2GAAA

Crystal structure of yfh7 from saccharomyces cerevisiae: a putative p-loop containing kinase with a circular permutation.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
353
structure length
326
Chain Sequence
VDTHKLADDVLQLLDNRIEDNYRVCVILVGSPGSGKSTIAEELQIINEKYHTFLSEHPNVIEVNDRLKPMVNLVDSLKTLQPNKVAEMIENQGLFKDHVEDVNFQPVKYSAEETAVVARGGTANAIRIAASINIAQIVPMDGFHLSRRCLDLFKDPQTAHKRRGSPSTFDSNNFLQLCKILAKTSLKVSSTSSVFEKLSKTFSQTIPDIFVPGFNHALKDPTPDQYCISKFTRIVILEGLYLLYDQENWKKIYKTLADTGALLVYKIDIDYEATEERVAKRHLQSGLVTTIAEGREKFRSNDLLNGRDIDNHLIKVDNIVHIRNDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Hypothetical 39.9 kDa protein
publication title Crystal structure and functional analysis identify the P-loop containing protein YFH7 of Saccharomyces cerevisiae as an ATP-dependent kinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 110
structure length 326
sequence length 353
ec nomenclature
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07728 AAA_5 AAA domain (dynein-related subfamily)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gaaA00
2BBSA 3ZZ0A 5KNBA 3AVVA 1HH4A 4LV5B 3ZD6A 3G5UA 5FBVB 1OW3B 3RVBA 1NLFA 2JATA 1OFHA 2E1RA 3FMFA 4Q4HA 3ZQJA 1E3MA 1P2SA 1KDOA 1ZUIA 1GSIA 3W5IA 2YYZA 1DARA 1VECA 2Q21A 5B58C 4QBFA 1T6NA 2YWGA 2G9NA 1A2BA 1OV4A 1HEIA 1GP2A 1D2MA 4IVQA 3SE0A 3QKUA 4HLDA 2J5XA 1LS1A 1P7CA 5F98A 4KV9A 4V03A 4NYIQ 4V0KA 1ZBDA 2NO0A 5KDDA 4QJ5A 4K8OA 3A36A 3NC1C 4OHZA 4XVQA 2ZYUX 2IXGA 4ZI2A 5BN4A 4PPGA 3Q5EA 2XNDA 3KXKA 3REGA 4ZCIA 1F60A 1R10A 3DPUA 1G3IA 3CR8A 3SYLA 2JJ1A 2NIPA 3MWLA 1TQ6A 4BLRA 1VTKA 3D6TB 1S1CA 3AF3A 1QG4A 1AKEA 3W8NA 1X1RA 4F7WA 5L3QB 4RZ2A 5SZIA 5KSYA 3MWKA 5EE0A 4IJMA 2G1JA 5LPNA 3ZIAA 3THYA 1PUJA 4C0AC 2PT7A 4MGYR 3SHWA 4TMKA 2ZRKA 5CYOA 4D2IA 3AV0B 1HQCA 4YMWA 3QXCA 4GSYA 1EG7A 1Q3TA 1S0UA 5CIWA 2D4HA 1AGRA 2OFXA 5EXXA 5CM9C 5KNCA 5AUOB 1YZKA 4YLGA 4EPWA 2FA9A 2WPDD 4TL6A 5LBIA 4XJXA 1IN8A 3CF6R 1Q20A 1OXUA 3U5ZB 1HT2E 1E79A 4EKDA 4GNKA 4LUCA 1G5TA 1W0KD 2OFOA 2JIZD 3GQBA 4HUTA 4JVLA 1E1RD 1R7RA 2WZQA 4P4UA 4Q1DA 5LD2B 4DSUA 3QBVA 1FL9A 2R6FA 2OM2A 5K8UA 3VKHA 2PX0A 4NCHA 3MGCA 1Z06A 2PZEA 1P6XA 2CK3A 2ZI6A 2HT1A 2O0JA 4U02A 3X2SA 3AF0A 1EESA 4IDNA 4G3XA 3OIUA 1DTSA 1IONA 1JEEA 2V1UA 1TQ4A 3T12A 4AURA 4RCZA 3BC1A 4NYMR 2ERXA 2O0KA 4BRUA 2ASEA 3NEJA 1ZW6A 2FOLA 2PLRA 4IVRA 4TL7A 5JEDA 1XCGB 1NSTA 1N6KA 2XXAA 4Q4LA 4C4PA 4Z1MA 2ZYWX 3V4RA 2KB0A 3X1WA 2C03A 4PC3A 2CE2X 5JJKA 1SXJC 1Z22A 4NONA 3QY0A 1C1YA 4OJQA 4JT4A 4TT3A 5UKDA 1GG2A 2PL3A 3CX6A 5JS7A 1W1WA 3B13B 5B64A 2IYUA 5FI1B 1ZUHA 3IILA 4MGKR 2CE7A 3CH4B 3FMIA 1ZCAA 5E7IA 2BC9A 3ADCA 1VHTA 4DLUA 2IBMA 3AQ4A 3QPVA 3HWSA 5K8TA 4QNRA 3QKSA 2EWWA 4DJTA 1RW4A 5EZ5A 1R5OA 5JCZA 1G8HA 3A4MA 2BHRA 1OXVA 4LDJA 2QP9X 1IY1A 1E2PA 2WMOB 4DDVA 1W44A 2VP4A 3EAQA 3K0SA 1GZSA 4I99A 5HR5A 2ZIAA 2BKUA 3EZ7A 1NVUQ 2FU5C 1SVIA 3SJZA 4JLOA 1B0UA 3FKQA 3CF0A 2X19A 2HYDA 2DCUA 1QF9A 1P60A 3P1JA 3N70A 3HU3A 3T5GA 2XZOA 2DWPA 3SQXA 2G0NA 2MMCA 1CF4A 1NMXA 4GP6A 1OT3A 3HR7A 2BMDA 3GJ6A 1KI1A 1T5IA 4FD2A 2HYIC 2ORVA 1EFHA 5JWOA 5F9HA 3V00A 1MRNA 4R98A 1E9SA 1KIMA 2NG1A 4M0LA 1E9DA 2ZRLA 3U44B 4RD6A 1JBKA 5HZHA 4JVSB 4MRVA 2EFHB 5JMTA 3VKGA 1XEWY 2QG6A 4WVFA 4IFBA 2ONJA 3L2OB 2R6GA 2O5VA 3NEYA 1ZC4A 3W6PA 1GNPA 5A4JA 1SKYE 3P20A 3T06B 1ZM7A 2FMXA 1G291 4BEJA 4DLTA 4GBMA 4EFMA 3NBXX 4PC1A 4CEJA 2EU8A 4M1WA 2XGJA 3GEHA 5JRJA 4HLQB 3U3OA 3KQKA 1JQLB 5GJVC 3C14C 1SGWA 1FTNA 3JZMA 4FWIB 1JR3E 1II0A 1KY3A 1EFRD 1MO3A 3E70C 3BERA 3CLVA 4TMTA 1R5BA 4URVR 2P5SA 2P6NA 1DG3A 1GKIA 2CCGA 4IOMA 4MKHA 4WZ6A 5LD2C 4IW3B 1KZGB 2AKAB 1Q22A 3ICQB 1A82A 1D6JA 1NSFA 4JMPA 3EXAA 4Q47A 1XP8A 2B7CA 1W5SA 4XH9B 4IEIA 3ZYCA 4R71A 2A5DA 4M22A 4XSGA 1LY1A 1DPFA 2Q3MA 1ZM4A 1J8YF 3CB4A 1OH6A 3I8XA 4D80A 2UZ3A 3FKSD 2OE2A 3TUJC 3DL0A 2HV8A 3DMNA 4AK9A 1U8YA 1ZD8A 1N25A 5EUMA 3NBFA 4M1YA 4QBGB 1Z2AA 2VBCA 2ZUCA 1UAAA 1BH2A 1G17A 2ZAMA 4N1AA 2F43B 2W2VA 4B71A 3W3AA 4YDSA 4BFVA 4FMDF 1R2QA 5FOXA 4F38A 4Q48A 3K0CC 4DDTA 4LK2A 1QHYA 1ZUNB 2F43A 2MMGA 1W36B 4QGHA 5AUNB 2CDNA 1IN5A 2EQBA 5B57C 4M8NE 4CEHA 2IYWA 2ZRPA 4MRPA 1JR6A 2NOAA 5FPKA 3UXMA 1JJ7A 4M1SA 3KFXA 4O2LA 1KK2A 1J2JA 5BN3A 3RS7A 1I4TD 5C18A 3OIYA 2O0HA 4Q1BA 3GCGA 4MKFA 1CJVC 3RLFA 1ZVQA 4AWXA 5KU1A 1K6MA 2QUZA 3IDQA 1VCMA 3C5CA 4RY2A 4ZV4A 3QG5A 1NLYA 1DAGA 1XB2A 2OUKA 4B74A 5H68A 3QENA 4BGDA 2A7QA 4NPHA 2DB3A 4M9XA 4OYHA 4IXNA 1KK0A 3CNNA 3Q72A 2MSDB 4ZDJA 2HF8A 3EARA 5G40A 4JLAA 3ZVNA 3IHLA 821PA 4Q7MB 2ZI9A 3CPEA 4G5OA 3ZDQA 2P67A 3WYFA 2FX3A 1WCV1 2A5FA 3RS0A 3VNVA 1U99A 2QT1A 2OLKA 4KVGA 3T35A 4UQOA 2RGNC 3U3RA 2R9VA 1M34E 1BIFA 4XIGS 3FVQA 2QM8A 1KK1A 3TW4A 4DHEA 4Q02A 3L0IB 2GXAA 4IOLA 2RKOA 3Q5DA 3NH9A 3GLIA 3VR1A 1KI3A 2Z43A 1NN3A 1Z28A 2Z83A 2QP3A 2ZRFA 2WIBA 1CU1A 1KMHB 4MRSA 4ZCLA 2C9CA 3NDBB 1UPTA 1NLZA 1XMJA 3THXA 2DYKA 1YHNA 2ZJBA 4ZPXA 4XVRA 1BO6A 1DO2A 3BRWD 1M2OB 1XTIA 4IRUB 4Q03A 4TL9A 1KMHA 2ODEA 1E94E 2WVJA 4WIAA 3MMPA 3IBYA 1UKZA 3M1IA 1TMKA 3IEVA 1P2TA 2C96A 4XOIA 3OESA 2BJWA 2WOOA 3PQCA 2OBNA 2ATXA 4P33A 5CYPA 3SFVA 2KE5A 2X8AA 5DN6A 2XNSA 3M6AA 2J45A 2Q9CA 2DFLA 2QL6A 