1YRHA

Crystal structure of trp repressor binding protein wrba in complex with fmn
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
200
Chain Sequence
b'PVKLAIVFYSSTGTGYAMAQEAAEAGRAAGAEVRLLKVRETAPQDVIDGQDAWKANIEAMKDVPEATPADLEWAEAIVFSSPTRFGGATSQMRAFIDTLGGLWSSGKLANKTFSAMTSAQNVNGGQETTLQTLYMTAMHWGAVLTPPGYTDEVIFKSGGNPYGASVTANGQPLLENDRASIRHQVRRQVELTAKLLEGGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords trp repressor binding protein WrbA
publication title Crystal structures of the tryptophan repressor binding protein WrbA and complexes with flavin mononucleotide.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Protein binding
total genus 66
structure length 200
sequence length 200
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2005-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yrhA00
2FZVA 4U7HA 2BPOA 2BN4A 2M6SA 1D4AA 3TZBA 1FLVA 1WSWA 1J9GA 2OYSA 3B6MA 1C7FA 4J8PA 2N1MA 1H69A 4H2DA 5B3KA 1YCGA 3NHLA 1SG0A 2Z9CA 3FNIA 5LMCA 3UXHA 3W79A 2B3DA 1FLDA 2ZKIA 4D02A 3OJWA 2KQUA 4QOEA 5B3LA 3K1YA 2HNAA 1BVYF 2V5VA 3NHSA 5EAIA 1CZKA 2V5UA 4CETA 2GSWA 1YCHA 3ESXA 2FLVA 4QOJA 3FW1A 2Q62A 2KLBA 1SQSA 3KEGA 2FOXA 1VMEA 4QODA 2D5IA 4FGJA 1J8QA 5LJLA 4QOHA 3ESYA 2F1OA 3R6WA 4N9QA 4YAWA 3B6JA 3HA2A 3JSXA 1T5BA 1AKTA 1XYVA 2FVXA 4Y9UA 1ZWKA 4ICIA 2QX9A 3ZHOA 1BU5A 4Y9RA 4C14A 4LA4A 3OX3A 2FZ5A 4YALA 3OJXA 4XDGA 4ZVMA 2BF4A 2RG1A 3NHKA 3U7RA 2A5LA 4C76A 4ZVNA 1C7EA 2HNBA 4DILA 3LCMA 2OHJA 3OX2A 1XT6A 3OVMA 3GFSA 1X77A 1YDGA 3ESZA 5F12A 1CZOA 3RPEA 3GAMA 3FVWA 3QE2A 2OHHA 5LJIA 4QOFA 3NHUA 3P0RA 1AG9A 1CZRA 1E5DA 1FVXA 1NNI1 5ULLA 1J9EA 1F4PA 5JROA 1YCFA 4C0WA 4N65A 2X2OA 3NLLA 3F6SA 1AKRA 2Q9UA 3B6KA 1OBOA 3L9WA 4LAFA 4CF6A 2MOKA 4FX2A 4QOIA 1DXOA 3HR4A 2QMYA 2QR2A 4GQIA 1FLNA 2FAXA 4HEQA 3NHFA 4S24A 1XYYA 1DX9A 1AKWA 3OX1A 1JA1A 1GG5A 4U7FA 4ZVKA 2W5UA 2XODA 2HPVA 5EMNA 2QWXA 1CZHA 3LT5A 1CZLA 1RTTA 3N3BC 2FCRA 3EYWA 3FX2A 5FA6A 3OWHA 3F2VA 1KBQA 2X2PA 1OFVA 3QFRA 3NFRA 1JA0A 3W77A 4FGKA 4ZVLA 2R97A 4FGLA 4Y7CA 2QMZA 5BUCA 4N82A 4HS4A 5F4BA 1AKVA 1I1OA 2QX6A 2V9CA 4NLLA 4YAUA 1YRHA 4XDHA 3W7AA 6NULA 1YKGA 4M0CA 3O2NA 3F90A 1KBOA 3D7NA 4QOGA 2ARKA 3F6RA 1FX1A 3GFRA 4YAOA 5TGZA 1XI2A 3NHWA 2Z9BA 2XOEA 1RCFA 1CZNA 3KAQA 4GI5A 2MTBA 5FX2A 5NULA 2OHIA 3ES9A 1QRDA 2AMJA 2FX2A 3W78A 4C0XA 2Z98A 1AKQA 3B6IA 5F51A 4R81A 4U7GA 2MT9A 3KLBA 1RLIA 3TEMA 1B1CA 1CZUA 2WC1A 4NULA 1AKUA 1RLJA 1AZLA 1AMOA 1FLAA 4DY4A 1TIKA 3FJOA 5A4KA 4PTYA 3OWXA 5FUQA 1T0IA 4LTMA 1WSBA 3SVLA 1QHEA 1V4BA 3NHRA 4BMPB 3TE7A 2R96A 3NHJA 2BMVA 3UXEA 4YQEA 2MWMA 5EA2A 3U7IA 3N39C 3EDOA 1QR2A 1D03A 2Z9DA 5NLLA 4LTDA 3GFQA 2BZSA 4ESEA 2QX4A 1ZWLA 4OXXA 4F8YA 3L9XA 1J9ZA 4LTNA 5LLDA 1FUEA 1DXQA 3NHYA 1QBGA 3QFCA 2M6RA 4YAFA 5LBUA 5LVAA 3NHPA 3K20A 1D04A 2FDXA 2QX8A 5LBTA 3G5MA 3KAPA 4DIKA 1YOBA 1FTGA 1TLLA 1H66A 1ZX1A 4BMOB 4H6PA 3HLYA 4GR9A 3O73A 4PU0A 1AHNA 3N3AC 4PTZA 3S2YA 1OBVA
chains in the Genus database with same CATH superfamily
2FUKA 5FPTA 5FULA 3IALA 2P78A 3WLSA 1TQDA 2GZ3A 1EFTA 4DUGA 3VR6H 3ZUGA 3A14A 1FMLA 2O8CB 1FDSA 2Z8YA 5JBIA 3Q9NA 2C2HA 1QO9A 5KC9A 1JU9A 1LVUA 2I6UA 3OZUA 4M76B 5JSFA 3WIUA 3KQSA 1X7GA 2HCBA 3FTPA 3PU6A 5GJCA 3UUWA 4F86A 2FF5A 3K5PA 2GPYA 1K0UA 1N8TA 2GWHA 4RVNA 4MV0A 1MV5A 3NOOA 4OMFG 1DQNA 3GFGA 4MUNA 4QGFA 4N0PA 4OJQA 4BRWA 1NJSA 2EFGA 3IQIX 4HCJA 2J85A 4CF3A 4ENVA 1W4CA 5AESA 4XRRA 4F56A 1WSWA 1GNVA 4E15A 4NBRA 1GKKA 3IBGA 4RU1A 1DSSG 2WK1A 2IYQA 1QP7A 2XVMA 4JWKA 1ZUWA 3PFWO 3OURA 1KMHB 4XM1A 2OYSA 5FL7A 3AETA 3EISA 4R31A 2UZ0A 4JZYA 4TXMA 4E07A 1ZNQO 2DHEA 2H52A 8ABPA 4PQEA 3LVQE 3SZLA 1VDMA 3R24A 4PONA 3UHPA 1Y8CA 1Y3FE 3BDAA 2PZAA 5T67A 2CWDA 2PYZA 4RK6A 2XVXA 5ICMA 4B7ZA 1P4RA 3KJIA 2VYQA 1KQPA 2A86A 3A1DA 4BWGA 4OQXA 5A7FA 4CBVA 4YRFA 2BFFB 1URPA 3DBLB 2IUFA 3V46A 2OCBA 2Z9CA 4GICA 1Z88A 3C85A 2GF2A 4J3FA 5DX0A 4EUEA 2YVAA 3O3OB 1LD3A 3SEQA 1UZMA 4BZQA 4YH1A 1GYRA 1FXWF 3K9QO 3L7CA 1A2OA 2TRSB 5A7GA 1K5PA 2AG0A 3VAZA 4KUGA 4TT3A 2B3DA 721PA 4C7JA 4PZAA 1SUBA 2ZS7A 1N0UA 1XAIA 4INAA 1AK1A 4MW2A 5A9SA 2D1RA 4DIOA 2VYNA 1UP6A 5T8KC 1V3UA 4I50A 1Z18A 4REMA 4QBIA 2JVIA 3TAHA 1N9GB 1S7CA 2WUVA 4FILA 4KUHA 3U7JA 4W7HA 1QG6A 5AK4A 3QPCA 4IM7A 3WGUA 1Q5PA 3GGDA 1E4OA 5LP1A 4HLCA 1JN0A 4O2BA 2BI4A 2FB9A 4RIFA 4AKIA 4DV3B 1VYUA 2ZITA 2NAPA 3PP8A 3RUFA 1B8PA 3N0VA 1QB7A 4N5MA 1NA5A 2WT8A 3LC0A 3G2JA 4A8JC 3IO5A 2QRVA 1P0FA 3KPJA 4GPBA 2OB1A 1B41A 5DM1A 3GF4A 2VA9A 4Z0NA 3HA7A 4JUFA 4ZDKA 3EDYA 3Q1LA 4NECA 4P22A 1Q0UA 4RGQA 4F9EA 5CFLA 2WG0A 2YQZA 1LEHA 2P4EA 3AONB 2Q4EA 3CZ5A 3HCPA 2A6PA 4NENB 2FOXA 4TQUS 4N47A 3DZHA 4U4AA 4CLHA 4JI5B 1JHXA 1WXGA 1U3GA 5IWCA 2DG2A 5DHFA 5J2UF 7MHTA 1PLJA 4NBNA 5H9VA 4M1KA 4BDSA 2XUZA 3VZCA 3GT0A 3M6XA 4LECA 4PSKA 3IAS6 3AI7A 3VR5H 1DT5A 1GA6A 1XN1A 2XQGA 3OZBA 3L0DA 1XHLA 3SQXA 5DX1A 5HRUA 3Q72A 5CM2Z 3KPWA 3JARA 3HBFA 2WNHA 3HWRA 2BH2A 3N6VA 5E9QA 5P21A 2P11A 4N9QA 4X93A 3Q7QA 5BUSA 2CLKB 2JK1A 3D6VA 1D2EA 1Z7YA 2YWGA 4F4UA 3HV0A 2ZJ2A 5TT0A 4LNUA 3VH1A 4XD7A 2QYSA 1QYWA 4QUDA 3NHZA 4NPAA 4P0PB 3O90A 5FUBA 1XYGA 3R7BA 5C8XA 