1CDDA

Structures of apo and complexed escherichia coli glycinamide ribonucleotide transformylase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
189
Chain Sequence
MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYAADE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase(formyl)
molecule keywords PHOSPHORIBOSYL-GLYCINAMIDE FORMYLTRANSFERASE
publication title Structures of apo and complexed Escherichia coli glycinamide ribonucleotide transformylase.
pubmed doi rcsb
source organism Escherichia coli
total genus 52
structure length 189
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 1992-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1cddA00
4EW1A 4ZYTA 4EW3A 3GARA 1RBYA 4TS4A 4YFYA 4R8VA 3AV3A 3LOUA 1RC0A 4NV1A 1YRWA 1GRCA 3W7BA 4EW2A 1JKXA 4DS3A 1CDDA 4ZZ2A 4ZZ1A 5J9FA 1NJSA 3Q0IA 1ZLXA 2BLNA 4QPDA 4IQFA 3NRBA 1MEOA 3AUFA 3OBIA 1S3IA 3DA8A 1C3EA 4ZYWA 4Q12A 4ZYVA 2YWRA 3P9XA 1FMTA 1CDEA 4ZZ0A 1GARA 3KCQA 4ZYZA 3DCJA 1MEJA 4ZYXA 4S1NA 4QPCA 3N0VA 2GARA 5CJJA 2CFIA 1C2TA 4TTSA 3O1LA 2BW0A 3TQQA 4TT8A 5J63A 4YFVA 1RC1A 3TQRA 4ZYYA 1RBQA 3R8XA 4ZZ3A 1ZLYA 1MENA 2FMTA 4PZUA 1ZGHA 1RBZA 4ZYUA 1RBMA
chains in the Genus database with same CATH superfamily
1DC8A 2QW0X 2B9EA 2PZMA 4X1YB 1Q7RA 1XOIA 4EZEA 1FS4A 4U00A 1ZWKA 2PUWA 4NC9A 4CNQA 3G2OA 4K40A 2BHRA 2DKNA 2JS7A 1QLJA 2WPNA 2II6A 3KQPA 4PANA 3AVYA 4IR7A 3ZR4B 2J48A 4NARA 3ASZA 5BWBA 1Z08A 1U9IA 4L0MA 4E2XA 4N12A 1ND6A 4EKYA 4H4CA 5AKEA 2WSSA 3JQ8A 3AOGA 3C6XA 4FMCF 2BMWA 3WRWA 3V8MA 4IXDA 4BL5A 2XQFA 4D4JA 4CLOB 3I01A 4PFQA 5A7GA 2IXDA 3CNLA 2GFQA 3DKIA 2J59A 1P7VA 2ZJ6A 3B1WA 4KQ6A 1KI3A 3UPTA 3W77A 3BMQB 1Y1KE 3NHLA 1CUHA 3CT6A 2IU3A 1H0HA 2EOAA 4FZ3A 3JQAA 4RFVA 5JXJA 1RYYA 2DWPA 4JYBA 4Z4QA 1XZGA 3DNMA 4UMDA 1RWMA 4YCJA 3KZCA 5TE9A 3R8CA 2A84A 2BLNA 1N5OX 4E6EA 2RGXA 4NPAA 3SQOA 1FTNA 4LYYA 4EHAA 1X14A 5AW7A 5CCBA 5BWOA 5A7FA 4GMGA 5K5EA 1ACLA 3EVGA 5TGTA 1DAIA 1A27A 3FR8A 4R1OA 3WDKA 1CEXA 4JSRA 5ITVA 3QXJA 4UU8A 1C3EA 2XDYA 4XDGA 4HS9A 1N6RA 5DASA 5EWMB 1ZKDA 1GZ3A 1GA1A 2WWRA 4V1CA 2PRKA 4MKHA 1GPJA 5EIOA 2JAHA 4RH3A 1VPTA 3EVNA 3JVVA 4CEIA 2BWJA 1KGDA 1JEOA 5AW9A 1T9HA 3L2OB 4AZWA 1A4UA 3GWGA 3QPAA 4C7OB 2Z1MA 2WFMA 3LQ1A 2ZE6A 5D3KA 3EY9A 1MQAA 1JLSA 7MDHA 2QP9X 3E7WA 1A7KA 3MRVA 4XQ9A 1VG8A 4QDJA 3FNBA 1I2MA 2R00C 4CRWB 5A1JA 1OB2A 1P74A 5DHTA 5DYIA 4F3CA 2G1KA 1H3EA 1NJFA 3ZTYA 4A2WA 4HRYA 5I4KA 2Y1GA 3O8QB 2R8ZA 5FL7A 4TWZA 4UM7A 1QJ4A 4K28A 4LXIA 1ONBA 1XCBA 4HGRA 5AW3A 3HR8A 1P0CA 3MSXA 2QF7A 3OM8A 1LD3A 1UT8A 1VPLA 1Z7YA 1P62B 3UC5A 4LOAA 2HH9A 3NH9A 2HMAA 4WN3A 1NVDA 1AZSC 2DHCA 2R1VA 3FMFA 1F2UB 1VIAA 4GPEA 3W6ZA 1C1DB 1ZD2P 5KTTA 4WXHA 1EK1A 1TT5A 3AB3A 4BC0A 2GEVA 4GLBA 2PAFA 2UZ1B 4FOOA 4EYGA 2VO1A 4J6FA 5ARDA 3FUVA 1RIFA 2JFOA 4M53A 2VQ3A 1U0BB 1Q92A 2ODAA 1LQTA 1YCGA 3R4CA 1TUIA 3ZBQA 3MGGA 4OSPA 3U19A 1PG2A 3A6ZA 1MMFB 2EL9A 3TTYA 2WU0A 4GGPA 3W1VA 2WB2A 3RAJA 2VNKA 2FEOA 1R5JA 4C6HA 4J0JA 2ARKA 1RMQA 1LWNA 3RU9A 3TQTA 3VU8A 5E6RB 1PJ2A 5TRTA 1JEQB 2G25A 3IAUA 4AJOA 1E64A 1ZCJA 2PDAA 2MIIA 5JHHB 3D2BA 1NFQA 1EXMA 3NETA 3OCVA 4EW3A 2QLBA 4ZO7A 4HNUA 5B4TA 4C06A 1XU7A 3CCFA 2BJHA 1JJBA 5CU7A 2QN1A 4FNOA 5EEGA 1KQFA 1G21B 2CLSA 3EGDB 3ED5A 1IHOA 1L4LA 4RLFA 2J33A 3CLRC 1UZNA 1I13A 2HNBA 3MT9A 3D0KA 4CTOA 4J0IA 2C42A 1U1IA 2H5LA 3RVKA 1A8UA 4ZO8A 2HXYA 4RANA 4BQSA 4C3VA 1RXVA 4YO7A 4KNYA 2JIQA 4P4UA 1P1FA 1HKUA 2BEKA 2WRZA 5CD9A 3AESA 1SJ9A 1VL2A 3AEKA 4BNLA 3F8TA 1WP9A 1D1TA 1ZD1A 3W90A 8ABPA 4U7JA 1FMLA 2RSLA 3ZE8A 4Q24A 2RDMA 3PWSA 1ITZA 2CLOB 4KFTA 4OP1A 5P8WA 1ZI9A 4PAMA 1XRSB 1Z6GA 2Z5FA 3P4XA 3FZEA 2VDRB 3TI9A 4S1OA 4IIFA 1AF7A 1KI6B 3AC0A 2FZKA 3N75A 4W8OA 1E4YA 4MVJP 1WMDA 3EXG2 4L75A 1A97A 3IAEA 3AIKA 4MR7A 3CYFA 1IB6A 1VBKA 1V37A 3R0ZA 2RJOA 3DPUA 4ZMSA 1HBJA 1WXXA 2VHTA 5EJ5A 5D3MA 3NRJA 2W6ID 3DHEA 4JQYA 1STOA 5FEUA 2C4WA 3ECSA 3IAS6 1YE3A 1J2YA 5AK6A 5ED0A 5C46F 1E3MA 1M0SA 1RTKA 3VSDA 3PWZA 2FFRA 2A5GA 1EFVB 1JPUA 1ECGA 1QONA 3JARB 4UHDA 3WQSB 3G9UA 1R0LA 5IVDA 3D3KA 1XVLA 3TLAA 3IP8A 1UJ6A 1VBMA 3A3NA 1BCRA 4KYTA 4W82A 1V9CA 3ORYA 4HSEA 3AR4A 1KO4A 4IY1A 2LRHA 2DGDA 1FDIA 1ZMOA 2JJQA 1EK2A 3DMYA 2VNHA 2VZ9A 5FORA 3ROQA 3DWIA 3PUWA 3H84A 1BGVA 1E7RA 3LGSA 2P1RA 2CB0A 1KAQA 1ESMA 4X71A 3SXPA 1DHRA 4AMZA 4DBVO 2O2IA 4P4TA 5IASA 2ZUWA 3D1LA 4RD3A 3WBBA 3IVMA 3FCEA 4KQEA 3JZIA 3OU6A 3VNQA 2ZIWB 2OCGA 2CZCA 3CW2A 1E92A 1WCXA 4PONA 1L5LA 4AN4A 4PNPA 1GYQA 1BXRB 4XWAA 3VZPA 4AWBA 5K0JA 5HM8A 3DMNA 4GD3Q 1LNZA 3ESZA 5JC1A 1LV7A 3PX7A 2CUKA 3AILA 3DT9A 1GZ5A 2XUJA 4D3XA 4LVCA 3F47A 3DO5A 4TUYA 1CP2A 3NHMA 2XVZA 5ALUA 1XTKA 3BEOA 5JD4A 4MVJE 3VR5A 1HGXA 3HV0A 4BRWA 2XUGA 3S27A 2KI5A 2LIVA 3LO5A 2WT4A 4YLGA 4XTRA 1FYXA 4H35A 4IJMA 4TKLA 1OOEA 4P3OA 3DL7A 4J94A 3KB8A 3ZTWA 4B3RB 5CLHA 1N1EA 3N2ZB 5BUSA 1ZNYA 1VJ1A 4IGEA 2EARA 3R7SA 1GGEA 1P7WA 4AIRA 3AVPA 1G60A 1OI3A 3T3PB 1UM9B 2J0VA 3D6UA 1MH1A 1R6UA 1GOTA 1MC4A 2QE6A 3ZWQA 4NCKA 5JATA 1QRSA 2ZBRA 1KQOA 3QY0A 3DZIA 1MJNA 2JHAA 2JJ2A 4TS4A 3CZ9A 1M5RA 2V3VA 5KB3A 4MUEA 2AD1A 2I2CA 2GPBA 3H17A 4AO8A 