2P5TB 2REBA 1UKVY 4PHHA 4Q1EA 1NL3A 2IYZA 3KDSE 4KYIB 3LQQA 3E1SA 2XEXA 2YOFA 2KBEA 4E07A 3A1SA 1AZSC 2CNWD 3QXJA 3RSOA 3UWOA 1OF1A 2XTMA 4ZO4A 1N0VC 1OFTA 5AJWA 1GUAA 4TYWA 1IBRA 2VP0A 2VHTA 4PO9A 2HXSA 2GAAA 4EDHA 1JR3D 4HSEA 3R9IA 2Q3HA 3BFVA 2N1BA 4L15A 3SJCA 4PFSA 1EWQA 3K70C 2DPXA 3K0FB 4B34A 3PFIA 2ZAOA 3RAPR 1DAFA 2IYQA 3QPWA 4GOKA 3SZRA 2O8FB 1EK0A 2CJWB 4NCNA 1BKDR 3DOFA 3FHCB 2F1IA 3VMFA 2JCSA 1X8LA 1W36C 3K0FA 3JVVA 3PR1A 3ZVRA 1XPRA 4A9AA 2ZSDA 1XXHE 2WJVA 3FGNA 3SJBA 2QENA 3ZS9A 2IUUA 4AD8A 2O8FA 3QEOA 4M1MA 2CJWA 3ZLJA 1W4AA 4NMMA 3B82A 3RS3A 3UIEA 1NRJB 2GZAA 4Y0VA 2FFQA 3RRMA 4AKEA 5J4KA 3SQWA 4DXAA 1LB1B 5HCNA 5P21A 2QTVB 3UANA 1AGPA 4CF7A 4EUNA 3MCAA 2BBOA 3B1VA 5DGXA 2IA5A 4XTCS 2WJJA 4A6PA 1PLKA 5KSPA 2ZUBA 4OJKA 4F4JA 3Q8XB 5DE3A 5EP1A 1Z6YA 4TQUS 4E22A 3GMTA 3PXGA 3ZZUA 5JCPA 4IKEA 5KDOA 1PLLA 3IQXA 5CDFE 3GJ8A 3KB1A 3CRMA 4A6XA 2XITA 3P4YA 1J70A 4LCBA 5EXPA 2OCBA 1RYFA 3IPXA 3BD9A 4B6FA 3SBEA 2NO6A 1AS0A 2YKGA 2ZJOA 4H1VA 1TEVA 3DHWC 4N3NA 1FUKA 1RYHA 3CRVA 3GLFA 3TQCA 4EJSB 3DO6A 3MUFA 4C0HA 3UKDA 3GJ4A 1XWIA 2JEOA 2O8EB 1EX6A 1FMLA 4US1R 2ZJZA 1UDWA 3MD0A 2GXUA 1Z0JA 4GDFA 2C8VA 4BECA 4JLPA 3RABA 2NTYC 3HU2A 1Q1QA 2QM7A 3KKPA 4LJ7A 3PV0A 1NG1A 4CT4B 4EJSA 1A4RA 1ZJ6A 2HCJB 3FFBA 2WPDA 3LBNA 4PX9A 4YXWD 4LJAA 2O8EA 3U3MA 1U0JA 4LC1A 3U61B 1E98A 4DLYA 2CEAA 4M2LA 2ZRBA 3VU9B 1G7CA 1W0KA 2JIZA 3I3SR 1OKKD 3H86A 3WHLA 1E1RA 2ZS8A 1E69A 3MLEA 3WBJA 4A4DA 3EPLA 1XZQA 3K09C 1D2NA 3ONWA 2YNMA 4B3DA 4B32A 1T5LA 4PAQA 4EPRA 3RNLA 3VU9A 1TX4B 1GL6A 1WA5A 2WAYA 4HLUC 4E5UA 1Q1ZA 1W5TA 1IN6A 1AZTA 4LHYA 3THOA 2WICA 3WP0A 4G01B 1MKYA 1S1MA 4UXJA 4BRWA 2JLRA 4WOPA 4A82A 1LF5A 2WWIA 1IY2A 2J1LA 4ON9A 3HPQA 4L4UA 2ZQ5A 3H0KA 4D0LB 2P6RA 3B6EA 5L3RA 1E2QA 1I4LD 1JPNA 4EPVA 1IM2A 4FINA 5JECA 3V9PA 1P75A 2EYUA 4DIDA 2GK6A 3U7FB 2OZEA 1L4UA 3S1AB 2VHCA 3A37A 4V0NA 4YMUA 4LPSA 3UMRA 2D2EA 3IO3A 1KTVA 1XTKA 2ZXUA 1JB1A 2GF9A 1A1VA 3TIFA 3RWMB 4LGMA 4Q4JB 5G3YA 721PA 3S1AA 2BBWA 2PJZA 3EA5A 1Z0IA 3QVUA 4JL6A 4CRWB 3JZAA 1ZNZA 3TVDA 1IHUA 2IXFA 2BCJQ 4NYJR 2B92A 5J5CA 5BN5A 4O2RA 2WJHA 5FUVA 5EE1A 3EWAA 2RGAA 4GZMA 2FPKA 2FZLA 2D74A 2F1RA 3RS4A 1ZCBA 3VX3A 2QRNA 3QBTA 3QXSA 2O8DA 4MGZR 1RVDA 5JSZA 3BWDD 1HT1E 2DR3A 1VYTA 3R7WA 3IIMA 2GHIA 2ZRHA 1TF5A 4TMWA 4MA4A 2C9YA 1YZQA 3SOPA 5CITA 2OV2A 2VP5A 2C04A 5JS8A 2PX3A 4TZ0A 5SZJA 2P65A 1QHGA 3OE7D 4EQ6B 2AXNA 3FMOB 3KX2A 4BLPA 4FIDA 2WKQA 1FFHA 1JAHA 2GCNA 3GJXC 1P72A 2IYSA 2QQ0A 4XD7D 4MGIR 1RFLA 4EQ6A 2YOGA 1RJ9A 4MDEA 3IIJA 5J47A 3IKJA 4TYQA 3BOSA 4TQAA 2NPFA 3Q7PA 3A4LA 3KUDA 4PC6A 4OK6A 1FP7A 1AIPA 3LX5A 1S96A 1G7RA 1XTJA 3PUVA 4KBFA 1UEJA 2O52A 1O87A 4JKYA 1FW6A 3GEEA 5EP4A 3G0HA 4F4CA 3UG6A 2IL1A 4BPBA 2J7PD 4MRNA 4B33A 2V7QD 2XTNA 4NCJA 3NHAA 2NZJA 5IT5A 2W83A 4ZKDA 1E96A 5GJBA 1SHZA 4AC9A 3ZGXA 4KHZA 1YR7A 1LF0A 5DYGA 4NHOA 1N6IA 1DE0A 1NIJA 4KODA 5J4VA 4NL4H 1EFRA 1E9FA 3PEVA 4BLOA 3ASYA 4I1UA 2B8WA 1E9AA 2CLSA 4UKDA 3TGPA 1MO5A 4QBIA 4PO1A 5J4LA 3AP2A 3Q3JB 5EXSA 2NMVA 4RFVA 4HAZA 4FN5A 4Q4HB 4PAOA 2HT6A 4GMXA 2WJGA 3CUEF 2IS6A 4WXRA 1KI6B 1W2GA 5HE9A 1TQDA 4DDUA 2A3RA 3RHFA 1UKEA 3FKSA 4LRWA 5GJCA 4M1TA 2E9SA 521PA 4TSFD 2V1XA 1FQJA 2OESA 3B9PA 4D0NA 4TLBA 1WXQA 1NKSA 3TNFA 2OBMA 2LKCA 4M1OA 1KI6A 4D25A 3AUYA 1CR2A 3W90A 3I62A 1OE0A 4ESHA 2ZUDA 4HDQB 1N5LA 1M74A 3TSZA 3G82C 3EIQA 1Q12A 2J3EA 1Q1BA 3VQTA 1IN7A 3UATA 2H17A 4B3BA 2AFIE 3CX8A 3IBGA 4ZCMA 5C4MA 2W00A 3KKMA 2JLWA 3REFA 4LJ5A 1CS4C 3AVOA 2VSFA 4B3FX 3THYB 2EWVA 3KL4A 1U9IC 4CIDA 4RD4A 2CCKA 1OHHD 4BZQA 3BGWA 3O8CA 3T5DA 1R8QA 4E09A 4C0BA 3IPYA 3MJRA 5A0FA 3LBHA 3RRNA 1NN1A 3LX8A 5FTNA 4B2PA 4OK5A 1U81A 1MH1A 4I81A 1QHXA 2GDJA 2VP2A 5J4YA 3SU8A 4BEBA 4WZBE 3E5HA 1Z0AA 2D2FA 3B1WA 4QJ4A 5JHHB 3ECCA 2AFHE 3EIHA 1Y3AA 4OL0A 3NBYC 1S9DA 2ZJ8A 3NBZC 2J0SA 1KO8A 2GBLA 4W5HA 2RGGA 1KKMA 2AD1A 4P32A 4NH0A 1HURA 1FX0B 1S9HA 2YC4C 2YC2C 1GRRA 1G5RA 1UBFA 4A8JC 1TU3A 1VYVA 2VIIA 4BUJA 2OCPA 4A2QA 4G0NA 2WWWA 1S3SA 1YZNA 3OIVA 1YKSA 1FX0A 4JLDA 1XMVA 2QGNA 3MG9A 4KI0A 1VG9B 3KXLA 2QQEA 4HDCA 4FMDB 1R0WA 1SXJE 4MH0R 5KTYA 5FL7D 1CJKC 1BYIA 1Z2CA 3BFXA 1VDZA 1OIVA 1GKUB 4BZXA 2IW3A 1D9ZA 2REOA 3DDCA 3KKOA 3LWNA 3TJZA 3Q85A 5C1BA 5HKKD 3O8RA 1RKBA 1EXMA 1Z0KA 1JXOA 1MO4A 4ZIRA 4BFXA 3KXIA 3K9NA 4HB4A 5EE9A 1VIYA 3TE6A 1G8GA 4RFSB 2C95A 1U8ZA 2PZFA 4A1FA 2XXAB 1AN0A 3SJAA 5AJZA 4CVNA 1HA3A 2IEZA 3QE0A 1TF2A 4KXFB 5EE3A 4CZ2A 3W5JA 5FBRB 2R2AA 2SHKA 1LV7A 5KHOC 1ELOA 2JJ2D 2PH1A 4RFSA 1E2LA 1MOZA 4AYXA 2F55A 2JLXA 1GKYA 4AYTA 2YWEA 4JJKA 1SKYB 4L5BA 3QUSA 4B47A 1NMYA 2VYFA 3QKSB 4Z54A 4LYJA 1PLJA 4DLWA 1XJCA 4C0LA 1KSJA 1MR3F 1NP6A 3LFUA 2ATVA 2CNWA 5AUPB 5BXQC 2ZM5A 2JLZA 1XF9A 2ZS9A 3BH6A 4Q01A 4QG7A 3R8FA 3ETLA 2CXXA 1WBDA 1RC8A 1JR3A 2Z5FA 1W4CA 1P9RA 2H8KA 1MT0A 3NTUA 1FUUA 1D9XA 5JFGA 2J0VA 4R2HA 4XVUA 5D3QA 1OJLA 2BM1A 3CNOA 2HLDD 4MKIA 4DSTA 5FOUA 1XU4A 3VAAA 2ZVQX 1XD2B 1X6VA 4FWTA 2PEYA 3TH5A 1KZ7B 3RSLA 2LKDA 2FPLA 1N6HA 1IY0A 1KMQA 5FBWB 1GRNA 1FMJA 1IJEA 2PLFA 4Q19A 5ELXA 2VRWA 4NKRA 1N0WA 3LAWA 4IDOA 5JI3E 3TK1A 1XD2A 4MKGA 2JLSA 4OQNA 1IXZA 4FCVA 3AKYA 3L8YA 1N6PA 3KFVA 2YZ2A 