3NUQA 3C7DB 4ZOQI 4MGYR 2OFFA 3CRVA 2A8YA 4ZVMA 1UKYA 1U2RA 3PKIA 1N7GA 1Z07A 3F5QA 5DN6A 3LLCA 3WBBA 4DY6A 1Q14A 1Q7TA 1Z5OA 1KQGA 1TZJA 3SJAA 3UWOA 4QLAA 2XUIA 3PUJA 3U39A 2HNBA 1KH3A 4KR7A 3KLPX 3QNWA 4OBEA 5SZJA 4EKIA 1HLGA 4FQ8A 3VMMA 1I2AA 1BGVA 2VP9A 3MLAA 1J8DA 3SC4A 1X77A 2TMYA 2BFPA 2WW8A 3T9DA 3WL8A 2DU8A 3A28A 2NM0A 4N3CA 3I76A 2F55A 1GQYA 1N2OA 1DWPA 2GXSA 3IKLA 3DDUA 2FQQA 3EGDA 1WKCA 2R6JA 1M6VA 2OFXA 2XTAA 2WYVA 5EZ6B 4D4JA 4MWSA 5DNWA 2OHHA 1JFFA 1V7PC 3DR5A 3ORSA 2WUFA 3G8DA 4YT5A 2AMYA 3PGJA 3QLJA 3C6YA 2NXNA 3B8HA 1LQUA 4CZ2A 4YCLA 3IXLA 1Z45A 1HX7A 1F2TB 4L8WB 5D3MA 3WADA 4RD2A 1P1JA 5G0SA 4F45A 5DVZA 3GZNB 4IEEA 4ZOLA 4MR9B 1CQXA 3R75A 2HSZA 2G63A 1IK6A 2I4TA 3F5MA 3N9IA 4FDMA 4NDZA 2ZVQX 2F8LA 2VF5X 2Y0BA 3KYBA 4GP7A 2XZDA 4ZWNA 5DNEA 5JZOA 4YP7A 1YZGA 1UBHS 2J9FA 2LDXA 2V0NA 3ZDCA 1M10A 1GO2A 3D6HA 3PC8A 4A0FA 1XZAA 5LYJF 3KSUA 1SK9A 2F43B 4CL0A 2O2HA 4DPKA 1A8HA 1N6IA 4KODA 3CNHA 2ID9A 2W6QA 1BMFA 4YRNA 3E22B 3TW6A 1HZZC 5BY2A 1AGYA 2CXHA 3W9UA 3IR5A 3PGA1 5IEBA 2QTAA 3LIPA 2FEWB 2D7CA 2FW6A 1OI7A 2MU1A 2WJ3A 3X1KA 4JGIA 4K28A 1ISPA 1KZ9A 2NYRA 4Y8VA 1ODFA 4Q4JA 3CVOA 3KUCA 1KR5A 4RAOA 3GD7A 1G8YA 3BICA 1H6AA 4W1QA 3MTGA 3WWCA 4NCBA 2IKQA 3GFVA 4LQLA 3ML1A 2GO1A 3G82C 4MPRA 3U62A 4CW7A 2ECPA 1BRTA 2HJWA 3AI1A 1UL1X 3I01M 1ZEJA 1J7KA 3AL2A 5IG2A 2Y71A 4WXRA 4PG6A 1DKQA 2O4UX 2P65A 1RHJA 2VJDA 4R98A 5EYPA 1KYZA 2QTVA 3BE5A 3DCJA 3LA8A 1KTIA 5A9TA 1EK2A 1M34A 3WO0A 1UT8A 4V38A 5HJ2A 1T9AA 3PSHA 1AQNA 1XBTA 4YBZA 5JZBA 2XGSA 4JXZA 4PZZA 3ICQB 3L05A 2W2LA 1GFWA 2XODA 1X13A 2X1LA 3T7JA 1NE7A 2DXIA 2QWXA 1UK8A 2KI5A 2ZRLA 1NVKA 1F4LA 1HT1E 2B8NA 4OYHA 2FUG1 2R8PA 2H57A 2XMRA 3KHSA 4I4TA 1KI9A 4OFZA 1OLUB 4R9VA 4WXHA 4D44A 4QRIA 5B58C 4PAWA 1A5AB 1Z6PA 5I9LA 4FEEA 3T12A 1YBVA 1F1JA 3AX6A 4L5CA 1JSZA 1CQPA 3BE4A 1B8UA 1BE1A 1PQUA 1PT7A 2A9VA 3CE6A 4IO1A 1K98A 5K3CA 3AXTA 2M32A 4L8YA 4FYJA 4TS1A 1ZGBA 4XASA 5LMUB 2Q9CA 1UMKA 4TVSA 3ECCA 3LBAA 3JZIA 3G17A 1LPNA 1GVHA 5LM3A 5JRJA 3H5AA 3IYLW 2I6SA 4ZAWA 1EX7A 4GMHA 1AKNA 1L7OA 2QN3A 3OC0A 4JBGA 4EFDA 5IJWA 1E8NA 4BC0A 5AXBA 1OA1A 2VF2A 3KVNA 1R9NA 4Y6GB 4BQOA 1DWQA 3DMGA 2V96A 3O1LA 1XD9A 2XMCA 3LGXA 4HEA6 3GYGA 5HBGA 3S55A 2D7JA 4HS4A 4RVOA 5FHRA 4P7KA 1UK6A 1JAZA 3VC1A 1ZNZA 1CDEA 1WNFA 1Z47A 1ISHA 5E1BA 1BA2A 2PZ8A 3C3MA 1X2BA 1EXWA 3HDTA 5I48A 5CCEA 1SZDA 4EUKA 1R0ZA 2JS7A 3WIVA 3VTZA 3TIIA 2XZTA 1QKKA 1UBLS 5BSEA 2HEIA 4BO4A 4FE3A 1Z33A 4YGYA 1CP2A 1RAGA 2BFWA 3O3MB 3EQ6A 1JB9A 3ZD8A 1KYVA 3NORA 5COBA 2O48X 5D2CA 3UYLA 1FTYA 1BH6A 2A0XA 3JTMA 4LZOA 4WK4B 4X6UA 1MJGA 5GM2A 1FPMA 1ZK3A 2ZATA 2E4XA 1QH9A 1Y1SA 4BLWA 4R5HA 2XB4A 1KAHA 1FZTA 5GZ3A 6ADHA 5DP2A 4P80A 1O8BA 2F8MA 2C98A 2HV8A 2YH2A 1PDOA 2ZI5A 3FSGD 5EE9A 2ZM5A 5DGXA 1OI2A 2RAFA 3TPCA 1V26A 5IZCA 4B46A 3ZV6A 4Z9FA 1NI3A 2J0UB 4JSRA 2WV9A 2XTMA 2W98A 3CIFA 1IZYA 1F8XA 4JBNA 4X3PA 5KJ6A 1TNDA 3EZ9A 4AW9A 1JEAA 2X3UA 5KQPA 1BD3A 3OEHD 4RF4A 3FPJA 4MS1B 3IE2A 4F9GA 3RVBA 3AVTA 3D4IA 4PIVA 1RJEA 5KTTA 1JSRA 1EQUA 1LDGA 4PS0A 4BUZA 1Q11A 1NX9A 2DTDA 4RHUA 4L51A 3ZHTA 4CI0B 2PIDA 2BEUB 2QMOA 2VT6A 3RTBA 3TIGA 1CQJA 2VI5A 3O8OA 4AUEA 1QRTA 4NCAA 1IFXA 4YCMA 3GG9A 4AI6A 1Z74A 2CHQA 2X76A 4KLNA 3SJCA 4NAHA 4UPDA 3BF7A 3FY4A 1COWA 3I5MA 4LYDA 3QELA 4YLYA 4LOAA 3KLMX 2IYYA 1W88B 8MHTA 2L82A 1ZU5A 4AXXA 4GXNA 1DRUA 1XX6A 3ZHSA 2FFBA 5CXQA 3DZCA 1KDRA 1E59A 1K4MA 1E1KA 1BD4A 2JBHA 3ELBA 4RKQA 4GR5A 5JFOA 1SA0B 2Y1GA 5ENZA 5HZMA 1CY8A 2ES4A 2O20A 3SP1A 4IFEA 1UADA 2JZOA 3H7AA 4QT0A 2CUNA 1M8JA 3GJ3A 4RNCA 5GINE 1TD1A 2X5JO 3NXKA 4TMVA 2JJYA 4NULA 1KFBB 4LYJA 3D81A 4D82A 1AKUA 2Z4SA 4GMFA 2RBKA 2IV2X 2FSIA 4L75A 2DWQA 3KBBA 3MMPA 1VCMA 5JCJD 5F1KA 1DDGA 4UREA 2X1MA 1Y7HA 2VPQA 3PF9A 4DIFA 2H17A 3GAAA 2NACA 4EHNA 4UEKA 3CR8A 3QF4A 3QWAA 1PJ4A 1SCKA 1Z39A 3SIPA 1FJHA 3BRCA 1KY3A 2OLEA 5EJ2A 4R71A 2NZ2A 1YL7A 2W93A 3T5AA 3WWDA 4I46A 2CWWA 4AECA 4PW0A 3CLKA 3BIXA 2NO6A 3R6DA 1PK9A 4WA7A 5DM0A 3F7TA 1VPDA 3W2GA 1L4UA 4OQEA 4KGVA 4AJ4A 4GOND 2VEOA 4EJ0A 1G60A 4AZ0B 4DCGA 1V25A 2NO0A 2IEBA 4NE2A 2QLFA 5BV0A 4DYDA 3KIPA 5CFPA 5JMTA 1E2BA 2G3YA 2P8SA 3CRMA 2BHSA 4FN5A 3SX0A 1ORIA 4TWRA 1TF7A 3C4QA 3UG6A 2XQVA 2P2LA 4P3XA 4PZUA 4KLCA 2IYOA 3A25A 3GCZA 2VSNA 4UUPA 3TFWA 2I3AA 2IXDA 2H48A 1FS5A 4E5PA 4TLLB 2WPNA 4UEOA 2Z2XA 3T5CA 3VPDA 2E4ZA 3ABSB 3V55A 1TQ8A 4GZ6A 4C87A 1RFLA 1W47A 1JIXA 3AR8A 4FFDA 5EQTA 2QX4A 4RE5A 3TW0A 3MGKA 4WN3A 3IEMA 4LHSA 3NKFA 1H6DA 3D8UA 3H04A 1Y98A 1JEYA 4XM2A 1SHLA 5FTKA 4ZGWA 2ILVA 1NT4A 3MD9A 4BMZA 3UMCA 4DSOA 5FJIA 3RSCA 3WVNA 1MG5A 1NM5A 1DIAA 2IOYA 3I9MA 4OXRA 5EXSA 3AU8A 4MLCA 3DV0B 2GLTA 3ONFA 4BE7B 1XTRA 5L3QA 1VPTA 4TN5A 2H3HA 2J5XA 2VPYA 3IUEA 4FCTA 5ITSA 2OCLA 1V8PA 2PH5A 1NJ8A 1E1LA 2I2WA 3HA5A 2PUWA 5HIJA 3E9MA 2EZUA 1RYEA 4YAFA 1D1TA 4D4LA 1L7QA 2YMMA 3NM5A 3AR4A 1EDDA 2GARA 3KJFA 1TZCA 2ZANA 3MJCA 1L4NA 2NWQA 4UUBA 1H3FA 3G2IA 3I6QA 4QBHA 4N8EA 3U3KA 3UB2A 4QUIA 1QIFA 1T4GA 5DM2A 3GJ7A 5EHQA 3UAZA 2BM8A 2IYVA 4D8VA 3FOZA 3FCOA 4F5DA 3KXPA 1K27A 4FK8A 1J8FA 5BN5A 4JYZA 5DW0A 1JKJA 2R1VA 2ZI7A 5E4FA 1ILEA 2REBA 5JEEA 1NMQA 