 3NHAA 4URZR 1NBEA 1WMEA 2V97A 2IUUA 2DWUA 4A2CA 4CNQA 2UZ1B 3CEHA 3IC5A 3OMXA 1OC4A 3CH5A 4TYQA 1Z4JA 2QVYX 4JSYA 3W8NA 1DC7A 3L0IB 4LFAB 6ADHA 3ADDA 3UTDA 2FMUA 5HG0A 1RXUA 1KQOA 1NASA 2C5EA 3WGNA 1NLUA 3OM0A 1IIRA 4LY9A 4QHYA 4WADA 4ZD6A 1GTSA 4P4SB 3VSAA 4NQRA 4DA0A 5B6IA 5GIOE 3CR3C 2AX3A 4IZ6A 4YECA 3V1KA 3MRVA 2CGEA 2FRXA 4LYEA 1TUGA 1M1UA 1WP4A 2BM0A 3OZBA 2IYSA 4FR5A 1F1BA 2I80A 4BRWA 2FUG6 4UOZA 3HL0A 3QA3E 3FPEA 1E3EA 2HF7A 3KYBA 1MC8A 4BO7A 4PR3A 3J81A 5AKLA 5C52B 1RQPA 1YNSA 4JCCA 2M6KA 1QFMA 3I1JA 2IP1A 3KSMA 3UMBA 1DFIA 3P2JA 1V1RA 1EUCA 4DIEA 1PT7A 4PQFA 5LQNA 1K5HA 2AFIE 2C99A 3BFVA 3HUEA 4YQEA 4PYRA 3KAJA 4C6TB 3AKYA 4N4AA 4HWSA 1IN4A 2WWWA 1KEKA 3AKZA 5K3FB 5J3JA 1TAHA 4HAUA 1E77A 4MOWA 4XDGA 1X9GA 4RV5A 3CONA 1CR2A 2QPLA 3FLBA 3OLCX 4MITA 1KVQA 4UE6A 4AUEA 4OHCA 3DA8A 4DHEA 2FQQA 5K8JB 1JQAA 2CE7A 4MUXA 4LI0A 4CHTA 1IZ0A 4CMGA 2GPWA 3QBTA 1F06A 1J9EA 2RARA 3E7DA 1TAGA 4WY8A 2MR5A 3TOCA 3H1AA 2FV8A 1L7NA 1NIJA 5CDUA 3K0AA 1F4PA 2GAFA 2JHAA 3EZ2A 3K53A 4KGDA 1TKCA 2XWJI 4F9TA 5IXSA 1KOGA 3DKIA 2C9ZA 4LYHA 3KXKA 1A9PA 1F2TB 2OC4A 4KKXB 4UTVA 4TYYA 3HO8A 1YQDA 5DNCA 1HYHA 3K7EA 2G67A 4KE6A 3NHFA 3LRPA 5FHRA 3ZW7A 3CLVA 3BICA 1TVMA 3OZIA 2RBGA 2Y67A 3FLMA 4RSHA 3C6MA 2VP0A 3B3FA 3H17A 4K8RB 1D5WA 2GM9A 3OQIB 1HYGA 1X1DA 2I8CA 1E1QA 4XWTA 4EG5A 1UCFA 3WS7A 2O8CB 4K9MA 4EEKA 1S2OA 2C8LA 4H35A 1XUOA 3G85A 3D1VA 4HTAA 4NYJQ 3HUFA 1KXZA 5EP2A 4BO0A 5KBYA 2UUCB 4M0LA 3F5SA 3PWZA 4B3CA 1E2HA 3K71B 4FC6A 1FYVA 4ZI7F 1UBFA 3G2JA 4EG7A 3QWBA 3AI2A 3HYLA 3OSZA 4R1PA 3R09A 1FXWA 1DXOA 1J99A 3G0GA 2UUBB 1XDSA 4FMCB 1P0IA 3D64A 2GK6A 4HGZA 4Y6GB 1W47A 3OE7D 5ALZA 5IZCC 3HJHA 3TCXB 4QDKA 3AHGA 3PVZA 4L85A 5IH7A 1GTVA 2MDTA 3MINA 4N0PA 4NHOA 4LJ4A 2OMKA 2GAOA 3VZBA 3EG5A 4OY3A 2IU6A 2ODTX 2JCBA 1YMUA 2XTMA 2PGXA 4PSDA 4S1TA 4UNNA 3ZWYA 4DLRA 4GBMA 4JASB 4MPPA 1C14A 4D9IA 4LF9B 1CUVA 4INJA 4C0XA 3BWBA 3KQHA 2O8DA 2GCNA 3TJRA 3RBZA 1H2HA 1SUAA 3P0JA 3GPIA 2WYHA 1B3RA 4ME6A 1TJNA 2FWIA 5D3ZA 4ALMA 4IJWA 3PRHA 5FPQA 3UA3A 1WZCA 5EHIA 2ORWA 3ML1A 1KK2A 4MQMA 2CLLB 1KR5A 2FYTA 2JVIA 1K2WA 2LCFA 4OA8A 4RHYA 4YRJA 4KDCA 3UHPA 3CSUA 3PS9A 4BBZA 5DWQA 2P27A 4X1IA 2IHUA 1C30B 3UGKA 5KNBH 1N2XA 3CIOA 3EQ2A 1WKCA 3V42A 1AN9A 3FPCA 3Q87B 2RGNA 2AYXA 2XUJA 3JCZA 1IATA 5K09A 1PG2A 3GRRA 3N70A 2EBHX 1CERA 4TXMA 2JAOA 3GOQA 2R8XA 1EWVA 1Y3FE 4GVPA 4TRNA 4BV2A 1JQDA 1Q44A 4GKVA 1QO7A 2VCEA 4EX7A 4RY2A 5AICA 3UV7A 4BKMA 5J2UA 3DTVA 3THXB 2XTAA 1WZNA 3T5GA 1EBBA 5BSFA 3GFQA 1H6DA 1R6AA 3BMQA 2OBFA 4J2OA 4QPNA 1KPIA 4BGIA 4BVHA 4CUJA 4DLYA 4IRMA 3D4LA 1CTQA 1YQTA 1MP0A 5C1PA 3HLTA 4LA4A 3CT4A 2IKSA 3MXTA 1H4TA 4UDOA 3OP1A 4C7BA 1O0CA 2BPOA 3TRIA 1AXGA 4N5DA 1RP1A 3C45A 4MCAA 4DEVA 1Q3KA 3I62A 1JQ5A 1TJPB 3HN7A 3SYKA 3KL4A 1WCXA 3TQIA 1GTZA 1WZIA 2YXBA 3BIWA 2A0YA 2BGJA 5ALRA 3ENQA 2FG5A 4RPIA 3WQHA 4IAOA 