4WACA 5JCZA 5A3JA 3U4CA 4PLGA 5K6TA 2RGNA 4QPJC 4GDFA 5E2AA 4CIYA 4HUQA 1HNZB 5C8YA 2QIOA 1C8LA 3OMWA 3TLGB 4D6PA 5BP7A 3NBFA 2G9ZA 4Q1DA 5C53B 3TNLA 1KP2A 2IX9A 1CIVA 2P9EA 1EDBA 3NAGA 5GJBA 4IICA 5AI0A 3FKSD 1O7JA 3QUQA 5CW2A 5IAKA 4BE4A 1IE3A 1NNLA 2WTBA 4CYMA 2EAUA 1YKFA 2XMSA 3S6JA 3P2EA 2O7RA 2P30A 1N3YA 4NAHA 3URKA 1CD5A 1TMKA 3ZXSA 4AUEA 4UUAA 2VK4A 4BP1A 4F06A 1KWGA 4CW7A 3GNSA 4TGLA 5FKJA 3LMKA 1D7AA 4N40A 4TVBA 1J2RA 2PL5A 2OMEA 1EYZA 3OQJA 4NIMA 3UJDA 3ZWXA 3MMSA 3OWXA 4RFSB 2JCGA 2WPDD 5LWHA 1TTTA 3GAZA 4HLQB 2ASVA 4B3GA 4BUJA 4JA2A 3WYBA 1Z73A 2O7VA 2GJ4A 1N2HA 3KVOA 3FYTA 4IOKA 4LUCA 4P83A 4XEHA 4R3UC 2JIPA 3S5JA 1T8WA 1XB2A 2DEUA 1KZ4A 3PQ6A 3VNUA 1BHJA 4CV1A 5C80A 4YBRA 3KEGA 2PD6A 2QKYA 3PHHA 5DHQA 2XGGA 2V4UA 4KWTA 4PFKA 4EF6A 1KQPA 3IKVA 4K9RA 3O8BA 3GNLA 4LHYA 5IYZF 1ODIA 3G02A 1Z4OA 4ZVNA 3FDJA 1VXRA 1VYUA 2H4XA 3RO7A 2VK1A 2YWXA 3WHIA 2RHMA 6YASA 4YAIA 5KEIA 2MYNA 1UZAA 2JF0A 4KXXA 3RDPA 1AKWA 3ROPA 3F4KA 3U4QB 2JHFA 2PKCA 4IIXA 4HDSA 1A8PA 4PLVA 2K2QB 4RQAA 3L6DA 5L3SA 1W7AA 1VJRA 3HGMA 1V35A 4EPYA 3EDQA 3UB2A 3WGQA 3UV6A 2PGLA 5U4XA 1CF2O 1THMA 1HE3A 3H19A 5EUQB 2RBEA 1JQEA 3KD3A 4MLPA 3OOSA 1SPBS 1V39A 2GM5A 4DLUA 1E1MA 2UUPA 4DQXA 1EVZA 2VEDA 3OSUA 3FVVA 4DJDC 4MVWA 1E3TA 4ZALA 1Z0SA 4C5AA 4ZMRA 3AR5A 4WE3A 1XU9A 2VAWA 4C2UA 2QRKA 3CCCA 4I4NA 1N2CE 2CJFA 2QSYA 5U4QA 3T4UA 4MR9A 1G3MA 4OEHA 3NAZA 3GJ8A 1T36B 1I3MA 4UARA 5KNDD 1YF3A 2RGRA 4Q1AA 5ERXA 1ZM9A 3K0EA 4JXJA 2HFKA 2VDNB 2B0JA 4EL0A 1TVKA 3MXTA 2FWIA 1CY4A 1L8QA 4GZ6A 2CXUA 2R3SA 3INYA 1M1XB 3GRVA 3MNFA 4EGCB 3BH7A 4MYDA 4GWKA 4D8UA 4DLWA 3T5AA 1SKAA 4LOKA 1PNQA 1PSDA 2CLCX 2PS0A 2XZTA 4IP0A 5AM5A 1NM5C 2J30A 3HCOA 1HQYE 4K1LA 3NUZA 1Y7LA 3SZUA 1YBMA 4OYRA 1LJUA 2Q3CA 3OD5A 4RPKA 1N1DA 3CEAA 3ILVA 5HHTA 2W6CX 4MARA 1DPGA 3VHQA 1PR1A 1RRGA 2FG5A 3TZEA 5EFZA 5JAHA 4NF2A 4TXHA 5D86A 1GV0A 1I2BA 1XMXA 3K0BA 3U4GA 1IHPA 2GF2A 3R6DA 1EA5A 1VE7A 2AHOA 3C98A 2H2DA 3I5UA 3KQWA 4ZEVA 4X00A 3FE2A 1DZIA 1NQUA 1PT8A 4I5IA 4PZEA 3IUSA 3WIDA 1FFSA 4YCSA 2FH5B 1A8IA 1J24A 2ZBFA 1T5BA 2AK3A 3PF9A 2ERCA 5E6SA 3V32A 4ZEMA 2E6UX 3W7AA 3ZCSA 2D1RA 2E1PA 1FLDA 5T8KC 1XDZA 1RS0A 2FWBA 2ZANA 1KI7A 3FHTA 4RELA 2ZJ3A 4KXFB 2JLVA 4XYBA 1THZA 4Y2PA 4AKSA 4UHCA 2OV2A 3HE3A 3JAWB 3FTDA 4KZPA 3JPYA 1BJRE 5ALIA 4EI2A 4HDKB 3EVCA 4TKVB 4ESOA 1XIVA 5MN6A 5ALPA 3TG2A 2G4CA 3H5IA 2PV0A 1A5SB 4ZEXA 1XDDA 3NRBA 1ZONA 2QRMA 4ALNA 4HXFB 1KSHA 2XR1A 3FFBA 3HVJA 1EJBA 3GP5A 4GKBA 2VSYA 4K46A 3LUAA 3QVUA 4U0KA 3MD0A 3MWFA 2JK0A 4KAFA 3DG9A 2Q5JA 1G0OA 3QUCA 1LQUA 3FYUB 4QHTA 4UTRA 5AVUA 3IE1A 5HP4A 2HR1A 4FLMA 5LFAA 3EWSA 1I0ZA 3DDNA 3NHRA 4R84A 3R23A 5KMGB 4TTAA 2C9DA 4TUYF 3E03A 3SC4A 1A9SA 5CCEA 2RHBA 5TV2A 3ZWAA 4YRSA 4ITVA 2ZYUX 2WLSA 2GILA 4M55A 4EFDA 4HEHA 5I47A 4RAQA 3ZIAD 1P4HA 4PG7A 9GPBA 1WZCA 1D1PA 3F1KA 5EIBD 1YS2X 5AQEA 3ELUA 5DBGA 4TMZA 3ZHSA 3R0VA 3RVNA 3FHJA 2PUGA 3HG7A 4U9HS 3ZLUA 2A9QA 1P4AA 3U7IA 2K7ZA 3WLOA 1HYEA 1RJGA 4W1PA 4AZ0B 3QA9A 1Q57A 4Q16A 3ROEA 4UXHA 4F92B 4Z86A 1NBOA 1ODKA 4O5OA 2WE8A 1Z6QA 2WU4A 3MS4A 3MJ4A 3I4CA 3LVQE 5G3ZA 4TWJA 2FW9A 4ZC8A 4OI1A 1W2WB 5B1DA 1JEDA 1GPLA 1AHPA 3WA7A 1PNRA 2R65A 3KFXA 1OH8A 4QQFA 1ZD4A 1OYWA 2ZRFA 1K9VF 4PCLA 3FH0A 2MINB 5BO5A 1WHTA 2H1HA 4Z4HA 1ZC4A 3Q1LA 4KMOA 3OURA 4QNMA 1RJ9A 3B78A 1P33A 2Y1DA 2G1UA 1F48A 5A0FA 3TTSA 5AI6A 1GNLA 4MS1B 3PTAA 1M2FA 2XA1A 4M89A 5C8VA 1N5MA 1EB9A 2OAQ1 3K0SA 2CEAA 2DTEA 2V45A 5JUWA 3UNXA 1JJVA 4C01A 5FI5A 1Z0IA 4AM8A 1G41A 3E7PA 4L73A 2R6GA 5LP6B 4G4JA 4EFMA 3B7GA 4PYRA 1MAVA 1ABEA 3TLEA 5IT9A 5G41A 4UUNA 2OVBA 3A25A 4XFJA 2E6KA 3E23A 4LMAA 4X54A 5C4GB 4N3CA 1M8GA 4X90A 5AHXA 1BC5A 2C03A 1RT9A 1TO6A 2QPLA 4AMGA 1S8NA 2HRDA 1Q0SA 2Y1XA 1WA5A 3U61B 1BWPA 2XZDA 3MWJA 1II0A 3L8CA 1Y7IA 5G0SA 4D4GA 4F5WA 2P6RA 3LE8A 3V55A 1DC6A 3QITA 1LBIA 2O5EA 3E61A 1V8DA 2UV8A 5DBFA 1E9VA 1G4HA 2ZSHA 3PGVA 4QDXA 3IUJA 1U2GC 2BBTA 2ROQA 3KXPA 8OHMA 1SBCA 2CL5A 1VI5A 2QT9A 3GFVA 4WERA 5KO2A 2QHXA 1NI3A 2VYVA 4JEIA 4YP6A 4PO1A 3EZXA 3T7TA 4BO1A 1Y4ZA 1TAQA 4WCDA 3IIEA 3D6AA 4OFWA 2PANA 2BAGA 2AG0A 1M67A 1HE8B 5BOSB 3Q3CA 4A8JC 1E8NA 1JPNA 2HY7A 3IR5A 3PITA 4Y2RA 1D03A 3FGPA 3IV6A 2ZUFA 2XT6A 3PEEA 1IWPB 1G20B 2PYZA 3F6RA 4OOEA 3UAYA 4C5CA 5B58C 4R1MA 1QU3A 4Y2VA 4M0DA 4ER0A 1GJRA 3BF7A 3CMMA 4PG5A 1SKQA 5KTYA 2NAPA 4WJLA 1PDVA 3ZOKA 1PNTA 1H5UA 2WD7A 1W96A 4ZO4A 1W59A 4AECA 4YLYA 2C5SA 2RH8A 3AHEA 1WB9A 5LZ5A 4II7A 1YS6A 5CDSA 4WADA 1W88B 4P4SB 1QS0A 2XLCA 3HJCA 4KJZA 1AB6A 4ZAGA 3CH7A 3D4IA 4ZCLA 3IJRA 4ZAZA 3EMKA 5LBUA 4G4GA 2R96A 4BEWA 2BGGA 13PKA 4FWBA 1TUGA 1NXPA 2HMTA 4ZC1A 3G2LA 5AK3A 4GMFA 3D6HA 1Z12A 3ZV6A 4CVNA 3CN7A 4LVOA 1P4JA 1M6VA 1FSSA 3K3PA 1T91A 4GR5A 4HFNA 1YD7A 1KR2A 2NV0A 121PA 5AVOA 4ETIA 2JHPA 2V59A 1PQPA 1G8MA 2AQ8A 3C8HA 4G37A 1X92A 3HO1A 1CSEE 4RENA 3QGMA 5BPHA 3GLTA 3VC3A 4G89A 3PNLA 2RHWA 3TIXB 3VJRA 1ZH8A 4DYDA 4FT2A 1HZJA 2JFYA 4KI7A 3ID6C 2BLLA 1ATIA 4RK7A 4BLSA 1V4NA 4K0KB 3GAFA 4Q4HB 2JBAB 3KV3O 4YAGA 1QVRA 3PNMA 4NR0A 3BHIA 4BVFA 1AV7A 4RF3A 2LCIA 3QWBA 1S3GA 2PBZA 3A6JA 4MGZR 5H68A 3WLRA 