2GAAA

Crystal structure of yfh7 from saccharomyces cerevisiae: a putative p-loop containing kinase with a circular permutation.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
353
structure length
326
Chain Sequence
VDTHKLADDVLQLLDNRIEDNYRVCVILVGSPGSGKSTIAEELQIINEKYHTFLSEHPNVIEVNDRLKPMVNLVDSLKTLQPNKVAEMIENQGLFKDHVEDVNFQPVKYSAEETAVVARGGTANAIRIAASINIAQIVPMDGFHLSRRCLDLFKDPQTAHKRRGSPSTFDSNNFLQLCKILAKTSLKVSSTSSVFEKLSKTFSQTIPDIFVPGFNHALKDPTPDQYCISKFTRIVILEGLYLLYDQENWKKIYKTLADTGALLVYKIDIDYEATEERVAKRHLQSGLVTTIAEGREKFRSNDLLNGRDIDNHLIKVDNIVHIRNDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and functional analysis identify the P-loop containing protein YFH7 of Saccharomyces cerevisiae as an ATP-dependent kinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
molecule keywords Hypothetical 39.9 kDa protein
total genus 110
structure length 326
sequence length 353
ec nomenclature
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07728 AAA_5 AAA domain (dynein-related subfamily)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gaaA00
1Z83A 3KUCA 3T15A 1ZP6A 1NG9A 3U3OA 1II8B 2FV8A 2VF7A 2XSZD 1RIFA 4L16A 3PEWA 1EWRA 4D25A 2WWFA 1XXHA 3K0AB 2QENA 3CX6A 4TQ9A 2PCLA 4GRAA 3ZD7A 4IVPA 4G5RA 4RKEA 4CEJA 2WTUA 3UXMA 2RGNC 3GLGE 5JSZA 4B6FA 4JVLA 4DEXA 1XD8A 2CCKA 4QHYA 5JFGA 4IFBA 2BMJA 4HYYA 1M34E 3V9PA 3C7KA 1GILA 3KQUA 2C5LA 1OFUX 2H1LA 4BECA 2FFBA 5IT5A 1GTVA 3FDIA 3FKSD 3THWB 2AXPA 1ZMXA 2Z4RA 2ZR7A 4LX0A 5AUOB 2N46A 1VCMA 4Q1FA 1Z5ZA 2MSDB 2FEMA 3DZDA 3RSOA 3RVBA 3TSZA 1XBTA 5L3RA 3CLVA 2XEXA 3U3JA 4EJSA 3ZLJA 3CF6R 3A1TA 5C46F 3IIJA 3LBNA 1IAQA 5EXSA 5UKDA 1FQJA 2C98A 1G8HA 5HE9A 1L7VC 4G5QA 4TWZA 4E03A 3RRYA 3VR6A 1CTQA 1TNDA 1O87A 1T8TA 1TQ6A 1TU4A 1TQ4A 2PH1A 1U0JA 2OCYC 4QC2A 3MJRA 4DDVA 3CW2A 1N5IA 1RRGA 4KJZA 3A1WA 4TL9A 1E2MA 3X1WA 3A1VA 4MKHA 2C9YA 1X1RA 4Z1MA 3D8BA 3RYTC 1R8SA 3TR0A 3QENA 1HURA 1LS6A 1KI1A 2HJVA 4QNMA 1G5PA 3SZRA 5SZIA 2YJTD 3VU9B 4DHEA 3SDZA 3SE0A 1E32A 1XJCA 2BM1A 1KO8A 2GBLC 4TYYA 1GL6A 3ZS8A 1AKYA 1YR6A 4A0HA 1YHNA 1TEXA 2B7CA 3C5HA 3RS3A 3UWOA 2JGNA 4TYWA 3A8TA 3UMSA 1D2NA 4YC7A 1N6KA 1TQDA 2B7BA 2NO7A 3Q7QA 2P6UA 1BMFA 1TPZA 2GCOB 2A30A 4D6PA 1E9EA 1J99A 1F2UA 4Q01A 3FMIA 2Q9AA 2CCGA 3DKVA 2MSCB 2XITA 1R0WA 5GJCA 4YXWA 1E9SA 1R5NA 3UK6A 1XWIA 1OKKA 1XD2B 4PZLA 3ZGXA 3AVQA 1R5BA 4EFNA 4EPRA 1A4RA 1N3BA 8OHMA 2A5JA 4ILEA 3LQRA 5JHGB 3GLFB 2FJUA 3AF1A 4NYJR 3SS8A 1SXJD 4BFSA 1KDOA 1G9XA 4RD3A 2Z5FA 5JS7A 1XXHB 3K0AA 4POAA 2QPTA 3SFVA 2LKCA 1P2UA 1KGDA 3P1JA 2D74A 2J0UB 5DSZA 5FPSA 4N3NA 4YMWA 3RANA 5FL3A 5FTNA 2CVFA 4LZZA 5EQTA 4UNNA 4RZUA 1J70A 1MRSA 4DLTA 5HTKA 3NEYA 5FR1A 1Q44A 3OIVA 4JS0A 1UBGA 1N5JA 3UG6A 5JEDA 3KB2A 5A5GA 2RGCA 3ASZA 1B0UA 1BH2A 1WP9A 2HV8A 4CT4B 3ZZ0A 1WCV1 3RDPA 4NYIR 2ZS9A 3AKYA 4FMCB 1E79D 3JZAA 3PG5A 1J7KA 3BFKA 1E1QA 3EIHA 4NU0A 5FBLB 2J0VA 3FHOA 1Q57A 3L82B 4PO8A 1KYIA 3NHBA 1W0KA 3ETLA 4I81A 1LFDB 3J81k 1CLUA 1VMAA 3F8TA 1AN0A 2JAQA 5EE9A 3WHKA 4AKGA 4A6XA 1KDPA 1L8QA 2ZE6A 4IVRA 2J0SA 2F9MA 2HJGA 3BWDD 1G17A 1NL3A 2OT3B 2G77B 2QQEA 1Z07A 2V1UA 1G7RA 1Z8FA 2VSXA 4UQOA 4B6EA 4DIEA 2YC2C 1WXQA 1U94A 3DMDA 4E07A 1P6XA 4AYTA 3NKVA 3HR7A 2ZJ8A 2GKSA 4D4LA 2DYKA 1EFCA 1KZ7B 4Q9KA 4BEJA 1GL9B 4W5WA 1Q21A 2OCBA 2JLWA 2D2EA 3FMPB 3VR4A 5L8VA 4MGKR 1XJ0A 2ATXA 4L4UA 5H1YA 1RRPA 2BCJQ 3CZPA 4BQSA 4AK9A 4LBVA 4BFTA 5ELXA 1DADA 4BE7B 3EWAA 4OQNA 3N5CA 3K8YA 4A2QA 3RRMA 4WW0A 4PC6A 1E2HA 1S9HA 3CRW1 5CK4A 4XTRA 2FFQA 4KLZA 1N6HA 2DWQA 2VHCA 4Q4JA 3AKEA 3BH7A 4Q4JB 4WBSA 1S8FA 3P4YA 2XX3A 1V43A 1T8UA 2F3TA 5JWRA 1OIXA 1DAMA 4HAUA 3IILA 5JJKA 1N6IA 2D4HA 4A2PA 4TL8A 4DLWA 1L4YA 3C5CA 1QG2A 5IK2D 2GAOA 1K5GA 421PA 1KIMA 1SKQA 3QEJA 4ZDIA 1DPFA 1SVLA 5AJXA 3KQKA 4LHVA 1ZU5A 1HEIA 3W6OA 3LX5A 2HXSA 1GNPA 1S2MA 2Q3MA 5TDHA 4QGHA 4UXIA 4IVQA 3RS4A 5JEEA 3KKNA 4ERNA 4PC3A 5AUQA 3WY9A 4AG6A 2RGAA 1GWNA 1T3HA 1J90A 3RRZA 1TF5A 1MR3F 2WKQA 4KAXA 4ASUD 4F92B 5EXPA 3NDBB 4OHYA 5BN5A 4GZMA 3SR0A 4DUGA 3SYKA 1P9RA 1E0KA 2GK6A 5JMTA 1A82A 3B85A 1E2GA 2GETA 1DS6A 4LWZA 3QSYA 4XH9B 5CDFA 2JA1A 5CK5A 5DISB 2ZRKA 1E2NA 1U0LA 2O8CB 2XB2A 4TMXA 3VX4A 1P9WA 2WJJA 1RRCA 4LJ7A 3O8RA 3CPJB 1UF9A 2J7PD 3QOFA 4NYMR 1QHNA 4RFSB 5D3MA 5FUXA 3W3AA 3LVRE 1LB1B 3K09C 1OIWA 3K9LA 2JLUA 2XGJA 2BHRA 1RZ3A 4FN5A 2JJ1A 3T1TA 2IYQA 3L0PA 2CNWD 2ONKA 1X8KA 4JLVA 1JR3E 1CR2A 3BOSA 3V00A 1MABB 1YE8A 5LD2C 5M04A 3I8XA 1JPNA 1ZRHA 1R6BX 4B35A 3MMPA 4WA7A 3K70D 4LYAA 3MWLA 3LXXA 4XVUA 1ZD9A 1MKYA 3IQWA 4IFEA 2G6BA 4NP6A 2ZANA 5JI2E 4D0NA 3D7MA 4PX9A 4RD6A 4KFUA 3GJ7A 2WZQA 2BM0A 4CGZA 2OFOA 3MFYA 1SHZA 3QG5A 2JDIA 4B3CA 1UDWA 4DDWA 2YNMA 1RJ9A 3QI2A 1EFHA 3N2IA 4P4SB 3AP3A 5TMPA 3KQNA 3QKSB 4PPGA 1W2GA 3WYAA 4KU4A 3GLGA 2Q0HA 4PSAA 5GJBA 2WICA 4UNQA 5E7IA 2ZI7A 4G5GA 1QRAA 2JLYA 4JVNA 1U99A 1T4GA 2BBTA 1CXZA 4TL7A 4UJ3A 5C2JB 3MCAA 2J46A 2N1BA 4JT4A 4C7OB 2HEIA 2O0JA 4Q4HA 1ZCBA 3CH5A 3CPHA 1ESMA 5KOYA 4QJ4A 3U4QA 3GMTA 3ICQB 1I2DA 4JYBA 1P72A 3SHWA 2ZJYA 4QBIA 3WRYC 1JNYA 4Q5IA 3TNFA 3LQQA 2ASEA 4Q9LA 3K53A 4IHQA 1XP8A 2CLSA 1XB2A 3BD9A 2PBRA 1NF3A 4A0RA 1W46A 2R44A 2O8BB 3AVYA 4Q9JA 