1CDDA

Structures of apo and complexed escherichia coli glycinamide ribonucleotide transformylase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
189
Chain Sequence
MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYAADE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYL-GLYCINAMIDE FORMYLTRANSFERASE
publication title Structures of apo and complexed Escherichia coli glycinamide ribonucleotide transformylase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase(formyl)
total genus 52
structure length 189
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 1992-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1cddA00
4QPCA 4TS4A 1YRWA 1RBYA 4ZYTA 3GARA 1ZGHA 3KCQA 1FMTA 4ZZ3A 1ZLYA 4ZYYA 4S1NA 5J63A 4ZYWA 3P9XA 2CFIA 1MENA 4TT8A 3W7BA 4Q12A 3DCJA 4R8VA 4QPDA 3R8XA 1GARA 1NJSA 5J9FA 1C3EA 5CJJA 1RC1A 2BLNA 4DS3A 4ZZ0A 2GARA 3NRBA 4YFVA 3OBIA 2YWRA 1ZLXA 4NV1A 3AUFA 1RC0A 4YFYA 3AV3A 1C2TA 1CDEA 4ZYZA 1GRCA 4PZUA 1S3IA 4IQFA 4ZYVA 1RBQA 3TQQA 1CDDA 2FMTA 3O1LA 4TTSA 4ZYXA 3TQRA 1MEOA 1RBZA 4EW2A 3DA8A 1MEJA 1JKXA 3LOUA 1RBMA 4EW1A 3Q0IA 4ZYUA 2BW0A 4EW3A 3N0VA 4ZZ2A 4ZZ1A
chains in the Genus database with same CATH superfamily
1VGQA 3M6UA 4PM4A 4Z0HO 4HNUA 5ALVA 3T7EA 4CT4B 2ZBUA 1PGQA 2IYTA 5DBFA 1U2DA 4OL0A 4XR4A 5C1BA 2ZUFA 1FX0B 3IBSA 3AM5A 4O2AF 4DTIA 4ND8B 4UEKA 2OSBA 5JS1A 3ZDFA 4DR5B 2Q5OA 3NGMA 2OKGA 4PQYA 2B4QA 2PX3A 1UZLA 2AR0A 2FPKA 2OZLB 3LBHA 1AKWA 3IMKA 3OJ0A 4ZYYA 3AU9A 2QEQA 1KI9A 3CLHA 4DLLA 1LLDA 4CRWB 2FXVA 3PI6A 2ZBPA 4GX2A 4LUCA 3I30X 4HQRA 3HXMA 1D1SA 3E5NA 4TT8A 4D0NA 2PAAA 2XI4A 5ALUA 2QX9A 4PRKA 5JCOC 1T35A 4F6CA 3P5SA 3PR3A 3SF8A 1SU8A 3G7NA 1UH5A 4FNMA 1FEZA 4Q3BA 3KR1A 4Q16A 3NM5A 3T5MA 1U28C 3PHCA 1E2DA 3T15A 4A0RA 3HVRA 1K2VN 2WZQA 1DAEA 4JYZA 1CQWA 1KYTA 2P7HA 2X42A 3F98A 4CTOA 5DLQC 2X8WA 3MJ4A 4DTCA 4N65A 1VL2A 2HWUA 3HCBA 3WJ7A 2QUHA 3N2LA 3KOMA 4KZPA 4PIPA 4PYIA 5JJCA 3N3AC 4E2FA 1ZR2A 4FN4A 1VG9B 2XYGA 1G8KA 3GT0A 4UAJA 4XGRA 1D2NA 3DD5A 5JI3E 4WFIA 2GJ9A 1K7YA 3T3IA 1B1AA 2O3JA 3GJSA 4EEXA 2VYCA 1K5GA 1NG1A 4FIDA 1V2GA 2GPYA 2VPPA 3AIKA 3IP3A 3MJCA 2GARA 3QUAA 4B3DA 4PNEA 2BDTA 4DIBA 2EKBA 4D5EA 1PWZA 3D3KA 1WMAA 4EL0A 1FNDA 4W6ZA 4CM4B 2XXAB 1JTFA 4S1PA 2FGKA 2A8YA 5LDGA 3LRTA 3AC0A 5EMHA 4Z5XA 2ZBDA 3NH9A 2NZYA 3PE6A 3QWFA 3C98A 5EMKA 1K88A 3Q3IA 4HTFB 4KRGA 1D7AA 1Q92A 4LTNA 4HS9A 4NBRA 4L7VA 3ZVRA 3OX3A 3CRZA 5CD9A 1Q7BA 1VKNA 2PSJA 1L7OA 3FRHA 4IF6A 4GRAA 4QBIA 5AKYA 3H6KA 4F8YA 2O8FA 1DAOA 2UZ1A 2R2AA 1FFXB 2ARKA 4W1RA 4HY3A 3F2VA 4DNFA 1PG2A 3ITNA 2BZ1A 4Q1VA 3UYLA 4RJ2A 1TU4A 1JHQA 4MRRA 2GJSA 3UWSA 5KSYA 4O4IB 1JLKA 3F3SA 4AX4A 5AHWA 3O75A 3VH2A 1BMTA 1L4BA 4YJ2B 1DG1G 3EPPA 4IIJB 1U0SY 4ZO4A 3C6MA 3NVDA 3A6PC 4ZO6A 4ZEXA 2Z58A 2G25A 3PQEA 3QIAA 2IYXA 3FYUA 4AG5A 3OTOB 4D56A 2FCRA 5EL0A 2J9YB 2V8OA 3L0PA 3IRVA 1MRSA 1NVWQ 3DE4X 4FCCA 4I9GA 3WLHA 2XUAA 4GE0A 4GMFA 4EL5A 3CW8X 1R15A 3JVEA 3J7TA 4FCWA 4DCTA 1CNEA 3VPGA 2AFHE 2J0SA 2B78A 3I2IA 4ZU1X 2PH1A 4OX9B 1NBWB 3H75A 2AYXA 3QENA 1N2GA 1Z2NX 1TCVA 2WG2A 4J0HA 5CU7A 3UW3A 2C2GA 1CP2A 4P83A 1L7VC 5IYZB 5KOHB 5LL6P 2H0AA 4I4TA 3I5UA 1XCMA 4A10A 5D5QA 2JIPA 3EFOA 3VPXA 1PWXA 5F7OA 5IXYA 4RZSA 2C83A 3ESXA 4HAYA 4Q1EA 1JZSA 4MEJA 3UVEA 4BNHA 4BVBA 5DI3A 1M2NA 3CN9A 2EQAA 1E2KA 1T9ZA 3LXUX 4BVGA 1GQSA 4V0LA 2WJ4A 3NDPA 5GV8A 4E5MA 1CZNA 2XE8A 3CQ9A 4U39A 3HFJA 3M4ZA 1ZX1A 3ECSA 4RVCA 1QGUB 1ISHA 1IM8A 3GMDA 3KNZA 3HXOA 4HYEA 3OQMA 3ZDQA 1IOVA 1QOPB 1XYYA 1KI7A 3DB2A 1KC3A 3W5BA 4UARA 1WSBA 1AS0A 2Q6IA 3OZAA 1V47A 3K5HA 2A88A 4H0FA 5KYUB 3RS4A 3GWGA 4ILKA 3VNQA 1XMSA 4K0RA 4ER0A 4DJTA 3N8HA 4E0BA 1PFYA 3HUUA 2EBHX 1STOA 1X39A 4MYUA 4Z9AA 1MR3F 4RPKA 4I9NA 2IUUA 1GZ4A 4MS4B 5DYYA 3AIMA 3C6ZA 2IOFA 2NU6A 1LFAA 2XKJE 3S40A 1J99A 1OTXA 3WISA 4EUNA 4YUXA 4D45A 1J90A 2EW8A 5E1DA 2VH1A 3AR3A 1OPRA 2JASA 2QRNA 2ZT5A 3AFMA 4L8LA 5EMNA 2ZJ2A 4A8HA 1E2GA 3P19A 1DXOA 1XXHB 3TYXA 2GRJA 4QQRA 3Q5DA 4N5HX 1I1QB 3E27A 5BYJA 2A1TR 1JR6A 3NORA 3F4BA 5ALDA 3MJEA 2FMFA 2FSVA 2PL3A 4U0KA 1ESEA 4EFMA 4RHUA 1ZYUA 4YRAA 3ASZA 3MT9A 3WX0A 1JH9A 2CDAA 1OAKA 2FN7A 3O21A 4S1TA 1EJ0A 4DBLC 5B1YA 1YR9A 3SLKA 1UFVA 2OCDA 4HTAA 2OHVA 3LW8A 3P2MA 5AJUA 3LO5A 3LCCA 2P8JA 3DBRB 3UUWA 4BO2A 5BSRA 4OLFA 4AC9A 5HW0A 3PUHA 1FLDA 1ZMRA 4X92A 4LYHA 1GNSA 4IFBA 1EFCA 1JWAB 1OE0A 4WINA 5J1TB 4IKEA 4J07A 1GFWA 1LF0A 2GZRA 3CGGA 3TW4A 4Y8VA 5J2TA 1F60A 2R7AA 3RFCA 3WKDA 4IIXA 3O0TA 2H2FA 4MR9B 4WZBA 1E2FA 2W2TA 1Y4ZA 3WADA 1UKZA 4CCYA 4AKIA 1R0WA 3ZDAA 3DDHA 5EUBA 1JG2A 2COUA 2G5TA 1FYXA 1AGPA 3BM5A 1XCOA 1TD1A 4BFVA 3EDCA 3VI4B 3JQRA 3UFXB 2GN2A 3FOAA 5BNZA 1NJ6A 1G3UA 2J6IA 5EHXA 5FADA 1AM4D 2CNWD 5F21A 4IOKA 1J06A 5EUMA 5L7TA 1PG5A 1DVRA 3OMWA 2PZBA 1N2JA 5CX1B 2B5OA 1Z2DA 3HSKA 4ALJA 2VQSA 3HKDB 3KZNA 1B2LA 3O9VA 4CM7A 4G2NA 1B0UA 1W5EA 4FS8A 5IT5A 5HKOA 4UHDA 3LDFA 4BJ6A 1QYVA 4K6CA 4DEYA 4NK4A 1GZ5A 4M55A 1JPNA 3UGKA 1O6CA 5IT0A 1I2ZA 3RT7A 3QPAA 3BJEA 3EF1A 2ES4A 2VXYA 5JC8A 4L4XA 3M3HA 3WK6A 1VA5A 2VNJA 4C2BA 2N3ZA 5AW3A 3B6MA 5F2NA 1KC1A 4GC9A 1N0UA 1V6AA 3OOEA 1Y6GA 