3PXBA

Impact of brca1 brct domain missense substitutions on phospho-peptide recognition: t1700a
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
211
structure length
208
Chain Sequence
RMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERALKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Breast cancer type 1 susceptibility protein
publication title Impact of BRCA1 BRCT Domain Missense Substitutions on Phosphopeptide Recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 208
sequence length 211
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3pxbA02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3pxbA01
3SHVA 3COJA 4XPZA 4XQ0A 3T1NA 3EF0A 2LE0A 4U4AA 2D8MA 3QVGB 4IFIA 3T7JA 1N5OX 3T7IA 4Y18A 2HTFA 2ADOA 3PD7A 3QVGA 3HUEA 3I0NA 3PXDA 3PXCX 3L41A 4BU0A 2VXCA 4IGKA 3SQDA 2EP8A 3HUFA 2DUNA 4BMDA 1KZYC 2EBWA 3PC8C 3PXBA 1OQAA 3PC6A 3KTFA 4OFBA 3L40A 4ID3A 3PC8A 3I0MA 2XNKA 2COUA 2WT8A 2COKA 2VXBA 5ECGC 1T2UA 3EF1A 3PXEA 1WF6A 1Z56C 4BU1A 1Y98A 3FA2A 3UEOA 1L0BA 4JLUA 2AZMA 1CDZA 2INGX 3AL3A 1L7BA 3UENA 3T7KA 1IN1A 2EBUA 4BMCA 3K0HA 3PXAA 1IMOA 3L46A 2K7FA 2ETXA 3SZMA 3K15A 4Y2GA 2L42A 3AL2A 2JW5A 2M2IA 3II6X 1T15A 2K6GA 2E2WA 3K0KA 3U3ZA 3PA6A 3JVEA 3PC7A 1GZHB 1T29A 2COEA 3OLCX 1T2VA 3K05A 3K16A 1JNXX 2XNHA 3SHTA 4N40A 2R1ZA 2NTEA
chains in the Genus database with same CATH superfamily
4HQLA 5GP1A 1FUEA 1I0IA 3O8QA 4QU5A 1CUDA 1MFZA 4EHAA 4P0QB 4BRZA 2QIPA 3Q7SA 1RS0A 4L8FA 4BMNA 1MZPA 4ZEOA 3F0TA 1VBFA 2BMDA 3OU7A 2CDBA 1BDBA 4LV6A 3CLRC 3BT7A 3WYFA 4LZAA 1U9CA 3DH0A 2P9JA 3HP4A 1UBOS 4U6QA 2D1QA 1CQWA 2I65A 4PYMA 3CY6A 4DDMA 4I2VA 4EX6A 1W581 4FQ7A 4WCVA 5K0JA 1A4UA 1J0BA 1XPUA 1L7AA 1XG5A 3WKAA 1Q0HA 2O8CA 1EVLA 3D1VA 1KFBB 1TU3A 5GV8A 3MW8A 2YS6A 3JASB 1EDZA 5F77A 3N2EA 2QNIA 1SJ9A 3PJGA 3A9TA 1D8AA 1OKKA 3PXCX 4GI7A 1O0CA 4MRAA 2GVZC 4F3CA 4H9GA 1AY0A 5HP4A 4TN5A 4QNMA 3WK8A 4GKVA 2HWXA 2ET6A 2AQKA 1KJ8A 4Y2HA 1V7CA 3ZJUA 2W70A 3DAFA 4NF2A 1V8PA 4L4RA 4P5DA 3EG5A 2CL0X 2HTEA 2WD9A 3BB4A 5JISA 2RB4A 3KSUA 1MIHA 3PHIA 2FWPA 2OWEA 3FWKA 1YZHA 3AHFA 3PPXA 4FS3A 4LVCA 4GI1A 4ZTBA 2WP0A 5TLSA 1DWPA 4KQCA 1Y3FE 3TTYA 1FLAA 3UK1A 2FY8A 1GT6A 1J23A 1ZJ5A 2GVNA 2Q1YA 2V96A 3JQFA 5BN5B 4CEHB 3ORQA 1A4XA 1W19A 1ZWLA 2PSFA 3QXSA 4RD4A 4W82A 4YLYA 3N2KB 1QG6A 3GGGA 5DNVA 4FT2A 1WY5A 2I0FA 2AFVA 4BNWA 3DKKA 5JV5A 4D8WA 1ZBDA 2JJ1D 1NM5A 1X7ZB 3KUKA 4GYWA 3CXUA 3VNAA 1NW4A 1ODSA 2FSVA 5LPNA 7REQA 1QKIA 4DB4A 3MGKA 4RJJA 2OVFA 4O6VA 4TS1A 3OWHA 1RR6A 5A3JA 3GV0A 5K09A 3ESZA 1RPNA 4V0OA 3ZJ4A 1IWOA 3K2EA 5CK4A 2C57A 4R40A 4WINA 1TRKA 3T9FA 2PPVA 2R48A 4CLRB 2ZRBA 5IN5A 1Z74A 2ODPA 2G9QA 4ZHQA 1YL5A 1D9XA 2B69A 4OREX 3OO1A 5H3CA 4FKBA 2E4ZA 5HF6A 4RYLA 4UDXX 1OBVA 3C4JA 3HVKA 4LDQA 3ZNNA 4XB2A 5B37A 2IUYA 5AKJA 1QE0A 3QHPA 2DHRA 2J32A 4LXUA 2JGJA 3LECA 1Z68A 3ZVMA 1EX6A 3CE6A 5DB4A 3WLLA 4AZ0A 1JZQA 2J3JA 1E9FA 1EE2A 2QUBA 4JT9A 5HRCA 1N2CB 2A67A 3OMWA 5GIOE 4JI2B 1MB4A 4FZRA 4J49A 1RYMA 1UZUA 1YDEA 2C98A 2VC2B 4X3OA 4X71A 4D4MA 2OFOA 4DLSA 2F00A 1PVVA 3PE6A 5AVZA 4WSOA 4GNRA 1VGRA 4TL8A 4OYHA 3SZMA 5CDGA 1RXCA 2AOTB 2WYHA 2HIMA 5JVDF 1SUIA 2O8FA 3E3OA 4C4PA 4ZANA 3EX7C 2ZAIA 4P35A 1P1HA 3OZGA 2DBQA 3FGZA 1C1DB 5D5HA 3T3IA 3RVKA 4H60A 2WWRA 2ISQA 3WMRA 4S05A 1OHHD 4TMWA 2OZVA 3GCZA 1TW3A 4UMDA 4MWSA 3Q5GA 1AK1A 5BQFA 3FWPA 4OHBA 3INYA 2IZ1A 4IY1A 4ABYA 4HNTA 4KO1S 2JJYA 5AKYA 2HK6A 3O1JC 4CM1A 5KNDD 4NENA 2IXAA 1ZEMA 4CR7A 2X3UA 3H3FA 2O54A 3LY5A 1F06A 1TGYA 2FW0A 2JFOA 5BN3B 2WWFA 3RU9A 4HAOA 7ADHA 3H9GA 3HG7A 1DQZA 3K2BA 4AD8A 3N53A 3VX3A 4MVYA 1NXVA 3UH1A 3GJRA 2IITA 4LTMA 1XAGA 1ZD8A 4OPMA 3VMFA 5BYAA 5E1DA 4P83A 5CH3A 2FPPA 5A04A 5G1OA 2Q5CA 3OHMA 4R5HA 1DKUA 3BEDA 3NEYA 2W2KB 5HS4A 1H5UA 1UJBA 1QFMA 2MSEB 1PGOA 3BSFA 3C6ZA 3PQEA 4F3NA 5AVSA 2B7CA 2HI0A 5GJWC 5JPIA 1B23P 2OPHA 1SOAA 3O74A 3LT0A 3IFSA 1OX5A 1EDBA 4JSTA 4LDRA 4RULA 5CM2Z 5IKOA 2XYPA 1KH1A 4PSCA 1I32A 2OCPA 2R6DA 1XZKA 2BFWA 1PN3A 4J2TA 4PAWA 4A0HA 5KNDH 1AZTA 2W6QA 1G1AA 1SVWA 4PYOA 5K2OA 4GM4A 4G5RA 1E2HA 2ZJOA 2QTVA 3NHWA 5D3MA 3T7RA 3WGHA 2AZXA 3OKPA 2WWWA 1VXOA 1L5SA 3G8AA 5BR8B 3R0XA 1W8DA 1QE3A 4P5PA 5D85A 3K35A 4I81A 3EGDB 3TMKA 5G2OA 2A4MA 4OH1A 1JDSA 5C3UA 3W8EA 2BHRA 2FP4A 1XK6A 3JQEA 2VFAA 1GN9A 2HPHA 3M8KA 1F2VA 4NV3A 1JHXA 2ZU0C 3GLVA 2FN8A 4E4YA 1EJ2A 2D2FA 1HT1E 3PUYA 3K5PA 3LBHA 5ALZA 5E9WA 2H51A 1HKHA 2QTNA 3PEVA 4MKGA 3W78A 1Q3KA 2DTEA 2VQDA 1YE8A 5D5QA 5A6SA 1VRVA 2PKQO 3A9RA 3TTXA 2V54A 3FDZA 3VTFA 4EW6A 1XMJA 2C07A 1UINA 3MGGA 4ACAA 4D57A 4F8YA 1KFJB 1VRCA 3WGZA 1JNYA 4DUPA 2ACEA 1ULUA 3T3OA 3AEQB 3B9RA 2W2XA 3S44A 3VR2A 2X8JB 1DHRA 1UKEA 2IYUA 3CSUA 3F90A 2NLOA 1DUVG 1MJFA 3I1JA 3IX7A 3KUDA 4X00A 5SY9A 4CT4B 5JAPA 4TYNA 3RO7A 2EXXA 5IDYA 1BW9B 2PX0A 1Y3BE 3LBNA 1YS7A 5F7ZA 3VYUB 2H2AA 1SKYE 2VK8A 3T3MB 2ECQA 3ZWMA 4MUKA 2ZRNA 1NPTO 3Q0TA 4EY3A 2BGNA 1YIOA 1YOVA 1M6YA 1B16A 3HM2A 2A5JA 2O5EA 2CNWD 3RWMB 3ZTWA 2QVLA 2RBGA 3D8TA 1EJ0A 4LC0A 3DQQA 3WMEA 1Y8CA 3UXEA 5DN6D 2O0MA 5EHXA 2QR5A 4GKBA 1WOMA 1UDWA 1XU4A 3U1TA 1CUBA 2XE8A 3DMNA 2L18A 3QU7A 1I8TA 