1N6OA 2WOJA 4MRVA 4C0HA 3THOA 3SEAA 4PO9A 1G6OA 4RD2A 1E2JA 4BASA 1W36D 1JR3D 3B1VA 1UJ2A 3EZ7A 2CK3A 3NBYC 2QNRA 1W1WA 4X8LA 3OHMA 3EZFA 5C1BA 1E9CA 3N2EA 5HCIA 2QQ0A 4TMWA 4F91B 1JB1A 4A36A 3FYHA 3ZVLA 3QPWA 2G1KA 3X1ZA 1MOZA 1Z0FA 2QAGC 3QXXA 3EX7C 5JCZA 1ZUIA 2NPIA 4V02A 5HE8A 3ZIAD 3WNBA 3BC1A 5L3VA 1YZKA 4YMSA 1P75A 3LXRA 3CH4B 1RJ9B 2KB0A 1N6LA 1CS4C 1KAGA 3C41J 3T61A 1ETUA 4Q00A 3WYGA 4AYWA 1OJLA 5LPNA 2IK8A 1E9DA 4U7DA 4OBEA 1R0XA 3CZQA 3RHFA 1UKVY 4CEJB 5CITA 3FPAA 4LUCA 2CE7A 1CULC 3KFVA 3KXKA 2ZI9A 4WZ6A 3U6BA 3WMEA 1HA3A 1X3SA 2C77A 2V7QD 4PQFA 4GOXA 1TF7A 4DLUA 4A8JA 3GQBA 4DDUA 3EPKA 4B43A 4HAWA 2ZUBA 1HY3A 3GLHA 4DB2A 2VHJA 2RKOA 1NSFA 1UDXA 2ZRMA 1GNQA 3OIYA 4LV8B 1BKDR 2JJ2D 2RGEA 4P4SA 5DI3A 5AJYA 2JLZA 4PANA 4V0KA 3AF2A 1D5CA 5CYOA 2NZJA 1XPOA 4HZUB 2VP5A 2ZRDA 1R10A 2C03A 5CB6A 1W36C 1GKUB 4M53A 3W8RA 3M0EA 3TE6A 3X2SA 3DOFA 4L9SA 3I92A 1HT2E 5FI1B 1BYUA 2IHBA 3CNLA 1AS3A 721PA 4PSVA 2QN6A 2WMOB 1S96A 2QGZA 1DELA 2EYQA 3S1AA 4CRWB 1JI0A 3OIUA 4KI0A 4W5JA 4JT2A 5H8WA 2Y8EA 3GJ0A 2FSFA 2P5TB 2PL3A 2AD1A 1Z0DA 2NTYC 2D3WA 4M8NE 1IN7A 2F1HA 5FTJA 3OEHD 3W90A 4TTPA 2J3EA 1OH6A 1DTSA 4YDHB 5EZ6B 1HV8A 3ADDA 4QM6A 5F9FA 3K0SA 1KSJA 2DWOA 4GBMA 4MGZR 3CKLA 3GJ4A 4PPQA 1GIAA 1TEVA 4L8GA 2R6FA 2ZM5A 2CEAA 5TVKA 3M6AA 1WBBA 4ZIRB 2YINC 1Z0IA 1J8YF 1HYQA 1NI3A 4DLXA 1UPTA 2CL7X 2JATA 5L3QA 4WAUA 4Q1DA 2YKGA 4G3XA 3GLIB 4RD1A 1FMLA 1W44A 2C2HA 1OFIA 2G9NA 4DC9A 3GPLA 3O47A 1E2PA 4R7ZA 3PUVA 1UKYA 2EVWX 2VO1A 3AM1A 2B8TA 3MJHA 2MSEB 3A36A 4X8OA 2ZYWX 3AF3A 2HXYA 3K09A 1IY0A 4A1FA 5J4VA 2QAJA 1RE0A 1NLZA 2C96A 3LV8A 1WBDA 1QHGA 1A1VA 2CBZA 5DGXA 2PX3A 1SVOA 1VCOA 2V7QA 4C0LA 1XX6A 2YYZA 3KUDA 1AK2A 4WOPA 4NH0A 1EX6A 2FX3A 1GKYA 5J5CA 4AC9A 1G5RA 1KDTA 1DARA 4A4DA 3I61A 4JSTA 2WSSD 4TT3D 4YDSA 3PFIA 4MKGA 3W5JA 2QT0A 3PUYA 2AX4A 3SYNA 3NG1A 1M7HA 1IY2A 821PA 3RS7A 4AURA 2W2XA 4RD4A 3CPEA 2J87A 1C1YA 1PVOA 4RCZA 1IHUA 2W58A 1JR3A 4PAMA 3DKPA 4B44A 2ZTSA 1HH4A 4LOAA 4E09A 1ELOA 1YU9A 2TMKA 3EC2A 3MD0A 1VCNA 3CO5A 4Q4LA 4PXAA 2GVDC 1XEWY 3MUFA 2PJZA 1D9XA 4QFMA 3GEHA 4B71A 3AUXA 1XTJA 5DH9A 4UXJA 1FX0A 1XMVA 2EFDB 3W3ZB 1KMQA 4LSGA 1G3QA 4W5HA 4B3XA 4ZO4A 3W5IA 4DLVA 2QMEA 2BBOA 3KX2A 4KSCA 3RWMB 2QU8A 2A5YB 3I1FA 3L43A 2VQSA 1FW6A 3L0OA 4LI0A 1XRJA 1E2IA 2LWIA 2OEPA 5E3HA 2O0HA 4URXR 1ZIPA 1W48A 4CW7A 2QUZA 2IYVA 3EASA 4XWAA 1AS0A 5FUWA 1E1RA 2YC4C 1OB5A 5JRZA 1NLYA 2CHQA 4LV5B 2ZU6A 2QE7A 4YONB 1SGWA 4JLJA 4EPWA 3B60A 2WPDA 3VNVA 5EUQB 4MKFA 2N42A 3V4FA 5J40A 3TH5A 1TUIA 2WBLC 5EJEA 3ICEA 3EWSA 4F4IA 2GCNA 2E87A 3DL0A 1DO2A 3QBVA 4PAQA 2CL6X 2O8DB 1IXRC 2CMKA 2QA5A 1W0JD 2YHSA 4LYFA 1JJ7A 1K8RA 4W9MC 1GM5A 1G20E 2AKYA 2IYRA 2VTKA 1AKEA 2YWHA 3ASYA 3BB4A 5FPTA 4D4JA 4OYHA 2OBMA 2PEZA 1US8B 5EZ5A 3EPLA 4LDJA 3T5DA 3U7EB 3JZMA 3WRXC 1PLJA 3Q3JB 3FGNA 1IN6A 4M1OA 4M1YA 5TARA 2VP0A 3AF4A 2JLXA 1M6NA 2ZR0A 1VDZA 4C0AC 4MUAA 4Q1EA 3ADKA 2F6RA 2J0UA 4S35A 4UNPA 2QPAA 3FMFA 4TLDA 1L4UA 3OZXA 2RAPA 1X6VA 1KMHB 2HLDD 1UAAA 4R2IA 4TL6A 1JQLB 2A5DA 3NTUA 3SN6A 4ZI3A 2GEVA 3VR5A 2Z6VA 2ODEA 1ZNZA 1G3UA 4F38A 2OFXA 4DT1A 2GBLA 5D3QA 3B7GA 4TZ6A 1IBRA 1NIJA 1X8JA 3AQ4A 1II9A 3QE0A 3IBYA 3KKMA 6Q21A 3KTAB 2F43A 4V0OA 2JCSA 2J7PA 1HQYE 4MRNA 4HLQB 3IIKA 5CM9C 4LJ4A 4M9SA 4XD7A 4ZDKA 3TSOA 5HZKA 2FN4A 2JLVA 4TYPA 3KQLA 4PHFA 1C4OA 2KBEA 1P7CA 3FKQA 1KK3A 4XOIA 4Q7JB 5JJIA 3KKQA 1S9DA 1OKKD 5J4HA 5G41A 3NVAA 4B32A 1W2HA 1TF2A 2RMKA 4D0LB 3ZD6A 2AK2A 3ND9A 3KTAA 3VFDA 2XJ9A 3QBTA 1XMJA 4DJTA 2O8BA 1JJVA 3U44A 2IUTA 4AD8A 1U0HC 4GOKA 4BWYA 1Z08A 3GLHE 3K0FA 3LRPA 2CHGA 2NMVA 3VHLB 2W6JD 1EESA 3NH6A 5DHFA 5EXXA 3TSWA 1MO3A 4IEIA 4OI2A 4QHSA 5FOTA 4O0MA 1VG1A 1NG1A 2A7QA 4HUQA 3SYLA 4IKEA 2AK3A 2BKUA 1KK1A 1VIAA 2A5FA 2DBYA 4K46A 2V6IA 3GLIE 4MRPA 4DLRA 1F6BA 3I8SA 4F93B 2V6JA 1J2JA 3IQXA 3LW7A 4DSOA 1S4QA 3GLFE 1P2TA 3B13B 4B48A 1TX4B 2GXSA 2WWHA 4R9UC 1R2QA 2XXAB 2FFHA 2CLCX 1VG8A 4FMCF 3RNLA 3GLGB 3TK1A 5KSYA 3B78A 2O8FB 2ECKA 4HATA 1P3JA 2CDNA 2VHTA 1CJMA 2RHMA 3X1XA 4IDQA 1Z6XA 1WMSA 4TQUS 4JIMA 1KI3A 5KTYA 1E94E 3GEEA 5FL7A 1G21E 2HF9A 2ODWA 2WWYA 1R4AA 4QBHA 3NHAA 1NVUQ 1XZPA 1ZNWA 4TZ0A 4KO8A 4DCVA 3GEIA 1QHHA 4GFDA 5DI3B 2RGNA 4B47A 2GXUA 2UZIR 1Q1BA 4HZIA 3BH6A 2VL7A 3O8BA 1DAEA 1DOAA 1FNMA 1AQYA 1NIPA 1CR1A 3TAHA 5J47A 4NTZA 4MYTA 1YJ5A 1NY5A 4B3GA 3HDTA 2KE5A 4ASUA 2VIIA 2H5EA 1SXJC 1Z0AA 2D7CA 2IW3A 1M7GA 1SVWA 1LS1A 2QORA 4Q02A 1Z6GA 3ZZUA 4QJ3A 3FHTA 1Z47A 1G7TA 1II0A 2V55B 4NCNA 5EP2A 4XIGS 2GESA 5GVRA 3E1SA 1F48A 4Q1CA 3QKTA 4LHZA 5KDDA 3BGWA 4KSBA 5D3MB 3X1YA 2DCUA 2CK3D 3RS2A 1EFRA 3ZDQA 2V54A 1P60A 2ZIAA 4HUQB 3REGA 5P21A 3LDAA 2AXNA 2PX0A 5SZKB 2IWRA 4Q7KA 4HB0A 3TQCA 4CEHA 4LJ5A 2OCAA 1WRBA 3GJXC 2PEYA 1Q20A 2W0MA 4ZIRA 4BEBA 5B58C 5F98A 1LY1A 1NKSA 2XZPA 4P3YA 4BLQA 4DXAA 2QMHA 4H1UA 3KJIA 3BJIC 2ZETA 4P33A 4EJSB 4PZZA 2FSHA 1U9IC 1IXSB 1Q0UA 4FIDA 4C0QC 5FFMA 4RD0A 1WF3A 1G4AE 2WJGA 5K8IA 4J0QA 2WJIA 4A8JB 2X8AA 4M1KA 2REBA 3FHCB 5JS8A 4C2UA 4CF7A 3HYRA 4XWOA 4XJXA 1IXZA 3PR1A 2V4ZA 4N1AA 4URWR 3R7WB 2ZI4A 2E9SA 1ZM4A 3KL4A 1SXJE 3LFUA 3S1AB 1FP7A 4C0JA 2CL0X 1MT0A 4Q7MB 2J0QA 2QPOA 3EC1A 