3TO5A 1M1NB 3L0BA 3Q9SA 5GONA 2GARA 5LR6A 3VVMA 5ER6A 1JHVA 4AD8A 5HRCA 3KVNA 5DM1A 1SKYE 4KPGA 2GYUA 4GYYA 3NCHA 2ZJBA 5EIBD 1E2LA 3A9WA 3LBYA 3ER9A 2C0PA 1PEAA 2FR1A 3FWNA 2Z30A 4MHOA 4Q19A 2FQXA 2P8SA 5TY0A 2AR9A 2IY9A 1T3SA 1T2AA 4YAOA 4RVDA 5CB8A 3U4QB 2QZPA 1WCV1 3C6BA 4K9NA 5FNZA 4UCXA 3FDIA 1SH7A 2X0NA 4B4WA 3CC8A 4M0EA 3SBEA 5A3JA 4UTXA 3IEUA 4Y9TA 2ZUEA 4HX9A 3HS3A 4ROSA 1E7QA 3ZD6A 3C16C 3AVPA 2EKBA 4D81A 5A9RA 5H5JA 3NO4A 5CEFA 1DHRA 2X2PA 4RFSB 5HFAA 1Z0JA 1XMQB 3JQBC 1I4OA 2JCSA 3IQIX 1GQYA 2WT9A 2Q50A 4TXLA 4ECAA 3BWMA 3I0MA 1FX1A 3STVA 1EIWA 2J30A 3RRMA 1MV5A 1QGDA 2WE7A 3WP0A 1WV0A 3L9WA 1JH8A 3H86A 4JLAA 3CKLA 4NMLA 1TIPA 1UBKS 2DWQA 1OIVA 2XUOA 3CF0A 2M6LA 3A05A 4DDMA 2QLMA 3I6YA 4KR3A 3RYFB 3DPUA 5EXDA 2OD7A 1RQRA 5LPNA 1NZFA 1YRBA 3LUBA 1GZHB 3WTCA 2XPCA 1E7RA 1UJNA 2QOEA 3DULA 3G8AA 5L3ZA 3X2EA 4B80A 2ECOA 3NJ8A 1M8JA 1G63A 3F4KA 1JEQB 4XYEA 2OFFA 1D2AA 3H18A 3OCUA 4EARA 4XIIA 1HF3A 4ZT7A 1NHGA 4C04A 1CULC 5AVXA 3O1IC 4H6PA 5CXQA 1OJLA 1UP6A 3CV3A 1T4BA 3OMLA 1ZOSA 1SUIA 1VLLA 5CTAA 2CLSA 5JD3A 1ZHHA 2NP6A 3IEIA 2JF0A 1PJRA 2A0WA 2J9FB 4RCVA 5JCJA 3HHEA 3WWCA 5BMVB 4I19A 2VDOB 3EH2A 1EB8A 1PUXA 4KWCA 3R8XA 3FNIA 1OI7A 1M6YA 1IUOA 3QVXA 5E3HA 3A7DA 1TA0A 4TTRA 3C3MA 4MV7A 4RD6A 2UYCA 2Z9CA 4TXNA 4W7IA 1GPBA 1JP7A 8GPBA 1LXCA 2JHFA 3B9QA 5JSZA 5BNIA 5K0BA 4B3RB 2LXNA 3R40A 3ZV7A 4N40A 2XNDD 5DGDA 4EZIA 4C3OB 3D81A 3DHYA 4EFMA 2EKLA 1XA3A 2J5KA 4QJ4A 1GARA 5AM2A 4OXYA 2REOA 4BZZA 1DIHA 2ORYA 3EVFA 3T3DA 4QASA 4G9GA 1KOFA 3ROTA 1Z0UA 3DXYA 1QTIA 2BMAA 2CJWA 4MR9A 4W82A 1DTEA 3GLIE 2FP3A 2GZ1A 3HJUA 4RY0A 4OBEA 1ISSA 3EA5A 3ZTTA 3B1ZA 1A77A 3ENWA 1SZCA 4RMJA 1PNVA 1NVKA 2BFEB 4AYTA 4WWHA 1B23P 1TOAA 2VDQB 4BGDA 3K9WA 1JAXA 3GB9A 4U0KA 1OMOA 2PX0A 2V6MA 1YIOA 2H07A 4HLUA 3DONA 5IN4A 1BDHA 1M8PA 1HFJA 5H9VA 5LXTA 5HIIA 2VDRB 2V6JA 3DL7A 4DRXA 2NV2B 4COOA 4O2LA 3OZVA 3B1YA 1NQOA 3LSYA 4ZEWA 3VI4B 2VJAA 1YZLA 3U56A 4V0ME 3HO6A 3GLHE 3PDHA 3PRKE 3K0SA 4NDAA 1A95A 2BCGY 3W1EA 4UCFA 4DIKA 4ZTBA 1MB2A 2H4ZA 1OB5A 2I1VB 4EG0A 5LNK1 1T9HA 2KM1A 3CCFA 2VJKA 2C42A 3EPLA 3FPLA 4PAWA 1HURA 3F47A 3KIPA 2C8KA 4D4IA 3F90A 1GDDA 3U61B 4JXKA 2RMKA 1M66A 4BWFB 1XD2A 4ZOEA 4R2XA 5DEOA 1Z36A 3OG9A 3R7NA 3NMUF 3S1AB 3BRSA 5B4VA 3OFJA 1JQ3A 2B30A 2GPYA 3ZY4A 1ZRNA 1OYOA 1EFPB 4BNHA 5A5GA 1V35A 4XH9B 1WR8A 4PLHA 1VPTA 1OWMA 2W4QA 3QXJA 4YJ2B 3JAWA 1IK4A 3ZU5A 3HB1A 5BN3A 5ICCA 3PQ3A 1XKXA 4BBAA 4G4IA 4C0LA 1U2GA 1DAKA 1U80A 3CZ9A 3GDGA 1IN6A 4X1YB 4EBFA 4YCSA 3BAZA 5COBA 2NZXA 3BVPA 1V7QA 4WOCA 5ICEA 4L6IA 3GT4A 1HOXA 1XZNA 4XCQA 3H9GA 1RHKA 5FJJA 1CYDA 3CEJA 1F6BA 3EC2A 3P9QA 1LPMA 4I81A 3B2QA 3CNOA 4X8MA 5DJ5A 3QQ5A 5J63A 3BRWD 5PGMA 2WYIA 4E15A 3Q12A 1SXHA 2J59A 4RSRA 1DQPA 1XQXA 1FMCA 1FDUA 1L4EA 3S81A 1TK3A 1V8PA 1XCOA 5K3SA 3I37X 5JH7A 5FR1A 4QUDA 2ZRHA 3O5AA 2QW0X 2YRXA 3QU9A 5AQ1A 