2GAAA

Crystal structure of yfh7 from saccharomyces cerevisiae: a putative p-loop containing kinase with a circular permutation.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
353
structure length
326
Chain Sequence
VDTHKLADDVLQLLDNRIEDNYRVCVILVGSPGSGKSTIAEELQIINEKYHTFLSEHPNVIEVNDRLKPMVNLVDSLKTLQPNKVAEMIENQGLFKDHVEDVNFQPVKYSAEETAVVARGGTANAIRIAASINIAQIVPMDGFHLSRRCLDLFKDPQTAHKRRGSPSTFDSNNFLQLCKILAKTSLKVSSTSSVFEKLSKTFSQTIPDIFVPGFNHALKDPTPDQYCISKFTRIVILEGLYLLYDQENWKKIYKTLADTGALLVYKIDIDYEATEERVAKRHLQSGLVTTIAEGREKFRSNDLLNGRDIDNHLIKVDNIVHIRNDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and functional analysis identify the P-loop containing protein YFH7 of Saccharomyces cerevisiae as an ATP-dependent kinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
molecule keywords Hypothetical 39.9 kDa protein
total genus 110
structure length 326
sequence length 353
ec nomenclature
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07728 AAA_5 AAA domain (dynein-related subfamily)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gaaA00
4GRAA 4Z54A 4DSUA 3HWSA 4GOJA 3CKLA 1UF9A 1B23P 3O8CA 1TUEA 2ZRJA 5FPHA 2VO1A 1KKMA 1UKEA 1W0KA 1E99A 1ZJ6A 5J47A 2O8DA 4M0LA 2QBYA 3U44A 1IY2A 2GHIA 2HJVA 3SBDA 4PAQA 2XTNA 1TADA 3H0KA 1D9ZA 1R5NA 2A5JA 1PLKA 2VSOA 3KQKA 1XJCA 1E0JA 2GNOA 4HUTA 1H8ED 3OE7D 5TVKA 2VP4A 2AK2A 5E7MA 2NZ8A 3UMSA 3WP1B 1TMKA 2JJ1A 1X8KA 4FMDB 1OYWA 1XZPA 4B2IA 1KO8A 4WZBE 1JEDA 1SZPA 3RWOA 2CMKA 2QN6A 1G6OA 2NPIA 1NMYA 3PJRA 1L4UA 1NIPA 5DLQC 3W8RA 3QKSB 1KHTA 2R6CA 4ZCMA 3D3QA 4QHTA 3EX7C 5TV2A 3X1DA 2LWIA 1W48A 1U81A 1YQTA 1AGRA 1CBUA 1J8YF 1KDOA 3BAFA 3CB4A 5EZ6B 2WM9B 4D82A 2MSDB 5TB5A 2FFBA 4D81A 1L8QA 3E70C 5FOXA 4Q7MB 4ASUD 5L3SB 1BKDR 1IOZA 4M9SA 1P75A 4KYUA 5J4YA 2WAXA 3QBVA 1NMZA 3ADKA 3EZ2A 2HXYA 5TARA 2ZANA 2V1UA 3QF7A 1OKKA 5J40A 2QEQA 1P3JA 3VR3A 3ZIAD 4DKXA 1MABB 2YOFA 2ZRIA 3RSOA 3UK6A 4HLCA 3RHFA 3W6PA 2W0SA 4B3GA 2ZVPX 5KUTA 4LHWA 3BIFA 4IXNA 3LAWA 1M7GA 3RRZA 3UPUA 1KSJA 2V6IA 4QBFA 3L2OB 3I1FA 5EXTA 4UNNA 1YHNA 2ZSDA 4DXAA 4URXR 1JBKA 1NP6A 1NRJB 2FZ4A 3TQCA 3KXLA 2JIZD 2DBYA 3Q5EA 4U7DA 2CHVA 3BERA 4HI0E 1JQJC 2Z6VA 4RZUA 5FOSA 2FOLA 2IEZA 3NG1A 3QY0A 1LS6A 4M1SA 1OIWA 2GCOB 3VFDA 1J8MF 5FUVA 4MGKR 4QHSA 4XD7D 2CEAA 1XTKA 3A1UA 3X1WA 3FB4A 4BFVA 3WBKA 3OEHD 1PV4A 2ZUCA 2FF7A 2N46A 2D74A 2ZR0A 2O52A 4OK3A 4IDOA 1D8TA 1J7KA 4Q48A 3IKJA 4XVQA 2I4IA 5DI9A 3DMNA 4QBHA 2VF8A 4HUQB 3LVRE 2C96A 4I4LA 2C04A 2FFQA 1YJ5A 4FXPA 4D80A 4A2QA 1NBMA 4IDNA 3A8TA 5JJLA 2YKGA 1J2JA 2RCNA 2A5FA 4L9WA 4LY6A 3RS4A 2ZREA 4OJQA 4WW0A 1FTNA 3PENA 1HE8B 1X86B 4BLSA 5HKKA 3SR0A 4A0RA 4URVR 2KWIA 2ORIA 1YZLA 5JRZA 2QMUA 2X8AA 4LZZA 3TNFA 1TF2A 4RCZA 1JAHA 3D8BA 3ZGXA 2D2FA 1VG0B 4LJ7A 1XF9A 4W5JA 2QM8A 4AD8A 2CDNA 4KFUA 2VHCA 3GJ7A 2O8CB 1E9SA 1RRCA 3HYTA 1OFIA 2GF9A 3QPUA 1WQ1R 4IVQA 3THWB 2WWGA 3AVPA 4IW3B 1R2QA 3X2SA 5KOYA 1Y3AA 3LQRA 1U90A 4UKDA 1ODFA 4TT3D 2OLKA 1FZQA 3THOA 4ERNA 3DM9B 5AUPB 1YVDA 4RD3A 4BFXA 3BC1A 1N6KA 1XEFA 1I4TD 1BS1A 3HR8A 2B8TA 3GD7A 1FPMA 1Z6YA 2R2AA 5IDVA 4QXAA 2JAQA 2QUZA 4Q9IA 2WJHA 1XFAA 2HJGA 5D3MA 2V9PA 4Q19A 2OT3B 2IYXA 3CPJB 3X1YA 2O8EB 4MGIR 1G8FA 3FKQA 3GFOA 3EWSA 4PSKA 3I73A 3TSOA 3UWOA 2FH5B 1I4LD 1FL9A 4ZIRB 2PZFA 3I62A 4LBWA 3KQNA 4DLWA 3TSWA 3I72A 3PEVA 4YMUA 3NC0C 2Z43A 3BGWA 1V43A 1GTVA 1PLJA 3NVAA 4LV5B 2A30A 2RH5A 3MJHA 1PUIA 1WBDA 1GIAA 2C98A 4E07A 1QHHA 4NCIA 4P4TA 1S4QA 1HQYE 1N6OA 4QGHA 1XNJA 2O8FA 4DCNA 1JI0A 1E1RA 1VIYA 1TPZA 2QT1A 1F2TA 2J7PA 3B2EA 5TMPA 2ZETA 4OHVA 1Z08A 4JVNA 1K5GA 4JZKA 2FPKA 1DAHA 1C4OA 3N2IA 3OFND 4UQOA 4A4DA 2H8KA 2AKAB 1P5ZB 4Y0AA 1QBKC 3LXRA 3SFVA 4ARZB 1II0A 2NGRA 2RAPA 1AS3A 2WIAA 3K0FB 2IS2A 4FIDA 1OHHD 1H65A 4Q21A 2WICA 2XGJA 2IHBA 3CF0A 4Q02A 3AF3A 4LUCA 1X1SA 4KSBA 2O8DB 3VX4A 2WSSD 3VX3A 4B48A 4BFYA 2XTZA 3DPUA 2CNWD 4NYMR 1MO5A 2PT7A 1R8QA 1U0JA 1Z29A 2GVZC 3E2IA 3SDZA 2IUTA 4S2EA 5LD2B 3WRXC 3LLMA 1T5LA 3DKVA 3QKUA 3I5XA 3W9YA 2JLSA 1XP8A 5BQ5A 3O8DA 2W58A 4FMCB 4O25A 1A1VA 3PQCA 1I4DD 2ZAMA 4M21A 3C7KA 1SVSA 3R9XA 1KNQA 2P6UA 4KVAA 4M2LA 1SGWA 4POAA 4Z1MA 4CIDA 3BS4A 1SKQA 5DN6A 2VQSA 5IK2D 2ZJ2A 2FEOA 4KJZA 2ZUBA 4PC6A 3RLFA 1ZRHA 5FI0B 3Q9LA 3HU1A 3RRNA 2QMEA 1UM8A 1XMIA 2W2XA 3K8YA 3ND8A 4B44A 1O87A 2ECKA 5C46F 4RY2A 3QEJA 2ZJZA 4JVMA 3EARA 2KB0A 3MUFA 4B76A 2JJ2A 3SQWA 2YWEA 4AY2A 3DOFA 4PHHA 1GAJA 4C0SA 1UAAA 2P5SA 3PFIA 3RC3A 4TTPA 1HUQA 5EE1A 4TL9A 3B1ZA 4OQMA 421PA 4WA7A 2ODNA 2Z0MA 2WWIA 4Q1BA 2Q9BA 5C4GB 4PC2A 4D2IA 2ORVA 2QAGA 1NF3A 1KMHB 1SVKA 3A4MA 5LB4A 2ZRLA 4NYIQ 1IM2A 1ZD9A 1MOZA 4ZPXA 1YRBA 3RS7A 1G9XA 3BH0A 3DZDA 5B57C 3H1TA 4TL6A 4NZYA 1GNPA 2QU8A 4P32A 2PT5A 2PZEA 3LO5A 3C8UA 3GEHA 1S9HA 3ONWA 3L82B 5FUXA 4JBYA 4Z8YA 1YR9A 5HE8A 2C9OA 1ESMA 2VEDA 5A0FA 4GBMA 3U5ZB 2BEKA 2FZLA 1KI8A 2RHMA 1N25A 1W0JA 4OQLA 1IN7A 1MRSA 1ETUA 1A7JA 5AUQA 2ZRKA 1E32A 3MWJA 2MMGA 3SHWA 2J41A 3E5HA 3N5CA 2RGNA 1LNZA 3NH9A 2BKUA 3MJRA 5C2JB 1P60A 4KV9A 1AKYA 1ZCBA 2NPFA 2QPAA 1E0KA 1SXJC 1WA5A 3GJ3A 5DSZA 2WWYA 4LRWA 4XH9B 5L3QA 1W2HA 5CJ2A 5P21A 1K5DA 3DHWC 4TMTA 4A8JB 3RS5A 1G3MA 2RMKA 3KKPA 1MR3F 