1UANA 2QE7D 3D6MA 3NFYA 5EMMA 3T1QA 4CKBB 1YOBA 3I6IA 4RIEA 4CG3A 4GW3A 3BF8A 3K6JA 4ZQGA 3KCNA 2ROQA 3HLYA 4I5GA 2HJRA 4Q7JB 3JSAA 4NEHB 1ZH0A 2CFCA 2BSQA 1O95D 1ULSA 1FYFA 2ETXA 2GHRA 4JL5A 2RHMA 3PC8C 4PZYA 3HU5A 3MS2A 2P6PA 5KOHB 1XA0A 4JJ6A 1QFJA 1G1AA 2G76A 3QLVA 3ZE1B 2PA0A 3IIMA 4CKXA 1QP0A 2IIPA 3P96A 5IBRA 4B2LA 4WKGA 5ER6A 4PEVA 3A9TA 2P9JA 1NXWA 4B73A 1OBVA 1KSGA 3NVKI 2YRFA 3EA0A 8GPBA 2DPHA 2PD3A 2VCEA 3A4IA 1K9SA 3HJTA 5LA6F 1PEKE 1XRQA 2H7YA 2HCRA 1DAIA 4KE8A 4BUCA 5AW5A 3HB1A 1Y6GA 5ELMA 4CE6A 4XWWA 5FWXA 1TCCA 2BJHA 3GLGB 4FDTA 1ADBA 1T8YA 4LRQA 4CQLA 2YC2C 3TR0A 1JDNA 4G8BA 2C7OA 3DLAA 4Q47A 4UQOA 1F14A 2WUDA 1YR6A 4M4SA 1IPEA 4EF5A 2I9KA 2OCDA 3I5XA 3HKEA 5HQ3B 2GD0A 3W5HA 3U5ZB 4R8LA 4KN9S 2O52A 2VNHA 3ICCA 4Y0AA 1SCAA 1P0MA 1IN5A 3EMKA 3GU3A 4I3FA 3EGVA 4DCMA 1OFUX 3C3WA 5CK5A 4KPYA 1XA4A 2FWPA 3H0CA 2WKQA 2REXB 2EQBA 3FVVA 4Q9AA 5DHQA 5DE3A 1K6JA 9GPBA 2B35A 1PGOA 2IZ7A 2JATA 3FAKA 2OLJA 3NHLA 2ONCA 4UASA 5IYZB 2BHTA 2OZEA 3EIWA 2B34A 1QH1A 1PL6A 2EX4A 2OYCA 2NUPA 1ETUA 1A1SA 4C5BA 5A3JA 1XZ8A 1PG2A 4S1WA 2IEDA 2XI4A 1C29B 5ALMA 1L3CA 1PNQA 2X4DA 2D54A 4RWEA 1O9GA 5TS2A 1RPJA 5KYYA 5EINA 4V1CI 1E62A 3CLRC 4JI4B 5IN5A 1XZPA 2CHVA 1LX6A 2JFFA 3CWZA 3OJCA 4TLEA 4N5HX 5TQJA 5C5IA 5FEMA 3BXHA 2Q07A 3LP5A 1SNYA 3OJWA 2R7AA 4H1UA 3HU1A 2CFOA 4G37A 2Q7XA 3DDOA 3KT6A 3GVHA 3K15A 1U0RA 3ETEA 3EQ8A 4RTPA 3K1YA 1UDRA 4B3FX 5AM2A 1TAQA 4IUDS 2NO7A 1D3AA 2C94A 3I37X 2ICAA 5B12A 1LJUA 2ZJYA 1HUQA 3F78A 3HWX1 5HE9A 4AUKA 5CA1B 3GHHA 2JLZA 1GGFA 4OSEA 4WKCA 1TCVA 2DFDA 5I9BA 4E6EA 2QQGA 3KJNA 4AJOA 1EUYA 1SQFA 1YJ8A 3S7TA 5F1YA 1EWVA 2FWRA 2O3JA 1NLYA 4JBHA 3OFKA 3WLHA 1IY9A 4RM2A 1ZYUA 1BQ3A 4KWHA 5T6BA 3A9VA 3UJAA 1TLFA 3OAAD 1WVMA 3I3OA 3M83A 3ZH2A 3L18A 3B13B 4BN4A 1F5NA 3PWKA 4PM4A 2NOAA 4R7ZA 5F2OA 2Y99A 3PRKE 2JHGA 1A4XA 2Q27A 2I0FA 1U0TA 1PLKA 2C9ZA 1J99A 1RKQA 2PRSA 3QY9A 1A69A 5AKJA 2PUGA 3ZV3A 3MS4A 1L7AA 4GOOD 2YTZA 3O21A 2HSJA 2P1DA 1Z2AA 4CLOA 1CY0A 4CFSA 1IHYA 3CJQA 3FLMA 4MI3A 4PZ9A 2ZT6A 3E9DA 2Y77A 3EVTA 3ILHA 1YB6A 1U8UA 3WMFA 4U2KA 1N9KA 1ABBA 2OV8A 4QYWA 5IZCC 1RLMA 4ZO7A 3Q40A 4A6XA 1MNAA 3QOFA 3HA2A 1JH8A 1Z06A 3P8ZA 4GBJA 2NU9B 5LQJA 3MIIA 4M3NA 1XP8A 4HZGA 1JB1A 2C97A 4PAQA 5K0EA 4HVAA 4NE7A 4N8DA 2CUKA 2OBFA 4MYUA 4RWZA 1ADJA 4EYOA 1SFRA 2QI9F 1KO5A 1Y6RA 5TGDA 1USUA 2P6NA 1EHIA 4YV1A 1LJ8A 2Z2KA 3FB1A 4N3BA 3HM2A 3WOVA 4QVGA 2J5QA 4UTZA 4UUMA 1N4AA 3F5FA 3U3OA 4CF5A 6ABPA 4OATA 1USWA 1Y6QA 2H0RA 1QGUB 2IOFK 1I51A 1C9NA 1NX6A 2GF0A 2ZTMA 4LYGA 2A5LA 1JVBA 1JDUA 1N5OX 2HWUA 3CLTC 3H16A 1XRNA 3IHWA 1C7EA 1Y5IA 3IMFA 4HS9A 4MQBA 1V6CA 1GZ6A 1YL6A 3LXUX 1POWA 4I1VA 4PSVA 4QTTB 5ALKA 1JV2B 3KWJA 2OHJA 4LPKA 3NBKA 3TN7A 1EP1B 4R9NA 3I1FA 3PQ8A 4RFSB 3UUGA 1JTVA 3BK2A 1YDGA 1SCQA 1N0HA 3ESZA 1Q84A 3FIUA 4JDUA 2DBRA 1J22A 2HDHA 3OP1A 5LCXA 3RANA 3SFVA 3UAYA 3LUJA 5D7BA 2GVDC 3GCDA 1YQXA 3H1FA 3T9BA 1ZL0A 1RZUA 4YGXB 2Q3CA 1RNLA 4FBGA 1ZNXA 3E3AA 3T94A 1XMIA 4FFBB 1O5TA 3K0FB 4II7A 4MW5A 4PGAA 3DGEC 4DC9A 1NBEA 5EFZA 4CODB 3FTNA 3NC4A 4RH0A 2CGEA 5J59A 1T3LA 3BFXA 5CEFA 3QE9Y 1RKVA 1Z34A 5L3VA 2YICA 1KMMA 2VJCA 4JIGA 3U4GA 1OC4A 3PS9A 5C5DA 4OJYA 5JYBA 3NW9A 1ULTA 1WXDA 1U04A 2QIPA 4IQ8A 2GI4A 1R5JA 1NV9A 3W90A 1JAXA 4JKYA 4K0RA 2VRBA 5CVVA 5EE0A 1IHXA 3V4LA 5DM60 5CB4A 5FPYA 3JWJA 4OFXA 2BKAA 2BUCA 1QYRA 4DJAA 1B26A 1AMNA 1BS2A 2WJWA 4N6NA 3TQQA 4EB3A 1CRPA 2H2DA 2R8OA 3T95A 4IIUA 3EVZA 1NVAA 4Q5IA 2OLKA 1VKZA 2RCYA 1YO6A 3RSQA 2GZ1A 4YROA 2QR2A 4WNYA 1Y8QA 3G1WA 3A7DA 2LRHA 4XX0A 1EVYA 4Q01A 3U9SA 2J3KA 1LW7A 4Q1FA 2JANA 3N0RA 3I0MA 3K32A 1HDCA 5JAUA 2AA3A 2X8AA 1XZCA 3GMSA 3W5BA 2O8NA 2VPIA 2PUFA 1QE0A 4ZN6A 1CYEA 1G4HA 3MTIA 4MR8B 4S24A 4AFNA 1D9ZA 1DX9A 4MUEA 4MYSA 1NJ5A 3WZ2A 1NVWQ 2WMDA 2UZIR 1Y3BE 2YS6A 2ZUWA 3IQZA 5F2KA 3W5UA 3HS3A 3TWOA 1AQUA 3JQAB 3PYMA 1DC5A 3LSTA 3E84A 3MCWA 1CR0A 1ND5A 3OTIA 3AV0B 4B4KA 2HT1A 1PZNA 2Y0CA 1TAHA 2GJSA 5AMXA 1IRXA 2GPTA 1IEQA 3CX4A 4PPYA 4UBNA 1MVLA 3NBQA 1Z4IA 4B6JA 2XECA 4B2YA 1NM5C 4BB9A 2C1EA 2X9GA 5FQNA 1T34A 4G4JA 4Q3NA 1E9VA 5BSGA 2ZI4A 4M98A 3ZW8A 2OFPA 1S2NA 2BBSA 1O9BA 1X7WB 3P9KA 1D5CA 3TTXA 4RCYA 1DBRA 3K31A 1KKLA 1NBOA 1ZGJA 1VP9A 3EDRA 5TQVA 3KYIB 3KS9A 4A15A 3DFZA 1NPDA 3F2VA 2QTNA 4MPJA 6REQA 5J4YA 2YWDA 4G5OA 5ECWA 1XNGA 1FMTA 1HM5A 1XPOA 5HS6A 4IX1A 1MB0A 4Y1FA 5B7GA 1JW9B 2IYFA 1K5HA 1JA0A 2OUKA 4MCIA 2LKDA 4R84A 1GG9A 3FXAA 3OZTA 4U5XA 4YDQA 4MQEB 3LYLA 3SWWA 1ZCFA 1WMEA 4JUDX 1O97D 1ATZA 4FEGA 5TRTA 4FGLA 5AVTA 4G4SP 3P2KA 2QMZA 5I9MA 5TJHA 4B3RB 1N5IA 2X5KO 3RKUA 4IEIA 1FE8A 2QU8A 1WLYA 3EEIA 4WZAA 5KYXB 3BORA 3VSAA 1R3DA 5BR1A 1YB4A 2C8LA 1FC0A 2VPWA 16PKA 3QLVC 5JV5A 4AF6A 4HWRA 4EG6A 2N1BA 4NLLA 3V1LA 1BCSB 1XCMA 4C3ZA 2BMEA 3CVXA 3S8YA 4TV9B 1YFLA 3I9FA 2ERYA 3PC2A 4YN3A 1TEXA 3AKEA 2EC5A 4Q15A 5JARA 4JP2A 2FEMA 4D0SA 3E4DA 5IRCD 3O4IA 1N0WA 1ECBA 3KZMA 4P6VF 3W7AA 3JQAD 5CFNA 5HRCA 4ZC1A 1PK8A 1SXPA 3DR3A 5BSKA 5M5BA 3LLVA 1L8XA 3VR3A 2AFIE 3PC4A 3G9XA 2CHUA 5L3SB 4PZCA 1CRZA 4U7JA 4DUPA 2NU6B 3I9JA 1AT1A 2A3RA 4DB2A 2QVZX 2XWSA 3X2FA 2FRVA 4DV5B 3P9IA 4E3ZA 3ZV4A 