3UOWA 1V8BA 2GCOB 9ABPA 1T5OA 2XSZD 2ZE8A 2XITA 5DLQC 1TM7E 2H4WA 3I3SR 4BUZA 4RY8A 4YV0A 3H5TA 3A58B 4L74A 4DV7B 3QEBZ 2ZUVA 1P91A 4PAQA 4U7FA 2IYFA 3H7IA 2BY4A 3VKHA 2C9BA 4HZGA 4M54A 4DLTA 3HCWA 4GZ5A 2A94A 4ND6A 2JZNA 3SBOA 1C3JA 4R01A 5IM4A 4S04A 4LY0A 1F8FA 1TA0A 3UMGA 4LDRA 4DPLA 1GAJA 3FHCB 2ZJ7A 3KELA 3P2IA 5KQSA 2Y66A 1MO2A 1PJCA 3NX4A 3ZK8A 4HB0A 1AC5A 5FO1A 1KH1A 1ZK0A 3I6MA 5KTOA 4FN5A 4JLKA 4YHBA 4AS1A 3IQDB 2I0FA 2FOXA 2IYYA 5G0UA 4EKGA 3STYA 3Q5DA 4E0BA 5LQAA 3Q6NA 1X2EA 2Q3MA 3I8SA 2H2WA 3GRRA 1OBFO 1T0JB 2AOVA 2ORYA 4Y8VA 3UPDA 5JNRA 2EFJA 3COVA 5BN5A 1NUPA 4CUKA 2AOTB 1LDYA 2V0CA 2ZPAA 3NWPA 1GTL1 3FPCA 1NBMD 2ZRQA 1KKMA 2YV2A 1V7PC 3AY7A 4JX8A 4W1RA 3IE2A 3E5NA 1SC6A 5B6PA 5K2OA 4FYWA 1E5TA 2PM8A 1U7TA 2ZR0A 3GN1A 1NW6A 4IW3B 2NNLD 2FQ1A 1MX9A 3L5OA 4FMBB 1NMQA 3QWIA 2PX5A 2SCUB 3J80A 4PLTA 4Y1RA 3BQNB 4J90A 1ZGGA 2JGNA 4OU4A 1DIGA 2VDMB 3N3BC 4I6JA 4M9UA 4X1YA 4YCDA 5BN4A 1RPZA 2ZULA 4FN4A 2F3QA 2WW8A 3NVDA 4BO7A 3FJ1A 4GX1A 1WR8A 1ZXXA 5GM2A 1AGNA 1SZCA 4WZZA 1Z13A 4LHWA 2AYXA 3QHQA 4YXWD 1EZ4A 1GUZA 5JNTA 3LV8A 1WQ4A 2MWMA 2Q5CA 4UMEA 5DXAA 3Q1KA 4BKOA 3UZUA 4CLOA 2HPHA 421PA 4RCYA 4EI9A 2HHAA 3HCCA 2V7PA 1CU1A 1Z7GA 2H9YA 3I0MA 3QU9A 3JPWA 4CLHA 3SWWA 5HF6A 3BMQA 1N34B 3BD6A 2OD9A 3F5MA 3JWIA 1G3UA 4NE7A 4PG6A 3J81A 3F49S 2GLXA 2VTBB 4DUGD 1Q1EA 4JGIA 1JQ3A 4L5IA 2BONA 4AY5A 2WQ7A 2X0IA 2VK2A 3RFCA 5JFTA 2G67A 2QJWA 2PUEA 2CJPA 1N57A 3CLVA 5K0ZA 4CGZA 2V3WA 3OY7A 4M0MA 2PUCA 4CBVA 4B43A 1QKIA 2WUEA 3LPAA 4LJ4A 1GTZA 4TQ9A 2PLRA 1PV4A 1M2NA 4FI3F 3JQRA 4WSOA 1KYTA 4YJDA 4BJ5A 4YP5A 2NYVA 4AYXA 3WB1A 5TVGA 3OOYA 3Q8WA 1JNYA 1EM6A 4JDPA 3D1VA 4Q1BA 5EWMA 4ZYXA 2HBQA 5JCXA 1C41A 5JJKA 3R0XA 1E0DA 3RAGA 1G4UR 2Q07A 2RAUA 1NBHA 3I1IA 3MT7A 3QX8A 2WILA 5FNVF 5JDCC 5SYAA 2OBFA 2GZ3A 1RAFA 1UQRA 1G7TA 3C4VA 4RMJA 3NYIA 4C7OA 1E61A 5KNCH 3L7LA 1JWLA 5FTWA 4B6QA 3K8QA 5D5HA 2BFDA 1D2HA 5TARA 3BWDD 1U1GA 3RT7A 1G16A 1D5WA 2OKGA 3PGA1 4N18A 2P4UA 4TL6A 3L7JA 2RMKA 2JGEA 5EOVA 3V8VA 4DQDA 2LDXA 3FNHA 2LVBA 3HR7A 4K6GA 3O8QA 1P31A 1S3SA 2Q5HA 2ZJ2A 3VNAA 2AX4A 2WYIA 1YVPA 3KHSA 4E13A 3M7IA 3FRJA 2F1RA 3RS5A 2VYNA 2HZBA 1OH5A 4D98A 4RXTA 4QICA 3TGLA 2IPAB 4AT1A 1QVZA 2O3QA 1C7QA 1SD5A 2YZNA 2BJVA 2ZIZA 4IJKA 3S0JA 4HOYA 3VPCA 3VPHA 1PR3A 3RSFA 3R7AA 4Z3KA 1E96A 2RC6A 2WYHA 2BMFA 1C1DA 1Y48E 4PR3A 3R3SA 3NR2A 1XD9A 2X4IA 1QFZA 3NM5A 4MI6A 3TB6A 3GUZA 3TRHA 3WLKX 4R0MA 4G5HA 1G7CA 3E22B 4HWPA 2RG1A 2M6RA 1JFTA 2E4AA 1E2UA 3LU1A 2H1IA 4K6HA 5DOVA 3WDSA 4RIIA 3IPLA 3TKAA 4XWYA 4HSGA 5CDUA 1X6VA 3F7NA 2WWHA 3UW3A 3UJBA 3BKXA 2GXAA 3UG6A 2OORA 4Y30A 1GSHA 2EDAA 2UYQA 2VHWA 3FFXA 3F98A 2HK6A 3IQXA 4RZQA 5EHQA 3ZGNA 4Q1EA 5J3JA 1L5SA 2D62A 3PXGA 4KDEA 4M36A 1BU5A 5E6RA 1RE0A 1JEQA 3K9WA 3SS7X 4BY9E 5IMBA 5KQGA 4OHWA 3C3DA 3V1LA 4E7OA 3DDHA 3JALB 4L0DA 3VXKA 2XUAA 2WVGA 3EWIA 3DQQA 1SC4A 1NJ6A 1G21A 3HI4A 4JLWA 3EGDA 4P54A 1K9SA 2QQFA 3WYGA 1WUIS 3INNA 1EBUA 1U2DA 1F0KA 2FRDA 4WDQA 1GUBA 1Z47A 4IBOA 4DZTA 3DDUA 1Z5PA 2FGKA 4KDFA 4QG3A 5LIPA 1W0JA 4CIBA 1ZK1A 5AJUA 1G6OA 5HQTA 4UQPA 1JWBB 3W8FA 1FYVA 3OQOA 1J25A 1KYIA 1YR1A 1WPRA 1BDMA 3CX7A 4LISA 4RQTA 1NU8A 1QO0D 4XYMA 1RHKA 5C8DA 5FL3A 5ECWA 1HWYA 4E5DA 2AXNA 3O4FA 3QBDA 2W4MA 1TM3E 1DNPA 3UHFA 1G38A 1GTMA 1XRRA 4N41A 1AQYA 1DXHA 4D0NA 1QE0A 4GPD1 3SHQA 3ZWKA 1CEEA 4P6VF 4QT4A 1B8NA 1EFDN 1VLJA 1KI6A 3IHTA 1KEUA 1R0KA 1J2TA 3D7KA 5IM4F 3DL0A 4KQJA 5K4AA 3VOTA 4WOBA 5LDGA 2JFWA 1QRAA 3EG9B 3QP9A 3I52A 2OO5C 4NAUA 3GELA 4DZRA 3LZDA 3PE6A 1SIBE 1U3GA 3U0BA 3UY4A 2BFBB 3GUUA 1FMFA 2V5UA 3FF1A 1R37A 5EWJB 4TL8A 1D0VA 4OGLA 2PO5A 4S1NA 2BRUC 2G9NA 4RTNA 4H27A 2CXOA 2H06A 2J31A 2NO1A 5MFPA 4PICA 3OJ0A 3PEUA 5DYNA 4UEWA 1U7UA 1EFVA 4JJAA 2JD1A 3VYTB 3JARA 3KXLA 5DBIA 3AY6A 3PC6A 1OYOA 2AC7A 3CGGA 3IQFA 2BTEA 1LCIA 2RHJA 4DG8A 1GAEO 3VPAA 2QUAA 1QP8A 3QJGA 2CW5A 2WQZA 5EVJA 4W5JA 3FHOA 4JVLA 2H9AA 4E5KA 4YT4A 1DTWB 1OXUA 1E2IA 1GCGA 2G8LA 1J8VA 4HWKA 2H00A 4M1EA 3W06A 4CM3A 5CRIA 5BQOA 4P1ZA 3QFHA 4DMKA 2WKQA 4F1WA 4PZAA 4MWEA 1ZYUA 1LS1A 2A30A 2ZZKA 3OPMA 1TF2A 4YDHB 4U6NA 3HM2A 1T34A 3HCNA 2NSLA 2VC2B 4HVLA 2ZJZA 5IVPA 4QT0A 4QUHA 3BJIC 4E7PA 3BE8A 1FDTA 1BXRA 1JUDA 3B9QA 3EDYA 5HGJA 1U7OA 3MWYW 3H5OA 3TLXA 1WMSA 1VBNA 3HP7A 4LRSB 1DCTA 2QT1A 4KLAA 3WJ1A 4TV8B 1MABB 3JVIA 4PZ9A 5ALJA 4RTOA 5KYYB 3IP5A 5JYEA 3OFVA 1SEVA 3WQHA 3ADOA 3QBEA 4AJKA 4FYMA 4ZP1A 2FRVA 4A26A 2VAXA 3NORA 5J4YA 1S8OA 2CXQA 3G5UA 4I7EA 4AD8A 4ARAA 2PIDA 4DM7A 2V3CC 3AF1A 1P72A 4L8WB 4F4DA 1RCFA 3HYTA 5JZSA 4M1YA 1KZYC 2X77A 4J1NA 2Y6VA 1TU4A 3AO0B 5F76A 1JH8A 3P27A 1C3XA 2XUHA 1U3DA 4E5PA 2FMXA 1W4AA 2K2WA 2C5HA 3SM9A 3TL3A 4DHEA 1E9RA 1Z6YA 2QROA 3E53A 4ZO9A 3EN0A 3IEIA 2H16A 1F2DA 1I14A 1XP8A 3Q0IA 5FUWA 1UM9A 3DKPA 1PYGA 2X4DA 1HYHA 4JMLA 5ALRA 2RK4A 1KFBB 4DSNA 5DM70 2H5EA 2X8JB 3IOMA 3CRQA 2H1LA 3DKKA 3RFVA 4M88A 4P7KA 2AOWA 2SKDA 4BZWA 3CRVA 1T8SA 4KYUA 5GTDA 1NMXA 1GIAA 1UEJA 2F6RA 2NO0A 1BYIA 4TLCA 5NULA 2FSFA 4C78A 1YU9A 3RS4A 2BH2A 4G85A 1LPOA 1M9NA 2O3TA 3L93A 2ZKLA 4Q37A 3R6GA 3HCBA 4BFSA 3I9V6 3DHWC 2NPOA 4XUGB 4TQAA 