3EIHA 2GRJA 1JPNA 3OEHA 4HLUC 2VHJA 2GKSA 4Q7JB 2VP5A 4LPKA 2ZRHA 2O8BB 1IXRC 4PO8A 1G3RA 2VP0A 2ZS8A 3UIEA 3PG5A 3A58B 4PR0A 3SJBA 4P0TA 4LHVA 1EFRA 5J4HA 1XPRA 4PQRA 4LOAA 1ZNYA 4I1SA 1QG2A 5BN3A 3U6BA 3IDQA 4DIEA 4Q4HB 2OFXA 3QE0A 2D7DA 3F8TA 2KE5A 3X1XA 3U7HB 5DI3B 4BFTA 4D4LA 4K81B 2AKYA 1M34E 3RRMA 2QM7A 3WNCA 3P32A 3NKVA 3QNUA 4DLXA 1SVIA 2OXRA 3ASZA 3QG1A 4F92B 2ATXA 3U3RA 1YZGA 3I4LA 1XRJA 4Q9HA 2OE2A 5JBQA 2VLIA 1MO4A 2YOGA 2CVFA 2NG1A 2ODBA 2BOVA 3VKHA 4HYYA 1ZNXA 4Q4JA 3DVLA 4PQFA 4DJTA 1QHGA 4HUQA 1F5NA 2VP6A 3QVVA 2GZDA 4KYIB 1ZCAA 4KITB 2G1JA 4CEIB 2DFNA 3R7WB 3DOEA 3T1QA 2ERXA 3TK1A 1GG2A 5JFGA 1RC8A 3WXMA 2HCJB 3ZH9B 1H8EA 2DWOA 3GEIA 3OE7A 1IONA 4ZDKA 5J4LA 2I3BA 2IWRA 4AURA 1E1RD 2BHRA 2WKRA 3K0CA 2DPXA 1RPZA 2JLZA 4NKRA 1XWIA 5FPKA 4KCGA 5L3QB 1G17A 1XMVA 1COWD 4D6PA 4V0MA 5IF9A 3GLHB 1YZUA 3IBYA 4XIGS 3TE6A 4A8JA 1PJRA 5EUQB 5C1BA 1JQLB 1KSHA 3MWKA 1W36D 1R6BX 4ZI2A 4AYTA 5HZHA 5C4MA 1G3UA 4V0OA 1WE2A 2ZU0C 4EPVA 4LCBA 2DY1A 3Q7QA 2W6JA 4BUJA 3HYRA 1GVNB 2D2EA 4LWZA 4RD6A 3AVQA 2VRWA 1E79A 3OEED 3ZZTA 4MKGA 3WBJA 3JZMA 1VPLA 4UNPA 3TLXA 1E9CA 1G7TA 1W44A 2FFAA 5DIFA 4EUNA 2D62A 4PZYA 5JWOA 1E2QA 2EFDB 4JYBA 3ZS9A 1U8ZA 4IOKA 3PCRB 4KI0A 3CIOA 2PX0A 2QTHA 2IBMA 3EIQA 3JVUA 2J7PD 3GLHE 4G3XA 4DT1A 1RVDA 3MLEA 4XD7A 2W2TA 1II8A 1VHLA 1WMSA 4HDOB 1HA3A 6Q21A 2CK3A 1OV4A 2B8WA 4TYPA 2C2HA 1LVGA 1NMXA 3THXA 4TZ0A 1FUKA 3TUIC 1RYHA 4QBGB 3BOSA 4URZR 4QJ3A 1D9XA 4ZO4A 5FR1A 4TSFA 2QTVB 4LV8B 2ZI5A 4HEJA 5CJPA 1I2DA 2VH5R 3EZ9A 3SI7A 2FSGA 2IYVA 2Q6TA 4PO1A 2YHSA 1RIFA 4CT5A 5FTNA 2RGCA 4LC1A 1AQYA 2GXUA 1T3LA 4JIMA 1QZXA 2V54A 4AKGA 4ON9A 2WPDD 1XJQA 3SS8A 3BWDD 3DMDA 2YWGA 1S96A 1G41A 1G21E 4E22A 1F2TB 2ONJA 4YXWD 3TW4A 2ZTSA 4BPBA 2HV8A 5KDLA 3N70A 2PH1A 4H9GA 3SJZA 2NOAA 2BCJQ 3NBFA 4FW9A 3L8YA 4KXFB 4PHTA 4RFSA 4UNQA 5JCPA 2DCUA 1D5CA 4PSAA 5GJBA 2P0EA 1TF5A 4P33A 3EZ7A 3HU3A 4MITA 1G6HA 3OIWA 1E3MA 4LK2A 2V1XA 3QUSA 3CWQA 2IEYA 1KDPA 3K0FA 2J45A 3NIBA 4HLUA 1N5IA 4P4SB 2IA5A 3ND9A 1IXSB 4TN1A 4ABYA 2OLJA 1BYUA 2CBZA 3QXJA 2R9VA 4X8HA 1RE0A 2J59A 2BBWA 1IN4A 4RD2A 3WHLA 4YXWA 1X6VA 4GNKA 3K70C 1JR3E 1NY5A 2GBLA 1E9FA 4QHYA 5CYPA 5EZ5A 1XMSA 3MRSA 4ILEA 2W83A 4TWZA 4FCTA 1DAIA 5H1YA 2IL1A 2QPTA 1U0HC 1TQ6A 4HZUB 4OJKA 1FP6A 4PTLA 2OZEA 4LJ6A 3SNHA 3B85A 4Q18A 3T1OA 1O3YA 3VR1A 1VG9B 4QNRA 1DBSA 2FX3A 2FSFA 1PUJA 1X8LA 3HJNA 3IEVA 5KTYA 5DGXA 5IRCD 4HSEA 2RGBA 4PXAA 3W90A 1CR2A 4BLQA 2YWHA 3H4MA 4PPNA 4B34A 4D4KA 2OM2A 5AUNB 3PEUA 3R9IA 4C0JA 3EA0A 1CJMA 4C0HA 1CJKC 3CR7A 4X8OA 4N3NA 4MYTA 1EXMA 4AWXA 1DO2A 1Z6XA 2QSYA 1KZ7B 2YVUA 3AF2A 3KB2A 3MMPA 3EPLA 1D2EA 1UPTA 1YZTA 2XX3A 1ZNZA 4OQXA 1N5KA 2WJJA 1DE0A 5DH9A 4NE2A 1NJFA 1VCMA 3QI2A 3VU9B 3RNLA 5DO9A 3SQXA 5F98A 2GZHA 4IFEA 5DYGA 2ZJAA 4N0EA 1E0SA 2BC9A 2QP9X 4DVGA 3THWA 3U3OA 1NG1A 1U0LA 4Q4AA 5IK2A 2ZS7A 3B7GA 1XD2B 4WIAA 5LBIA 4CYMA 3EPKA 1AK2A 4A2WA 3TVDA 1GNQA 2QSZA 3PUXA 4HAVA 4DB2A 4B74A 4MA4A 8OHMA 1OIXA 1C9KA 3WMEA 1ZM2A 4E09A 1ZC3A 1EFHA 2KJQA 2IX3A 5ELXA 1OXVA 1NVWQ 4LYHA 3K1JA 2PZGA 2IF0A 2KBFA 1OFUX 3DL0A 4G01B 1OH8A 4V0NA 3NWJA 2XXAB 2D06A 2CL7X 3SN6A 4L4UA 2VHTA 1W36C 1EFCA 5AWFC 3SJCA 5K8LA 3CRQA 4JJZA 4MRVA 4U02A 3S1AA 1HTWA 4Q5IA 1FTSA 3KFXA 2BCGY 3WMFA 4GMXA 2PJZA 3CH5A 3KJHA 1KO4A 1N6RA 1NN1A 4HZUA 3SC3A 3GLIA 1ZIOA 2ZJ5A 2JLVA 3AVXA 1CF4A 2HF9A 4KFSA 3TRFA 4QG7A 4BZPA 4RD4A 2ORWA 3KJEA 1YU9A 3I8SA 4Q47A 1CLUA 2FU5C 3CF2A 2AD1A 1CR1A 3L0IB 4XTRA 4LYJA 5HKKD 1EX6A 3FMPB 3MWYW 2O8FB 2GILA 4M1OA 2O5VA 3KKQA 1KGDA 1ESNA 2GJ9A 2HLDA 2YJTD 2GBLC 4JLVA 1GKYA 2BKEA 3T34A 2G0TA 5JHGB 1SVOA 1W0JD 2PEZA 1G7CA 2JJ2D 4MKIA 3QENA 5J5CA 5GADl 2MSEB 3CW2A 1NLFA 4Z1MD 4C0KA 1IJFA 1KYIA 1KI6A 4O0MA 4QGAA 2J46A 5CDFA 2WWFA 1WB9A 3M6AA 4LYAA 1TQ4A 3IIMA 4DBLC 2UVQA 1PZNA 3ICEA 1RZ3A 1E9AA 2YC4C 1WDTA 2HEIA 5FBLB 4F38A 1ZU4A 2OEPA 5FBVB 4BRUA 4KLZA 1LY1A 3CPEA 4TMKA 5JSZB 4IOJA 4ZKEA 4DDTA 4BZQA 4Q1CA 4UXIA 2CL0X 3KQHA 2XZOA 5BXQC 2AHOA 4R98A 4DLVA 1YKSA 4OYHA 5AK0A 2JLWA 2QROA 1P2VA 1Y63A 2BBTA 4KLNA 5CK4A 3UKDA 3P4YA 4DLUA 3ZVLA 4Q1EA 3NH6A 3M4YA 4M1KA 2V4ZA 2BMDA 2EFCB 2GETA 3S1AB 1EESA 1RRFA 4WZAE 2P5TB 3WP0A 2RHDA 1Z07A 3TR5A 3FKSA 1WBBA 1NLYA 2EFGA 3H86A 3QKTA 3R7WA 3GJ5A 2XITA 4V0LA 3X1ZA 4MYCA 1Z0FA 1FNNA 2GCPA 3QKRB 1VMAA 4GP6A 1R4AA 4TLEA 1IN5A 3TMKA 4A9AA 5B58C 4HDCA 4QOSA 4Y0VA 4NBSA 1X8JA 5H68A 4PSVA 1KNXA 2VA8A 3KTAA 1L2TA 3HR7A 4M8NE 1FUUA 4CEJB 4OI2A 3GLHA 3AH8A 1VTKA 1H8HA 4BASA 4I1VA 1ZD1A 4BRWA 3UMFA 2O0KA 3WMGA 2E1RA 2KSQA 2VYFA 2AFHE 2P2LA 1NN3A 2JLXA 2J7KA 1OH7A 3KKMA 1R7RA 1RYFA 3IEUA 1W47A 3WYAA 4KU4A 2B6HA 1EFRD 2YZ2A 3E1SA 4IDPA 4C2TA 2HDNB 1OB2A 3FMIA 5SZKB 3U3JA 2PLRA 1KO5A 3FWYA 1LTQA 3HPRA 4NTZA 5HCIA 5J4VA 5FOWA 4NYJR 5EE0A 5EXXA 1SVMA 1MT0A 4BLTA 2YC2C 4HB4A 4EDHA 4V03A 2Q3HA 4RKFA 5JHHB 4FMBB 1SHKA 2XTMA 3CWZA 4Q7KA 2F7SA 4NU0A 2ZJOA 3TQFA 3OIVA 2P6NA 2H1LA 2QNRA 2WKPA 5DNYB 4B3DA 2XNDA 1QDEA 1H8HD 4PAMA 3A36A 1M74A 2QG6A 2EFHB 3OFNA 3QIAA 4YDHB 3ZS8A 1XTJA 1Z6GA 2F3RA 1AS0A 2W2VA 4L16A 1JR6A 2RGXA 2ZPTX 5KNBA 1ZUNB 4FCWA 1N5JA 3DKPA 3IHWA 4RCYA 4WZ6A 5CIQA 3K9HA 1ONBA 5L3SA 4CDGA 1OHHA 1GUAA 