1FX1A 3B60A 3TFQA 1GGKA 3UVEA 5DSZA 3VYTB 3NHWA 1RRMA 5G3ZA 2OQVA 1E9AA 4HJXA 4Q7EA 2ZYRA 5LDHA 1CJKC 4G0UA 2PWPA 3TCXB 1PYGA 2ADFA 4PICA 5AP9A 4B6EA 4WE3A 2ZIZA 1CUYA 5K3FB 3OPVA 5FX2A 4NFSA 4DRXB 1DQRA 2XYGA 4H18A 3FOWA 2OHOA 3GLFA 3I5AA 1ZUIA 1Z75A 1QRDA 2W2QA 2K2QB 4JCOA 2AMJA 2BFMA 2NPFA 2Q3HA 3TLGA 4MDFA 4MJ3A 2DCUA 2VR1A 5A04A 4OHYA 4FVTA 4FWTA 1G8FA 3EFOA 4KR0A 1M2GA 4TKUB 2G8LA 3FLAA 4TQAA 2H5LA 2K5UA 2ZKLA 3TVDA 3S8EA 1QE5A 2FW0A 4LXYA 3RJ9A 1CFJA 1DAPA 4EG7A 4KSCA 2NU7A 1N2IA 1N6LA 1XR3A 2IHYA 4IEFB 4IOJA 1YAJA 1Z4JA 2ZAOA 1T4BA 3CS3A 1CZUA 4F46A 3AY7A 1MNQA 1E2UA 1RFGE 2WIBA 3ORRA 2QAGB 2VUTA 3P0JA 4RA9A 4KO1S 1CUBA 2JJMA 1IWOA 1AN9A 3F3KA 1R8JA 1KKMA 1RLJA 3WQHA 4G26A 3ROMA 1Y1PA 3DBRB 1FK8A 3FZYA 4JKIA 1UPUA 2AT1A 3L0ZA 1D8AA 4GS5A 2AJ8A 2WD9A 3IQEA 3O8QB 3QBEA 4LMRA 3CLVA 2L17A 3BAZA 3CLUC 5COAA 5JW6A 2PSHA 4N6OA 4FT2A 1M2VB 1Z2DA 3S27A 2DZDA 2QRPA 1KZ1A 1YC5A 4B85A 2ZRDA 1QRSA 1DX6A 4B80A 2OESA 2ZYVX 4TM7A 5BXYA 8ATCA 5J2TA 1RRCA 2K7ZA 1NBIA 1F6BA 3QPUA 4WEQA 3L4SO 1OWPA 2BTQA 3M3DA 3RVOA 4B3MB 1MB3A 4D3XA 3CH6A 2YMPA 3R4CA 4AC9A 2HYIC 1C0KA 3HKBB 3NVMB 4QEDA 4K8OA 1VIMA 3D43A 1YVRA 4LWZA 3QUBA 2C5GA 2M2IA 2NZYA 3D3NA 4HVCA 3INNA 1FUUA 3CUVA 1OXUA 4RD1A 5C32A 2IE0A 4XAQA 1GT6A 3ROFA 1F3LA 1ORHA 1YR3A 3SIRA 3ZBQA 3MT8A 5DLYA 1FFSA 1H2FA 3K9BA 3UMSA 4TZ0A 2YWRA 4MW7A 1KXZA 2Q6LA 3OBIA 3GNTA 2IL1A 1QAOA 2VP5A 2Y67A 2Y1EA 3B51X 4K05A 1MW8X 1JJ7A 2Z2YA 4GU5A 1AZWA 4U6NA 1AS3A 4I19A 1GPH1 1GUZA 1SVNA 4EB6A 3QU2A 3L1JA 3BWYA 2C5FA 4P92A 4A2QA 3QX3A 2QJOA 3IUBA 4NFYA 4C4SA 1T3SA 2F1KA 3N8KA 1KVQA 5DU2A 4ZU1X 3VR6A 5JI2E 4QJBA 2FEXA 4PZ0A 4A7PA 4BV8A 1XNQB 1T91A 4Z0HO 1EUCB 4EKDA 4G4SO 5EIOA 2D1QA 1X9IA 4FUQA 4BNDB 1EEXB 3LV8A 4A0QA 1SXQA 2IW3A 1X1DA 1IJFA 3BBLA 3B1YA 3IOYA 4KN5A 4WA8A 4ZVRA 4R7TA 4YEDA 4JP1A 4G1VA 4Z9YA 3RVDA 1Z8NA 5C81A 3ZWXA 2JLUA 3HYTA 4BGIA 1XTVA 3UJ8A 2ZBQA 4IH9A 4RMGA 3WXMA 1FUEA 2C3PA 1YF3A 1YIDA 4WDQA 2NVBA 4MZDA 2VG8A 4C6TB 1M8PA 2FQ1A 4OK3A 3DM9B 3DZBA 3NIWA 4IXWA 2PVPA 5FO0A 3ZWVA 1A5TA 5TGTA 2I55A 2AFIB 2OCGA 3EVEA 4JC0A 5ESRA 3TLEA 4DGSA 3B3JA 5J4LA 3KAJA 3ZI0A 5U4QA 1XCOA 3I04A 3R41A 1JEJA 2XADA 3D8NA 3EVDA 3JXEA 5TPWB 1ZZEA 1MX9A 1LSSA 3MWJA 3L1UA 1BMQA 2G88A 4NZNA 3UCEA 3O4JA 1O0CA 4ZICA 3ZWBA 2GEJA 1E0KA 3BTVA 2GPNA 1NMYA 4YP0A 5JOQA 4K03A 1C0EA 3PPIA 4CJXA 1W49A 3QEMA 4UNIA 4E13A 4G5FA 4W8GA 2JD1A 2VAVA 3VYSB 2R65A 5KHAA 3RVQA 3WL6A 3WGMA 1JHMA 3K73O 3HH8A 1X87A 1VSVA 2I6TA 3OPMA 3DTVA 2Q3FA 3JZFA 5FL3A 3NRBA 3RH0A 3T5MA 3U7QA 4CIVA 1EUQA 4RY8A 4X44A 5CVUA 1HT0A 3DZFA 1RQNA 4MWDA 4QTZA 2XLBA 4URWR 5AVJA 2O54A 2X0RA 1YHYA 4RS3A 4HDNA 2CKDA 1L7BA 2PV7A 1L0BA 2V6JA 2WF6A 3C6MA 1BSVA 2YNMC 3FRHA 2VQFB 4O4HB 1HKUA 2IYWA 1QQ7A 4PTZA 3OOEA 4FS8A 3E0XA 5CDTA 1SVWA 2XUAA 3JQ9A 1P5FA 1N2SA 2I4OA 4CDMA 4M9ZA 4Z6KA 1L4MA 5ALUA 4AY3A 2QK4A 5B30A 2QM7A 2VS1A 4U7HA 2O3TA 1QG4A 2HK6A 1NQ5A 5KC8A 1UKBA 1YQTA 4F04A 4PNZA 3DWEX 3H1PA 1TYCA 5KX5A 3Q2KA 3E53A 4B6SA 3EXHA 1CUZA 2XZOA 821PA 4M83A 1H05A 1KAEA 4GRIA 3NP9A 1PO7A 4K3VA 3GEPA 2DLNA 3LOPA 5FPQA 3G0HA 2IPMA 5ERYA 4AICA 1RPNA 1F60A 3IQFA 4JVMA 4ZTZB 1QRAA 1IBKB 2CJWB 3ONVA 3OFND 1E96A 2C07A 4RL4A 4FNOA 1U2PA 1SXIA 2ZRIA 3GN1A 4L4SA 2WJAA 4DIUA 3KKKA 1DINA 3I05A 1P2SA 4Y9SA 2NX2A 4ENUA 2OHFA 3PNOA 4XIIA 5JISA 3WLOA 1JIJA 1O96A 4FS3A 2QZ9A 1XWFA 1UAAA 2DQSA 4A27A 5B3KA 2F67A 3PI7A 3PEUA 3PDCA 3A4NA 5ER9A 4ZVPA 1H1TA 3LW8A 3QMPA 4J29A 2QJTA 3DB2A 4RFLA 4U02A 2WY2D 3ZHUA 4E5YA 4JQYA 5HHTA 2D7DA 1T0BA 3RBAA 3U44B 2I4NA 5TX7A 4KQ2A 2PLNA 5E3IA 3W79A 2E2WA 1EKXA 1QWOA 3HHPA 3OEEA 4RZ3A 4H59A 4CMKA 4DCVA 1DAMA 3EJWA 4B4OA 4EJ2A 1EP3B 1MEEA 1B7GO 2O07A 4E6PA 3WBKA 4Z1OA 3OUZA 4LDJA 4R2HA 3CLHA 4R0VA 3K05A 5REQA 1E1RA 2YY7A 3NHSA 2P9HA 3L43A 1OYYA 2BBOA 2QY6A 4ILEA 3ANLA 3K9NA 2GSWA 2SCUA 1QFXA 2XYVA 2LPMA 5KYUA 1KQNA 3AVXA 1PEDA 2G9NA 5C35A 3WYNA 3OKCA 1KZ4A 2F3UA 3CUEF 3DBOB 4L15A 5K0SA 2BGNA 5AK3A 1JLLA 4ZCRA 3BBPA 2G4CA 5BNTA 3BERA 1WR8A 3FYCA 1FJ2A 4I7EA 1R4ZA 2ANCA 4QEKA 1M33A 2DH5A 3FUVA 2Q62A 1CE8B 4BWYA 4FB5A 1YVDA 3QJGA 3HGTA 4N7BA 4G8DA 1Q0TA 3DL7A 5B36A 2F1IA 2IVFA 1DCMA 1XELA 2XTJA 3HG7A 3NTQA 3UBMA 4QODA 5I7EA 3HO1A 3OLWA 1GZVA 1L5NA 2WM2A 3OEWA 3MFYA 4KAFA 4BDTA 4YWHA 2XKBA 1GZDA 4CLRA 4PVDA 5I6DA 5K7SA 5C1OA 3AGPA 3OQPA 6LDHA 1C8KA 1YS4A 3IBCA 1Z3IX 3IUNA 5DH9A 4B3DA 2ZXFA 4IWYA 1OGYA 4TSFA 2BAGA 1XFDA 2G72A 1T1GA 3AXSA 4JJZA 4YI5A 4F72A 3ZIUA 1Y1KE 3KB1A 1ZIPA 5ARDA 5EP3A 2M6KA 2FSUA 1WULS 3WSVA 1CUVA 3F3SA 1MQ8B 2VNSA 3MW8A 1CUSA 5C1PA 4Q7KA 1AKTA 1WHTB 3KQOA 1XKLA 1N4DA 4MGKR 1AD2A 5B2ZA 4ZI5A 3RYHB 4Y9RA 3UKOA 1VM6A 2IYLD 1N2CA 5JCPA 3BJIC 3C7TA 1WAMA 4HXEB 4J75A 1EUZA 4BGVA 1E1NA 1BHO1 2HRZA 3A36A 4WNCA 3RS5A 3V48A 5JD5A 1UWVA 4W7SA 1GU1A 3EW9A 3HFGA 1Z0FA 3DZDA 3K5WA 3MXOA 1QBKC 4NICA 5K99A 5FFMA 5AW1A 3GRKA 3OIGA 4NYMQ 2IGTA 1T2VA 2CV2A 2O7NA 4F1KA 3HSKA 1IUPA 2ZWPA 2XMGA 5U4XA 5FOSA 3MT9A 1Q95A 3SBEA 3WLAA 4QQNA 2XXAA 4S04A 2PA3A 4AQYB 3H1BA 3RTCA 2E4VA 2OILA 5FDFA 4MKZA 2P2ZA 4EO4A 3AKDA 2M9MA 2VCHA 1DARA 2YMQA 4Q1BA 5F35A 3JAMA 5IUKC 1FB5A 4D5EA 2BFEA 3OOHA 1K6IA 3MJ4A 