1YRHA

Crystal structure of trp repressor binding protein wrba in complex with fmn
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
200
Chain Sequence
PVKLAIVFYSSTGTGYAMAQEAAEAGRAAGAEVRLLKVRETAPQDVIDGQDAWKANIEAMKDVPEATPADLEWAEAIVFSSPTRFGGATSQMRAFIDTLGGLWSSGKLANKTFSAMTSAQNVNGGQETTLQTLYMTAMHWGAVLTPPGYTDEVIFKSGGNPYGASVTANGQPLLENDRASIRHQVRRQVELTAKLLEGGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords trp repressor binding protein WrbA
publication title Crystal structures of the tryptophan repressor binding protein WrbA and complexes with flavin mononucleotide.
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 66
structure length 200
sequence length 200
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2005-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yrhA00
2MOKA 5EA2A 1DXQA 4BMOB 2FDXA 5LMCA 1AKTA 5F51A 4DILA 5JROA 1CZNA 2FOXA 2OHIA 4CF6A 1D03A 3W79A 2F1OA 4F8YA 4BMPB 3SVLA 3U7IA 3EYWA 3S2YA 4FX2A 4N82A 3HLYA 5ULLA 3GFSA 3KEGA 1RLJA 3ESYA 5F4BA 1FLDA 1B1CA 3N39C 6NULA 2QMYA 5FX2A 4YALA 3G5MA 3LT5A 4PTYA 1C7EA 4U7FA 3RPEA 2MTBA 3B6JA 2N1MA 2R96A 5LJLA 2HNAA 5BUCA 5NULA 4LA4A 1GG5A 1AHNA 2QR2A 4FGLA 4Y9UA 3ESXA 2HNBA 3ES9A 4NLLA 2ARKA 1J9EA 2Z9BA 2ZKIA 1FX1A 2MWMA 3NHPA 4QODA 5LLDA 3HA2A 1CZOA 3QE2A 3B6MA 3N3AC 3ESZA 5B3KA 3LCMA 3K20A 1WSWA 1TLLA 3F90A 1AKVA 2W5UA 1AKQA 1FVXA 1QBGA 3L9WA 2M6SA 3JSXA 4LTMA 4GR9A 4S24A 5EAIA 5B3LA 2XOEA 2BF4A 3OX3A 5A4KA 1CZUA 4C14A 4YQEA 1JA1A 4C0XA 2WC1A 1YCHA 4YAWA 4H2DA 3FJOA 4FGJA 4D02A 3F6RA 1CZLA 1F4PA 1OBOA 1OFVA 1J8QA 2Z9CA 2FZVA 3NHUA 2X2PA 4ZVMA 1QR2A 2R97A 1JA0A 4J8PA 1ZWKA 4YAUA 3FX2A 3KLBA 4N65A 1RLIA 1RTTA 1D04A 2M6RA 4R81A 1ZX1A 3OX1A 1ZWLA 3NHSA 3D7NA 2FLVA 4N9QA 5F12A 4XDGA 4QOJA 1WSBA 2A5LA 2FCRA 4YAFA 2FAXA 2V9CA 3F2VA 4DIKA 1CZKA 1OBVA 1XYVA 1AKUA 3TZBA 1J9ZA 1D4AA 