2BKLA 2IS6A 4MUMA 5J2TB 1KYYA 2OCBA 1TTQB 5IZCA 1W2GA 1I1HA 3TD9A 4D9CA 3KJHA 3GBSA 1ZVVA 1E6WA 1NUSA 1SRQA 5AK5A 1UT5A 3ZNQA 2YIVX 2QN8A 4XGKA 1Y4DE 2B6NA 2ISQA 4N6OA 2E4WA 3CU5A 5K8JB 1P9LA 2FOIA 3L1VA 3V3KA 2PNJA 4FFLA 4RFSA 5DV9A 3U81A 2CDRA 3ZN2A 2AE2A 5HDQA 3ZIDA 2ZBVA 2CLMB 4V03A 5FHQA 5BN4B 1I7QB 4P36A 2ZBEA 3I1JA 4AKHA 3K73O 3BQ9A 2XADA 3BPSA 3IAXA 3SN6A 3A4IA 4NU6A 1EEXB 4R16A 2AW5A 1DRJA 1MJFA 2C57A 1F5NA 1Z9BA 4NH4A 4GVLA 3SF0A 2UUAB 4FYJA 1K0UA 2O4CA 4LMPA 4Q7LA 1Z07A 2Z5VA 3B3GA 3LVFO 1XZCA 2VDKB 2QYTA 2X1MA 3PZRA 1R6DA 3HB7A 4QPNA 4ZVPA 3RC9A 1ORRA 2JFNA 4CTMA 3KRTA 2O3SA 1LPSA 1UAYA 2FEKA 2P69A 2VXCA 3K9GA 1K98A 3BZUA 4QJ5A 5SZHB 1O03A 4R8LA 5J63A 2ZB8A 2H0AA 5I4IA 1KKLA 2AMVA 2FUNB 1L5YA 3VYWA 1UODA 3R5SA 4M0EA 3U4QA 1GPMA 4LQLA 1SVSA 2JAPA 4D45A 1PDOA 3EGEA 1YRQA 1WZIA 3GFFA 5JAPA 2OBNA 2QV0A 2VCHA 1UPAA 3IO5A 4X65B 5GM1A 2HJHA 3A6DA 3EA4A 5KOYA 1PJ3A 1F60A 1VHQA 1G5PA 5ECGC 2PUVA 5LD2C 1K06A 1N2GA 4XLTA 5HDBB 5JD6A 2NV6A 1ZOIA 2XOKD 5JWHA 2PZKA 3G0GA 4RE5A 4OJMX 2LXNA 3A9CA 4V0LA 5E0OA 3RSHA 5BQFA 1UKZA 1BIFA 1QOPB 4RHCA 2F8LA 2ZUBA 4QQNA 4WDRA 4W9MC 5L3ZA 3GY0A 4JXKA 3UJHA 3WAGA 2E4XA 1RZRA 3NBAA 3DZBA 3PFWO 1YB6A 4OQFA 2BJWA 3KOMA 1CUZA 1RC0A 4WKPA 1I30A 2VDLB 3CQ9A 4WXRA 1T36A 1PRYA 3IEMA 1NOIA 3OLZA 2WG1A 4Q5IA 5LA6F 4PO3X 4AP9A 4XYGA 4AN1A 4ZU6X 3BH0A 2Z6VA 2A7QA 3EMBA 4OB7A 1DG1G 4ZZ2A 3DAHA 3ODPA 3GCWA 2ZS8A 4PC7A 1IHXA 3QNWA 5ITWA 1Z6PA 2FDRA 1HA3A 4BIMA 2XQIA 1QH8B 2I8AA 4RQUA 4X93A 5AJZA 4YRBA 4D3DA 2VAMA 3S81A 3I61A 4LCJA 1UC5B 3KQQA 4NBRA 4Z3OA 1L5RA 2VHEA 3M2TA 3HJHA 2HHHB 4IDNA 4UAJA 4RVDA 5IU6A 4UUMA 5KI6A 4JCCA 2ZVPX 5BWMA 4HBGA 3C6KA 2HSZA 1B74A 4MDHA 4NESA 3EZFA 2R5NA 1ODSA 4QXMA 1Z2CA 4DCMA 3CY6A 3QQPA 2BC9A 1I1QB 4IUBS 2EX0A 2W70A 5AVVA 5BYBA 4BRSA 1LPBB 4BGVA 4IZIA 3PLNA 3HY3A 2MHCA 4RV9A 3KPVA 5JSKA 1MJGM 1ZIDA 3DDZX 3PIIA 4EFNA 1DWPA 4J07A 1P4RA 3EQ7A 1K75A 2JEYA 2C1XA 1EDOA 3O9MA 4B2IA 4I1IA 5I7EA 4LZNA 5CAEB 3JAWA 5TMEA 1PUJA 3R3ZA 3SIPA 1R6XA 3FJYA 4HDKA 3DBLB 1OROA 4N54A 4NK5A 4OD0A 1C30B 1E2MA 2VF4X 4BJ1A 1WBBA 1OWLA 1ZN8A 2BBWA 3Q4GA 1QM5A 1UOEA 2QJFA 3E48A 1XA3A 1J8FA 4KXWA 5FI3A 2WJ4A 2QLMA 4YP9A 1EXWA 2P1ZA 2Q62A 3K8OE 2BMVA 1AQNA 2MU1A 4INZA 2NUTA 1I33A 5LYYA 2FLVA 4HWRA 2HPAA 2VT3A 4KBGA 4JC4A 1Z16A 3A2MA 2YZGA 3FYUA 4C20A 1Z4QA 3N8GA 3GK3A 4TT3D 3RIMA 1E2QA 2F4VB 4LYAA 3K1ZA 3SZOA 5KMGA 3DNFA 3EEBA 5IULC 2BV3A 1TA9A 3IBGA 5ALOA 5ANRB 3PJFA 5F7ZA 4B34A 1YFLA 3O3CA 4Q4JB 3TIVA 3V5NA 2FSGA 4P8RA 3W2IA 4D0LB 3T3OA 1GQFA 5F77A 3GEBA 4C0AC 3KUUA 1YZTA 3EHEA 5E2BA 1FDUA 4QJIA 4MUNA 1U94A 1RABA 1VI2A 1U0LA 4GYWA 1OQAA 2FEWB 4EUFA 4R0VA 4WY8A 3EIXA 3RREA 4HYYA 3LSYA 1QHEA 3EAGA 4QHYA 4CL0A 3AUTA 2GFIA 4YNBA 2HEIA 1ZHHA 2PS3A 4AJ1A 3KOYA 1XX6A 5KBYA 4MDFA 2D7DA 1U7HA 2PU5A 3NHSA 1GZ4A 3E5RA 1Z5NA 2G88A 1JLLB 1AG9A 4JX9A 4QRDA 2CL0X 3AHCA 2X0NA 1Z26A 4ABYA 5GIOE 4OB6A 4FEGA 4O4LA 3FYSA 2X9VA 5FPTA 2UVPB 3QI7A 2JH3A 3BIOA 5KOHB 3G5MA 3OZVA 3G6WA 2HMUA 5JCOA 2NWQA 2ZRDA 2EFCB 4YI3A 3HR4A 4ZQHA 4Z4CA 2VBGA 1M1UA 1ZOOA 3VTKA 3X1YA 5ADVA 5CA0F 4TWBA 4I2VA 2V6GA 1NJ2A 3INRA 2H54A 5JTTA 4D43A 4JL6A 4M98A 5CIWA 3L4BA 4MS1A 3WMRA 3LKDA 4A5SA 3NBUA 2J3QA 2R8PA 3RNLA 1F8UA 2A78A 3LUCA 2O06A 4IJUA 3V1TC 1OU4A 1WB6A 2BHNA 1E94E 2GJSA 2JI4A 2ZJ1A 4FI3C 4W5OA 1I3LA 2GEJA 3MC1A 1A9PA 4MV8A 2I8LA 2JJMA 2OAEA 1URPA 2X8AA 2QQEA 4OI4A 1OF1A 3TEJA 4YJ3B 1DXOA 4DTIA 4EO4A 2QWXA 2BDEA 3TSZA 5ICSA 2QXYA 1M0TA 2G70A 2VIIA 3ZY5A 1NDQA 3T9BA 2REQA 3IQGX 4YECA 3WL4A 4EUNA 3MJDA 1DG9A 3TMYA 3ZZUA 3U1BA 2CKMA 3IAM6 4KQIA 1JPVA 4GEGA 4LYEA 4JC8A 5C5EA 2P9TA 2PRJA 4HX2A 1DOAA 5DW0A 4CEJA 5F2EA 4TYWA 1WL8A 2LE0A 4X94A 4DXAA 5BW8A 2Z8YA 1JBEA 1EU1A 5IARA 1YAHA 3ZDBA 3F6SA 3FCCA 2YIMA 4CIWA 1ZUNB 1EAYA 4ZQFA 3TZLA 4JEHA 3F73A 4ON9A 5BOSA 4WK0B 3KETA 5TF4A 5CFZA 1G20A 3RIXA 2G0TA 1GFWA 2BH9A 2V54A 1PJTA 3HCAA 3E4DA 3L8FA 3QVLA 4NI5A 5CM2Z 1DTEA 3HYLA 5IJAA 2J6IA 3NTXA 2F59A 5FQOA 3D7MA 3LWZA 4OQQA 5IJXA 3OF3A 3UFBA 1NBEA 1QV7A 3BRWA 1J0EA 4FFWA 5T67A 1V3QE 1X2BA 3LL7A 5GOZA 3VPSA 4MWDA 4BFLA 1B0AA 2R7AA 1W88A 1AN0A 4P4SA 4R31A 4CM9D 1SCAA 3FPAA 2QZPA 4FTWA 3MQ4A 4MRSA 5IKXA 5HKKD 1GNTA 5LJLA 4RJ2A 5JR3A 1D9ZA 1CJBA 1W8DA 1WHSB 3O9VA 3RBVA 4ZT2A 1IJBA 3BK1A 3FOAA 3HL0A 5AK4A 1PBNA 2DMRA 1UXJA 1YL5A 2GEDA 2O1SA 3AUYA 4RSHA 5IXYA 4U39A 3L6EA 3DL2A 1DDGA 3TLMA 4UBJA 3V4OA 3V9PA 2D2IA 1Z8NA 2F4NA 2YMQA 4EFLA 4F72A 1QP0A 2DR2A 1IY1A 1AY0A 2NACA 1WZNA 4WINA 3L0DA 2NU6B 3UK7A 3VR5H 3BRCA 4J0HA 4TLDA 2C4TA 1RZUA 2J7PD 1X7YB 2OXRA 1EQAA 4RD2A 4B2PA 1TCVA 5C8XA 3R8FA 4M0KA 1RRFA 4K5QA 2DTDA 4DBZA 3QVGB 1KJQA 2R68A 1QFMA 2L69A 1MRZA 3BK7A 4ZYTA 2IHNA 1MCZA 1WF6A 3KWFA 4FHZA 2YR0A 3AL0C 2C3UA 2E4YA 3B8EA 3GGOA 3LQYA 3MTQA 4MS3B 2OHHA 3RTGA 3TUJC 4OLBA 4MJ3A 3I9MA 4Q4HA 1WW2A 3FWPA 5E8RA 3BZBA 1BW9B 1HNNA 1MP0A 2JBAA 3DE2X 2DWQA 3IXMA 3H2HA 1F9AA 4EYOA 4OYHA 3IBFA 1BVRA 5HUHA 3OIGA 2GCOA 3MOGA 3GCDA 4L3OA 2JD0A 1N33B 2WM2A 3HZRA 5CM9C 1V47A 4R8MA 3MWGA 4PLFA 3H2BA 2HRZA 4M1SA 5DZSA 2IE0A 1GFSA 1XALA 2A9VA 2ODTX 4LYDA 3UTCA 2Q6IA 1Z35A 3D3WB 3BTOA 