2R7MA 5E9AA 3MT7A 2C4UA 4XTRA 2HOQA 1I4WA 3ASUA 1ZGCA 3EIHA 1H9BA 1XRQA 1NPDA 1SWWA 4I50F 4KIUA 3V8BA 2NAPA 4QLBA 1DPFA 2JFPA 2Q5EA 3IUQA 3NMUF 3BGIA 1UF9A 4YAIA 1X1TA 3AF3A 5FUXA 1ZJWA 1GXSA 1NBEA 4YP5A 4K8OA 2FFHA 4L2IA 4M8IA 1QLHA 2XWQA 4MUFA 4OLFA 4C0XA 3TOXA 2Q1WA 4NDZA 4PLVA 4EQ6B 5MFPA 3STWA 2YHUA 2XQGA 3NASA 4KPGA 4UMEA 3KVVA 2BFEB 3HCFA 5BN4B 3Q2OA 4PHTA 4ND6A 4AKIA 2I29A 3JQCA 4F71A 2FE4A 3BWMA 4M98A 5TV2A 4BQRA 2EKLA 1JDZA 3HCDA 5IARA 3OIGA 4J0CA 3HDTA 4DLNA 1LBQA 1YRWA 3BFKA 1UBLS 4YUAA 4ILEA 1CEYA 2ZIVB 4C5BA 2O2SA 2FEPA 2XSZD 3NORA 4KAJA 4YPVA 4CHGA 3TR6A 2QNBA 4L8LA 3TQRA 5EXTA 3NUQA 4QNNA 5T6BA 3OPYA 4AN0A 2A1IA 3H11B 3RSSA 1GDHA 4LXIA 3AG6A 2C9MA 1I1OA 4MGEA 2YHIB 3UTDA 1BH2A 4KP7A 3RUFA 3VR4A 1RXEA 3G3EA 4X90A 3H1PA 3QYAA 3FZNA 4TWIA 3AIIA 2ZVJA 4DV2B 1RI2A 3ADBA 2MDTA 2P3QA 1EQUA 2XB6A 4YGYA 3R20A 1WUJS 1CUXA 4FNGA 4PNPA 1XJWA 1M66A 2CMHA 3CNBA 3CW9A 4J4HA 4W5OA 4WOBA 1MXFA 4QUGA 1LNZA 3N2NA 2GEKA 2Z2ZA 1FOEB 5JC8A 1KDVA 4KPEC 1PL0A 5F9FA 4OH7A 3TX6A 2JFVA 3HNOA 4XASA 4YT5A 5EUMA 3PHGA 3TSOA 3HS3A 3HLTA 3WLOA 1THTA 3SIWA 4YC7A 5EPOA 5ICMA 1EI9A 3PQ5A 2H2WA 3DJYA 4GBMA 4OLHA 4HVCA 5I5EA 4QGSA 5IDXA 4BXOA 2IIPA 4EB3A 2DR0A 1CJCA 1JSRA 1D1TA 4NE9A 2Z04A 4ESHA 1IU9A 1MAHA 2QT0A 4JB8A 5K8VA 1X7YB 5FFNA 1DAPA 3VGPA 1CPYA 2AH5A 1JE0A 3GRAA 5A71A 2IQ5A 1E3EA 2GEVA 1GRCA 1D09A 2AEFA 3R5FA 1GUFA 4O33A 2VCEA 5TT0A 4ZZ3A 5JNTA 2A1UA 2FQXA 3FTCA 1SUBA 3IIJA 3JU3A 4MRRA 1C8LA 2J3LA 5C53B 2I33A 2WTAA 2VSQA 2C7GA 3NAMA 5EYPA 4FKMA 2R6GA 2ZE8A 4D42A 3IELA 4NNPA 5HSGA 1XD2A 2X4DA 1OWOA 5L53A 1HDYA 1IOZA 4I4NA 3RLFA 1ECFA 2HA0A 1ESZA 1TO1E 3U1VA 3AJRA 1OT5A 1ZUIA 4HI0E 3AEKA 1PIWA 3DFZA 3PQDA 3R3UA 2AW3A 2F64A 4L6AA 1K3UB 4WY5A 1MEEA 1FNNA 5JFOA 1SQ6A 5AK0A 2GKOA 2K2WA 2F1KA 5IDVA 1YRBA 3AI7A 4D6YA 3PITA 3G8YA 2GM9A 4CM8A 1NT2A 1G8MA 3GCXA 3N8KA 4N03A 3IP1A 1HRDA 3EJWA 5TPZD 3WL7A 2NTNA 1GYQA 2VSXA 4AF8A 2V4UA 3PQ7A 4MQEA 4MW6A 1MW9X 4ZCPA 1NVWQ 1KTIA 1GQFA 5HUJA 5CX4A 4YRTA 5CMLA 3GLHB 2AFHA 1X7XB 3PNQA 3T35A 3UN1A 2PTHA 5K7SA 3S7TA 4TV8F 2XKJE 4WLNA 3UJ6A 1QTIA 2X1LA 4F5EA 6PFKA 4BAUA 1GILA 4YV1A 1SIUA 2GN6A 4LCEA 5EJ2A 5KNCH 1JEQB 1HUQA 1QZUA 2NW6A 2VJPA 2GVDC 4HEHA 1RRMA 3O73A 3OZUA 4MR9A 2ZCJA 2XB8A 1LS1A 3PLAE 4UULA 1N9ZA 3RT1A 4QPJC 5JMOA 2VK1A 3HVHA 4K40A 1QJCA 5LDHA 5M2QA 4F7WA 3D7SA 4ID9A 2YYYA 3Q3GE 1K4KA 3TW8A 3MWKA 1A9XA 2NO6A 3WKCA 1Z15A 4JP2A 1W5EA 4A15A 1OA1A 1CZHA 4TZTA 5FWXB 2WJZB 4P4NA 4YRQA 1L7XA 2NXCA 4GLLA 4I50B 1TTQB 1PS8A 2AEJA 1PP4A 3B6MA 4JUDX 4XIYA 5CW1A 5CVUA 4RWZA 1KETA 3RH0A 1SRRA 2GPBA 1SG6A 1OGYA 3VAZA 2R7AA 3QTTA 1D2CA 4V2UA 1Y33E 3SZRA 2ZPTX 2P90A 3M1LA 4QDTA 4BMDA 3AJEA 3HFSA 4BVKA 2VLIA 4KG7A 4TKVB 3S2FA 3KE9A 4RELA 1WMSA 4XVHA 3W2FA 2DEUA 4IMJB 3G2JA 4U2DA 2PWYA 3ROMA 3RYCB 1JKFA 2GH1A 3QK7A 1K5PA 1Z8FA 2FWBA 4YR7A 4AG3A 2ZJ6A 3EVNA 3TZKA 3G13A 5BUSA 3T4PA 2C5LA 2ZVQX 5A2QA 1AUOA 1U80A 1X14A 4D0RA 1GRQA 5D3QA 3KSDO 2JI8A 4Z4CA 1CUCA 1GZUA 5KHOC 3CH4B 3PI6A 3UKDA 2WDPA 3R5JA 1W29A 5ALQA 1UMCA 3UKJA 3ZWPA 4POOA 3COVA 2JI9A 4WLOA 1FPQA 3N86A 5IDQA 4YJGB 3EFBA 1N3YA 4LCJA 5K3CA 3M83A 1EUYA 3ZE7A 3RC9A 3CUWA 3T5PA 4HXYA 1NSYA 4QHSA 5I9TA 1LBHA 1UAGA 1WDTA 4IJ5A 1YFKA 1R0YA 4TUYF 3TLKA 4EELA 5I8WA 4UZFA 3RRYA 1IE3A 4K6FA 2J7KA 2GQ0A 4MW4A 5AHXA 3VDMA 5KYKA 3SQWA 4EDHA 3VKVA 7AT1A 1X7GA 2O8VA 2WT4A 3PZRA 4Q16A 1AKWA 2V7QA 5LSAA 3K6SB 4HB3A 1KSJA 1J25A 2PFSA 2QTCA 3MD9A 4TXNA 4YAFA 2E0IA 3UUGA 4LOKA 2I3ZA 4Q3BA 3VZDA 3G5LA 3B6JA 1KEZA 1UBFA 2LXNA 1AK2A 1L7OA 1ORRA 1CV2A 4BVEA 1AN9A 1NLFA 4WHMA 4FGUA 1F12A 2C99A 4ZAVA 3W4KA 1TQ2A 4MVJF 2IWHA 4D92A 3NU1A 1VJ1A 1NA5A 2NVOA 1E0JA 3HKEB 4WZZA 2DFDA 3E81A 1FUKA 6YASA 3E9QA 3ZBPA 2JBAB 3BB3A 3L0DA 1YVUA 5E6RB 1VMKA 2ZEJA 2H54A 3F4LA 3BX1A 4ZMRA 1Z9BA 3PTAA 4II7A 2P2CA 3I64A 3PFCA 3SVLA 2PL3A 1T9DA 2C2ZA 4FFSA 4JAVC 4G56A 1IOLA 1SELA 4RZUA 3GP8A 5HFAA 1RPAA 3TBKA 4CT0A 4D44A 1UC9A 3RG2A 1TD1A 4RLSA 4K9KA 1IM2A 3H4MA 3IJRA 4PYNA 2RKWA 1OA0A 3FGNA 4KXQA 5CTAA 3RFTA 4C89A 1QYDA 4FR2A 5JQGB 3CT6A 5C35A 4DIKA 1W9HA 2H7VA 2FW8A 1K8YB 2HLHA 3GMDA 2AXEA 1ZGBA 1JPNA 3GZ4A 3R0IA 3T0FA 4ZI2A 4ZK2A 1KMNA 3R75A 1DJMA 2PT6A 1EFPB 3OOWA 4HFRA 5B2EA 5I7FA 3MQFA 3JQ6A 2CBZA 4KR7A 4M1KA 1KAOA 2XODA 3Q7RA 3A1TA 1NF8A 3G82C 4HYEA 4FSXA 4TTPA 4RTKA 2WWYA 4RABA 2AOWA 4TV8B 4WJZA 5CDHA 4B3FX 4RHXA 2GAOA 2NO9A 2XRZA 4C4OA 4EZIA 4IWXA 1L5MA 2I4MA 1GD1O 1Y8QA 3VC1A 4A5SA 4KK3A 2PRIA 2EFEB 4EKEA 4Q3DA 2P2SA 2CNKA 3HJBA 4OXRA 5BYBA 5ECYA 1GIAA 5G02A 3PWSA 3UCEA 2VO1A 4NZ9A 3N75A 1L1QA 1FFGA 4RMJA 5JOQA 4ZHSA 3CLVA 2QBYB 1OU4A 1C80A 4YACA 3HXMA 1EQAA 2D0OB 2R11A 3H42B 3HN2A 3N1UA 4YMLA 3ZDDA 2ZT8A 3GA0A 3RRXA 4DVJA 2GXUA 4QRHA 4QDUA 3RADC 5LIRA 4HDOB 1TB4A 2XH8A 1BEEA 4JQYA 3AFMA 2I1QA 2IZZA 4MUXA 3PGMA 2C8JA 1LS6A 2TYSB 3CLTD 4MQ5A 2PMEA 2IF0A 2Q62A 3AVUA 4KIGA 4ZOQI 2HL6A 1ZJZA 1RMYA 4B09A 1GG2A 5BWBA 4K9DA 1MHPA 2X2PA 4TM7A 1JZTA 1YS1X 3P0JA 2ZOSA 3WL4A 5BSTA 4B47A 3U16A 4BGDA 1ZONA 2PGLA 2XYQA 4M0LA 2AFRA 2G7MC 4MB6A 2WIKA 1NR7A 3T7EA 3EF3A 2GPTA 1UPXA 1WQ1R 3D4LA 5JJBA 1J9ZA 3P4YA 4L4ZA 2BSAA 5CPFA 