2F67A 2H1VA 3L7BA 3C5CA 3EMDA 5K3CA 3VU8A 1II8B 4JLKA 3D5QA 2J87A 1DRUA 1IHUA 1O5OA 2QSUA 1ZSNA 5FPYA 5H3LA 4ZJYA 3ILYA 2CLLB 4QU9A 5HDQA 1JR3D 1ZEJA 4YMGA 4HAOA 5IDWA 4BNFA 4M1SA 2IXAA 2ANCA 1NAIA 1ZCJA 2GVNA 4IEEA 4ENVA 4MIEA 4EB3A 5EKXA 1QQ5A 1ZGGA 4OJTA 2IYOA 1VL8A 1XQYA 1L5ZA 4J0IA 1ZCZA 3I1FA 4R0VA 3NOQA 3MWYW 4MUAA 3U61B 1NXPA 5JSFA 3VMFA 1NU8A 4NE2A 4CM9D 3MUEA 4WBSA 3QKTA 3HN6A 3V46A 5KTMA 1L5LA 2AFIA 1A5AB 3QEMB 3FZEA 2IJGX 1VYVA 1WP9A 3P9NA 4OHMA 3KQPA 4X94A 3MGBA 4CMHA 4DUYB 1KVRA 1V4BA 2RSLA 4BL5A 1E20A 3PNOA 5I9IA 4PCLA 4UCQA 1JFLA 3N9IA 5JH7B 3ZHTA 3CUKA 4LYAA 2FOXA 1CY6A 1LLUA 4OYHA 4TWAA 3RSSA 1YCFA 4D80A 1KAQA 2QENA 1EJ2A 4NESA 3WDMA 3TNDA 4GR4A 4GD3Q 3JASA 1ZISA 3WQBA 2Y0PA 2IWRA 1XRLA 3C3XA 3E18A 3PBKA 4IHJA 1NI5A 4GFDA 2GGSA 4NEQA 4BMCA 4DDWA 1B0PA 2O8CB 2Z2KA 2XHEA 3GUCA 1ENYA 2HWXA 2I2DA 4KX5A 5HA5A 1JT9A 5K03A 1XCLA 2JFNA 4TKVB 4AKGA 3ESQA 3KSBC 2ODEA 4HFMA 1RPZA 3NRJA 5FA8A 4EOGA 4W5NA 3H3JA 1NMYA 1OZFA 1XAJA 2BGTA 2GPWA 2ZFUA 3KPYA 3NTLA 4M9QA 3CLRC 4R5MA 3BSYA 3KQOA 3MRSA 1NU6A 2V7TA 3PVCA 1H6BA 5HJEA 3PGJA 3VNAA 3ZBQA 1K7EB 1JLLA 3D0RA 1PRYA 2O48X 2Q4BA 3T0IA 1S2IA 4LXHA 4KACA 4KWHA 4GWKA 3H19A 3BJIC 4GNKA 3ZC3A 2C94A 5EERA 2P7IA 3PLNA 2QYTA 3QMVA 4NCBA 1LPOA 2DPLA 2QGZA 1PEAA 4EY7A 1C3LA 2ZQYA 1YJCA 3PUXA 3HDHA 1ISGA 1XTTA 2PFGA 2GTIA 4QJ3A 4DDTA 1YZFA 3GAAA 3M5PA 3T95A 1W0JD 5LR6A 2AGVA 3FDIA 5DNDA 2GD2A 3PDIB 3UJBA 5CA0A 3RTAA 1NNUA 1DAGA 5DOZA 4ZZ2A 3S8MA 4BTEA 4J90A 2C4TA 5LQJA 4UCXA 1P0IA 3D8NA 3L1JA 5AJZA 1V4NA 3PC8A 2O0JA 3UWDA 1JHPA 3GDHA 3EIUA 4HFJA 4EHNA 3C70A 3ZGOA 3QPVA 2XKKA 4JMLA 1QXSA 1CDOA 2RKWA 2C2YA 2Y4OA 1J2TA 3PGLA 1N7GA 4W9MC 3QPWA 4Z1MA 4GECA 5ES4B 1USVA 2OWDA 3FMOB 4HDAA 2WF5A 2H5EA 3ETJA 2IPNA 1VIVA 3ZV6A 1TVEA 7ADHA 2Q0SA 1SULA 2JFBA 2YXPX 1KMMA 3Q1LA 4IS2A 1U2QA 4PFQA 4BQOA 5JAPA 1UKEA 2QX4A 2F1RA 4D2IA 4EVSA 2ZRJA 1L5HA 4J4BA 1P72A 2JCYA 2R8EA 4P4SA 2A9VA 5AO9A 5I7HA 3CKMA 1WXFA 3UZUA 4DARA 4GSYA 4YRKA 1F2UB 2VCYA 1NVBA 1PJBA 1HMPA 2OO5C 5FOVA 2IHYA 2NV2B 3FUTA 3M9WA 4CLHA 1K4YA 2I3GA 3OLWA 4PBTA 2UZIR 2QJRA 2UUBB 4O4IF 4XM0A 4V2IA 5G0SA 4IEIA 1DOAA 2NSHA 3L18A 1Z7BA 3EGDA 3HA5A 4QOGA 1KAEA 4IIJF 3RVDA 4EAQA 1L7NA 2H48A 1G6KA 2M6SA 3IR6A 2O2GA 1ADFA 1N8SA 3RIHA 2A33A 4A8JB 4M37A 4WLOA 1HO3A 5EIBC 2IPXA 2WOOA 1IK4A 2OB1A 10MHA 5AW0A 2WWRA 1WXGA 2BKAA 4FYXA 5HKBA 4NL4H 3R7DA 1F8FA 1A2OA 4IXWA 3EVGA 4LJ6A 1E1CB 4OJYA 2WWVD 3IJRA 3V1KA 3MUFA 1KNQA 2UUPA 3DFMA 2VKTA 3S6JA 4BOYA 2UXBB 1YAJA 4DAOA 4ZCMA 3MBIA 2WFLA 1PS0A 3DPSA 3N8GA 1ECBA 1R6AA 2MOKA 2JBAB 2C0CA 3OIDA 1JHYA 3N0XA 5LCXA 2JGIA 4C29A 3OUUA 5IYZF 3TBKA 3KM0A 821PA 2DLNA 3NWEA 5EC8A 5CCDA 3SR4A 1W4CA 1Z7WA 3SXPA 3BBPA 1W36D 1PR6A 4FUTA 3NT5A 2II6A 4OBWA 3VOBA 1EWYA 1NMQA 1L5SA 3WWEA 3H97A 3U7HB 1YFJA 1IL0A 1TUGA 1YXMA 2BMEA 3AR7A 4IHKA 1JILA 2DFVA 1CHNA 4MRPA 3W8FA 1TXGA 1V37A 1IZYA 4XYGA 5A0FA 3W1EA 1O94D 4WN3A 4XZ3A 3DXFA 1NLYA 4IPTA 1E7YA 3V8MA 4ML3A 3IOEA 1Z4MA 4ITVA 3JALB 2BFEA 4BJ1A 2UVDA 1W29A 4BMOB 2Q1XA 5J43A 1FQKA 4G5XA 3MAAC 4KMSA 2FW1A 4F7WA 3OZRA 4Y98A 2BFFA 5C7YA 3AQIA 3EOBI 3BF7A 1GR0A 3KV3O 2VK8A 2K2QB 3CHYA 4QOHA 3VPAA 1KQFA 4C1BA 3MWEB 4WPGA 1L1QA 1I6WA 1V43A 1EFLA 1NONA 2WG1A 4IX9A 4HX9A 1XG5A 4UPVA 1KVQA 2MIIA 4E7PA 5FTLA 2ZUVA 3EIHA 2OY0A 5FPKA 5K09A 2BMDA 2XSZA 4LBZA 4XH9B 3HYRA 5EUCA 4JLWA 5F23A 1VYHA 1HYHA 1GZVA 1I32A 1CZLA 1TA4A 1P4SA 1W6RA 2BGMA 2GTHA 2HDWA 3EGVA 4Q9AA 3EEBA 1WUIS 4W5WA 1L8QA 2O2HA 4V0ME 1KL7A 3ZCXA 4OM8A 3BMCB 1RU3A 4NH0A 5H3HA 4EYEA 2ADOA 2DUWA 3NHZA 3HWWA 3FDFA 4JLSA 4Q18A 3U39A 1FL9A 4OGFA 2GK7A 3VJLA 2UYCA 3RHZA 2HEGA 3KP1A 1C8LA 2FMUA 2HT1A 2OAEA 4MQEA 1R6DA 3DMHA 4QEZA 3JQ9C 4E46A 3G2PA 4ZYTA 1FYVA 1QE0A 1QIDA 2V65A 2X2OA 1S89A 2ZWOA 2DTDA 1T2NA 2QE6A 2XDWA 4DREA 3ROTA 2JBHA 1BKYA 1KFEB 3K3PA 1KHTA 1X1CA 4TPKA 3CCCA 4G1VA 4EKEA 2G83A 2V6FA 2PT6A 2ZLBA 3A05A 3KHTA 3EVAA 1YGPA 3QZUA 1GCUA 2XUIA 3ZDCA 3UT0A 1KSHA 3B9BA 4G37A 2ZJ0A 2E87A 3CZCA 2NAPA 1P2DA 2ZUCA 1FVXA 2BRUA 1JIUA 2PLFA 2I6FA 2YUIA 4LK3A 1DUVG 4Q02A 3BE4A 2LIVA 3HB5X 4GMHA 1Q21A 1TJ5A 1US8B 2Q3BA 3GEEA 4M3NA 1ODJA 3WAKA 1NW9B 3KKLA 3VTFA 3MJRA 3W90A 1OVMA 3Q2OA 3GLGE 3RSQA 1K6XA 4YO8A 2BKVA 2J3KA 4BO7A 1RCFA 4RV9A 5K0JA 1LDEA 3NV9A 4JFAA 1OREA 1HT1E 2O2EA 1QQAA 3EA4A 3UT5A 1WMEA 5A4FS 4O5AA 1Y7HA 3IUBA 1JBQA 3ESBA 2NZUG 3N7AA 4P7KA 1M10A 3ZGXA 2FZLA 1MZVA 2BMFA 3OM9A 3ZDRA 1KP2A 3NBKA 4H16A 1AY0A 2OECA 4OHWA 4TMZA 2FKNA 4PRZA 4TYWA 3KQYA 1XLUA 1F0KA 3DNPA 3IQWA 2OKCA 3QF4B 2CCGA 1UOPA 1X38A 1YVUA 2MSEB 4L0CA 4RIGA 3KQUA 3WOVA 3H8WA 4UMEA 3HCOA 4QEDA 5A03A 2V7VA 4MAFA 5EIEA 5AM0A 2DHCA 1V8ZA 2YQZA 1YL7A 1HZZA 4INOA 2PJRA 4GL2A 4PN3A 5ELLA 2J5BA 2F8TA 621PA 1K27A 1YJXA 4EHAA 4KN8A 2O54A 3G59A 5TQ2B 4OD0A 1C1XA 1ZUIA 4AECA 1E3LA 4YK7A 1ZN7A 2YC2C 1PS9A 1EE9A 3TLGB 5DTIA 1QH8B 1IBSA 4GZ3A 4PZLA 3I2JA 1SG6A 4BNGA 1RZRA 1N7IA 2B6HA 3VJMA 3G0GA 3MHPA 4EFKA 4MW2A 1GG5A 1P9RA 3KAQA 4L22A 4TN5A 5EKTA 2A9KA 5JISA 2PUBA 3DC2A 1K5HA 5E6UA 1RRGA 1EFAA 3P9PA 1A82A 5DIZA 5TF0A 3JAKA 1ZDMA 3OMXA 3WDLA 3X2EA 3ZPXA 2Y6VA 1HM5A 3CU5A 1MJGM 