4KXYA 3EPHA 1VIYA 2ENWA 4E30A 1D6MA 5YASA 4C5AA 1Q0RA 2VK2A 1T8TA 3W5IA 1RJDA 1N92A 4LKOA 3E7DA 2C8VA 4AY4A 2BISA 2GAOA 3NTOA 1LTKA 3T7KA 2PAAA 2C82A 1G5PA 1CNFA 2FR8A 3PGXA 4QXAA 4J1SA 1FP1D 1THGA 2FX5A 3HCAA 2CFIA 3AUUA 4IUYA 1NJFA 2QN9A 3G0CA 1RR6A 5DK6A 3HJBA 5LZ7A 3WK4A 2J0QA 4I1YA 3UM9A 3ILVA 1OVGA 1Q74A 1VLHA 1GKYA 1ANKA 2PYIA 2VHXA 1RTKA 2OO7A 3IH5A 5AJVB 5H70A 1PFVA 2IEIA 3Q11A 3F6SA 2E4WA 2RGGA 4I3GA 2FPIB 3PD1A 4BQRA 2GFHA 3IT3A 4IDFA 4P08A 4YJFB 1AV6A 3DEHA 4PXYA 3VR4A 2ZRBA 3NIGB 4Q9JA 5FF9A 3SQMA 3VVBA 5E2BA 3PXGA 3NYQA 2DPXA 2ZS9A 1X7ZA 4X7PA 5PGMA 3EXEB 2GBCA 4FX2A 4Z8YA 2V59A 2X0JA 2XXBA 3T3OA 2H7XA 2YHIA 3HR4A 4DM7A 4IOLA 3OJLA 2I3ZA 3DFUA 1L1RA 2DQZA 3AUAA 2BFBA 4GPAA 1X39A 1VGQA 5CH3A 3T9CA 2ISQA 2Q3LA 3JVDA 4INPA 3I4CA 1QHIA 4KW7A 2OK8A 1JWLA 4D6PA 3QKRB 1QF6A 4OXNA 3KEQA 7ABPA 2G77B 2YDYA 2AK3A 1E2PA 3ER6A 1KE1A 4DIEA 2X8JB 4F3KA 4IGAA 5D5PA 3GLUA 2B6HA 1T4DA 3HL4A 3L6DA 2D13A 2FOIA 4GF5A 4X41A 2HWWA 2AVDA 3IAAA 2CLMB 3I9V1 4GUAA 2E5FA 2OE2A 4LXQA 4Q3CA 4RHCA 3FCAA 1BMDA 5G4KB 1U0NA 3LF2A 4ZVSA 3UV6A 5KQMA 5DBIA 1SBIA 1SHTX 1WCIB 1CG6A 2XJ4A 4LPSA 1HFWA 2FUCA 2O3QA 4BATA 2ZAMA 5I7WA 4ISCA 2H1RA 1K75A 3T9FA 2ZTLA 3ER9A 1L7XA 3THWA 2FFAA 4EEZA 5IHPA 2J4CA 2W6JD 2E18A 1JG3A 2W71A 2AXEA 1MBZA 2HA3A 2Q2NA 2XBLA 3M1YA 1XDDA 3H2ZA 4J0CA 4OMCA 5AM1A 5GOZA 5TJ9A 4X45A 5BP7A 4DWOA 4JBXA 1VJGA 1CDDA 1HE8B 1PS8A 4N18A 4JVNA 3PK0A 4KEAA 4Y2UA 2HDOA 1C2YA 4NXNB 5A4JA 5L3ZA 2GFQA 2R11A 3K0AB 3L4EA 3PF8A 4F84A 3BCHA 1GTRA 1K3UB 3TM5A 4UBLA 4L73A 2Q99A 2XNCA 3FX2A 3GHYA 5FA6A 4P83A 1KSHA 2EGHA 2VDOB 4DN6A 1KI3A 2WFAA 2BGWA 1QQ5A 2BE7A 4YJGA 1J39A 2Q8NA 3D2BA 1JIVA 4TYWA 4UTNA 1A9XA 1QZUA 5A1TA 3BPSA 5JS6A 1GD1O 3HCWA 2ZJ3A 4X1KB 3ZTTA 3F8WA 5TQ0A 4RF2A 1GAEO 5EWMB 3H75A 2E4UA 5EG5A 1JEQB 1E2JA 4M38A 4QTXA 3RIEA 2XBUA 2QD3A 1T36A 4EY4A 3KSMA 3KUUA 2JGLA 4BNWA 3LP8A 4YMWA 3KQKA 3O3CA 2HMVA 4QULA 5FCDA 1XNHA 4OI4A 5KHOC 1M2WA 3E5RA 2C9OA 2XA1A 3PXUA 3FOCA 1WY7A 1KIFA 4GWKA 3CW8X 3ITKA 1JNXX 3DEAA 1EYZA 1G5FA 4AURA 4RDIA 1WEHA 3D59A 3LYHA 1CLUA 3MINB 3GLVA 4HFNA 4A26A 4M1YA 4YCSA 5JAMA 4YJ2F 3WK8A 1BS9A 4QDOA 4C4AA 2VDLB 4PIPA 3LLSA 3NBFA 2HJSA 4FFLA 5I9NA 5BW4A 1SWWA 3JQ9C 1Z82A 3O83A 3RIYA 4HNRA 4IDQA 4YRCA 1YRHA 4MLDA 5DHAA 3UV3A 4BO9A 3HWWA 2ZVPX 1ZM4A 3FBTA 2DB3A 3FTEA 1C3EA 4FFMA 3R0JA 4P33A 1IN7A 1TPYA 1XD2A 1XMSA 2YIVX 2ZJZA 2P30A 1T2UA 3IUPA 4GDMA 2R1TB 4HYQA 1Z4MA 4YCJA 3VUEA 4C1NA 2ZXEA 5I8WA 4FFOA 2BZ0A 3EXHC 3G59A 1P1BA 3G0BA 3CH5A 5BWCA 4QOGA 3A3OA 1R8QA 3X1MA 4BP8A 2AVNA 2W4QA 4O29A 1OV6A 1ZIDA 4OL9A 1XUOA 1G3QA 1P0PA 3PYXA 1JEDA 1QIKA 4F3RA 1DS6A 1DXYA 2Y1FA 5D86A 2JGKA 3DDCA 4QAJA 2P4HX 1IMJA 4P0TA 3ICEA 2V4UA 1CR4A 2B83A 4WUTA 4G9EA 2MSCB 1VGRA 3HJFA 1L9XA 3U3JA 2HPAA 2F00A 3ZU2A 5LPNA 2BUAA 4MMZB 5FQOA 1AMUA 1OKKD 3KLOA 4IHKA 4YQYA 5CITA 4AMVA 3G9QA 3BX1A 2XT9A 5F4ZA 1DAOA 2WSMA 3WKAA 5BNZA 5EN4A 1U0SY 2IRWA 1RPZA 1WKBA 1PTJC 2GPSA 3WFIA 1UXGA 2JDID 2PDAA 3PDHA 3PXDA 4YDHB 2B82A 3UJCA 2Q4TA 4F4CA 2O8FB 1ZU4A 2FX2A 4OHBA 1Y5LA 1Z2PX 4XFKA 1VKNA 5IXYA 3WG9A 5JG7A 5GQSA 1HE5A 3VA7A 1EXDA 3DQPA 4FQ7A 2IPAB 4QJIA 4C4ZA 3KWMA 5I7VA 2FSHA 4ZXPA 2PUAA 2HCFA 4BFLA 4TWAA 4X1IB 1IUKA 1VL8A 4M54A 1Q77A 4EJSA 3D31A 2I6XA 1JNYA 2VZ0A 5EKSA 3VVLA 3EHEA 1JE0A 1QGED 5JSZA 3R1IA 5K4HA 1VA4A 4GEKA 4DQKA 1XMXA 2UZ1A 2W6CX 3RAPR 3ZUPA 3L8YA 4F2DA 5DIZA 5A5DA 4FHDA 3IB3A 3DZIA 3U09A 1NVDA 3C8UA 5D5QA 4Z86A 2WVJA 2B7LA 1YT5A 3S5JA 4RLQA 4X7RA 3N2LA 1Q1GA 4JQZA 1EDEA 2OENG 3D7MA 3TZKA 1G5QA 2R9VA 1KI2A 2GT1A 4GI3A 3ST7A 3C1AA 6PFKA 5AKZA 3OOYA 1TIKA 1KK3A 2DQYA 4XD7D 2RAUA 3KUDA 3R9WA 1TO6A 3TLCA 5AVXA 2NUAB 1H2EA 4ZXFA 1BJTA 1T0IA 4UDNA 3E9CA 1SIBE 1IB6A 5KTKA 4K2HA 1Y8ZA 1PUJA 2IEYA 1WSBA 3CX3A 3FTCA 4J7XA 5J3JA 4O3MA 2XUPA 1UDAA 1LW6E 5DISB 2CEKA 3KEMA 3T06B 1EFHA 2VVTA 4RY9A 3UY4A 4W9MC 3FG9A 1US8A 4MULA 1GYQA 5KYVA 5EIBD 5HF8A 2XUKA 4YQEA 1YI0A 5CAEA 2JKYA 1RWWA 3OLVA 3S1SA 2FGKA 1U9JA 3FVRA 1WDMA 1KDVA 4WASA 2JGDA 2P91A 3FPKA 5HKLA 2GYVA 5LDGA 2TECE 1NN5A 1SXJA 1KMQA 2XCOA 2A0WA 4MV5A 4RVSA 3NMUF 2Z8ZA 2PHZA 3AI2A 4J9UE 2R25B 5ALEA 4EGAA 3WMEA 1IEVA 3WC4A 2B21A 1EFAA 4Z5XA 3ZKWB 4WK2B 2DBZA 2VBGA 1GAQA 2EP8A 5KWIA 4IQGA 4UC0A 4XGRA 5FWYA 1X86B 1OHHA 4F8YA 5EJ7A 3PR3A 3KD2A 4S1VA 4W9NA 1U7PA 1T5DX 4BPRA 4B31A 5FBQB 3DMFA 2J3MA 5FJJA 2Z09A 4KXLA 3KC2A 3BMOA 3SMVA 5A5VA 3BQNB 3AVYA 5LLDA 2Y76A 2EW2A 4NYIQ 3GEHA 2HDNB 3WJ2A 2P0AA 2OZLA 3QXJA 2BSAA 2VK8A 1ICIA 1TX4B 5EEGA 2C04A 2FMIA 3A3NA 4RKYA 4WWHA 2QN6A 4C0HA 3GUYA 5K6AA 1UFKA 2F59A 3U4AA 2O1EA 3L7IA 3DJYA 4OQFA 3L5OA 4PHFA 1ZUNB 3W2IA 2CVOA 1RM5A 4UDXX 2VXYA 2QU7A 1CUWA 2JHPA 1XMJA 3D3EA 1LPMA 4LHZA 1FTQA 1JPVA 2FR8C 2AN3A 5T7BA 1FNNA 2KYRA 2R3SA 2QTBA 4WFKA 3ZNNA 2EBFX 1OYVA 1S4QA 3I6BA 1L5ZA 3BQMB 4MW0A 2E0IA 4DR6B 1ZX1A 1R4MB 2AWOA 1GSAA 1JMYA 3O6VA 1NC3A 2ZIAA 3R5JA 4MXDA 4UHCA 1CKEA 4GVLA 1AJEA 2PTHA 5ALPA 3QKSB 4EG1A 5ALJA 1P9WA 2BM0A 1T26A 3LU1A 4YNBA 4F0JA 3FETA 4WMLA 1FUKA 3OJ0A 2IYRA 4MW6A 1MO5A 4FD2A 4GPTA 2B4QA 1NPYA 4E88A 2NV6A 1PT9A 5ALRA 2EJUA 4RQTA 3ZV7A 4TXNA 3HN2A 4V0SA 1J8YF 5AK6A 4PN7A 