1NW3A 1FJHA 2FJUA 5D7NA 3Q8XB 1YL7A 4HDNB 1DLJA 5C53B 1NNEA 2IZ1A 1R4MB 4M98A 3E9MA 4MH0R 3NTQA 4DLXA 1E63A 1BC5A 2P9BA 5IAEA 3N07A 2JLRA 1E0JA 2FR0A 2XUQA 1CUAA 4BQEA 4JP3A 2MHCA 1UK8A 3M4YA 3DDCA 4F06A 5KINB 2XOEA 3OEWA 2A5GA 2Z5LA 2HSDA 4XUDA 3DE1X 1W93A 1BKSB 4WJLA 4UM8B 4IDOA 1MHPA 1U8ZA 3BSFA 1G20B 4ADSG 2RBEA 2QTMA 1M0EA 2R60A 4MVYA 4RCZA 1RAAA 3MMPA 5ALEA 1VA4A 2D5AA 4ZVVA 4BJ1A 4RLQA 2ZBPA 3DCYA 2W6OA 1B2RA 1PWEA 4MR7B 4PG7A 5AI0A 4ZVMA 2XIQA 4L57A 3HXMA 4F3YA 4DCMA 1M0SA 1GUDA 4H08A 3ZDRA 4DCCA 4G0VA 4PHHA 3R7AA 4AECA 1PV2A 3G88A 4RK0A 5FLKA 3QXXA 4LZOA 2QQGA 2XWPA 2W8BB 2YWRA 4NMHA 4XAQA 4DLWA 4OGGA 1MB0A 1KY2A 1GZDA 1CDDA 2P7IA 4JDPA 3OQ6A 3TIVA 4F2WA 2PRJA 2HSJA 3THYA 2L2QA 1P1RA 4JK3A 1GSOA 2XQJA 3AU8A 3I0NA 5KI6A 1JDJA 3L8CA 1P45A 4HMPA 1JEDA 4MAAA 4XIJA 2O8NA 2C7RA 5ADHA 3UJAA 1GTRA 5K6TA 5CAEA 2V6IA 4EUSA 1I32A 1G4UR 1LSSA 2DQSA 3BOSA 3ROZA 2EJBA 2NSJA 4EKIA 2CLFB 3GAFA 3ILVA 1X1SA 3COJA 4Z4QA 1GAWA 2EP7A 4MRPA 1CJMA 3SDBA 1YFLA 1W48A 1BX0A 1U7PA 2PGIA 4WNYA 4EGCB 5HJ5A 1NVUQ 4RIHA 4ZA2A 2YJ5A 3F3SA 1D7AA 4DCUA 1RYFA 4ZJZA 2FN9A 3VR6A 3QLVA 1GPNA 1PX0A 3FJOA 5EE3A 3HN2A 1WB5A 2YUIA 2JI6A 2ODQA 3D8RA 3IP3A 1OFIA 4ND2A 4E4TA 2HRZA 3H16A 4IGAA 5IZ4A 3V33A 3VTZA 4DTCA 1DCMA 3N1UA 3ACDA 1GYQA 2FEKA 5HKKD 1TZCA 4FYXA 1JFRA 3CFYA 4QYXA 1EK6A 2KJQA 2IEDA 3N74A 1TKBA 1E1QD 4G5GA 4KMSA 3W2IA 1TC1A 1FP2A 4CF6A 2WTUA 3U44A 3R3YA 4UBNA 2HF9A 4G0XA 5FBKA 1BE1A 3L8HA 3EXEB 1C9MA 2QQ0A 2YVLA 5CA1A 5JE8A 3L6BA 4AJKA 3G0CA 3I73A 5KYYA 1I0LA 2RB4A 3P4UA 5AW2A 2WF8A 2ZDHA 4EF5A 4XLZA 3ISVA 3SEQA 3TIGA 5AUOB 1ODCA 2DOKA 5BSUA 4DSZA 1FTQA 2I9PA 1E4OA 5FL7A 5HCUA 4IVRA 1VLMA 1SHZA 2IGBA 2W2VA 3E9DA 2DYKA 3MTDA 4TMFA 1AMOA 2ZXFA 2NADA 4UFPA 4C43A 4JQZA 1OA1A 3C6ZA 3M8KA 4JELA 1GA6A 1TFRA 2CJXA 1ZOOA 1FQJA 4H7FA 3TOXA 4U2BA 2JRLA 4HAXA 2NTEA 2Q3CA 1INLA 5FWYA 4RPHA 4BQIA 2EFDB 2FZ4A 5LA6A 1KFEB 1EFTA 1ZEJA 3IEPA 4HTFB 4R40A 3EEOA 2WFMA 2B7CA 3COWA 4BU1A 2XVXA 3TEMA 1W2HA 4PGHA 3WWZA 4MRRA 3I2GA 5L8VA 3GRFA 1MT0A 1FRFS 1JEYB 2JDIA 3TLAA 2RI6A 1EFDN 3IFSA 1FUUA 2Q6VA 1O03A 2R84A 3LY8A 3AR4A 4L9SA 4TKUB 4DUGA 3MSXA 1G5QA 1IULA 1BZYA 4LJ8A 2NTNA 5TX7A 2B36A 2ILTA 4D41A 5CDSA 1NSYA 4TKMA 4UW9A 1VL2A 4W4TA 5F7JA 3R5TA 3E8SA 2CLHB 2OSBA 5D1HA 5E7MA 4A8JA 5AW0A 1UKAA 1FC0A 4F3TA 3DVLA 2AQHA 3QVKA 4GXNA 4HDMB 1CUUA 1R0BA 4BQPA 4G5SA 4CKEA 3ELBA 3SZMA 3BSSA 1E92A 1MO3A 2AD1A 1GPH1 2E49A 1VMEA 1XWIA 2C9OA 2Z4TA 3L84A 4PQRA 4RKRA 5J5VA 2IHZA 1V6AA 2PLFA 2PU5A 4A1OA 4HAWA 4YRFA 3SY8A 1H1DA 3LDHA 3NHPA 5C3UA 4YUAA 1GQRA 4QXOA 4D92A 2F4NA 1GIAA 2AR0A 2HL6A 3DTVD 2IEYA 2QNBA 5GM1A 2IE8A 2CHVA 5K6RA 3CCBA 4KAFA 5JVDF 4F7DA 4XSGA 4ZZIA 1WU7A 3X1WA 3AOEC 1Z6XA 2DC1A 4ARVA 4P0TA 1CEEA 1UBGA 1U9YA 3ZLTA 3V46A 2FDXA 3HSKA 4FMBB 4EFNA 3E22A 4X44A 1BH2A 1HQDA 3KQUA 2H9YA 1IXRC 3HKEA 4I9HA 4CM7A 5KTRA 2RD2A 3UKOA 3VOAA 