1EFUA 1GITA 2WVJA 4LBVA 5HE9A 3FKSD 4DLSA 1U8AA 3IIKA 1G7RA 2XB2A 1M6NA 3G82C 5KYKA 3LA6A 2CNWA 4JS0A 1CJTC 4FN5A 1J90A 5G53C 2ZYTX 1IN8A 2CHQA 2IWHA 3O8RA 4A6XA 3R9WA 2YOHA 5FTKA 4IVRA 1CRQA 1II9A 3V9PA 4CEJA 1ZW6A 3K0EA 4U5XA 4MDFA 2IXGA 2CLSA 2HUPA 2J9RA 2IC5A 4MUAA 2JLUA 5EE9A 3CNLA 3UG7A 4HDQB 4DZZA 1OB5A 4YQFA 1Q1QA 3DEFA 3WY9A 1RJ9A 4NHOA 4Q01A 4R2IA 5F9HA 3GJXC 2OAP1 4OHXA 1W49A 2CL6X 4TL7A 2OBMA 3Q3JB 3FHOA 3B6EA 4DSTA 4PAOA 4Q4AB 2GEVA 2RGEA 4B47A 2B7BA 2Q3MA 3H2YA 4OQFA 3KUCA 3D6TB 5HTKA 2H18A 4Q9JA 4YDSA 4JBXA 4BEJA 2J5XA 3DM5A 2HYDA 1OE0A 5JEDA 4P3YA 2EW1A 2ZSAA 5GJVC 4WOPA 1Z3IX 4I1UA 1KI2A 4M9QA 1E0AA 3I61A 3AVYA 4CEHA 4NL4H 3GJ6A 4KVGA 3EPJA 1OJLA 4Q4JB 3THYA 4TYNA 1E79D 4QGGA 4UNSA 3CRMA 2ZRGA 3BFXA 1FQJA 1CJVC 1G7SA 3BE4A 3MSXA 1UDXA 2FSHA 3WHKA 3R8FA 3REFA 4ZCLA 3UXMA 1W5SA 1OXTA 3C4JA 4TLAA 5JI3E 3NHBA 3U60B 2PJRA 2EYQA 1K8RA 3EXAA 1F60A 3LH5A 1OXXK 1NLZA 2WOOA 1VHTA 3TAUA 3C16C 4DHEA 1A2BA 5JEEA 4PPQA 1KDTA 5K8IA 1ZD8A 1N3BA 4MGYR 1HT2E 4RJLA 3FHCB 3IQWA 4TYQA 4LC0A 5L3RA 5JI2E 1CKEA 5JJKA 2IS4A 5KO2A 1FNMA 2ZRPA 4OHYA 2F1HA 2NZJA 2C9CA 2QP4A 2BEJA 4LHYA 4B2PA 3CNOA 1AIPA 1Z0KA 2RKOA 3F5FA 3U4QB 4XVRA 2ZSEA 2ZS9A 2V7QD 2O0JA 1AQUA 3KQLA 4TQ9A 1A2KC 2ZJBA 4NYIR 1PLLA 5EJEA 4TL8A 3DZ8A 1KAGA 2JGNA 1Z63A 1ZC4A 1XD9A 3W6OA 2C77A 1U8YA 1BO6A 2MMCA 5JMTA 2NQ2C 1E4YA 5FPTA 4PC1A 4MQBA 3TSZA 2WHXA 3K70D 2OV2A 2REOA 3T1TA 1UBCA 3EA5A 4NDZA 1NG9A 2GWHA 3QXHA 3NTUA 3U2QA 3B1YA 2W6ID 3BB4A 2V3CC 1QVRA 3VAAA 1E9DA 4CEIA 1KJZA 4O2LA 2F1JA 5CDFE 2NMVA 1JB1A 1CR4A 1OYYA 4CF7A 2GAOA 2R8RA 1FMJA 2OILA 2H7VA 3CX6A 2XNSA 2FFHA 4QRHA 4ESVA 2OSBA 1KZGB 4F91B 1YE8A 2OCYC 1VCOA 1W7AA 3A1TA 4B3XA 4L9SA 4IOLA 1UDWA 4UJ5A 1W36B 4TMWA 4AK9A 1Q57A 2WJVA 1MO6A 4WVFA 2H16A 1Z22A 3KZ1E 4MRNA 5CM9C 3ZQJA 4ARZA 4DSNA 3GLFB 1P9NA 1GFIA 1UEIA 1Z06A 3RS2A 4OHZA 4C4PA 1Z5ZA 4LBZA 2GXSA 1JPJA 1ZU5A 5EXSA 3Q72A 4PHFA 5FOUA 4B3FX 2XJ9A 4LJAA 4IKEA 3A1VA 3FTQA 1OF1A 1AZSC 1Q1BA 5FTLA 4B32A 2ANCA 4XTCS 2XAUA 2FDCA 3G0HA 2CCJA 3QPWA 2NO0A 1Z0DA 3T15A 3ZZ0A 3EWAA 4ZDJA 1QHYA 3AVOA 4GOXA 1P62B 2HF8A 3B82A 2N42A 3LQQA 2FPMA 1ZUIA 4QM7A 5AJYA 1WRBA 5BN5A 621PA 4A36A 2BJWA 1G5RA 3ICQB 2FE4A 4JLDA 1EFTA 3NHAA 4OI0A 2FSIA 2VHQA 2GCNA 1LF5A 2F9MA 2ZRNA 2CJWB 1QVAA 1NY6A 1OIVA 2ZR9A 3CLVA 2DHRA 1TF7A 1MKYA 4ZKDA 3BJIC 3LRPA 2XZPA 1DAFA 3NBYC 4GPTA 3AVWA 2H17A 5JWHA 4JLKA 4HAYA 1LFDB 2R62A 1XTIA 1P72A 1E2KA 1GRNA 2OAQ1 2VL7A 4BE7B 3C5CA 2AL7A 4YMTA 4JVLA 2IUSA 1T4GA 2J3EA 4LPSA 3WYFA 4JT2A 2CE7A 2FA9A 4OI1A 3GLGB 3K70B 3RRYA 1GSIA 3FPAA 3SE0A 3Q5DA 5BWMA 4FMDF 2GJAA 2HCBA 4QKQA 2OG2A 1P6XA 4IFBA 1I2MA 1W5TA 3HU2A 1HT1E 1P2UA 4WBSA 2OFWA 1US8B 2AFIE 1E2NA 2F9LA 1CP2A 2CLDX 1NVVR 4RD0A 2QAGC 2RGAA 3OIUA 2IYTA 4DEXA 3A4NA 3T1VA 4GMDA 4ITRC 1T8TA 4P4SA 4AG5A 3EW9A 4V02A 1U99A 2ZITA 3QPVA 1D2MA 1E2PA 2V8OA 4YMWA 1E4VA 3RS0A 3U7GA 1T91A 5EXPA 4GP7A 1YR7A 2IF2A 4KO8A 1KI3A 4F4JA 3EG5A 4D4JA 3ZVRA 2ZSBA 4ACBA 1N6PA 1TU3A 2XXAA 4JKIA 5FBWB 2Q9CA 2VF7A 3SYKA 3AKDA 4HLQB 1GRRA 4ZIRA 3KXIA 2BM1A 2F6RA 3LY5A 4MRPA 4NCKA 3T35A 2FWRA 2PCJA 2FN4A 1HE1C 4RFVA 1LF0A 2IYZA 1G291 1AN0A 2F3TA 1W4RA 3EC1A 2A5YB 4EJSB 5F2EA 1F2UA 2QY9A 2FJUA 4MRSA 1E9EA 2EFEB 1JJ7A 1AJEA 3AGQA 2G83A 3VR6A 3MCAA 1HV8A 3H84A 1G4AE 5AJZA 3AP2A 3PEYA 1E96A 5F3WB 1W4AA 1ANKA 1KSFX 3CX8A 2BBSA 3OESA 3W8NA 1G18A 3AGPA 2QRNA 2PEYA 2ZI4A 2GK6A 1IAQA 1E9BA 4R7ZA 3RABA 2DFKB 2JJ8A 3K9GA 4I99A 3KQUA 1CR0A 4JSYA 2WJIA 1DTSA 1XU4A 1G8GA 2FEMA 4JSTA 2WJGA 4Q1AA 1TL7C 1W4BA 1MABA 3O8BA 4DLYA 1JXOA 2DFTA 2GK7A 5KSPA 4DDVA 3REGA 4BFSA 1DG3A 3ADBA 1CRPA 1XZQA 1XXHA 5F9FA 2FG5A 3Q8XB 2WKQA 3PEWA 4QNMA 2IXEA 3AF4A 3ZJYA 3IQXA 1T0HB 2C9YA 5FBQB 5KDOA 2GA8A 1TNDA 4C0BA 4D0LB 2UZIR 2Q0HA 4XOIA 3R8CA 1XMJA 4G5RA 1P2TA 4DIDA 3GMTA 4JLPA 1VYTA 3KUDA 4RKEA 3ZVMA 2IYRA 3HDTA 4UXHA 1GNRA 4EKDA 3U61B 3GJ0A 4K46A 3A6PC 2X1VA 2LKDA 4F4CA 2WBLC 3THXB 5L8VA 2G0NA 2SHKA 2GAAA 1XEWY 4QM6A 1OXSC 4EFMA 1GDDA 4PANA 4BGDA 3EZFA 4LJ4A 5LB2A 5JCZA 1KO7A 1D6JA 3BD9A 2WAYA 1SQ5A 1VECA 1DAEA 2DB3A 1DARA 2J1LA 2CCGA 2J0UB 4Q9KA 5TXGA 2ZVQX 3I3SR 1R8SA 5UKDA 2P3SA 1MH1A 2C95A 5JJIA 2W00A 4A92A 4Q00A 1A82A 4EFLA 4O3MA 4CVNA 3AUYA 3GCGA 1TX4B 3TH5A 4EFNA 2TMKA 3BFKA 1G8YA 3D31A 1A5TA 4EPXA 1VKJA 2ATVA 2WMNB 3WRYC 1E1QA 1EGAA 2NO1A 3IHLA 3L0OA 5H8WA 5G3YA 3FE2A 3M0EA 3VHXA 1DELA 2HT1A 4RFSB 2Z83A 3VKGA 2LKCA 2IXFA 3BB1A 4QJ4A 4Q7LA 4HB3A 1HYQA 4RZXA 4TQAA 1NSTA 3LD9A 2R44A 2WZQA 5FFMA 3U3MA 1AZTA 1KMQA 3LXXA 1T6NA 4PC7A 4NONA 4DCVA 4US1R 4Q9LA 1M1YE 2AWOA 5KNCA 1S3SA 4XJXA 3K0SA 5FTMA 4V0KA 4LJ5A 1EX7A 4XSGA 2WPDA 3J81k 3KFVA 2LCFA 1R0ZA 5GVSA 3K0AB 4H1UA 3U4QA 1R5OA 3IPXA 1BMFD 1P9WA 2R6FA 3U44B 3LX5A 2BDTA 3BK7A 4I1OA 4LBYA 1DAMA 1T3SA 3KL4A 1KKLA 1II8B 3L0SA 2JLYA 3TVTA 1XEWX 2HLDD 3GLGA 2WV9A 1HY3A 1HH4A 4NMMA 2PLFA 1G4UR 1FP7A 3AEZA 4M4SA 721PA 2GF0A 1Z0AA 5FL7A 3T61A 3FFBA 4A8JC 2RGGA 4BWYA 2FGJA 3CNNA 5KNDA 3VTKA 1AGPA 2A78A 1KK2A 2Q9AA 2ZAOA 3CO5A 5JWRA 3C41J 1LS1A 1OFHA 3IILA 3KKNA 5JRJA 3EASA 1E69A 1E2FA 1Q3HA 2A7QA 2QZ4A 4DCUA 4C9BA 5CB8A 4DUGD 3QJYA 1RW4A 4PFSA 1BIFA 3B1VA 1SVWA 4S35A 5DHAA 4IHQA 5JZVA 