2I4TA 1L6IA 1TM2A 4X3OA 4BWGA 3A9SA 4CMAA 1ECGA 4E5PA 1FNCA 4GZ6A 2Z95A 1V11B 2X8JB 1SHLA 3H0EA 4RY2A 4WESB 3ONWA 1N0WA 1RQRA 1PZXA 1M75A 5C5DA 4U5XA 1S2LA 2PWYA 3QEOA 1VSQA 1J8FA 3H3FA 5CDTA 3GCDA 1WXHA 5H83A 5K3BA 2W6ID 4Q1DA 4HGNA 5HBGA 1WMFA 1NDHA 1MVNA 5CDUA 1PJZA 3KYBA 3THYB 5K45A 2E6KA 2XOKD 3EGEA 3HJNA 4Y2SA 1A4UA 2J32A 2NTYC 3LLMA 3BAFA 3B89A 4MKIA 5GM2A 3AI1A 3MINA 1U3TA 1XTSA 2B98A 4OATA 4RXTA 1XZIA 4KJXA 1H6CA 3O8BA 5IU6A 2ODTX 3CXRA 3SHVA 2C1ZA 3HRKA 1R4NB 3USZA 4BNJA 5CDGA 4EY3A 1S7CA 3U3OA 2XWBF 2NSLA 2LIPA 2QTGA 2WJJA 2ZWMA 5BQOA 1ZICA 4W5QA 1Z9BA 1TF2A 1B4DA 3PPWA 4OVKA 2XDQB 1I7PA 4QNRA 4DCOA 4BFZA 1N6PA 3QLTA 4GXNA 4G84A 4IF4A 1C1DB 3VC3A 1TW3A 4DVGA 5HJ5A 2J3LA 2W4MA 4NS4A 1XTVA 4LDAA 3TSZA 2P5SA 5AKXA 1O8BA 3TR6A 4WBNA 1GSAA 1I1NA 3TQHA 1F7UA 2PA0A 3DAPA 4N8SA 2AG0A 1ILEA 4IDDA 4UBIA 3S2FA 3X2FA 4D8TA 1CUVA 3AUKA 4YRIA 5EJIA 4CDGA 3KZMA 4M21A 3O84A 3VFDA 5ES3A 4ICIA 1F06A 1ZVKA 2J3DA 2WZBA 1O08A 5BUZA 3RTCA 3OFND 2FEPA 4YRLA 1FSGA 1DG9A 2HF8A 3NH6A 5BN5A 1I24A 1G66A 4J94A 4KAFA 4EG4A 4XFDA 5EJ4A 2IHBA 3GRKA 3QFCA 4MRMA 2OL4A 1ST2A 3GEMA 4NCXA 5C3UA 3DO5A 4H60A 2AYYA 1ISRA 2YWFA 3FUUA 3HADA 3NHWA 2PUTA 1LTKA 4IAOA 5JRDS 1KOFA 1TKCA 2A5FA 1YDEA 1BE6A 1Z5ZA 2F48A 3IVMA 3K96A 4YJ3B 5K2OA 1DBWA 4J4HA 4UPEA 4PZZA 5DLDA 2K4MA 1UBMS 4Q1FA 1NMZA 1ZK0A 3E7WA 4M9UA 1FP1D 2XA2A 5JG7A 4H17A 2GPBA 3L6RA 1E0DA 3GLVA 1OFUA 1YS1X 1UOOA 3EZLA 1CZHA 3AF6A 1QRUA 3PNMA 1T3SA 1VGVA 4NH4A 2AYZA 1EGMB 1SPBS 1JQKA 4M8IA 7REQA 1DQYA 3ER6A 3H5AA 1G7CA 2BEWA 2FUEA 2WICA 2PUHA 3SJZA 4O8ZA 3EZGA 4H31A 5LMZA 2JHPA 5TS2A 1Y5MA 3F5MA 1ZOIA 4G5YA 4MEAA 5BW5A 4NWIA 5EMLA 4WXHA 4I6GA 4WE3A 4XX0B 2X1LA 4XFKA 2HXYA 4U2EA 1DTEA 4UUQA 1YSCA 4MI1A 3NIGB 5AKHA 2VBGA 4G1EB 4ZMRA 2Y71A 2E5LB 3AK4A 4LRYA 5GONA 1G21A 1XDUA 3AHJA 3BB1A 2V0NA 3I8XA 5KX5A 4B3HA 5CT8A 3LUHA 3C8UA 2FWMX 2NP7A 1J9GA 3D7NA 4RX1A 3RUCA 4YX9A 5KWEA 4KO3S 1UP6A 2H1HA 1UM9A 2BUBA 3CS3A 4GBJA 4MEBA 1Q1AA 2F00A 2X5XA 3BILA 1M2GA 3HN2A 1WZNA 3MD9A 5E4YA 1E1MA 4MUJA 3U7IA 3WLSA 2YV4A 1VLQA 3E9YA 1G8JA 2C7VA 1Y6FA 4IDCA 3LBNA 1GV1A 5HKLA 1A96A 3OQNA 4IG4A 4JBXA 1OBHA 4EGAA 1W1IA 3WXMA 3ZCTA 1YONA 1O3YA 4C3ZA 5FH9A 1IOZA 4IO0A 4JR0A 3FVQA 3PNPA 1OWNA 3AHFA 2ZRKA 4YJFA 4ND6A 3ORSA 4FJ1A 2YQ5A 3U4QA 3U4HA 3CX6A 2JLQA 3B1JA 1OY1A 3OCCA 5I9BA 3FWNA 2WU3A 3T5AA 3TJZA 3HFRA 2I6GA 3CH5A 2QM8A 3OLXA 1U3GA 4KQCA 5KMGA 3FWZA 4X64B 13PKA 1U8AA 2Q1WA 3P52A 4DQXA 3PE4A 3AOEA 3KT8A 1FFHA 5CP8A 1ORDA 2DKOA 2V7BA 5KWSA 3C97A 4AZWA 1NPTO 5CBKA 3UXEA 3CZQA 1ZD8A 3N75A 1J2JA 1P5JA 1L7EA 4X7PA 4KR9A 4QHTA 3I39X 4B3GA 2QQ0A 2HIGA 1XF1A 3RJ9A 3SICE 2A30A 3WZMA 1EX7A 1PE0A 4PYLA 2NVOA 4UBMA 2XZDA 4ENRA 1E60A 1O8CA 2GK4A 2DGDA 4N0DA 4BX3A 3RYCB 1NY5A 2FEAA 4NU6A 2GKGA 3HMQA 4YAKA 1AZLA 2GVZC 4B9AA 4LBYA 4QNMA 5BR8B 4IBOA 2BM0A 4UVEA 1OLOA 2FZKA 4Y1GA 4HAXA 3TXXA 4DNOA 4CEHA 4AJNA 1OWPA 2XA1A 1USKA 3FB4A 4ZT2A 3U4GA 2H9YA 3W4IA 1NJSA 1TT5B 2JI4A 5HUJA 3CVUA 3SEFA 3TL6A 2PCLA 3VSDA 1SAYA 2DTXA 3COSA 4CT0A 2I03A 3JQ7A 5LQUA 1HSZA 1KORA 2YY7A 3MTBA 1NVEA 1OLUA 3M6MD 4A2QA 4BXOA 1UBSB 4M2LA 3T35A 2A0YA 4XJVA 6ADHA 1WMBA 1GTZA 1YKGA 4OXYA 1UC4B 4ZOLB 2QJTA 1JQBA 4ER7A 3L6CA 5JY1A 5F33A 3GQBA 1XDWA 5A05A 4FFPA 4WA7A 2WSLA 3HHEA 3C1AA 3ZQKA 2OP1A 2A0XA 5LYJA 3RO7A 3MB5A 4Q93A 4A0FA 1RJDA 2OCPA 4CCAA 3BGOS 3ADDA 4DF3A 4YEDA 3OQIB 1QHNA 3NTRA 4LWOA 1LY1A 4UHBA 2WU1A 1P29A 3PFNA 4FJ0A 4RKQA 3SBEA 1BFKA 4TTVA 3GUVA 4QUKA 2WAMA 3VR1A 2BLLA 5KINB 3B5JA 3PUWA 2N47A 1AKEA 5CXXA 1FP4A 3JZMA 4YDQA 2YZMA 3IQDB 3D3EA 2RKBA 5DNVA 2G28A 2YXEA 3T0GA 1Z33A 1L7MA 2F3TA 4Z3KA 4RHYA 5E7MA 3FI0A 1U31A 3O1LA 3ZD8A 2DPGA 3QKWA 5TVKA 3N7UA 1KEEA 5CD1A 3Q8MA 1ZAYA 4TTSA 5IKEA 1F2DA 2ZIXB 2ERCA 2EXXA 4I36A 1CQPA 1TVMA 4QPJC 1NOJA 1TE2A 2PRYA 1G5QA 3VR6D 3VTKA 5JCZA 4IVPA 4BNWA 2AJ8A 3O4IA 4OQMA 5BRAA 4UOZA 2GLTA 5HKAA 3TEFA 4YMWA 3OEYA 1V7PC 2JIZA 1G6HA 2Q49A 1O4WA 1VKOA 4LJAA 3OP4A 4NDAA 5SZHB 1Z2AA 3A2MA 1ZUNB 2HLDA 2Q7DA 4UFPA 3TKLA 3Q0IA 1RYFA 1G8FA 2GHIA 4H7EA 4RY8A 3CLTD 3WGHA 5A6VA 4V38A 1A5BB 4JEMA 2RBGA 2JH3A 1AV6A 4MUNA 2FF5A 3B7PA 4OYLA 4WVLA 4X71A 5IVIA 1Q11A 3RARA 3CF4A 1RJFA 2J9FA 3D6NB 4G85A 3IQGX 3QP9A 4HL6A 3MT0A 1VLJA 4ACBA 2OHJA 2QPAA 1E8NA 3IHWA 2RGUA 4M60A 3O0DA 4DDKA 2SCUB 5ALMA 2B92A 2HREA 4RANA 4FHGA 5D51S 4EF5A 2J5KA 3RYHB 3A9TA 1SOWA 1W30A 1XA0A 4MGHA 4YBRA 4EITA 3GCGA 4GH5A 1IUNA 5AUOB 1N9KA 5KVVA 1HYGA 4B6QA 4XIFA 3CXUA 3C6YA 3ZZ0A 3EUAA 5AW2A 2PGJA 4X90A 2G5PA 4BUCA 2B2NA 4D8WA 5DI9A 4ZYWA 2JLVA 4CQMA 1PWYE 2P9HA 2Q21A 1E18A 3C4QA 3ENKA 3SX0A 3PCTA 2AW3A 1XALA 1VJGA 2AK2A 4L76A 5KYXA 4TMWA 2JAXA 3U7GA 1HUQA 1GM5A 3H8VA 1O9HA 2GEFA 1QRRA 3NOVA 3NX4A 5BNTA 1SZPA 2NXEA 3GGOA 3QG5A 4Z1OA 1QHEA 4NOKA 5EXEA 4B4VA 1WV1A 2EZUA 2ZWVA 2XQVA 4AZ3B 4C5BA 5IDYA 4ENPA 4W5RA 2FJ0A 4ZO9A 2ZUEA 2WD7A 4DV3B 2XYRA 1KWKA 1Q2UA 4DEVA 4RK6A 3K09C 1TUIA 3EXIA 3DUFB 1M2EA 3G5MA 4HDRA 4L4RA 3H1EA 4ZQHA 2H7YA 2X0IA 4Q7KA 3B78A 1OX6A 1JQJC 2YJNA 5IAEA 4G0MA 3UEOA 5IC5A 4BPRA 2EJTA 4I1PA 4OGLA 4NU0A 1PK8A 4BQEA 3TS1A 4KQ1A 4P33A 2H7VA 4EHLA 4F8EA 5DPMA 