1D2MA 4HB4A 1ZM7A 2AN9A 2W83A 2OESA 3D31A 3PEVA 2WAXA 2ZI3A 4BLTA 2GHIA 5K8LA 2ZREA 1XTSA 4PQRA 2VP6A 1KSGA 4BGDA 4OJQA 3EXAA 2ZRFA 2ODNA 4NMMA 1FL9A 2Q6TA 3OIWA 3AVOA 4URUR 1AZSC 4IXMA 2AR7A 2GDJA 3GLHB 5KPJA 2BMFA 3T34A 4Q7LA 4LV6A 1GZSA 4KBGA 1W47A 1I2MA 2RGXA 1E2QA 1XEXB 1D2EA 2HT6A 4EPTA 5LBIA 4JLPA 1AJEA 2G88A 4DSUA 2KWIA 5H70A 2H57A 3QF7A 2NO0A 3C15C 1OXVA 1XD2A 4HAZA 3VU9A 4RJLA 1Z6YA 5KNBA 1KNQA 4BFUA 3M4YA 3MLEA 3RRNA 2KJQA 3TKLA 2ZE5A 3EA0A 4OK6A 5DO9A 5CYPA 5C4GB 4ARZB 4DSTA 2VLIA 2ZPTX 3L8ZA 4K81B 4CVNA 4MYUA 4I99A 4IW3B 2ZE7A 3QIAA 1KAOA 2C04A 4JYCA 4QG7A 5BYJA 3ZJYA 4F4JA 4AI6A 4R2HA 4CEHB 4YMUA 3C14C 4HAYA 1NVWQ 2EU8A 1OB2A 2BEKA 1E98A 2ZYUX 1QF9A 1E9AA 2F3RA 2ZSBA 4OI1A 4OHXA 4A0FA 4XVRA 1GITA 1P61B 4LYJA 4B74A 3QUSA 2IL1A 3WP0A 2YWFA 1XTKA 1IN4A 1S3SA 4JBYA 4XD7D 1NLFA 4DLZA 3GLIA 4GP6A 5IRCD 2G83A 1LF5A 4D4KA 3W34A 3TAUA 1NN1A 3P20A 5CB8A 4X8MA 4RKFA 3MG9A 1SVSA 1SVIA 3RWOA 1BS1A 1NY6A 4TSFA 3EPJA 3MRSA 1COWD 1DG3A 4BFYA 1RPZA 1KI8A 2JEOA 3Q9LA 4RZ2A 1Z63A 1D8TA 2W2VA 4ACAA 2WM9B 2VYFA 3SJCA 1XU4A 4GP7A 3EZ6A 4L5BA 5C18A 1W36B 1CR0A 4TTRA 2R6GA 4B75A 3T12A 1RRFA 3IKJA 2W00A 4LY6A 2R8RA 2IYWA 4HEJA 1KKMA 521PA 4TLCA 4BLRA 4KVGA 1VKJA 3QY0A 3AUYA 1RC8A 1VTKA 4O2LA 5FR2A 3W6NA 4GMXA 2H7VA 4MH0R 3CUEF 4DBLC 2PMDA 4PC1A 4GI7A 3I3SR 3QKRA 4OL0A 3LNCA 2GF9A 1KKLA 1WA5A 1VG0B 2I3BA 5JI3E 4II7A 1SVMA 2DFTA 2QE7D 4R71A 1UFQA 1HTWA 2FGJA 5LB4A 4C4PA 3EPHA 3OEED 1E2KA 2V8OA 1NVVR 2QMUA 1XMIA 2PT7A 3UKDA 4ABYA 5JCPA 1AS2A 3B1XA 3OF5A 3BE4A 5F9HA 1U8AA 1LW7A 4KITB 1UBCA 3B5JA 4QGGA 2OBNA 4FWIB 1OPXA 2D7DA 3CWQA 3HPRA 4A8JC 2ZAOA 4HI0E 4JMPA 2FOLA 1MO5A 1ONBA 4PR0A 4NCHA 3L8YA 5AUNB 1N6RA 2E1RA 1NNEA 1C9KA 3B82A 4QXAA 2BDTA 2F1IA 1E9BA 2H18A 5GJVC 1KDRA 1NBMA 1T0JB 2FG5A 3W8NA 5GADl 2ZSDA 3EARA 3DVLA 1FUKA 2NOAA 4MYCA 1QZXA 1ZNXA 2BV3A 4A0GA 4M9QA 5FUVA 5CIWA 4IOLA 2GXAA 1Y63A 5B64A 1V5WA 3UMFA 3CX8A 1H8HD 2R6CA 4JVMA 1KI6A 3PITA 4I1SA 1U9IA 4OQLA 2O8EB 4PHHA 4ITRC 2X1VA 1E79A 4LYHA 3GFPA 3OFND 3B9QA 3DZ8A 4R98A 3IHWA 1WB9A 1JXMA 2ZSAA 1VPLA 2O52A 3ZQ6A 1QHXA 1TL7C 1KK0A 1QG4A 2IEZA 4TT3A 1G1MA 3DM9B 4Y0AA 2O5VA 2P3SA 1LVGA 1NMYA 2IX3A 1UM8A 3DEFA 1HE1C 2C99A 4HLDA 2GZHA 2ERXA 3MWKA 4JL8A 1XCMA 2WJYA 4DCTA 3KXLA 4BZXA 2BWJA 3I5YA 4MRSA 1PLKA 4RFSA 4OQMA 4HDCA 1OXSC 4N0EA 4OHZA 5JHHB 1Q1QA 1W4RA 2BKEA 3HU2A 4EQ6A 4HAVA 3FVQA 1F2TA 1XNJA 4FCVA 4MDEA 4MKIA 2XOKA 5FPYA 3R8CA 3T35A 3A1SA 3REFA 3BXZA 2BVNA 3ZVNA 3CNOA 3LY5A 2G3YA 4B33A 1SXJA 4O25A 1XF9A 2IA5A 5EP3A 3T1VA 5FI0B 3CRQA 1P73A 4C30A 4C0BA 5DE3A 2JDID 1XMSA 2X77A 1FFHA 1IJEA 2RHDA 3ADBA 5BXQC 4KYUA 1IONA 4ZKDA 2ORVA 1XXHE 1OF1A 2ZRBA 3I32A 2OILA 1T6NA 2XTNA 3OEHA 2VPPA 5DI9A 5J4YA 1Q1ZA 4YLGA 5CJ2A 2QBYB 1MABA 1SXJB 3KJGA 4Q66C 5IK2A 2IXFA 5KUTA 3LAWA 3K1JA 2QEQA 2ZRHA 1X86B 3SFZA 2W2TA 3Q7PA 2ZVPX 1RKBA 4DEYA 2A5GA 3T5GA 4Z1MD 1SQ5A 5SZHB 2DY1A 4KHZA 2IYTA 1ZNYA 4GPTA 2OCPA 2G0NA 1Z06A 1UKZA 1P2SA 3Q85A 4EIWA 2PJRA 4D26A 5JJLA 1SULA 1E0SA 1YR8A 2RGBA 5G53C 2XNDA 1MRNA 4B2PA 1CU1A 1KI2A 3EAQA 4AKEA 2NIPA 3IBGA 2BC9A 2NPFA 2GNOA 2MMCA 2ZSEA 2FZ4A 3BFXA 4U00A 4ESHA 1FMJA 5AUPB 2R65A 1YQTA 1Z6TA 2F1JA 4Z8XA 1ZINA 4GT1A 3GCGA 3CB4A 2FA9A 1A2BA 2RCNA 4PHTA 1XEXA 3BS4A 3IIMA 3LW8A 2ATVA 1G8YA 4Q1AA 1E1RD 1E2EA 3DO6A 1CF4A 2AWNA 2F43B 1UBFA 3HP1A 2OE2A 3C4JA 4QRHA 3H0KA 1GSIA 4B76A 1F60A 2Z83A 4ACBA 3VHXA 5DYIA 5EE5B 2UVQA 2JJ8A 3EZ9A 3QKUA 1KOFA 1DG1G 4IDPA 4TMKA 4WVFA 4BUJA 2CJWA 3SNHA 4XWKA 3IUYA 3AEZA 2X2EA 1Y3AA 2IEYA 2QP4A 5CLLA 3TUZC 1GNRA 1T5LA 3T06B 3NXSA 5B30A 4V0NA 2JLQA 4B2IA 1Q1EA 1YRBA 3F0TA 1N25A 3I4LA 5FUYA 1NN3A 2VH5R 2QTFA 4YQFA 1A2KC 5L3QB 3FOZA 3PEUA 2GZAA 4HLUC 2I1QA 4CZ2A 4TQAA 3U7GA 5G3YA 4BFWA 3THXA 3HU3A 1ZBDA 2IT1A 3NH9A 1QHIA 3QF4A 3SI7A 2Z0MA 1KSFX 3PQCA 2VP4A 2EFHB 2ZRJA 1FP6A 5DYGA 3K0FB 2LCFA 3QVUA 621PA 1ZUNB 3TR5A 2XNSA 1TTTA 4PHGA 1FUUA 2RB4A 1KO1A 1ZD1A 3E5HA 3R9XA 3DM5A 1S3GA 4QM7A 2XZLA 2OXRA 2WKPA 3QEOA 4NYJQ 2WAYA 1GP2A 4US0R 4CT5A 3CRRA 4ZCMA 3SC3A 1OH5A 2DPXA 3V4RA 3OE7D 1E4YA 2UZ3A 5IDVA 4EUNA 3AH8A 5FPHA 3MWJA 1KO5A 2XNDD 4ZCIA 3RSLA 2ZJOA 1JAHA 1YR9A 3AVVA 1GG2A 1Z0KA 5BQ5A 1N0WA 2HCJB 1K6MA 4KXFB 4DB4A 5TXGA 5JWOA 2PCJA 1G8GA 4EAQA 1W0KD 1AIPA 3X1DA 4ZDJA 2I1VB 1XCGB 2GCOA 3U3MA 2XZOA 1JXOA 3R9WA 4TMZA 2ERYA 2ODBA 2R9VA 4XSGA 1KSHA 4MYHA 2KI5A 1OFHA 3VR3A 1N0UA 2WIBA 4D2IA 2ANCA 5FOWA 1SHKA 2P6NA 3BK7A 4TN1A 4IXNA 2FEOA 4ZPXA 1NKTA 3A4LA 5BWMA 4G1UC 3R8FA 1SZPA 4NE2A 1Z3IX 4OI0A 2BBSA 1N0VC 3ONWA 4KCGA 3B1YA 1COWA 1DAFA 1N5KA 2V9PA 1Q12A 4JKYA 3SJAA 2FPKA 2DFNA 2C78A 3IO5A 3QXHA 1E9FA 2NGRA 3UATA 1CJTC 2J5XA 4C3ZA 4EPVA 1IQPA 3K0CA 2AKAB 1U8YA 3EW9A 3PUXA 2HYIC 4DVGA 4L15A 2GILA 1UEJA 2V1XA 2ZJBA 3GD7A 4AY2A 3BORA 3I73A 4M22A 5JZVA 5KDLA 3RS0A 1NVVQ 2OFWA 3QXCA 3B6EA 4NL4H 4IOKA 2ZJAA 5SZJA 2IWHA 3GJ3A 1W4AA 4FI3C 3VKGA 3THXB 1SKYB 2OSBA 2ZROA 1S1MA 2XOKD 2GWHA 2BMEA 1PUJA 2PZGA 3QJYA 4WXRA 3ND8A 4WXPA 3SJZA 2ZXUA 2QTVB 5DLQC 2ONJA 3LBHA 4LBWA 5TB5A 1ZCAA 1D6JA 4KODA 3TUJC 2BBWA 2CVHA 2IYSA 1EFTA 3QKSA 1GFIA 2W6IA 1KTVA 1WQ1R 3R9IA 4H9GA 4BRUA 5LB2A 2QY9A 4XVQA 2R6DA 4DCNA 3DHWC 2R62A 1GDDA 4C0SA 