1X1TA 2ACVA 4AN1A 4DPLA 2RGBA 3NV9A 1GT91 2ESRA 3LLUA 3PFIA 4AX4A 1W87A 5HBRA 1VJ5A 1ZISA 1TJPB 4MUJA 2GEDA 5BURA 2O8DB 4MVJM 4D96A 4FUTA 3TOXA 3WR5A 5FFNA 3B89A 2BPOA 3GJ6A 4O4LA 1JTEA 3H42B 3P27A 4A2PA 3MTEA 4OGFA 2VCYA 1QHFA 4HDSB 3GFBA 2ZAIA 3PA8A 1OY1A 1MFPA 1A8UA 1W8DA 3LL4A 4W1RA 5AWFC 2X7JA 1JA9A 3TXAA 4Z4HA 2A1UA 2H5IA 4A5SA 1QG2A 2MDTA 2YFHA 4FSDA 4MK4A 4AJKA 4B9EA 1J9GA 1JHDA 4CR8A 1YDHA 1FZQA 2OMEA 4MQLA 2WWYA 2AOXA 2BFDA 2ZBPA 1J0BA 1RAAA 1NBME 1T6BY 4NI5A 3C8MA 3EGEA 3DL4A 5H02A 4A8PA 4BU0A 1GGHA 2XDAA 2PL3A 5GP1A 1XO1A 3UGKA 3ZBPA 2GK3A 3KYCB 5HIAA 4W5TA 2I2BA 1GP2A 3T6KA 1CBUA 1YCGA 4XGIA 4ZYUA 1JHYA 1XLWA 2KWIA 2MINA 4P84A 1PP4A 2WB2A 4ZAYA 5AFSA 3ZWOA 3C16C 1T9DA 4EARA 2FPSA 1HORA 3WRYC 1E18A 1Q7BA 2J87A 3TTUA 4ZYZA 3H86A 1EHCA 1ZZGA 4S0XA 1H2WA 2E82A 1UKZA 2R6AA 1FFXB 3GT7A 4K88A 4V2UA 1KEEA 2B5WA 2B7BA 1BRMA 2BKLA 2UVPB 2WZQA 2ZKIA 4PGHA 4LF7B 1L4EA 4IMIB 3H2GA 3VJLA 4FGSA 1YR2A 2FFJA 1NF9A 5FKJA 2WWVD 4WOPA 5B1EA 1OWOA 3OT1A 1YB2A 4DCSA 1PR2A 1XDUA 4Z3KA 4QVKA 4OUDB 3CQ9A 1BVYF 2WUEA 1JXMA 4M8LA 5GOTA 2QD1A 4DJDC 2D74A 2ENUA 1NR5A 3GFTA 2A33A 1FVFA 1ZD8A 1SH7A 1GAWA 1V8BA 3M4NA 3PDIA 4JJKA 4R1PA 2DFTA 1L7MA 3OZ7A 3ANNA 3ESXA 4LE0A 3A6HA 5IUNC 2PRIA 3LUAA 1BWSA 3E3NA 5I9SA 2B4KA 1LWOA 2R44A 3PJDA 2JI4A 2WD7A 3F96A 3SM3A 1AU9A 1JDJA 3D2AA 1Z6AA 5CHEA 2H65A 2GCOB 4ZVQA 1Y34E 2Y1LA 2NZ8A 5CHYA 2NSLA 3EW7A 1ISJA 1EGMB 3LDUA 4XVUA 5BVHB 3I6ZA 1J8QA 1N2ZA 2PS0A 1EFPA 1HFEL 1QVVA 4XCQA 1UJ4A 1P7ZA 2QP9X 3CCBA 1WB5A 1IJKA 3T7IA 4M55A 4RZXA 5BOVA 2PSFA 5KCMA 4TWZA 2D2FA 3B5JA 1SC3A 2XVAA 2TMKA 4II3A 3F2IA 4BMVA 4CHTA 4NR0A 1GM5A 2G5PA 2BGUA 5F3RA 3OF2A 3TZ6A 2NTYC 2O5RA 1S5PA 2L0XA 3F3MA 4AZTA 2L2QA 1U7OA 1VYVA 1K8QA 3DB1A 2QRUA 3P9PA 1QH8A 4XQGA 1G2OA 2D0OB 3ZC3A 1VLZA 4ND5A 2JKVA 1O6FA 4H7KA 5A1JA 4X8MA 1GKUB 2CBGA 4B83A 4DARA 1HZJA 4E03A 5A5FA 4JOQA 3IJEB 4HAIA 1C0PA 1CY6A 1ZNWA 4A82A 4YP9A 4XJVA 3E15A 3QYFA 1WXXA 4O1MA 3NM6B 3OPXA 3ZE2B 4NK4A 3I9V6 1GOTA 1GN9A 3KFXA 4RJ2A 1P0IA 4DUYB 3KVVA 1ZNYA 2GJAA 2LR0A 3CX7A 1C0LA 1HXHA 4YO7A 4L3OA 1RLTA 2OSBA 2QPAA 1P2FA 2IYXA 1C3OB 2Q5CA 3QEAZ 1LS6A 1OFGA 2Q50A 2RGEA 5L7WA 3TVYA 1TEZA 1CPYA 1M66A 5EESA 3M1AA 1ESDA 2P9CA 3HVKA 1LSJA 3ITNA 1DLIA 1EK0A 1U8YA 3HJNA 1XL1A 1FY2A 5HQTA 3JYPA 4EJSC 2OHXA 1GPYA 1TU3A 2XUFA 1RXVA 2H4XA 2OSVA 1U9ZA 2J31A 2Q4DA 4OSPA 2J3LA 4NKRA 4GGMX 1RJ9B 2OV3A 2P4UA 3IPXA 3QYPA 3VO1A 5BWLA 4MDEA 2ZOSA 3GLHE 3LYAA 4DMUB 1VZ3A 4JC8A 3AG6A 4BGUA 3BMNA 1E92A 1TEVA 4K40A 3E9NA 4XQ9A 1YDWA 2ZUUA 2VTKA 3HI6A 4HPWA 4ZARA 5AIAA 4EGJA 2GHQA 3EZYA 2BY4A 2X13A 4DQXA 1RZVA 1JP7A 3Q8WA 3T9AA 1TKCA 3F74A 1E9BA 4JENA 5F5NA 3OTHA 1T5OA 1PFGA 2HEGA 2EFHB 2GB4A 4MRMB 1Z83A 4RPKA 1INLA 3LBYA 3P0HA 3THYA 5IMBA 1A2BA 4LRUA 3ZW9A 1I3KA 1JQ3A 4N65A 4YLGA 1MDBA 3DHYA 3FYUB 5JD3A 1WDWB 4LYEA 3ZHYA 3K0EA 3CEHA 3ZDQA 2Z8XA 1AKRA 1NYTA 1Z2CA 3IFSA 4OEHA 3S2UA 1DEHA 2WIKA 1C5KA 3QKUA 4GECA 3ROPA 3DCYA 1CXZA 3OESA 1X7XA 4P86A 3UTDA 1LLFA 5CT6A 1E3MA 3JPYA 5IU6A 4QOIA 3KDSE 5DTIA 4CFZA 4HTFA 1UWCA 4YUAA 2ZWIA 3DMYA 5ERXA 1GA4A 4JN6B 5E1MA 3JD2A 3RNLA 3CKKA 1AKYA 3AEXA 4MUBA 4AMYA 5IT0A 4FYMA 3N2KB 3QXCA 1RJGA 4TYPA 1XQ6A 3E5HA 2QUHA 1GRCA 1T29A 1E3WB 4K86A 1WV1A 4NCIA 2O0KA 4OYYA 3BDIA 1R27A 2ZW9A 4OFBA 3LBIA 4J16A 1TCUA 2VDQB 2VHEA 3I8XA 4UXIA 4CV0A 1GKLA 4FJ2A 2W2VA 2JBWA 2G6TA 5SZHB 2C29D 1XYYA 3RVSA 2O8VA 4NZ9A 1EWTA 3CGGA 3SM9A 5K0GA 1NBHA 1BXGA 3PL5A 4N5DA 3VOAA 4L6IA 1WCV1 1BU8A 4KPUA 4DNXA 2O05A 1MLDA 3LBHA 1FRZA 2BCGY 1Y9ZA 4UQPA 3B2NA 4BFUA 4W9NC 5KMGB 1ICEA 3W8FA 1TUBB 2F1RA 2XUHA 3HBAA 4H6WA 1ZS9A 4B3BA 2W42A 4AT1A 4D42A 1S2DA 1RWOA 3O4GA 1T9GS 1SHUX 1GL7A 3K0CA 1OFTA 2QRHA 2AG8A 3H1GA 4PS1A 1O6ZA 2G1JA 3ONEA 4DLYA 1JIQA 1I7SB 1CZHA 3KKOA 3P26A 3AR7A 4RTSA 2VPZA 3IV7A 4GMKA 4MZXA 1NVGA 4A4DA 1NJ2A 4KQ1A 4HX9A 5FBVB 1E0SA 1TK2A 2CXTA 5GM1A 4JUIA 4UCXA 3FTFA 3RG2A 1V9CA 2MMCA 5TC4A 3DH0A 2CMKA 3G9TA 1OTHA 4P0QB 1NBMD 3VDRA 5HCUA 1HDIA 1YTLA 1M6YA 3I4LA 4OG2A 5IAGA 3ONDA 3NNSA 3OWOA 4Y6QA 1TL7C 4PX2A 3UFXA 1SD5A 1IY1A 1QOZA 1U63A 2W6IA 3NI2A 3PFFA 1KGDA 2XF2A 3IKMB 2DKFA 1RHUA 3DVLA 3LFTA 3SXJA 4G2TA 1L5MA 1WL8A 5BSVA 2X0KA 1LGYA 4PLZA 4WACA 1KI6A 3QE3A 3T4UA 1QV7A 4EW3A 3AF6A 3K1JA 5B53A 3WLKX 3OPYB 5FOUA 1M67A 3FDZB 3T54A 1WCYA 2AV6A 1OAAA 2JIDA 2WICA 4MPTA 4QO8A 3P71T 3ZDFA 4WCDA 3FYSA 3GNSA 5FWDA 4ND3A 4YIHA 2WYUA 2PQMA 4E46A 5CB4F 4U3JB 4DLVA 2XSZD 5KCZA 2RAPA 4AMGA 3QVVA 5ALVA 1PWZA 5A2GA 3RLFA 1T3TA 5DKFA 1JTFA 3ASUA 1BG6A 1TGYA 3ESAA 1PJAA 5LWHA 5D8DA 4EI9A 2WHPA 2YYAA 4IMRA 4KP7A 3TLBA 1XCGB 2C0CA 3PFBA 5HJ7A 4C4PA 3K1AA 3PT9A 4MW9A 4MQFB 2AFRA 5LD2B 1RT9A 3TD2A 2DWCA 3V3TA 1JEOA 3E7XA 4JBYA 4LJ4A 5KQGA 1F48A 3BMXA 4KXXA 2NN3C 3DAPA 2FFRA 1G3UA 3O03A 4ON9A 2Z3ZA 4HB4A 5L7TA 1WM1A 3ND8A 1DT3A 4X9XA 2IY8A 3O9VA 4C3OB 2IS4A 2PKXA 4CG2A 1JYFA 2C7RA 9LDBA 3KJGA 1DKOA 3BJMA 3TX6A 3GLHB 1LBQA 4UPEA 1KBOA 3RIMA 4HWSA 1XZHA 1OVMA 3B53X 3KAKA 1XRRA 4DCUA 1E94E 2G82A 3NS7A 3SN6A 5A4DA 5BMOA 2PMFA 2R7KA 4HQFA 2WU1A 1ULZA 1CHNA 2BJWA 5GVRA 5KUTA 4XPIB 5DTEA 2P2NA 3PPWA 4Q9NA 5FUMA 4X54A 2PYDA 3F5DA 2VFAA 1GVNB 