3B6IA 1QHEA 4ZVKA 1T5BA 2RG1A 3UXEA 3FVWA 2OYSA 2D5IA 3L9XA 1RCFA 5LJIA 4PTZA 1DX9A 1YRHA 3R6WA 2XODA 3TEMA 3OWXA 1CZHA 1V4BA 1C7FA 2QX8A 3NHKA 3KAQA 3QFRA 1XI2A 3O73A 3GFRA 3OJWA 4GQIA 1TIKA 4HEQA 1YDGA 2QX6A 1YKGA 5LBUA 1KBQA 3ZHOA 4OXXA 3NHWA 1BVYF 4FGKA 2QMZA 1KBOA 4U7GA 3TE7A 2FX2A 1YOBA 1DXOA 4HS4A 1X77A 1QRDA 1FLNA 4QOFA 2FZ5A 1NNI1 5NLLA 3N3BC 3QFCA 5TGZA 4ICIA 4ZVNA 5LVAA 2BMVA 1SG0A 5FA6A 4PU0A 1SQSA 1AG9A 1XT6A 2HPVA 2QX4A 1FLAA 2BN4A 1T0IA 3W78A 1E5DA 1J9GA 1YCFA 4NULA 4DY4A 1YCGA 4U7HA 5LBTA 4Y7CA 3NHJA 4ESEA 3U7RA 4C0WA 4QOEA 2KQUA 2GSWA 2QWXA 3NLLA 1H69A 2B3DA 3K1YA 3OWHA 3GFQA 3EDOA 3F6SA 2KLBA 4C76A 1I1OA 1VMEA 3UXHA 2OHJA 4QOGA 3W77A 1AMOA 1FUEA 2AMJA 2MT9A 1H66A 3FNIA 1XYYA 3NHRA 4LAFA 3NHLA 3B6KA 2Z9DA 3OX2A 3FW1A 4M0CA 2BZSA 2Z98A 1BU5A 3O2NA 4LTDA 4QOIA 3KAPA 4LTNA 2V5UA 3GAMA 3NFRA 2FVXA 2V5VA 3P0RA 1AKRA 1FTGA 4H6PA 2OHHA 5FUQA 2Q62A 3OVMA 1CZRA 3HR4A 4QOHA 1FLVA 2X2OA 3NHFA 3W7AA 4CETA 4Y9RA 3OJXA 2BPOA 2Q9UA 1AZLA 4ZVLA 4XDHA 2QX9A 1AKWA 3NHYA 4GI5A 4YAOA 5EMNA
chains in the Genus database with same CATH superfamily
2WMNB 3AB3A 4HZGA 3LPDA 5HIKA 1RRFA 2QIPA 3PNQA 4YMVA 4OLAA 3SHWA 1RZRA 4QEZA 3C3DA 3QUQA 4DLXA 1CEYA 2DPLA 3NP9A 4FDVA 1R27A 4M8IA 4YWHA 1P7ZA 1KMQA 3BD6A 4L3WA 4KXXA 2EX4A 4EO4A 2JGDB 3JQGA 5K8CA 2DC1A 2Z8YM 4ZARA 4F4CA 1XEXB 2JIDA 2C7GA 1AKTA 1KEZA 3FHTA 4PLFA 1DEHA 3CMCO 4FFDA 1A82A 1Q2UA 2QDXA 3DOOA 4FFSA 4BJ1A 5HHTA 2RH9B 5IT4A 3R3WA 1DKQA 3WNZA 4FE4A 4OFWA 1PFUA 4WJZA 2C20A 1UPTA 3BJEA 1F06A 3AI2A 4QBIA 4IGEA 1RJ9A 4YMIA 1NQWA 3D2LA 3TRIA 1DZIA 1XEWX 4AUEA 2PH3A 3SXJA 1QH8B 1DXHA 1WCV1 4BO9A 5BMVB 1JKMA 2I66A 2W43A 3ZQJA 1T3HA 3B8EA 4RELA 1X92A 3N58A 5ULLA 3UG7A 4XQEA 4XASA 5TEWA 4M1ZA 4WECA 2GDZA 5LYYA 5MGNA 1UBUS 2VWQA 5ADVA 3B2NA 4UEJA 3MRVA 3AY6A 3BTVA 5KYYA 2NZXA 4Y2UA 2VJQA 3KOOA 1GJRA 