3M6IA 4GQIA 4Z4GA 1BS1A 4D0SA 1F7VA 1PNOA 3VPGA 3UIEA 1B76A 2HFJA 3CNHA 3DZKA 3M81A 1FP4B 2F1HA 2E3JA 2WFLB 5G1OA 1DEAA 4XLTA 1TD1A 4AY4A 2AHOA 2IEAA 5GVRA 5L3VA 2C0QA 4DYDA 3HJBA 1J06A 1R5OA 3CX7A 3CZAA 4OP3A 3WFIA 4P4NA 4BMOB 4IDQA 3A28A 1X7XB 4Z53A 1I3CA 3M49A 4C08A 3NIGB 2QVGA 1QUFA 1R8JA 3TDNA 3VR2A 4RNDB 3HSSA 3E1GA 1AA6A 4CI0B 3MGBA 2J3LA 1VOTA 1ICEA 1KIAA 3GNQA 1ZBDA 1R6TA 2FSVC 1HLPA 3HWSA 1XRLA 1R16A 2Z95A 3DDSA 3MB5A 2ZCJA 4JR0A 4MJXA 4RUKA 4F86A 1CLEA 2ZWPA 2PUWA 2QDXA 1H6AA 2RDMA 1YDMA 5EGNA 1X7YB 5JO9A 5KNDA 1P72A 2OVFA 4LNHA 1FTGA 2FX3A 2TECE 5CK5A 1RXSA 5BRAA 4CM9A 2CKDA 5C1BA 1ZK0A 3BKXA 3L6RA 2H31A 4UPDA 1D04A 1CJKC 5KVQA 2XCRB 2I2XB 5MN5A 1OYYA 2XH8A 5FBQB 1AZSC 3NYRA 4JD5A 4TXJA 2D2VA 1RM0A 3MLEA 3KXDA 3T7KA 1IZ7A 2EERA 3TE6A 2G9VA 1OZFA 5AKJA 3VKFA 4BXOA 5CDFE 1XJWA 2PGDA 4G67A 4BC0A 1UWLA 2ZJ8A 1AF7A 1LBTA 1DMSA 4MVJE 3RDPA 3FXAA 1DC5A 3IP5A 3LC7O 2QA5A 4O0MA 3G2LA 3WJ2A 1U4NA 4MUGA 1M74A 4U5QA 4IIYA 4NLLA 3LPNA 5T7BA 1YJQA 3RO7A 1WG8A 1MGPA 1YULA 3EODA 4AYXA 1KI8A 3JPYA 3W2GA 1LQ2A 4DV2B 4ARSA 3JV7A 4LYDA 2XHEA 1EE9A 2CLOB 2YTZA 1NBOA 1YZVA 1Z8FA 5F21A 1EUDB 5KZMB 3JSAA 4YO7A 2H2AA 2VJLA 5EWLB 4EO9A 3NLLA 2A88A 1PK7A 3F6CA 2FJPA 2GFQA 3TNYA 1V6CA 2BEWA 3SE0A 2N75A 4JA0A 4G8JA 5AKGA 3U5ZB 1CUXA 4RVCA 1E32A 1FX0A 2CKMA 2OSVA 4EJSC 5JCJD 4D8XA 2CVHA 1PWXA 4L3OA 4DXHA 1YVDA 4EKYA 1NSTA 2OVBA 2F6RA 3OD1A 3UPUA 4YDRA 3ZXYA 5EKUA 4YMIA 2BEKA 3F46A 3L8MA 4JBIA 2XB6A 3JR3A 5JS2A 5AK5A 3WNVA 3GGDA 3EXHA 3N58A 2IBSA 3EXIA 4UVHA 4EPXA 5HIKA 1S1CA 1V8ZA 4J0CA 5BPHA 1DAHA 2EG9A 2P9QA 5MHTA 1V3VA 4BATA 1VDMA 1ODIA 3CX3A 4ZFNA 4P3YA 3KHUA 3H6HA 3RYCA 3NTUA 3UWSA 4CF5A 2DPLA 4FHDA 1MPXA 3E5RA 4CCYB 2YQ5A 3KT8A 4QO8A 1ZN7A 4UUPA 3RK1A 4CUZA 3FTFA 3DAPA 4AQ7A 3FOBA 3H9QA 4NH4A 4XIGS 2QMYA 4C0AC 2NSLA 1EX9A 4LHXA 3GJZA 3H6GA 2CDRA 4HADA 4P5EA 3F8SA 3GLFB 1WD7A 2Y05A 4P98A 3RGWS 1F2DA 2I7VA 3M6VA 3RTDA 2JW5A 1DCKA 1CB0A 5LU8A 1H2YA 2FRDA 3K9CA 1IIBA 1UFRA 2NU7A 4FFBB 4G1UC 4RKWA 1ZGHA 3TQCA 4CU5A 4NNPA 2PAFA 5HMLA 4G1EB 3S7TA 4B4OA 4IEFB 3FETA 2B5VA 1T8RA 1N7IA 3A6KA 2Q2QA 4WA8A 5G3ZA 5CIWA 2QLBA 4H4DA 1QIFA 4QHSA 2P2SA 3AI3A 4NNOA 2O07A 1T8UA 1WEHA 2EF0A 2VHZA 1P6UA 1LF0A 2EZ9A 4OOFA 2WZQA 5LZ8A 1QFSA 2IDJA 2VQ6A 4OAPA 2GVNA 3HCBA 3CX4A 4CGZA 5A4IS 2BZSA 3CRZA 4P3OA 3GJ5A 4L95C 1RWKA 4HAIA 5AW3A 3KOWA 3O2SB 5CFLA 1L6IA 2AJCA 5DCYA 3PITA 4LJLA 2OWEA 1A4IA 2FA9A 4E14A 1RWPA 3IXQA 5KHAA 1HDGO 3DC2A 4ODIA 4XFKA 4ED9A 5I7VA 2C3UA 4K2HA 3QELB 2O50A 4OHVA 5C5EA 3DHNA 3H0KA 1ZSNA 1M6NA 2FWPA 2YQZA 5ENDA 5I7EA 2G4LA 3USZA 1KK1A 3WLPA 1XTQA 4NU8X 5AW5A 3RBVA 4M3NA 4PG8A 1OBFO 2GEJA 2IXAA 3BGOS 2D2FA 3FWYA 2G1UA 4Z0HO 1KHTA 4BO1A 5A5VA 1KKMA 1EWQA 3JWIA 1MXHA 4NFHA 4KXUA 1TCVA 2GPBA 4MS3A 3FDZB 4HGQA 3SHWA 1O6ZA 2QMHA 3KG2A 3OFNA 1E0SA 1U0TA 1LGYA 3AUAA 3AEQA 3DPIA 4LI3X 4TL7A 4Y98A 1YB2A 