3WRYC 4AO6A 5HE9A 4WXMA 4EARA 4GOXA 3LUDA 1PNQA 1GFSA 1NATA 1OFIA 1M2VA 3PK0A 3MD0A 4NBSA 4JC4A 3H3XA 3UGTA 4UFNA 1PGNA 1RYBA 2I6XA 1L4UA 2BT4A 4ZJPA 1M83A 5L6LB 4HC4A 4PLPA 3AYZB 1WA5A 2VUSA 5BMVA 2ACKA 1GT6A 2FQXA 3KQHA 1T8YA 1UK9A 1USUA 3VVCA 1L3IA 1JFFA 1T0IA 3T9EA 4BLWA 3M81A 5CFPA 4MS3B 4ARVA 2Z2XA 3FNEA 5FL7A 5LDDC 3DS8A 2W70A 4FFOA 4QYIB 4CIDA 2PX4A 4A2WA 1ZBDA 5LP6A 3EQ9A 1NBMD 3BXXA 5EE5B 3U80A 5JAMA 1BVHA 4NYJR 5CNMA 1PR3A 4U6NA 4I9UA 2PMBA 1MX9A 3R7FA 2NTEA 2ZB3A 3IFSA 3KR9A 1JHOA 4DGQA 3T3MB 3B1VA 1HEIA 1CC1S 4RKRA 1Z5WA 4KRXA 2OR3A 2IDJA 5DNUA 3ZCRA 5L3QA 1V1MB 2Q1SA 4H3SA 1TF5A 1Q3KA 2P1ZA 4PVCA 4XDHA 2MU1A 3VU3A 5A5EA 1N2ZA 1C7RA 4QATA 2WVJA 1Z17A 3N07A 5I7SA 4RTQA 3K0AB 3QNWA 1AN9A 5E4FA 3EW9A 2DT8A 3DYBA 2HY7A 5D00A 1DJOA 1SXJB 4XQEA 3U9TA 4A0GA 2G9QA 4ZDIA 5TJ9A 3SC2A 4KK3A 1VLVA 4CTJA 5IWCA 2XLBA 4AB1A 4Z1MD 1G8SA 3DM5A 1AOXA 1W4AA 2VDWA 4DCNA 1TTHA 2LRHA 3AWIA 5ALOA 1A8IA 4YJ3F 4HH4A 3LT5A 5AHKA 1JYSA 5HS6A 3HJFA 1G7TA 4ZGGA 1N5IA 3PPIA 3IUPA 1COWA 3EVCA 2GSWA 3W7AA 5ALTA 1MRNA 1N2CA 5ESWA 4TTRA 3B85A 4COOA 4IFIA 3SVZA 1XK7A 1X3LA 1LBSA 3CEHA 3K8QA 5KKAA 3UWKA 1F38A 2FSSA 3HUEA 3GH1A 1DIAA 2GPSA 1VPLA 2GUWA 2ZJ3A 3AVOA 3KKMA 3NWPA 4LJ8A 4M1TA 2IELA 3FIUA 1TPZA 3U16A 2Q8QA 3PFCA 4KTTE 1YIAA 2OMEA 1I2BA 4RF2A 1VKZA 3LNTA 3ZCPA 2HSWA 1SKYE 3LZ6A 3SIRA 1Z4OA 3MXTA 5HZKA 1N25A 3TKAA 3B1FA 4G4SP 2A4MA 2QIOA 1ORVA 4AVYA 3CZMA 3HUTA 1VB3A 1VTKA 2VP0A 2WIGA 4QGAA 5EZ5A 4AUEA 1VE1A 2E85A 2RARA 3KSUA 4OQZA 3UG7A 4KB5A 2BGKA 5AK5A 2A5JA 3UXMA 5L3RA 1USWA 4BEBA 4HXFB 1R8XA 3NALA 1VXOA 4KWCA 3IESA 5ARDA 1MJ5A 4RDIA 2DKNA 2CW5A 2WFZA 4YAFA 5FDFA 4IL5A 1SBNE 3PEEA 1JAZA 2CK3A 2H9IA 5LBTA 3ZQ6A 4J2OA 5SZIA 4AF8A 2ZR7A 3V2GA 2DBVO 4ZZ0A 1ODFA 1QBGA 1DJMA 2P9CA 4A1FA 4MHTA 1NOKA 1RWMA 5DHSA 4KXWA 4Y1RB 5C8YB 4V1CB 1LZLA 2GOYA 4PG5A 1JWLA 4KXUA 3BXZA 3S5UA 1ZD4A 1Z6XA 3EZ9A 3IIKA 3PLAE 5BURA 1A4RA 2JKVA 1ZOPA 2QRVB 3G0CA 5BSVA 3B52X 4OUKX 3KYCA 3BD7A 5H82A 4EBBA 1GEEA 1EM6A 1SVOA 2F8LA 5HTKA 1E5XA 4NAHA 3UMSA 4N6OA 1GV0A 1LLQA 5ESXA 1DAIA 1QLWA 1VHJA 1E2JA 1YR2A 1E8DA 2GTPA 3KB6A 2WVGA 1Q1BA 5LJIA 4RZUA 3AUJB 1PFWA 1BN7A 1X3SA 2V7UA 3SKVA 4X7RA 1VIMA 2PKQP 3LW7A 4LDPA 4FBMA 1V3QE 5DSTA 4AY3A 2PS9A 3D4LA 3ASUA 3QE3A 4JUCA 3T4XA 1TJNA 2FWJA 2XSZD 4QTUB 5H80A 2JLBA 5JCOA 3R9KA 1Z22A 3DTTA 2O2YA 4YDSA 3WFZA 4AIIA 4CMEC 1XI2A 2P2NA 3T7AA 5JAOA 3KB8A 4FXOA 1QZZA 1O6GA 3LO8A 1U28A 2CB9A 3OQPA 4I5IA 2I71A 3OPMA 4MDEA 5TPWB 1IEXA 4EO4A 4C3UA 3QHAA 3INNA 3D6TB 1PW7A 3E3MA 4HAWA 1T91A 3CNOA 4M88A 5CYGA 1YQGA 2PNFA 4NHEA 1GAJA 4R4JA 5LZ7A 3T1VA 4FDAA 2AOXA 4DQLA 1YNSA 1B3RA 3OHMA 4FSXA 5D7BA 3VH1A 2HMUA 3HO1A 3ZJUA 2IS4A 3SFVA 1Q0TA 4FDTA 3N05A 1DKPA 4EFLA 3T06B 4WEOA 2EEZA 1OGYA 2IXDA 2BCGY 2X6QA 4Y30A 4ZOLF 3T54A 2ZEJA 4A82A 4D97A 5KJCA 1NVAA 1UEIA 3GZNB 3LECA 3J81A 4U00A 1ZXXA 4DM7A 3PEVA 3A1EA 3ZI0A 1JX6A 1UIRA 1UWLA 3KPWA 4LC9A 1RQXA 4CIXA 2IC5A 3B51X 4NNJA 1FZTA 1RYEA 2V7EA 4X61A 4D9FA 1OBOA 1HDIA 4HGPA 4PG4A 1BQEA 1E98A 3I37X 1E0KA 4ZQIA 5F52A 3K2EA 4MVJE 2LCFA 4OYYA 4EMBA 4R8KA 4TS3A 1B74A 2DQ4A 4BE7B 1EGAA 2C98A 5B4UA 3LVRE 3DMFA 4O4LA 4MWDA 4Y6LA 4ERXA 3C6QA 2DXIA 2ZR9A 3E9MA 3LVFO 8AT1A 1MJGA 2IXTA 1CQIB 4DG9A 1KJYA 5C53B 1U3CA 3ROQA 4XD2A 4R2XA 1VP9A 4HWTA 2VYVA 4E2XA 3WIUA 4FNAA 2MYTA 1T9GS 3QE0A 2JAPA 4C76A 2BGGA 2WK1A 3CNEA 3HXPA 4FKBA 4TVBA 3JQDA 4PZCA 3UPUA 1XO1A 3T8YA 5KWVA 4PLVA 4CLOA 1AGRA 5IKMA 2WWIA 5LOVA 2YDXA 2WDZA 1RM0A 1PEYA 5AP9A 3SMQA 2EVWX 2JARA 2XZPA 2VP5A 4EDFA 4KX3A 2ZJ8A 1NAHA 4MS1A 2AN4A 2PZKA 4Y1EA 3FYTA 3NEAA 3PNLA 1VCOA 3FTQA 1WBDA 4YCAA 2DYKA 2CXNA 2JLUA 4C89A 2G9RA 5DN9A 4DW8A 1RZRD 2QR3A 1UKCA 4YC7A 1HR0B 3USCS 2HFJA 4LY9A 2X0EA 1VE9A 1F8XA 3OH8A 4H35A 1DC6A 1RKQA 4WQMA 3UT6A 4YALA 3QKIA 1ZM9A 1NBHA 3GFSA 2XYPA 4Q4JB 3WGGA 3DMGA 2BHSA 1QG0A 2C9OA 4MUGA 4NZMA 2ZB7A 3I45A 3V4PB 1AZSC 1XZBA 2WNSA 4UOQA 5FUQA 2BH2A 2XBMA 4Q7EA 4JXKA 5E1OA 4EKIA 1ICIA 4PZAA 3PZBA 4G5SA 4J75A 4H7DA 3MUOA 4N5DA 2J3JA 5AVWA 3OLZA 1JQ3A 1Z34A 3C5WP 3E0QA 2CMKA 1NXXA 3C8HA 4ZJUA 4FHZA 1EFTA 3QLUA 4LECA 2AFVA 1NLFA 5TR9A 1E6KA 5CVUA 3K15A 3QUTA 5EPOA 3L7YA 1RYHA 2WWHA 2C57A 1AURA 3D31A 1CULC 1SVIA 2QW0X 4RVFA 5DYGA 5HGXA 4IOJA 1FA9A 3PC7A 1IJBA 1ZM2A 2G17A 2XUZA 3ANTA 3K6JA 3MMNA 3RM3A 3O8OB 4EB6A 5CA1F 2GZ2A 3DA8A 4ROTA 1U2TA 2P9FA 2BZ0A 1KJZA 4E4TA 1J33A 2Z4TA 5HK8A 3RRFA 2BPOA 4K26A 2VH5R 1V16A 2AI2A 5JZVA 2UVPB 3I0NA 2L82A 2FDCA 1U0NA 4V0OA 3DHNA 3PJGA 2GM4A 2GZDA 5L40A 1E6MA 3CLSD 2WLTA 4U2CA 2JCVA 5BN4B 1V25A 3T0FA 1WDMA 4OF4A 4B6SA 1UPUA 4BQQA 2JCGA 2MSCB 2P1DA 5BT8A 3D8BA 1IDN1 1QC5B 3TI9A 2HMVA 1ZNYA 2OAQ1 1DIOB 1EHCA 1X86B 5GJVC 4XQCA 5AK6A 2V1UA 2JJMA 2PZAA 4WNAB 5IEBA 4GMDA 4IOMA 4R81A 3QVXA 4G5HA 4BBJA 4DA4A 2V03A 1JEDA 2WMYA 4GE3A 3RK4A 4CNQA 1E2EA 1FXWF 1AUXA 1SQ6A 2AFHA 4GI7A 3AU8A 4R68A 3LC0A 3VNRA 3K0KA 4LF8B 2XRYA 3TAXA 2J4CA 4AN1A 4DXAA 2GZ1A 2OHXA 4F3TA 4M49A 1KZGB 4L51A 1MD9A 1BN6A 5DCWA 4FSHA 1RAGA 3PFHA 4QTZA 2GJ4A 1MB4A 3MBOA 2WT8A 4X8HA 2CSXA 2YC4C 3OI7A 3Q8WA 2X3FA 2Q3JA 4B4OA 4P3PA 1QZXA 3BSSA 3HJAA 3I1YA 4ND2A 