3T5CA 4BMSA 3DE4X 1P45A 3LLVA 3AF5A 4G1EB 1E79A 1WLYA 4OHVA 4O4IF 1LLQA 5BMVB 1N2JA 5GZ1A 1DP4A 4UPDA 1E0JA 1WSDA 4S1TA 4K9MA 2C1EA 2I6FA 1VM6A 3G1UA 2OFWA 3HN6A 4NU8X 5F33A 3WS7A 3PJGA 3LY8A 3UQZA 2F55A 2XT9A 2C7QA 4DCJA 1Q16A 3WRXA 4HO1X 2QGNA 3NHZA 4WOCA 1FW6A 2BFMA 4KI0A 3QHPA 5F2OA 1VB3A 3L43A 4PSAA 1MTOA 1T3LA 2Y93A 4MI1A 4B6SA 3T99A 4DREA 2AOTA 3OC0A 3D2LA 1AXEA 5KQPA 3UGJA 3WNQA 4E1AA 4RIHA 4OX9B 5LP1A 5CDFA 1R66A 1ZI8A 5T4HA 5DX1A 2Z9CA 3HLKA 2CHUA 3MA0A 1GN9A 4J0DA 1E4VA 1NI4B 1R8QA 1M6EX 1ZX1A 1QORA 3DWGA 4MULA 3QY9A 2WP8J 4QGGA 1ZY2A 4X3OA 2X41A 4XM2A 2SCUA 1O94D 4ZD6A 4G0QA 1JDVA 2XI4A 2HN9A 3H1BA 4B6EA 3BWCA 3SXUB 3TLBA 4ZI7B 4MPTA 3RTEA 4HWSA 4UEOA 3SZGA 1E8MA 1Q2XA 2QAJA 4GMKA 4XB6B 5K0SA 2GD2A 3SC6A 2PXCA 4HMQA 3O6VA 5A62A 2YYAA 4QYTA 1RWNA 2CMDA 4FYYA 4F97A 2JJ1D 4WN9B 1S0UA 5HE9A 4DM3A 1JS1X 1T2DA 4PZDA 1I3NA 3D8TA 3EFBA 3RQIA 3F4BA 2WICA 2AC4A 1CULC 2VPYA 1WF3A 1B76A 4B6RA 2I87A 2WY2D 2YJ5A 4ZODA 3CNNA 3ZYZA 4O4LF 3VSBA 3ZCRA 4X66B 2JLZA 1FS6A 1TEHA 1SCQA 2HWKA 1TCUA 1EBBA 5BUCA 1XCLA 2GA9A 1ECPA 3O4IA 4MHOA 4WL0A 3UMJA 2VTBA 1PUXA 1LW6E 2WD9A 3NV9A 3ONNA 4RORA 3IL2A 2VR1A 2WWYA 1JLRA 2GYWA 2HQ1A 3GEMA 3JWEA 5EZYF 3JASB 3ZHUA 5ALKA 4L08A 2PBLA 3IKMB 1XZMA 5WRFA 4D9MA 4YUVA 4ER5A 2PZBA 1IOZA 1Y3HA 1V5EA 4M7RA 1KERA 1NPTO 2O2DA 3ZBTA 4WFKA 5LBTA 3RWMB 3WHLA 2LCFA 4J7XA 5CH3A 1G8AA 2KB0A 3AUJB 3T0FA 4GR9A 3BBPA 2AZTA 4EUEA 1WXFA 3DZCA 1EZZA 4DJFC 1UAAA 3MJCA 3R5KA 3R24A 1CQIA 2XWQA 3I73A 4RPJA 3K70D 1K4KA 1RJFA 2G5TA 3MINB 3U7EB 3ZH2A 4WNAB 8MHTA 4C04A 3HFGA 4C43A 1V5WA 3GPIA 1RP1A 1T5HX 1TZCA 3MPOA 4KR6A 4JEMA 5FTKA 2GO7A 4GVPA 4BMVA 2Y0DA 2IFTA 3STUA 1UBKS 5LOVB 4BVJA 2WZDA 4GF5A 1GG9A 1F4VA 2C5GA 3ESXA 4W8HA 1YCDA 2BFPA 1JKXA 1CDDA 3BXHA 3JD2A 3VOAA 4HVCA 1JIVA 3FN4A 3OO0A 3QUBA 1C9EA 2GZSA 2WI8A 3TECE 3AVVA 1E5XA 5L9AA 1KJYA 1N6PA 1PLKA 5J9FA 3M4YA 3TX2A 2CNLA 2E55A 4YO8A 3IP3A 5I7OA 1MJ5A 4NJEB 3EQ8A 4OO3A 4KTTE 1DEOA 4DQUA 3ZV4A 1U0RA 2VF2A 3GLIE 3GCXA 2Z09A 3A26A 1UMKA 1UT6A 4CUJA 4UBNA 4KR3A 4QOSA 4RKQA 5KYVA 3ZVNA 1KIFA 3E22A 5DNWA 1JKJB 3DDSA 3FTQA 4GRAA 4KOEC 1U5AA 2ZXUA 3W04A 1XZHA 5IHPA 1DIHA 1G3IA 1JG7A 1UJ4A 3G68A 5KYKA 2PV7A 1P2SA 2A58A 3Q7QA 4FE4A 2BMEA 5FTNA 1NY6A 1XWWA 2VZ0A 2JIRA 3KLPX 3C6BA 3TW0A 3IDZA 2Q3DA 1YRYE 1EEHA 1K6MA 2G5PA 3GGGA 4IDHA 1R9NA 2JAWA 2D5LA 3L5KA 3MILA 5CLGA 3FSGD 1MIHA 5EZQA 3TM5A 3ED1A 3ZEAA 1CQZA 2KBEA 3JALA 3KXDA 4R41A 1GQQA 2WA1A 4N6GA 2C4UA 3MCTA 5LKRA 3GLFE 1SGWA 1QGYA 3E2MA 4U7TB 2FPIB 3U44B 3WDMA 3GDHA 2C61A 2KHZA 4X20A 4A15A 3T9FA 3FPSA 1Z8FA 2E1RA 3ZVLA 2J08A 4KRYA 3OZGA 3IJEB 1PX0A 4BZPA 1A82A 2XKBA 1OJLA 3FSRA 4ID3A 3DF7A 1UMCB 2GARA 3UK6A 3GDWA 4DCTA 5IK2A 5CB8A 3DE6X 4E2WA 3CVOA 1C1YA 2QRJA 2OV1A 5FT9A 4TZ6A 3EC1A 4F84A 3NH6A 3LL4A 3JW8A 1CQWA 1E58A 1KNQA 1O2DA 4HFMA 3KSBC 3P9KA 3FBGA 2OD2A 1NZFA 2HBRA 2VQ6A 4Q93A 4F5DA 4L76A 5ESDA 3QPWA 1DAKA 3EAQA 4UNSA 3KVNA 4Y2SA 1GKLA 3IDOA 3ZE2B 4DQKA 1SXIA 1H4VB 3QW2A 3USES 1WXIA 4KNVA 1A5AB 1XF9A 3EG9A 3PFBA 1J00A 4I8IA 4TSFA 5GJWC 3ZQ6A 3N2YA 2BFBA 3WFJA 1AKUA 1X74A 1HMYA 1VCIA 5EWJA 3TZCA 4CQNA 3WP0A 5K0TA 4X7RA 3IUYA 4Q9LA 5F4ZA 3D4OA 2GK3A 3OQVA 1TO1E 4G8DA 4N7BA 3RUIA 3PKJA 2KYRA 1RJDA 4JIGA 4F7WA 3HA7A 2CF5A 2OHGA 4N48A 3HEAA 2QX4A 5KNBD 3TWOA 3I0ZA 1ZG3A 4N7JA 1OGJA 5KWIA 1EFAA 2QP4A 3S8YA 1XMIA 5FF9A 1WOMA 1DTWA 2H8GA 2YN0A 3QMWA 4Y3UA 5FUQA 3GDFA 4EEZA 4UZSA 3EW7A 2MYPA 4ARUA 2YWCA 2W0SA 3PI7A 3CIFA 4EUKA 1J8MF 1CRWG 4A2PA 4EA6A 1J33A 3EHDA 1E1NA 5CGZA 2YFQA 4ARZB 1JF8A 1FEZA 3K05A 4MW7A 4GZLA 2B4AA 3LUPA 5H83A 3KSMA 4E33A 2ID4A 2WTMA 3EWAA 4NEQA 1VCNA 3R5TA 4TV8A 1KEWA 1MABA 4X95A 3SYKA 1DX9A 5KYYA 3OZTA 3ZCVA 2DHQA 1FFHA 4BBJA 4FB5A 4TXMA 2JW5A 2PSSA 1DO8A 1VLQA 5CXSA 2B98A 4OXKA 2VH1A 3LT5A 2WZBA 5I9TA 2F1KA 3G7SA 1NRWA 3RTDA 3KDAA 1SVIA 1NT4A 1QIHA 3HWSA 3QOXA 3DR3A 2P40A 4LC0A 2H4JA 4BAZA 1T8RA 5C3MA 3KLMX 4RGYA 5I7SA 5L3VA 2NT4A 2EEPA 4IIUA 3C7KA 3FTNA 3SZLA 1GARA 3IO3A 1W6RA 5K0FA 1W8IA 3FLAA 2NN3C 5KU7A 4RC9A 3ZDZB 2VS1A 3NALA 4OP2A 3BSFA 4I50F 4IDAA 4PAGA 2VHQA 3RUDA 1GCAA 1OILA 2X8JA 1A1VA 3ETDA 5A2GA 2D00A 1AB5A 1LDEA 2ZR8A 1YR3A 3DAYA 3DKVA 2NPIA 5EHZA 5SY9A 3HP1A 5F3WB 2PFGA 5EHIA 1DCMA 5G0VA 5B53A 1L2TA 5EGNA 2OB2A 4P31A 3RUEA 3SKXA 3AFMA 1DJQA 2HL6A 1SELA 2I4IA 3F6PA 1DINA 3MGKA 3QWAA 5C1IA 1U0NA 3W4KA 5BR4A 1AVTA 2WTEA 3QOWA 4KQFA 3X44A 5FA8A 3AL2A 3C1TA 3JWJA 5CHEA 4R98A 2IHZA 2BF7A 5JCJA 2UUOA 3EA0A 4AJ4A 2V8OA 4EY3A 4BAUA 3ZLBA 2I34A 2GPTA 1ZVQA 1DV1A 5IZCC 4QIHA 4EGAA 3VR4A 3WK4A 4GOKA 2C8LA 3HXPA 5B30A 1XNHA 4HQ0A 5BSMA 3L1KA 3NLLA 1PD0A 4A6PA 2RG7A 1ESCA 1LJ8A 3L06A 2IY7A 2IS4A 2D2FA 2XBMA 1FU4A 4IX1A 1WMEA 3LO8A 4A0GA 5TT0A 2PH5A 5D00A 1OXTA 4TM8A 1KQ3A 3UUWA 4C3UA 2H4YA 3T1VA 1JEYA 2CK3A 3ANXA 3F67A 2BFEB 1UDAA 1Z0JA 3U3XA 1RC8A 2DB3A 2LZ0A 2CFTA 4R2IA 1F1BA 1N4DA 4UTZA 1CP3A 7ADHA 1S2DA 1YMVA 2HUNA 4NQRA 2C2WA 3M5DA 2VPPA 3ABOB 1SQ5A 2EKLA 4HRXA 2X0EA 3ZGXA 2GA8A 1QIJA 2A0UA 5B1EA 5IMSA 5I9NA 5E6UB 4HXEB 1YU6A 3MTAA 2Z58A 1G17A 2FQXA 1JA0A 2A92A 5ALDA 1NXQA 4XJTA 5CPBA 2IHJA 3W5VA 2GN6A 5JZVA 3VU3A 