5CIWA 1QHHB 5E7IA 2QRZA 3KTAB 4L15A 1E1QD 1UBEA 1ZNWA 2EVWX 1MO3A 2ZE6A 5G41A 3P27A 3FYHA 5KPJA 1KJYA 1GKUB 2WIBA 2ZJ8A 2VPPA 1M7HA 3TR0A 3W3AA 3VU9A 2WMOB 4B3BA 2X2FA 3ECCA 3ETLA 4PPFA 1IJEA 2PX3A 2VBCA 3N2EA 1NNEA 2F43A 3TUZC 1E2DA 2XSZD 1E2MA 4NP6A 3GQBA 2ERYA 1E2HA 3MG9A 2C5LA 1RJ9B 3BORA 1US8A 4FD2A 1RKBA 4LX0A 4XWAA 1C1YA 3MFYA 4DRZA 1JEEA 1GM5A 4LYFA 4LJ9A 4II7A 2IYYA 3LBNA 2JATA 3O47A 5E3HA 1G64A 4A0GA 3ZQ6A 5H70A 4O2RA 1GRQA 3BRWD 4A82A 3PXGA 4B33A 3OAAA 2JCSA 3PITA 4IOMA 3CH4B 1G1MA 1Z28A 3KDSE 3TKLA 5B30A 1IXZA 1EK0A 4D26A 2CK3D 4B2LA 1KK0A 4C0QC 2HT6A 3GFTA 2H57A 3ASYA 4PZLA 5FL7D 1SXJA 1TEVA 2D4HA 4C30A 1J99A 2JLRA 1GL6A 1R5BA 1DG1G 2G3YA 4E03A 4EPRA 3BXZA 2EU8A 1VYVA 2ZRBA 5G3ZA 4BEBA 4GZMA 1ZP6A 2NO7A 3RAPR 1YRAA 2OCAA 1DPFA 2BMEA 4JVSB 4M1MA 5HZKA 821PA 1XCPA 3NDBB 4HATA 4GT1A 3FGNA 3W34A 3AVUA 1ZM3A 4NPHA 2REXB 1RRPA 5CB6A 2P67A 3P4XA 2PMDA 2RGNC 2K5UA 4CRWB 1NL3A 2QE7A 4GZLA 2IT1A 3VQTA 3ZLJA 3W5JA 4KODA 1VCNA 1Q12A 1TAGA 2J0VA 3TAHA 1R0XA 1XJ0A 4BQSA 2PMKA 4MKFA 4TLBA 1P73A 1Z0JA 1Z6AA 4ZDIA 4US2R 5FUYA 2BMJA 3G5UA 3QXCA 3AM1A 2QTFA 2REBA 1X3SA 1N6NA 3QVUA 2OUKA 3UMRA 4B3CA 5BYKA 4BLOA 3MWLA 3IPYA 1XEXA 3PR1A 4URWR 4DUGA 3GJ8A 3TJZA 1NBME 1Q20A 4M1YA 1KIMA 4TZ6A 4YMVA 4DCTA 1CU1A 1NVUQ 3CRW1 2IUUA 4AYWA 5EP4A 4G1UC 4B6EA 5LPNA 2ZE7A 2WWWA 2Z4RA 2ZYWX 4G5SA 1W1WA 2OHFA 3OAAD 4MRRA 5SZIA 3KJIA 3LW7A 2DYKA 4JL6A 2BMFA 3BBPA 3F0TA 3PUYA 4M22A 5JECA 5IT5A 5J4KA 5B2ZA 4QC2A 4GL2A 1SXJD 4L5BA 5D3MB 1OH5A 2BVNA 1GILA 4Z8XA 2EWVA 5AUOB 1VCIA 1P9RA 2QQEA 3RANA 1SULA 4QBIA 4BLRA 1E98A 1UKVY 4P4UA 1XXHE 4A0HA 2FGKA 5SZHB 2VP2A 3AB3A 4JT4A 4XVUA 3CONA 1R0YA 4LHXA 2FPLA 1IQPA 1QRAA 2IYSA 4A15A 4TT3A 4B75A 4AC9A 2CLCX 2VSFA 3AV0B 3EAQA 3T5DA 1U94A 1TTTA 5LDDC 4LDJA 2C78A 3LBIA 1SKYB 1F6BA 2XB4A 4OQNA 4B43A 2BWJA 1NI3A 3ZD6A 1FQKA 3B9QA 3UG6A 4M1TA 3CR8A 4MYHA 4TTRA 2JDIA 4W5HA 4EQ6A 1DAGA 1Z0IA 5HR5A 4R71A 5JS8A 4YONB 2O8BA 4ACAA 2IHYA 3V4FA 4RVCA 1N6HA 2X2EA 4MH0R 4W5WA 4YC7A 2G6BA 1XXHB 1FX0A 1G5TA 2J87A 5JLJA 2QBYB 3K53A 3B1XA 1XEXB 2VSXA 2R6DA 1KK1A 4IEIA 5A5GA 1XPOA 3GJ4A 3AVVA 1S1MA 3IO5A 4C0AC 2P6RA 2O0HA 2VP9A 2ZE8A 2ZRCA 3C14C 2X77A 3B5JA 3MGCA 2JJ1D 1N0VC 3FOZA 1DS6A 1SKYE 1HURA 3LNCA 2W6IA 2IYUA 1N6LA 1OH6A 1S2MA 4G5QA 1Z6TA 4WXRA 4JYCA 1XB2A 2O8EA 5AJWA 3NBZC 3QKSA 2XJ4A 1GL7A 2VTKA 3FVQA 2JA1A 1KO1A 3ZZUA 1JXMA 2FV8A 3UWKA 1XTQA 1UBFA 2J0UA 4WXPA 2QPOA 2GJ8A 4E5UA 1W2GA 1AKEA 1YR8A 4HLDA 3F3YA 2H5EA 3VHLB 4EJSC 5CLLA 5K8UA 5FUWA 4RZ2A 3VNVA 3CBQA 4G5GA 2D3WA 4FWIB 4AYXA 3NBXX 2CE2X 1A4RA 1JECA 2ZUDA 1KI4A 1WF3A 1NKSA 3I8XA 4LV6A 4QJ5A 4GFDA 2I1QA 4MKHA 2AN9A 3GLFA 1T8UA 2AWNA 5FBRB 2ZYVX 5FOVA 4LGMA 4TSFD 4EPYA 5GJCA 1BOFA 2Q21A 2HYIC 3QF4A 4DLRA 1S1CA 2BIFA 1FMLA 3IGFA 2RB4A 1KI9A 4JJKA 1XD2A 2A9KA 2ZJYA 1M7BA 1NKTA 4EQ6B 4FI3C 2ZI9A 3WNDA 2F43B 2DWQA 1FOEB 2XOKA 5KDDA 1L7VC 1CEEA 1S9DA 2YWFA 5B64A 2QAGB 3C5HA 2ZSFA 3ZDQA 4BFZA 1FX0B 2KBEA 4NCJA 5DN6D 2P65A 4A2PA 2GCOA 4UXJA 3KKOA 1G16A 2G88A 3DDCA 5EP2A 3CZQA 1F48A 3EPHA 4OI4A 1OFTA 4CZ2A 1TQDA 3CF6R 3P20A 3QQ5A 2R6AA 1U2RA 2D7CA 4TMVA 2ZM5A 4TMZA 3B9PA 3JZAA 4EPWA 3QXSA 1ZIPA 3ZD7A 1VDZA 2WWHA 1KDRA 3NDPA 4IRUB 4I81A 4KFTA 4HB2A 2QL6A 1K6MA 2FNAA 1WP9A 3THYB 4LHZA 2C99A 1W4CA 3AVTA 4BFWA 3KJGA 4ZI3A 3AKEA 4M9ZA 3OZXA 1CIPA 2E87A 2A2ZA 2ZI7A 3LV8A 2G9NA 1W46A 4DWJA 1G5PA 3SZRA 3NC1C 2AR7A 2OXCA 2C03A 3T5GA 3FMFA 2DFLA 3UANA 2UKDA 4CGZA 3MD0A 3A1WA 4M53A 4AKHA 1DVRA 5BYJA 1S0UA 1E2LA 1NSFA 1XD8A 2X19A 2ZQ5A 1TQ2A 1DO0A 1E2IA 4TTQA 5FTJA 4D0NA 5M04A 3ZVNA 1Z8FA 1EWRA 3Q85A 3RC8A 1ELOA 1N0WA 5KSZA 2YYZA 4ZDWA 5EUMA 4ESHA 2A3RA 1RRGA 1Z2AA 4XSHA 1QHNA 2ZU6A 1UKYA 4IXMA 4D4MA 1OSNA 2CCKA 4AI6A 4UNRA 1SXJE 5FPYA 3B13B 3QSYA 1OW3B 2QT0A 3FDIA 3LLUA 3QF4B 1JALA 4X8LA 4LI0A 2VIIA 2W6JD 3GP8A 1IN6A 2ZI6A 4TLDA 3W3ZB 1JAIA 1KMHA 2QQ0A 4US0R 1KSGA 3I92A 1SHZA 2G1KA 1N5LA 3CPHA 2CXXA 2AXNA 3L43A 4PHGA 1VG8A 1HEIA 4IEEA 1Z47A 1TUIA 1OLOA 4X8MA 2DWPA 2XNDD 3QG5A 2FMXA 2XZLA 3AUXA 2GJKA 3ZIAA 2ZXUA 4URYR 1L4YA 1LW7A 3RWMB 4Q03A 3PUWA 4JLNA 3U6KA 5SZJA 3U7FB 1SXJB 2NIPA 3Q7PA 2ZIAA 3K0CC 4HAXA 5D3QA 3LVQE 1Q1EA 4HB0A 1NIJA 3B60A 2R6GA 1F3OA 1B0UA 2QENA 3D7MA 1QHSA 2WWXA 4UJ3A 3SJAA 2GESA 2BV3A 5E7JA 4G0NA 2QGNA 5CM8B 5AJVB 5K8TA 1CTQA 3RDPA 4HAZA 3CZPA 1RFLA 2KI5A 3VKWA 3GPLA 5EE5B 4JKYA 4URUR 3ADCA 4XWKA 2QA5A 2NTYC 4OHWA 5HCNA 3PUVA 5CK5A 4JLJA 4FWTA 4C7OB 4EAQA 1AM4D 4DC9A 4JMPA 2AX4A 3OHMA 4C3ZA 4PQYA 3KXKA 2IYQA 3TGPA 3U3KA 2WJYA 4ZCIA 2F1RA 2O8CA 2GEDA 1JNYA 4ZV4A 3PUZA 1QG4A 2A5DA 4OL0A 1FW6A 1IHUA 4BFUA 3SBEA 4Q1FA 3HPQA 2QGZA 2GEUA 3LFUA 1ZMXA 4DCSA 1G3IA 1KY3A 4GSYA 1Q44A 1KI1A 2OO7A 4KAXA 1E94E 1XX6A 1KTVA 2IYWA 1G8HA 2JEOA 3SYNA 1T0JB 5CYOA 3TIFA 4DSOA 1MV5A 1OT3A 1Q1ZA 3BFVA 1V5WA 2QE7D 3RSLA 1YR6A 1E2EA 1R0WA 2BBOA 2DR3A 1PVOA 4YMSA 5DISB 4KBGA 1CS4C 2F1IA 2GZAA 2ASEA 2WSSA 3CUEF 2AD5A 3I32A 1LB1B 1ZINA 1T3HA 4V0ME 1S3GA 1GP2A 4L8GA 2EYUA 4MGZR 5KSYA 1AS2A 2XSZA 4M1WA 1GWNA 2YV5A 3AKYA 4B6FA 4GOKA 1KJWA 4PZZA 5FOTA 4RSGA 2QMHA 3T12A 1QF9A 4OK5A 1R10A 2MSCB 3WNBA 5BN4A 3AKCA 2Y8EA 2JASA 2EWWA 2RGDA 3WYGA 2V55B 1U9IC 1N0UA 5CITA 