1XR3A 4W82A 3ENZA 5ICSA 5K8VA 3LBYA 4MQ4A 2AMVA 4Z3OA 4HRAA 2GYWA 3OC0A 3W2TA 3ICQB 4DUGD 2W93A 4B6RA 4LF7B 1DZ3A 2NQTA 2IV7A 4RK5A 2C29D 1NDQA 4V3CA 1XMIA 4QRIA 1LSSA 4LZPA 2NTNA 2VZ0A 2XGMA 3RSGA 4E1BA 1VB5A 2Z3WA 1AHIA 3E22A 3HFSA 2Z8YM 2B8WA 4RKFA 2A3RA 1T3LA 5FBRB 2ZJOA 1NJFA 2X3UA 2YHBA 1GZ7A 3D4OA 3EFHA 1I2MA 3GDWA 3MTJA 4U9UA 5GOTA 2Q6LA 2WBLC 4RGQA 4YB8A 1IU9A 2X0JA 2JNWA 3BG5A 4C04A 1CEXA 5I5EA 4YFYA 2ONJA 3WTCA 1QCCA 4BQNA 2VP4A 4MMXB 4P58A 3FROA 2O2JA 4ZOQI 1YC2A 2BD0A 2WNIA 1U0HC 4EPVA 5FIUA 2ZATA 1OPXA 4J6FA 4RE6A 3WMEA 3MLBA 1G55A 3QWHA 3SJAA 3UUEA 4QZVA 1KQGA 3CRQA 1NXWA 2VTBA 1CRZA 3NMUF 2E18A 3M49A 1G98A 3CWZA 4XLZA 4QRDA 5IPFA 4UULA 1JAHA 3ABZA 4RZ2A 3VZPA 1ZC4A 4IH1A 4PO1A 4EZIA 2I62A 4GNRA 2ZGVA 5DDIP 3AZQA 1R3UA 3FNGA 3MT8A 5FBZA 4ZVQA 1QQTA 3T41A 4C2UA 1X1SA 2ZVPX 4JVSB 1K66A 2EKZA 1H0SA 2V7PA 2C9YA 5AKJA 1CB0A 421PA 1W8DA 1PFQA 2BOVA 2FPIA 4MROA 3LYUA 1QFSA 2H3HA 2YFKA 1R0SA 2AQIA 4KEAA 3BA1A 4R1MA 2HTEA 4F0JA 1CVIA 2AZTA 1Q91A 3KDSE 4FYHA 2QUJA 3U4MA 2RBEA 1D6SA 1SO8A 1BYUA 3VOTA 1QU2A 1Q20A 4LYDA 1U4NA 3HUFA 3VO2A 4RTJA 2JLYA 1SZDA 4Q5IA 1RQ7A 2OENG 3L4BA 3QFHA 3ONVA 5KHLB 5EKUA 1IHYA 4BLRA 5EJ6A 4CM6A 2A0FA 3A3YA 2J67A 1RDFA 2BFCA 2XH8A 3P20A 4WCVA 3R7SA 5C8YF 2ORED 1JQ5A 3O3NB 4DWWA 2NP6A 3RC9A 2OFWA 5ILQA 1TGYA 1HKUA 2P9TA 3ZWBA 4PHTA 4UTZA 2HA4A 1J0EA 3G9ZA 2QK4A 3DMNA 1SH7A 1P2BA 1YQTA 4B0OA 5E3HA 1NTOA 2C0PA 2IXGA 1F3LA 4JR1A 5F73A 5DTJA 4ARAA 1RJ9A 3SR0A 1V71A 2OQVA 1JEOA 2F43B 1PTJC 3DFZA 5LLSA 5BQFA 4NHOA 1ZD3A 3U7JA 2NG1A 3NT4A 3DR5A 2QSYA 1VCHA 4H7PA 4O0LA 2H00A 1I4DD 2HCTA 2ZBGA 3GN2A 3G2NA 4IIYA 4G0PA 3KT0A 4DYDA 4QLBA 1JMKC 1FXUA 4JA0A 4YR9A 5EIXA 1FNNA 4QTYA 1PJCA 3CRW1 16PKA 3W77A 1U2GC 4IHQA 5REQA 4ND3A 4ZPXA 3B9RA 3EBOA 3TW6A 2OXIA 1QVRA 2XNCA 2ZRPA 2D1FA 4GSLA 4F9TA 5IMSA 5LWQA 1SUDA 1NXVA 1V5IA 2ZRDA 1DKUA 1FY2A 1XMPA 1UMDB 4KGXA 4MI6A 3UGQA 1RAIA 1QX3A 3MG9A 1LA2A 1XZKA 3G9XA 4FBGA 3UC5A 4UEJA 1XK6A 3GD7A 2OVBA 1PU2A 4LDQA 2RAVA 5GINE 1QO0A 3IAHA 2N75A 3IL2A 3RC8A 1XPJA 3R3VA 2B20A 3Q87B 1E3TA 4FZ3A 2O1XA 1SBQA 3V34A 5LUAA 2FPGB 1V8FA 3GPDG 3OJLA 1IZ0A 4WZAE 3KTAB 1LJLA 2Y67A 1KE1A 4AYWA 3WGNA 4Z2AA 1F48A 1J2RA 1PSDA 1XUOA 1UOEA 1CVLA 1I51A 1NQTA 1Q14A 1BD4A 2H8GA 2J7KA 1L3CA 2OXRA 5TRTA 1SXGA 4LQCA 2EW2A 2P3SA 2V4ZA 4D1YA 4B84A 1XDDA 5I9SA 2JI8A 4NJEB 4B44A 1G8PA 4MKXA 3C3DA 5HGJA 4V03A 3S2ZA 4L9AA 3QBVA 3VO9A 2IPMA 3ML1A 4NDNE 5KPJA 3CE6A 2VDVE 1DQNA 2CJPA 1ESDA 1Q50A 2IXBA 1H1LB 3CJRA 2HLDD 4LZNA 3T7SA 3VYUB 2HMSA 3WL7A 1S4QA 4LXQA 2VQ3A 3AKCA 5EOVA 4E13A 3L3BA 4AUKA 1L5MA 1IY1A 3JRNA 2EWMA 1BMDA 1PT7A 2OO5A 4DV0B 1O87A 1X7ZA 1Y0BA 1ZCBA 3PE3A 3ZXSA 4W8HA 3D43A 5KKNB 4QTXA 1PEDA 1IZ7A 4JDPA 4YXWA 3ZXIA 3BKWA 2QMOA 2WHRA 4IMIB 3GGGA 1G4HA 2OGSA 5JDIA 5KHOC 1KMHB 2NW6A 2X5KO 1OYOA 1U8YA 1R0YA 2JANA 2RHRA 3MTEA 3BA6A 3O6VA 2X8BA 2ZYWX 3CFYA 4IW3B 4U2GA 1RWPA 3STVA 5CFNA 4YAEA 3H2HA 3GF4A 3IPCA 1WP4A 3SYKA 5JVDA 4R2HA 3LKDA 1FQWA 2WIBA 2WR8A 3PNVA 2BDEA 2GZSA 1EK6A 4CQMD 3FBGA 3ZJYA 3SLRA 1XN1A 3VC1A 3RTGA 1FW6A 1Z4QA 2IH5A 5HNKA 1JV2B 4P36A 3M83A 4B74A 4I99A 2RH8A 3OE5A 4TZKA 4PPNA 1H0RA 2YNMC 2HEIA 4MUBA 2CLHB 4F7DA 2FN8A 2IH2A 2V9PA 3TSWA 2VPQA 1Z7GA 4GUDA 2RHBA 4BO4A 5TT1A 3U6BA 4DCVA 4Q9KA 3PQDA 2Q6KA 4TLMB 2G1JA 2VJQA 1T0JB 2CXUA 2OV3A 5EIHA 2OB2A 3MLAA 4JLUA 2H9AA 3VU9B 2B5VA 2CD7A 4E15A 4NMLA 3RFTA 4CHGA 1N2XA 1NYTA 2B25A 5JARA 2VJOA 4ZAWA 3QA3E 1AXGA 4AP9A 4DLSA 4QHSA 5FPSA 1ZO8A 2H06A 3K0FA 1ESMA 4GPIB 2MSWA 4IXTA 1QIFA 4DC9A 3JYQA 1E2MA 4JP1A 2JGFA 3P97A 1R8JA 2QRMA 4XLLA 2CFSA 2H5LA 2QN8A 4MUXA 3WVNA 2I1VB 3I9KA 3QVGB 3ZI7A 4HGZA 3SCZA 2WMOB 2CJWA 1YZTA 2HBQA 2W2KA 2W6OA 2FZWA 3FPEA 5FWXB 3E35A 4UCWA 2MSKA 2ZRGA 1GNTA 3WL8A 1A0OA 5BYBA 1MZPA 2P5YA 5AUNB 3URKA 2LNDA 1PSWA 5A3JA 4NC9A 4TTJA 4YQZA 3WYNA 3AM1A 3FYDA 1COZA 4B45A 2WPDD 1ACJA 3D7KA 1NN5A 1FTQA 4DLBA 3Q6MA 5DX8A 1M74A 2HC9A 4CW7A 5C7IO 3MCZA 4YCLA 1JE0A 3CR7A 3M5CA 2QD4A 3EXFA 3JVIA 1KS2A 3KJNA 3D8UA 3OO0A 3GLRA 1RCTE 2BKUA 3AL2A 1KJWA 3RI3A 3IV9A 1GITA 4QO8A 5DRYA 3TLJA 2ZU6A 3B8EA 4U7FA 2D7JA 4ZVMA 2XBUA 1UJMA 2QP9X 1VCIA 3S29A 2PWAA 9GPBA 4JB0A 1KYXA 1I2AA 1U94A 3MYYA 2AUNA 4FEEA 4XSGA 2W0MA 4IWXA 4X1IA 4ZIRB 5M34A 1UJ6A 1PNRA 1U7OA 3A6GA 2VBCA 3SSNA 4Q00A 3IOCA 4RKEA 4OLBA 1SCUA 3OLYA 1OAOC 3KFLA 4UU1A 1XZCA 1XA3A 4FFMA 4AJIA 3RJTA 3THXB 3E9RA 4E33A 2IEGA 2AN5A 4G8DA 4U5QA 3RNOA 4I1UA 3BXGA 3F7OA 1TADA 4M1ZA 3L06A 2FLWA 5I3CA 3Q3VA 2INGX 5YASA 4HP8A 4TT3A 4RPHA 2RGRA 3KCNA 1E0JA 1TMKA 4LS3A 2W6MA 3PXEA 4K1LA 4IICA 2O5RA 1W0KA 5CITA 1Z4LA 4QOSA 2FX3A 1CEEA 3AJEA 1Y1LA 1MJHA 4MRAA 1TTQB 3EXG2 3M4JA 4C0QC 4DA8A 1S2MA 4L4YA 5BRJA 4QVGA 5I7AA 1HDEA 2E1PA 2I22A 1E79A 4DWVA 5K8IA 5MFZA 3LCUA 2OLEA 5AK3A 1NPYA 4QQKA 3AH8A 3P0JA 5FA5A 1QP0A 1COWD 4QAQA 1TM4E 5ALZA 4Z53A 1JFRA 1OFHA 3ROMA 4F5EA 1JLHA 2E5WA 1SQ5A 1ZU4A 1OX4B 3PDUA 5T67A 5K3EA 4LIPD 3L0OA 4H7FA 2ZUDA 4Y6GB 3FTCA 3IP5A 3WK8A 1FOEB 4HB0A 3WGOA 4G81A 4CKWB 5I7EA 3HM9A 1NSFA 1R6TA 1V5EA 1J8YF 3QV1A 3SKXA 1U63A 1YE8A 3C87A 1RFLA 4ER6A 4JB3A 3LVQE 2D1RA 3LLCA 3LUCA 