1NKVA 2RHJA 3VI4B 3P2IA 3B6ZA 3JQPA 2C2KA 3NHMA 1I2MA 1L9KA 1YCDA 2IU4A 3VPSA 3O8CA 3ZNQA 4ZCIA 2HU7A 3SKVA 3UB4A 3QQ5A 5K01A 5CX4A 4INJA 4CMIB 4M9UA 4YJHB 4NYMR 4BQEA 1RQPA 1EFCA 4KMRA 1Z73A 2W2NA 3HRKA 4S35A 3RROA 2A94A 1ZMBA 2TS1A 3NPMA 4RETA 3W5SA 3PE4A 3UMBA 1U9YA 2VJMB 4L5JA 3TCKA 4MEAA 5K8VA 2UYCA 4U7GA 3WLQA 2V3VA 2Q1SA 3CPHA 1M7BA 5HRAA 3I6YA 4CQMA 3A4VA 3FAZA 4F5YA 3TEMA 3BKXA 3AF5A 4IHJA 3CRW1 2ONJA 4JI2B 1Q44A 2WRZA 4QFMA 1L5HA 1E4EA 1UFRA 1DMSA 1Q7RA 4BWVA 3U3ZA 5IVPA 4QL3A 5HKKA 4MQMA 5BMVA 4DXHA 4RM3A 3TXYA 3ZN2A 1RKBA 2UVDA 1PZGA 1QYDA 3Q8KA 1XQWA 2WWWA 2OGZA 4TYMA 1WLSA 2ODWA 4DV1B 2H9YA 3E35A 1MEJA 4HNSA 2F1JA 2BIFA 4LN1A 5M2QA 3ESBA 2APJA 3PQCA 4GZLA 4UBIA 4ZAXA 5JXWA 1ESMA 3RAEC 3IDSA 1ZI9A 2F90A 2RONA 3NM4A 3UCXA 4AJNA 3I1YA 1A9TA 5F33A 1K4KA 1N8SA 4NARA 3RFUA 5CG1A 2KE5A 2OBLA 1C1DB 1VJ1A 3I2IA 1N8KA 2AB0A 5C8YB 3FDIA 3RJMA 4N40A 2LDBA 1A04A 2P6OA 3P9YA 3RYIA 2XD9A 1CETA 1PJCA 3NHRA 3E6AA 4HFJA 4MINA 3OZXA 3H9JA 4OK5A 2Y9MB 5HTKA 4BMPB 1P74A 1W19A 4BCBA 3BWVA 3MWEA 1H85A 4D8YA 2ZJ5A 3QVJA 7AT1A 4P54A 2XGGA 1XB2A 1ACLA 5JFTA 3DBHA 3EARA 2V3WA 3UUEA 1N36B 5K20A 1PJBA 1UMBA 2I4MA 3NHBA 2PZKA 5EJIA 3U7IA 2QHXA 2DERA 1GA1A 1IWPB 1J00A 1J06A 1P1FA 3FR8A 3PUYA 4QGBA 2IVZA 2ZE7A 5EWJB 1TOAA 1FQJA 1P2BA 4HXYA 4DT1B 3L6UA 1DO8A 1T6XA 1GG8A 4ZREA 3WLEA 3C7KA 4DBLE 2OZKA 2NIPA 4WN9A 1FF9A 2CDBA 4D9CA 4FE7A 5KI6A 4CPDA 3FWPA 3LCVB 5B4TA 4F12A 2ZUSA 2XKJE 1VIAA 1NMXA 3VTKA 3EB9A 4EPRA 1ZLXA 3II6X 1IQUA 2HGSA 2QUIA 4Q34A 2CK3D 4XFDA 4BFYA 4FLMA 2DY0A 2OORA 3K8ZA 4M0UA 4M0PA 4RK7A 5EJ5A 3R4VA 4PFJA 3KHUA 4CUJA 4X64B 3VPCA 3OT4A 3F6EX 1D2RA 3RTEA 3QFCA 1JQ5A 3MAGA 5BN4A 3I32A 3QUCA 3GK3A 4KHZA 4BNFA 5AUOB 2FWIA 1N7HA 2W2KB 1P9RA 2BTEA 4ZT4A 3TD9A 1CJUC 4CR7A 4F1WA 5AUQA 2YR0A 3RRNA 1U5BB 10MHA 2QDXA 2JRCA 2YNMD 4I8XA 4FXOA 2G83A 2YVQA 1V3TA 1C3LA 4QZVA 1BW9B 1OSNA 4IDAA 4JFRA 3IDZA 1HE2A 1OX4B 4H3KB 1GCUA 1LBSA 1OWNA 3BCRA 3H5IA 4JU9A 2WPDA 4BNGA 4BNJA 2FPOA 2GCNA 1Z2OX 3WYBA 3PT5A 1IQPA 2YVLA 4ZZ0A 4PN3A 2PZEA 1TRHA 5GWXA 5TNXA 3RRBA 3SOPA 2EKQA 3U4HA 2W2TA 3IUMA 3KQQA 3THXB 3IAXA 2IHVA 4PYQA 4ALIA 3E05A 1L6IA 2BV3A 1CEXA 2EHJA 4RDXA 1MC4A 1SG6A 4MEBA 4UBJA 2QTCA 4RE6A 3HZOA 3JX9A 4OM7A 1G6KA 2WIAA 2NXWA 3ORFA 1C7RA 3LDHA 3M2TA 4R5MA 1SC1A 1W46A 2FN7A 2HO5A 1F0YA 4IMJB 4HZUB 1TKRA 1ZI6A 3K71B 4BO8A 4G0MA 5FAXA 4IZIA 4IZ6A 3OLXA 1B43A 2HLHA 2IDMA 3DF9A 1E6KA 2HF7A 2HHAA 3EZFA 1T1IA 1U3FA 1G7RA 1XZLA 1YBHA 4BB5A 5L8VA 1YZVA 1MT0A 1TC2A 3D5TA 5E6RA 5E8JA 4GKAA 4LY3A 1U7DA 2SNIE 3QFTA 4EENA 2V7QD 4ZEXA 4FR0A 4PSDA 5CPBA 5E2IA 5DNVA 1N3IA 3FM9A 4J16C 3BQ9A 1PBTA 2IXBA 3H9EO 4UBOA 1EI9A 2RGCA 4NZZA 4KTVE 1GZUA 1IBCA 2M6SA 1SD1A 3A1VA 2AJDA 3AWDA 3E58A 2OOSA 1XOIA 2HN9A 1V11B 1GNQA 5AOAA 1KK0A 2F62A 1V4NA 1BCRB 1R5OA 1V6AA 3OQHA 1JILA 1QC5B 1EJ6A 5BRNA 5KKAA 1B14A 4OHPA 1GZ3A 1XVVA 2I1WA 2C95A 3KEFA 4R2XA 1PE0A 3U6BA 1EE9A 3RRZA 3M6MD 4HDQB 4L02A 3L2OB 2WFLA 2YN0A 3G8BA 1D9XA 3FUXA 3K0CC 1XNRB 3UEOA 2AJLI 2PO7A 1NR7A 1DB3A 2Y4OA 2RB4A 1N7JA 4NJMA 4QATA 2OECA 2QZJA 1P44A 3BSSA 2EL9A 3TKYA 3QVLA 4QBFA 4EG3A 1MABB 3SVTA 1NFFA 2KBFA 4OLAA 1MAAA 4ZDJA 3UWMA 1JEYB 3D7LA 3X44A 1A9SA 4DL9A 4ETMA 2AFHB 2AZXA 4REOA 3P9XA 3S1LA 2ZAYA 4IIXA 2ZB4A 4FZJA 2IDZA 2PUTA 3HB9A 2XCSB 4ESVA 4ZYXA 2VSXA 3CF0A 2MYPA 1PT8A 4HUQA 4QLOA 2GM3A 4F4DA 4GL2A 3W4IA 2PK3A 3LTEA 1ZC3A 4KH0A 1MQSA 1RAIA 1HEYA 1M73E 2PFKA 2Y4NA 5DBGA 1EUDA 1UBSB 4CMCA 4J0EA 2W6ZA 1N6HA 3TAUA 2JGAA 4X84A 3A1EA 2J3QA 3DOJA 1Z5NA 2H1CA 3MAJA 3OHPA 4A5OA 4MI9A 1LXCA 3NBZC 4GM4A 5JS2A 1BNCA 2MSWA 3DT8A 2IYNA 2V5UA 4UXHA 4V0KA 5EKUA 1E60A 2DT8A 2HZBA 4HNAA 2DJIA 2W00A 1X1QA 4JLMA 4BV2A 4RBNA 2JAWA 3EUFA 4L7VA 2GTIA 4TQ9A 1UMCB 3USES 5L7YA 3C3PA 3USZA 1MAWA 2PSEA 3H6HA 4YRGA 5JSQA 1V1RB 4MUYA 1E6UA 4NC9A 1I4TD 4YMHA 2OWEA 1N2HA 2HDWA 1ADFA 4JT8A 4W6QA 4FMDF 4PNPA 1VMKA 3BL8A 3PNVA 4BP1A 1P60A 3VPBA 3LYUA 2GAFA 2IT1A 4Q1VA 2NT3A 3OLCX 4X65B 2QPOA 3FGPA 2W70A 1D2MA 4RH3A 4KRFA 4R01A 2VXCA 4MX8A 4NH4A 2NMVA 4U0JA 2JAUA 3K2BA 3ZE0B 3WIEA 5KX5F 3EEQA 2GCIA 3LUDA 3AEUB 3QW2A 2YUIA 3QX9A 2A4MA 4NNOA 2CHGA 4EJMA 3OZGA 4WERA 4JI8B 2NP6A 1Z6TA 4BKPA 3CC8A 5IF3A 1NW6A 4CV2A 2VAWA 1QO0D 3WYGA 1Q22A 1YZHA 3NTVA 1M2OA 2IXTA 2QX9A 2VTVA 1O58A 1P62B 3INTA 3LHDA 2AW3A 3A4TA 5JLAA 2FA9A 5AHWA 2Z8YM 5KSPA 5TMEA 1VLMA 4AS2A 4C01A 2C0QA 3M4XA 3DEKA 2HBZA 2OP0A 2UV8A 4C21A 1QGAA 2P2DA 3P9QA 3ZOKA 3OX3A 4BKRA 4ARUA 1F1BA 4EOGA 4DVJA 3CUKA 2NYAA 4BEVA 4FEYA 5HS4A 1NJ1A 3KTDA 3LPNA 4O0MA 3ESRA 4C76A 4YT4A 2VUSA 4Q3KA 2R4UA 5ADVA 4NYIR 3PCXA 2O2XA 2WF5A 1T25A 3DE4X 4TKVA 1RWPA 3C7AA 1T9CA 1XPJA 1R2QA 1ZK1A 2QGFA 2ZS8A 1FW8A 1AS2A 1IQ0A 3DVAB 3OVMA 5CPFA 4CMEA 2VK4A 5E4TA 5JJIA 1BVRA 2QTWB 1ZHHA 3FPGA 4CMBA 5K2MA 3CJTA 3RIHA 1RM3A 5DLDA 4MRPA 4PNHA 4MS3B 4W1PA 2B99A 3V80A 1EXMA 1WBBA 2QQFA 2ATXA 1JIIA 1TMGE 3R77A 1N6PA 5C51B 2O8CA 4CGYA 2HA5A 4P31A 5TSDA 4CM9D 1BMTA 4X7BA 1WXHA 3CZMA 1W5TA 4DA7A 1OLOA 3LX8A 4IFBA 4ZOCA 4EJ6A 2B36A 3K70C 1WP9A 1FVXA 1NRXA 3O8NA 4KYTA 4TS9A 4UNPA 1P4HA 1PVDA 3PX2A 1ESNA 3DKKA 2IKSA 1TW3A 3RAJA 4DCOA 1MOZA 2I7TA 