4YCAA 2E6KA 3C4VA 2ONKA 4MVJI 4Q9AA 3UV7A 2PJDA 1DNPA 3ZQUA 2NTVA 1QAOA 1RQ2A 3W2EA 4BNFA 4ZOBA 1IG0A 3UC9A 3ND8A 3ZJ5A 5BSHA 2JLVA 2ZXEA 1MV8A 2HNBA 2F3SA 3BKXA 2WJ3A 2DLNA 1JFFB 3O3MB 1G3IA 3L6UA 1AB6A 4NYMR 2HU8A 4LYAA 2OV3A 3QU4A 2O7SA 3OCXA 4AECA 2OKCA 1DCKA 4M88A 4LRWA 5EWLA 3L43A 1HSOA 1U8XX 1NIJA 4P7BA 3PHLA 2H17A 4GECA 5EJGA 5FAXA 3C4QA 3C98A 3F6SA 3EXAA 3WO1A 2P4UA 4C6SA 1K66A 4EJFA 1RHMA 3AO0B 3FDIA 3TO5A 1DFHA 2CLKB 3FMIA 2WIAA 2IU6A 1WMDA 3HKBB 2W00A 3NTUA 4WESB 4KHPB 5DLQC 2Q7OE 3AKDA 1ZBQA 2ZYIA 3HVRA 3T4EA 1F20A 4P84A 3NBYC 4RA9A 2FQYA 1NR1A 1GCAA 1OFVA 4UTRA 4LSGA 4NCIA 1EWYA 1Y80A 1ZXBA 3O8LA 4WKGA 1HA3A 3D2BA 5BP7A 1DT5A 4BECA 1X7DA 2WJHA 4ZI7A 3WNQA 1JEYB 4B6FA 2BSQA 3U56A 4BNTA 4LJYA 1F4PA 5A1TA 4UBLA 2ONCA 3CR8A 3DZCA 4N7BA 5SYAA 2B83A 1TCUA 2PZBA 4IDEA 4M9RA 3OQVA 2WYOA 1AHNA 4OKNA 1KSGA 1KBOA 1UJ6A 2Q50A 3NHYA 4YB8A 5HNKA 4B17A 2H2IA 2ZJ5A 3RFVA 4CCYB 2H18A 4R1PA 1LB1B 3ZU5A 3IT0A 4WK0B 1LPNA 4MV6A 5AMXA 2XITA 5DV9A 1K7YA 5TMDA 1E2BA 1RRPA 2F6RA 2YN0A 3JQBC 2H9AA 4MTCA 4WOPA 8MHTA 2QRGA 4MJ3A 1Q6YA 4BZPA 2IS1A 4X0EA 3OLVA 4O4IB 4AN1A 1CUFA 1J2YA 2OB2A 1I3OA 4HYTA 5EJ4A 2JLRA 5KREA 1SBNE 1KAGA 1WAMA 2XW6A 4INAA 4PC6A 4DXAA 2C42A 1YS9A 2EERA 4S1PA 1WCXA 1BH6A 4ARCA 4C0BA 3ZZ0A 3N6VA 1CZLA 1K7FB 1U65A 4MGYR 1NYTA 4M7WA 4R2IA 1X9IA 3EE6A 2X15A 4D9GA 3EUFA 1B2LA 4EFDA 3DMTC 4F7DA 4N41A 4CKXA 3SM3A 4MS3B 3T5GA 4XGKA 1DUIA 1OTHA 2JK0A 1TCCA 2JHAA 3FPBA 2PEZA 2OUKA 1POWA 2O3JA 2YVKA 3UW1A 2QMOA 4IZOA 4C4TA 1X1QA 2FI1A 2E3JA 4URUR 2P2ZA 4XJTA 1QQTA 1HL3A 1QONA 2G25A 4QKQA 3ABOB 1OD6A 1XF1A 5IYZF 1ZA2A 2VUUA 1GA1A 4FDVA 4D9JA 3NV7A 4Z2AA 3U6KA 1SG0A 2Y1LA 5GTDA 5EXXA 1H1LB 1EKXA 5EXSA 5UKDA 3U40A 3VZQA 1ZCZA 2F8TA 1NDHA 1OFUX 4J0QA 1I2BA 1N78A 2Q3LA 3B60A 3ZGYA 4XEUA 4EPXA 2HHCA 1LVUA 1U5BA 1K5DA 3P2MA 4M87A 3L9XA 3I8XA 1IZ8A 3U6BA 1EIZA 3WGLA 1SU7A 1PR1A 1P81A 4MQ6A 4TZ6A 3DZFA 1O77A 2MSCB 2R8PA 1PNRA 1Q15A 2ZYHA 4BO1A 4B35A 5H68A 4C0WA 2FPIA 4DLBA 2V0NA 3MN1A 4G1EB 2QA5A 1ZK0A 2B5VA 2ZXFA 2F48A 3AKYA 2DKNA 3KZVA 3WX0A 5JATA 1TMKA 1UBTS 1T1GA 1FP1D 1H4VB 2BI4A 4GE0A 3RC7A 4EM6A 2PYIA 1UJNA 4YDHB 4AS2A 4DIUA 1E2PA 1W36B 1Z17A 3MINA 3TE7A 4HWGA 2BFCB 1KZHA 4U8HA 3HJAA 5DHFA 2ZUDA 5EJIA 2JGKA 3C8UA 1Z5VA 1NNLA 1RXUA 3VSCA 1NC3A 2P41A 2HMUA 1C4XA 1Y9EA 1ID8A 1I6MA 2FDRA 5JAMA 5LD2C 1E2LA 3CH6A 2FX2A 1IONA 1U28C 2VSFA 4XQGA 3KIPA 3ZWDA 5CFRA 5JWHA 1XEXA 3ZCUA 3CLUC 2PD3A 3FCOA 3JALB 4TPKA 3GVXA 3VNRA 3K1AB 2ODWA 1V11B 4OJQA 2WB4A 5DGDA 1TI7A 2JCVA 5ADVA 5IAOA 4B3DA 1EGQA 4EG3A 4CIYA 1JKIA 3C7KA 4N47A 1YJBA 2R1UA 3NJ8A 2DETA 2HHHB 1VXRA 4JQSA 5BR7A 1MJHA 3MOGA 1AQYA 4L0MA 3ESXA 5GY7A 1GFSA 1N7HA 5HF8A 4C4RA 4Z3KA 3QG5A 3LXMA 4UXIA 3UOAB 1FUIA 3JV7A 4DCTA 5BV8A 3VSDA 5ALPA 3OLWA 3ECSA 2E6UX 3UCFA 4HLQB 2IOHA 3KOMA 4MLPA 3GA5A 4XGQA 4TT3A 5A5EA 3COWA 2OM2A 1K3TA 4UU1A 1TQ4A 1NMYA 4RS3A 3DV0A 1CJTC 2QX6A 4RYDA 3DXFA 3CUYA 5AM1A 3AVOA 3JQ7A 4DF3A 5K9ZA 4DUZB 3DO8A 4WNYA 1TFUA 2WW8A 4X1OA 1ACJA 1NRIA 2M98A 1UZMA 2VP0A 2DPYA 4A6DA 2RH9B 1AKQA 2PH1A 4L9AA 4Z0TA 1QH9A 2NPFA 1D1SA 1LU9A 1W93A 2D5LA 3DFUA 4KYTA 4MWEA 5FOQA 3A4NA 2VDPB 4MUJA 1R18A 1ZP6A 4G9GA 1X3SA 1VPEA 4N3GA 3MAGA 2A0XA 3DOEA 1HLFA 3NTOA 2IS2A 1O1YA 3NALA 3FWNA 1VG1A 2J6BA 1A69A 4F4JA 5HK9A 3QEMB 4RF5A 4K6KA 4A6PA 3S40A 1KC1A 3HA3A 1Z0JA 1TLFA 2O2ZA 2VHWA 1UL1X 3ZIAD 1G5HA 3CR3C 1NXSA 2HRQA 5EHZA 1QJ4A 3O2JA 4W5TA 2OAGA 1OLUB 4BY9E 1NBOA 1MLDA 3OQJA 5T41A 1F51E 1SQ0A 3H97A 3OIDA 3ZK9A 4MUMA 2OXFA 4NOMA 5JSHA 3ZHBA 4ZO7A 1KAQA 1HOTA 2GD0A 1VA5A 1VP3A 2GRJA 1LSOA 3LYLA 4D74A 1P1FA 1DKLA 4EABA 4LF5B 2G0NA 3ZC3A 4DJJA 2O52A 2WJGA 4FFPA 4EG8A 2GJAA 1WXQA 1X70A 1AMUA 2G5PA 4AJ1A 1BYIA 1TUBB 4Z4IA 4HEA1 2YJNA 3WGYA 2VDOB 5K01A 4FWTA 1JFSA 3B2NA 4OL0A 3T0IA 4XGIA 1HYEA 3PRHA 2CJWA 1YZFA 1OILA 2ASEA 1O97D 2JASA 3IEXA 3QVJA 4TL6A 1KZ9A 1FFBA 3M6XA 4YH1A 4B79A 1DZIA 5CA1B 4U7DA 1P8JA 2RGRA 4PINA 3GEEA 3SJZA 2YR0A 4IIFA 2XT9A 4Q7MB 2JGMA 4MJ7A 1LDNA 1U7XA 1ZL2A 2H65A 1V96A 4R0NA 1ELOA 4UDYX 3UBMA 1E5QA 1LI4A 2XTAA 3RARA 4IHJF 4B6OA 2XLCA 5KNBA 3IXMA 1QK4A 3LJKA 4ZO9A 2Q9AA 3GA7A 5DEOA 1EVIA 5A9SA 1K68A 4OX9B 2ZDQA 2J4FA 4FC7A 4DCNA 2IF2A 3CRMA 1VSTA 4F1WA 2CBXA 3EGCA 2IOFK 1WHTA 3LTEA 4WBNB 4Z4HA 1HT3A 1I4DD 3MSCA 2IIBA 1KYVA 1J4AA 3D8RA 3WNZA 4HDNB 4OMCA 1JNXX 3WR5A 2I2WA 1E4EA 3F5FA 3JY6A 4U6SA 3C85A 4J7CA 2H1VA 1F8FA 2OGUA 4X84A 3ND7A 4LJLA 3RUHA 4E09A 3A6HA 2EW2A 3CZMA 3K8OE 1F8YA 2QM7A 3M6WA 3KJGA 3FOEC 2V7EA 2BEWB 1FYXA 1JRLA 2AE2A 2EL9A 3QBTA 4I5GA 1XRLA 3TLEA 3JQBA 1DFIA 1H2RS 1KEPA 2W6OA 4OP2A 1E1YA 2G1AA 4LJKA 5THQA 1I3LA 4J91A 3AUUA 2AG8A 3H9QA 3RAJA 3O03A 3W7VA 4J7UA 4EYOA 1A1VA 3RI3A 2BWJA 5F2KA 5DM4A 1PWHA 4DB2A 4IOMA 1Z0FA 3NYIA 3PD7A 3BIXA 4E03A 5HX7A 1G6HA 1C1YA 1M2OB 3NS7A 4RIHA 3U4IA 5GAJA 5JANA 4GKAA 4WD3A 4MUYA 4EKDA 4YPOA 2WHEA 2P9QA 1X8XA 2VQ6A 2REOA 1X7WB 3I1IA 3L1JA 5FD8A 4FFNA 3B6IA 2UUOA 1M33A 4YMWA 3K0BA 4TV9F 2RB5A 2CD7A 2WINI 1DAKA 3IKVA 3LT1A 4TRMA 2Q41A 5FJIA 4TXHA 1XMXA 2BH9A 4E2FA 3GAAA 2XZOA 4DA4A 4TWJA 1XD9A 1N2HA 3DMTA 4Q9KA 3GQBA 2BMJA 2X9GA 2ZM5A 4KN8A 