4KFRA 5GVRA 3VR4A 2AKYA 2P0EA 3OEHD 3V4FA 3PITA 4D0GA 3KUCA 3Q7QA 2V4ZA 4GPTA 1E0KA 3GJ3A 3VNUA 3L0SA 1E2MA 4RD1A 4CEJB 4KU4A 3A1UA 5EUQB 5JZVA 2Z6VA 2BM0A 2CHGA 2NO9A 1TPZA 4H9GA 3WNBA 4UNSA 2Z4RA 1LS6A 2P3SA 2Q3FA 4MRRA 3CWQA 1T8TA 1N6OA 1Y63A 1DOAA 2QA5A 3KQUA 2BEJA 3RANA 4C0KA 4D4KA 3ND8A 1NNEA 1E2IA 1ZP6A 2C98A 1E4YA 4QHYA 3W3ZB 3KJHA 1ESNA 1GNQA 3LH5A 4LWZA 2ZEJA 4PQFA 4F91B 2R65A 1V5WA 1Q0UA 4KFSA 3U7HB 5AJYA 2QROA 4PHFA 1U94A 4K46A 1DAKA 1GWNA 2B6HA 4HZUB 4QKQA 4URXR 2RGEA 4CYMA 3T1OA 2W6ID 5CB6A 1NY6A 3THWA 3WHKA 4JSYA 4G1UC 1XD8A 2AWOA 1WBBA 1J99A 4Q1FA 3AF4A 4FMCF 4DCVA 2ZYTX 4M1KA 4HZUA 4A2PA 4FCTA 5JWRA 2XJ4A 5HTKA 1BYUA 1JNYA 5IF9A 2OLJA 5M04A 3F8TA 1YR6A 1UKYA 2IF0A 4LI0A 1JPJA 2ZYVX 4GI7A 4YXWA 1U0HC 3AF2A 1NVVQ 1YZUA 2WBLC 4HYYA 4ZI3A 2WM9B 1TQ2A 1G3RA 3DKPA 1SXJD 2IUTA 3KJEA 2IWHA 1OKKA 1RPZA 4CEHB 3AVPA 4KO8A 5F9FA 1RRGA 1F6BA 1N5IA 1ZNYA 2GA8A 5E7MA 3P27A 1PVOA 1ZM9A 1XCPA 4BFZA 1KO7A 1F3OA 1GAJA 2NO1A 4D26A 3CX7A 1KJWA 4JLBA 3EC1A 3B60A 4LJ4A 3SR0A 1DG1G 4URYR 5FOVA 4RD2A 5EQTA 3NWJA 4HB0A 5CK4A 1VIAA 3RC3A 4OI1A 4DCUA 1E2JA 2JAQA 1G5PA 4OI2A 2CLDX 4O25A 2X1VA 2HJVA 4KJZA 4MITA 5KYKA 4NE2A 1UBCA 2FN4A 2YINC 3IQWA 5B2ZA 3EA0A 1CR4A 3T1TA 1ZMXA 2G6BA 2G83A 1N6RA 1Z6AA 3EIEA 1TL7C 2FGKA 2NO7A 3NVAA 4FI3C 1TTTA 3QF7A 3WYAA 5JEEA 4MYTA 3DZDA 4TL8A 4CW7A 4HI0E 1RRFA 1CEEA 1B23P 1ZYUA 4KITB 3RYTC 5HCIA 1KSGA 1Z29A 2PT5A 5B30A 3QOFA 4PC7A 1U98A 3HYRA 4M4SA 1GITA 4P3YA 1Z6XA 5FR2A 4DLRA 3FHTA 2E87A 4RJLA 2OEPA 1SVKA 4O0MA 3GLIB 4IHQA 1OH7A 2J7KA 1PJRA 2J41A 1XMSA 2JDIA 2KBFA 4AG6A 2ZE7A 2QSYA 5A5GA 1ZC3A 5CJPA 1CTQA 3EPKA 4UNNA 1O3YA 2NPIA 2WKRA 4G5QA 4IFEA 1KAGA 1QHSA 3DM9B 1T9HA 2GZDA 2ZJAA 5FPSA 3THXB 4TLCA 2A5GA 5KPJA 3EG5A 3K9GA 1LVGA 3SFZA 1XXHB 2V55B 3DEFA 4Q21A 3WNCA 4Z51A 4UJ5A 1E9CA 1S8FA 3OE7A 2WSSD 4S35A 4B73A 3TBKA 3DM5A 3PIRA 5FL3A 3B1XA 5AK0A 5TXGA 1IJFA 1ESMA 1XD9A 4NBSA 2N42A 1XXHA 5CM8B 4Q9LA 3CKLA 4R2IA 2GRJA 3BH0A 1VG1A 4XD7A 2A2ZA 2QAGB 2H7VA 1MABB 1E2NA 5E95A 2ZS7A 4PTLA 1DAHA 2C5LA 2HDNB 1QZXA 1JALA 3SS8A 1E9EA 5HE8A 2RGXA 4AY2A 4C0QC 3W9YA 2QAGA 4QNMA 4L9WA 1YZLA 1MABA 2EFGA 1CBUA 3QXHA 4DB4A 3I4LA 4DCSA 4V0ME 5DIFA 2UKDA 3OHMA 5HZKA 221PA 3SI7A 3EW9A 2J7PA 1AK2A 3FTQA 2V7QA 2ZRCA 3RS2A 1AS2A 4PQRA 4NYMQ 3VKWA 1E2GA 2IYVA 1H8HD 2RGBA 5CDFA 2KSQA 1SULA 1N0UA 3A1VA 3T61A 1E99A 1F2UA 2WIAA 1KSFX 4L8GA 5BYJA 3ZJYA 5E3HA 1UF9A 2D7DA 3R8CA 4JLJA 1KO4A 3NXSA 1P3JA 1GTVA 1M6NA 3K09A 3C16C 4TWZA 4QRHA 4JBYA 4LV6A 3RS5A 1FTSA 3AB3A 4YMTA 3U4QB 1QHIA 4HLUA 4C30A 4FXPA 4P0TA 1N5KA 2F9MA 5FBLB 3DZ8A 3FB4A 3F5FA 2AWNA 1ZIPA 1IXSB 1Q57A 2OSBA 4M21A 3GFOA 3SNHA 3U4QA 3WMEA 4JJZA 2JGNA 2D3WA 1ZNWA 2ZR9A 5DI3B 1A2KC 3ZVMA 3WMFA 1WB9A 4TSFA 5K8IA 3BBPA 3CNLA 1I4DD 1U90A 2DY1A 2DWOA 1P62B 2OT3B 2IYTA 4EFLA 5AUQA 5C4GB 3I92A 3FWYA 1CLUA 5DI3A 3M0EA 2ZI4A 4NYIR 1Z8FA 3QNUA 3U7EB 4BFSA 4LYHA 4TN1A 3ICEA 3SN6A 1A7JA 1YQTA 2NGRA 1AJEA 1XJQA 3A1TA 1XX6A 3D7MA 4DEXA 1G3MA 1II9A 2PZGA 1F5NA 1RZ3A 1N6NA 4JYCA 1G4UR 4O3MA 1F2TA 2J46A 2WJYA 3VFDA 4ASUD 3EASA 4LY6A 4N0DA 3GLFB 1OHHA 2AR7A 2ZI7A 3A1WA 4W7SA 4F4IA 3TRFA 3CZPA 2BMEA 1PV4A 1VPLA 1W46A 5JJIA 4H1UA 5FUYA 2FFAA 1KY2A 3TAHA 1M7BA 4ITRC 3KQNA 2QI9C 3X1ZA 3IHWA 4Q7JB 2WHXA 3KKNA 5TY0A 4C9BA 4DT1B 2AL7A 3VR2A 1KI4A 4ACAA 3K0AB 1SZPA 4MUBA 4DIEA 1NVWQ 3KKQA 5DNYB 3AVTA 2G77B 2QY9A 3LV8A 2ZSBA 3F0TA 2B7BA 2RHDA 4W5JA 4DT1A 5BQ5A 3QF4B 4TYYA 3C41J 1FNMA 4I4LA 4DLXA 3K0AA 4BFUA 4TTRA 4C2UA 3KQHA 1XRJA 1NN5A 2AN9A 2KJQA 3CIOA 3AVQA 4A0RA 5FL7A 5G3ZA 4AKGA 3QF4A 1IAQA 4K81B 2FF7A 3BB4A 4RSGA 2FE4A 3AKCA 1SQ5A 2WWXA 4ACBA 1G4AE 3CPJB 4HAVA 4PANA 1PUIA 3HDTA 4DKXA 2OXCA 2GCOB 3GFTA 2VPPA 2ZU6A 4AG5A 4YMVA 5HKKA 4KSBA 4Q7LA 1D2EA 3TUIC 5TMPA 2W58A 4BFTA 3AVWA 2C2HA 2QEQA 4BLTA 2HJGA 3OZXA 1OLOA 2GCOA 4HUQB 4OQXA 2CL7X 1T3HA 2BWJA 5KNDA 1E2DA 3K70D 3N2EA 3K0EA 5DHAA 2JJ2A 5L3SA 1E0AA 1KJYA 2BBTA 3NIBA 4HUQA 4WXPA 2MSCB 5CK5A 2J59A 2CBZA 3LBIA 1EFTA 5FTMA 3AEZA 3SDZA 1P73A 1W36D 1XEFA 4D81A 3OIWA 4I1VA 1KI7A 2VO1A 1G7SA 4A0GA 3AH8A 1XPUA 2O8DB 5JSZB 2H57A 5H1YA 1XEWX 2DHRA 5TB5A 2ODWA 2J0UA 3R7WB 4ABYA 3SYNA 3K53A 3ZD7A 3ZZTA 1NVXQ 2QNRA 2YOHA 3BK7A 1NKTA 3PUWA 2QU8A 4MYCA 2JDID 1KNXA 4B6EA 5AJXA 3FE2A 4URUR 3A8TA 1DEKA 2WWGA 1G20E 1SKQA 2VQSA 2PMKA 1DBSA 4V0LA 2QZ4A 4E03A 1BS1A 4LHWA 1E9BA 5FOSA 4QL3A 3VX4A 2RH5A 2ZJ5A 2OCAA 2ZSAA 2IS2A 1JAIA 2AK2A 2DFNA 2ZE8A 4BLSA 1F48A 2HLDA 1KNQA 2Y8EA 2OHFA 2ZJYA 2IS1A 3EC2A 3OAAA 1RJ9B 5AR1A 1RIFA 2Z0MA 4Z8XA 3J81k 4PZLA 4BE7B 5FTKA 3U7GA 3PEYA 1NF3A 1OXSC 1U9IA 2IYRA 4G5GA 1KOFA 4IDQA 2HCBA 4OHVA 1OIWA 4JS0A 2VL7A 5JWHA 4CEIB 3B9QA 3QKRB 3I32A 2F7SA 4JYBA 5C2JB 2UZIR 4CDGA 3GLGE 2P2LA 3CH5A 4JLNA 1XTRA 1KI8A 2PCLA 3X1YA 4D82A 3ADDA 1G8PA 2WJIA 3OEHA 2VSOA 3CR7A 2CMKA 4PPFA 1OB5A 1R0XA 1ZRHA 1OH8A 2WSMA 1T3SA 4CEIA 3QKRA 1QHNA 3W8RA 3GLHE 4DLSA 1G16A 4EJSC 1QBKC 2BIFA 1WP9A 4A8JA 4FMBB 1NJFA 2C78A 5BYKA 3B85A 1G8FA 1W2HA 3K9LA 4HB3A 4IOKA 4DLVA 3HR8A 5DISB 4DDWA 4TYNA 4U5XA 4JBWA 4LHVA 4D6PA 2BEKA 4QM6A 4KYUA 3LW7A 4B3XA 4NDZA 4EFNA 1Q21A 3W34A 1X3SA 2IYYA 2GXQA 1XCMA 1SVOA 1MO6A 1X8JA 1ZM2A 3BE4A 3I8SA 