1GRQA 3WYFA 3QNUA 3KZ1E 3LVQE 2YOHA 4DZZA 5C4MA 3I5XA 2XTMA 1YZQA 2FF7A 4Q47A 4TMVA 2FGKA 1EG7A 2EWWA 2IBMA 2P65A 3NIBA 1FPMA 5FTKA 1KY2A 1VHLA 3EIEA 2X19A 3MWYW 1NN0A 4PFSA 4V0LA 2OM2A 3BIFA 5CDFE 2P6RA 2D62A 2IHYA 1KJWA 3LWNA 4MA4A 4JSYA 2VRWA 4IDNA 3TGPA 3EZ2A 1E4VA 1OLOA 2P2LA 2QGNA 2GTPA 5JLJA 4AYXA 3SHFA 4BZPA 1W0JA 1PJRA 3VX3A 5BYKA 1OT3A 3PIRA 4M9ZA 1NVXQ 3DPUA 1G8PA 5AWFC 1R5OA 2EWVA 3H1TA 4A2WA 2IYLD 2AL7A 4HSEA 2RGDA 4PO1A 4QBFA 4MGIR 5JECA 2AWOA 3B1WA 2O0KA 4NCJA 2VSOA 2WWXA 3Q5EA 1XZQA 121PA 2WIAA 4JKIA 1KK2A 2BJWA 2IYUA 2PZFA 1ZC3A 3SJBA 1XEFA 2QP9X 3CF0A 4GMDA 1RFLA 2QP3A 2FZLA 1YZLA 3ECCA 1ZM9A 2ZI5A 3P27A 4K8OA 4ZI2A 1L2TA 1U8ZA 1BOFA 2ZI6A 4HLUA 4HB3A 2OAP1 3F5FA 3H2YA 5JRJA 3W6PA 1BYIA 2NZ8A 2HF8A 3HR8A 4AG5A 2VHQA 4Q03A 5IHPA 2WV9A 2A9KA 4MDFA 4KBFA 4BRWA 1G64A 4KVAA 5AR1A 1H8HA 4AWXA 1G5TA 4UKDA 1DAIA 3Q72A 5DHAA 1T5IA 3VQTA 1E2DA 2IYZA 5FBVB 1D9ZA 3MSXA 3TJZA 3WMGA 1G3IA 4EDHA 2ZRAA 2C9CA 2QZ4A 1LTQA 1R0YA 2ZRPA 4JBWA 2Q21A 4OJKA 1E69A 3QKRB 2IS4A 1LF0A 1QBKC 1S0UA 3GFTA 4FXPA 3G5UA 4HDQB 1ZU4A 4IDOA 4LHXA 4PPNA 3HU1A 2C95A 2QG6A 4TSFD 1G6HA 3L0IB 4NHOA 3LBIA 2L0XA 2CLDX 4UXHA 4QBGB 5K8UA 1G16A 1OH8A 1NRJB 4AKIA 4AKHA 5KSPA 2FDCA 3TVTA 5HPYB 4UJ5A 5F2EA 4NONA 1DAKA 2F7SA 3DOEA 2IYXA 4NCKA 3JVUA 1ZAKA 4HLCA 4RZ3A 1KO4A 4BLSA 3U5ZB 2GA8A 2ANBA 1CKEA 4IRUB 1E2FA 4LJ9A 1Q3TA 2VEDA 2WPDD 3Q8XB 5J4LA 3TLXA 1M74A 1PZNA 1R8QA 2CE2X 2Q3HA 5DIFA 5KSZA 4H1VA 4ZV4A 4FWTA 3M1IA 2OUKA 4D80A 4US2R 2NO9A 4NCIA 2OV2A 4YXWD 1E6CA 4RVCA 1G291 2VP2A 2AHOA 2AFHE 2GJ9A 2ZJ5A 4LBYA 4LC0A 3CR8A 1PLLA 1SVKA 1N2CE 1YZNA 2ZQ5A 3L2OB 5FOUA 4B34A 1JR6A 3VAAA 1PUIA 3TIFA 2F1RA 2A2ZA 1XPRA 3QPUA 1W49A 1OIVA 3SOPA 4E5UA 1OXXK 1LV7A 1IJFA 1DO0A 1JECA 2IXEA 3A1UA 5A0FA 2DWPA 2QRZA 1KI6B 4JLAA 3B8HA 4Q9HA 2BJVA 2Q3FA 2F9LA 5CIQA 3I62A 1SKYE 3LA6A 4URVR 4GNKA 5GVSA 3K9HA 2WJVA 1MO6A 2ZSFA 4TTQA 4B2LA 4BLOA 2J7KA 2WJHA 2BCGY 2EFCB 1DE0A 5L3SA 2OO7A 3UIEA 1TAGA 5KDOA 1W4BA 1E99A 1M2OB 3B1ZA 3CWZA 4GL2A 3TW8B 3RC8A 4Q48A 1AM4D 4QGAA 4OI4A 4NDZA 5BN3A 4QHTA 1CRPA 5K8TA 4MQBA 3AB3A 1IY1A 2W6ID 3EG5A 5AJWA 1F2TB 2WVJA 5KU1A 2EFGA 3P4XA 4BFXA 2VF8A 1XEWX 3IPXA 3AKDA 4E22A 5H68A 4KLNA 1GRNA 3RLFA 3TBKA 2NO6A 4P4UA 4YMTA 5LD2B 3TMKA 1H8EA 1KI7A 1Z2AA 3CM0A 1GOTA 4O2RA 1CJVC 2FE4A 1ZYUA 5FBRB 3LO5A 4NYMQ 1KNXA 4DT1B 1XD9A 2HT1A 1VHTA 3T1OA 2CJWB 2UKDA 1U90A 2YOFA 2GF0A 2GJAA 4M21A 5CLQA 4EPYA 3HWSA 5GJWC 4GDFA 1N6PA 1OH7A 1G7CA 1VYTA 4I1OA 5FPKA 3GJ6A 4RFVA 4S2EA 2FNAA 4NPHA 4U5XA 3IPYA 5HR5A 1W7AA 1FOEB 3ZIAA 1ANKA 5JSZB 3KQHA 4IJMA 1F3OA 1NSTA 4LC1A 1DVRA 5G3ZA 4LHYA 4BFVA 4D4MA 4TLEA 4PC7A 2XB4A 4FCWA 1E9RA 4RCYA 3WXMA 4EFMA 2WWIA 3L0SA 4TLBA 3KJEA 5DNYB 1T9HA 2O8DA 2OAQ1 1IM2A 1NBMD 1O3YA 1BO6A 4B73A 5FBWB 1XFAA 2Z4SA 1ESNA 3H4MA 3FE2A 1ZC4A 1CJKC 3NC1C 4Q18A 3AKCA 4OHVA 3ZVRA 5FH9A 2D06A 1JALA 5KSOA 4LPSA 2P67A 2IF0A 2JIZA 4LRWA 1YZUA 3PV0A 1QVAA 1W5SA 2H8KA 5DN6A 1FTNA 2QM7A 4IOMA 3BB1A 4WZBE 3U3RA 1G7SA 1UKEA 4UNSA 1DAHA 2AFIE 3R20A 4BFZA 3U7HB 3OEEA 3FTQA 1S1CA 2HCBA 5KHOC 2J59A 2YV5A 1KY3A 4M1TA 3AGQA 2Q9CA 3OE7A 1KHTA 5FOVA 4EKDA 3FB4A 5HCNA 2Q9BA 4DCUA 4M1SA 1QHSA 4DCSA 4C7OA 2IS2A 3OAAD 5EUMA 1XJQA 3B9PA 3BRWD 1JPJA 5FL7D 2F55A 1E3MA 3LD9A 3QVVA 1OHHA 1CEEA 3GJ5A 3QXJA 3U3KA 4LGMA 3VR1A 4F7WA 1DEKA 2NG1A 4G5OA 4G01B 4JJKA 5HZHA 2YWEA 1GAJA 1UBEA 3PXGA 1JAIA 2OG2A 5DN6D 2A3RA 1HUQA 4D82A 2GRJA 2VP9A 1BMFD 4FMDF 1Z22A 4B3BA 3TQFA 1JQJC 2RH5A 3FMOB 2GAAA 4N0DA 2OBLA 2QROA 1FNNA 1QHHB 2ZRGA 3H84A 3THWA 1EWQA 4HZUA 4RSGA 4CYMA 1M1YE 2H17A 4ARZA 1II8A 1I4DD 2QI9C 2G0TA 2X2FA 5TV2A 4JJZA 1EGAA 4OQXA 2YOGA 2PLFA 1Z29A 1KI9A 3UPUA 4US1R 2CNWA 2JLRA 1TU3A 4PPFA 2EYUA 2IS1A 4PTLA 1OW3B 2RGGA 1RYHA 3CR7A 3O8DA 4JL6A 4M0LA 3W9YA 2GJKA 3R7WA 5E7MA 1XTIA 4LHWA 4FMBB 2W6JA 3GLFA 1QDEA 4M9XA 3VKWA 1JBKA 4Z54A 5FTLA 1HQCA 1YRAA 5KNDA 4ESVA 2DHRA 5BW8A 2AD5A 3N70A 3PENA 4DLYA 2VBCA 1FQKA 3AV0B 3BB3A 2REOA 2J1LA 1ZM3A 3SBDA 1X8LA 3WHLA 2ORIA 4PC2A 2G1JA 1F2UB 4WZAE 5F3WB 1YR7A 3NWJA 3CIOA 2XJ4A 1US8A 1WDTA 3CRMA 1OE0A 3LLUA 2PZEA 4BLPA 3UANA 3T1QA 3WMFA 4PAOA 4CEIB 3KXIA 5FOXA 3A6PC 4LBZA 1ZJ6A 3E2IA 1GKIA 2FSIA 1WE2A 4DUGD 1UADA 3A37A 1ZM2A 1RYFA 2CHVA 2ZYVX 4TYQA 2ZAMA 4FCTA 4X8HA 4MITA 1XCPA 3DDCA 2C9OA 4Q19A 1ZVQA 2B21A 5HKKA 1GVNB 3CONA 3QXSA 3PVSA 3NC0C 2WSMA 4D0GA 2DB3A 2QSZA 5AK0A 5CM8B 3THYA 2NQ2C 4B3DA 2OXCA 5CJPA 4CEIA 4I1VA 5FTMA 1Z0JA 3SBEA 2GJ8A 4JLNA 2VA8A 2OLKA 4ZKEA 2GJSA 5KPDA 2FH5B 5AJZA 3AP2A 3KB1A 1CBUA 3K0EA 4PSKA 2VHUA 1KJYA 3SU8A 2BMDA 4JLKA 1KO7A 3C8UA 4JBXA 4QJ5A 4IDHA 5G40A 2FU5C 3U6KA 2P0EA 3KJHA 2YZ2A 1I4LD 4A6PA 4QOSA 2HUPA 3D3QA 4M1MA 1T3SA 2WHXA 3MAAC 1QVRA 4MRRA 3HPQA 2QAGA 4KFRA 2IF2A 2IUSA 1AZTA 2WMNB 3KKPA 3WNCA 1VYUA 4A92A 2EQBA 2ZUCA 5HKKD 2MMGA 4GZLA 3VNUA 4V0MA 3SQXA 2ZJ2A 4FW9A 3U2QA 1J8MF 2CXXA 3G82C 1XDBA 4PZYA 4XSHA 3UMRA 3PJRA 4A82A 2I4IA 3QQ5A 3C16C 4A9AA 4WIAA 1ODFA 2WWWA 2QAGB 2CCJA 1U81A 3TW4A 4DRZA 2EFEB 1K5DA 1EX7A 2HYDA 4FMDB 3IO3A 5FBQB 2IXGA 3PUZA 4FD2A 2ZRCA 1H65A 3EIQA 2FPLA 2IS6A 3NBZC 3B2EA 3A58B 3WBJA 3Q5DA 2B92A 4NZYA 4TLAA 1TQ2A 2BIFA 1GRRA 1ZW6A 2PT5A 3RC3A 3BERA 