2DBZA 2PS3A 3L4BC 4K9OA 4BYMA 1N4DA 1R64A 1NXXA 3ES9A 1E9VA 2PS9A 3OX2A 4LDPA 4MV4A 4N7MA 5KMGA 2VA8A 1HFEL 1W88B 2VF2A 4HMOA 2IYRA 1DGQA 1ZUWA 2AC2A 1V47A 5DI9A 3DL2A 1DJOA 2H1IA 1SKBA 4R9VA 4Z7NB 2RHGB 3D5TA 5BN1A 1KQNA 3SWWA 1BWPA 4BAGA 3H1GA 3KHKA 4M37A 3U61B 1E3QA 1M1XB 2ZXUA 1OWPA 1RAFA 1NP7A 4A4DA 1A8IA 3L8CA 5AICA 2W48A 3D1LA 5E8RA 4AKTA 3CC8A 4H6VA 4JXJA 5DWQA 3ANYB 3BJRA 1NVGA 3DFFA 1SC9A 5B1SA 3TZCA 1N2ZA 1XZEA 3R74A 1B3RA 3LUGA 3K9QO 5LYJF 2UYGA 1USGA 4ZC1A 4YDQA 5IT5A 3BJMA 4QDXA 3ZHUA 1L4NA 5TF0A 5K4GA 1XEAA 4GOKA 1GA6A 2F4VB 3KCNA 3LVRE 2ZRMA 2CJFA 2CUTA 3QENA 2PUFA 1H69A 1SBHA 5ALMA 5TQ2A 1ZG3A 3TVYA 1EG2A 1UK8A 4N5NA 3JR7A 4QFBA 1P1JA 4IRUB 2C8LA 2GZHA 1QG4A 4DIDA 4XW2A 3DMGA 2D74A 3SDSA 5CIWA 2P2GA 2VSNA 2X13A 2XZDA 3L7BA 1RM4A 2JEZA 2YMPA 3DMHA 3NVMB 3KRTA 1WMEA 2RIPA 1NVMB 1ZN2A 2GNOA 4U7TB 3DPUA 4ZTUB 4S0XA 5ABPA 3GBSA 3OU6A 3KWJA 3QJ5A 4MA5A 3ROKA 1Y4UA 3SX4A 4CNQA 3A2LA 2WJWA 3DDZX 4Z0HO 5FBLB 1QIJA 1BJTA 4OF4A 4MOWA 3WGTA 1OBFO 3VU0A 4XYLA 3MMPA 2HDWA 1U7DA 4XFJA 3B7GA 1V35A 1YR1A 4CEIB 1U4OA 2I2BA 1IK4A 1Y7TA 2ZWIA 5AXAA 5ECDA 3DMPA 5C5DA 4RPGA 1LF0A 1ECBA 2EYQA 3OM8A 5A3QA 1ZAKA 4L3WA 1AO0A 2FA9A 3THYB 5JXJA 5I9SA 2OCYC 1JKMA 1YDGA 1VE3A 2WMDA 1IVNA 2ZTHA 1CQIA 3AVPA 2W9XA 2Z6VA 3IP6A 2RD2A 3DE6X 3L0PA 4NCXA 2HQBA 4NLLA 3SKYA 5I51A 4HGYA 4PLFA 2DY0A 3STYA 5KI6A 4DY4A 2R9VA 4FHCA 4PNHA 2GSDA 4AP9A 2ZSBA 4XARA 1LDYA 2W5UA 3ORHA 1JYEA 3NW9A 1RQ7A 3EFEA 2OYCA 2W6ZA 4BNJA 3A4TA 2CZGA 1FTQA 1T36B 3MEQA 2ATCA 5LDGA 4KAXA 2E9SA 1OWNA 2OBXA 4GOLD 4G8DA 5K3AA 4A1OA 4RSHA 5ER6A 1H6AA 1KAMA 5FBQB 3T9BA 4QJIA 3TQTA 4B3TB 4DR3B 1GGVA 2UXCB 3HO6A 2QZZA 4B31A 1DCFA 2KBFA 1S0UA 4OHKA 1EXVA 4NS1A 1MQAA 3ROEA 4ALMA 4H59A 3VR5A 1QF9A 3GJYA 4KO4S 3TH5A 1SVSA 5NULA 3NHJA 1PUJA 4E5KA 4CIVA 3OTWA 4BKMA 4Z4GA 2Y1WA 1YR7A 3GLQA 5CNMA 2FN7A 4BVLA 4RFVA 4KXYA 4BLOA 2IHTA 1A5SB 3PNYA 2R5NA 3AHGA 4DNPA 4X7BA 4LTNA 2AMVA 4C7OA 3TRIA 2ZWAA 4B6EA 1Z4MA 4JJEA 4FFLA 2FFJA 1HYQA 2X8AA 3BXOA 4MS4A 4KPYA 1E3IA 3VYSB 4HUQA 4E12A 1T8SA 2NZVG 5DM70 3ZGNA 4JWTA 4WY2A 1R0ZA 5B7NA 1CNFA 1LWNA 4AROA 1EZZA 4JIGA 4CKCB 1I1HA 5IBRA 2O7RA 5IJ9B 1WP9A 1Y4AE 2IEGA 3N76A 2JAWA 1UKBA 3KDSE 3OZCA 3Q12A 4UUNA 5L7YA 1ZEJA 4RZXA 1H6DA 3OA0A 4FIZA 2FLWA 5G0TA 1TKAA 2YVLA 2ZIFA 5CHYA 3I2HA 4B46A 2GBCA 2ZU6A 4PRYA 1SXJB 3AEXA 2ZQZA 3C15C 3EVBA 5EWJB 3RYIA 3RJ5A 1YZVA 3S2UA 4ZDKA 5ITSA 4A8JB 1LPAB 2UVQA 5K1ZA 2XX3A 4HY3A 1QHGA 5BWNA 5U9CA 2FLVA 2HK8A 1E5XA 3DXZA 2G72A 3JYLA 2KYRA 4A91A 1FDTA 2G76A 3BIFA 2POCA 3ITDA 3KTAB 3NIGB 4NEHB 3SHQA 3LKBA 1WXWA 2NYRA 2HKIA 4W8HA 1US8A 1ZK3A 3E84A 2ZVDA 3KAJA 2Z2JA 4UVIA 3I4FA 5KWIA 5HBRA 2FMHA 1JHUA 5A3SA 3INNA 2EWMA 2OGWA 3H16A 3ICPA 1H66A 2I9PA 1E1KA 5L4NA 4GI3A 2C1EA 1XQVA 4GLOA 5ENZA 1HDEA 1PGPA 1M2VA 3HE3A 4GHWA 2J8ZA 4OXYA 4C4YA 1M54A 5K8TA 2HQSA 2ADMA 2A14A 2DBVO 5D1NA 5ES3A 1J5PA 1QQBA 3OE4A 3TFQA 2P11A 1IHDA 2P78A 2X7JA 2KW5A 3ZWKA 2LVBA 3L6OO 4V03A 1XRSB 4C2UA 1ZCJA 1UXGA 3FNRA 4JLMA 1TE2A 4JWKA 1UWVA 4PSVA 4U2KA 2HWYA 1UQTA 4DNQA 2W2QA 2P2LA 4TRJA 1VPVA 3NUZA 1QGUB 3T7JA 1T2EA 4IVPA 1M2GA 4UBKA 4L5AA 2AK2A 5FTJA 5AQ1A 4EPYA 2CYCA 1W0CA 4IXWA 3WNBA 2ORIA 2WJPA 3DTVD 4OQDA 3LUPA 2R8RA 1NMQA 3I0NA 4P3NA 1RPZA 4E3WA 5SZJA 3FPHA 4JP5A 1G38A 1K8ZB 4G0MA 1T1IA 3HSSA 3B1FA 3GG2A 1MX9A 5LZ4A 3JASA 2BFNA 2Q1SA 5DGTA 3RASA 1G17A 1ECGA 4A0FA 4BEBA 4ND4A 2YDXA 1HQYE 2A57A 3ZQKA 2Z58A 4C7MA 5JNVA 2OXCA 3RSOA 1RLIA 4PVDA 4M89A 3HBNA 3PRYA 5L7WA 2IH5A 2CN1A 5KTOA 3HYSA 1J56A 2PA3A 5DBEX 4TZ0A 4ZARA 1E69A 5TVKA 1R9GA 5AK5A 3L40A 1BO6A 2JAXA 4PHHA 1ZNQO 2KJQA 2HIAA 1PZFA 1CB0A 5FBWB 2Y92A 3AU9A 4URFA 1AXGA 4HVLA 3IEVA 2FG5A 4V0KA 2PANA 3TW4A 2JJ2A 3LL7A 4FMBB 4A92A 4C04A 5BN5A 5DWVA 1KRWA 2JVJA 4Y98A 1P8AA 4NATA 4K2AA 4LYYA 3SGLA 1FDOA 4N5LA 3NGMA 3FTFA 3G1TA 1A9YA 1OX4B 3KXPA 1JJFA 2O6LA 1M5TA 3C5VA 3GGPA 3NDIA 4FVTA 2DTXA 4JFRA 5L3RA 1AKYA 3UCXA 4BIIA 1KU0A 3T1QA 3FA2A 3ZXUB 4RMHA 4Z54A 5DI3B 4JJZA 4BNUA 3W3AH 2EVWX 1PX2A 1WZNA 3FFXA 1X8KA 2VT6A 4QG7A 5CLLA 4M54A 4G0WA 1E2KA 2GEJA 1NAHA 3R2JA 3IR5A 2B4RO 2LIPA 3I45A 3PC4A 1WMFA 1SBCA 2PUEA 4X7PA 3V4FA 4CLRA 2QLLA 3DKVA 3DOCA 1I2CA 1BN6A 1DRUA 5EJ6A 3M70A 4LFAB 3QI2A 2MWMA 4DJ5X 1DKQA 1B8PA 4BMCA 1D4ZA 3F2VA 4V0ME 1U9ZA 3OWXA 2R6FA 4FIDA 4QODA 1T8TA 4QXOA 3VC2A 3H6KA 1N6RA 3A4LA 3R7LA 5JXIA 2C5EA 3VPHA 2R8OA 3G8DA 3MUEA 2ZJAA 3GEPA 3QH4A 4QLAA 3NDBB 3BD8A 3KOZA 5C1IA 2FB9A 1F7VA 1N2CA 4DM4A 1J0XO 3CH5A 1W46A 2IIQA 2ZP1A 5GOZA 3RNOA 2YZMA 4DW8A 1FRFS 3KYDA 2O06A 3KQNA 3GRPA 1NX9A 2DQYA 5JNRA 1OTXA 1J8FA 2H3HA 2CXOA 2Z3ZA 1PV2A 4HQ0A 2ZE5A 5HILA 4C03A 4U5XA 3KWFA 3QBJA 2MSDB 2YWFA 3HQ4O 3RHFA 5EIWA 4DDTA 2RE8A 1TTTA 1C1DA 1L5HB 1MH1A 2Q0SA 3HXPA 5FT9A 1BQ4A 1DSSG 2FEMA 2QDKA 1MEJA 2JGRA 3LQ4A 5EIOA 4GKKB 1T9KA 2HMYB 4MVJE 2GEFA 1H23A 4MVWA 4PF1A 3IODA 1KDTA 3HL0A 3MT0A 4H77A 5K0GA 4L85A 1G21B 2VPQA 2O1WA 4J6FA 4GM1A 1E2GA 1AK9A 1I6LA 2OHVA 2X5OA 3P9YA 4PFJA 1P4GA 2I1VB 3OLZA 3P9RA 4UMVA 1SXQA 4X20B 1JIUA 2RAPA 1ZOSA 3TPCA 1UBMS 5IT0A 3O3NB 1T3ZA 3ORFA 5AK4A 5BN3A 5J3JA 4CTNA 1RMQA 5CFNA 3ASVA 3QPVA 5F78A 