3HCPA 3OOEA 5A4AA 3CR7A 1Y7HA 4NZNA 2HSZA 1NPYA 5AOVA 2I4OA 1OJ7A 1DJNA 4I4TB 5LM3A 3R3WA 5DZSA 2O48X 1QIEA 1ZK1A 3N2KB 4UUQA 3RG2A 4FUQA 4M89A 1WM1A 2MIIA 3K8QA 1DPFA 3K70B 5AKYA 2D4HA 1AD2A 2QMEA 4NSNA 4XPIB 2JFFA 4GRAA 4FZJA 1IM2A 3T5CA 4I8XA 5LZ2A 1KH1A 3OX3A 1N8SA 2CMGA 3OUZA 2PXHA 1IAVA 3OZFA 1YL6A 3WHLA 1ZVMA 3U3OA 1C0LA 5FXMA 2AN1A 3GDWA 3IALA 4JLJA 3QVUA 4H1TA 3T7IA 2OESA 2PS0A 4LE0A 1D4OA 2YUTA 1AXRA 4EW1A 1A7JA 1BW9A 2IYAA 3B1VA 3L7JA 3O8OB 1QDLB 3RTCA 3DD5A 4ROTA 2DR3A 5FNVB 5C8DA 2GZMA 3M83A 5DT2A 1THGA 3QITA 3PQDA 3QPVA 1E9RA 2ZFUA 3IT1A 3DVSX 1CUFA 1I5RA 1SUPA 2I1QA 3S5JA 2EJCA 3FVWA 3CZCA 4KDFA 4ZAVA 3LUKA 4MEBA 3VM6A 4DWWA 1PWHA 1XVVA 2IOHA 4GOKA 4OP2A 1U1GA 5L6MB 1KMHB 3VFDA 1V5FA 1CETA 3CPHA 4E46A 2ERYA 5KYKA 1O87A 1ODFA 5FQOA 2DBQA 3TH5A 2VK4A 2X1VA 2C8JA 4D6YA 4KRXA 2GILA 1VE7A 3C8ZA 4HVAA 3PUJA 4K9PA 4WFIA 4WZBB 3WDMA 1S01A 5FDFA 4Q7LA 3OZWA 4BTLA 5BQ5A 1MC1A 4Z4FA 3MK31 3J81k 3HVJA 4LJAA 5JMOA 5D6NA 4L2IB 1HZZA 5JRDS 3I6ZA 1W4AA 2Q4BA 3C4JA 3W6PA 1FYWA 2VTVA 2OG2A 5JWRA 4YCLA 5E4JA 3WZMA 4BJHB 3QTLA 5FPKA 3CTPA 1E2QA 4DAOA 4FM9A 1KYWA 3FUWA 4W1QA 2D1YA 5FOSA 5J5AA 4A2WA 3B5JA 3ND5A 2W4MA 4NECA 2WJGA 4N48A 2VSNA 3PWSA 4HO1X 5DI3B 3EUAA 4J91A 2F1JA 4ZT6A 5JARA 1PFKA 5GV7A 1KQGA 1HLDA 3OPQA 5FP0A 3WK5A 2N47A 4B2LA 5H02A 4R8RA 1IDOA 2HD4A 4WK6A 2Z2ZA 4XXHA 3VR6D 1GTMA 3FCCA 4A0HA 4GQAA 3OPYI 1GQOA 1E20A 2XXJA 2ZBRA 4CQNA 4BE4A 4JFAA 2EKPA 3DBVO 4B8YA 1QX3A 2ZTUA 2R4UA 2YHIA 3SZGA 4DQDA 2DHQA 621PA 2D13A 3JU3A 1XU4A 4HWRA 4L9AA 2AI3A 3L1KA 2BRUC 1DOZA 1RCFA 4ZODA 3S70A 4AN0A 2KPOA 4B3SB 3AUTA 4BRUA 2CUKA 2GEDA 2PFKA 1E0AA 4AKTA 3DOJA 1IHDA 2VPXA 3PFNA 4V0LA 5FBRB 2CY0A 1ZXLA 4NCJA 1Q84A 4XWAA 2EZ4A 2N1MA 2PX5A 4NMWA 3E8MA 4LRYA 5F7ZA 3B82A 3R77A 3TNLA 2ACWA 4CMAA 3TMAA 3QJ5A 3FRHA 2FVYA 1U94A 3A1WA 1R4ZA 4L3VA 2VRCA 5FL7D 3AJ8A 3SNKA 4ID9A 1WNTA 1FVOA 3ZHQA 4MIYA 2PKQP 1UDBA 3G7UA 4DIFA 4BNIA 1KHHA 3UANA 3DDZX 4QBFA 4CMKA 5IANA 3A9SA 5BV1A 3EZ9A 1UDRA 1XRRA 4IH4A 1QIDA 2YW2A 1KPHA 3UJPA 2FCRA 1KJQA 5JI3E 5DSXA 3CQ9A 1OGYA 1II0A 3WGGA 2B34A 4FTWA 2UZAA 1Y81A 4K8OA 3GMSA 5AKKA 2OV3A 1PL0A 2GN9A 1EQ2A 3QSGA 1KGDA 4M8NE 2OXIA 2JDID 3S2ZA 5DNEA 4YREA 3F1LA 3WTBA 4WE3A 1Y9DA 4ND5A 2UUAB 2VH1A 4IXMA 4DUGD 2ZWAA 1WDKA 2KQUA 2ZB3A 4NBRA 4Y9UA 1LLFA 1I3KA 5SICE 2Y1FA 4KC0A 5EESA 2FPOA 2PZEA 1EK5A 1ZMOA 3O8LA 2GCGA 3TD2A 1UJCA 4YC7A 1ORDA 1ZIPA 5KYWA 2R0QC 1Z2OX 2AVNA 2ZYGA 4YRAA 4EA9A 3DF9A 4PLPA 1GLVA 1NT2A 3OE5A 5CXUA 4FINA 4G85A 4JVMA 4KLRA 4UNQA 3RU2A 1NW8A 1CSEE 4BBPA 3H1BA 4PG4A 3H5IA 1CJUC 3KU1A 2WHQA 2NW6A 2QL6A 4BRZA 5C7OO 5K3OA 4K3UA 1YMQA 3RKUA 1IPFA 3RRXA 4UD6A 4HDSB 4EGAA 1NX9A 3IPXA 1IUPA 4OO3A 5SZKB 1EIZA 4NATA 4BWGA 4C6SA 1NPTO 2J9YB 4D9MA 2NZ2A 3I8XA 4ZMRA 1WHSB 2PBFA 1KNXA 2FFBA 5F9FA 2IYXA 1FDWA 2VHXA 3RHTA 4Z4HA 3FNEA 1O6CA 3RANA 1IHYA 2JKYA 3GJSA 2XUIA 