2HLDA 1KMHA 2XTZA 4LPKA 4P31A 3G0HA 3IEVA 3VMFA 1CRQA 5LDDC 4EFLA 1U98A 2BOVA 2JIZD 4Y0VA 5KYKA 2GZDA 1N6NA 3PUWA 4HB2A 3QPVA 1Z6AA 2ZE8A 1Z2CA 1G3MA 3FWYA 3TUIC 1HE8B 3KKOA 1E96A 1VECA 3NBXX 4EPXA 1CJUC 2ZUDA 4LJ8A 2C8VA 3BAFA 4JVSB 4QL3A 1OXTA 2LKDA 2QM8A 4M4SA 4CIDA 3AVWA 3IGFA 3THYB 4LJAA 1XPUA 3D6TB 2REXB 5EE3A 1MV5A 2ORWA 3CRVA 1JEEA 4DLSA 1VG9B 3UG7A 2WSSA 2KSQA 2WOOA 4KFSA 2A78A 2ZU0C 4OK5A 1N5LA 3AP1A 3WBKA 1G19A 2ZS8A 3GP8A 4QNRA 2O8CA 1IOZA 1F5NA 2QMOA 3U44B 2GEUA 3E70C 1Q22A 2BEJA 4MUBA 2ZEJA 1XTRA 1FX0B 1OHHD 3LLMA 3NEJA 5JWHA 3LX8A 4I4LA 1IN5A 3K0CC 4B3FX 1FZQA 3KFXA 1OYYA 1VIYA 2V3CC 3K9GA 4OQFA 1BIFA 2ZRIA 2R6AA 3AVTA 5E7JA 1A7JA 221PA 1LNZA 2FSGA 2IC5A 4XTCS 3EA5A 4JLMA 1TMKA 1NMZA 4RZXA 3WP1B 3F3YA 3A4NA 1T91A 1CR4A 1EFUA 4ON9A 3GFOA 4V03A 1KZGB 3I72A 1XTQA 2ZS7A 2O8EA 2DR3A 3K9NA 3U61B 2IYYA 4Z51A 3IDQA 2ZITA 3HJNA 4F4CA 3VKHA 4ZCLA 1AGPA 3O8CA 3ZQJA 3FFBA 2OZEA 2QSYA 4LK2A 2ZYTX 2IUUA 4G0NA 2W0SA 3IHLA 1NBME 5JBQA 2FWRA 1OV4A 5L3SB 1E2LA 5B57C 2KBFA 4IEEA 2GVZC 3QG1A 2ZVQX 2J45A 4NBSA 4NYIQ 3U60B 2SHKA 1AA9A 2PMKA 3H86A 2DFLA 4U02A 2O8FA 4I1UA 3VTKA 5J4KA 1EXMA 4DWJA 4L9WA 4A15A 4O3MA 3AVUA 4P0TA 4BPBA 2J41A 2VSFA 4JLBA 2J9RA 1P2VA 2WKRA 1P9NA 2JJ1D 1DAGA 2WWGA 4IOJA 2H16A 3RS5A 3TVDA 3ZYCA 1P5ZB 4OKSA 2JLSA 4D81A 2EW1A 1RVDA 3HYTA 4Z8YA 3RABA 4FINA 2QBYA 3A4MA 3ZZTA 1GL7A 2FMXA 4Q4AB 4Q1BA 3U4QB 1Q3HA 1W4CA 1I4TD 1AGRA 4JLDA 2NO1A 3LH5A 4LJYA 2ZRLA 4QKQA 1TUEA 5EE1A 1P4SA 3ZS9A 4RY2A 1H8ED 1G4UR 4BZQA 3MGCA 1A5TA 4V0ME 5ANRB 1Z28A 3AF0A 4M1WA 3CBQA 2P5SA 2ZRNA 1CP2A 1VYVA 3ZH9B 1RW4A 4EJSC 1E0JA 2H92A 4KV9A 3CF2A 4QGFA 4TYNA 1VCIA 5IF9A 2D2FA 4ZDWA 4G5SA 4KFTA 3AVXA 1YVDA 3ADCA 4W7SA 2K5UA 2R2AA 1KI4A 5TY0A 3FFAA 3ZVMA 1NMXA 1PV4A 4C2TA 3SQWA 3TRFA 5FOSA 2PLRA 1P62B 3DMNA 4MGYR 3VR2A 4AIIA 5BN4A 1CIPA 1YZTA 4LCBA 1DBSA 4EQ6B 1U2RA 3U7FB 2JASA 3KDSE 5B2ZA 5KNCA 4JZKA 5EP1A 1NJFA 5EXTA 2XSZA 1G18A 2QTHA 3CNNA 1YZGA 1JEDA 3PEYA 4UNRA 3JVVA 4DDTA 3PCRB 1R7RA 1EFRD 3IEUA 3OESA 5A4JA 5E4FA 4P4TA 4DSNA 1G41A 3NDPA 4URZR 1NN5A 1OFTA 2FPMA 1KJZA 1HT1E 1ZD8A 1NP6A 1MH1A 1MO4A 4Q9IA 5E95A 1T0HB 2B6HA 2QRNA 2YVUA 3P32A 2JJ2A 4HUTA 2B8WA 3K70C 4DIDA 1G8FA 3CX7A 4JLOA 1T3LA 2GCPA 4OHWA 4P32A 1AQUA 2XXAA 1B23P 1X1SA 4LJ6A 4C0KA 4TMTA 4Q4AA 1E0AA 3OAAA 3UWKA 4C9BA 1EK0A 1TADA 3RAPR 3AGPA 1W5TA 1NJGA 1ZIOA 4GSYA 4Q21A 4URYR 1OSNA 1UEIA 2GXQA 3NBFA 4GOJA 4PQYA 3AVPA 4HAXA 2Z43A 3P26A 3FKSA 2OHFA 4KYIB 5EP4A 1OXUA 1GUAA 1R0ZA 1OYWA 3WNDA 3BBPA 2ZJZA 2XAUA 3BFVA 4YMVA 1FTSA 1M8PA 4DKXA 4CDGA 2QL6A 2GEDA 4HDOB 4M2LA 5KO2A 1ZUHA 4NKRA 3GJ8A 2QT1A 3K70B 2FFAA 3BH0A 5EE0A 3OFNA 3QF4B 2OLJA 1QHYA 1YKSA 1IN8A 2YWGA 1E1QD 4JL5A 2DFKB 2GK7A 1G3RA 4OK3A 2HDNB 4Q4HB 5AJVB 2ZR9A 1M7BA
chains in the Genus database with same CATH superfamily
1X1DA 1PN3A 2X58A 2FTKE 2ZUSA 3FCCA 3VDRA 4ZU1X 1X1QA 1TMYA 3DEAA 5KVQA 2UXDB 4TTTS 3E48A 1TCUA 1NX9A 3A27A 1W76A 4G4JA 2UUAB 1JDZA 3OX4A 3UENA 5JJ5A 2Z09A 3C6MA 3P0JA 2OQRA 5HFJA 4GRAA 3PPWA 3ENZA 3IOMA 1C9EA 4PZ0A 4QAQA 5I7RA 1RHKA 2WTUA 2BZSA 3UXMA 4EKIA 1GUYA 4RC9A 5CT8A 4LQCA 4JVLA 5A7FA 3Q7EA 4HYYA 4NE9A 1M34E 1QOPB 1XU9A 1WXIA 3RVJA 2CLOB 3KQUA 5HUQA 2NW6A 4BECA 2MR6A 4HWSA 2HIAA 2FFBA 1N1DA 2H4ZA 5DBOA 1NTRA 3FDIA 1LJ8A 2UYOA 1MOSA 2AXPA 2RB5A 3ZUPA 2ZR7A 4LX0A 5AUOB 3THWB 2N46A 4P08A 4P3OA 4Q1FA 4F1WA 7REQB 3V8NA 2WU0A 2P4QA 4J75A 4DA6A 4BO0A 4PRYA 4QPNA 4KSYA 1SU6A 3RSOA 5L3RA 4R05A 1CUEA 1J21A 2QNIA 2XEXA 2OAEA 5JXHA 5KMGA 5C46F 1Z18A 1IAQA 2RJOA 4LXXA 5EZSA 5DEIA 1LBQA 1UMDA 1EFVA 2PTGA 3KDAA 1H9BA 2CVOA 4UVGA 5CR9A 4W8GA 2QRMA 1U7XA 2RG7A 4TWZA 5CG2A 3GLKA 3H2SA 1QO0D 1QS0B 4M1QA 5JDCC 1O87A 1U0JA 3CZAA 1GZ7A 2C3PA 1KIFA 3IAUA 3MJRA 3VPDA 3GPCA 5D84A 1D1QA 3A1WA 3JAKB 4KJZA 4CMKA 1RLMA 3VYVA 2V6FA 2FSVA 3DFKA 4LF8B 4OYLA 2V9ZA 2Q5JA 2O05A 1XLTA 3L9XA 1G6Q1 1O0BA 2VUHB 2ZBUA 2VSNA 3HJUA 1UINA 1N0HA 4XCQA 2C94A 3LHKA 4NJMA 5J9FA 3OCYA 4Y2VA 4A5OA 1JSZA 3TR0A 5JAMA 4EG8A 1HURA 1RPTA 1ZUD1 2IEDA 3STWA 4Z7OB 5A1TA 2GMWA 2GHTA 5SZIA 3R3JA 1XJCA 1UQTA 1KO8A 2GBLC 2W6MA 3CNQS 4L8YA 2J85A 5FQOA 5DLYA 3RS3A 1Z45A 3KPWA 2JGNA 1H1LA 1NLUA 3ONVA 1ENOA 1POXA 2AX3A 3GBSA 5ALJA 3SJ7A 4FB4A 2RE8A 4KDEA 4IDAA 3H1AA 1TQDA 3RE1A 1A97A 4LF7B 1J39A 4XA8A 5D2CA 4E3WA 2P6UA 4Z9BA 1NUTA 3NASA 2A30A 3WNZA 3D02A 3H3JA 1E9EA 1J99A 5GY7A 4Q01A 3FMIA 3NHKA 2Q9AA 4QFBA 1P29A 1SZDA 3DKVA 5TJHA 2YN2A 2MSCB 5AJUA 4YXWA 4TX1A 1MDBA 2QE6A 4PIPA 4ZHQF 1XD2B 1ZJ5A 3R75A 3VSBA 2YL2A 4JX9A 4IEFB 4IGFA 1NC1A 4D3FA 2PM8A 4A10A 2ONCA 3LQRA 1ZJYA 4FYKA 3HVUA 1KJ8A 2QW8A 1LLCA 4R1LA 3SS8A 1SXJD 2D1YA 3IESA 1MNAA 1XXHB 1AO3A 4POAA 3SFVA 2QW0X 4B7AA 3FDXA 4R0VA 1KGDA 2ES4A 2JARA 2D74A 4UEJA 2J0UB 2IUYA 4WUVA 3Q2OA 5FPSA 4WNAA 1S5PA 3C3AA 1WAMA 4AX4A 4DM3A 2JH3A 3LUPA 5EQTA 1QIIA 2YYYA 4UNNA 1K3TA 2ZCJA 5LA6F 2GUWA 5HTKA 1XQ1A 1NBHA 3KZMA 3OIVA 2VHZA 1UBGA 4M54A 2PUTA 2BR5A 4TTSA 1CZOA 1AK9A 1N5JA 4GOMD 1GPH1 2NTEA 1ACLA 1C5KA 1ZZEA 2WYVA 5A5GA 4B79A 5BWOA 2BFFA 2OSVA 3ASZA 3SX2A 4HDRA 4X61A 4DR6B 2JD0A 1B0UA 3RM3A 4U9HS 2IYAA 1WTCA 3RDPA 2P7HA 1U2PA 1V4NA 2ZS9A 2ISCA 3RNOA 3W8FA 3JZAA 2QTCA 3GFQA 