2RGBA 2XDQB 4IXNA 4AWXA 3PBKA 4F1JA 1UOQA 3SU8A 4I1OA 4JOQA 4P7JA 3M9XA 3W3ZB 4NZYA 5HQ3A 1EK5A 1CVLA 2W8BB 3M6AA 1FSPA 2VBIA 2UVPB 3WK4A 3EDMA 2ZT7A 3HSKA 3F97A 1DAGA 4C43A 3JRWA 1RJGA 4A8HA 1CR4A 2OP1A 3V48A 4NPHA 2X1HA 2H52A 5CNJA 5B55A 1G2PA 8GPBA 1E7MA 1KXJA 2CCJA 4Z53A 1YB5A 3GUUA 3ETGA 3PU6A 4S12A 1Y6ZA 2D5AA 5LMUB 3TQIA 4J3FA 3TW6A 2WTBA 3OD5A 1AURA 1BMFD 1J24A 3WRVA 5E7MA 4H15A 2GCGA 4EOGA 2OQVA 5B4TA 4J07A 5K3BA 4PGHA 4FCVA 4RSMA 2FUKA 3NBAA 1V7ZA 4CQLB 1NBAA 1D07A 2J5RA 3EG9B 2OA0A 3Q8KA 4CG2A 3AV0B 1G9TA 3K7EA 2HWWA 2NQ8A 3CX8A 4MKZA 4R8SA 5EGSA 2IHVA 4AUNA 4HWKA 3EGDA 1WS6A 2V6JA 1W4ZA 3AEUB 4QRDA 3ZXSA 4C01A 1M1NB 1WB5A 2MYNA 9MHTA 4Q03A 4RPLA 2C4VA 7GPBA 1JU3A 3L0BA 4BNLA 1ZICA 2ZYVX 4N3BA 2FUG1 2I6FA 3OOYA 3TZQA 2V03A 3N70A 4HLCA 3MUOA 4NJMA 3IL2A 2A1TS 3P96A 4KSYA 1O9BA 1J0CA 5HRUA 4IIYA 5KPJA 2IV2X 4ZWNA 3FG9A 1BQ3A 3T95A 2VZ9A 3F6BX 2OO3A 1QHHB 1MRSA 4HDCA 4M0UA 4RPJA 3QVKA 1Y7PA 5DX1A 1XZLA 1NV8A 2JIPA 5BW4A 4C0LA 3GLFE 1P5FA 1A97A 2VRCA 2WAMA 3UHAA 4ATNA 2I22A 3AEQA 2VH2A 4GGPA 1FNDA 2XNSA 5G40A 4MJXA 2JNWA 4UBOA 2V6IA 3TB6A 3C1AA 3FZQA 4I4IA 4PLZA 1ZMTA 3A6LA 4NV1A 1CUSA 2XNCA 3CVWA 1R5NA 2ZM6B 2O7VA 3OJWA 1TF5A 2HJGA 3GIDA 3NOQA 4LXHA 1U3CA 3AR2A 3GJSA 5IBCA 4U2BA 1COWD 1OYOA 4MCIA 2I4TA 4BFUA 2FPWA 2OQRA 3IDFA 1BX3A 2JLCA 1NXWA 4KSCA 2L0XA 1OAKA 1XTBA 1U0RA 3HBAA 4HNRA 4MX8A 1TM1E 3ZX5A 4BEWA 5K3OA 3OOHA 1ONOA 4NCAA 4PZCA 3RW9A 4EFKA 1AN0A 1RWPA 2P1DA 3JD4A 4M83A 3EMKA 2GKGA 3FYSA 3CFYA 1NTOA 1R3DA 1J99A 4WXEA 1RTTA 4CM5A 4R1SA 1PT5A 5B5SA 4FE4A 1B7GO 3P0HA 2QP9X 5BXYA 4OB7A 5FPHA 3KV3O 3I30X 4HSEA 4KMMA 3AM4A 2QPAA 2YRXA 4C2BA 4GOOD 4ALKA 4D0NA 4JLVA 2D06A 1E7RA 2SKEA 1MAWA 2WFAA 3S70A 3AERA 5IG2A 3RFXA 2XGSA 1GLNA 2P6PA 1J00A 5JVDA 4DL9A 1S2GA 3NHSA 1R15A 3UATA 1IPEA 1K7SN 5FPPA 3CLKA 5CEFA 3QE9Y 3I6BA 1IEXA 4J1SA 2FOXA 2BFEA 2R6R1 5BN4A 4WBXC 4E6PA 4EHJA 3STTA 5C5CA 3P9XA 2YNMC 3NBQA 1QRAA 3ZCRA 1I7PA 1Y5IA 4O0LA 1HR0B 2HRBA 4MYSA 1E1RD 1Z34A 4E1AA 5AW1A 3UK2A 4ZEVA 2G5CA 2GBLC 2PKWA 1EGHA 1J7KA 1XDWA 2FPLA 2XGMA 2Z2IA 3IBCA 3OF2A 1QHXA 2VCYA 2YQ4A 1BEUB 1SA0B 3DOIA 1LV7A 2QMQA 2D2XA 4LV5B 5A4JA 5LJLA 3I12A 5K3DA 3G7SA 3SFVA 1T6ZA 3O90A 4H1WA 2BBTA 4J03A 2CSXA 4G1CA 3WDSA 2FF7A 3U7HB 4AFNA 4ZOLF 4BZWA 2YHIA 3LX6A 2ZJZA 1OYYA 3PPIA 4GDMA 3TLXA 2ICAA 3SBEA 2FUEA 5JT1A 4DR6B 1ZM2A 3A1DA 5KVCA 4CODB 1JT9A 3HP1A 2M6SA 4BWFB 2PMCA 3GLIE 2CDAA 3TK1A 1TEZA 3J81A 3MERA 1II9A 3LLVA 1UODA 4P93A 1CG6A 1JLHA 2GEUA 2OAEA 2WWIA 3GJXC 3QEJA 4JA0A 5ED4A 3N07A 2R6HA 3IEIA 2GXAA 3HMQA 2WF9A 1X19A 2XVZA 4YROA 5LR6A 2TRSB 2R97A 4IMPA 1WF6A 1PHRA 5CLGA 3WLAA 1RKXA 1JAXA 2JAUA 5C5IA 1S8OA 3AMVA 4K2HA 4JB0A 2CVZA 4BVHA 1JX6A 2PJZA 3PLRA 2C58A 1MORA 1NUAA 3A0UA 1KR2A 1MC8A 4X3PA 2QL5A 1JTFA 1H2BA 3CF4A 1EG7A 8OHMA 4EG7A 5LFAA 5LN1A 1OU0A 4EGFA 3HBJA 1JG4A 1II8A 4JUFA 1X7YA 2OHIA 3CX4A 3W6ZA 4NMLA 4WADA 5M34A 4WFIA 1AXEA 4DR1B 1NUTA 4NSNA 3OEEA 3Q9SA 3JPYA 1L5RA 2OHJA 4K87A 2H1OA 1QX3A 1MDFA 4FNAA 4MWZA 1PRYA 1U04A 3RIEA 1IM5A 5HGXA 4UDOA 1ENOA 2CV0A 2FPOA 4AY3A 3AGQA 1XLVA 2P75A 3TLGB 1XQ9A 4Q9DA 3VZPA 4ZMBA 3ZY6A 5CG1A 1ZOLA 2PX3A 4M1MA 4R2WA 2XMDA 1YQQA 3G2PA 4GBGA 2B5WA 4B80A 1P80A 2XUKA 3VX4A 1XZAA 4BKQA 3QNWA 1TVMA 5IT9A 2RBKA 2XIQA 3H87A 4I6GA 5IBQA 4ALJA 3MHPA 3DO5A 1W9MA 1FC0A 4Y9UA 1PJSA 3LDFA 1PZNA 5DYTA 4WT7A 1W0JA 1PS0A 4D2IA 2WSSA 3DTNA 1PK7A 2C3PA 2WA1A 2ZK7A 3OT4A 5KYTA 4GDFA 4F8EA 5ALEA 1NLZA 3QW2A 1X7XA 821PA 2WU4A 1XTZA 3PQFA 4E5DA 2QSZA 4OYRA 5LQNA 1ZOIA 3PNMA 4LZOA 3TL2A 1U8TA 3V97A 1QO7A 2E4XA 1WKCA 2EARA 3PE4A 1HE1C 1OIVA 4H7HA 4F2PA 3EIFA 1JEQA 2II6A 3UWMA 3CZQA 1GT91 4UC0A 3DDNA 2BIFA 4ENUA 2J3HA 3PT5A 4HF7A 2CNBA 3TTUA 1VB3A 1YFJA 3DO6A 5D00A 4A0RA 1KI6B 2D1YA 3EVTA 3AUSA 2PUGA 1FXUA 1VMDA 2ZUUA 3AFIA 4ZV4A 3NYRA 4Y6PA 5A62A 3NT2A 2YJZA 3KHSA 5JEEA 1XQ6A 4WVLA 2F9MA 3NXSA 5GOTA 2N42A 1PZHA 2PCJA 4I50A 1XQXA 4PR0A 2VPWA 1YZLA 3BORA 5CP8A 3D6AA 3I9MA 1U3TA 3FD8A 3EGXB 4FFBB 1ZPDA 2J4CA 1EPUA 5F2OA 3GNSA 3LC2O 2Q07A 1F2DA 4O2LA 5IX8A 1RAAA 2PH5A 2WEKA 2C2WA 3WLSA 1DC6A 1TO6A 3LA8A 4CLOA 1H0RA 3L05A 3PFNA 2OCGA 4G4SO 1AUPA 1X9HA 5E7JA 3ZZMA 3WRXA 1JR2A 4EPVA 1Q20A 5TNXA 1S8AA 4TKVA 4DRZA 1WE2A 4J1NA 2BHTA 3EC7A 3D02A 3IOYA 4PGFA 4I0WB 4A8TA 3RYCA 4H6WA 1E7YA 1VA4A 3KVNA 1T5BA 4M36A 4YYZA 5ALVA 2YH2A 5T6MA 3FLBA 3HCRA 2O1SA 2EHJA 2WTXA 4FDMA 5FWDA 4DLYA 5CBKA 4JI7B 1M2FA 3EXG1 3WA7A 4Q82A 1BU8A 5EHQA 2Z8XA 4FLFA 4EO4A 1AF7A 5KSOA 1Z5ZA 3I9FA 3RUCA 3VJKA 1K2WA 4FZ5A 4X1KB 4NNOA 5IHPA 2C84A 2GHRA 1OREA 3ZGVA 4DBVO 1QG0A 4JUBA 4AK9A 5BR4A 2D8AA 2R7LA 1J07A 1E0SA 3I28A 1Q16A 3FYUA 4ZOLB 3VR6H 1YACA 2XMZA 2IYYA 3HRKA 3KM0A 4OIMA 5CGZA 3JAKB 1UEJA 2ISCA 3FF4A 1EA7A 4P1ZA 4MWCA 4ZODA 1YR6A 3I73A 1KP2A 3IP7A 4MIOA 2H2HA 2M1ZA 3V80A 4FOOA 2G7ZA 1A71A 1GGNA 3X2FA 1NN0A 2IUEA 3FVRA 3ND5A 5AVJA 2FMFA 2FRVA 3JD2A 1C0IA 3P9IA 1V48A 4JS0A 1W4RA 2WTEA 5FB3A 1Z7BA 3IT1A 3PGA1 4DLRA 4E22A 1TMGE 4G1VA 1JI0A 2Q6VA 3TSCA 2WUVA 3K4QA 3BWEA 4C0KA 4CZ2A 5E38A 4EYKA 4Z49A 3K6SA 3ADDA 4XJXA 2HRCA 4YJ3B 3TM4A 3N8HA 3BRCA 3V4LA 2J0VA 3VPXA 3UK7A 1PQ4A 