2FG5A 1OSNA 1W0JD 4URZR 1S4QA 4HAXA 3PCRB 3PG5A 3AUXA 3BB1A 3CW2A 1WMSA 2GTPA 2I1QA 4ZKEA 8OHMA 2FSFA 2WTUA 1NBME 4JIMA 4ERNA 2W6IA 3OFNA 3TKLA 2VTKA 5FR1A 4OI0A 1CJTC 3K1JA 2FPMA 1YR8A 1G3UA 2YWHA 2I1VB 4DCNA 2F1JA 2FJUA 1N5JA 4X8MA 1NY5A 3R9XA 2EW1A 4WBSA 3LXRA 4LJYA 5DI9A 2XZPA 1SXJB 2ONKA 4Q9JA 3RRZA 5EJEA 3TR5A 1JI0A 5SZKB 4UNRA 3GEIA 3I5YA 4TTPA 1SVWA 3BS4A 3U2QA 3LXXA 4JVNA 1SXJA 4BZPA 3Q9LA 2F9LA 1QRAA 3WBKA 4IDHA 1FPMA 1Z08A 3H1TA 2IC5A 4XWKA 1TADA 3LA6A 2V9PA 1EFCA 2QT0A 4BQSA 1DAEA 4KFUA 1E1QD 3VHXA 2RB4A 1IOZA 1JEDA 4NCKA 1C9KA 3PEWA 5AJVB 3HPRA 1YRAA 1W49A 2ZI5A 4B43A 5D3MB 2RAPA 3CM0A 4LHZA 4PAMA 3KJGA 4JT2A 5JHGB 4OQFA 4DUGD 1AKYA 4WA7A 5IRCD 1DO0A 2ZRIA 3EZFA 4LSGA 1SVSA 1X8KA 4DSNA 1HE1C 1ZM3A 2XB4A 1OFUX 4GRAA 4PSAA 1IQPA 1CKEA 5KSZA 5F2EA 5D3MA 5CB8A 1T0HB 3UPUA 4KAXA 3QPUA 3TUZC 2GESA 3VR5A 4JL8A 1EX7A 4LYFA 1P9NA 3OEED 4P4TA 2GEUA 1BOFA 4PPQA 2OXRA 3QKTA 1G18A 3KTAB 4FMCB 2ZITA 1ZU5A 2XB2A 1HTWA 2V8OA 3LQRA 4KLNA 5KSOA 3VR6A 1KDRA 1KHTA 1CRQA 2LWIA 4QHTA 4YDHB 1W4RA 4GZLA 3AKDA 1OFIA 4X8HA 3KTAA 3HJNA 1GL7A 1HQYE 1ANKA 4PO8A 2YV5A 3L0PA 4Q7KA 2FNAA 4OI4A 3EZ9A 4JLVA 5L3QA 1GOTA 2QMUA 4B48A 3FFAA 1VMAA 3AF1A 4ZIRB 1PZNA 2REXB 1ZD1A 4MUAA 3MAAC 4C7OB 4C0SA 4IOJA 1VG8A 1HV8A 2KWIA 2R44A 1WQ1R 3U3JA 4ZDKA 2C77A 2MSEB 3F3YA 1TF7A 4DEYA 3FYHA 4HDOB 2ZVPX 2ORIA 2CVFA 2FV8A 2B8TA 1ZINA 4C7OA 2ZANA 4A36A 1N3BA 3LVQE 3WYGA 4V02A 5H8WA 1AQUA 2WSSA 2GEDA 2QSZA 3MFYA 4TZ6A 4TYPA 2FEMA 2H18A 3TQFA 1GIAA 1OXXK 3B5JA 2R6AA 2W6JD 4JSTA 6Q21A 4OHXA 2Q9AA 3ZS8A 1XJ0A 2IK8A 4QGGA 1J8MF 4A0FA 2RGCA 3C5HA 3TSWA 3CRW1 1LTQA 4OHYA 3W6NA 1DS6A 4GFDA 4LOAA 1L4YA 1J90A 1KK3A 2J9RA 3MSXA 2R6CA 3PJRA 1E2HA 1SHKA 1HE8B 1E4VA 1NG9A 2BMJA 3WMGA 4UNPA 2BOVA 2OFWA 1S2MA 4IXMA 1Z07A 5FFMA 1G41A 3O8DA 4M9ZA 3IGFA 5FTLA 1A5TA 3PUXA 1JQJC 1T0JB 1M1YE 2ZPTX 1H8EA 1H8HA 2IHBA 2WAXA 4JLMA 4KLZA 4B3CA 1AQYA 2OO7A 3DOEA 4QHSA 1NN0A 2IHYA 3EWSA 4B2IA 2BV3A 2FZ4A 1P4SA 2WWYA 4MDFA 3MJHA 3K0CA 2GEVA 3NG1A 2A5JA 1YJ5A 3CRRA 2GNOA 3T1VA 2FWRA 4NYJQ 2ANCA 4M9QA 1FOEB 4JZKA 3OAAD 2QE7A 1VYUA 1G21E 1NBMD 1NIPA 2BDTA 3LW8A 1K8RA 1T91A 3CO5A 3P4XA 5K8LA 1YR9A 1ODFA 1R4AA 4DCTA 1COWD 4YMSA 1CJUC 3A58B 2R8RA 1KAOA 2XSZD 1V43A 4PR0A 2A30A 1BMFD 1UBEA 2GAOA 2JLYA 1DADA 4LBWA 4OQLA 4Q66C 5FPYA 1DAIA 3GJ5A 3C7KA 4QFMA 3VHLB 2QPTA 4KSCA 5JBQA 2RHMA 2GBLC 3B78A 4QBHA 1QDEA 1VKJA 2XTZA 3B7GA 1KI9A 2UVQA 4GT1A 1AS3A 2AD5A 1QVRA 4L9SA 2GVZC 3HYTA 1YZGA 1UDXA 3ZH9B 3B2EA 5KPDA 1TUEA 2IF2A 1R0ZA 1E9RA 1XNJA 2QBYB 4US0R 1T3LA 4JBXA 2P6UA 2RGDA 2DWQA 3QG1A 2RGNA 2QPOA 1GL9B 1L2TA 2TMKA 2ZRGA 3ADKA 3NDPA 2PEZA 2IYLD 5EE5B 1II8B 1W48A 4Q4AB 4QOSA 4ASUA 3THWB 1GNRA 2VH5R 1XTSA 3DKVA 2QBYA 1U0LA 1P2VA 1CIPA 1M7HA 2CHQA 4LJ6A 5FOTA 3H4MA 5TARA 2G0TA 3U44A 2FSHA 4HEJA 1II8A 4PXAA 4Q4AA 4TLEA 4HAUA 3AVXA 4IVPA 3OFND 2GWHA 4S2EA 1UJ2A 1TAGA 2VSXA 1T4GA 5CLQA 4QM7A 3LRPA 5AWFC 1XZPA 3L0OA 5DSZA 2VLIA 3BORA 3CONA 1YE8A 2ZJ2A 2X2EA 2ZR7A 4HZIA 4D4MA 4F93B 4L16A 1WRBA 2VF8A 1M7GA 1TEXA 2YVUA 1D5CA 3X1DA 1K5DA 2VHJA 1P61B 2ERYA 2QN6A 4DZZA 5IK2D 3CBQA 4WAUA 3FHOA 2FSGA 4C3ZA 2JLUA 4C2TA 4D4LA 4FW9A 2HUPA 4US2R 2ZSFA 2BVNA 5DH9A 2XX3A 2ZR0A 3CRQA 2QTHA 1UEIA 2VHQA 3U6KA 1E2KA 3M4YA 5FI0B 1DAMA 1NI3A 3R9WA 1QHHB 4G5RA 3I73A 4RZ3A 5BW8A 2PJRA 1CJMA 3KZ1E 2ORWA 5GADl 1QHHA 1UADA 4LX0A 1KO5A 3K70B 2QORA 5G41A 2JJ8A 4AIIA 4I1OA 4BFWA 1EGAA 4PZYA 4UXIA 2NQ2C 4R7ZA 2XAUA 3MWYW 1MV5A 3C8UA 4AYWA 2VHUA 2XNDD 4P31A 5LB2A 621PA 1ZAKA 1VG0B 1XTQA 4TMVA 1X86B 3EPJA 2JJ1D 3BB3A 3TVTA 4TLDA 2H5EA 3EX7C 2WMNB 2WOJA 2IWRA 5DLQC 2HEIA 2F6RA 1SVLA 5E7JA 2CCJA 4PSKA 2JLVA 3CWZA 4B76A 4OBEA 4V0MA 1N2CE 3ZIAD 2FGJA 3AVYA 4POAA 3JVUA 4UNQA 3BXZA 4LBZA 1KDPA 3SBDA 1TU4A 1XMIA 2YWFA 2XOKA 3O47A 2QAJA 1NMZA 2BJVA 3NKVA 2ZRNA 4URWR 1YZTA 2GILA 1G8YA 4LBVA 2IT1A 1OYYA 1JECA 4KFTA 2AK3A 1XPOA 5JJLA 3RC8A 4ILEA 4NTZA 1E79D 2JASA 2CVHA 4A0HA 4PHGA 3TMKA 2V54A 1ZD9A 1R6BX 3AP1A 5EP3A 2Q0HA 5C46F 4B3GA 2R62A 5CJ2A 4NCIA 2BMFA 4V0OA 2IYXA 2ZU0C 2GVDC 2ODBA 2GKSA 4RZXA 1W7AA 3C4JA 3DVLA 5EXTA 2G3YA 2ODNA 1UM8A 4LC0A 2H92A 4GOXA 1VHLA 3NH6A 1UBGA 1Q44A 2CK3D 4BFYA 5GVSA 3B8HA 1YU9A 3CPHA 1E32A 1Z0FA 2QMOA 1JJVA 5DO9A 2WV9A 1DVRA 4PHTA 3K8YA 5J40A 3I61A 2IXEA 1NJGA 1Z83A 2HF9A 3X1XA 2Z4SA 3U3KA 1N6LA 2H16A 4LJ9A 2C9OA 4UXHA 1F2UB 3DMDA 5IDVA 2BCGY 4MYUA 3U6BA 3VTKA 1HY3A 1H8ED 3D3QA 3NHBA 4Z1MD 5BWMA 1ONBA 3E2IA 1T8UA 3T15A 4JL5A 2F3RA 2J87A 2WKPA 4ZDWA 4TT3D 3LD9A 5TV2A 1R8SA 4WW0A 3UMSA 2OAP1 4PC2A 4AI6A 4RKFA 4RVCA 4TTQA 4YC7A 3UG7A 4HAWA 4CGZA 2GXSA 3KB2A 1ZIOA 2QE7D 4MQBA 1W0JA 4A92A 1WF3A 4XWOA 1H65A 1D8TA 2EFCB 3IO5A 2ZSEA 4G5SA 3PENA 4I1SA 4HB2A 3B1ZA 4OK3A 4U00A 5FUXA 2YHSA 5KUTA 3AM1A 3PEUA 4RZUA 5ANRB 1ZU4A 2G1KA 5LDDC 2XJ9A 2W2XA 2O8BB 2EFDB 2ZETA 2W2TA 2DFTA 4JVMA 2Q9BA 4YONB 1XEXB 4QC2A 3P26A 3GLIE 3IUYA 3O8BA 4QXAA 1HYQA 1CULC 1R5NA 2GF0A 4PPNA 2O8BA 2W0SA 2GETA 3LLMA 5FUWA 3MWJA 4WZAE 1E2EA 1RRPA 2PMDA 5TVKA 1XEXA 2ZROA 2IS4A 2ZTSA 4F92B 1Q3HA 1G6OA 2FH5B 3TW8B 1CRPA 1US8B 2VP6A 2GJKA 5DHFA 1OH5A 1F2TB 4OHWA 4PZZA 1U8AA 2JLQA 3T34A 4B2LA 5DYIA 1CR0A 1P9WA 1TUIA 5CIQA 5IHPA 