3H18A 5KTKA 2YJNA 3KQTA 4P93A 5L7TA 2EHJA 2WJJA 2XQVA 3NDRA 4N1AA 5DTQA 1ZM2A 5KHAA 3TOSA 3H4VA 2VJNA 2DQKA 1KMCA 1H1TA 1OLOA 1YS4A 3UJNA 1C0LA 2IYSA 2WJ6A 1AHIA 4HADA 3EUEA 3KEQA 4J3JA 3HACA 4AWXA 5JNUA 4MW1A 1CQJA 2ECKA 3D5TA 1B8OA 2NX2A 1JHUA 1L4EA 3NCHA 5IP5A 2D13A 4JAVC 1BDHA 3JVEA 4UTXA 3TL2A 4QM6A 3NM4A 3SU8A 4W9NA 1JR6A 3FMOB 4MKFA 4DF3A 3V46A 1IZ7A 3LRPA 2NU7B 3RKSA 3W2FA 1HDEA 1RM3A 1HRDA 2R86A 3DZFA 3G8AA 4LXQA 5EMLA 2JCSA 4Y0AA 1GD1O 2FK7A 4A91A 4EMSA 4ACBA 2X1LA 4LXHA 4C05A 4S05A 1YXMA 1LVGA 5KUTA 1N6KA 1G59A 5CYPA 1VRWA 4NZPA 4EVQA 4WCFC 4JR1A 3V4VB 2I91A 2Y99A 3NDBB 1HRKA 2VP4A 4QLAA 3W4JA 1GNSA 1N5DA 2M6SA 3DVQX 1YDGA 2X9GA 4FEAA 2WP0A 4MP8A 3P4YA 2DBRA 4IOMA 4ND4A 4DAEA 4DLSA 2I3GA 4BVLA 5C32A 4W5RA 2OP1A 3NIDB 4EELA 4M60A 1WOYA 1Y1RA 2ZYSA 5TB5A 3L92A 5JS2A 2H17A 1H5NA 3QG1A 3QIVA 3K9NA 3OLCX 2ZTSA 1CF9A 1ZUHA 3D7NA 4DUYB 2FSVA 3RBXA 2AGVA 3I9KA 3R3JA 1UPBA 3KZMA 4W7IA 1ZH4A 1G64A 4UUOA 3SQDA 3DBIA 2VP0A 3PNKA 1FXUA 2F1HA 2B30A 2QTLA 1XQVA 2GPAA 1GU7A 4L8LA 5DISB 3V4LA 4UATA 3CWCA 3ETNA 4BZZA 3HGQA 3I12A 4ZVVA 3HFJA 3W3AA 2HO5A 4ZT7A 3OM0A 3CJTA 1QO7A 3Q9SA 4KRFA 3ZXXA 1MC5A 3NEPX 1U5BB 2O0MA 5THXA 5BR8B 2JBHA 3VKUA 3FR7A 2JASA 3DE7X 1ESDA 3PUJA 3BWXA 3VKFA 1M0WA 5E9AA 3ZE6A 2P9YA 1Z75A 2HDHA 4LRUA 1Q7TA 4X24A 2W5UA 4X1OA 4BZXA 4EL5A 5LZ2A 1YCFA 4RZ2A 4YFVA 3TQRA 4EG7A 5CAEA 5EC8A 2OHVA 1TL7C 1VE1A 1O89A 1UFOA 2HSGA 1TEXA 3DBLA 3IVGA 2QPTA 1S4MA 1C30A 4HQNA 1L0BA 4NBSA 5ER9A 4D44A 2FMTA 1V1MB 2AMYA 1P1BA 1T0BA 2YFYA 2WHEA 3E1GA 4FT4A 4RFLA 4BKQA 5KYWB 1QWSA 4LY3A 2XB6A 1OMOA 4KRXA 2D3WA 4I4TF 4LBZA 6GPBA 4HXYA 2JPDA 3CR7A 3MVEA 1Y89A 3GT7A 1XN1A 2ZTLA 3BWYA 5DCYA 1M8FA 1Z2OX 2Y1OA 1H23A 4JI8B 2P8SA 4Q1VA 2FSPA 2FPMA 2VDPB 1YR8A 4TV8F 5AVZA 4ES6A 2NUPB 5I7AA 4Z7JA 3UHJA 4IINA 1DWOA 1PYOA 3R9WA 1GHTA 2Y1WA 3IT0A 4R2LA 4TV9F 3KG2A 3IP6A 3MTJA 4Q4JA 3PJDA 3ZE9A 3HVKA 1S2GA 4W6QA 2AR9A 4C6SA 3B6KA 4CMAA 1CYDA 5ECYA 1FB5A 3PUVA 1JX6A 1K2VN 3H5RA 4NTZA 3M6UA 2PMKA 4DNPA 2BZ1A 1A4IA 4UASA 1ZR2A 2RGAA 2RJ3A 1HLPA 1Y6QA 2XCOA 1XEWY 1O58A 1W0KA 1VLLA 4ZWNA 3UMVA 1NMSA 3UAVA 4MUFA 5C5DA 1ULTA 2PVSA 3R5HA 4KODA 5I51A 1TAUA 2XV1A 2DTXA 4O1IA 1LFDB 4XB1A 3PR2B 1JLLA 1X38A 1AK1A 2GVZC 3FIUA 3FOWA 1A9TA 2QTVB 2C83A 4I8DA 1W4CA 4RULA 3IUBA 2G3YA 3O9ZA 3HBFA 4HAIA 5DHRA 4PN7A 1MR3F 1W5TA 2UVPA 5KOHA 1U65A 4WASA 4XWOA 1RQGA 2W6JA 2Y0PA 3L0IB 4BDTA 1YHNA 3BDVA 3R6WA 4DV2B 3H04A 1TF7A 3K9BA 3B1JA 1LPMA 3K4HA 1DEAA 5TR9A 4YH1A 2PD4A 1W19A 1B16A 3I58A 4NDAA 5BYKA 4YRAA 2NVUB 4TPKA 1JFRA 2V9CA 1KBQA 2JAQA 1XRMA 1XKTA 4R8SA 2C2ZA 2GZ1A 5A6VA 5KHLB 2HREA 4LGYA 3QJ5A 5EG5A 4I1PA 2OXEA 3KKZA 4J3NA 4FLFA 4P0PB 4Z1MA 1USWA 2L18A 1E18A 3GP8A 1TADA 1K6IA 1VMEA 3KM0A 3PR1A 4HGZA 4OL9A 3O8CA 1SIOA 4PTZA 5JZMA 2YFHA 1IEXA 3GLQA 3LWDA 5CUQA 2OGSA 3SSOA 4XAQA 2M1XA 2XW6A 3WLIA 1T3SA 4NMMA 4YJ3A 1UDXA 3UAOA 5C2JB 5DX0A 4DC0A 1L1EA 1OHHA 2AN4A 1MA3A 2Q2VA 2P27A 3KKQA 2WG2A 5TVKA 4FFBB 4ZTUB 4LOJA 3TKLA 1N32B 1IY8A 2G17A 1ES9A 3LIIA 3KEMA 4HH4A 4IOLA 1IATA 4K9DA 1L5KA 3MT8A 4L22A 3HDJA 2YL2A 4JDUA 1L5MA 2I66A 1WVMA 1EDDA 3HP4A 1ZUD1 4H6XA 2P78A 1TD9A 3RK1A 2DBYA 4JR2A 3WLFA 2CVHA 3KQOA 4B6GA 1X9GA 4IXMA 1JXMA 3UOAB 5CDFE 1YV9A 2X8BA 3SXJA 2EBFX 3DOFA 4OHOA 2WKSA 1RWWA 1ZUNA 3BGVA 3O74A 4ML3A 4U9UA 3TGWA 1CRLA 1DO0A 1QHNA 4OQPA 1FFEA 1GTVA 1TDJA 3W2GA 4L5YA 2QPOA 4EJFA 4B7ZA 4BEBA 3AM1A 2VNSA 5COAA 5CVCA 4YP0A 4ZQEA 4CKCB 3Q3HA 1ZHFA 3P94A 1TMGE 1ZO8A 1EMDA 3H9GA 4QUKA 3CLUC 3ZWYA 5CCDA 2P3SA 5HQJA 1VJCA 3DWFA 2YRWA 3NPAA 4N3AA 1YMQA 1WP4A 4OF4A 4NRDA 3P26A 4HVAA 3WHPA 1CDOA 4PY2A 5JQWA 2E5LB 4BO2A 1ADJA 1A9XB 5ADHA 4P34A 4AJJA 3U7JA 1LK7A 1QYVA 1VIMA 1TVMA 3KUXA 1G5RA 5IBPA 2W37A 4CT5A 5I7HA 1T4GA 5E9JA 2SBTA 1VCHA 1ZKMA 2IPLA 2RHDA 4V0MA 3AV3A 3QM1A 4BO9A 5AVXA 2G5GX 1WHSA 3JRWA 3L8EA 2ZBDA 2ATEA 3AJ9A 2J9RA 2QAGB 3LQ4A 4HGNA 1EFTA 4QUAA 4DDVA 1UR5A 3AETB 4LECA 4H16A 4IZ6A 2CSXA 2ID9A 2IEIA 5KVQA 4X62B 1RWBA 2DKOA 3AZPA 2NU6A 3E7XA 1RR6A 1VMAA 3LHFA 3LYLA 1X7YA 4XYEA 4K7JA 4LGCA 2YHIB 3I1FA 3K8ZA 4OYYA 2KSQA 2WIGA 4TXLA 4AW9A 1QK5A 3E9YA 4LS3A 4ZRMA 1NQAO 2PH1A 3QVGA 2XXAA 3KR9A 4A0RA 1SEPA 1E4OA 2ZT8A 3AU9A 2AF3C 2CHEA 5AYVA 4MS3A 3WLNA 1KC1A 1M1ZA 1SU4A 4BAGA 5FCDA 2YV4A 2NO5A 4B31A 4TTQA 1AMUA 3DOOA 3G8DA 1BW9A 1USVA 1YNOA 2OWEA 3PFIA 3PRHA 4BX8A 2M9MA 1DARA 2GYYA 2O2XA 2B8JA 2LP4Y 3TTWA 2P5SA 1CRZA 2X14A 2C8KA 2ZI3A 2DSTA 2PUHA 3VVCA 1SBIA 1NVKA 1X70A 3E9CA 5KSYA 1ZMTA 2PGXA 1W52X 3T9DA 3D3WA 3SX4A 4BN0A 5CVJA 3WLLA 1TM1E 5NLLA 2YJTD 3DOJA 3KSRA 3GLVA 4IWXA 1N3IA 4G0OA 4AF7A 3VQTA 1XWIA 3VNVA 5BMVA 4KREA 4OBEA 4C0BA 1P39A 5A5GA 1BJKA 2REBA 2OSVA 1O6ZA 1SCBA 1T0UA 3VMFA 3OIWA 2ZRAA 1Z28A 1ND5A 4FWTA 4G0WA 3FSJX 5J5VA 2NUBA 4K81B 4H2DA 2O3RA 1P0QA 5J47A 2HA3A 4ENRA 2OLJA 4R2KA 5ALEA 3ZQKA 4WV3A 3WRXC 2V0GA 3ZS9A 3ZWOA 2V4ZA 4B3SB 5CFOA 1RRPA 4MJ7A 5LQCA 3DC7A 6ABPA 1WKVA 3V7WA 3N2GB 4QDOA 2FN9A 5EQTA 2PAAA 3OWOA 1O95D 4DDMA 4QXAA 4OM7A 4TQGA 4AI6A 3UJAA 2LD4A 1Y9AA 2HLHA 2IDZA 3B70A 3AKCA 3IT3A 5C1OA 3HSKA 1NI4A 3IHWA 4O0MA 2GK6A 2PFKA 1IZ0A 1IH8A 2O7SA 2QP3A 