1A7JA 1CERA 4YP6A 4D9HA 1X8LA 3DPIA 2BPOA 5C18A 2WV9A 5D2CA 3B70A 3FRIA 5IKXA 2GFIA 3PQ8A 2E89A 5E95A 4H0NA 2XHEA 3JAMA 1T26A 2A78A 3AFOA 2JC3A 3CEPB 5D86A 3WBFA 4YRSA 3I8SA 5JI3E 1VSVA 2M6LA 1NHGA 5MN6A 2B4AA 5LA6F 4EPWA 4RL4A 4CMCA 1RPJA 4DGSA 1PSDA 1SIOA 2HJRA 3MYYA 4IRXA 5E6RA 4HC4A 5EGNA 3SDZA 5REQB 3CZ4A 3L8FA 4G2TA 3IV9A 4UUBA 3OLYA 1R1DA 1MQ8B 3DOHA 5CAEA 2QP3A 5SZHB 1P2VA 3FFTA 3DOJA 3L84A 4R9RA 1KO5A 2YNMA 4BMVA 2NSLA 3C3EA 1ZIDA 4WFKA 3SYMA 4ESVA 1R5OA 3KELA 3R76A 3GFSA 1AGNA 3COPA 4UM5A 3QWIA 3QEKA 2GBLA 2Y05A 5LZ5A 1RVDA 3RUEA 3QJGA 4QX6A 4DM3A 1FFEA 3EXIA 3F8SA 4Z9YA 2E4VA 1FJGB 4Q1EA 2GF0A 4JBWA 2R85A 4BQQA 3VR1A 3D3NA 1UBHS 1YNOA 2C04A 4Z7JA 3A7DA 3QELB 4UU7A 4IH9A 1N2GA 4KO8A 2ADFA 4RJLA 3C97A 2ABWA 4EECA 5H0IA 5JS7A 1EFPA 3JZIA 1GGKA 3RSLA 4C87A 2NQTA 1N5JA 2EX1A 2G8NA 1YIDA 2NX2A 2VXCA 3DVLA 4WVFA 2V9CA 1EX9A 5ITWA 3V32A 1ZNWA 5BRJA 3D0KA 1C7IA 1JMYA 4JXKA 1TA0A 2ZTUA 5F64A 2EV9A 4P80A 2FWJA 4TV8A 1A9TA 2DGDA 3KJHA 4EGCB 1RLTA 2ZI3A 3SC4A 5C8VA 4H3HB 4R2XA 3GHYA 4MUIA 1DV1A 3IAHA 4ARIA 1LPBB 5FOVA 2WFZA 4FGKA 1E6WA 1EFTA 3TTWA 1H94A 1MG5A 1AGYA 3JYNA 1E66A 1ZOOA 3OZAA 5A4KA 5FTLA 2G1UA 4H7FA 4KQIA 4J1TC 4QLOA 5F9MA 1YCDA 3ZW9A 4FP9A 4EUHA 4OHRA 2XY4A 4QJ3A 4MA4A 1WXEA 3DAOA 3FDXA 1QVRA 5AK3A 2O6HA 3AB3A 4O2BF 2ZTLA 3BJEA 3VPSA 5BVHB 5HIKA 1JB9A 2O05A 4ZRNA 4PSDA 4Q4JB 1NASA 5DBGA 5B58C 5F98A 1L5WA 3IBFA 2P3OA 1IUNA 4MI9A 3TOCA 1GPWB 4FHDA 1LNSA 4D9MA 5BYKA 2APJA 1XUOA 3KUUA 3SY8A 1T8WA 5JZMA 2PTGA 3X1MA 1A7KA 3E9ZA 1ATIA 4FT4A 1U6JA 4M2LA 2QORA 4LOIA 3W8RA 4CVNA 3VJLA 1SXJE 3AH8A 4YASA 2VZ8A 2EQ5A 2IU4A 1BS9A 1H2HA 1N6LA 2NU7A 2QX4A 4LBZA 4PCUA 4AYWA 2HA7A 5BW5A 5JPDA 4URVR 3IUNA 4ZI5A 4FFVA 5KZMB 4D81A 4CMEA 5JXGA 4B4DA 2E87A 1G7SA 1E4OA 2DH5A 3QNUA 1IOVA 4HQFA 1VIYA 1EK6A 1X1BA 2B3DA 2HBYA 2OORA 5DASA 4KZPA 4DR5B 1CY7A 2BCJQ 2VOEA 1EGMB 5BV7A 2IJGX 5IAKA 2IYLD 4A9AA 2YX1A 1QFJA 1S7GA 2A2ZA 3UPTA 1WB9A 1UMDA 3NNSA 1JPUA 5IH3A 1JFFA 1HM5A 4YT4A 4RK1A 3HJUA 4BJHB 1IEQA 2OCKA 1UBJS 2C5SA 4BWYA 5I9MA 1NSFA 4UCWA 2CVQA 3UWKA 3TKLA 4K3VA 1ZN9A 1TKCA 5KSPA 4F9TA 1KFEB 1QO0A 1ZD2P 3HM9A 2GNPA 4ZXFA 1LJUA 4ZXPA 2ZZKA 4HOYA 3D8HA 5KU7A 1SXGA 1T9CA 1VI6A 3M49A 4GP7A 4WOCA 3VR2D 5E2BA 4N3AA 3W9YA 3I0ZA 1QC5B 1K2VN 4GLJA 4G5GA 2R00A 2VXYA 4YJKA 3KOYA 3H0EA 4KVAA 1PW5A 4DIMA 4COOA 1PR4A 1LDEA 2AJ8A 3AF4A 4JP1A 4LCBA 3EIQA 5KX5B 1KJNA 2F9FA 3VR3A 2XA1A 2AOVA 5JHHB 4OHPA 3F7MA 4WESA 4BNXA 2AWNA 2YYSA 3ABSB 2P7HA 2VDRB 4I5FA 1RYBA 4M7RA 4ETMA 5JS6A 3DCIA 2YRWA 2MINB 4UFNA 4V24A 3ZW7A 2PAAA 5A06A 4KKXB 4ROSA 2NO5A 1C4WA 3L06A 3MTAA 4RFSB 2H1WA 3QUTA 3Q72A 1RRVA 3HI6A 4I2NA 4LK2A 4I1IA 3K9BA 1WV1A 2YWHA 3D4IA 3PWKA 4DXDA 2PSSA 1E2JA 2R8BA 2CF5A 3NWBA 4WKBA 1JEYA 1U2ZA 1Z4QA 1SC6A 2WZDA 3I6QA 3SQNA 3BHJA 4KUEA 1NVVQ 3D6HA 4YRBA 3CUEF 2LKDA 3D81A 1RQXA 3L41A 1F6DA 1Q57A 4LJSA 3PPWA 3CLRD 1SVUA 2A9QA 2WYWA 3HCWA 5TIIA 4CCYA 3S1LA 1ZH2A 1KK3A 4JI5B 4MO9A 1ZMXA 2EP8A 3WQHA 1HC7A 4GPIB 4G63A 3FWYA 3VNQA 1C9DB 5I47A 3L0SA 3RRFA 1OPRA 1TEXA 3NBKA 3Q1LA 3K6KA 1I0LA 1M2WA 1SVIA 4NBTA 1G66A 2IYSA 4IIDA 1KKMA 4O4IA 3KSBC 2Z6AA 1XMQB 4GMFA 5EQTA 1C7ZA 3LRXA 4I55F 3KDPA 2TSYB 5HZGA 1GHTA 1X6VA 2O5CA 5ESXA 2ZB7A 3EA0A 1XDGA 4RESA 5KDLA 3M3HA 1UPUA 1Q5PA 2B1JA 5A7FA 1HDXA 3OZWA 4G1MB 4W8GA 1TADA 4OY3A 1PFVA 1D5WA 1O8BA 4W9RA 5TGTA 1L7PA 2BEUB 1GSIA 4HDAA 1XNQB 3EWNA 1RYNA 1ZQ9A 5HM8A 3H6GA 3T3GA 1QHSA 3T5BA 4DLTA 1HG1A 4XPIB 3X3HA 1G3QA 2OXTA 1T2UA 1BXRB 3EGOA 1GYRA 3U4GA 3KE8A 2FMXA 4TKZA 3D6NB 3GFFA 4CIWA 1A8HA 2PZFA 2YIMA 4JX9A 3VR4D 1ECCA 1SKAA 2AXPA 4FTWA 1W76A 2YXDA 3D4OA 5MHTA 3IAS1 1Y3CE 2IP4A 3DEKA 4JJ8A 4ND2A 5DISB 5ILGA 4NCBA 4NAUA 2Y77A 1D7OA 3KSRA 1T6YA 1I4TD 1JQBA 2MSKA 1O87A 4I9GA 3VNBA 1ODTC 2KQUA 3C87A 3U2QA 3L0IB 1E64A 1B8NA 4O3MA 1V3QE 1IPFA 2C5AA 2FZVA 4I6EA 4IV8A 4YPFA 3RVOA 1RLOA 4LI0A 4HAVA 3TGLA 1VL1A 1JZSA 4JC5A 1U3DA 1XWIA 3F6PA 3T9DA 4B48A 1MVNA 2AOUB 1G6Q1 3ENVA 3QP9A 1GNLA 3V8RA 2XTMA 3WSVA 4B9EA 1E2NA 4QPZA 5FO0A 4OLAA 3EIOA 2ARKA 1KEWA 2FRDA 2HC9A 1DT3A 3A6KA 3O2SB 4N39A 1IZZA 5AKHA 1M2JA 2FZ4A 1NW6A 2PBLA 2QTFA 3GUHA 3OX4A 5EHNA 3TZLA 4GLFA 4FONA 1NW5A 4LF8B 2J5BA 2G88A 3DUFA 3NGXA 3OTQA 3R7FA 1PW7A 3RBVA 2AVDA 3TKAA 2YOFA 3NVDA 4BVBA 1TZ2A 1N8SA 2XWJI 4LNUA 2OB1A 4ENWA 2P9HA 4AKHA 2FEXA 5DW3A 3SQOA 1B0PA 3IQXA 4NMHA 1XP5A 3IUMA 3R5XA 4RCZA 1CVIA 1Z0UA 4F04A 2W71A 1TYCA 2NVBA 2OK8A 4IHQA 3U4AA 3WIUA 4P4LA 2VUIB 3ELDA 3VVCA 1E1NA 2BFCA 2XOXA 5F3RA 3SF8B 1G63A 4Q24A 2XT0A 2WFMA 2X42A 2OHOA 1QVWA 1E98A 3NP9A 5JNWA 1NG9A 1OWMA 3GFGA 4M99A 3C1TA 1F1JA 2YUTA 1RI1A 2QTAA 2FR1A 3OT1B 2OQIA 1J0AA 3TECE 1XDUA 1GLVA 1RCFA 2ESRA 3BWDD 3JALA 3PHHA 5FHQA 3K1AA 1XCBA 3PYLA 1L4MA 3TLJA 1V11A 5K3EA 3STXA 3W5AA 1OFTA 1ZVQA 1IBCA 2GLUA 1IQUA 4DR4B 3GZNB 3M5WA 2Q9UA 4L8GA 4NYJQ 4FMCF 2R6JA 2RHWA 3BWXA 4HZIA 4LHXA 4K88A 1YCHA 1QYRA 2Y8EA 2OG1A 4LVNA 2OZPA 4J1TA 1F2TB 4OXNA 2WQ7A 3MD0A 1VJGA 4H1UA 4F0JA 3ZKAA 4JB2A 1CJMA 1XP8A 1U8CB 2DUNA 3R0JA 1JAYA 3S8YA 1ZIYA 3QMWA 1RW4A 3ISVA 4V39A 2OGZA 4Z4EA 1SZPA 5G1NA 2E85A 1NMXA 2DYKA 4PU0A 4HP8A 1GZSA 4Q15A 