3DKRA 3WLJA 1L5OA 5B58C 4DR7B 3LC7O 5KYVA 5CK4A 1VI6A 4YECA 3S68A 4LNUA 1WQ1R 2ADFA 4ZVUA 1ZGHA 1H2RS 2QV7A 1BDMA 2PXCA 3NEYA 2GNPA 2WFMA 3JWGA 3T1YB 4CF3A 3UHOA 2PBRA 5JW6A 1UADA 3K53A 3OZWA 4H6WA 1U5AA 3I2YX 3K20A 1GL7A 1SR8A 4M9CA 1C0IA 1AA9A 3BWEA 2ODWA 2QUIA 4MQFB 4V0MA 5BSUA 1ZWKA 3PHHA 3O38A 4PR3A 2VYFA 3ST7A 3OEHA 2LBPA 4M1EA 4RA6A 2ASVA 3AL3A 1Y80A 3PQFA 3SR3A 2CK3D 3MJDA 4BAUA 2I2CA 3BL6A 4J7XA 1ZSYA 3D4IA 4RIIA 1CV2A 2NVUA 4BB6A 5BOSB 4AKHA 4G4GA 1OI2A 1DGQA 5EXDA 2REOA 1DCMA 1WXQA 3IQIX 1V7QA 5L53A 3VZBA 2FRVA 3AR9A 3T7JA 3HNOA 4NF2A 2WSMA 3WB9A 2VHCA 5JNUA 1PFKA 5HOQA 1MAWA 3W79A 4TVSA 2Y8EA 3HE3A 1FRQA 3ZWNA 1YS6A 3VOSA 4AG6A 3GUUA 4XB6B 3GLTA 1BMFD 3LX5A 2O6LA 4DS3A 4BBPA 5CLJA 3IOBA 2QQFA 4I5DA 4NCAA 1KF0A 1UFOA 2FEXA 3BRCA 3CB2A 2YWDA 2J7PD 4FYMA 3BMOB 1PIWA 1D2MA 3PL5A 3AF5A 2K7FA 5DYWA 3L9WA 6REQA 1L1EA 1U9IC 3BDAA 4RHCA 5CUQA 5H0IA 4DUZB 1VPWA 3T5TA 1DAFA 3FB1A 3AFGA 2PLRA 4ZAXA 3WS7A 1FUKA 1U0FA 4OHRA 3D9QX 3OY2A 4EG3A 3AHCA 5BV8A 2QGFA 2YYSA 1ZCFA 4NX2A 4F4HA 5I8WA 5KQRA 4I66A 2B4RO 2LCQA 2JJ2A 1OU4A 2A9OA 1GNVA 3HTXA 4WOKA 1XWFA 1M6HA 4J16C 4K3VA 4P35A 2IYQA 5GJBA 1HC7A 2O3QA 1EXMA 2IE8A 1IBKB 2YWJA 5ALPA 2QZZA 5AJYA 3GYBA 4PC6A 3B20A 5JZBA 2XUKA 1L1RA 2NNLD 4EVIA 2X9VA 3SEZA 4B7CA 4FW9A 3S2UA 2PJDA 4PZ0A 4MCIA 5HIAA 1N78A 3SDZA 3PFKA 4DC0A 1N3IA 1N4AA 1KYVA 1RP7A 2VAMA 4OXXA 4EWLA 5ER9A 3ETLA 4LKRA 4W9NA 1W1UA 1M2OA 4ITRC 2FP4A 4K8RB 2BTQB 1F5NA 2C9CA 5CEJA 5M29A 4I3GA 1T15A 4F3CA 2AZXA 1ZU5A 2D0IA 3L8DA 4Y18A 1NM5C 1U3WA 1KDOA 5DT9A 2GN0A 4BTLA 3B5IA 1UFQA 1U7HA 1XDSA 2AJTA 2OM2A 3IDOA 2CEAA 3LV8A 4UBLA 1MX5A 5F1OA 4MVJM 1VL5A 1X19A 5FBHA 1UBOS 4CDNA 4QASA 2QVLA 4ZZ1A 4TOIA 2HIAA 4J1TA 3GPBA 4MWBA 1QHFA 3VPHA 3W4KA 2JL1A 4I08A 2VEDA 4NP6A 3HBFA 1XQ6A 2R4QA 2AOWA 3ZV3A 5LVAA 4FGLA 2RK6A 1U0TA 2AK3A 1U8UA 3JQAB 3IOYA 3BT7A 4WK2B 2Q27A 5JAHA 2W6PA 1SK9A 1X7HA 1ZUWA 5H3CA 4F06A 5K6AA 1W9HA 4IV0A 1JDUA 2QRUA 4Z4IA 4DRXB 4LC0A 3LRXA 1U5CA 1KOGA 2VYVD 2MINA 5GTDA 4JI7B 4D8UA 1UL1X 1XROA 2C8KA 2A9RA 2RH5A 1Q1GA 2HRZA 4EJ2A 5ITWA 1XNRB 1SEPA 4YP1A 1R0KA 1K5DA 5AI8A 1RRPA 2XE7A 3ILXA 3IXLA 3ZI4A 4A0HA 3RC7A 4EEKA 2DWOA 5JRJA 4RTOA 3IRUA 4H2DA 4I50A 2XWQA 2C2OA 2WIAA 1FVFA 1NKVA 4A7PA 5EWMA 4ZKEA 3GJZA 5D1NA 5FL3A 3RFVA 4ENUA 3AETA 3TR5A 4FDUA 5CLFA 2RDMA 1TQHA 3GWZA 3PC2A 1A7UA 5AW8A 1X7XB 1XCJA 3EXHB 3FTDA 3ILSA 1QYRA 2NUTA 4AJLA 1J22A 5B2EA 2CMFA 5B58T 3A1WA 4I1SA 2PX2A 3IKMB 2QPTA 1T9BA 1WHSA 4CIWA 1EUYA 2R6JA 3QHQA 4GMXA 3LRPA 3WQSB 4UASA 2VTDA 2RE8A 1RC8A 3NFRA 1EBBA 2QE7D 3LUPA 1DCKA 2AS0A 4L1KA 4WACA 2IRWA 5AXBA 3MZ0A 4A9AA 4BASA 1LDBA 2O7SA 3HDTA 3CLUD 3GGCA 4DMKA 3LUBA 5CDSA 2PZGA 3CPJB 2J6BA 2P9JA 2XNDD 5EJ7A 5CDFE 3MIIA 5KTOA 2EWWA 3MS4A 3O47A 3X1MA 1OZHA 2OLJA 3O1JC 3PRKE 4IFTA 4NBNA 3ICWA 2QTBA 3CNLA 4E5NA 3NNSA 1OROA 1Q7CA 2IP4A 2PVSA 3HLYA 1NNEA 4O59O 3DLPX 1NV8A 5DBGA 1VJ5A 1ST3A 3QE2A 3BCHA 1NMEA 2GM3A 3K9CA 5JCJA 3TQFA 4D9HA 2AF3C 2ZRAA 3IE1A 2N0SA 2UUOA 4CMCA 1T8WA 3H1AA 2FYTA 3C1OA 3ONFA 2HDNB 4OAQA 3WDSA 3GUZA 2B1QA 4B1FA 2QAGB 5HX7A 2Y4NA 5B53A 2DPHA 2ORYA 4EQ6A 5A1JA 2Y1LA 3F73A 1Z4KA 3AXSA 1C7FA 1FS5A 1L3BA 3SX4A 2ANBA 1IK6A 4QU0A 3BMXA 4G0QA 3CNBA 3A6JA 2NU9A 1E1NA 2YZNA 3G2OA 2P2DA 4XJXA 2PGIA 1Q16A 4P3NA 4EYQA 3R6LA 4YRDA 3PI7A 4OHKA 1FDRA 2Q0XA 1NW4A 2F3PA 4Y6PA 2VWGA 5JMOA 3QOWA 4AS2A 3AJAA 3O8QB 4IGKA 2R1TB 5LU8A 1LC0A 1XNJA 3UXYA 1BSVA 1N6OA 4NABA 1YU6A 2ZAOA 3DOIA 3DHEA 3S2SA 3GJ6A 3BE8A 5IT4A 3PRYA 5JMPA 2EZTA 4IEFB 4MQUA 3I42A 5ELMA 1HOTA 3L1HA 1Z2OX 4TL8A 3E5MA 1LBQA 1H2HA 3BKXA 4KYIB 2PL1A 1U9YA 2LP4Y 3BWVA 2ILTA 1K6IA 1C9YA 3IERA 3L6UA 5LB2A 5G1OA 3S8EA 3K70C 2CLFB 1D2RA 3JQ8A 4C03A 1RI1A 4N5NA 2I9PA 4LQLA 1ZNQO 2B6NA 2FSUA 2I6UA 2H17A 3PDHA 4AXBA 5KDDA 4LDJA 4NS1A 3UJNA 1YRWA 3NBZC 2WD9A 5EESA 1XTRA 1WSWA 4LXIA 1Z25A 4D9IA 4MV9A 4BATA 2P35A 4MGKR 1CR1A 4YMVA 2RGEA 1AUQA 3TVDA 1L4GA 4EA9A 3HZOA 1D7OA 2BC9A 3KXDA 5FTKA 4OAPA 3ZU3A 3SXUB 4ALLA 4PAOA 3HG7A 5IM5A 3QBDA 2VNAA 2W00A 4RABA 2XCTB 4ZOEA 3ZWMA 3NV7A 5C5EA 3IEIA 3ABQB 3IKTA 4LZAA 3FHOA 4CKCA 5IKXA 4G5OA 1HFWA 5B7PA 2C8LA 5IHXA 1WY7A 3F1LA 3OFVA 1ZKDA 4X1OA 3KB1A 6PFKA 3U3MA 1CCWA 5G02A 1UK6A 3VDQA 5K9ZA 2AOTB 1GCAA 4EUKA 5HZHA 2G1AA 1R4MB 1T2FA 4R8MA 1UJ2A 5LA6B 2CXRA 1GXSB 1O0SA 2O0HA 2CKDA 1WB9A 1YT5A 1OWOA 1N3LA 2GCPA 4XYBA 1BHSA 5AKLA 1PNTA 3A0RB 3KQLA 2Z6VA 1XT6A 1S8NA 3VI3B 4O02B 2OV2A 1G9SA 1H6DA 1JS1X 3CKLA 3HKCB 5A5VA 1JJBA 2X77A 2IX3A 1DX9A 3D2AA 1JU9A 3TCNA 1KZ4A 1PBNA 3DXXA 2O1EA 4GPTA 1AKUA 1JHXA 1YA8A 2YBDA 1RWKA 1KK1A 3BMNA 2BFAA 3EVFA 3MTAA 4HVTA 4C6RA 5LC1A 1WXXA 1GILA 2X9NA 4M1QA 4MDYA 4KXVA 4DM4A 2JVIA 4M22A 3SN6A 2WIFA 2C4WA 2C96A 3KZCA 3QKSA 1E2HA 2DBQA 3E05A 4KLRA 1Z0FA 3KYDB 2NUAB 4YCMA 1ZSVA 1OD6A 3Q7IA 4B6JA 1GRCA 3EUEA 2NYUA 2V4MA 3IJPA 3ES9A 3KLPX 4GKVA 1CWUA 2IOQA 2DUUA 3STUA 1TKRA 4G0WA 3FOFC 2X40A 4OL9A 2DFTA 1LS1A 1QKIA 1XZAA 3I01M 5KYYB 4O2AA 2WQZA 2GBLC 2P4SA 4WDQA 4D4JA 3OZ7A 3I09A 5EMMA 1CDDA 2QMYA 3ZKAA 3HV0A 4GHWA 4BE4A 4JOCA 3U09A 2I0FA 2C5SA 4LKOA 4F12A 3H5LA 2IIVA 4GBGA 5FBKA 2RGAA 2Y1FA 4BJ3A 