1E1QA 4GL2A 2EVWX 2OBLA 1US8A 4Q9IA 3PUZA 3LLUA 1DELA 4KBGA 2BKEA 2ZRAA 4HLCA 1WDTA 4IEEA 4QGFA 4EPYA 3ASZA 3ND9A 3QEJA 2L0XA 4B44A 4D4JA 4EIWA 2DBYA 4PQYA 4DUGA 2XZLA 4P4SB 3B1YA 2OILA 3BFKA 2QMHA 2QPAA 3RDPA 2R6DA 4DRZA 121PA 3QQ5A 4Q5IA 4Q18A 4NZYA 1FZQA 4LPKA 4YQFA 3FOZA 3WXMA 1LFDB 3K9HA 1GFIA 2AHOA 2JA1A 3A4NA 4NU0A 4P4SA 4RKEA 4X8LA 4TMXA 1W4BA 3UMFA 3NC0C 3LY5A 2RCNA 4OKSA 2IEYA 4X8OA 3FPAA 1E2FA 2AXPA 3OEEA 5KDLA 4A2WA 1J7KA 2K5UA 2YJTD 3R20A 1VCIA 1FP6A 1G64A 3A6PC 2O8CB 2OAQ1 4JLKA 421PA 3D8BA 5HPYB 2HXYA 4FCWA 1VCNA 1XDBA 2ZREA 4XTRA 4EPXA 2KI5A 1SVMA 3LDAA 4OQMA 5JI2E 1KDTA 3AP3A 2RMKA 4RD3A 4QJ3A 1YVDA 1KKLA 4GMDA 1XBTA 2GJSA 2QAGC 2O8CA 2X2FA 4UJ3A 4EAQA 1E0SA 5LB4A 4KVAA 3QJYA 4IDPA 2B21A 4QGAA 1G19A 1Z0DA 2GJAA 1CR1A 2N46A 1G1MA 1I2MA 1EFUA 5KO2A 2ECKA 3WY9A 2FFBA 3KQLA 5G53C 1AM4D 4DSOA 4TLAA 4U7DA 2Q6TA 1TNDA 4Y0AA 5F3WB 3AGQA 3H84A 3LNCA 5H70A 2QMEA 3AGPA 3QSYA 1Z3IX 1GM5A 1KI2A 3GLGB 1Z63A 4RD0A 3SEAA 3AKEA 2AX4A 5L3SB 4LBYA 1GRQA 1QG2A 5FPHA 2H1LA 1Z6TA 1MRSA 5FOWA 3ADBA 4B35A 1KSHA 2W6JA 3GLHB 3AVUA 3N5CA 4Z8YA 2OG2A 3TSOA 3HP1A 4RCYA 3TR0A 3GLGA 2EFEB 2ZE6A 1L7VC 3BJIC 1OYWA 1KJZA 1Z47A 3OF5A 2F1HA 2J0UB 1EWRA 1UFQA 2PCJA 1KGDA 1KO1A 1VCOA 2VF7A 3RRYA 1FNNA 3QXXA 3GLHA 2ZI3A 3KJIA 3PVSA 4HAYA 4AKHA 3BAFA 2I4IA 2IX3A 4W9MC 3EPHA 3D31A 1GVNB 2GJ8A 4EPTA 3EZ6A 3UWKA 5L3VA 4HATA 4M9SA 3BH7A 5EZ6B 2CLCX 4LHXA 2XOKD 3QIAA 5EP2A 2V3CC 3GLFE 2QTFA 3I72A 1HUQA 4NP6A 1OB2A 4TQ9A 3EZ2A 2GCPA 2J0QA 3P32A 4Q1AA 3L8ZA 2A78A 3QI2A 5TDHA 3N2IA 4DVGA 1E0JA 1K5GA 1OXTA 3I5XA 1Q1EA 2EYQA 1IN4A 1S3GA 5L8VA 2GZHA 2I3BA 4W5WA 4N0EA 4Q4JA 3WP1B 5FH9A 1I2DA 2GK7A 1LNZA 4Q9HA 4C0JA 1YRBA 1NBMA 4J0QA 3IIKA 1L8QA 2VP9A 3H2YA 4CT5A 3GPLA 4GP7A 5CLLA 4Q00A 2ZRMA 1G7TA 3GFPA 5FBQB 3GJ7A 1COWA 4DLZA 1U2RA 4R9UC 4KCGA 2XSZA 2ANBA 3FMPB 1W47A 2FFHA 2V6IA 1BMFA 1GILA 1R0YA 4PSVA 4BWYA 2A9KA 4ESVA 1OPXA 4Q9KA 5KOYA 1QVAA 4TMZA 3WRXC 4DBLC 3W6OA 1ZNXA 4JKIA 4A8JB 4XSHA 2CHVA 2QP4A 1RE0A 4BASA 1CP2A 4DC9A 3BIFA 2V6JA 1Z6GA 3WNDA 4ARZB 3U60B 4B75A 4BLQA 5JRZA 3SC3A 4II7A 4MYHA 1P5ZB 4XWAA 2OCYC 3SHFA 1RRCA 3UK6A 2ZRDA 2A5YB 2ZE5A 5FTJA 5DN6D 2PBRA 1C4OA 2DFKB 2LCFA 4ARZA 3TLXA 3ZQ6A 3GP8A 5FPTA 2VEDA 3L43A 3PUYA 3RWOA 3GJ0A 2NZ8A 3GD7A 2FDCA 1G9XA 3C15C 5SZHB 2G88A 2D62A 4M53A 2QRZA 3LVRE 4DWJA 4LJ8A 4LYAA 2WWHA 1AA9A 4LV8B 3FDIA 3HU1A 1X1SA 5E4FA 1IXRC 3IEUA 2D7CA 1P2UA 1CXZA 1E6CA 3CF2A 1XFAA 1WE2A 4AKIA 1JXMA 3MRSA 1GDDA 2C99A 2FSIA 1M8PA 2CL6X 2QGZA 3LO5A 1G3QA 2ZRJA 4GOJA 1Z5ZA 1OIXA 3CZQA 3VR3A 4A15A 4ZDIA 2W0MA 3T1QA 2FEOA 1G6HA 1LW7A 3I1FA 2GJ9A 3QVVA 2VA8A 5GJWC 5IK2A 2F3TA 3WRYC 2X77A 3ZVLA 4Q1CA 4LZZA 1NVVR 2D06A 1ETUA 2CL0X 3SYKA 4DB2A 3L82B 1FQKA 2IUSA 5JLJA 5J4HA 1KYIA 3TAUA 2WWFA
chains in the Genus database with same CATH superfamily
1R0RE 1Y6QA 2XVAA 3ZOKA 4JQOA 3H5OA 2H59A 4RJJA 1L8AA 2FWPA 3GFGA 1BZYA 2QQGA 3OQIB 1YK1A 3DOOA 2A9QA 1OW3B 3AI3A 1NLFA 4G81A 3FMFA 4Q4HA 4INPA 3ZQJA 4Z3KA 3U1BA 1IZZA 3WLFA 2OHHA 4LW8A 5AVWA 1GSIA 4J0FA 2WU1A 3D2CA 3R3WA 3W5IA 1VECA 2FDXA 3K20A 3LOQA 4A2CA 2NWQA 1L7AA 2D5LA 1D2MA 1T8YA 4IVQA 3UPDA 3W1VA 5HYVA 5F98A 3EQZA 1HYEA 3DEAA 2SCUB 3HJTA 2NO0A 2GARA 4V03A 4V0KA 4CM9D 5KDDA 2A35A 3IUPA 1C3VA 2UU9B 5D1HA 4K8OA 3NC1C 2YIVX 5AOBA 5AOAA 3ASVA 1ND6A 3RBVA 4PPGA 5CDTA 5KREA 2WTUA 4ZCIA 1R10A 1R3DA 1YNOA 2PPLA 2XMCA 3CR8A 2GZ1A 3EODA 1CHDA 4GM1A 3SYLA 1W52X 3MWLA 1CEYA 2N0SA 1VTKA 2RC5A 2YFQA 3NPAA 1PWXA 1S1CA 2DPLA 1QG4A 3AF3A 4OGWA 4TSKA 4YN3A 3AI2A 1X1RA 2EC5A 4D43A 4IJMA 1U5BA 2PAAA 2VHXA 4B9AA 2OD2A 3ZIAA 5A3VA 3THYA 2PT7A 4MGYR 5JSHA 4H6PA 5GIOE 3HB5X 1U2DC 1LSSA 4LECA 2ZBVA 4AECA 4UBLA 4BUCA 1ZOPA 1WVGA 4RV9A 4D92A 1HQCA 2PX6A 4DRYA 1FMCA 3HS3A 3HHEA 1LXCA 3IUBA 4BS9A 1IULA 1EG7A 1GXSA 4MYRA 2ZIEA 5HNKA 2OFXA 1D1PA 2G72A 4F9FA 3OJCA 1YZKA 4P3KA 3CN7A 4YLGA 3OLVA 1ZH8A 4TL6A 4ARIA 3AESA 3GGPA 3NHLA 2XYPA 1GA6A 3U5ZB 1HT2E 2XDAA 1CR6A 3GAZA 4UCXA 5MHTA 5KWVA 2OFOA 1W0KD 3Q8KA 2CKDA 3G3EA 7GPBA 2RI6A 2WZQA 1OZ0A 5LD2B 3EZXA 3MOGA 4KR7A 1HF3A 1U1IA 2PKYX 3MBIA 4MYDA 5DRTA 1H23A 3DDZX 4YUAA 5HIIA 2GZ3A 5BSMA 2YNMD 1Z7YA 2C92A 3GFVA 3LC1O 5K8UA 2ZQZA 1KEEB 1ND5A 2OP0A 2OORA 4OJNA 2H0QA 1M76A 4DJEC 3GL9A 4E5YA 4EYEA 5DWDA 3LUAA 3ENVA 1J0CA 4IIFA 3M6VA 3ZZNA 2CK3A 3SP1A 4AFNA 2QL5A 1P2BA 3EQ6A 5FD8A 4IAOA 4AULA 3S40A 2ACVA 4D9EA 1FP4A 2O0JA 3UJ9A 4MAAA 3PLNA 3X2SA 4IDNA 1PV1A 3PDJA 5E2IA 4AX8A 5LQSA 4IJKA 3RJZA 4CCSA 3OIUA 3RYCA 1IONA 1JEEA 1PKXA 1RMYA 2YMPA 3P97A 1NUAA 1KC3A 4KMMA 4KQFA 5DASA 4B5LA 4DJJA 5LR6A 3EXEA 4K0RA 3FYUB 3KPYA 4RCZA 3BC1A 1ECGA 3BWYA 2O0KA 3JAWB 2NUTB 3NEJA 2FOLA 3NTLA 5JEDA 5AP9A 4C4PA 1USVA 2OMEA 1NUSA 3IULA 4XARA 2KB0A 3X1WA 2C03A 2Y0BA 4YJHA 4BV2A 1TU0A 1USGA 2QRHA 3ZG6A 4DTCA 1Z35A 2FPRA 5UKDA 3I0NA 3ZXYA 1GG2A 4IDAA 1NC1A 4QU5A 4XUEA 1DNPA 5CT8A 2RJOA 5GGXA 2EF1A 5AM2A 5JS7A 1T0IA 3K5WA 1GDTA 1U3WA 4MGKR 2CE7A 1VPTA 1ZCAA 2HD4A 3KWMA 5JS2A 1VHTA 4DLUA 3U7QB 5A0TA 4UCWA 3QPVA 1Q95A 4NWIA 3RIHA 4XYBA 1W5BA 4PPYA 1YBVA 1VBNA 2GBFA 3FCSB 1MD9A 5EZ5A 4DQLA 2YV4A 5JCZA 1YS1X 1PJLA 2VUIB 3A4MA 3N2YA 4H3KB 4IRMA 4KR0A 3GDOA 4J0JA 2QP9X 