2WOJA 4R2HA 2GXQA 3OF5A 3SYLA 1YZKA 1GZSA 1CJUC 1E6CA 4BLPA 2H92A 2EQBA 5LD2C 3CX7A 3LWNA 3A1SA 3LW8A 1P61B 1JJVA 4PO9A 1ZVQA 1CXZA 4JBWA 4TMXA 4KBFA 3T06B 4DLTA 4NYMQ 4DB4A 2XEXA 1KI7A 1TEXA 3CRRA 1UADA 1VYUA 3K9NA 2ONKA 1XPUA 5CLQA 3I5YA 2HXSA 3GEEA 4AKEA 1ZM9A 4TYYA 4W7SA 4LJ8A 4AKIA 4F93B 4U00A 4GDFA 3VR2A 3QXXA 2ZRMA 4GI7A 1KY2A 5FI1B 1KI6B 3VMFA 2W0MA 2J0QA 1ZM4A 4Q66C 5HPYB 3FFAA 1NBMD 2OBLA 3P26A 3K0AA 4MYUA 4ASUA 3GFPA 1BMFA 1ZM7A 2ZRAA 3IIJA 3TW8B 1DAKA 5FR2A 2PL3A 4OKSA 1NJGA 5TY0A 3P1JA 3EZ6A 1XCGB 2ZRFA 3PV0A 2QP3A 4JL5A 1VG1A 2ZE5A 3A37A 2B92A 3V00A 4DT1B 1XCMA 3VNUA 2C8VA 4W9MC 4IJMA 4CEHB 1NVXQ 3K9LA 4RD1A 1ZYUA 4IDQA 3B78A 4MDEA 3GLFE 3V4RA 4WAUA 3RYTC 4F4IA 4CT4B 2CJWA 4R9UC 4A6PA 4AIIA 4EJSA 4EIWA 4D25A 1F2UB 1SVLA 5FH9A 1KK3A 5EE3A 1QHIA 3BH7A 4OBEA 4A1FA 2BM0A 4DEYA 4XWOA 3AP1A 3HP1A 2XOKD 1GL9B 1KOFA 2QMOA 1T5IA 3LBHA 4FINA 2OFOA 1M8PA 1N6IA 3R20A 1Q21A 4FCVA 4HAWA 5L3VA 4PX9A 1G19A 2QAJA 1WCV1 3LDAA 3A4LA 2ZI3A 3AF1A 4OK6A 5JS7A 2ZR7A 1P7CA 3K09C 2F55A 4QL3A 3QKRA 2PBRA 3BB3A 2ZEJA 5KSOA 2GXAA 1U98A 3DO6A 1JR3A 2ZRDA 4K8OA 3ZYCA 3W6NA 1E2GA 2ANBA 1BH2A 3AF0A 3QOFA 1QHXA 3ADDA 1M2OB 3IBGA 2Z5FA 2V6JA 5ANRB 2CHGA 1E2JA 1FFHA 1GOTA 4NYJQ 1BYIA 4Z51A 2ODEA 2VHUA 5EQTA 1LV7A 2IW3A 1IY0A 4BECA 4YLGA 2ODWA 5GJWC 2I1VB 2JIZA 3KX2A 4KSCA 4C0LA 1ZBDA 1XDBA 2ZYUX 1G3QA 3JVVA 4NCHA 3FMOB 4TLCA 2B7CA 2OCBA 1OXUA 1UFQA 4N1AA 1XTSA 2OBNA 2QI9C 5DHFA 2YNMA 2BJVA 4IVPA 3QEOA 5EP1A 1JR3D 1G8PA 1D2NA 1NN5A 2GTPA 1S8FA 1DOAA 1VIAA 2Z4SA 2YINC 2G77B 1NVVQ 4HZIA 1EG7A 5AJXA 2GDJA 2IK8A 3OIYA 4DDWA 3VR4A 4C2UA 1AA9A 4FMCF 3AP3A 3K09A 3QBTA 1UEJA 4JLMA 1TU4A 2E9SA 3OEEA 4RZ3A 5EP3A 4JLBA 2GJSA 4KFRA 4D0GA 4J0QA 3NXSA 5FL3A 4NH0A 4TQUS 1Q3TA 4P31A 2OESA 1XTRA 4CW7A 2AK3A 5DE3A 5IHPA 5KU1A 1KAOA 3L8ZA 4G5OA 1UBGA 3C15C 4DDUA 3KB1A 2GVDC 4N0DA 5GVRA 2NO6A 2IS1A 4JLOA 3SOPA 1COWA 1DADA 1OPXA 2JLQA 4B35A 3LX8A 3TUJC 4QFMA 3FHTA 4BZXA 3VR5A 121PA 1X1RA 3RVBA 5KPDA 521PA 2Q3FA 1Z83A 3B8HA 3SU8A 3NEJA 3M1IA 5C18A 5KHOC 1IY1A 3EC2A 1IBRA 1HQCA 1W0KD 3CM0A 4JLAA 3GLIE 2N1BA 4KHZA 2WSMA 4Q4HA 1UKZA 2R65A 1P2SA 4A0FA 2CVHA 5E4FA 4EPTA 3L0PA 1Q0UA 1UJ2A 1Q22A 3BH6A 5DI3A 3U7EB 4B73A 2WTUA 5A4JA 2B21A 5E95A 3W5IA 3TBKA 1ZUHA 2L0XA 1P4SA 1ZAKA 1E9RA 5FPSA 3PIRA 4TYWA 221PA 3UATA 5JSZA 1DEKA 1CULC 4DLZA 1T9HA 1WXQA 1NN0A 2IYLD 2AXPA 4QGFA 3IUYA 4Q1DA 3IO3A 2NO9A 4MUBA 4PC3A 1GKIA 2UZ3A 3SEAA 5AR1A 4F7WA 1J70A 3SHFA 1YZNA 2IS6A 3GLIB 2V7QA 1YZQA 1MRNA 1Z2CA 3CRVA 4Q4LA 5BW8A 2QORA 3B1WA 3SFZA 5TDHA 4LJYA 4M9XA 1U9IA 1OKKD 4H1VA 3RS3A 3AQ4A 2OCPA 4JL8A 4IDHA 2J0SA 1N2CE 2A5GA 4NCNA 2ZROA 3PVSA 4HAUA 1G20E 3GLGE 1EWQA 3MAAC 4B71A 5DYIA 4AG6A 2PCLA 1XBTA 3EIEA 3NEYA 4PPGA 5G40A 4C7OA 4LSGA 2JDID
chains in the Genus database with same CATH superfamily
3ZH2A 1FTQA 1YGYA 5I7RA 2A9VA 1NXQA 3HWSA 4YRFA 1N57A 4GOJA 3FRJA 3CKLA 2HWUA 4HDRB 2ZAGA 1ITZA 4KRYA 4NOJA 4FJ2A 4MPPA 3TI9A 1B23P 1T25A 1KJ9A 1TUEA 4F9GA 3Q8MA 5FPHA 1L5RA 3K0BA 3VI4B 1SKUA 1A7AA 3CE6A 3N76A 3QQPA 2B8NA 2AEMA 2VDRB 4D42A 4FYJA 1RAAA 2HJVA 2EDCA 1QNLA 2E4YA 3SBDA 1NASA 1WLSA 3H0KA 1DBRA 2AOVA 1GKLA 3EHDA 3WK4A 1WCIB 4HUTA 3OZBA 4EABA 3D2CA 2WSIA 3UWSA 1F51E 5B6JA 5DASA 3FPGA 2IPMA 5CNMA 2GN4A 2QZ9A 4WZBE 1AUOA 1P31A 3ACBA 2CMKA 5FO0A 3K8OE 2QN6A 1TCVA 4U6NA 3K16A 2GHQA 2QMQA 4HF7A 4OGWA 3NV7A 4U7WA 2R6CA 3LCJA 3ZVKA 4M0CA 5FWXB 1UQUA 1Z2OX 4GW3A 3A27A 3M6VA 2WPNA 3SXPA 4D3SA 2CVOA 1N7HA 1YQTA 4CCWA 1O94D 2CB0A 1E5DA 3CB4A 3BAFA 1YC2A 2CBGA 3JAWB 3MRVA 4CIWA 4DMUB 3A6DA 1V47A 4DREA 2ZIEA 4PX2A 1GPMA 4KPUA 2GTHA 2XUHA 3ROQA 2PO7A 4GPZA 4ASUD 3TM5A 2GPTA 3G68A 3L02A 4HJXA 4KWTA 4RAOA 2ZUEA 3OZTA 3TO5A 3IA7A 3H1FA 4QQKA 1NMZA 3G1TA 3EZ2A 1HZZC 2NPOA 1L5HA 1YDGA 4L5JA 2BHSA 3N53A 4IJ5A 1VE5A 2I2CA 2P2YA 3ZIAD 4DKXA 1HLFA 4YV2A 3QX3A 1MABB 4WZBB 2ZRIA 3UK6A 3CRZA 2NZWA 3K31A 1P44A 2C8JA 4JJFA 3OQIB 4YFVA 5KUTA 3W7BA 4YXFA 4F3TA 2VS1A 4IXNA 5TF0A 3LAWA 4A8PA 4KUGA 3QFCA 1SUSA 3QTLA 1FYFA 1OYVA 4M38A 3UPUA 2QD2A 4E1BA 5EXTA 4UNNA 1YHNA 2C5SA 4DXAA 1IB0A 3H1BA 1Z3CA 5CU7A 1JAYA 1PK9A 1JBKA 3FNGA 5AW3A 5P8WA 2ECFA 3ZV3A 2DBYA 4N3GA 5CGZA 3WO0A 4U7DA 4CFSA 1HNWB 2R1TA 4HI0E 1V6SA 4MAMA 1ZH4A 1XMQB 4JXZA 5HMMA 2EIXA 4MS1B 1JKFA 2M6LA 5CG1A 5E4TA 4F96A 5FOSA 4AP5A 3FPJA 4HXEB 4M1SA 2YUTA 4MWZA 4CDNA 3VFDA 1OR8A 1J8MF 3O6VA 4MGKR 2OZPA 1UQRA 1Q0ZA 3OT4A 2MHCA 1CD5A 3K20A 3R3JA 3ACDA 4DARA 4DMMA 4J2OA 4KQHA 3T3GA 3PNBA 2PS3A 1NJ2A 4ZAXA 3RGWS 4CLHA 3WBKA 1O57A 3T7CA 3B1JA 2ZUCA 2FF7A 3RD5A 4FDMA 1YZHA 4N5IX 3VOAA 1HL3A 2J32A 2I80A 5GZ3A 5KX5F 3R5SA 2REQB 3RTGA 3W5HA 1PJSA 1RHMA 3BK1A 3MINA 3BJEA 1U3UA 1WPGA 3O5AA 3LVRE 2HBRA 4RGBA 1NQWA 3ROZA 2PX5A 3EDRA 4G4GA 3FTFA 1NDUA 1FRZA 1EK1A 2C04A 3JQAA 3MTQA 2A1UB 4DQKA 2HR1A 3RUEA 2O7QA 4Q93A 4E4TA 4A2QA 1XKLA 1SQ6A 3OFVA 2C7BA 1Q0QA 4ZQHA 5EZSA 5GIPE 2VXYA 4ZHQB 2UUAB 1XQXA 3E84A 4WNAA 5SYMA 1J2JA 1MX9A 3U31A 1CK4A 4LY6A 3FDZA 4O2BB 4D02A 5HHTA 2P4QA 1SB9A 5AHOA 1TEHA 1N2IA 2Y66A 1IBMB 2G40A 4BLSA 4MEJA 5IT0A 3NETA 1JVBA 4QTUB 2KWIA 4DCGA 5JCOC 2C57A 3CSSA 3NMUF 2Z57A 4TV9F 1DQYA 1DBWA 2WU8A 3D8BA 3FN4A 3N58A 1OTHA 