4LF5B 1KR2A 2GK7A 3M6WA 1FNCA 1X1RA 3GDGA 3BH7A 4MKIA 4CTNA 1G4AE 2BDTA 5FBHA 5G3YA 3CXRA 1WDLA 4EM6A 1M1YB 3WV4A 4DR5B 2DRIA 3GZTB 3EGWA 4AG5A 4OGGA 1VE1A 4QPJC 4ZVUA 3TNDA 4CM1A 1DDOA 1GCGA 2QV7A 1KMHA 2I2FA 3IBTA 4QD3A 1RE0A 3C8DA 1GXSB 4LCJA 1WMAA 1RYHA 2IPLA 2R1UA 3HYSA 2D6FA 2IXFA 1MPXA 1HTBA 2WINI 3ZWCA 4CYMA 2GX6A 1I6MA 2FI1A 4MP8A 3CF4G 3RCBA 1EK5A 3L8MA 2BFFA 3DBLA 2XHEA 1R10A 3EXIB 4GQIA 3F8TA 3X2EA 4BE9A 5HKOA 3R44A 1A76A 3HLKA 4NBVA 5FH9A 4Y2GA 2V1UA 1QHHB 3MT0A 3FKJA 1GDDA 5JWOA 5A62A 1DLJA 1GFZA 5IDXA 5BPHA 1L2TA 3VDMA 2I62A 4B0PA 1GV1A 3NWBA 4WZBE 1GIAA 5TY0A 3SLRA 4C6RA 9LDTA 5ICGA 3MNFA 4BB6A 1R18A 3GP5A 4C0QC 2XMSA 1Y5MA 3DE0X 5E95A 2RI1A 3T5TA 4Z7NB 4ROTA 5ALSA 2DX7A 2QV0A 1N9GA 3SFTA 2Z1DA 5K8TA 1M8FA 4P7GA 4EMSA 2J3IA 1IN6A 2JAQA 4PX5A 5D5HA 1SHKA 4EQ6B 2OORC 1UJCA 1Q7GA 4K9DA 2W5UA 5COQA 3T7AA 3WB9A 2BHRA 4ME6A 1IG0A 4RPHA 4H31A 3HNRA 4Q39A 5ALLA 5EMNA 2EIXA 2NSDA 4N49A 3N7TA 5BN1A 2GPJA 2I8AA 4FZ3A 4UAJA 1B6SA 4H7DA 4I66A 1RDFA 3VPFA 4GYWA 2QR5A 1FVHA 1QV9A 3NEYA 5K03A 1CF2O 3OCJA 5IJAA 3JWGA 4P3PA 1DKUA 3I1IA 1AY0A 4J91A 4C29A 2FSSA 4NENA 1LSOA 2NO9A 1V3VA 3JS5A 2QYHA 4R8RA 3BWBA 2AQKA 5LKRA 1IN1A 1KI4A 3BZWA 3TQRA 2A59A 2HFKA 3QFRA 1G5TA 4R1OA 4GPIB 4G0NA 1XTJA 4M8SA 4TKMA 2ZYTX 3FKSA 1BEUB 1P6QA 3M9WA 3M89A 1N2GA 1SC9A 2CB0A 2VJLA 1DG9A 3AB3A 4JMPA 3ZWPA 3UMJA 1PX0A 2J9ZB 2O1WA 2XYPA 3DXXA 3G13A 3TTSA 3UK1A 4UU8A 2QXTA 3OD1A 4DB4A 1V5WA 4KSBA 2GEBA 3JV7A 4PBSA 3EZNA 3K9WA 2PT7A 2QRNA 5L3RA 3H3FA 4UHBA 2ODAA 4F4IA 5I4KA 5L53A 4M86A 1H2RS 3GD5A 2O0JA 3D5EA 4OLFA 3A6JA 2J46A 4D7AA 4BYMA 1QM5A 1KERA 1UZLA 3GDWA 1QPGA 4IVNA 3HFJA 1IU9A 4NP6A 4WLVA 4Y9TA 2FE4A 5F1OA 1HG1A 2Z4RA 3EXFB 3H7IA 3SKXA 3WHIA 1XSEA 4HP8A 1A71A 2C59A 1M2EA 1HYHA 1BAPA 1TM3E 3E3OA 5LDDC 1MXFA 1YD7A 3T3HA 1OH5A 1U0FA 3W8NA 1DOZA 5CFMA 4Z4FA 4QGSA 2AS0A 2J08A 1D09A 2FJ0A 3C1TA 4IDHA 3HYLA 1FXWA 3A4YA 2AD1A 4BRUA 4EVRA 1BOFA 3ZU5A 1SEPA 1MHTA 2EJWA 3F9RA 3LQ2A 2C1ZA 3NT4A 1XQVA 2WE7A 5C1IA 4YRBA 2GRJA 1C30B 3BUSA 1S6YA 1Z4OA 3ZJUA 1QHYA 1DADA 1KH2A 2Y66A 1AGNA 3EBOA 4RCVA 3U6KA 4WVLA 5HCNA 3SICE 1NP3A 4ENQA 1T9ZA 4R51A 3D7NA 4EH1A 3OEED 3Q1KA 2A0YA 3HB5X 4YDSA 5E0KB 4DC1A 3ZHZA 2WJ6A 3C3KA 1J0CA 2QN1A 4MV9A 1U94A 4WGFA 3C3EA 1E3EA 3R9KA 3O91A 1OJ7A 3U7HB 1SXHA 5DTQA 4O1HA 4TMTA 4ABYA 5KOJB 1XJQA 4HBZA 4NBWA 4RANA 2P6RA 1L7VC 2X2FA 4J7CA 4RLFA 4U7TB 2JGNA 2YUTA 4Z2YA 2LE0A 2Z5FA 2WAXA 1Z3CA 3KAQA 3H2YA 1NW3A 2O2DA 4EHJA 1F2TA 2RHDA 1OB5A 5IWAB 4Y1RB 3GZNA 1TTHA 1WPXA 3AR3A 3PWSA 5CLHA 3OO1A 4KG7A 3OF5A 5DM4A 1XF9A 3RVNA 2LZ0A 1HWYA 5F7JA 3UT5A 2QMHA 1ZR2A 1G5RA 3R76A 3W6OA 3WKCA 3G6KA 1VE9A 3WO1A 1GY8A 1CSEE 3JVEA 1GITA 2VP4A 4G5HA 4XWAA 1PYOA 1U2TA 3SJBA 1IVSA 2F43A 2F9FA 4MA0A 1IDOA 5AVOA 2YW2A 2PJRA 2CZCA 3ZX5A 1MJFA 3C3DA 5DIFA 2V54A 2OG2A 1OBFO 3NDRA 5AVZA 2BEJA 2PEZA 1WO8A 2WSLA 1SZCA 5F5LA 3QXGA 3E22A 2E4AA 4JLKA 4JYPA 4AIRA 4EAQA 4G0YA 5FOWA 5IZ4A 3K5HA 2GUGA 3WHPA 4WZBB 4YYZA 4MDYA 1XEWX 4MCHA 4XQEA 4MKXA 3TM4A 4DDMA 3T15A 1EDOA 4XGKA 3NBUA 3NGLA 3P1JA 2IU0A 1EAYA 4NQRA 2QGZA 1GJRA 4KI0A 4TX1A 2PMEA 5HWSA 2YZKA 3LQFA 1ZIOA 2HF8A 3NVDA 4KO4S 3U3RA 4E2XA 3HC7A 2PQ6A 4LRSB 5BPFA 1CEYA 4Y18A 5BNFA 3B9QA 1DIBA 4Q7LA 2QSJA 3KJHA 3KQUA 2AEMA 3OM9A 1B6RA 5E1OA 3T7EA 2Z5LA 3D6UA 4LJYA 2ZYIA 3G23A 4HF7A 2Y1OA 3L06A 5MGBA 1QU3A 2A58A 4TTJA 4XZ3A 4XWGA 3THRA 3N6XA 2IHKA 5DJ5A 3IMCA 2ZP1A 1C8LA 2XYQA 3UMRA 4IXDA 1TVKB 4OXKA 1S0UA 1OJLA 1UQUA 2QORA 3FSGA 1PX2A 2JAHA 1V7CA 1Y5NA 3O92A 2H07A 1PDWA 2Y93A 3MK31 4K9RA 4OY3A 1G8PA 3LPCA 2CVPA 3PC6A 4H15A 2JBAB 4ZCSA 6CHYA 3LT2A 3GGJA 1UJBA 3OE5A 4B44A 3B20A 4BNHA 2VF8A 3OEHA 1AZTA 1CW2B 4IDDA 1II8B 4U2EA 1OLUA 1UKCA 1Z28A 2GGSA 1Z2EA 2YV3A 3AUJB 3N39C 4FGUA 4HK4A 4MVCA 4WNIA 1GNPA 1K8XB 2C4WA 1UXIA 4P35A 4RHEA 1CUEA 3RHZA 3AIIA 3TINA 1HTWA 3W9SA 1UOPA 2Y92A 3IMEA 3T1VA 1DBQA 1IJEA 2AN4A 1ML4A 2P67A 4H08A 5SY4A 3VC2A 5K0JA 4O4IF 3ZLBA 3LO8A 4OXYA 2F64A 2RHTA 4CUKA 2PT5A 1RHRA 4WY8A 1RXUA 2IP2A 4M0LA 1M6HA 2AYZA 4W5OA 1ENZA 5K09A 1W35A 2XEDA 3P9SA 1GZ4A 4J0DA 2C7BA 4N7MA 4YFVA 1TA0A 2QNIA 4HD8A 4N3AA 1VECA 3HK2A 5K0BA 2C31A 1X1SA 3W8RA 2QM0A 4Y2XA 2HWKA 4LZJA 5DHRA 2TYSB 2O5CA 1YJAA 2GZHA 4CMEC 4E31A 2XKKA 4U6QA 2WU8A 3VR4D 2XVYA 3QITA 5BYAA 1RRPA 2WA1A 5LBUA 1T3HA 4EQZA 1MH1A 4WOBA 1BYIA 1WD7A 2ISCA 4AZ3B 3P97A 1KAQA 4PR3A 3AEYA 4MLZA 2EWMA 1Z0IA 1M8GA 5K8UA 2E1RA 1IONA 2QX8A 2NLOA 2C92A 1W6RA 2R86A 3BRWD 2FETA 3LQRA 3I1JA 2WHRA 4DJJA 4H4EA 2XQJA 3KOWA 1N3BA 1QNLA 2J8ZA 2VHVA 5BR4A 5BV8A 3PFGA 5JI3E 4V0ME 5LWQA 1D1PA 1NG1A 1NDHA 1T1SA 3KQWA 3T3DA 5LLSA 3M6IA 3OPYI 2OPHA 1HR0B 1FQWA 1PKXA 1Z29A 3D3WB 2AC2A 4GSYA 2HW8A 3WLTA 5AXAA 5BSRA 3V6LA 1DC6A 5GTDA 3M0EA 1V1MB 3S2IA 4MWCA 2QG6A 3RADC 2W0MA 4S12A 3ZE6A 4LYFA 3VZSA 4E2ZA 4OQZA 3B2EA 4B3IA 8OHMA 2CLOB 1IZ9A 2HH9A 3MWFA 1UDXA 5H59A 4KV7A 3ZGYA 2ZQ5A 3C5HA 3MBIA 4K6OA 2VZLA 3MPUA 4P58A 4L8GA 4D9MA 3OLZA 3NVAA 4HAOA 4E51A 4PLYA 1TPZA 1KP9A 2HHLA 2JEZA 4YP1A 2MCFA 5BWOA 1DFGA 5FV7A 1AA9A 4DWVA 3HADA 3SZ3A 5EIAA 2WM8A 7ADHA 3PNBA 4BQFA 2BVNA 3OO0A 4K3UA 4ND4A 3WMXA 4KAXA 2QL7A 3COYA 3SS8A