4RV5A 4MW0A 2VNAA 4D3XA 5CA1F 3DTVA 4D6YA 4DDVA 1W44A 3TQHA 4YVFA 3FPFA 1D2RA 1GSHA 2VP4A 1RQ7A 3PE6A 4L4XA 3ZWOA 2GPSA 9LDTA 4EA9A 2NO5A 4KI7A 3BWVA 4PSDA 1U2QA 5BSVA 1PD0A 3PRHA 3HC7A 5JO0A 4ZAZA 5D6NA 1B0UA 2A14A 4JB3A 2OHGA 1PG2A 4O2AB 3CF0A 2N47A 3H6GA 2HYDA 4Y1EA 4AMVA 4JMLA 3QFRA 3P1JA 1V8FA 2DR0A 1T8WA 1RE1A 2AN3A 3N70A 3N8NA 2DHCA 3VH1A 3SQXA 2GD1O 4BBPA 1CF4A 1X15A 2JHAA 3TIGA 4PN7A 1OT3A 1DG9A 1OWMA 2B98A 5I9NA 5KTRA 2BMDA 4FD2A 1KI1A 1BWSA 1C9EA 1T5IA 3CEMA 3E22A 3QV1A 5K8CA 4GNRA 2HFJA 5F9HA 3PXBA 5JWOA 2JLCA 3WLJA 1CUUA 1MRNA 1RLUA 2B4AA 2EP7A 4R98A 4RABA 5JDCA 4ZOLF 3SXJA 4CIWA 1KVRA 3PGLA 4M0LA 3AY6A 5I7HA 1K3TA 3L6DA 1E9DA 4RKYA 3PF8A 3ZWQA 4E6EA 3U44B 2D5IA 2WUFA 4G0OA 4DMCA 3JQ7B 1IHDA 4ZZ0A 2C5SA 1TLFA 2I67A 1KAEA 3A9UA 4I5FA 4MQEB 2O50A 4YAWA 1P6QA 1XDDA 3VKGA 4P86A 1RM4A 1LLDA 4TKVA 3NEYA 3WB2A 3W6PA 1FS5A 2JBAB 5A4JA 2I8LA 2UVPB 3T06B 4L4ZA 5D3ZA 2X9GA 1EUDB 4BEJA 3WLIA 4E32A 1QFMA 1ZGAA 1F4LA 4NZ9A 4QOHA 1JYFA 3C3WA 4M1WA 2OZKA 3GEHA 2XGJA 4NZZA 2ADMA 1LGYA 2GZSA 2OC9A 4FHDA 1AXEA 1P1BA 1WXXA 3UAYA 3KQKA 3F5DA 2VJBA 1J4AA 1FTNA 1LX6A 5FQNA 3EIFA 1A4UA 1VOTA 2IZ7A 3AUUA 4TM8A 3BERA 3VJKA 1ISIA 1X38A 3DWEX 1N2CA 1QGUB 2XYGA 4MKHA 5CFOA 2Z5LA 3NFYA 1PJAA 2DLNA 4U8HA 4OHRA 4WZ6A 4IW3B 1Q22A 3V1LA 5CLJA 1NXOA 1NP3A 4Q47A 1JMYA 1XP8A 2B7CA 3ZYCA 2D2VA 3QHAA 2A5DA 4M22A 2HK6A 4RFLA 1ZM4A 3HCOA 4KDEA 3KYBA 3G85A 4TSRA 1UP4A 2XUAA 3I8XA 4HGRA 4IJ5A 1WZNA 2UZ3A 4Y6RA 4EWLA 2PV7A 3PFWO 4BLUA 2XKBA 5T6MA 3DMNA 4BAZA 4EEZA 2HPHA 1GQFA 5IPFA 4BNTA 3NBFA 1EUZA 4FLMA 6PFKA 2H6EA 1N4AA 4MTLA 5ALVA 1J1UA 3PJGA 3K35A 3OD1A 4RK7A 5COQA 3KAKA 2VBGA 1I7SB 7AT1A 2A9RA 3D3NA 4N1AA 4IHJF 1T29A 4ZVUA 5B3KA 5B5SA 2XECA 1ZFNA 1TVMA 4FFBA 3GA5A 2DTDA 3LYLA 2VYVD 3GJQA 2BELA 4Q48A 2GEKA 3K0CC 4FX2A 5T8KC 3RVLA 3SZLA 3V32A 4D4GA 4LK2A 2R7AA 4DDTA 3DFKA 4CV2A 1QHYA 3D7LA 2F43A 5A7HA 5K8VA 1P1KA 3E3AA 5AUNB 1BROA 2CDNA 3WL5A 1XQ9A 4QWWA 5B57C 1L4HA 1LBEA 1VFPA 2NYVA 3IAS6 4URFA 2IYWA 2WHEA 5E6RB 2Q28A 4CM7A 4CEHA 2XMDA 1JTFA 1JR6A 3WNQA 4TVSA 1C4WA 2NOAA 2R4TA 1JL3A 2F9FA 1DQSA 3H42B 3BZBA 1KK2A 3OQVA 5BN3A 3Q15C 3RS7A 2HDOA 3AFIA 3NVKI 3W4IA 1PE0A 1TM3E 1ECCA 1KIFA 2IY9A 3BCSA 3I2JA 3QBEA 5JOQA 4DPMA 3Q2IA 1K6MA 2BYTA 1FJHA 2WQ7A 2GF2A 1IUOA 1WXHA 3ROPA 1OC2A 1A7UA 1NLYA 3FNFA 1JJBA 3QENA 4NPHA 5FWAA 4F06A 2J4DA 5GIPE 3OIFA 4GWGA 3PD7A 1XTBA 3Q72A 1G2OA 1HC7A 2WABA 5G40A 4JLAA 1BDIA 3CHYA 2ZI9A 5LP6C 1W30A 3DV0A 3LUDA 3T3MB 4RHEA 2P4SA 4L4SA 3FB1A 3VNVA 1YJBA 2QT1A 4AS3A 4UTPA 4NDNE 4CCYB 4O4JF 4ZT7A 4R0VA 3U4HA 3P9KA 1NM5A 1D03A 1UJCA 3RCBA 3T9FA 3EGWA 3I53A 1EB8A 5E1DA 4FOPA 3VYUB 2EZUA 2CMDA 4HLNA 4PWYA 4WZAB 1AY0A 4JNKA 2RKOA 1AMNA 3NH9A 4A8TA 4MK4A 3A6FA 1C3OA 4WESB 2IDKA 2FVYA 2ZTMA 2DSTA 4U7HA 3B9RA 1GTZA 3SAJA 3VNQA 3TDNA 1REQA 2ZRFA 2Z4TA 1CU1A 4MRSA 2GFHA 1SK8A 3R40A 3WWDA 2GCEA 1K0FA 2H08A 5CA0B 1K27A 1TAHA 3B5EA 4G4SP 1NLZA 1XMJA 3OJWA 4KQ6A 4BNXA 4BPRA 3THXA 3W8EA 2DYKA 1YHNA 1A7AA 1ECJA 2ZJBA 3DVAA 4YYZA 3K32A 3H2BA 4IVNA 2NVUB 5EAIA 1KMHA 2GHTA 2ZB7A 3MMPA 4NS1A 3B6IA 1QAOA 3TRDA 3UM9A 3IEVA 1P2TA 3VHQA 2C96A 1VSQA 2YV3A 4OUKX 2XCQA 3FW1A 3T3DA 4A03A 1A8IA 4P33A 5EIWA 3SFVA 1KBOA 3QEBZ 2OV6A 5A5DA 3H2KA 3KC2A 3M6AA 5ALIA 3IBSA 2X6TA 5JPIA 3G9QA 4K9KA 4NAVA 1C2TA 2G63A 2J45A 2M98A 1PG5A 2PUVA 1SA0A 2DFLA 3A9SA 3FJYA 3ID6C 4KRYA 4MW2A 4BX3A 2I6GA 4PHHA 4Q1EA 4N12A 1W34A 4PFKA 4RK4A 3DZGA 5LYJA 3T3EA 3GGOA 2IQ5A 2RK3A 3LQQA 1BEEA 5LFAA 4V0RA 1J22A 4WLOA 2C00A 1KRHA 1PL6A 4HV4A 1LZKA 1YWGO 3K9QO 2OAGA 5JXHA 4KWEA 1J2YA 1CV2A 1E20A 2A0FA 1Z2OX 3LDGA 3NV9A 4XKJA 1N0VC 1VBMA 3BWMA 4JEHA 4OHCA 5FKJA 4BVGA 4JLWA 4Z4GA 4FWBA 5EZQA 5FUMA 4S1TA 2VP0A 3WTCA 1N4DA 1UWLA 2HXSA 3FRHA 3ZY3A 2J3QA 4HP8A 2Q3HA 3BFVA 4DBZA 1ZOIA 4R9NA 3UFBA 1FTQA 4DF3A 1KEZA 1SJ9A 2NVWA 1V35A 4OGGA 3ZU2A 4AJJA 3X1JA 4BDSA 3E9RA 4ZI7B 2ZAIA 2ZAOA 3ISVA 1R0SA 1MAHA 1DAFA 3U0VA 1HZJA 3KUUA 4UOQA 3AVWA 2O8FB 2IE8A 4NCNA 4X1IA 4YRZA 4Q3AA 2F1IA 2CLMB 1EZ4A 1FSFA 1M75A 2DKNA 3K0FA 2BGWA 1IQ0A 1QHEA 2H29A 2J33A 4A9AA 1M6WA 1P7VA 3FGNA 2WJVA 2QENA 2FFJA 4RZSA 4GKAA 1SN7A 3H1GA 2IUUA 3K6SA 3BMXA 3G02A 1KMNA 2CJWA 3HY3A 3QEOA 5THKA 3TN7A 3WIBA 4ER0A 5A4MS 1QK3A 1D1QA 1YCGA 2GZAA 4Y0VA 2H52A 4B7XA 4CKCA 1XA0A 1KPHA 2AMYA 4FE3A 1QLWA 1QM5A 4JFAA 3RYFA 6NULA 3IE2A 5LKAA 4D46A 3PQEA 3SQWA 3JQEA 4M87A 5HCNA 2PGOA 2YRFA 4RA9A 1E9VA 2A1TR 2RGUA 4IYJA 5AO9A 5T41A 3RUPA 2Q50A 3MCAA 2BBOA 3QSGA 5FT9A 4E5PA 4HFRA 1XRSB 4E5SA 3C70A 3HCPA 1WULS 1Q0QA 2ZUBA 3UV7A 3E2PA 2IU3A 4MLZA 5F3RA 4D8YA 2EARA 1J9EA 5LA6A 5EP1A 1LLFA 3WSWA 2ZKLA 1Z6YA 4P3XA 4TQUS 1T5BA 3PXGA 3ORHA 5JCPA 2C84A 2PRJA 4IKEA 3B20A 5KDOA 4NK5A 2A6PA 4FB4A 3GJ8A 1XLTC 1ADJA 3CRMA 3KB1A 1EAMA 4MUMA 4PAGA 4YJ2B 4ZO8A 5C53B 4F8EA 1A4XA 2FKNA 2G40A 1J70A 1LPBB 1SBCA 1UAGA 5AHOA 2OCBA 3IPXA 5TPZD 5BSWA 5KTOA 3SBEA 1V8PA 2JNWA 5F1PA 2NO6A 2PTHA 1AS0A 1W0CA 2Z08A 3CMMA 2Q5JA 2ZJOA 5KVVA 1TEVA 2QSJA 1YCDA 1TMOA 2GD2A 1F2VA 4H7DA 1MC4A 1PT7A 1CPYA 4OKIA 3HDGA 1RYHA 3FR7A 1IPEA 2QWXA 1GGFA 3N8IA 3VZBA 4AZ3B 4EJSB 2X8LA 3MUFA 2XCSB 3AR5A 4HH1A 5LQNA 2HA0A 2O8EB 4W9NC 5HW0A 3RBXA 4F9TA 3NRJA 