2XDYA 4MI1A 5KTMA 3BD8A 4NU0A 5K6AC 5FBLB 1E1DA 2Y2UA 1DKRA 2H1IA 2PV0A 3L82B 3NHBA 3D43A 4BVAA 3F4BA 3SSMA 1G55A 1CLUA 3JSAA 1B0ZA 3CZ5A 4PINA 3FTDA 1IB6A 1Y3BE 4NAUA 4B7XA 1JZQA 3NPMA 3MNFA 2Y1XA 2HJGA 5AXDA 1G17A 1NL3A 3I6MA 5A9TA 6AT1A 5BV1A 3RAEC 1QV9A 4BMPB 4DIEA 1X80B 1T43A 5JTTA 2YC2C 4EA9A 4J3FA 1U2GA 1WXQA 4LVOA 5CHYA 5GMOA 8GPBA 4AP9A 1P6XA 1XDUA 3NKVA 2F8LA 5E38A 1ODSA 2DGDA 2BEVA 2X4LA 2GKSA 3BWEA 4B46A 2J9ZB 1EFCA 1PSWA 2X2PA 4JU9A 4Q9KA 3PFGA 3RUHA 4QUDA 2VTBB 2CEKA 3VR4A 1EXNA 3ZWMA 2NP6A 4U2GA 1XJ0A 3C3YA 4NZOA 3NOQA 3DULA 4TV8F 1P45A 2BCJQ 3RHZA 2L42A 3HDHA 4AK9A 5ELXA 4UMFA 1Z4KA 2VAXA 5F73A 4R01A 4BE7B 3RVRA 1X92A 1MENA 3T3EA 4JWKA 3IAAA 2C7BA 1VZ3A 2DUJA 3TZBA 3RRMA 1YUMA 4HN4B 1E2HA 2JFXA 4PC6A 5FJJA 5AKHA 3CRW1 3T3IA 4LJLA 1EQAA 2LGJA 3RT1A 5A4KA 2YCLA 4PLZA 5LKRA 3YASA 2XE4A 5DDIP 3IV7A 4FR2A 3KCQA 3R0JA 1MNQA 3UAYA 1ORDA 4ZVPA 1OBOA 2XX3A 1SCIA 2ZT6A 3GZTB 2IHNA 2F3TA 2AR0A 1OIXA 1J8FA 1DAMA 1UP7A 1QCDA 1PWHA 4OXXA 5DTMA 1YQXA 3MYYA 5KNCH 5JJKA 4MS1A 3A14A 4GLBA 2YDYA 1A50B 2RHLA 5I4BA 3TDNA 1HPLA 1PE0A 1VSTA 4GI3A 1XZAA 1K5GA 3VKVA 1IZZA 3SVTA 5KHAA 3EIXA 5DK4A 3CVVA 5AJXA 1ZU5A 3P2YA 1XOIA 4K1LA 3W6OA 1DCFA 1A9SA 3HLKA 3LX5A 5FFNA 1QKIA 1RWKA 2WFLB 4UTVA 4Q6WA 3LSTA 2I1WA 4QGHA 4IVQA 4UXIA 3KKNA 5DHPA 1RR6A 4ERNA 5IHXA 2H1VA 4ZVOA 3AEUB 3RW9A 4O6VA 4IF6A 3M2PA 3RRZA 1J90A 3ZU4A 1TF5A 4NARA 4GZMA 4EW2A 3D4IA 1JMKC 2H00A 4U0KA 3SYKA 5GIPE 1P9RA 1PR5A 3WL6A 3RHSA 2WIJA 4IS3A 1NI5A 3B85A 2BGKA 3IELA 4LWZA 3Q8KA 3MHPA 5JCXA 3WDSA 4ITUA 2M9MA 1X19A 2E6UX 1MGOA 1GEEA 2JAOA 4QQNA 2XUAA 2ZRKA 4A1OA 2HMTA 1U0LA 3A1NA 3EEYA 3RIGA 5C7IO 4JY7A 1H2ZA 5KVSA 2XB2A 2O5EA 1WV0A 4TMXA 3RIYA 1P9WA 2WJJA 1GPWB 3WB0A 5IBRA 2TMDA 3CPJB 2AQ8A 4NYMR 1CD5A 5FUXA 3AF5A 3ITDA 3W3AA 2OXFA 2ZYRA 4BY9E 3K09C 3K73O 5AK6A 1M2WA 2XGJA 4M0FA 1GUFA 2X9QA 2V58A 3L0PA 1ZOSA 2CNWD 3P2MA 1M6WA 4URFA 4JLVA 2CDAA 2O5RA 4Q3EA 1UK8A 4JI5B 3V00A 1MABB 1Y9AA 1F06A 4G4SP 4ZT7A 3LUGA 1UK9A 3GP3A 4HXFB 4J0FA 4BRSA 5LD2C 2BFWA 1GRVA 1AQNA 3MFQA 1EX9A 3NANA 2CLHB 1S8OA 2ZBFA 4WA7A 3ZPXA 4LYAA 3ZHQA 4ZI7B 2R6HA 4GKBA 4CIXA 4OUKX 4ZTBA 1N2OA 2G36A 4XVUA 4YRBA 4IFEA 5B37A 4YCLA 2OC9A 3U48A 1N92A 2VXYA 4RD6A 1L1RA 1KJJA 1O96A 4LOJA 2AF3C 1JKFA 3G8DA 4QQ8A 3V34A 4Y6SA 5ESWA 4AKTA 3M49A 2F2TA 3CSSA 1O58A 1YZ3A 2X76A 1UDWA 2ID8A 1L5HA 2YNMA 3DZHA 3I2GA 1LDYA 3PLRA 1XMQB 1LK5A 1VIMA 1RKVA 1Y7PA 3QKSB 4CLRB 1W2GA 3GLGA 1MJGM 4KU4A 4RH1A 2PD6A 3SIWA 2ZWVA 4LC9A 4UNQA 4BVGA 2Y1GA 4GSLA 3BRCA 4R81A 1E6LA 4LZJA 2QRVA 1R9MA 3GGJA 3JPWA 4KO1S 3TKAA 5A6SA 5CCXA 3FDJA 4NBRA 5IKMA 3DA8A 1QIFA 2J46A 3IIEA 2FLVA 3O4VA 4JT4A 2PTHA 2IPXA 2W90A 4YQEA 2AXQA 3CPHA 3PF8A 5KOYA 3EHDA 3M1YA 4FFOA 2ZUUA 2D2VA 3GMTA 4HN2A 2E37A 5ELMA 1LC3A 4JYBA 2GQ0A 1N7IA 3MQFA 4UC0A 2V7UA 4BC1A 1NURA 3VAYA 1W93A 1JNYA 3KYIB 4JNCA 3TNFA 2YJGA 5JQGF 3CE6A 3LUDA 4DQUA 2AJCA 3K53A 3WWEA 2CLSA 1YBAA 4H08A 4KQEA 3V1UA 3UWSA 2EAUA 3DZIA 2PS1A 5BV8A 1RP7A 2VSYA 4QXPA 3THOA 1YMVA 1G6OA 2C0CA 1TO1E 1O0SA 3V2GA 3IB6A 1RWVA 5KQSA 3W7BA 3EZ7A 1SBYA 1GGNA 2V74B 2F67A 2F8MA 3D7NA 4ZAZA 1RXVA 3PGKA 1NX6A 3H75A 2GD1O 4PFQA 1G9SA 3OHMA 1U9ZA 1CHNA 4E2ZA 2ID9A 1EP2B 3O95A 4JITA 3QYAA 4GI5A 1Z4IA 4KQJA 5HCIA 1J9EA 2WZCA 3WLHA 1GHTA 3VZCA 4A36A 3TFOA 4WKNA 3EVZA 3QPWA 4U8HA 2I4RA 3W78A 2W5UA 1Z0FA 3QXXA 4OPMA 3T7TA 1V35A 2MCFA 1ZUIA 4V02A 5HE8A 1ZDMA 3D7RA 3GHHA 3ZIAD 3EW7A 1CB0A 2BZGA 2L19A 4C4OA 1YZKA 4X9XA 4YMSA 1P75A 4QARA 1SOMA 5JAZA 2KB0A 3EZYA 3WYGA 3HEAA 1W6RA 2IK8A 5TPZD 1J0XO 5KSWB 2AJ8A 4OBEA 1R0XA 3OE5A 3RHFA 3W6ZA 1I14A 5AVSA 3ER8A 3CLRD 1YCGA 5K3BA 3OQPA 4EB3A 1UAYA 1CULC 4GBGA 3U6BA 1X3SA 2C77A 2G07A 4I50A 1H66A 4MQMA 1GTSA 5MFPA 1PK8A 1EFVB 1ESEA 3JQ7A 1XA4A 4B43A 2ZUBA 1UZLA 1AX9A 2GO1A 3SP1A 3ELUA 4DB2A 1RYBA 1RNLA 5KQRA 3OIYA 4AUEA 5EHGA 5GZ3A 2VNJA 1E7RA 1D5CA 4YPOA 3KAJA 1RTKA 2B83A 3U0BA 3NJ4A 5EWLA 5JE8A 1CWUA 3QPAA 3O4GA 1TKCA 3M0EA 4JC8A 3TOSA 3TRHA 4F5YA 4X62B 2JVIA 4BAUA 1O6FA 2WG0A 4PSVA 3SEFA 2CV1A 2WMOB 2QVYX 4IQ4A 2RDMA 2GCEA 1JYFA 1XO1A 3KAKA 3WQRA 2HKIA 3BWBA 3KE8A 3DEIA 2Y8EA 4P5PA 4MVYA 1FY2A 1H6DA 2PL3A 2ZUEA 1HLFA 1BOOA 1SBIA 1ZONA 2NXNA 3EBLA 4LZPA 1T2EA 4Q3LA 3EH2A 4WLUA 1VLHA 4N3CA 2XOXA 3DMTA 4W8OA 4D3DA 4OCZA 4HNGA 2PVSA 4YDHB 4FNAA 3W5HA 1SBCA 1USKA 2Y66A 5EZ6B 1HV8A 3G2QA 5LNK1 1TO6A 2C5AA 4GBMA 3NU1A 4MGZR 3OTWA 2E2WA 2VRBA 4HFJA 4PPQA 4ZCQA 3ESZA 1SB9A 3O8QB 3LZDA 4IIXA 5LUAA 2CEAA 3RG8A 2I6GA 4C4YA 4ZRNA 1I2ZA 1HYQA 2IBTA 5CVEA 3ZN2A 4BBPA 3JQPA 2UVPA 1C8KA 3ZHXA 1KEEB 2JBHA 3DBLA 3DHNA 1RYZA 3NUGA 4G3XA 3WZMA 3VJMA 4YYEA 4EHDA 1UZUA 1ND5A 2BN4A 3GLIB 2NO4A 2VTDA 3G0OA 1VB3A 2D1QA 3EGEA 1QFMA 3O8OA 4GG1A 4W8HA 3T7SA 3LJKA 3PUVA 4D9JA 5KWIA 1ZJZA 3MJHA 3ZE1B 2MSEB 2O19A 4FOLA 5JQGB 2OPBA 4X8OA 2IDMA 4MI6A 4A1FA 4DC1A 1IY0A 1R6VA 3DVAB 4NVRA 3WLMA 3QFSA 3LV8A 4DG5A 1A1VA 5BSVA 5DGXA 4CT0A 2J5QA 4IIJF 4U9UA 3WI7A 1Q7BA 5JBIA 4XPIB 1ZY2A 1VCOA 3P9QA 2G9QA 2QLNA 2YV2A 4FDMA 2DUMA 2JFQA 1EUDA 2EBWA 3DYIA 1MXHA 2NO5A 2XE6A 3GLSA 3Q8WA 4NH0A 2W2KA 4YAFA 4F5ZA 1CEYA 2WIDA 4YDSA 2OA0A 4MKGA 2PNJA 2Q0SA 1VBNA 3HU5A 4F8YA 2XCRB 3VC7A 2FK7A 1SPBS 