1N5LA 4MRVA 1ZM4A 2WDPA 2B34A 3BHMA 2Y1KA 3OIGA 2P79A 2PLNA 1P60A 3ET4A 2R6FA 5THQA 2QN2A 3MMPA 5KX5B 2NGRA 3A4NA 3AP1A 3S1AA 3FXAA 2QY9A 2BIFA 3N5CA 2CF6A 2O06A 1GWNA 3KJFA 1XYGA 2ZI6A 3R7AA 4HDCA 4RORA 3RUFA 3TR0A 5LZ9A 3QPUA 4ER5A 3K09A 3URMA 2C3UA 3DNFA 2FGJA 1B8NA 1U0BB 3QQ5A 4DRYA 2WABA 5IWAB 4YRGA 4RH0A 5EQDA 1EMDA 1OLXA 5T4BA 4TYNA 1CHDA 3QPBA 1HEUA 2Q5QA 2P9YA 3B53X 3K30A 2M32A 3AEQA 4YCNA 3UOWA 4GKKB 3WRYA 4LJ5A 1E59A 4RPIA 4ZOCA 2PSFA 4FUQA 3VVBA 1OAAA 4BFLA 3C5HA 3EWAA 4PINA 4ZKDA 3D7RA 4C7MA 1WE2A 4ZAFA 2HGSA 1Z75A 1V39A 4LSGA 4EKDA 1EZZA 4JAVC 4BFWA 2GD0A 3AIIA 5A3QA 5JWOA 1SFRA 4WUTA 3V4SA 4JY7A 4JBNA 1WBJB 4JITA 4D9NA 5MFPA 2N1BA 3H0CA 1RE1A 1ONBA 1T5SA 1SM4A 4GL4A 8LDHA 3NHFA 4QU8A 3IAEA 5IDQA 1X7WA 2P3LA 5FLYA 3SSOA 3QTBA 2JFFA 3FLBA 4JJFA 2ZR0A 3CKKA 3KSRA 1TJPB 2SECE 4J0FA 5LBIA 2ZYSA 2VDRB 1ZWLA 4M7OA 4LY6A 3DE6X 3FI9A 1S01A 3IODA 1CF2O 1LB1B 1MQAA 1RWNA 4FP9A 4CV1A 3O8CA 3ICEA 2Q3MA 2HM7A 4QJ5A 4JOSA 3KVOA 5CJPA 3ZVMA 2XYVA 2B4TO 2CHVA 2E4YA 4FC7A 2Q46A 3NKLA 3VAZA 3QH4A 3LOQA 1IBLB 1BX3A 1ZQ9A 2PAFA 4B35A 4NENB 1NRJB 2FP3A 3PGMA 2HV8A 5F98A 1TAUA 2HJRA 4AQDA 3ZHCA 4R7GA 2AR9A 1QO9A 1T4MA 1VDMA 4EPWA 5G53C 1JTVA 3PCXA 1Y6QA 1AT1A 2WJHA 3Q41A 2AOUB 4H4CA 5A9SB 2AKYA 2WSYB 2CXTA 2ZUBA 3BQ9A 3PT5A 5GOZA 3UKDA 4Z0TA 4B46A 1LK7A 3UWOA 3GFOA 4CL0A 3H9CA 1CRWG 1LSJA 2QMZA 4P31A 5NULA 1PEKE 2HJHA 3OJOA 5H68A 2AV6A 4NULA 1QK5A 4P2GA 2JEYA 3VJKA 1BCSB 1MQ9A 2PZLA 3QVLA 4F5WA 1D09A 2JJ1D 5BUQA 3M6VA 4WT7A 1XHEA 4PONA 1WCYA 2C4VA 4FCVA 5ALGA 3BGIA 5KREA 2F4VB 4C9BA 1Z47A 2AD1A 2WU4A 3I76A 4OSOA 4KYVA 5EEGA 4EI9A 3PJRA 3KHUA 4CXMA 2ICAA 3JD3A 4RENA 4Y9RA 4YI3A 2V6IA 1UZUA 2P68A 3QKUA 4F92B 3PC3A 4MWZA 3A4VA 3ZU5A 5BV1A 4MLDA 1YACA 1ZY2A 1UMBA 4F5YA 3ZEAA 3DMPA 3NVMB 3G2MA 4W7HA 1OFTA 4EVRA 3T3NA 4W1QA 1IMOA 2OCGA 1ZL2A 2PS3A 1U80A 1X1DA 3C3EA 3NFYA 4KAXA 1UM8A 4K2AA 3HRIA 3T9BA 3LUGA 5KTRA 2O0KA 5CT6A 3I9MA 1KY4A 5EIBD 3AEKA 4FI3F 1GPAA 2PO7A 2VDMB 3ULKA 1Z7YA 5L3VA 4LV8B 2H85A 1KPIA 5DNYB 4X3CA 5EZQA 1L8AA 1UBUS 2CF5A 3V1MA 4NECA 1SXJE 4R41A 3T5GA 3THSA 1XYVA 3JWJA 4U6SA 4OFWA 1F51E 4A0SA 1RLTA 2WUFA 4CHTA 2P6NA 1LRJA 1C14A 2FWBA 2GX6A 3U1VA 4R0MA 1O57A 1NBOA 3IUSA 3HXKA 1E4EA 1SZJG 1Z0KA 4M76B 3L8FA 4QOJA 5JZOA 4YHHB 1BXZA 1CUSA 3GV0A 3OQBA 5ELXA 2IZ0A 3DVAB 3JVUA 2PV7A 2Z83A 3I5AA 3MTDA 5IBRA 4CV0A 5LYYA 1DFGA 1DWUA 1QMGA 1ZR4A 3A0UA 2QN3A 4YLYA 1B8PA 1JHZA 1G20B 3NLLA 1FMFA 5FP0A 1X0VA 1UODA 3A6LA 4FYIA 4DRZA 2X5OA 4IXNA 2JHAA 1EYZA 4RM3A 2VUTA 3DJYA 4UBOA 2ZDGA 3S0JA 1DBIA 3G85A 4J0GA 5KTNA 5CLIA 1TIKA 3B3JA 3ZVKA 3CISA 3RVMA 3R9XB 1EESA 3AV0B 4A2CA 3IPYA 1SELA 1EB9A 3KIPA 4M98A 4NARA 1DXYA 1P4GA 4HFNA 2XA9A 4BO6A 4KV7A 5EZYB 5K0SA 3G2QA 4KMOA 4Q19A 3LUKA 2RHLA 1PAUA 1TF7A 2LD4A 3GB9A 3BE5A 3HU5A 4GVPA 3WJAA 5M5BA 2O19A 3V2IA 3MBKA 4FSDA 5CNIA 2CLOB 3ELDA 1MB3A 2CJXA 3H4VA 2NUPB 1S8OA 4KUGA 3TAUA 4M9ZA 2RH9B 4Q82A 1XF9A 4L27A 4CM5A 1QGED 4PX5A 3IAXA 1VJ0A 3G17A 7MHTA 3BFPA 4JSYA 2H2IA 1RP1A 3ZR4B 4CMEA 3F1KA 5JS6A 3I61A 2PGDA 1U02A 2FPUA 4OHOA 4P4UA 4Q7JB 3RVSA 7MDHA 2K2WA 1T1SA 3WC4A 3MTGA 1DBSA 1LGYA 1WD7A 3PHGA 4JHXA 4R16A 4CTNA 5IVPA 3DEIA 2GHRA 3A2KA 1CR4A 1EP3B 4PE5B 1YBVA 3OU2A 5LXTB 5J59A 1KI4A 3JQPA 3QTTA 2R7KA 4IIBA 1J25A 4AJHA 4D98A 3SWWA 1ZMBA 2V45A 4GEKA 1RZVA 2UAGA 1MNAA 1G19A 5JT1A 3HB1A 3CRRA 1MHTA 3CCBA 3PQ5A 1SXJC 1YWGO 3HLKA 2QGNA 5CEFA 4EYKA 3NYRA 2E55A 3UPTA 5CBPA 4TT3D 1PYGA 1LDYA 1I4OA 1QGAA 2QXUA 3N0RA 3W04A 1KYZA 3AV3A 1CJMA 5K5EA 2C2MA 2GT1A 2JCXA 1W0KD 4OQPA 3FLAA 1KRWA 2J3IA 3UKJA 5B6JA 3DV2A 4YCBA 1E9AA 1HQYE 2G08A 4CLEA 2GZMA 4IDFA 2DWCA 1E79D 4JENA 4XA8A 1HORA 1QF7A 3RBXA 4DADA 5TB5A 3DZIA 4HJRA 3TCXB 3GK3A 3JX9A 5BN3A 3VNSA 1C0PA 1LRLA 1XRJA 2P4HX 2VJYA 3PFWO 2Q5JA 4I81A 3VC7A 2N42A 2WRZA 4YCSA 5K8TA 3ZYCA 2R7LA 4K81B 4MHSA 5EVCA 3SQWA 1GEGA 3DLAA 2IIQA 3TMKA 4R7TA 3A1CA 1U0JA 3K1AB 4XCVA 2BEJA 3TAHA 5AD1A 4W7SA 2FG5A 2VTKA 1P0QA 2QQEA 4RFVA 2XRFA 4XQGA 5F77A 4FXPA 3R0QA 3I4CA 5FWYA 1AH2A 1JHDA 1X80A 5LA6F 3JWIA 4DLXA 1W36B 4PYQA 2Y05A 2ZBVA 1O97C 2FOLA 4EX6A 4QGHA 4BFSA 2BJVA 2JFUA 1IY0A 2C20A 1UEXC 3W6ZA 4EHBA 4E11A 3H9QA 2WAAA 5KJEA 3OPYB 4JK3A 3FR8A 4KIWA 5K0CA 3NHMA 3VU1A 2IZ7A 1OTYA 3ZKWB 4JXZA 3REQB 1WY5A 2Z2JA 1LX7A 2HJVA 1YS2X 1YOBA 2IQ5A 3EZXA 3GLHB 3LKZA 1DDIA 1ND6A 1DBRA 2DUNA 1S2GA 3D2CA 4QYSA 1Y3CE 3TSOA 1YKSA 1QHGA 2NPOA 2TMKA 4KDCA 4NSNA 1VIDA 4ARZB 3TTVA 1XKQA 4WJLA 2XT9A 4EH1A 1CUIA 3CBGA 4HHEA 1PGPA 4BFCA 3EMKA 4JJZA 1PYOA 1XTIA 3E4CA 1QORA 2VJNA 3KAPA 5IX8A 2JD2A 4ZFNA 5IBPA 4LHSA 4V24A 3RDPA 1FX0A 2YVKA 3AUXA 4ND8A 1P3JA 4FOOA 4YQFA 4AM8A 2DLCX 2ISQA 3RS9A 1HI9A 4UUMA 2PX5A 2WZCA 4YV2A 2OZLA 2QP3A 2XMDA 3A11A 2CV0A 1PZNA 2WIJA 4MV8A 2XECA 4F96A 5ILGA 2QRQA 1EFPB 3RKRA 2QG4A 1OH7A 1OFGA 2WWXA 2R87A 3U4CA 3HS3A 3IEUA 3WKBA 2RI6A 3Q72A 4P4GA 3RK0A 1UMKA 3QU2A 2V7QA 4P80A 2O07A 1I0ZA 3TGPA 3FFAA 3NCHA 2CNKA 1VMIA 3DHYA 2Z2ZA 4L02A 4C78A 4YCJA 3NCTA 2NACA 1BOFA 1RKXA 4MVYA 1O9BA 3EIXA 3GDFA 2B83A 4XI9A 5ADWA 5J58A 2VHEA 1EWQA 3OTIA 2GASA 4BRUA 1N9GB 3WGIA 2IU4A 2PRKA 1OILA 2UYOA 