3Q0EA 3HCNA 1O95A 1VMEA 1V1RA 4LJ7A 4W5JA 4FOTA 2D5CA 1UDRA 1N2XA 2J9YB 4PZDA 2VHCA 2IH5A 1F20A 4CI0B 3HYTA 3OPNA 3WDLA 3IIEA 2GF9A 1EPUA 3QPUA 1CF2O 1PFQA 1G4HA 1Q7BA 1WQ1R 1LBEA 4UQPA 5CDTA 2Q8PA 1R6AA 2FP4B 2EKZA 1CY2A 4MINA 2HHHB 3X2SA 4IDAA 2C42A 1E1KA 1Y3AA 4B83A 4X94A 2O5EA 2IZ5A 4I4TF 4CM6A 4YT2A 2B78A 1FVHA 2RB5A 3GN2A 1K4KA 4RPKA 4YJ2A 1IBKB 3ABIA 1UBSB 7MDHA 1YVDA 1F3LA 1QIGA 1XI2A 2VK2A 1KQPA 2X0IA 4RPJA 3TQRA 5BSKA 1XEFA 4AFNA 1DEOA 2YZNA 5HRUA 2XXBA 4PWZA 4BDSA 1MH9A 3RFTA 4XYEA 3FLBA 2ZIZA 4QXAA 1RMYA 3U4MA 4I14A 3UGJA 4ANFA 1DV2A 1XFAA 4WERA 3B9RA 3HCAA 3JSAA 4Q19A 4ZD6A 2ZTHA 3FKQA 3GFOA 5CH8A 2Q41A 3KNZA 4PSKA 3M70A 4TZTA 1T3TA 2VYVA 4G4JA 5DHRA 3A9RA 4ZIRB 3TGLA 1YF3A 2PZFA 4E5NA 3FWPA 3KQNA 4PLPA 3L3BA 4DLWA 3TSWA 3EHEA 3I72A 1UXIA 3NC0C 1WF6A 3BGWA 2HHJA 4IDFA 1GTVA 4PRYA 3TYXA 4ZEXA 4A27A 4B8WA 4DG5A 2RH5A 2P3QA 1PUIA 2NVOA 4K1LA 1GIAA 2ADOA 1NRXA 1I94B 2C98A 3MMXA 3GUHA 3OFKA 1LH0A 3W1WA 4HV4A 3CZAA 4DXDA 2OK7A 4CQNA 1HDYA 2PT9A 4ABTA 4UZEA 4DCNA 3L6OO 3WB1A 3OFSA 2YQ4A 5F7OA 3WGJA 1RRVA 1C9YA 4UUAA 1QIIA 1VIVA 1S3FA 3BMNA 1BHSA 1YL7A 2VHVA 1QH1B 4JZKA 3OTHA 4DPMA 3MWEA 1C7RA 3AHGA 1V6AA 2G8NA 3PR3A 1JQ5A 2BR5A 2G9QA 1PR4A 4UEKA 3OFND 5A9TA 2H8KA 4D9EA 1P5ZB 3L0CA 1ND6A 3VO2A 3T1HB 5JPDA 4WKCA 1II0A 1KIAA 3HVIA 3O3MB 2NGRA 2RAPA 4UHEA 4B45A 3UICA 1M8JA 3K0FB 4QFCA 5EKSA 5EIHA 4B4KA 1H1TA 2VG8A 2YMLA 1QV6A 1RLUA 1ZA2A 5JZSA 1DBQA 3ZE7A 4UUMA 3USCS 4BMSA 1Y33E 3O8QA 5FTWA 1NMEA 3OZWA 2GPSA 5CDYA 3MJSA 2O8DB 3N2ZB 3U1VA 3VX4A 1F2DA 1QQ7A 1IM8A 1YI1A 1ZI9A 1SC1A 3ICOA 3VX3A 1MRZA 2AEJA 2F17A 4BFYA 4Z1OA 4PW0A 3HY4A 1CUCA 5U1PA 3OOEA 3KB6A 2PT7A 3HM2A 3KS9A 4EHNA 4WTOA 3E2IA 3ON5A 1K8QA 4DMRA 3SDZA 4S2EA 2G5TA 1DJMA 2PMEA 3DKVA 1FIUA 3CQ9A 5EZYB 1Z36A 5K0GA 2VPZA 1BOOA 1PYGA 3DE0X 3WI7A 1QLWA 5MN6A 5BQ5A 1VLHA 2I03A 1B14A 2W58A 4FMCB 4DOMA 1A1VA 3CY6A 2GOYA 3A1FA 5DNAA 1N33B 4NWIA 1J8FA 3P9KA 4WCDA 2XYRA 2F2TA 1ZKDA 2CKDA 1KNQA 3JVIA 4GI3A 4M2LA 3WB2A 1U3TA 2OPBA 1WTCA 4WBXC 3HBLA 4G8DA 3JQRA 2IV3A 2PX6A 4CIDA 1IPEA 1SKQA 3IPRA 4O4LF 4D9MA 2VQSA 3LRXA 5IK2D 4QLOA 5DCLA 1V6CA 4CG3A 3I9NA 2ZUBA 2EOAA 1YR2A 2XVAA 4GVXA 4CL8A 1PTJA 3V6LA 4LSMA 4NF2A 2FPPB 1XVIA 1SG6A 2H48A 2QMEA 1UM8A 2W2XA 1OUMA 2CYCA 3CX4A 1VJ5A 3GA0A 1E3IA 1O87A 4DN6A 5A4FS 4OTZA 2ZJZA 1GQQA 5LA6A 4MTLA 1ESEA 2ZBGA 1PWHA 2KB0A 3INYA 3MUFA 4QTZA 3U7IA 3T9CA 2WYHA 2JJ2A 4ARVA 3SQWA 1PF7E 3H17A 2EGGA 4AY2A 1P1BA 1GAJA 4JXKA 4WKPA 4HYTA 4OMDA 4DV7B 2PT6A 2JBAA 3R5JA 4TTPA 3RC3A 4EG8A 4FFSA 3UMYA 3B1ZA 3I9V6 4OQMA 1CY8A 421PA 4EF4A 4EX7A 3EF1A 4KDCA 4ENQA 5LP6A 2EP7A 2Z0MA 2WWIA 3GFFA 5C4GB 1DDOA 1P1IA 3PT9A 4IP0A 8LDHA 3E05A 4FDAA 3AFHA 2J08A 1SVKA 2BI7A 2QYTA 2CFCA 3GFSA 3UO8B 4MJ7A 3ELYA 4YWJA 1Y7TA 5AMXA 3G5MA 3TF5A 1G9XA 1M1UA 3W8FA 1RHRA 4PLZA 8ADHA 1WSWA 3DZDA 3RK4A 3H1TA 5AI6A 1JH9A 3LWBA 4IRXA 4P32A 2PO5A 5CDSA 3F3KA 5AO9A 3LO5A 3VUFA 2XQVA 3C8UA 5LMNB 2PTHA 3DGEC 2RH9B 1JQAA 4KE7A 3L82B 4NY1A 1NBEA 2V9CA 4MHSA 5FUXA 2IU0A 3BVPA 4Q9AA 1S01A 3OWHA 5HE8A 3KLPX 1PRYA 3EWIA 3D2AA 2C2XA 3NTQA 1N25A 1XT6A 1Y5RA 2I55A 1MRSA 4R1TA 1DZ3A 3LC1O 5CRIA 5AUQA 4BU1A 5IANA 3KV3O 1HZJA 1WL8A 2Q3DA 2CXRA 4RTMA 1Q83A 3AWDA 4MKRA 2ZG6A 1LNZA 3OU7A 1HYEA 5IAOA 2UYGA 4KMSA 1NSYA 4R05A 5JO0A 4JB2A 4M7OA 1QQ5A 1KZ9A 2Z5GA 3OE5A 3ZV5A 5DSZA 1N4AA 1P45A 4J1QA 1XJ5A 3EEFA 4Z4HA 4XQEA 4KV7A 1UBOS 2Y6UA 4BNWA 1GQOA 1N0HA 4Y8VA 4EA6A 4ITVA 4RVGA 4B3HA 2A33A 4TMTA 2KLBA 2YJZA 2RMKA 3RFFA 1XXLA 4G36A 1FLDA 3EIHA 4EG5A 3EZGA 3MWGA 4HLUC 1B93A 2VHJA 4F84A 2JH9A 1PD1A 2VP5A 3OCZA 3CEAA 4WN9A 5GGXA 3R7AA 4PO8A 3CLHA 5JJBA 4OXYA 4V2IA 4BN4A 2G9RA 3M4NA 3H5VA 3JSXA 3DNPA 3ISVA 1AE1A 4L7VA 5IHXA 5AD1A 4CETA 1QG2A 2NZXA 1RLTA 1IEXA 2O6LA 2PZ8A 4IIDA 3G7UA 5EEGA 5BN3A 2BFOA 3U6BA 4M86A 2GLTA 3DA8A 1BE1A 4PS0A 2O7SA 3N28A 3QE0A 4JUAA 1P8JA 3VPXA 2K2WA 4B4WA 3UJ7A 4BFTA 4D4LA 2OBFA 3EXFA 4ZVQA 1G9TA 1M34E 3B8EA 4X6YA 1GLVA 3P32A 3NKVA 4KO2S 4YK7A 3ASZA 5FWAA 3AMVA 1EXNA 1YZGA 3I76A 5AM0A 2JF0A 1E60A 3AYZB 3HSYA 2OE2A 4KAJA 5DBIA 1M83A 1LDGA 3L07A 4K9NA 1DXOA 2O7VA 1JIUA 2XLCA 2ODBA 1TVMA 2BOVA 2PUTA 3UHFA 4XQ9A 4I1PA 3QVOA 2PN1A 5K3BA 3IQEA 4I9HA 3K72B 2OO5A 3V97A 1SBHA 2DERA 2JI9A 1F5NA 2AIRA 3BSWA 3F78A 4IMRA 4L3WA 1E18A 1K8XB 4F6LA 1GQ2A 1H1DA 2BHLA 3ICWA 5J63A 3WIEA 3O4HA 1JHYA 1IHXA 5EMLA 3UGQA 1ISPA 5KTTA 3E3AA 2HCJB 3GEIA 5H9VA 2VJKA 4BX0A 1QGAA 1M34B 2I3BA 3E5NA 3LGSA 3P9IA 2ZQZA 3NIFB 4AURA 1FQWA 2DPXA 4UHCA 4CMBA 5AHKA 2NU8A 1XMVA 4Q05A 4EYSA 2X4GA 4PYMA 1COWD 4LZLA 4D6PA 3GLHB 1WHSB 5BSMA 1EZ1A 2KM1A 3TRJA 1DX4A 1E5XA 3B70A 3WYCA 1LSUA 5KNDH 1CZUA 5EUQB 2DTEA 1E2BA 1KSHA 4OUDB 3CINA 4UZSA 3MWKA 5D3KA 1W36D 4O1MA 3UNXA 5CFLA 4AYTA 4YYZA 5C4MA 4L0MA 4V0OA 1WE2A 1G8SA 1NXSA 2CW5A 1YA6A 4EPVA 2CDCA 3I6MA 5B1SA 3FYUA 4CMAA 3G1WA 1P0CA 2GF2A 4P53A 1NZJA 2FZGA 2D7DA 1VI6A 5JC1A 1E79A 3IP1A 3WBJA 2WU3A 4HS9A 3TLXA 1ND5A 2IU3A 4RMIA 4EZBA 4IIJF 3H5NA 1W44A 3M7IA 1UOPA 4J07A 4KGXA 4EUNA 3FCAA 3PPVA 2NSHA 3Q98A 3BICA 1NNEA 1VSQA 2BN4A 5A4MS 3PXAA 3ZS9A 1U2ZA 1LTKA 4KI0A 4ZOQI 1Q0LA 2LNDA 1Z45A 2HHLA 3DWFA 1BFKA 3JVUA 2Y3IA 2J7PD 3GLHE 4JB0A 3HNPA 