3BULA 3WTCA 1M7HA 2CT8A 5L6MB 3IPRA 3DLHA 2YYSA 1Y3IA 3E9QA 3RS7A 3S55A 1M0SA 1DC6A 3IR7A 3V8PA 1TM5E 2W2XA 5EMNA 1JHRA 4JELA 1Z2OX 2OR3A 3EXEA 4QNNA 5C7LO 4LDAA 2AJDA 3KR0A 4G0ZA 4RCZA 2JIRA 2W58A 1JR3A 5AI9A 1XVLA 1RHRA 2CN1A 2O2YA 3DKPA 3E23A 1U7PA 5LBUA 5TQ0A 2H29A 3O73A 5L95A 2RHGB 1N8SA 1W59A 4Q1VA 2PUCA 1R6XA 3V9AA 3IQIX 3DD1A 1JLSA 2GVDC 1JLLA 2CXNA 4FBMA 4G5HA 4RIHA 3G89A 1WXXA 2H1RA 4LMRA 1FP1D 3HTXA 1EK6A 1XTJA 1HQDA 2GN2A 3CTPA 4UXJA 4RXMA 3W3ZB 1JT9A 1YRQA 2FCAA 1FNDA 3CYFA 4W5HA 4B3XA 2UXBB 3HP7A 2P2GA 4ZO4A 4E12A 3F2IA 2J08A 1IZ9A 1USGA 2GPNA 3RWMB 3I1FA 3HLTA 1FP4B 2Y0DA 3HVHA 3ZJ5A 1IUNA 4BMVA 2CLMB 3L0OA 3CEHA 2ZT8A 2ZP1A 2ARKA 2QJRA 4INPA 2ADOA 5E3JA 1K97A 1YJ8A 1L5RA 1TM4E 2LWIA 2XUKA 3ELYA 3QLVA 5E3HA 2O0HA 1WKBA 1ZIPA 4EI7A 4CW7A 4URXR 2QUZA 3VU0A 4QE3A 3IVGA 3IT0A 4KAAA 3EASA 2C5GA 3K5IA 1E1RA 4OJNA 2GA9A 5FUWA 2FSPA 4LV5B 1TUGA 3ZCUA 1IMOA 1Y1QA 2PWAA 4B8YA 1WMBA 3TECE 1MA3A 1D6NA 5DM4A 1L4NA 1L7BA 5J40A 3TH5A 3V4FA 2RIRA 1ZRNA 2FOIA 1TUIA 4R2XA 4FFRA 1NBAA 3PFNA 4NZPA 1O95D 1XROA 3DL0A 4G8CA 1WVGA 1TA9A 1XTBA 2EATA 3PX3A 5EWJB 3DO8A 2AUTA 2HDHA 3PGJA 2XWJI 5IDYA 1LH0A 1OWOA 1L7MA 1K5PA 1BAPA 4V0SA 3QTTA 1GM5A 5FPTA 2VTKA 3ASYA 4K0RA 2YWHA 3M5PA 5DW0A 2PS9A 3WRWA 4ETWA 4RL4A 4NFLA 5EZ5A 3EPLA 1C0PA 1P4JA 3A6KA 5LN1A 3GZ4A 4WCVA 4HC4A 4GPBA 5A4IS 1KEUA 1QYXA 3OQVA 5E6UB 2FW1A 1A27A 3G2MA 4RTOA 3FGZA 5JJCA 1M6NA 4W9RA 4N47A 1ODTC 1Q0LA 2MOKA 4BV2A 4G67A 4U2KA 4UNPA 1C1XB 5IZCC 1EU1A 3FMFA 3L8CA 1L4UA 3WAKA 4F96A 5BOVA 4U3JB 1E1CA 1JHVA 1DNPA 4NEGA 3WYEA 1UAAA 4L50A 4R2IA 3VH4A 4W9NC 5LYJF 3E9NA 3ZK9A 5ALDA 3FLBA 4Y2JA 3SN6A 2GEVA 3VR5A 5TIIA 4RYLA 3OSZA 3MK31 3IQEA 5EAIA 3U1TA 2W4QA 4IV0A 4BNWA 3PC7A 1G3UA 4KRXA 1CV2A 2DUUA 2HCFA 2OFXA 4J6EA 4BX9A 2FR8C 2V7EA 2DXIA 2GBLA 3B3GA 2HOQA 3HYCA 1HTTA 1LLUA 3N8DA 3PDIB 4NECA 4RVOA 5IFKA 2PBFA 3HCOA 1QGAA 5C4IA 1XDZA 4ZC1A 4R9NA 5C5DA 6Q21A 3CEMA 5TGTA 1TM2A 1GYRA 2PIAA 1B73A 3N07A 4MRNA 5E9AA 1XCBA 2QG4A 3DEJA 3IIKA 5G2OA 3WB9A 2HV9A 2Z8ZA 4M55A 4U2DA 2QTWB 4ZVLA 1QYIA 2FN4A 2JLVA 1X9GA 4OKIA 1ZIDA 3FSJX 2X14A 2KBEA 4PHFA 3FKQA 4XOIA 2IU0A 2NAPA 3VR5H 4MCJA 2IUEA 2O2ZA 4MV7A 1LBIA 3PICA 5G41A 3P9KA 4MPPA 2JEYA 2WYUA 1TF2A 2RMKA 3CR3C 3HKCB 4FKBA 4CUKA 4D0LB 3SVLA 2AK2A 4CKWB 4DM4A 3ND9A 3ZGZA 2V98A 3PT5A 3ONNA 3QBTA 5HM8A 3RFXA 5KTOA 1U3WA 2WQ7A 3JPYA 4R1SA 1CRWG 2ORED 1Z08A 3TTTA 1Z39A 4ZCTA 3VISA 1BVHA 1Y8RA 2FZWA 3AIOA 5T3UA 3V2UA 1HETA 3QUTA 4UM9D 1MC5A 4RKYA 3VHLB 4AMVA 3NH6A 4BX8A 2NMVA 2R0QC 3IAS6 5ESDA 3RUIA 2CZGA 3KR9A 4QHSA 4DIKA 4ONEA 1ST2A 5FOTA 4O0MA 1GGVA 2Q9UA 1XMOB 1EJ0A 2ADFA 3DDZX 4NESA 1XL1A 3EQ2A 4PVCA 1KQNA 2XCTB 5JISA 1U65A 5IH7A 5TPWA 4OMCA 1DC7A 1ZVMA 1RWPA 3ABOB 4C1BA 3I8SA 4F93B 3RIMA 1QOQB 4J16A 3MWGA 2FAXA 5A6SB 4BO1A 1S4QA 2XWPA 2FLKA 2I76A 1V8FA 2GXSA 2OECA 3PC2A 4X97A 4CLXA 4KR9A 3UMCA 5AOVA 3WWOA 2QAIA 3P96A 2CLCX 1VG8A 4I14A 2A1TR 1R4NB 4NMLA 4HATA 3E4CA 1AB5A 4BVHA 1CJMA 1SC9A 4WHMA 5HG0A 5J2TB 1CVRA 1WZUA 4EJMA 1RQRA 1KQGA 1KI3A 5KTYA 1GPDG 5ALXA 5CB4A 1J00A 1Y4AE 2J3QA 1FDTA 1AY0A 4GC5A 1X1BA 3THSA 5K7SA 3K5PA 3NHAA 2MSNA 3P9CA 1ZN9A 1NVUQ 1M1YB 2FUNB 2FPOA 2RG1A 1U9CA 1Q50A 3FCUB 4I55F 1XZPA 2B4QA 4TPKA 3QNMA 5ALNA 3UT5A 1JWLA 1G59A 4DCVA 2XUZA 3DZJA 5SY9A 3N59A 4TKZA 2WIGA 1IATA 5JDIC 2RGNA 2GXUA 4PSUA 4IMIB 4EX7A 1JG6A 1CNEA 2JGAA 1U8UA 4MIOA 3BH6A 3RBXA 2VL7A 1X1AA 2ISQA 1DOAA 2REQA 4FR0A 4KWEA 4QO7A 1ZWKA 1FNMA 1AQYA 1NIPA 2NUTB 3G2OA 3FNRA 4HNQA 4G86A 1CCWA 1NY5A 1YJ5A 1ECFA 1I01A 3HDTA 3O82A 2KE5A 2PSSA 2IIVA 2BFCB 2VDOB 3LT2A 1A5AB 4ZA2A 1EK1A 3C1TA 3TW8A 1OCEA 1Z0AA 2D7CA 3UZUA 4QDZA 5JPCA 4Q02A 2CJPA 2BELA 3ZZUA 4BVLA 1BROA 1E6WA 1OAOC 2G9ZA 5EIBC 3SIPA 2GD0A 1G7TA 3FHTA 2GN6A 4R9VA 3AOGA 1N77A 1IEQA 1OWNA 4X3PA 5EP2A 3QQPA 4XIGS 1PF7E 2GESA 3W1VA 1TEZA 3V5NA 4GR5A 3WB2A 1JAZA 2R84A 3DSRA 3GDWA 3IAHA 3AB8A 4KSBA 3VNQA 1R88A 1AZWA 2W2PA 4XVCA 2P9JA 3ZDQA 5D00A 5P21A 1FFBA 4WESB 3QFRA 1V7ZA 2VK2A 1GTL1 1HEUA 4JX8A 3OCWA 4BO4A 1KH2A 5K6RA 2IY8A 2Q28A 2W0MA 4NWIA 1IDOA 3ESQA 2ZJ4A 4BEBA 3CS3A 1JV2B 1L4KA 3G23A 3BK1A 4CM5A 5K8JB 3T5PA 3HBNA 3K72B 2QMHA 1K6EA 1ZHOA 1XNGA 1I0IA 4H1UA 3RRFA 2B5VA 3GV0A 3HHEA 5IARA 1KRWA 4KMOA 4EJSB 2Z3VA 3FM9A 1GQSA 1NBIA 2E55A 2XVZA 3IQZA 1KEPA 4C22A 4JFRA 4F4UA 1NUAA 1YB1A 1H22A 2ZJ0A 4YGXB 4B3TB 4Z2YA 3COWA 2X8AA 2LW7A 1I5OA 4CIBA 5I3ZA 2VQEB 4C2UA 3HYRA 4XWOA 2RSLA 2EKBA 2R751 1N32B 3NWPA 2QN3A 2E9SA 2ZI4A 2AJTA 1SXJE 2GI4A 3KL4A 2O59A 2VSQA 4POOA 1P2FA 1E5VA 3EC1A 1HORA 2CXUA 3FZGA 1NXQA 2W4IA 4FOOA 3NAQA 4G8JA 4RGBA 3D31A 4L0DA 3WB1A 2OMKA 1M83A 3DBRA 4YP6A 1RVV1 3FHJA 4LVNA 5K8LA 2ZREA 2I6XA 5J2UB 2VP6A 3OMLA 1UT5A 1W8IA 1UFOA 3PUJA 3CTMA 4J4BA 2ODNA 1DCMA 4X6UA 4IXMA 2XYRA 2AR7A 1JQAA 3GLHB 4NENB 5BWBA 3ZNOA 2Z9BA 1I7NA 1XTVA 1R5JA 2J30A 1URPA 3HB5X 2AMVA 4Q7LA 5A03A 3IKTA 4LE2A 1W47A 5CURA 4C29A 5ALLA 2RGXA 2NTVA 3BFPA 3L18A 1E2QA 1Y1PA 2YBDA 3T4XA 3KQSA 3DO5A 3GW8A 5KB3A 1D2EA 1TYDE 4J3JA 2HT6A 3JQAA 1MB4A 3PJDA 4GR9A 5KJ1A 4OXYA 2I2DA 4UHHA 4K9RA 5B1IA 1UXHA 1JS1X 4ZT2A 2VI5A 2H57A 3QF7A 2NO0A 4XW2A 4BVFA 1OXVA 4PWZA 5ADHA 1C3VA 4WX2B 1NATA 3VR2D 