4REOA 2QD2A 3MFQA 4UW9A 4UU0A 4EHHA 2HZ7A 3DLHA 1ZRHA 1YA6A 5TMDA 2UVQA 2W22A 3J7AC 1E2BA 2JLZA 2VF2A 3FBTA 5KTPA 1Y33E 3IQFA 1TDJA 1INLA 2ST1A 2ZULA 5DIFA 5BVGB 2OAGA 3S99A 1TK2A 4G0UA 2VHXA 1G7RA 1NR5A 2J3EA 3MWKA 1MDBA 1U99A 4KQ6A 1TK3A 2DFPA 1I2CA 2GNAA 4G26A 5F3DA 2DEUA 1RJEA 3DE5X 4LX8A 1OH6A 1W87A 3L7OA 4A6XA 1JEYB 5BR4A 3EEIA 5CLGA 1P6UA 1W581 2WKSA 4E30A 1T6XA 1GPUA 2A0KA 3D8HA 4MQMA 4XVRA 4V0KA 4CM4A 3KEQA 1Y7TA 4XWYA 2ONKA 1H2XA 1D2CA 1YQQA 2J0VA 4QUIA 3MQ2A 2XVZA 4R2JA 4YS6A 3I0ZA 5TMPA 4O3FA 3A1FA 3L7MA 3P0FA 3A6ZA 3VKUA 1U4SA 4ZCTA 3DHWC 4IGIA 4LXUA 2IQIA 4U7GA 3EIFA 3FNBA 3LHSA 3FVWA 4H7JA 5CK5A 3TX6A 3SDBA 1KBOA 1JYFA 2XCOA 1J7JA 2HLHA 3SVTA 2J0QA 4Q6BA 1YRHA 1KSGA 1R37A 2QTZA 1LDMA 1TU3A 2G4VA 2Z98A 3ELBA 4P86A 1FFWA 2DU8A 3JQ6A 1FFXA 2Q4TA 3IJ5A 4TXMA 2Y9MB 3C48A 2JFVA 3UBTA 5IS2A 4O4IA 1P74A 1UMCB 3KD2A 3TIXB 4UKDA 3AF2A 3U40A 1G38A 1AF4A 2GK3A 1ZW6A 3Q10A 2OGUA 4HNSA 4IIJA 5C32A 1ZCAA 4DMFA 1MX1A 4MGZR 3EBLA 1QS0B 1KHHA 2JIQA 1IBRA 2Y1WA 3WHLA 2TSYB 3L5KA 5KCMA 1UPFA 3HB0A 4KPUB 4U7PB 2O5CA 3VGPA 3TVTA 4LOIA 1EVIA 1H3FA 3F7NA 3UMRA 4YRJA 1WPXA 3KETA 3HPQA 3TZ6A 3FNQA 1EQAA 1W2HA 1DBPA 2I29A 1H5UA 2WM2A 3EQ8A 3FYUC 5JBNA 3H8SA 1UBJS 4P7JA 3RSFA 4XQ9A 1ULBA 4PQRA 2WAXA 1QIKA 3JD1A 3IUYA 1XZPA 4P54A 1P5RA 3GVPA 2LXNA 2C5LA 4JJKA 1GVNB 3UQYS 2H0QA 1RI4A 5IYZA 5KOHA 3KZXA 4HYTA 2W6JD 4LG1A 5K3AA 2R6CA 1UFRA 5EHNA 2R0QC 2JFOA 2H4WA 3M82A 4JVOA 4S05A 1B8VA 3HBMA 3AVPA 3DW1X 4WKOA 4MUFA 3M6WA 2ZWAA 2RGXA 4JLPA 3JCZA 5ARBA 2X7JA 2YJ6A 1MQSA 3BX1A 3H9EO 3TJMA 4OK5A 4GWLA 2VYNA 2EAUA 3WWZA 2NT4A 1Z45A 1H5QA 1VLMA 2YR0A 4XFJA 1D03A 1EM8B 1GNQA 3SX2A 3ZXYA 3J81k 3DL7A 1JDBB 2ENUA 2UUAB 3FNRA 2G72A 1R64A 4FR5A 4FDMA 2YQ4A 4YH1A 1E1QA 2XB6A 3WE7A 5E8RA 5KYUA 2ACEA 1R00A 4K28A 3BERA 1IOLA 4N3AA 5IAKA 2I6SA 1NXTA 3KJEA 4U8GA 3DZ8A 2HNKA 3OUTA 3GZJA 1JLSA 3R3XA 1TEHA 2QVZX 1WL8A 3FRJA 4K6OA 3IR5A 5BSTA 4I9FA 2D1SA 2Q3EA 2ZAYA 3Q3JB 2A94A 2HSGA 4B80A 4ZEMA 2B69A 1SCIA 3PPYA 2BSAA 3N2KB 2QXTA 1BZYA 3O8DA 4MS4A 4TSRA 1LNSA 3TN7A 2SKEA 4V1CI 1KJ8A 4C05A 2R5FA 3VSAA 5CFZA 1W93A 1AQLA 1NYRA 2F9MA 1NQXA 2D5AA 3GG9A 4K7JA 4AD8A 4X20A 4ZTUB 3HDVA 4JP3A 3U26A 1W5BA 1GGEA 3VVMA 5L3SB 4Q66C 3W2HA 1XXHA 2IYRA 4FB5A 1SUBA 1W88B 4B5KA 1FBNA 1L4EA 2B37A 2XW6A 1FS4A 2O3SA 1T9KA 2VPYA 1A8SA 2ZSAA 1TC1A 4DNQA 1EFKA 1IUPA 5BUCA 4RVSA 3P0RA 4OAOA 4D4IA 5EZYF 4E21A 1PTJA 5A1TA 5E0OA 4YQYA 1X13A 1OOEA 3B36A 4D4GA 3L01A 2FR8C 4NYMQ 3X0DA 1XDBA 4Y9TA 1Q0SA 1F8YA 1XELA 2HCRA 3LBAA 4LHZA 4CZ2A 4MB2A 5FYQA 3DAGA 1D04A 5TMBA 1LLFA 2XVMA 2PJZA 5IF9A 1A9QA 1ORWA 3DBRA 1D0VA 1HK7A 4P8RA 4XRRA 5EJEA 4XWGA 2Z8XA 2XX3A 4Q01A 4BNLA 1FTWA 1XU7A 1X7YB 2BFBA 4QQ8A 1U2GA 4J8PA 5E4TA 1HQDA 3MM4A 1U7XA 4L0QA 3QFRA 3OIWA 3B1KA 2PANA 2P90A 3ETDA 3WLKX 1ULHA 2WV9A 4ECAA 2EF0A 4RA9B 4O1IA 4EW2A 5GPBA 3LYAA 4YIHA 5KYWB 1KJIA 4MUMA 4MR9A 3S2IA 4UU7A 2Y6UA 1APBA 3RHSA 5FCDA 4DDHA 4UCFA 5DH9A 5LXTF 1XJ0A 1EFUA 4Q47A 5DHPA 5ALEA 3P9QA 3T3GA 2ZE8A 2R86A 3OSZA 4JBWA 1I6MA 3LA8A 4PYRA 3TI7A 3UO8B 5DO9A 3UFXA 3HWSA 3T4UA 1A77A 5DN6A 2DWPA 1BS2A 3HYTA 4MWEA 1K8RA 3EYAA 2VHQA 1IHXA 1ZC3A 2AT1A 1IJKA 2KB0A 1DEAA 5JXIA 1JEQB 5FKJA 1V5GA 3O93A 4I1IA 3DFFA 3M1LA 3HKDA 4EI8A 1YBMA 3C16C 4D79A 4LF9B 4OKNA 2GAOA 4ZCQA 1IHDA 4EM6A 3ZQ4A 3CUYA 1F7VA 3PDJA 3FGOA 4KOEC 1ZGAA 4JZKA 3T3HA 1ZOSA 1P17A 3ZDYB 1RYYA 2RJNA 3LDUA 4JCCA 4OX9Y 5H9VA 4GM4A 4MTCA 1LJUA 3PYMA 2C1EA 3AF4A 1YZVA 4P53A 3QW4B 5FV4A 3CT6A 5JD6A 2E9SA 1M34E 3DHVA 2J45A 3C4VA 4MINA 4G56A 3T12A 1KH3A 1DAPA 1CXZA 3OCYA 2FSFA 1Z06A 4Q4DA 3VR5D 4C6TB 1UWCA 5AUPB 3EXG1 3ICCA 4V02A 1M66A 2H18A 2ZTVA 3RIMA 3KDPA 3LXRA 1II8A 4QC2A 2CXOA 2WWFA 3M1YA 5KYGA 2UXDB 3IHKA 5DGXA 1S2OA 3KKOA 2BM1A 3VBCA 3LQ4A 2R25B 4UPDA 3V9PA 3FGPA 1NA5A 4Y67A 2OEPA 1RT9A 3KEGA 2F1IA 2XEXA 3RASA 3MWLA 1WZCA 1HEYA 3WYFA 4AN0A 1WDKA 1UDAA 4JUFA 1IG0A 1LI4A 1G2QA 2AQ8A 2QRPA 3D6HA 5CHEA 2NPFA 4D0LB 4BY9E 4Z4EA 3TSCA 3TBHA 1QVZA 1W85B 3IT0A 3WGJA 1E2NA 1NT2A 2VCHA 1DC8A 2C8VA 4F04A 4YACA 1SIUA 1C30B 2XAAA 3GH3A 5A6SB 1KKLA 1YZGA 4RFSB 1N3BA 5LOVF 3QEMA 2UXCB 1T5OA 4C4OA 5EGSA 1EJ6A 1XMVA 2RHJA 2VDQB 2YMPA 3U2QA 5FOTA 3W8NA 1QJCA 2YNMA 4JIMA 3GNTA 1OH8A 1W4LA 2E89A 2FMXA 1TQ2A 3P2IA 4BMPB 5JADA 4B0PA 2FFBA 3YASA 3HUDA 1C50A 2OT3B 5A7FA 3DOCA 3DE0X 1B2RA 1D8TA 3KUDA 3CH7A 4ADSG 1P0CA 5F76A 3B3GA 1JH8A 2FJUA 1P7ZA 3A27A 3TD9A 3RSLA 2DQYA 2C5HA 2GCEA 4RL4A 4ZVSA 2O8CA 4Z6KA 3FWYA 4KSCA 4YV7A 4YY3B 4MYDA 1KIFA 1KK0A 4TLDA 3JAWB 3UK2A 3R3HA 4TKVA 2ZJBA 2VUHB 4ESOA 5BW4A 4NQRA 9LDBA 3N58A 1EH5A 1RHRA 3MJVA 1UJ5A 2AMYA 2GBPA 4BNMA 4JR2A 3IV7A 4LF6B 1JBEA 3ADKA 3ECCA 3K6RA 1GKUB 2I7TA 1ELOA 3NBFA 4GLFA 1P2GA 3CUSA 4M0PA 5L4LA 1NXOA 3AUSA 1A2KC 1O7JA 1UJ4A 1JFVA 3N2IA 5B3JA 3NKFA 4R1OA 2WTUA 5FBQB 3EISA 1D2AA 5AJTA 1VA4A 4XWTA 3TIGA 2OHHA 3U7QB 2FLVA 5IAOA 2HWWA 4JS0A 1YZNA 4ND5A 4UM9B 4A03A 1HFEL 3LLUA 1SHUX 1UP4A 3VR0A 1C4OA 2ISCA 2WC1A 3U31A 3X3HA 3IT2A 3UMJA 1Q6ZA 1XEWY 1XRSB 4RDHA 5BWOA 2AHOA 5KWJA 2D54A 3T9AA 3OA0A 3CR3C 1AQUA 1RI2A 5DE3A 5JSQA 3GNSA 3PDIA 4C7OA 3IIJA 3ADCA 3J80A