3H4IA 3L8FA 4XM1A 2B4TO 3AVTA 3KJZA 3UW3A 1XQ9A 1IMJA 2R97A 5AW1A 1U5AA 1E8DA 1H1LB 2GBIA 3HK2A 2Q99A 5A62A 3KJFA 5CCXA 4FYIA 3QIAA 5IDYA 1OROA 4G5QA 3MILA 3OEEA 4II3A 1DARA 2FMXA 3D3WB 3IKJA 1FNDA 3GEDA 4BWYA 2RI0A 2VNHA 2X6RA 4PYQA 3KSZO 1NY6A 4MYRA 5IBCA 1GUBA 2W2NA 2X9GA 2YIMA 3CF2A 3ETJA 5TJHA 4B6GA 3PNSA 3TLCA 1BRMA 3V4FA 5FLEX 4Z6KA 1PR1A 1ZSYA 3MJSA 3ILYA 3WMXA 3CF4G 2NXWA 1QR2A 4URVR 5L7WA 3UKJA 3O6VA 2L42A 4QU5A 3VR2D 5EJ8A 2PS1A 1UADA 2GI4A 4ZEXA 4TMTA 2XCUA 4K0RA 2FW7A 2NPIA 5JAOA 1KDTA 3UOGA 1K9VF 3FB4A 3WNZA 3AUKA 1KARA 3Q72A 1F0YA 3BE8A 3WISA 2GESA 2Y76A 1WTCA 4TVBA 4ZDKA 4WBNF 3FBTA 1TM2A 3GCGA 2XT0A 1R6UA 1CJCA 3OHMA 3E35A 4MKHA 1LZLA 4L72A 5KNDD 1AY0A 4MS1A 3JD1A 2BFDA 1NP6A 2J0VA 5ALYA 4BC1A 4CM9D 3GGPA 4LHYA 1QP7A 2WM2A 3N2ZB 1VL1A 3LOPA 1KERA 3L8GA 4EFDA 4OD0A 1JMVA 1H2XA 1GY8A 1ONPA 4MVJF 4DKXA 1NP7A 4RVGA 3GLUA 1YVPA 1Y3HA 3B6MA 3K5HA 4OOEA 4CTJA 4PQGA 4DV0B 5AI4A 4JNCA 3H2BA 5U4QA 1XZBA 4DZTA 3PP8A 3TW0A 4NTZA 4MUYA 1AUPA 1SHUX 1NN1A 4QREA 3JAKA 4PWYA 1P0CA 3WMFA 3R3UA 4A82A 4C7OA 2FSGA 4QM7A 4QOFA 4FB5A 5CLFA 4N9QA 3DNMA 3C74A 4OM7A 1B6SA 3FKJA 4DADA 2UVPB 4CM6A 4GEGA 2NIPA 4HNAA 4IUDS 2H7VA 3L07A 2ZBFA 5JOQA 5AXBA 4YQYA 5EZ6B 5LNK6 3WIEA 2BFCB 3ZC3A 2QNIA 1JKFA 3REGA 4CHGA 3EX7C 1A8HA 3ZOZA 2JZOA 1B6RA 1G3UA 2IYFA 5SYNA 1ZR2A 1T8TA 1JG6A 3LHKA 4B7XA 5CITA 5DCWA 5IASA 5HW0A 2M98A 1SUFA 1Y0BA 3DQZA 3D3EA 1GRNA 2OCAA 2BEVB 1U7TA 2WTAA 2QTBA 1QH8B 2VBCA 1ULHA 2PE5A 2H9AA 3A36A 4BAZA 1EB9A 2ZDGA 3JVVA 1QDUA 4E2ZA 1JFSA 1V71A 2ZAMA 3TSOA 3DEIA 3H11A 3P9YA 2JJYA 3HZRA 1VLHA 2ZROA 2O2IA 2FSFA 3A3YA 3FGOA 3JATB 1DX4A 4WVLA 3UC9A 2YL2A 1J49A 1J6UA 2OXTA 1UEJA 1Z2DA 4ISCA 1AO0A 3WGKA 2B1QA 1IHUA 2G5GX 1ZCBA 2P0YA 2EW2A 3QPUA 4KR6A 1Y6JA 1YJXA 4HAVA 1QE0A 1UBMS 1K8XB 2QUHA 2QN8A 3JYPA 2UDPA 1QK3A 4K2AA 1W44A 1H6BA 1RCUA 1XB2A 3UWDA 2IFTA 3HJCA 4FK8A 4YT8A 2YWDA 1DIRA 1BMDA 1E5DA 3ROEA 1NI4A 4MQ5A 1NUSA 1X7ZA 3DKPA 4IVNA 1UPBA 2A9RA 3OURA 1KEUA 3LCMA 4UDYX 4DV7B 1JYFA 1VHTA 4C0QC 2WWGA 3STWA 3H2YA 1Y3IA 3H4MA 3BREA 3PFIA 5EJ2A 1SXPA 5LYJF 1OX4B 3WGUA 2O20A 3CEAA 2RHTA 2LDXA 3D6NB 3K6KA 3WBFA 2AXEA 3GROA 4HGRA 1PT6A 2EEZA 4DC9A 4DT1A 1R8QA 2NSHA 3U9LA 3UICA 4PXAA 4TRJA 1KMQA 2C9YA 5FAXA 3HJFA 4YS6A 3SX0A 4UVGA 3AY6A 4Q82A 5AESA 2YHSA 4HDKB 3C5CA 4RZ2A 4DA8A 2HO5A 4BYGA 2GBLC 1KEEA 1M2VA 2ZI4A 4K6FA 1AO3A 4P4GA 3DFKA 1P8AA 1RM3A 4KU4A 4XCVA 4ZICA 3DBRA 1NKTA 4IRXA 1HSZA 3VZCA 5B2EA 1B2LA 1MKYA 2IOQA 3OCWA 3PXBA 3Q3IA 3PSAA 1G4AE 2GBFA 3IKMB 4EPRA 2G09A 3AL3A 2SCUA 2A6PA 4Y6OA 3S3TA 5AKEA 3HY6A 4BGUA 4BLSA 5FYQA 4ND4A 4CQJA 1T9GS 2NNLD 4K6MA 1W6UA 1YBVA 3DP7A 3GRAA 3UENA 4E21A 4F4HA 4DCNA 3QOWA 2H1IA 3UXEA 1CQJA 3KKMA 1G21E 3GJYA 1DQYA 4RPGA 4PO9A 2R6CA 1E7SA 4I8IA 3OFND 4Y67A 4MKXA 3PLAE 2ZZNA 1E61A 2C2YA 3ICCA 2OPBA 2R1TB 2QRUA 1MX5A 4H7HA 2FG6C 3W7BA 1KYTA 4PICA 3JYNA 