2VBCA 1D5WA 4P38A 5DXFA 3VR3D 4H4CA 3F5SA 3GMIA 4J3FA 4E4YA 1OXKB 3MGBA 4LWPA 1QP4A 3LY5A 4IBOA 4YUZA 3ADBA 1NQ5A 4LOAA 4LJSA 1W19A 1GZ4A 2VOEA 5DNDA 1A04A 3RJ5A 4I3HA 3DDCA 1A9QA 3KDSE 4MVJG 4Q1FA 4X8OA 4X8HA 3SJZA 3CVXA 1U0LA 1Y8QA 3QQ5A 5LB4A 5JAUA 2BH9A 1Q16A 3AR4A 5DV9A 2QNRA 2C92A 2WNIA 4RQTA 2WQ7A 2JK1A 4KQEA 4U7FA 1ZQ1A 1AMNA 4C4YA 1BN6A 1DXYA 3IQDB 1OZAA 3IULA 4GUAA 5FBLB 3K0FA 1BMTA 3JAKA 2GLTA 3MCVA 3PVSA 3Q2IA 5FUMA 2XKAA 5JZOA 3AI3A 3M6MD 5EJAA 2P9EA 1N2XA 1KE1A 1GZVA 1N8KA 1S3FA 1VYHA 1T8UA 2ZTUA 4EHKA 1QJCA 2VZ8A 4E30A 4YQFA 4FCTA 2G80A 1NNLA 4MRAA 4PS1A 4QGBA 2OP1A 1PGQA 1OU4A 1BJRE 1J8YF 2PD6A 2Q5FA 3FVRA 3MW8A 3CTMA 3Q40A 4JJ6A 1MW9X 2BFPA 2HZBA 4UU1A 5CHYA 5CPFA 5AM5A 1QFMA 3SDSA 3SNKA 3SZOA 3TSZA 2O3SA 3IUJA 1ZNQO 3KX2A 1S8OA 3AOEC 5TRTA 1JB9A 4LF5B 2AK2A 4CKYA 4JP3A 1CUIA 3T5TA 1M6WA 2I6TA 3HY4A 4JBGA 1ZK4A 5BUZA 5I3ZA 1GTZA 2YWHA 4CHTA 3ZWKA 5E3IA 3OCZA 1F0NA 2JFVA 3C3YA 3PJDA 1JQJC 2OGUA 4QHYA 1XROA 1C1DA 4TQ9A 1QC5B 3K70C 4YJ2F 4XTRA 3OESA 4MP3A 5G2OA 1KC1A 4MB6A 3SEFA 1J9EA 3ZY3A 4DWVA 2Q4OA 5FBQB 4UE6A 5JMPA 1JG6A 5D1HA 3FSGA 2ZSDA 3EISA 2C5GA 2QRVB 3KE8A 1KQNA 1K6XA 2M6KA 4FUQA 4ZP1A 4JBIA 4FCWA 1TQDA 4Q3LA 3GDHA 3ESZA 3IMKA 2I33A 4M4SA 1Q7GA 1K8QA 2GPSA 2XUDA 4FVTA 4BMSA 5L8VA 1W2GA 4OXQA 5KOIA 4YUYA 5L45A 4JVOA 1NF3A 5EJIA 2J0VA 3SKVA 4PYJA 1HMPA 1Y89A 2JIZA 1VJ1A 3DE1X 3RIXA 3V7FA 1DELA 3UQYS 3W2TA 2BKUA 3B7PA 4HDNB 1PG0A 5M3BA 2JATA 4XW2A 4OHXA 3KHKA 1XZCA 2WB4A 5D86A 1LX6A 1K89A 4AT1A 4U2FA 1RJDA 4B3SB 2DJ5A 3NX4A 3TZCA 3ZVMA 3NV7A 4I1SA 4RJJA 4Z4QA 5C31A 4LPSA 1SKAA 2AJ8A 2PKXA 4CXMA 5LP6B 2HH9A 2FPPA 3F3KA 2YDYA 3VVCA 3IKJA 3PLNA 4F2PA 2RAVA 3CNNA 3EPLA 1SH7A 3TSWA 3TPCA 1N25A 1G9TA 3BCRA 4CTNA 2V7BA 5FHRA 2Q7OE 2OQ2A 4W9NA 2G1PA 4J0EA 1HNXB 4OQDA 4TLBA 1P1FA 3A9WA 3K8YA 1UM9B 1F4PA 3K9FC 3OO0A 3I42A 