4XYMA 4LECA 2VYND 5LP6C 1HDIA 1HTBA 1KYWA 1SVUA 2KJQA 2IDKA 3DFUA 4RENA 3TKLA 4LFAB 5AVJA 1JHYA 1LJUA 4OK6A 5CYPA 1ULHA 2ZIVB 3N74A 4YREA 4ARZB 5THKA 4K81B 4YAWA 3RODA 4P7GA 4CVNA 2O50A 4G2TA 2B99A 1PJLA 1TQ8A 4QASA 4IW3B 5K0JA 3NR2A 3TEMA 3UMYA 4UZEA 3GDHA 2DPHA 2C04A 3ZJYA 4QG7A 2JJQA 5BYJA 3C74A 1HI9A 3HVKA 2W98A 1I4OA 4YMUA 2ZQYA 3EH1A 3AL3A 4RSMA 4IHKA 1DL5A 2BEKA 4QJIA 3C6ZA 4XQEA 1GAWA 4L22A 4D74A 5KREA 1E9AA 2BH2A 2ZSBA 1BG6A 3I2FA 4OHXA 2M32A 4OI1A 4A0FA 2FWNA 2C9ZA 4O5OA 1GITA 5HXAA 1SBHA 1JU9A 3DOCA 4DAOA 1AHNA 3FOEC 3CJRA 3WP0A 1S3SA 4XD7D 4NHEA 4B87A 4DLZA 3H5IA 3HUUA 1AV7A 5E8JA 4LFBB 1KBZA 4G23A 3T9FA 3NM5A 3VRHA 1NN1A 2WSIA 2PX4A 3CRNA 4HAIA 2YX1A 1N1GA 3DR5A 1Y1TA 1KVTA 5JALA 3OZSA 2Q3BA 3GUYA 3WLEA 3MG9A 5EMKA 1NY6A 3EXEB 4TSFA 3HN7A 3QSGA 4JUDX 2I9KA 1CPYA 4BFYA 1L5QA 3BTSA 4CIYA 3HNOA 5REQA 4BNZA 4RZ2A 1Z63A 3N7UA 4E6PA 5IFLA 1D8TA 2W2VA 3EQ7A 2EG9A 4OGFA 3V7UA 4ACAA 2V3WA 1O6CA 4GP7A 1VE6A 3TAXA 1SU8A 3ZXYA 4UD2A 3NI2A 2NU9B 2W70A 4QRDA 6ABPA 1UMCB 2JFNA 4GYKA 2VJAA 4L8WB 2Y1EA 2FZGA 1RRFA 3IKJA 5EIFA 2GDZA 2KM1A 3TG8A 3GUVA 4G1FA 4LAFA 4PGFA 1MIHA 3I6ZA 2A86A 4FUQA 3WAGA 1IQ0A 2YQ4A 3G0BA 2ROQA 4YP1A 1A9QA 2QK4A 4IS2A 1WVMA 4L4RA 1VTKA 4O2LA 5LIPA 1NVEA 1OR8A 4GMXA 4MNTA 4U9IS 1HL7A 3O8OB 3RK0A 4QUKA 3FAKA 5HKOA 2IYNA 1QDUA 2R00A 4EZBA 2XWSA 4L5JA 2PQ6A 2CKDA 2COEA 2CBGA 4XYBA 2I3BA 2C88A 4IWNA 4E5VA 1I9CA 2QN9A 2DFTA 1U7WA 2QB5A 2RHOA 2QE7D 4JA0A 2Y76A 4KQGA 5HOQA 1P5FA 4NJEA 2RBEA 2Y1CA 4KACA 4MUEA 3STHA 5FFFA 3V7NA 2R3SA 2WFAA 1PJCA 1BVYF 2ECFA 5LB4A 3BDAA 1PL8A 5FUMA 4JBLA 3CGWA 1XJWA 2R60A 4BE9A 3WJ7A 4B31A 4H16A 3SSAA 1P2GA 1SC3A 3I9NA 4RF5A 4UDXX 4W6ZA 4KO2S 3WK5A 4G85A 3WHIA 4HYEA 4ABYA 4BEWA 5F9HA 5KAMA 1ZH6A 5ESXA 4MQEB 5IJWA 2AE2A 2Q07A 2WYWA 2XPCA 2ZTHA 4P1ZA 1U6KA 3SQMA 1UIRA 3RUDA 1ULUA 3ZCVA 3W0LB 4CKYA 3HPRA 4HPWA 2XMSA 1MUUA 2ZAOA 3M81A 4R8RA 5FYQA 3WDKA 1NAHA 4EW3A 2HA3A 5IWCA 1MO5A 3WWPA 4YECA 2ODAA 4PR0A 3L8YA 1N6RA 1ORTA 1L5WA 3GGSA 4I19A 3TZCA 3VO1A 2XMBA 1NNEA 5EWMB 2C83A 4BZZA 4JEIA 5LOVF 4B3RB 3HKBB 5T67A 4MTCA 1Z6ZA 1GU1A 1KDRA 1LSJA 1NBMA 1T0JB 1WBJB 3N2ZB 4LY9A 5GADl 2UVDA 3DVLA 5ICMA 4KQ9A 1Q7TA 4FHCA 1EE2A 3L4JA 1SC1A 5FUVA 3A2LA 4O4JF 3VH3A 1LTKA 2X3YA 4UQLA 4AJKA 1AXGA 3UMFA 4ENTA 2ZB7A 3TTXA 3NCTA 3QKIA 5L45A 1KI6A 1U9IA 1Z5PA 3IV6A 3Q6IA 4MWSA 4WH0A 4Y2RA 5B6IA 2O8EB 1E79A 4LYHA 3KEQA 4TUYF 5IULC 2R7AA 3GFPA 4GPIB 1J0DA 1QIEA 1NONA 5FNVB 5KQPA 1VPLA 2O52A 2A58A 2LIPA 4MV3A 3EPRA 1XKTA 2O2GA 1UBHS 4TT3A 1G1MA 1JA0A 3DM9B 3L7DA 4PS0A 3U4GA 4Y0AA 1YTUA 1VYHA 2O5VA 2P3SA 5TC4A 5EZQA 4BNFA 4RTSA 1UM8A 1Q14A 1Y1LA 1CZKA 2I54A 1MAAA 3FCAA 2C99A 4YK7A 4Q6BA 2YVKA 3ASVA 4JL8A 3T1YB 3T0GA 4J3NA 2Z2XA 1XCMA 4DCTA 2X40A 4DS3A 1EVIA 1PK9A 1W581 2BWJA 3HFSA 1U7UA 3KT3A 1LRJA 5E7QA 1WSAA 4A27A 1WG8A 2I80A 3KSZO 3MUEA 3DZKA 2BKEA 3LC0A 3UMBA 3HU2A 2R79A 1LV8A 2HWXA 2Z9DA 4MMYB 4XKJA 1CZNA 2BEVB 3NHYA 4HAVA 5IH3A 4YQZA 5JZMA 3PNLA 4FCVA 4MDEA 2GEFA 4MKIA 2HFKA 1L9XA 4YAJA 4NX2A 2VT7A 1ULBA 2DOKA 3NFRA 3PXDA 4TZTA 2HSGA 3A1SA 3DMHA 3NRJA 2BVNA 4JYZA 3RREA 5C5EA 2F1OA 1I6KA 2JL1A 4KG7A 4B33A 4BLVA 3WL4A 2R1VA 2CFSA 3T1VA 2NPOA 4YXFA 1LPOA 3CRQA 2GASA 4IIYA 3KUXA 4PG6A 1W88B 4CF3A 1SY7A 4C0BA 4AUKA 1RIIA 2WZBA 5AK3A 1YMUA 3FZEA 2X77A 1LPMA 5K3CA 3RI3A 4KGVA 3H5TA 3ICWA 1FFHA 4C5CA 3COPA 1YS4A 4EENA 3ADBA 4H27A 2YZKA 4KYUA 4OREX 1IONA 2AVNA 3TSYA 2H4WA 1CFJA 4FGSA 2VPPA 5DHSA 3QUAA 2XUDA 4X44A 1EWYA 3NB0A 2HRDA 5CJ2A 3UNXA 1T6XA 2QBYB 1MABA 3GBPA 3O4IA 1NDQA 5DGDA 3W1WA 5KYWA 3LAWA 2D00A 4MS1B 1Z5WA 2PXXA 4DEYA 6ADHA 1MEOA 2B4TO 1EA5A 1KYTA 1PJZA 2QQGA 1SQ5A 2XCOA 3F97A 4QVGA 3EAFA 3O90A 3ZDEA 4BNTA 1BVRA 1JIUA 4O4IF 4RWZA 2EX1A 3KK0A 1JL3A 1L1QA 2DKFA 4TROA 4RA9A 1Y1RA 4I7EA 4WKPA 1SULA 2C92A 5MGNA 1YR8A 1QORA 5TQVA 2DERA 3PHLA 2DHCA 2XNDA 1EM8B 3NIGB 4IIJA 4R6XA 3RT9A 4QYXA 1D2GA 3FOCA 3OKCA 5AW5A 4HN9A 2WWRA 4F6CA 1KE2A 2CYCA 3RVSA 3IBGA 2BC9A 4D9IA 5GGXA 5A71A 4PAWA 3U40A 4DGSA 4YT8A 2WA1A 2DQYA 4NICA 4ID9A 1EQUA 3GOQA 4ODIA 3S7TA 2R65A 4GT1A 1OBHA 2FA9A 2RCNA 3BJMA 3IIMA 3MWFA 3JY6A 1YZVA 1E2EA 2IP1A 4JCOA 1CF4A 3L0CA 1WCIB 2F43B 1KR2A 5BNWA 3HP1A 4EEXA 2IHTA 3C4JA 1KA9H 5JY6A 3H0KA 4B76A 1S2GA 5B3KA 4HDMA 4RV9A 3KVVA 3G6WA 5DYIA 4AJ9A 4E2XA 3IP1A 3PTZA 3RU2A 4R1OA 3PDJA 5IMBA 1KOFA 2DMRA 4RHEA 4CLRA 5HGJA 3RBAA 2EKZA 1G21A 4BUJA 3QFHA 3CEJA 3SNHA 3IUYA 4F9TA 1D2CA 3ZOZA 4UZSA 3QWBA 3RTEA 4IF4A 4ETIA 2OXTA 3ZWXA 3T7JA 3HB4X 1E1NA 3EGDA 4LI3X 3JWHA 1HNNA 4YJFB 4A26A 3H9CA 4ZVVA 5B30A 1PFYA 3MYRA 1ZWLA 1O97C 1PWYE 2QUKA 1YRBA 2HJ9A 1PT8A 4FFBA 3KELA 3MJ4A 4BNVA 1OLXB 4P5DA 4CV2A 3CUWA 3A11A 1WX1A 3CIFA 4LXQA 2X1MA 1A2KC 4EB0A 4W5OA 5KTPA 2I5PO 1IUPA 4HLUC 3UMVA 1RXIA 2WILA 1P7VA 2FPSA 4MUFA 1RKQA 2IS2A 1ZLXA 2SKEA 3LC7O 3FVRA 3ZGYA 4CKCA 4LJRA 1DC4A 1QHIA 5A3VA 1P7PA 1MC4A 4RQTA 4D4HA 1NU6A 3SI7A 1CK4A 2Z0MA 3EGVA 4L9AA 1V9CA 3AJDA 1F8YA 4YY3B 4EKGA 1U63A 2IPAB 2C1ZA 3FSGD 4EX6A 2ZRJA 1T5BA 3I9V1 2Y0BA 4K9QA 1U5BA 3IJ5A 3KNZA 4YRZA 4L7VA 4MV9A 1IVNA 3CPSA 2XNSA 3M5WA 5HJ2A 7REQA 1FDWA 3CISA 2FUKA 3NIFB 4O4JA 3OQIA 3SM9A 2NLOA 1VXOA 1S3GA 2DTDA 3I05A 2WKPA