3TQHA 4A0FA 4AZTA 5GZ1A 2PXCA 1AKMA 4OPMA 3IRVA 3VVLA 2F9MA 2BFBB 3GLSA 3PHCA 4NL4H 3GP3A 3SJ7A 5ALUA 2ZSUA 5IJZA 3C3AA 3MOIA 3EVTA 1FNMA 3VMFA 1WPQA 4GI3A 3KQQA 4QU8A 1B8OA 3KD3A 4Q4AB 4JLMA 4KI7A 4YLYA 3T54A 1XRPA 1NBMA 3NATA 5H16A 1IQRA 1F6DA 2WSYB 1SB9A 4B83A 5KWSA 5TB5A 1AS3A 1KI6B 2FN3A 3C41J 3SS9X 2IZZA 3A6EA 1OLOA 3VSBA 5J4YA 1QPZA 4JVSB 1H85A 4XQGA 3PF9A 1K7YA 1CS0B 2FHSA 2XMQA 1ZHOA 3L7IA 4UMDA 2Y71A 4LBYA 2YJ3A 4OSOA 2WSSA 2OLKA 3NM6B 3ZOKA 4P2BA 2C4MA 3GX1A 5BXYA 2H0QA 2YS7A 5FX2A 1R3UA 3E70C 2ATCA 1QMGA 4TLAA 3HGTA 2I67A 4J1TA 3VYWA 3C8HA 2BKXA 2VP5A 1W29A 3R9KA 3RSQA 3BMOB 1TRKA 2DLDA 2PZJA 4WKGA 1G3RA 1JHDA 1GP2A 2OR3A 3D7SA 1E2GA 4G0OA 3UBMA 3PUKA 2N9UA 3QPAA 4EI9A 4CKCB 2G04A 1Y9EA 4GLFA 5TJ9A 5DLPA 1C7JA 3K20A 4RZXA 4HUQB 4JI8B 1EFLA 2ZJ3A 4H3SA 2I5PO 5H83A 5DK4A 1XXHE 4X8LA 2WB4A 4KK3A 3P26A 4Z0TA 3V1TC 5T57A 2V9ZA 1ZRSA 2NZWA 3HKDA 3PUZA 1JLMA 4KAAA 4UEKA 3BXZA 3HU2A 1WVMA 2OMEA 1EK2A 3R3JA 3UGTA 2E48A 2G76A 1IM8A 4RS3A 3NIDB 2QV0A 4GZ5A 4R1OA 3IAAA 3DL0A 3RRNA 2YHUA 4K9LA 4I99A 1SXJE 1DBRA 2ATIA 5KAPA 4D4GA 1B8NA 1N2JA 2QEQA 2QWXA 3T1QA 3CNNA 2PBLA 4X64B 5F12A 4QGSA 2WJVA 5HDBB 2GAIA 3COPA 2A0XA 5B2ZA 3EXFA 4MARA 4S2EA 4WNIA 4FOTA 4PLFA 3GFVA 2FWJA 3LUHA 3TZQA 3NVDA 4YRQA 4EHBA 2XUGA 4G0PA 3FCOA 3M5WA 4E7PA 3WLEA 3PUYA 3M1IA 3LJKA 4U9UA 3VKVA 1OVMA 1TJYA 3VKWA 3GP8A 4URFA 1N75A 2DGDA 3UN1A 1XG5A 5KMGA 1AV6A 5HF5A 5ITZB 3GZNB 2JVKA 5JAMA 2UZ3A 1N2HA 1ZLYA 2A0FA 3D7LA 2FZVA 4OQNA 4FN5A 5LUBA 4O4LB 2A78A 3EIXA 3CTMA 1FSFA 1O5TA 3I01A 4HQRA 1A7KA 2B4QA 2G8NA 2IT1A 2ZDQA 2MINB 1SOUA 1WU8A 1D2GA 4GQBA 1JWAB 4PG6A 3ZWCA 2P5YA 4EG3A 1FZTA 4OXKA 1WNFA 2ZE5A 5E9QA 5CYOA 1S6YA 5CUQA 1X39A 3MGAA 4U6SA 1CF2O 2C94A 1G9SA 2VRCD 1SG0A 2O3SA 3E03A 5DO9A 3Q4GA 5ADWA 3CVXA 1P4HA 3QNMA 4AAYA 4MDFA 4YPVA 1PW7A 4XRRA 3GP5A 4BASA 2FFAA 3C3DA 4L8YA 4MKFA 5JXIA 5KPDA 2IYUA 4CG3A 5MGNA 2O05A 4RK1A 1DPGA 5LP6A 4B0OA 3D3QA 3FSGA 1NUPA 1BX1A 1QKJA 4DMGA 1YR9A 1OV6A 1MVNA 1O94C 2QE7A 1Z8HA 2WK1A 2X3FA 4H0CA 3ZWMA 5HOEA 2FWMX 4HNQA 4PLYA 5LYJA 3SR0A 5C8YB 5JQWA 3UEOA 1A4RA 1MFPA 5FI1B 2BM9A 5HBRA 1CUHA 4MV3A 4P93A 3RJZA 3PSHA 2HJRA 4L51A 4UDNA 3DE4X 1RT9A 4YROA 4OI1A 3EVAA 3MUFA 1X80A 3NORA 4TWRA 4IIJF 4UM5A 4XVHA 4PR0A 3Q88A 2Q1XA 2QBYA 3M9WA 2OAGA 1UAAA 3MS2A 4H6WA 3TZCA 1RJGA 1SHTX 3HU1A 4B3FX 3ZU2A 4AS2A 4BNUA 1W36D 2M1ZA 1NGSA 1NVDA 2CLMB 2G0AA 3ZXXA 2F8SA 4W1RA 2V9CA 4KWIA 3B3JA 4X60A 5AJHA 2EGGA 2NSYA 1KYYA 1U28A 1KP2A 4N3CA 5KTMA 4Z7QB 3RPEA 3NIBA 4QXMA 3F7TA 1G5FA 4Y1EA 2JBAA 4ENVA 1F0PA 2NTVA 2RH4A 4UEQA 1RBYA 4KWHA 4WKNA 4DSTA 5CD9A 5JSFA 3H83A 5K01A 1ZJWA 5J4VA 4YLGA 4RD2A 4TSFA 4MTLA 3VAAA 4C4SA 1AKQA 4V1CB 2QXTA 1ORIA 3O0DA 3ZV6A 4AP6A 1XMJA 1KDVA 3PCTA 4HP8A 1EGAA 3OT1B 3Q3EA 1C1DB 3SKYA 3D7KA 1ISHA 1Z18A 4D9CA 2VNIA 1U3VA 3H5LA 3W9SA 3HR7A 4R16A 1UMDA 1Q7GA 1Y80A 1LJLA 1RI1A 4FEEA 