3A1EA 4Y2XA 2OAQ1 3Q1KA 4AY5A 2WIFA 2NO4A 4EY6A 2HXGA 2X1MA 1OXBB 4UM7A 2V7GA 4W99A 1PJBA 3NH9A 2CFOA 4UAVA 4RE5A 1RZUA 1C14A 2O3TA 2OUIA 4IQGA 1DRWA 2BFDB 3ECCA 3G5MA 4K9RA 4ZYVA 1OGIA 1Y1LA 1F8UA 1T35A 4US2R 1JTEA 2O2EA 1YO6A 4K1XA 1T13A 2BR3A 1W4BA 5ECGC 1BXGB 1GPBA 4KQXA 3IOCA 4Y2SA 1S2NA 1F9AA 1CLEA 3G5TA 1ISHA 1BWRA 1FFWA 1UWCA 2PZGA 4H7EA 4PBTA 5DNEA 1ZVVA 3QEMA 3B13B 1AZWA 5CIYA 4DV3B 1M0TA 1C3XA 1NWHA 4G0PA 4QQ8A 3RSCA 1P7VA 3ELBA 4BFCA 3CQ9A 2FJ0A 1MA0A 5CFPA 2D00A 2PX6A 4I55B 1ZESA 3I2FA 1G2IA 1I2ZA 4R16A 3BRWA 1E3MA 1OLUA 1YVRA 1LD3A 1T5TA 2QW1A 2YYAA 4OHUA 1F6WA 2IXDA 5H7XA 2MYTA 2DSNA 4GD3Q 4GBJA 2MMGA 5IAAA 3GDOA 1FSGA 1A3CA 1ITZA 3PUVA 5T8KC 1GAWA 3BEOA 4JBLA 2R2AA 1JV2B 2WNIA 3Q8MA 1QH8A 4NBSA 4MK4A 1T3GA 4XSGA 1TUBA 5FWNA 1FSZA 1H65A 4NZMA 2ISSD 4OOEA 3GCGA 4DLLA 4OB8A 1ZXXA 1W5FA 5B3AA 1TVCA 2K6GA 3I52A 4H2DA 2B8NA 5E9QA 5K6AC 2ZR9A 4FMDF 3LUHA 4D6PA 3TLYA 1M34B 2CJXA 4NE7A 3V6LA 3WWEA 3I9KA 1QWSA 4XWKA 5JS1A 1SXJC 2HU5A 2JH3A 2VJMB 4WQMA 4A8JC 3AHCA 2N46A 1PR5A 3AR8A 5CJ2A 2V7QD 2R4TA 2PO5A 4QPPA 4R9SA 3L82B 2EG9A 2IYXA 3E22B 3SQLA 4AUEA 3KR0A 3VYRB 1JJAA 3D7MA 1A9ZA 4XSHA 4WBNA 1Z63A 1SMKA 2N75A 1YA4A 1THZA 3AONB 3AVTA 3OJ0A 4HDNA 3EGIA 4MKHA 1J8MF 3TTVA 4AY6A 4BE9A 4QTZA 1U7TA 1A4RA 1YI8A 4MWBA 2H4FA 4NH0A 4ARZB 2J41A 3BWBA 1JHVA 1MBZA 1XLUA 4ZU1X 4KDCA 1ZKDA 1CJUC 3SP1A 2GGSA 2ID8A 3OTGA 4Z3DA 3WZLA 4Y6RA 5H83A 1Q0PA 3BJZA 2BEWA 2VZ0A 2CLMB 3I2JA 5LUBA 2PKEA 1GZ4A 2B6NA 5GZ6A 4YIHA 4MQUA 2CFTA 4A2QA 1WZCA 3Q3IA 1DXQA 7MHTA 1V6CA 1T0PA 3KEOA 3L1UA 3L8YA 3VRHA 3MT9A 2NN3C 2BZ0A 3WXMA 3C41J 5AW0A 1Y7HA 1RE1A 4UATA 4KGDA 1B26A 4MVJH 1BDHA 1M2OA 1VM6A 3O9ZA 1T1JA 1G5QA 2W83A 3WLQA 1BX0A 5HWSA 3HP7A 4E1VA 1EWQA 4COKA 2QD5A 2HJWA 1KYIA 4C5CA 1V3UA 1X7WA 2VTEA 2UDPA 3KS9A 2P79A 2IL1A 3CS3A 3R9XA 1AD2A 3STUA 1CUGA 4FOLA 3W8FA 2DUMA 1TJ3A 2XIJA 5M7EA 2PXXA 2Q99A 1JE1A 3E18A 3C2QA 4PYRA 4ZZ1A 2WILA 3KEFA 3KPJA 5D87A 2FQWA 5K8LA 4P7KA 3FR7A 5DX0A 4FMCB 1XGKA 2NZ2A 1JXMA 2BVNA 2XNKA 2V9PA 4OQQA 5FIUA 2EKQA 3S81A 1AHIA 3IVGA 3O92A 4S04A 1SUEA 4FE7A 3PJFA 3K09A 1SU8A 2G3YA 2PMFA 4WY8A 4RMGA 1W88A 1AXRA 3FJYA 1FU7A 4FEEA 5JBIA 5JASA 1WZEA 1NRWA 4HQNA 4KV7A 4NWIA 4UM9D 4KWHA 1M1UA 2B82A 2HNKA 3M6UA 2IPNA 4YP0A 3U60B 4NU8X 1VMIA 5I45A 3OMXA 5LZ2A 4IIJF 1AOXA 1UJ5A 1JLLB 4HKTA 3KU1A 3SI7A 4JHXA 5HF9A 1P75A 1IQ0A 2EX0A 1N75A 3NHFA 3AZOA 2OO7A 1C9YA 4H4DA 3WIDA 5FL3A 1ZYUA 5HM6A 3H5WA 2VTVA 1T4CB 3KD3A 3DLHA 1AB5A 2GAJA 1RC0A 2ZIXB 4DJFC 4M46A 3MTJA 3IBTA 1KS2A 2MU1A 3HU5A 3PJDA 1BMQA 3OKAA 4L3VA 4XVQA 5BMVF 1M6EX 2Q5QA 3RVNA 4O5OA 3FUXA 5C51B 1M2EA 3VH4A 1QDLB 1N8TA 4UCQA 2Q3FA 4HQKA 4LF9B 1CD5A 3VOBA 1XEFA 5KVQA 3JARB 1IVSA 3A9CA 1A98A 3VSAA 1WSAA 1L5FA 1RYFA 3P94A 4DMMA 2JJMA 1F3OA 1DAHA 1GKIA 3OIFA 3W79A 3S7ZA 1B3BA 2BHNA 1C3EA 2ZR0A 1CUJA 4PO3X 4WTOA 5HR5A 1XDBA 3PEYA 4XI9A 1EVYA 3IPRA 4CE6A 2RMKA 3U9LA 5L7TA 4PHFA 2UZAA 3QE2A 2ZWOA 2HK7A 3DHNA 3QV1A 4FEGA 4M55A 1ADJA 5LLSA 1DRJA 4G0QA 4YMVA 1G6OA 2IQIA 2Y2UA 4MW5A 1USUA 2MIIA 1FNMA 1KNQA 2VN8A 3FUCA 4HRXA 5L3QB 5LLTA 3H2IA 3FI0A 5AVRA 3M3PA 2BM1A 3TTSA 4DILA 1Y8RA 4LPKA 3FTPA 2Q49A 2QSJA 1MT0A 4IDCA 4LYHA 3F5QA 3EXEB 5JPCA 3UM9A 1ZC4A 2KI5A 4NXNB 2DR3A 4XUEA 4JEUA 4Q7QA 1NZFA 3DDSA 4Q05A 1QV9A 4V3BA 3U4DA 2JRLA 4IHJA 4QWMA 3QXXA 4BO3A 5DRTA 3HKCB 5CCBA 5C32A 1YU6A 1BFUA 2VSOA 4AXBA 1A2KC 2QOEA 2W6PA 3THYA 4Y2VA 2Y9MB 1KZ4A 1CY8A 1UXOA 1SIWA 2VT2A 3MAJA 4GMHA 1MKYA 4CT5A 3RUIA 4MUNA 4OM7A 1GL6A 1OVGA 2VDWA 1EDOA 1OXTA 4XWWA 3E5HA 1EAYA 3AOEC 3EDRA 1GCGA 1KWGA 4UD6A 1T36A 4IO1A 1R00A 4FR5A 1IDN1 2IXEA 1WKVA 2R1TB 2I6TA 3GJ7A 4KODA 5F5NA 5BNIA 1Y48E 2V58A 3PYMA 1QCDA 5D7BA 3KD2A 3IHLA 3TRFA 1Z5PA 5COAA 1XTRA 2RAVA 3DQZA 4HAUA 5C7OO 3PNPA 4BC1A 2Y67A 4GI2A 3NGLA 1FPMA 1R27A 3R3XA 2VPXA 4MUHA 1YJXA 3CXRA 4S1OA 2IK8A 1GTMA 2QZPA 4QECA 4ZP1A 2Q1TA 5JSYA 4IBOA 1NT4A 2QAGB 3OH8A 5JMPA 1PZEA 1U8UA 4LHWA 3LW7A 4X45A 4XE5A 4ZRMA 1QWOA 5DNYB 5ICEA 4ZDJA 5T8KA 4NDNE 3KK0A 4GICA 4PFKA 3LIPA 3CLSC 2PVSA 2R84A 3P9KA 2CVFA 1P2DA 1IIBA 3VHRA 4JEHA 3ZU2A 4HJXA 2RGDA 3H3JA 4QAJA 3UJ3X 2YY7A 1NFQA 2VK4A 3V5NA 3OIUA 3ZW8A 2OFPA 2D7CA 5IJ9A 4R8VA 1E63A 1GITA 3R77A 3UMFA 5K6AA 1P45A 2QXTA 1Z0SA 2CJYA 4D43A 1U2PA 1BX1A 3KOOA 2HF7A 1SU6A 5ILQA 4G0XA 2FUCA 1SHJA 4FKZA 4U9UA 3L4JA 5EWJA 1SXJA 4QUBA 4B71A 1PVDA 3RS8A 1NTRA 2YZ7A 1G6KA 2UZ1A 4A8JA 3V2IA 3R5TA 2O8CB 1TVKB 2A0WA 4MVXA 1MQ9A 3E7PA 3W7BA 3OQIB 4IIJB 1UKCA 2OZLB 4XXHA 1AUXA 2XUOA 1RXYA 1BFDA 1VBMA 1ULZA 3D2CA 4U2FA 4HGOA 4YVFA 4ZT4A 3UYLA 3GEIA 2Y1DA 4RJTA 3G2KA 1OZGA 3H2GA 2FMTA 4D25A 3M9LA 5EJMA 1F8GA 1VKNA 2ODAA 3WHPA 1XTIA 2A9VA 2ZCVA 4MKFA 3O8OA 3UV3A 2XCRB 4K6GA 1PFQA 5LYJA 3LHIA 1I9GA 4F5YA 2B0JA 2GYUA 1YBVA 2QY9A 3E05A 4EL5A 4CKWB 1TCBA 5IAGA 3X2EA 1QIDA 1XB2A 5ITVA 2PDAA 3AX6A 3JWEA 1P5JA 3MBOA 5DSXA 3DE1X 3I5XA 2BT4A 2IXFA 2IYAA 3QVVA 4IVNA 1UMBA 3V1KA 1UDXA 1FUYB 2G1KA 4F9FA 1NATA 2A0KA 3B12A 5EI5A 1VPDA 4WJLA 2XT6A 4BNNA 3BILA 1FP2A 3OICA 1LK7A 2HN9A 3K53A 1X42A 3UAWA 1AA9A 4RV5A 3IHWA 3ELYA 7REQB 4B3CA 2IYWA 5I7UA 3IE1A 2JLXA 2D0PB 1BA3A 5LXTF 3KQOA 