4Y1GA 2AMLA 2JGDB 3PFFA 4GMGA 2C8VA 5CEEA 1V5EA 3HU2A 5L7WA 4CT4B 4YJ3F 1RXCA 2XZDA 1QFXA 2HCJB 2R1TA 2WPDA 3FFBA 4PX9A 5FNVF 2DCMA 4LJAA 4JJIA 5HJ2A 2NU7B 3CY6A 4LC1A 3EF0A 4M2LA 2X22A 4YV2A 1XKLA 2VZ0A 4C29A 3D8HA 3I3SR 1OKKD 3WHLA 4PHCA 1E1RA 4Z53A 1UMKA 4R9VA 4O4HB 3CX3A 1SU8A 3EPLA 5BVHA 4AB1A 1D2NA 2XQJA 3ZNPA 1V96A 2G8NA 4RH0A 1U0GA 4EPRA 3RJ5A 1GL6A 2WAYA 1LQTA 3H5VA 1AZTA 5JAPA 1U3TA 3WP0A 4L9AA 5LC1A 3K0KA 4WOPA 1X1DA 2E7ZA 1XN1A 4GOMD 1S8AA 1SB8A 4MKXA 1KMIY 1GKKA 1SXIA 2JEYA 2OBBA 2IV7A 2AJCA 2QX7A 4WCFC 1EXWA 4Z4HA 5C1OA 5EMMA 5L3RA 4RQTA 1PK7A 1VJDA 4MHSA 4RORA 1I4LD 1EIZA 3KKKA 1IM2A 3JR7A 5ALUA 5SYAA 4ND6A 3L8EA 3V9PA 5BQ3A 1XMQB 1P75A 2G9QA 1SNYA 4XPZA 3PHIA 4QJBA 4QUGA 1RXSA 1UBUS 2HK7A 2J3IA 3DGFC 1L5KA 2BFAA 3INRA 4TTVA 5HQJA 4CBVA 2EGGA 1Z68A 1HKHA 2R8PA 2ZXUA 2CXOA 1JB1A 1AXRA 2H1HA 1LH0A 1QORA 3ROQA 3GCZA 2I4MA 3I2HA 1EM8A 1QZUA 1H42A 3F6BX 3I1IA 1XVUA 1KOJA 4Y2RA 3RWMB 2IODA 3S1AA 1ZUD1 4ZAWA 3EA5A 3A6HA 4K2HA 3T5AA 4Y2VA 1ADGA 2ZB4A 4E12A 2A9VA 4CRWB 4F45A 2VATA 1ZNZA 1IHUA 1KKUA 3JR3A 3M49A 4GXNA 3EOZA 2TS1A 2HSWA 4NYJR 2V65A 5HQ3B 1A2QA 1NYQA 1HO3A 4O2RA 1A8HA 2E4ZA 5DNEA 2PHZA 3LUJA 3EWAA 5EE1A 5ILQA 2OSVA 3WGHA 3ZCSA 1IN1A 5BV7A 2VJLA 3ITDA 5A6SB 4B4UA 1LEHA 3WWYA 4ZOQI 1ZCBA 2B83A 5K0FA 1GUDA 2QRNA 4CN9A 3PI7A 5DTJA 4MGZR 2WIJA 2XBLA 3BWDD 5JSZA 4CQJA 1SU7A 2M6SA 2AV6A 2DR3A 2NTVA 4B7UA 3IIMA 2P91A 4NOJA 3ZHSA 2MTBA 1B8VA 2IVZA 3AM4A 4HKTA 3O83A 3SOPA 2HMAA 3JQGA 4R3UC 4LY3A 1XHLA 4KO1S 3ODGA 4GGMX 4EJ2A 1NOJA 4PNPA 1L8LA 2HADA 2NAFA 5KVSA 1ILWA 1SKUA 2PX3A 4HGZA 4BQFA 5K3CA 1VGVA 4MVJE 4RTNA 1CT9A 4QYSA 4CM8A 1O4WA 3OE7D 1L4GA 1T1EA 2AXNA 1KL7A 3BL5A 2XUFA 4CQNA 3KX2A 2HH9A 3KQVA 3IESA 3KVVA 1QVZA 4F1JA 1BWPA 2Z8ZA 3PUHA 3HSYA 4U2KA 4ZTUB 3NYQA 3TI9A 3BMCB 1CQWA 1P33A 2ZIUB 2KYRA 4XD7D 1YFJA 1RFLA 4R81A 1TLTA 1RJ9A 1UZLA 3RG2A 2VJDA 4QXRA 4JP8A 4QQ8A 4CT0A 3IKJA 1FK8A 2NPFA 1Y8RB 3Q7PA 3A4LA 4FYIA 5A3SA 4OK6A 3SDSA 2W4MA 2VJNA 3BA1A 4J2OA 2H1FA 1FP7A 1RFGE 3ANNA 4IWYA 1AIPA 4OO3A 1S96A 4CQMB 1XTJA 1PBTA 1MQSA 4F4DA 1IUNA 1AUVA 3CVXA 2GNAA 4JKYA 4KEAA 4ZQFA 4LKOA 3ZH2A 1P91A 4MMYB 1BKYA 5KX5A 1L1QA 1UMDB 2I78A 2XGSA 1UP6A 2IL1A 2DQYA 4OQQA 2AFVA 4MRNA 1JKJA 2V7QD 3IEKA 1QH8A 3R6LA 2NZJA 3GVPA 4UEJA 3VTZA 5CT6A 3RFVA 3ZCQA 4ZKDA 1R16A 4RZQA 2DGDA 4DPKA 3MYYA 1Q11A 4XCXA 3GNQA 3GB9A 5HIMA 4B7AA 4MPPA 1RQRA 4ZEVA 3BMNB 1ST2A 3GGSA 4IQ0A 4KHZA 1YR7A 1SXPA 1QU3A 1QJCA 2IDMA 2V7UA 4BNHA 3M33A 1DE0A 2W2LA 3IOMA 2VNIA 1IEXA 4BNFA 5J4VA 3MTIA 4JAVC 1M33A 4NL4H 5EMKA 4FFVA 1BXZA 1H3FA 2H9YA 2C4TA 3FNRA 4I1UA 1U2PA 2WIGA 3PI6A 3EWNA 3HB1A 4PNHA 2FPOA 3JZFA 4GG1A 4Q3LA 1JHUA 1Y48E 2EX4A 3G59A 4UKDA 3I05A 3H2SA 4IQ4A 4EB3A 5BSTA 4EKGA 3AP2A 5EXSA 1C0IA 4TV8B 2NMVA 1O97D 4PLCA 1U02A 3EHDA 4HAZA 4Q4HB 3SMVA 4GMXA 1UQRA 2BCEA 1JIJA 2WJGA 3ABQB 1MB9A 3KZNA 4WN9A 2IS6A 3EBPA 2NZWA 1W2GA 3LWBA 4L78A 1TQDA 1VLQA 1PW5A 3DC7A 5GJCA 4M1TA 3DB2A 2X0FA 2P2CA 4O2BB 4TSFD 4D0NA 5AVQA 1AKRA 1WXQA 4XQCA 1NKSA 2QXTA 2OBMA 3TNFA 1KI6A 2WW8A 1GCGA 5GP1A 1NUHA 3BZUA 1JVNA 2XA1A 1VMDA 4ESHA 4DCJA 2ZUDA 4G8CA 1QH1A 3TSZA 4EA6A 2JFPA 4AJHA 1FLAA 2OCDA 1IN7A 3NTOA 4KUHA 3PQ8A 2H17A 1HNNA 4LWQA 3N53A 2HF2A 3IBGA 1S01A 3MB8A 4G65A 3EG9B 2X0EA 1DKQA 4B85A 4NNOA 2HRRA 1L5LA 2JLWA 3JASB 2VR1A 3QFFA 1K63A 4WN3A 3REFA 3UJPA 3RSQA 3QMPA 2P9FA 4KXLA 3UUGA 1CS4C 1T34A 1VIDA 4PBTA 1TGYA 2ACKA 3L9WA 3EQ7A 4FT2A 3G2IA 3UQYS 2EWVA 3THYB 1CDOA 2DBQA 3KL4A 4D8TA 4D9FA 4YMLA 3BGWA 4QELA 1NU8A 1R8QA 4AJEA 1OLXB 4E09A 7MDHA 3OD5A 2V7WA 3LOPA 2GT1A 3RRNA 2DJ5A 2ZBDA 2G04A 4G56A 4LF8B 2HFKA 1NV8A 1QHXA 4WK0B 1YB6A 3MILA 5ALHA 3DE6X 4DLNA 3L06A 4CMKA 2Y27A 1XZLA 3H75A 4QJ4A 1C7JA 1RBZA 2AW5A 1AK9A 3ZCXA 1RM5A 3AESB 3GUVA 3GT3A 3BGVA 4UBNA 1V1MB 2OHVA 1QCZA 2WJZB 5KYTA 1KKMA 3VR2D 3RPEA 1LC0A 2VUSA 1JB9A 1UZAA 3DEZA 4ZI7A 5BR4A 5JAHA 4NH0A 1OLUB 2YN4A 1K68A 1S9HA 1YE5A 3EFOA 5GONF 1UBFA 3ZV5A 3LBAA 3GLRA 3NLLA 2B78A 3IP5A 3GJRA 3NKFA 5CAEA 5AOCA 3F8WA 2RJ3A 4Y2JA 5MN6A 4GWKA 1N2BA 1M2KA 1YZNA 1W2WB 1YKSA 5EUBA 721PA 3RVKA 3DXYA 5BRAA 1RWBA 3PFHA 3R77A 1JMVA 4D9MA 4FMDB 1K0UA 1R0WA 5E0OA 4TUYB 1DKRA 5CIYA 4ZHSA 1AKTA 5C52B 2ARKA 4NBKA 1NQOA 1OIVA 1Z39A 4MUHA 4BZXA 3CZ4A 1HL7A 3C1TA 5ALKA 3LWNA 3C97A 4WFKA 4E30A 3DZHA 2BFFB 2WU3A 3DONA 4MVJD 2Q1SA 4C1NA 3P94A 5C1BA 3OP4A 4NBUA 1Z0KA 1MO4A 5EQDA 3S70A 1K75A 2Z30A 3EXEB 4HGNA 5LJLA 3O3CA 4FONA 3VGPA 1T6XA 1YB7A 3CSDA 3OIGA 5ADWA 5EE9A 1SHTX 4MCHA 2X8BA 2WUGA 4NZMA 4PFQA 2OGSA 2PZFA 3GEDA 1U9ZA 5AKYA 3SJAA 2JI9A 1HR0B 2J9FB 5AJZA 4DG9A 4FC6A 5HS6A 2G25A 5E8JA 1YDGA 2DQ4A 3BRWA 3MXOA 4CZ2A 1UC8A 1GLGA 1J39A 4QPJC 1BX0A 2Y1WA 2H31A 3QU7A 1ZGCA 2AMFA 4RFSA 3I0ZA 2XQIA 4I4TA 3KE9A 4KL8S 4WNCA 3ROTA 1NXQA 3C2QA 2Q9UA 2O3RA 2BPOA 2YWEA 4JJKA 1SKYB 4ZU1X 5B4UA 5J5VA 4B47A 2UZ1A 3FYDA 2I4LA 4CG1A 1GU1A 1JDVA 1KDZA 1CY2A 3NVDA 1HEUA 4OXRA 1GAWA 4R8SA 1GV0A 1Z7BA 4EHDA 3JCZA 4EOGA 2AX3A 1DT3A 4IIJA 2VHVA 1MR3F 3LFUA 2ATVA 2CNWA 2CXQA 3O9ZA 3D7RA 4KAFA 5DW3A 2NZ2A 3R44A 4JELA 4LDNA 2HSDA 2ZM5A 1TD1A 1XF9A 1WBDA 3B2QA 1CEXA 1NJ1A 3ETLA 3R8FA 3GRFA 3O1LA 1ZH4A 2FUNB 1VB3A 3NNSA 4JBLA 1QMPA 