2CMFA 2XRYA 1T2VA 4I55F 3PTZA 1RLUA 1IK4A 2SECE 4GP6A 4BS9A 4I3FA 3D3QA 3SXUA 4CDGA 2MCFA 2BTOA 2XMRA 2Y0EA 2FFJA 4ZI7A 1BDJA 2B20A 2BGMA 1C8VB 2X4GA 4OJKA 3ZGYA 1MRSA 4CMKA 4DSTA 5ITZB 2C07A 1N1MA 4MGYR 4CLDA 5HKOA 1WPXA 5H59A 3G3EA 1L5HB 4QM7A 5A4KA 5B57C 3U1TA 7GPBA 1N9GB 4WN9A 4YBZA 3P19A 3JQBA 4GG1A 4HS4A 4UXJA 2WE7A 1WVGA 5FPPA 4B3BA 4DVGA 2QV7A 1PV1A 1HTWA 5SZJA 5FV7A 2FK8A 2EF1A 3SVZA 3TS1A 4MVJD 1ETUA 1FL9A 2JAUA 3I4FA 1V16B 4AS3A 1FMCA 4QJ4A 3AI7A 3PC7A 1AQIA 1IBKB 3QV1A 1VDZA 4P5PA 4D8YA 4C0QC 4PG8A 4GOXA 3ZWVA 2IEGA 3O7WA 5DXJA 1DMRA 6NULA 1KRXA 3DL4A 1D2EA 1TOAA 4C1NA 5JFOA 2B69A 2JZOA 1XC7A 4ETNA 3QKSB 4ZGBA 3E7DA 1DT3A 3E8SA 2D0PB 3OIYA 4DEVA 3ZLVA 4DM4A 1W73A 2L42A 3RS9A 4OGGA 3HXQA 2C00A 4B2YA 1WMAA 1CUUA 1PL6A 3EVBA 3HQ4O 3HUDA 5K1ZA 4X64B 2N75A 5HPYB 1L7XA 1H0RA 4A3SA 2O1EA 3K2EA 4NG4A 3BULA 1U11A 1N6OA 3GUVA 4IFBA 4EKDA 3A14A 1ECJA 2HXSA 4JBGA 3VISA 1AZLA 1USGA 3V2IA 4N39A 2BIFA 1ONSA 2BKUA 3TN7A 1RMTA 1PQYA 4FGUA 1N9KA 1D1QA 4EPTA 4QOFA 4ANFA 3VTZA 2O52A 3QEAZ 4YALA 3N9IA 3MINA 4LX8A 2GM4A 5LQRA 3B6EA 1QYRA 4WNAA 4XA8A 4HDNB 1MEOA 4E09A 3OM9A 5EKDA 1MNAA 2OVFA 4MP3A 1ATZA 1NATA 2GN4A 2IIQA 5DLEA 3RJTA 5B55A 5LOVA 5KYNA 4GPTA 3M6VA 2IYZA 3JTEA 2HRBA 2SKEA 3PBKA 1H6CA 3G13A 1E4EB 3OCCA 4NATA 2AR0A 2YXNA 4OY3A 5EKUA 1QBGA 1TCBA 5REQB 2XUPA 5JNSA 3GHYA 5I8WA 4YMVA 2O3JA 4JI2B 2EJTA 2YRFA 3Q72A 4LSMA 5D6OA 1R0YA 3ZDRA 5BSWA 3GJQA 2C3YA 1WPQA 3OP1A 5L6MB 2FEMA 4NJEA 1PJQA 5JMWA 1WTAA 3QVXA 1OW3B 3Q15C 1U2SA 5DLPA 1SPXA 4UMFA 2RIRA 2OFFA 5AKXA 4CI0B 2C7VA 4B6OA 1W1IA 1L7DA 1QOZA 3AZOA 5ALMA 2VJCA 3UANA 4YPVA 2H1RA 2PMDA 3OAAA 3FW1A 3PC3A 4FR0A 4ZAWA 3SZ3A 2OK7A 1U1EA 3R76A 5YASA 4INAA 3C3XA 3UMCA 3I34X 4WKOA 1YULA 3S8EA 4HJRA 2HA5A 2IDJA 1JHZA 1VL6A 2VPWA 4NFHA 4US0R 2DP4E 3KE9A 5JRDS 1FJXA 4XVQA 2COEA 3B3JA 2HM7A 2V65A 4MIEA 1TLTA 5HIAA 3DFZA 3ZDXB 2IPNA 3QTLA 1R50A 2XB4A 4R83A 3A6PC 3A9WA 3EWNA 2ZQZA 3PC4A 3S68A 5B12A 1N77A 1HLFA 5EQFA 1D3AA 2IU6A 5LN1A 4FHDA 1F3LA 2A7XA 3BL6A 4GL4A 4I5EA 1JSXA 1A72A 3BRQA 1GZVA 4MX8A 3CUWA 4MZDA 3ZE7A 2Q3FA 1L7VC 2YXBA 5LZ9A 4I99A 4D96A 3H1FA 4RVGA 1C0KA 2BISA 2FPIA 1GKUB 3IPRA 3U44A 2NW6A 2QPAA 2P6OA 3DHNA 5EP4A 4U1RA 4ZI5A 3JZMA 5J5CA 4ZYUA 4C7VA 4DILA 1HE2A 2QLFA 4JQCA 2M1ZA 3ZE1B 4QVGA 3G9ZA 1GR1A 5TNXA 3EIWA 2C2YA 3T3GA 1UMCA 4DCSA 5IJ9A 5C52B 2B35A 1CF4A 1ONNA 3PYLA 3O82A 2YVLA 3B1FA 4U63A 4O1HA 5TX7A 2DU8A 2FF7A 3OM1A 2SICE 4U7GA 4QVIA 4MWTA 4N0DA 2Q0QA 1DJPA 2B2CA 2QN9A 4LCBA 1MT0A 4MIKA 4QYWA 2DR3A 1B0UA 3JYHA 3P5BA 3QH4A 3SEQA 1HNXB 5BSKA 3LXXA 5JD5A 3UMMA 3I9LA 2V5AA 3BE6A 1GGVA 1WDTA 4QA9A 2QD1A 4RESA 4WEOA 1XNGA 2R8YA 2F3RA 2DM6A 4RLSA 5CTJA 2INGX 2IYEA 3JSXA 4MCHA 2QNRA 1E1YA 3SOPA 1I3CA 3OFND 1UDBA 1KIMA 1N3BA 2JRCA 4NECA 4YUAA 5BMVF 2YFKA 3UUFA 4D8WA 1DCKA 2H29A 3C8ZA 2NGRA 4K2HA 5DBHX 5EFOA 1TO2E 3IEPA 2QT0A 1QO9A 1DBVO 2ZI7A 3O47A 4R40A 3SDBA 2NMVA 4GXQA 3PWKA 4JNKA 1WZ2A 1QF6A 2P9QA 2CLLB 1GGKA 1TPYA 3WKBA 3PDCA 4WK6A 4G2NA 3ELBA 4RDCA 4CM7A 2GZDA 2CYAA 1H1LA 3FZQA 2AI2A 4OI0A 1UK6A 4CMEA 1Y3IA 1V9SA 1BD4A 4ITRC 1DAHA 1Z0KA 2OGZA 4R81A 1JU9A 1CB0A 2BEJA 3VRHA 1SUBA 1IC6A 2V7BA 1KP9A 2QQGA 3JD3A 3NWEA 4P81A 6REQB 5THKA 3HDQA 3OLVA 3ZHXA 4Z54A 1SXJA 5IWCA 4ABTA 3H8WA 4JQOA 2BI8A 4XUDA 3ME5A 4URZR 3ZC3A 1BH6A 5GQSA 5ESRA 3CH5A 2F1JA 2GPWA 2CNBA 3BFKA 2YHSA 1FF9A 3C6MA 3DEYX 2GVNA 2OC9A 1XJQA 3AFNA 1NY5A 3EW9A 1A95A 3OESA 4PHFA 3D1JA 4ARZA 1AGYA 2OCXA 4EGJA 1POXA 3DDCA 3KHTA 4DN6A 4IDEA 4UMVA 3G2QA 1FP6A 4NEHB 4AVYA 4LXUA 2GCEA 4OIFA 3PHJA 5T6BA 4MNTA 4JOCA 3G2MA 2VJAA 3AH8A 2KBFA 5KKAA 5AKLA 4P35A 3SKYA 1UP6A 1UQTA 4GKAA 5HMLA 3CEHA 3NJ8A 1EFPB 4QXPA 4CLRB 4QG7A 3PEYA 3KR1A 1KORA 5DGIA 3RJMA 3X1JA 5CFQA 1XJ0A 2GUGA 2AMJA 2H9IA 2VTDA 4OU5A 3TX6A 2X3FA 3WGHA 4C0XA 5CURA 3CVJA 3IMFA 2XDAA 1OXSC 2IYRA 3H8VA 4IZOA 4BVKA 1IJEA 2PXXA 1ARZA 3J7TA 3O8NA 5BORA 4MW4A 1CWUA 4LNUB 3NHAA 2ZYAA 2EKDA 1NNUA 3WRVA 2FJPA 3IMCA 4Q00A 5CB4B 5JHGB 2VPZA 1MO3A 4U8HA 3H1PA 3HO6A 2WEKA 3CZQA 3IA2A 4M8KA 3RSGA 1W85B 2WT8A 2BKXA 3DJFA 4Q3CA 3VBEA 2GXUA 4PCVA 4XRGA 3VTFA 3S1SA 1O0CA 3FHLA 1ZJ4A 4L50A 3ZU5A 2X0DA 4JYPA 4N7RA 4Q3OA 3RASA 4J49A 5IJWA 1NP7A 4J6EA 4DLXA 1PL0A 2FPXA 4XSGA 3L82B 4YROA 3GW8A 1LQ2A 2N9UA 4QOHA 3GARA 1QHHB 3VR1A 3P9NA 5EJ8A 4IIJB 4R2WA 1GGMA 2O5VA 2QMEA 4PC1A 2DERA 2ZAGA 3DEKA 1KU6A 2QTBA 2BGIA 4JBXA 3QSGA 3K9HA 2P77A 2V7UA 3DLTA 3OIVA 4BB5A 2PKQO 1XQXA 2GWRA 2HKIA 3F6EX 1DIOB 5IC4A 1M2OB 3F96A 3WYNA 4EYSA 1KFJB 4J1TA 2WWFA 2QVYX 4H7JA 4H1WA 2AEJA 2KWIA 4BATA 1EPUA 3JU3A 4C89A 2C2GA 2WMDA 3J7AC 2EGGA 1FUKA 3TCKA 1DEKA 1MDFA 2JAXA 2ZS7A 3B3AA 2Q6VA 2JLAA 5HZMA 2AN5A 3OZ7A 4J0FA 4YP1A 2BFEA 4MVXA 5TIIA 5IVKA 3ZWNA 4UM8B 4YK7A 4PPFA 5EJ4A 2AEMA 2OCDA 1OC4A 2EZUA 3ESCA 3KL2A 4G36A 3C14C 3D0RA 4GOJA 5EPUA 1IVYA 3IQHX 3JZFA 7YASA 3TGPA 5GIPE 2BYTA 3SVTA 1XAGA 5KREA 2J3DA 4JLOA 3OTOB 1T6ZA 5EZSA 1YIDA 3LDUA 4TYNA 5E6UA 1M66A 4NMHA 1H94A 4PGFA 3DE0X 3LBYA 2FMHA 2XNDD 3O21A 3CLTD 4FEYA 1Q15A 2XGSA 5TPZD 4WXMA 4ZOBA 2ZJAA 1IN5A 4JLJA 3ZU6A 4DWWA 1QHXA 4MAMA 4FGWA 4WA7A 1NNSA 1JIKA 2IYQA 