3ZD7A 4QATA 1DKOA 4KXMA 1QGUA 3BVPA 2QQGA 2Y1CA 1GAEO 2PBFA 3DWGA 2E5WA 1NI3A 3D0RA 1Y5MA 3OFVA 3ICEA 4EJ6A 1ZOPA 2YVQA 3AP2A 4RENA 1T6NA 1Z0AA 2P40A 3KZ1E 4EF6A 1O5TA 1RJFA 1KSHA 1TD9A 4J7AA 3VPGA 1K92A 1GG9A 4J75A 3TLMA 2EYUA 5A9TA 4ZAZA 1NYRA 2OFWA 3E3NA 2AMJA 2AJTA 2AXNA 2DMRA 2QJTA 3JZDA 1T5HX 2GYWA 2ZJ2A 4M38A 3STHA 3ZHCA 4Y1EA 5HVNA 2BM9A 4GO1A 5PNTA 2QKYA 3E9EA 4UTNA 2C2BA 1MB0A 3KETA 3EOBI 2O3RA 2OV2A 4IOJA 1KORA 1XWFA 2XB4A 2SBTA 4I5EA 4RM3A 5EPUA 3ZZUA 5LOVF 2O8FB 1LQTA 2OLJA 1J2JA 3KZMA 4IKPA 2ACKA 3OM1A 4BC0A 4F9EA 3LK7A 2P6UA 2EP5A 4LWQA 2UYYA 2VQ3A 4M22A 2J67A 2HD4A 3LQQA 4AULA 1GEGA 1X13A 5GM2A 1VZ3A 3HA2A 5JLJA 4TT3D 2I4RA 4UVDA 3VSEA 4V1CI 4JLUA 3NDRA 3TOZA 3KQHA 1PG5A 1P2UA 2AKEA 1OX4A 2JHCA 1ORIA 2FSFA 3JW8A 5DCWA 4ZEMA 1U4NA 1HFJA 3FR8A 4FFRA 4IJQA 1Q3TA 1UFQA 4B45A 5CXQA 1RYHA 5E7IA 4QOHA 3IPAA 1BN7A 4LDZA 4NPCA 1D04A 4QBTA 5AOAA 4QU9A 2YFQA 1DC4A 3UBTA 2Q9CA 3QVOA 4II2A 3LX8A 4WUVA 5GZ1A 2WYIA 1ZITA 3GDHA 3TG2A 3FRJA 3OKFA 1H85A 5BWCA 5HPYB 1N1GA 3ITEA 1SUSA 4UNPA 3BICA 2JFGA 3IBSA 4KXUA 1U8FO 4K05A 4MUAA 4PLYA 5JCJA 3QWFA 4U6NA 4AZVA 3CZ9A 4HUJA 1B42A 2ZIUB 4M9QA 3MF4A 5DXAA 1CZKA 2H0RA 3Q11A 1UP4A 3WLRA 2PZAA 3ZNQA 1NFRA 1PQWA 2FZEA 5TARA 1UQRA 4IIEA 4O8ZA 1Q1GA 2EFJA 1RWQA 1TJNA 4CU2A 5I7AA 3C7CB 4ZVNA 3DYVA 2BZGA 1NV9A 3TM5A 1L5HA 2GXSA 2JATA 3Q2IA 3TZEA 3KJZA 3TYXA 4CQMB 3GW8A 1EVJA 2WUDA 1F7UA 1GTJ1 2QQ5A 5J4YA 5JD5A 1XAHA 3OHSX 3L77A 2C2KA 4EZBA 3SE0A 4YCDA 1G21A 2FP4B 3LRPA 4DV5B 4QUDA 3O75A 2PXCA 1THMA 2PY6A 4YRKA 1DJPA 3R3VA 1FFXB 4G4IA 3Q85A 4YMTA 5KNBD 4LSWA 3OD1A 4QREA 4X20A 721PA 3P45A 1CB7A 1Y1RA 3OTHA 3AOEA 1LW6E 1MTOA 2B2XA 5A6SB 3NYQA 1KDOA 2XDQA 2FPMA 1ZW6A 4XDZA 1GUZA 1MOSA 1XNGA 2DUJA 4ZAYA 3FKQA 4P2BA 4CV1A 4WZ6A 1ZVKA 5C46F 4J3JA 1MX5A 2VHEA 4YJFB 3NUGA 2W8BA 4ER7A 1P2BA 4ZVKA 1CX9B 1TUGA 2UVPA 3WDLA 3TIFA 1P1BA 2WJ6A 2BMEA 2FYTA 3H83A 4LGMA 1V0JA 5SYNA 3SZ3A 2ZAOA 3ILVA 1Z0IA 3ZU4A 1UFKA 1Z07A 1XWWA 5FPSA 1ECJA 3P27A 2AFIE 3PCXA 1BCSB 1MF7A 2DWPA 1FFHA 3IE2A 3VV2A 3WL6A 4HH4A 4O2AB 3VPDA 5KYUA 1FQKA 4Z9FA 5LXTB 5H9WA 4GI5A 1R4NA 5F5LA 4V3CA 3EIWA 1EH5A 4NARA 1NMSA 1FYEA 3U3JA 5JDIC 3U7EB 4KQ1A 2D4AA 1IB0A 1DADA 4F5WA 3ZI0A 4CQLA 3EG9A 5F4ZA 2XB9A 2EBFX 1MMFB 1YJCA 1O0BA 2O2HA 4RHEA 1SHUX 5G41A 4UU0A 4QM7A 1CC1S 3PR2B 2QU8A 4WDRA 3OMLA 1RCTE 2NXNA 3AEUA 5IAEA 1WEKA 5EEGA 1M1NA 1L5LA 4ME6A 5JNSA 3GMSA 3AINA 3RVSA 4BQPA 2NUAB 4UTVA 4ANFA 4YRPA 5JQWA 5D8DA 4I6JA 4YJDA 3PHCA 1OE0A 3A58B 3ESDA 3DBVO 1I6KA 1CUEA 1X74A 3NHAA 3TUIC 2YTZA 4WE3A 3B6EA 1N2JA 5LQJA 2QIOA 1GARA 5LOVB 1ZI9A 3CF2A 4RGQA 1QV7A 3VPBA 2GD2A 4HLUC 1QHHA 1IY9A 2A30A 2J7PA 2P30A 3WMFA 3BG5A 1HSZA 3QKWA 3TSYA 4PWZA 2C2OA 5IC4A 4WERA 3WGMA 1GJRA 2DHDA 4N5DA 4QGAA 3L1HA 3VPCA 3QG1A 4E2XA 5IJAA 3HNPA 2QTBA 2HXYA 1BE0A 2C9ZA 5JZBA 1EFRA 4B9AA 4EW1A 1RJWA 2R66A 3IMEA 1IY2A 4JH0A 1ZUNB 3PE3A 4A10A 3PVSA 4RU1A 2ZJYA 4LSZA 1TC2A 3OPYB 1NNI1 1NX6A 4CMAA 3A1VA 1GZ7A 1ISFA 1U1CA 2D1RA 5KBYA 1YK1A 3ESRA 5HIIA 3ZE2B 1FZQA 1PJRA 4EMSA 3IDQA 4NFHA 2BTOA 4US0R 3CTPA 3KJIA 4HX2A 1E32A 2VDKB 3IOEA 3D8BA 3URKA 1QYVA 4MV0A 4L02A 3TQHA 4BBAA 3KQPA 1KPHA 1S8FA 3VYTB 2LDXA 3G2OA 2H4YA 3IR7A 3Q87B 4O08A 4DA9A 3DNFA 1SAYA 3PDWA 2CT8A 2ZSEA 1QXSA 4GL4A 3DHVA 3CN7A 1E94E 2QLTA 4GUDA 1M0SA 1FTWA 5TT1A 2G9UA 1SUAA 1S4QA 1ESNA 1CYDA 2J4DA 4KOAA 4HGZA 4R31A 4UHDA 3TVDA 4NG5A 5FFMA 3VBCA 1LFAA 4AU1A 4XFKA 1UT8A 5MF6A 3AKCA 3CLUD 3KSMA 2R8YA 2H00A 3MOSA 3HVUA 3AF2A 1YAHA 4NICA 2C3OA 4AM8A 3I58A 1JHZA 1CEEA 1E5VA 2I2XB 3WAJA 5EXDA 1R8JA 4E5PA 3IR6A 4EBBA 4D0GA 2AQ8A 3PTLA 3ROZA 2A1UB 3IUBA 3P20A 1IOWA 2X3FA 4CM4B 5K0TA 4J8PA 4A0SA 1KQFA 4FD2A 5KYNA 2PHZA 5LQDA 4MP3A 4Z6KA 4R9UC 1VPWA 1RHUA 3MAAC 4A0QA 3DLIA 4KUHA 1PI3A 4DMRA 2VTBA 3CCCA 4UQOA 1SA0A 4FSDA 1XZHA 1KDRA 3VA7A 4QDKA 4ZJPA 3DT8A 5F2NA 1R74A 4R0VA 2DULA 4NAVA 3TPFA 4BLRA 1U2TA 5F4BA 3ZR4B 1RQRA 5LP6F 1M2KA 3I9JA 2GAFA 1GWNA 2PPLA 3AZQA 4QPDA 4D3DA 3EPJA 3IOMA 4CFYA 3WGOA 4CM8B 4LF7B 1LVHA 3VU3A 1HO3A 4I5DA 5TB5A 3B3JA 3CGWA 3GJ8A 1PZXA 1MPTA 2Y0EA 4NEQA 1E1QA 4TX1A 2CL6X 5BNFA 4URWR 1FNSA 3H2BA 1HDGO 1KY5A 4O29A 4YP9A 2C0CA 5IZCA 1NHWA 5C4IA 1MQSA 1MJGM 2QV0A 3H1BA 3ZDFA 1VJCA 2W2TA 1Y8AA 3ZE1B 3BK7A 4DV7B 2IEAA 4KWCA 2YY5A 2B21A 5AVWA 3VR5D 3ER8A 3CNEA 4N7JA 4FB5A 1G2OA 4WW0A 1QF6A 4OAQA 1HGXA 4IDNA 4EVRA 4Z9AA 1WOYA 2O0JA 1YB1A 4UXJA 4MR9B 4TTSA 5EKXA 1FK8A 2Q2VA 3TI9A 1HDRA 1C3VA 2EC5A 4MAAA 2WMYA 4KIWA 5AJUA 5JWOA 1PR2A 5A0FA 1RRFA 2NSYA 2I6GA 5JSZB 5DK6A 3CVXA 4PYJA 4KQEA 4O0MA 3RIMA 4DG5A 5J2TF 3GK3A 1E6LA 4UTOA 2GF9A 2NU9B 4JLDA 4G24A 2R4UA 3EZLA 4OHCA 5F1OA 4M9XA 4YCSA 5DLEA 2GAIA 3H1AA 2C96A 5DYIA 2Q7DA 1QAMA 2RH4A 2YV4A 3FKJA 4Y7CA 1WB4A 3RVDA 1P5RA 4AO6A 1AHPA 1FCJA 1PU2A 3TLGA 3CISA 4CG3A 1V6AA 5C52B 1JU4A 3E1KA 3M6MD 1VYVA 4MUBA 4PWYA 3KJFA 2VT7A 1F4LA 3D64A 1AS3A 3FUVA 5CVDA 1U9IC 1MAAA 2CFCA 4ARSA 4NC9A 2X6TA 4QUJA 5EIXA 1XQWA 2JFUA 2O3UA 4H27A 4BN5A 1FU4A 4GQAA 1IATA 5CHEA 4YQEA 1PJZA 2J46A 2W43A 3LO5A 2PK3A 4RW0A 4QA9A 2BJHA 2FN9A 4TL9A 5HBGA 1QQAA 2J48A 3TD6A 4TMXA 3KTDA 3KYBA 2Q4DA 2WYUA 2D62A