1JR3A 4I55F 4MA0A 3TLGB 2CBXA 1DXYA 3KWJA 1FUUA 1I1HA 1NAIA 1V6AA 1YJCA 3RG8A 3Q0TA 2ZIFA 3CLSD 4MKIA 1AQ6A 5D7BA 5FOUA 2JW5A 3I23A 1XU4A 4UFNA 2ZVQX 1XD2B 1QH0A 3MC1A 4FWTA 2DUJA 2PS1A 3WOVA 4F6RB 4UHEA 5ALSA 3OLQA 2LKDA 2FPLA 2NYUA 5JSQA 5JAOA 1M6VA 4FBMA 2PLFA 3FBWA 2I8AA 5TT0A 2VRWA 1R9MA 4KQCA 1UJ6A 2CFSA 4OBXA 4IDOA 4TWIA 5JI3E 2LV8A 3ORRA 1NVDA 2IZ1A 4C4TA 3L8YA 3G2HA 4IJQA 2GN8A 1QZ3A 3O26A 4MR9A 5GVRA 3A3PA 2XOXA 2IH2A 3KUCA 3Q7QA 5LYYA 3Q2KA 2V4ZA 4GPTA 4QUAA 2O3TA 3ROMA 9MHTA 2QN2A 1FFYA 3IR7A 4U9UA 4KU4A 1YFLA 2VQEB 3D6JA 1YMQA 2NZXA 2Z6VA 2I4NA 1RZVA 1TPZA 2BZSA 4H9GA 4AXBA 5TX7A 4ZJZA 5EKSA 3LPDA 5DCYA 4OHOA 4KQ2A 3RHTA 1RWNA 3V48A 5FV7A 1N6OA 2DG2A 3A4YA 4RACA 5CCDA 3U4CA 3RANA 3T5PA 1E3IA 1O95C 3I2GA 3Q7TA 3QWBA 4FQ8A 5BWNA 3ITEA 1C7FA 2PZJA 3W3ZB 1DMRA 2FX5A 2XUPA 2XUGA 2O4UX 1ESNA 2DVMA 3LH5A 2C7BA 3TRJA 4PY2A 4IUYA 1LBTA 4PQFA 1FFXB 1BOOA 1LLQA 2Q1UA 3R24A 2E5WA 1V5WA 5DLPA 4C78A 3U7HB 5AJYA 2OTCA 3WO0A 2QROA 1C41A 1OMOA 3EEIA 4CDMA 1NPDA 3AINA 4URXR 1ATZA 1ZK4A 4HZUB 4J07A 2HRZA 2RGEA 2WVGA 4CYMA 4IP0A 4QKQA 5JPDA 2VUTA 2X9QA 3WHKA 4JSYA 3THWA 4G1UC 2AJLI 1J99A 3QE2A 4ZYVA 1NVAA 5F73A 3LC2O 4HN9A 1H4TA 2ZYTX 4Y9SA 5DHQA 1CWUA 3JTMA 4A2PA 3Q9NA 1M34B 5JWRA 4F86A 4TGLA 3WS7A 1BYUA 1JNYA 3BIOA 5IF9A 4FFBB 1FVOA 3DBHB 4I6JA 2WUEA 4IMPA 1RKXA 4MR8A 4YXWA 4FEYA 4ZI3A 1YZUA 2BFWA 4H3VA 3KK0A 1ATIA 3H7AA 1TQ2A 2EP5A 3HGMA 4J1TC 1YQXA 4LMBA 3RV4A 4YP0A 3D6FA 4GZ5A 4C5CA 1KOGA 3CLRC 4V0SA 3VDMA 2C5AA 4CEHB 1MGPA 5DEIA 4IWNA 2OOKA 1F6BA 2HA6A 1P39A 1N92A 3KV3O 3W9BA 1WDWB 3HKBA 3VU1A 3FH0A 2PM8A 3NO4A 4BB5A 5A2QA 1JE0A 5IKOA 1G98A 4LMPA 3WB9A 5BN3B 1SCKA 1IH8A 2VKQA 3H5AA 2JIDA 4WBXC 5BUQA 1PGOA 5F1OA 2P9YA 1GAJA 3UOWA 1FTWA 5ECDA 1QOPB 3PXUA 5AW9A 4D26A 3DHYA 3EC1A 3F67A 4M36A 1FU8A 1H1DA 3ETCA 4QQRA 5DDIP 3UT5B 2H1RA 1P5JA 5AW5A 4HB0A 2F4VB 3I9V1 1VIAA 3RC3A 1F7UA 2OV3A 2H0RA 4JQYA 4DCUA 3S27A 5FWXB 3PHJA 1LJUA 3LYAA 5E6SB 4KACA 3SGLA 2CLDX 1MC8A 1FDTA 2CT8A 4GSLA 4R4JA 4KJZA 4MITA 4HTFB 4X61A 1J0DA 4FSHA 1I94B 2YINC 2WB4A 2RSLA 2CUNA 3E9ZA 2G83A 3HL4A 1XDUA 3RREA 2AOTB 2OHOA 1JBQA 1P1IA 1SKBA 2WP8J 1RAIA 3NVAA 3OU7A 3AR2A 4DY6A 2AUMA 1A96A 2JHGA 4TM7A 4YCCA 4FLFA 4MYTA 3VH2A 4CIBA 4KBYA 4HI0E 1W4LA 3FVRA 2VI5A 3RVQA 4TTTS 2Y1DA 2PKWA 3SY8A 5BMOA 4EGSA 3EHEA 5CR9A 3I76A 3FHTA 2Y99A 4P3YA 3MOIA 3ZUPA 4KHPB 1GG8A 4DLRA 4YT2A 1C3OB 2B2NA 4J8PA 4O0MA 4G5FA 3ZNOA 2IXBA 5IRCD 3F9RA 2N3ZA 4X41A 1CUHA 2ZB3A 3DF7A 4MV5A 2IXDA 4JBNA 4A10A 5KOIA 2JDIA 3V1NA 1TK3A 1VE7A 1Z88A 1ZC3A 2QSYA 3OZEA 4P1ZA 4CCWA 3EEOA 1T4MA 2QUHA 2SKCA 2WKRA 4IJUA 3WLPA 4EG7A 4QFDA 1QHSA 5I51A 2RH8A 5FPSA 3THXB 1HFJA 4ER6A 2PTGA 3CEPB 3ROZA 5JXJA 1LVGA 2FG6C 3GYGA 3U0BA 2BI7A 2RI0A 3WNCA 1PTJC 2D1RA 2XQFA 2IVFA 4UJ5A 2AN1A 2PPVA 4S35A 4QM7A 1W93A 5J2UB 3TBKA 4B73A 4J3JA 4Q9AA 1U7PA 3LPMA 3H2IA 1JDNA 1P4RA 2N42A 1XXHA 4RJIA 4C2BA 4DR6B 5AKGA 3TEJA 2A0KA 3CKLA 4R2IA 4YRTA 5DOVA 5TQ0A 4F2DA 1VXOA 2A2ZA 2QAGB 4LS3A 2QS9A 2GWRA 4PTLA 5LYJB 3ESCA 5ALRA 1B7GO 5CFNA 3OJLA 1BDMA 1BNCA 3INTA 1E9EA 3ABOB 2X9LA 3ACBA 3LQKA 5A9SB 2FPPB 3UXYA 4QE3A 3W9YA 1Y6FA 1YAHA 4QNMA 1I4OA 4RJ2A 1QH9A 3IKMB 1WDMA 3A25A 5CTJA 2HMWA 3MTAA 1O9HA 2C2ZA 4V0ME 3H9QA 2EX1A 3F2IA 3TO5A 1JEQA 4LVCA 1E3LA 1NXWA 221PA 3N8HA 3HB0A 4HDKB 5IBPA 5C81A 4LF6B 3EW9A 2J7PA 4XE5A 2ZRCA 5DIZA 3WV5A 1H8HD 1DLIA 5CDFA 3KELA 2IPMA 4DNXA 4TMYA 4NHEA 1MX1A 2NUBA 4G5HA 3OPVA 4RNDB 3A1VA 4QTUB 3TAXA 4DMKA 3W5AA 4L8GA 5BYJA 1KSFX 3ZJYA 2IU0A 1UF9A 1J24A 4L6CA 4XWWA 1NNLA 4TQGA 5F3DA 1KO4A 3ZYZA 1I14A 3T4EA 3VJMA 2ZYAA 4MCAA 1RQLA 3C16C 4TWZA 2ZBQA 4Z6KA 3SHTA 2Z3WA 3RS5A 3T5TA 1FTSA 1UJ5A 1Y81A 1ZQ9A 3LT5A 1EI9A 1KQGA 3RRJA 2PGAA 1JDSA 3K6SB 4P0TA 1TW3A 1PYOA 4M1QA 2FN9A 1ACMA 3IE0A 3DZ8A 4MW1A 4LA4A 4FM9A 3OZDA 4E33A 1OWPA 3F5FA 3MXTA 1C3JA 2AWNA 4Y2QA 1DRKA 1KH2A 3I9FA 2CFRA 5IULC 1Q57A 1BVHA 3VPFA 3UMCA 1H0HA 3GFOA 4OD0A 2F62A 2Y0CA 3GV0A 4ND5A 2ZIXA 3L7NA 1KEVA 3SE7A 2WD8A 1H2AS 3PDIA 5DI3B 2PXXA 3UJAA 2OZPA 3ZVMA 3WMFA 4AZWA 1WB9A 3QTTA 1U0RA 3BBPA 3IAM6 2WM3A 1U3CA 1U90A 3P2YA 5HUQA 3KSDO 1P62B 1V3QE 2OT3B 2V03A 2ZTLA 3PA8A 5I7SA 1ICEA 1E3WB 3I92A 5C4GB 1CLUA 1HLFA 2BFMA 2C4NA 4IYRA 1XNRB 4HNAB 5IU6A 1JEAA 1ID1A 1K8XB 4LYHA 4NU8X 5EJ2A 3RTAA 1IJKA 1K08A 1LQUA 5HGJA 4L02A 3SN6A 1TCBA 2CYCA 5IC4A 2P0AA 1XJQA 4G37A 3G5LA 3D7MA 3CVYA 4DEXA 1QSGA 1O9GA 1DTEA 2PXHA 3ELWA 4J4TA 4JGGA 3NUGA 4RA6A 1N6NA 4JYCA 4IUBS 2ST1A 1Z9BA 4AROA 3RVRA 3T52A 4ASUD 4NCBA 3EASA 4C6TA 2LPMA 1R4ZA 3KQWA 5JSKA 3G49A 4DG8A 2QM0A 1HDRA 1WD5A 3I58A 4FVTA 4W7SA 1X19A 1SVUA 4QJIA 3ZE7A 1VPLA 4Y1FA 3HNRA 5JC1A 5JJIA 1JIQA 4H1UA 4YRCA 1CQIA 4DV4B 1XL1A 2FFAA 1KY2A 4PX5A 5FBHA 4OFBA 4ITRC 4EVIA 2RBEA 3KQNA 3WRXA 1JSLA 3A31A 3T5BA 1KQFA 1LU9A 1PNOA 1Q74A 3CZCA 5TY0A 1UBHS 4IMIB 3DT9A 5K3AA 1I24A 2R47A 4RDHA 4ISCA 3EAFA 3SIRA 4MCJA 3SVLA 2R2GA 5IWCA 5HJEA 3G8BA 1RSZA 2RG7A 1NVWQ 2UUPA 1L5HA 2FWBA 1Y37A 4QGSA 1K7CA 2WILA 3BXXA 3GOQA 5DJ5A 3LV8A 2HJSA 3NP9A 4CU5A 1FSSA 2OCIA 3BWBA 4LDRA 4CI0B 5BVHB 3OFSA 5EIBD 4DT1A 3STXA 5C80A 4MHTA 2Z2ZA 2QNBA 2JS7A 2PZBA 4PVDA 4DLXA 5BT8A 5CXUA 3KQHA 1PSZA 5F2NA 5AI9A