4P32A 4M8NE 4TTPA 1JU4A 4NOMA 1Q1QA 6LDHA 3O94A 1SOWA 2H18A 3ENZA 3JQ7B 4YCCA 2GZMA 1NVGA 4FDUA 5EJ7A 2G9RA 4IO1A 1JDUA 1KJJA 2XUKA 2ZE5A 4IGFA 1CY6A 2O2GA 1F12A 1G8KA 4AMVA 3L7YA 4PF1A 4LSZA 3WLPA 3RS7A 1YL6A 1KZGB 1NZDA 4KUHA 1J0XO 3SJBA 1BWRA 2AZMA 1EWRA 4NMXB 3BCSA 2QLTA 4DAOA 1YR6A 5FOXA 4FU0A 4DR3B 3KSUA 5GV8A 1SB8A 2NU7A 3VYSB 2WSSD 1TZJA 3DCIA 4M7WA 2G0NA 4BBZA 4C7JA 3OFSA 3BB3A 1I6KA 2ZRKA 4JLNA 1CE8B 3W3ZB 4JODA 3AM3A 3VR6A 1DIRA 5AVRA 2ZRBA 2D5BA 5KTMA 1JALA 2D3TA 4HPJB 5KQLA 1ODTC 2B99A 4D42A 3JQAD 4H7PA 4WQMA 3HCFA 5FPYA 1HE4A 3ZCUA 5LM3A 1O3YA 4R9NA 1SKUA 5HFJA 2CLIB 3EXHC 4C0HA 4EYKA 3T52A 2ST1A 4EY8A 5J2UB 5B5SA 3K9CA 1JHOA 5DGHA 1EUQA 5TJHA 1T1RA 2NTVA 2OC4A 5B1YA 4Z1OA 1NHWA 3N05A 4HLDA 4L95C 4TKUA 1Y6GA 1Z33A 2OQ2A 3P9PA 3GRKA 4K6FA 4BHTA 4CI9A 4D6XA 1WO8A 4EO9A 2C58A 2DAPA 4IJQA 4Q3KA 1AS0A 4GWGA 1BE8A 2GI4A 4AP6A 2O20A 1I6WA 5IAAA 4UFNA 2Z1NA 4CCSA 4ZGGA 2FSVC 3NRCA 1NAIA 5FIUA 1YRBA 2Z83A 4N47A 2XVXA 2C8VA 5IJ0B 1XCJA 5FI1B 8GPBA 5BXYA 1LPNA 1T10A 1X7ZB 4BNIA 4AU1A 1R6AA 3QLVA 3F6BX 4IIHA 1M8JA 5FTMA 4OBBA 5F1KA 1U5BA 2BDTA 3OX1A 4H3VA 4LWPA 5BSEA 2IY8A 1UBNA 4HMPA 2WFLB 4NFLA 4CL2A 4RKEA 3ITDA 3L7AA 1ESEA 2CVQA 2J67A 2EU8A 4TN1A 4D2IA 3L05A 5FL7D 3QPCA 1U4OA 4DSAA 2OXIA 2H4HA 2JIZA 2YWHA 4I6EA 5EE0A 5DM60 1V1MA 1ZJZA 2ZWMA 5C9ZA 1GRVA 2OV8A 5IBQA 2EJVA 2G09A 5BW6B 4WZBB 1E1LA 1KYZA 1M34B 4OMDA 2D6FA 1FZTA 3L7BA 1BFKA 4TYYA 5DIZA 2FFQA 1JU3A 3RRNA 4GLLA 3I2GA 4G0ZA 4M1OA 4NCJA 2WWIA 1NF3A 4QBHA 4F4UA 3IAM1 1TAHA 4TWRA 3CINA 3ICPA 4ZT5A 2QW1A 3HA3A 2NUPA 1L7PA 4G09A 4ZVRA 2E18A 4UZEA 1OGIA 2P5YA 1AK2A 3SLRA 4CFSA 2DY0A 5T57A 3UEOA 2JGIA 1V7ZA 1YA6A 1GGJA 3E4CA 1NVXQ 3T9EA 1J9GA 3F3MA 3PI6A 3PGKA 2JKVA 2AB0A 5CG2A 4HD8A 4D8VA 2Q6KA 2AFHB 2W71A 1U8XX 3OEEA 1ONOA 4QRIA 1EJ2A 1S2OA 3MLAA 2YICA 3USZA 3CRNA 3DH0A 4BFZA 3UM9A 2J3HA 1M6HA 3B48A 1KZ6A 2P5TB 3LA8A 1J99A 1KAHA 1XCMA 5IVIA 3CSDA 2XMQA 4JJEA 4LRYA 1MEEA 4TKZA 5EQDA 3TEMA 3FXAA 4FNMA 1KPGA 1WUYA 4KSYA 1MGOA 2QTVA 2JZCA 3JY6A 5LP6F 4B4WA 1NVAA 3A9VA 1E6MA 4CKXA 4GLJA 3PYXA 3DZKA 4QWMA 2X2EA 3VAZA 1NTRA 4Z0PA 2DH6A 3EH2A 3F74A 1P6QA 1B1AA 1A5ZA 3CTMA 5G0TA 4PRZA 3P9IA 1G4AE 3LCUA 3PSAA 1YB7A 3U09A 1PW7A 2ODWA 2PKQP 3G8BA 3WB0A 3TFOA 2RB5A 1KTVA 2C4NA 1GTJ1 2G83A 2I22A 2BGUA 3DMRA 4MQ4A 4NP6A 2PPLA 2NVUA 4ZQIA 2IITA 3ZY4A 5HRCA 2D1SA 5BQ5A 1TK2A 2LKDA 4OJQA 1R9MA 4MR8B 2GRJA 3EEIA 3RSOA 1GRRA 4HN4B 4AQ7A 2ZB3A 1U0JA 4XWKA 1FX1A 5CLJA 4ZEOA 1UBMS 3BREA 4AQYB 4RD0A 4RA9B 2ZXFA 1PS9A 2VA9A 3DPIA 2AFRA 3D7RA 4L02A 2VI5A 2FEXA 4PYJA 4DMUB 1EA7A 2PO7A 3KPJA 1L5GB 4EG8A 1XZNA 3QE2A 5K05A 4IIVA 4HAUA 4ZARA 1XTIA 2MSDB 3DMTA 2WV9A 4FMCB 3E70C 4DIBA 2RD2A 4V3CA 5AUNB 4RPIA 4BP3A 1U2ZA 4ZPXA 4MOWA 3THOA 1UJCA 2E3JA 1ZUWA 4D46A 5K6RA 4GHWA 3ZPXA 4FFBA 1A2KC 2XNHA 1ZRNA 1UQUA 2FSSA 4W63A 5K3CA 4GLFA 4I5GA 3A2NA 2HRCA 4S12A 3RUPA 3ZK9A 5IKMA 1R1DA 3G1TA 3LTNC 4NE2A 3TMKA 3ZG6A 4YQEA 4FBGA 2CVPA 2HO4A 2B3TA 4GMDA 4BFCA 2WOJA 3PEVA 5FUYA 3KYBA 1GLVA 3PHLA 5F3RA 3O7MA 2XGMA 4PM4A 1FZQA 4W5NA 3R6TA 4XIIA 4BQPA 4MVYA 2AEFA 2HAEA 3HLYA 3WO1A 1LNQA 2FZGA 1BVHA 3ISVA 1M2KA 1U3VA 1Z7BA 3EZGA 5L3RA 2CNKA 2P3QA 4ILKA 1N36B 3HDTA 3WK8A 1NUAA 4QDTA 3LA6A 4XLLA 2PR7A 2QLLA 3LUJA 2IV2X 3X1KA 4CKCA 4KXMA 5K8UA 2NXEA 2C0PA 2QSZA 1PT6A 3PPXA 2IUYA 3A1CA 1LJLA 4IKEA 2WU8A 3PUIA 3DEIA 5IT0A 3D4PA 3CF0A 1ACMA 4YR7A 3LT0A 1PSWA 1RXEA 2FMUA 4XD2A 3RVLA 3UWPA 2Q29A 4ZDJA 5JAIA 1SUEA 1X94A 1OI4A 1XCPA 3ST7A 3DMDA 1A9XA 4YY3B 1I9CA 2EZ9A 2OFOA 1RWKA 1DCFA 4NCNA 4I9FA 3F78A 4HZUB 4Z6KA 2XCSB 2CDCA 1KWKA 2O8FB 3FTCA 4MWBA 1Q17A 3Q0EA 4EJ2A 4GKKB 2FUKA 1B7GO 2QAGA 4WZAB 3RVPA 1SCDA 3WXBA 4A8JB 1DOZA 1XZKA 1QYWA 2JLRA 2V7TA 3B3FA 2C94A 4KIJA 2YC4C 4YTEA 4BQFA 3AETA 4DL9A 2XYPA 4L8GA 3ZZ1A 1IBMB 1TJ5A 2IZ1A 4R8KA 3SNKA 4YI5A 5ABPA 8LDHA 4HH0A 1KHHA 3QVOA 1RWXA 4MRNA 2DR0A 1QUEA 2YHIA 3VVBA 3F5SA 3DB1A 3Q3JB 3T5PA 1XMQB 3AUUA 5ALLA 3TD2A 3W05A 3BAZA 4IQ8A 2H48A 1M1NB 4EEXA 5HTOA 1Y42X 1BN6A 5B1HA 2EFHB 4D9EA 2FR8A 1M3SA 2R97A 3A9SA 3VOBA 3CKLA 2ZZNA 3UK2A 6CHYA 4HN9A 3EH1A 2AW3A 3VHXB 3X2SA 3CZAA 3ETCA 1AUQA 4H6WA 2CXHA 2VUTA 4D0SA 5DTEA 2CGEA 2OGTA 2QMOA 1USKA 3ENKA 3PT5A 1NYLA 3WFIA 3WGYA 3TXAA 3PS9A 3CWQA 1XDWA 3UAWA 1H8HA 4MCAA 4Z4FA 1KMNA 1JG6A 3N0VA 3KJXA 1VZ3A 1QJCA 4UJ5A 3E9NA 4QATA 2PZAA 1NSYA 1UWKA 3EXEB 1IU9A 3HCDA 3QKRB 4WXEA 1TRKA 1V8FA 3HS3A 2OAP1 5JBIA 1YUNA 1JVNA 4LAFA 3IDSA 5AOAA 3KSAC 4Y6PA 4CG2A 2QD5A 1EFCA 1R64A 4O4HF 4BTEA 4L9WA 1NQTA 1VE9A 1PKXA 4JQSA 1D07A 2Y0BA 4X7BA 4Y9SA 4C76A 5D5QA 4QEDA 1HKHA 3CRW1 4BVBA 1WBJB 3P45A 4KLCA 1QWOA 2HV9A 1IL0A 1YJXA 2OBBA 5TQJA 4YT8A 1R6TA 5FAXA 2ZSKA 1DBPA 1AJEA 1VPEA 1YS9A 4OA5A 4OJYA 1EXDA 2FWAA 1MQ8B 1XCOA 2Z3ZA 2JJYA 4O2AF 1KI4A 3FKSA 3HU3A 2PLNA 3OFKA 4UBIA 1NRXA 3FDIA 4RL6A 5I7WA 3THXB 2ISSD 1HOTA 1UBEA 2YYSA 2EP5A 3N2GA 2J7KA 3PNYA 2VCEA 4NCHA 5LLSA 3UXYA 3V8QA 4EPRA 1Z62A 2C5AA 5GAJA 1RBYA 4FHGA 4L8YA 5TMDA 5CR9A 3N5CA 1IZYA 4IHKA 1NE7A 1J0DA 5I7RA 2IY9A 3JZAA 1DWUA 3LY9A 3CRMA 1UZMA 4B3FX 1K7FB 3LKVA 3SBXA 1T1GA 3NB0A 3KK0A 4WJZA 3QYAA 5EE9A 4X63A 2Q3JA