2I4OA 4XD7A 2HGZA 3H18A 1Q7EA 2W2TA 4J9VA 4QRIA 3DSRA 4UD2A 4P2GA 1VHLA 1VJGA 3GH3A 4MZXA 5LXTA 3L84A 3SC2A 2YRXA 4PBTA 4CTJA 4JUIA 4TZ0A 1SBNE 3AI3A 4Z2YA 3FCCA 5F3RA 3BOSA 5LZ2A 4J7UA 4P3OA 1EVZA 4NATA 1ML4A 2JGIA 4XOUA 1EDBA 3PJFA 4CMIB 1I2DA 1L5VA 5HBGA 1I7DA 3COVA 4YIHA 2VC2B 3NOXA 1RIFA 4RSRA 1NXWA 3OF3A 5FTNA 2Q2QA 3LP8A 4E46A 4D6XA 2GXUA 4X66B 3N6RA 1MJ5A 3RODA 4YRZA 2V54A 2CF5A 4J29A 1NVMB 2NUPA 3GG9A 2WPDD 1MXHA 1IDN1 3P8ZA 1XJQA 4N5LA 4ZVKA 2YMPA 4LDAA 4BKUA 1JW9B 2RHRA 2WZBA 1A9QA 3H9GA 5TMEA 4ZXPA 4E22A 1F2TB 2ONJA 4QRDA 3TW4A 4YXWD 2HV8A 5KDLA 3IJEB 5IC5A 3B52X 3O8OB 5EUBA 1NFRA 5HKKD 5LP1A 3NBFA 4YJGB 5JDIC 2MR6A 4HFRA 4XGRA 4KXFB 4BC1A 4GEGA 4UNQA 5AVTA 5GJBA 1D5CA 3S2UA 5HJ7A 2C9MA 4C01A 1AU9A 3L7IA 1LTHR 1WU7A 2F62A 4TLMB 3DBHB 1WKCA 3OIWA 3T7AA 3U09A 2J9GA 1NOKA 3QWFA 1PWEA 4ZEOA 4CV3A 4LF8B 1PR1A 1LZKA 5AKKA 3HR4A 4OPMA 3KDPA 4MR7A 4P4SB 3ND9A 4JEUA 4M0DA 1OXMA 1IVYA 5AW8A 5A06A 3R09A 3WNVA 1LVHA 1XMPA 4OSPA 5CVDA 5C9ZA 1RE0A 1BG6A 1KFJB 4KO1S 1ARZA 3ZWCA 4RD2A 4X92A 2VT7A 2OMKA 1YSCA 3V42A 1DEAA 3C98A 5CT6A 4JP1A 1CQXA 2A5LA 3U56A 2GBLA 5CYPA 3JD2A 1IZ0A 3R6TA 5EHGA 5EZ5A 2G5GX 2NUTA 3SXJA 2G70A 3HI4A 1TQ6A 4OJKA 1R6UA 2Z2YA 1IQRA 4NIMA 1YVPA 2HBQA 4Y67A 5F5LA 5FWXA 3UJ6A 5C8YF 2RI1A 3WNQA 3VR1A 1QZZA 4QNRA 1DBSA 2CLHB 2OR3A 4WN3A 4I1YA 1USGA 3BMQB 2VDKB 2GARA 5KTYA 2C4UA 2C97A 3HO8A 5DGXA 5I7WA 5IRCD 1N75A 4Y2XA 4H1TA 2GHRA 2HA3A 3HBJA 4OQYA 1BDHA 1LU9A 4PXAA 5CPFA 4MQMA 1DIRA 5CH3A 3CUUA 4B34A 2C61A 2Y68A 3L05A 2GM9A 3NDIA 1MUUA 4S1WA 3EA0A 1VP3A 3LWZA 5T8KA 4O59O 2Z1NA 1D2CA 1R0CA 1KH2A 1NXPA 3OCUA 2VSYA 2C1XA 3F5DA 4QU0A 4RMNA 4AJIA 4EHHA 4CLOB 2EP8A 2YNMC 4AWXA 4WFJA 1DO2A 1QYCA 1BWSA 1KZ7B 1Z6XA 2WUFA 4GI1A 4C08A 3IVGA 4KK3A 1ZNZA 2X6QA 3VZSA 4S05A 3DP7A 1C41A 4GVPA 3VHQA 3HY6A 3ABZA 5B7QA 5CVTA 1XWWA 2DBRA 3T5PA 1VCMA 2Z5VA 3W2HA 3SQXA 2WJPA 5FV4A 4EGQA 4OGLA 4HWTA 4LY9A 2XDAA 2BRUA 2WA1A 3HKDA 1IUOA 4DVGA 1QIFA 3JQGA 2ID8A 5IK2A 3B7GA 1XD2B 4CYMA 1KEUA 3BWBA 3TVDA 1GNQA 1Z38A 2ALJA 2QSZA 3PUXA 4E94A 1RTKA 5LQKA 4DB2A 1QFMA 4MA4A 4J6FA 8OHMA 4FHZA 1FFAA 1WZNA 2LD4A 2B2XA 2IX3A 2CXSA 1EFHA 1BW9B 2JS7A 3DHNA 2NACA 4XE5A 1V0JA 3DL0A 4G01B 1K06A 2QVCA 3QVTA 1JHMA 4JGGA 4E2XA 3GNTA 2XXAB 4FS3A 2D06A 2OQ2A 1M0TA 1MEOA 1C7ZA 3O92A 4YASA 4M60A 3Q3VA 4PNZA 5GV7A 1L4BA 3WFJA 1RPJA 2X2PA 5E3JA 3WLQA 4E31A 4EKEA 3IX7A 1ZK3A 3BMCA 3CRQA 4U02A 1L0BA 1HTWA 4Q5IA 2EGHA 3WMFA 2AVNA 1SIWA 3D6FA 1PV1A 3QVWA 4LXXA 1HDGO 4A91A 1K2WA 3FJYA 3GRUA 4Q3LA 4QULA 4KFSA 1LVUA 4FFDA 3NFRA 4FCCA 3TRFA 1JDSA 1YBHA 3KJEA 2P5UA 3E53A 4HVAA 4KREA 1W75A 1YU9A 3M9XA 3PYMA 2FU5C 3CF2A 4MX8A 5B6IA 1CR1A 3DE5X 2Y6VA 4S1TA 2O8FB 5JH7B 5IU6A 1S6YA 2GILA 2Y0BA 2O5VA 1FU7A 3PUKA 5JBNA 1KGDA 2WU4A 2YWBA 4KN8A 4RIHA 2O4CA 4JLVA 3NIGB 3ZGVA 3KT0A 1EGHA 3SIWA 3TSYA 1M2GA 5EJ5A 1JFRA 5KJ1A 3UGTA 1OVMA 2QN1A 2G0TA 3TJMA 5CFPA 1G7CA 2GZMA 2JJ2D 3GK3A 3Q9NA 2OO3A 1J7JA 3QENA 4HEHA 2MSEB 4NXMB 3ZE8A 2P9HA 4Z1MD 3L7BA 4DUYB 4IY1A 5I7SA 1J6UA 1JDPA 1KI6A 4QGAA 5HUQA 4FU0A 2QU7A 3TIVA 3PQ4A 3M6AA 3RTEA 3F7MA 3ZI0A 3IIMA 4OY3A 5IX8A 2UVQA 1RYDA 2EBWA 2JC3A 1FXSA 1CQWA 1D4AA 1W25A 3I53A 1E9AA 1X1TA 3LLSA 3Q41A 4YACA 1DOHA 1I01A 1UKAA 1H2BA 4H6VA 5MFZA 1JPUA 5ILOA 5LQAA 4FQ7A 1Q92A 3PUHA 4XGKA 1JTEA 1N2CA 3B89A 4L6CA 1LSJA 1H85A 4HVLA 4BRUA 4BNFA 1ZLYA 3CPEA 3JQ7B 4EGJA 4IQ8A 4DDTA 4X1KB 4BZQA 3ZXSA 5AI0A 5JVDB 4KR6A 4RUKA 3U40A 3HY3A 4LOJA 2DRIA 4KQMA 5BXQC 1OC2A 2AHOA 4D8TA 2A92A 2QGFA 5A3SA 1RM0A 4DSZA 1Y63A 3L79A 3DWEX 4MVXA 2HZ7A 5CK4A 3UKDA 1QB7A 3HN2A 5EIAA 3ZVLA 3W5CA 4WQMA 1NBAA 4DNFA 3BL8A 4ISBA 4YUAA 1KEEA 1ENPA 4G97A 5FADA 1CUAA 2BMDA 2G06A 2UZ0A 4EY5A 3RYHA 1RRFA 3V1NA 3JWPA 2OC4A 5BWCA 1GAQA 3FKSA 4C7BA 1WBBA 2XHEA 4BNVA 3VR4H 1R4MB 2ZBDA 3OCXA 3ZDBA 3MUNA 1K97A 4V0LA 2G17A 3FB1A 5K3EA 3PNMA 3W77A 1P39A 1NT2A 2FUEA 1NUPA 1QFZA 3RKSA 2IKSA 3QKRB 1Q0PA 1I36A 2B35A 1SY7A 2G09A 3DV0A 3ZXXA 4HDCA 3BMNB 4QOSA 4NBSA 2DXIA 4H0NA 2H65A 2XEDA 5ED0A 4M8KA 4KZPA 5A7GA 1FUUA 4OI2A 3AH8A 1VTKA 1H8HA 3MBKA 4WSOA 2D5AA 3Q88A 1C1DB 1DC7A 5IARA 1ORIA 4MULA 2AFHE 4CT0A 1DQRA 3NJ8A 3K8ZA 1Y37A 9ATCA 2JLXA 2J7KA 4OXQA 4V24A 2LE0A 2PD6A 1R7RA 2A9JA 1RYFA 2X40A 1W47A 3WYAA 2GBPA 4JU9A 1EFAA 2B6HA 2V59A 4YIKA 2HDNB 1L4HA 3U3JA 4TOIA 2ACVA 2PLRA 4NTZA 3COYA 3LTEA 2ECOA 3D8HA 4Z0NA 4D3FA 1J21A 4HEA6 4NYJR 5EE0A 4CQLB 4HB4A 4EDHA 2Q3HA 5EZYF 3FVWA 4C14A 4FMBB 3CWZA 4DANA 2F7SA 5IYZB 1U0FA 4XRRA 4AF6A 4MZDA 1EIZA 2PIDA 3TQFA 5M29A 3ME5A 4HT3B 4JYAB 3HKBB 2AN4A 1IUNA 2WKPA 3TD6A 2Q2OA 1L4GA 3ZQ4A 3E2PA 2EQ5A 2I4RA 3NOQA 5HFNA 4DRXA 4UUOA 4BPRA 5FHRA 2FMFA 1KP2A 2CUNA 5LBTA 3DKRA 4DY4A 4YCLA 1A04A 4J0DA 1Z4JA 2OHHA 2ZBQA 5HFAA 4F0JA 2QG6A 4OSEA 4EW3A 3S2SA 3TCXB 3DPSA 5GINE 1GSOA 1G1AA 4TKMA 1HSOA 3F47A 4FCWA 2HK7A 1N5JA 4WZ6A 3FOEC 2YXPX 3K9HA 1ONBA 3AVWA 1OHHA 3DEJA 3L7CA 1GUAA 3NRBA 2AMJA 4HN4B 4I9UA 2CFOA 2XB2A 1M6NA 2ZM6B 2FOXA 4NBVA 5KYKA 4BMYA 4FDLA 2CNWA 4A5SA 4BAZA 2ZCUA 4KFCA 3JR7A 5LA6B 2G4VA 1CJTC 3AIKA 3W2GA 5C8VA 1HDCA 1CY6A 2I66A 4K28A 2ZYTX 3H5OA 4HWPA 3UAYA 4ZTZB 1IN8A 4JI0B 3GWGA 3NRCA 2HIMA 5IAGA 2IWHA 4AY4A 3BMOA 2YOHA 