4ZCTA 2ETVA 3DEZA 3SDZA 4UNPA 5KQRA 2UU9B 3OEED 1RBZA 1V48A 1JIIA 1RMYA 3BCRA 4Q15A 3P9NA 4TXHA 5CT8A 4BEVA 3UQYS 2Y92A 2KBEA 3OQVA 3KYDB 2OQVA 1U1EA 2O4UX 2Z2XA 3QKUA 2IXDA 2GA8A 3T1TA 1OAOA 1R6VA 1AKEA 1TQHA 3BH7A 5C8XA 2F59A 3AVQA 1GSIA 3MCUA 3H2KA 1FW8A 4PX3A 4QULA 4YP9A 4BFSA 2XZPA 4HVCA 2P69A 3P9CA 2COUA 2IP2A 4N03A 4RBNA 3RBAA 4K87A 3ROMA 4DA7A 4O02B 1NMEA 1LDYA 5C81A 4LISA 5K2MA 4IDPA 3C6KA 1EVJA 3K96A 4E5MA 1AURA 1WVIA 4Y2GA 3IE2A 2QYOA 5BUSA 4TV9A 4KR2A 4NU6A 1P7ZA 3KKOA 4I55F 2DTXA 2O7VA 3KTAA 4JP8A 5IKXA 1E8MA 4RPLA 1SC4A 2CFTA 3AHHA 3LCCA 4Q3OA 1WB9A 3AV3A 4ZCSA 1LSOA 1WB4A 2HDNB 2YXDA 4UC0A 3I9JA 3KKZA 2Q8QA 3OF2A 1JDTA 4B75A 4C7VA 1F8FA 1CZKA 1Z4MA 2G80A 2UYGA 1JDNA 1SBTA 3TM5A 3G8DA 3GQVA 1O54A 3QHQA 3KEOA 4IHKA 4DANA 1WA5A 3KB6A 4ECEA 1VYVA 3L2OB 5ETJA 2OBLA 3EE6A 1HPLA 1FMJA 3CUVA 3UMVA 2ANBA 2ZVJA 5TPWB 4KG7A 1YA6A 4Q9DA 5CH8A 4BJ3A 3WMWA 4BUCA 2PHZA 1GNQA 4WBXC 1E9DA 5I48A 4TYPA 5IT0A 2Y0DA 2ZAYA 2I7CA 3G0IA 1DVRA 3KQTA 3OEYA 3TI9A 3FCXA 5B7GA 2VTBA 2CXRA 2V5VA 2K4MA 2WSIA 1XEWY 1EP9A 2BD0A 4JL6A 4C2TA 4GECA 1P4GA 1ZH4A 4CWAA 1WOMA 3EWNA 1E6WA 4JL8A 2QLTA 4B3TB 4G09A 2Q3BA 2O59A 4Q34A 4LNUB 3BC1A 5LL6P 3IAUA 4XTCS 3VJLA 5CLLA 2BIFA 1Y3BE 3BT7A 3OE4A 1HI9A 1ACMA 2ZR0A 4RADA 2D59A 5DHQA 4EB0A 2VFAA 3QG5A 1RJ9B 5LBIA 1KSGA 4C5CA 1TGVA 4KVAA 1E9AA 1J39A 1JR3A 2ODEA 3GEMA 4RF5A 1LUAA 3GGJA 4TWJA 3VH1A 4RD3A 1GG9A 2GD1O 3STUA 3FR8A 2O0JA 1TZBA 3BIOA 3ETGA 2DR2A 3IUBA 4JJFA 4GOMD 2C7QA 2F00A 2R48A 3DHEA 4KQ9A 5E1MA 1QUEA 1W5EA 2ZIEA 5LKRA 3FZGA 3NBYC 2BBOA 3MWEB 2XX3A 3EULA 1DAFA 1S96A 3G0BA 3G2PA 4PSCA 1QK4A 2B0CA 3AFHA 1BAPA 4OMDA 4BKPA 4MUEA 5IN5A 2XUPA 2Y2UA 3ZWAA 3TRKA 5BYBA 1NFFA 4RVOA 4MRNA 1GJRA 4KVGA 1SCDA 4PO8A 1LCIA 3TSCA 3QEAZ 2XBMA 3TOSA 4I36A 4QLAA 4Z9BA 1V6SA 4CEJA 3U9SA 2G72A 1SBIA 2EWWA 4FMPA 2VTEA 2JLZA 4RULA 1HNNA 2WG1A 2WSMA 2R6DA 2Q4DA 3P9KA 3T7TA 2OE2A 4XWYA 2E6UX 2R44A 2A9OA 3CH7A 1NVTA 1DIGA 1R8SA 3C7KA 5JU6A 3DO5A 1VSVA 4H1UA 2H7XA 3WKCA 3KPJA 3EHDA 4HNUA 3ZDDA 1Z4NA 1Q1ZA 1FVFA 4X3PA 5EKTA 4CIXA 5AJYA 4GICA 1C8VB 1UPUA 5KC9A 2OM2A 2RK6A 2IUSA 3PKZA 3IPYA 5F1OA 1QH9A 4OG2A 1X14A 1M6VA 1ENYA 3H9CA 3OM9A 3DQPA 5AM3A 4EIWA 3BF7A 5ILOA 2W42A 3SYMA 3DB1A 5CX1A 1VCMA 1B00A 5CEJA 5FOVA 2CBXA 2EARA 1X74A 2PO5A 4R0MA 1W2WB 2ZJZA 1UR5A 1IWOA 4TT8A 3PXDA 4WK4B 3JALA 2NYAA 2WPNA 4GC9A 4I5DA 3W5DA 4IMIB 2R5FA 1NN0A 1WBJB 2XB8A 4RSGA 2DEUA 3THSA 4HPWA 3B48A 3W2TA 1ADFA 1JTFA 4HN2A 2G5CA 2PRIA 1ODJA 4M37A 4TTVA 5JEEA 2YRFA 4HN9A 4MPTA 5JDCA 4H59A 4CM3A 1RVV1 4PZYA 1C3OA 2FPLA 3PGLA 2X8WA 1NOKA 3SYNA 4LF5B 1N5RA 2WDPA 1AKWA 1G3MA 1G8JA 4AWXA 3PBKA 2F8MA 4GMXA 4D4KA 3VSEA 3ZNNA 4J1QA 2VATA 1GTJ1 2OV2A 2PZBA 2QAGA 3TZBA 1MABA 1U0BB 3FOCA 3KJQA 3KQPA 3SF8B 1Z6ZA 2Q3DA 3T9CA 4LX8A 3TOZA 4BUJA 1QFYA 2W9XA 3FTQA 1QGOA 2Q49A 4O2AB 3RRFA 3BPSA 3F96A 5ARBA 1TVKA 2FEOA