4L9RA 5FTKA 4KQEA 2B4KA 4IJWA 4X63A 3TXAA 1TDJA 1II9A 3BGOS 5IXJA 4U5XA 4N9WA 4MDFA 1ZD3A 1E6MA 2HUPA 2GSDA 4UCFA 3RV4A 2YIJA 3BAZA 4XIJA 1JKXA 1IVNA 1RJ9A 4R2IA 2IDKA 5F9HA 1M0WA 2E82A 2OAP1 1RJFA 3EVNA 1N3YA 2CL6X 4RE5A 4FKZA 1VGRA 5JYCA 2OBMA 3GLRA 3NQ41 2ZUVA 4HQ0A 4N01A 4GZ3A 1FDSA 2WSYB 1HXHA 2IV7A 2WV7A 3V8BA 4QUBA 2B7BA 3PL5A 3BGSA 3FWHA 3H2YA 4I9FA 3U7QA 1JA0A 4OQFA 3KUCA 5AK6A 5HTKA 3T0FA 4N12A 1MC8A 2YY7A 3F6SA 3M6IA 3PNOA 4AS3A 4BE4A 3IR6A 2J5XA 2Q6LA 4HCJA 1VHWA 2NW6A 3O2JA 3Q3EA 5JEDA 5K8JB 4J0CA 4P3YA 4TXMA 2EW1A 4Y6RA 1GCUA 1JU3A 1U5AA 4G0XA 2SICE 1K7CA 5JJIA 1KI2A 4FOSA 2MT9A 2QUBA 3I61A 1USVA 5KVCA 5IXSA 4KVGA 3EPJA 1OJLA 5K0ZA 4X24A 1UXKA 3QUAA 3THYA 2NM0A 1X74A 4X44A 4X3CA 2ZPAA 2EV9A 5M7EA 1H3EA 3LUGA 3BFXA 3Q4GA 3AUUA 5D3ZA 1CJVC 1G7SA 1Q6ZA 1DJOA 3OZFA 1V5GA 3R3SA 4H16A 3WIUA 10MHA 3WHKA 3HVJA 4IHJA 4QDKA 4D5EA 1Z4OA 2Z6UA 3OURA 4FXOA 3N5KA 4TV8F 1L5GB 1JLHA 2O2XA 4ZCLA 2OM6A 3H0EA 4ZJZA 4Z4IA 4TLAA 3OOHA 3ZY5A 1WR8A 3FKJA 3VH4A 5IF3A 2HREA 3PXUA 5JI3E 1E92A 1CC1S 1D1QA 3U60B 1KBOA 5JSKA 2QV7A 4JYMA 2P6MA 4MIEA 1QOQB 2JNWA 1PKEA 1NLZA 2WOOA 3K73O 1O6CA 1VHTA 1I14A 1WHSA 4MV5A 4YRPA 4LKRA 4CM9D 1RXUA 3CLSC 5BV7A 5B3LA 1KDTA 1Y80A 5F21A 1N3BA 2H2FA 3E9MA 4FBMA 4R16A 4RDCA 4HRAA 5HF9A 5JJKA 1CKEA 1O9GA 1GTG1 2PLWA 3TRHA 1FNMA 2ZRPA 5JARA 1XLTA 2DPLA 2NO4A 1YI0A 2ZSKA 3ET5A 4LHYA 1LBQA 4O4IA 3UCEA 4IIJA 1IY8A 2GM3A 2IU6A 1EAMA 2E6UX 1AIPA 4QBKA 1ZH8A 3F5FA 2QVLA 3OJEA 2QDKA 2RIPA 3A6ZA 4XYGA 3VC3A 4CKYA 2ZYGA 5SY9A 3KQLA 4NJOA 1A2KC 4K3UA 3VZCA 4MS4A 2AG6A 4G5YA 4Q39A 4DA7A 2B1RA 3QFTA 3EC7A 1Z4MA 1M72A 3VVMA 5CIYA 4E6EA 4AUEA 1HDXA 1U8YA 3MWFA 5EZYA 4PC1A 2XV1A 3HXQA 3P5SA 2ETVA 3LUBA 3OZSA 2QVBA 2HB6A 2ZT7A 4MDYA 2WHXA 3S5JA 1EDZA 3VPCA 3EA5A 4NDZA 4BGEA 1NG9A 1NZFA 4YI3A 4RCVA 1QVRA 2P9EA 5H02A 5JQWA 2YZKA 2MDTA 2RHOA 4F2WA 2F1JA 5KS2A 6ADHA 1UK9A 3E58A 2GN0A 3FUUA 3ONVA 1KMNA 3JVDA 3K30A 2GAOA 4J49A 4L27A 5FLKA 4KQIA 3NS7A 3HA2A 2C7QA 3QP9A 1CUGA 2GFIA 3K3PA 2XNSA 3RM3A 4Y18A 4QJIA 1MO2A 4QU9A 4F91B 3ROPA 8AT1A 2QLBA 4YRSA 4HH4A 1W7AA 3TDKA 3A1TA 3NCHA 1X7WB 1GR0A 4LZOA 2E3JA 1HPLA 5DBGA 3MWEB 2FZWA 4UJ5A 4ZVRA 1T1IA 2F67A 3V4VB 1UJ6A 4TMWA 2NXJA 1SU6A 1IMJA 4WVFA 2H16A 4E5PA 1F8XA 3GLFB 2BE7A 3TL6A 4QEKA 1MF7A 1U3VA 2VJLA 4JZYA 5D1NA 2XECA 3SEFA 4AZ3A 4F1KA 1OZFA 5A04A 2Q6OA 2PKRA 2C8KA 2VF5X 1P7VA 4MCAA 4KPFC 3LKBA 4PN3A 1IXKA 1HYHA 1ZU5A 1PFGA 4B3FX 3Q72A 4ECEA 2GBFA 5BNIA 3F6RA 2B99A 1L6RA 4WZAA 4Y7DA 3A1VA 1JHRA 3F98A 1OF1A 3NGLA 2CHFA 1FUYB 4EW2A 1Q1BA 5FTLA 3WO1A 3BRQA 1KU0A 1ZVKA 1ZUWA 2Z08A 4ER5A 2ANCA 1TM7E 2H1CA 5LP6C 4XTCS 2XAUA 5FNVB 3G0HA 2CCJA 3AYXB 3QPWA 4UFOA 5JD5A 4ZHSA 2VZLA 5L45A 4GL4A 5U9CA 4K87A 3T15A 3ZZ0A 4I55B 1YE3A 3QOXA 4QXRA 4YO8A 1HDIA 2Q50A 3CR3C 5DYYA 3FI0A 3OU6A 2HF8A 3B82A 1VE1A 4HXFB 2XH8A 1BCRA 1PVVA 2A88A 5JD3A 2C94A 5A9SB 1AUVA 2H4WA 3TI7A 3HG7A 1IZ7A 1W581 1WRBA 2Q8NA 5FKJA 3S8MA 3EMKA 4WY5A 2FE4A 4JLDA 4EMUA 5C7YA 1PZXA 2PJUA 3F6YA 1U7HA 5IC4A 5KYWA 2FSIA 2QLNA 1K08A 1G59A 1BCSB 2V98A 1PFWA 3MXTA 4CQMD 3GP5A 4ER7A 1SHJA 4K6KA 4R1PA 4K6OA 3W79A 1N77A 4OQDA 1QVAA 5B12A 2HA0A 2AUTA 2B2NA 4ZPJA 3UJDA 1DCMA 1NR1A 2QN3A 3WLOA 4YCJA 4RH1A 4CMHA 1WCXA 2PUVA 1Z13A 1V41E 3HB4X 2VQ3A 1SEPA 4JLKA 3RUPA 1C9EA 3GROA 2YX1A 4DW8A 3ZU4A 4HQKA 4UBMA 1H22A 4AX8A 1GRNA 5C34B 3VGPA 1X7ZA 2PXHA 2I6GA 4FNAA 4IV0A 4BE7B 1AHHA 1TXGA 5HDBB 1EK6A 1TAUA 3NAGA 3NHJA 2MYUA 1T4GA 3O3OB 4WK2B 3RJ5A 5NULA 3VDRA 2QDXA 1N9ZA 1KEZA 4JT2A 2FA9A 3QVMA 3IT1A 3G89A 4NBNA 3U7RA 1UJMA 4AF8A 4CDRA 2C4VA 1LNQA 3KQTA 1ZK4A 3STXA 2A86A 4GGPA 5BWMA 4QKQA 2HCBA 3X3HA 1EQ2A 2OYSA 1E7SA 1J07A 5JW6A 1Q11A 4FILA 1I2MA 1W5TA 5FDFA 1HT1E 2AJTA 4WBSA 1TIBA 1US8B 1CQIB 2AFIE 2LDXA 3GAZA 4HDRA 4Z9XA 4TKUA 1QIHA 2W6ZA 2H4FA 2QAGC 2RGAA 2WEKA 2IH2A 5EWMB 2OK8A 1VJ0A 3I04A 4M9CA 1ZWLA 1ESDA 3CB2A 5ALJA 4GXTA 4P4SA 4AG5A 4EM6A 2A84A 2DSTA 4EJSB 4UM5A 1IIRA 3K05A 2CNDA 1ACJA 1PR3A 1YL5A 2C5AA 2FPIA 3QPVA 4R1LA 4EYEA 1MAWA 4UOEA 1E2PA 2B4AA 4XDHA 2V8OA 1B42A 3SF0A 4HAIA 4IINA 4IXDA 3SQMA 5DNEA 4E4YA 5JD6A 4G37A 1AOXA 3GFGA 1MPTA 1MB4A 1V1JA 1N6PA 2BKXA 3W2TA 5FBWB 1E62A 2Z56A 2FB9A 3TEJA 4YUZA 2OQRA 3AKDA 1TD1A 2GLXA 3FFWA 3FZQA 4HLQB 5CH5A 4BYGA 3KXIA 1EI9A 3LY5A 4F56A 3GDFA 4NCKA 2FRVA 1MA0A 3DH0A 1GTL1 2FN4A 1U02A 2FN8A 4U1RA 3HJHA 4P38A 4YRDA 5JNSA 4JDPA 2V3VA 3Q9UA 4YJFB 3SHOA 3VNAA 3I83A 1AN0A 1FVOA 1L7PA 3THSA 1HORA 2NNLD 3DAFA 3F7NA 2BKAA 1UDBA 3T9BA 1MTZA 3VRHA 4MB0A 4BNYA 1AJEA 3LKVA 4CV2A 2PXAA 4P82A 2A4MA 2C84A 3MCAA 1HV8A 5AJZA 5DX0A 4BWVA 3D1VA 3NAMA 1KJIA 3L18A 1FFYA 5BSHA 3DJYA 4JC4A 1M34A 2YXDA 2BBSA 3S8YA 3L6RA 2PYDA 5T4HA 4KPUB 1QYDA 2DHEA 3TZBA 3RSGA 1IAQA 1E9BA 1KKUA 2QJRA 2DFKB 3NAQA 2DTXA 4L8VA 4MKXA 4R7ZA 1CR0A 3HABA 3U62A 4BO9A 2EJVA 4Q3OA 4RWEA 2FEMA 4DABA 1CEYA 5JZ9A 3JQFA 4KJXA 4RK4A 4Q1AA 4JEHA 1MABA 3GYBA 2G9ZA 5CPBA 3KV1A 4DLYA 3RBVA 1U2DA 2GK7A 4M99A 4UE3S 2YVLA 3T7DA 3REGA 1MMFB 5ER9A 4BFSA 5CG2A 2VHYA 2OCGA 3LXUX 4HGQA 5FJIA 4AZ0B 2CC2A 4JY7A 1OASA 1U0NA 1ISSA 1XZQA 3JWHA 4N6GA 2XCQA 1BN6A 1GTSA 1EWVA 4YPFA 4L50A 3PFFA 2J5KA 2CXNA 5HTOA 2IXEA 2X5OA 3AF4A 3ANYB