4DPMA 1WMAA 2IPAB 3D0RA 1QLJA 4QPZA 4UTOA 2CNLA 3NEPX 2FGKA 3H9CA 5ECWA 2ZIVB 2UZ1A 4QGFA 4F85A 5BQ3A 4MUBA 1EVLA 3QK7A 2DBRA 4IV5A 1DTSA 3BH7A 3IAAA 4PY2A 3TW8B 3UM9A 3ZU6A 4DABA 2ZJ4A 3C4QA 2I5PO 2PT7A 3EBPA 5C34B 3T9DA 4ZI7A 3AUYA 1JFVA 4JP2A 2HQBA 4H7PA 3EVNA 4EW6A 2B4YA 2NPIA 3SCZA 5JR3A 1B0ZA 1GLNA 4DDWA 2W90A 1U3FA 5JHHB 3MVEA 3S2GA 3T3NA 3CJRA 2BHSA 1HI9A 2HWYA 5HOQA 2IYFA 5M34A 3ZV4A 4LZPA 3DVQX 2COEA 2YNMA 4QU0A 5AJYA 5EHGA 1KAOA 1GAEO 1UM8A 4OF4A 3COYA 3G17A 3COVA 4BNLA 3RS7A 3ZH9B 3I34X 3L7NA 1F60A 1XK7A 2NSLA 3AU9A 1O94D 2DUMA 5BR7A 1YJAA 2FLWA 4W1SA 3DKIA 3HY3A 3GMTA 4EAQA 4OI2A 1N32B 3SN6A 3P9SA 1N6NA 2QPLA 3RHZA 3VSDA 3HFJA 1XTIA 3S1LA 4TLAA 3TECE 4FWIB 5CB6A 3TD2A 1AO0A 2OV8A 4JNCA 4EEZA 2NU7A 2XTMA 1BJTA 3QU2A 3U7FB 5TE9A 1AVTA 1XRMA 4RK0A 2VQDA 2WICA 4RACA 3DMTA 3C5EA 2JDIA 1PT7A 3N0XA 4NZZA 5LUAA 3D4LA 1UP6A 1Q15A 1U8FO 1KDPA 1S7CA 2QENA 3UV6A 2XYHA 1SAYA 3WK5A 1NPTO 3IEKA 3CTPA 1U0RA 3OOJA 4K9DA 3C45A 4P34A 4YCJA 2BGMA 2PZAA 1KJZA 5EXPA 1K06A 1W34A 3QITA 1VB5A 5LDGA 2P2SA 4V0ME 3ULKA 4GYKA 3TLBA 2FPGA 1KOGA 1S1CA 1NSYA 4YROA 4LMBA 4ZHQF 3ANLA 3DEHA 1AUOA 2C88A 3F8WA 1YRHA 5GOZA 5LN1A 3CNEA 1G2QA 1ZW6A 4KMSA 5D3KA 3CWZA 3DW3X 3R20A 3Q8XB 4I46A 4KI7A 4OQ4A 4XQGA 4BLRA 3SLRA 4M1OA 3U31A 4BC1A 2C8LA 1EHYA 2BV3A 3BRQA 3D4OA 5EE9A 4DLLA 2WU3A 3RABA 3CMMA 2QL6A 4QULA 2AMLA 1BA2A 1JLLB 4MS4B 3RK1A 3WHKA 1KEUA 3AH8A 2HT1A 5JT1A 4EL0A 3MT0A 4IF4A 1WEHA 2HBYA 3NT5A 4B34A 1DOHA 4OFZA 1Y9JA 2P79A 2VF2A 4WGGA 4CTMA 2JLVA 4KGDA 2L0XA 2ZIWB 4LEIA 3MWDB 3TIXB 1AUXA 4C3OB 2ROQA 4GQBA 3SE0A 1DWPA 4KPUB 2HCJB 4R9SA 2YJZA 2M6LA 3W2IA 2REQA 3OQIA 5EJ9A 3HR8A 2OCKA 1AOXA 3NTUA 1TKCA 3BG5A 3ECSA 3HCWA 4EHHA 3MHTA 1TO1E 1DL5A 4TVBA 3I05A 1Q0QA 3GFTA 3WL4A 4GKKB 1FXWA 4B85A 5KO2A 3IA2A 3RRYA 5ITSA 3C1OA 1C30B 1ZSVA 1V71A 3CO5A 3V00A 2MDTA 3KDPA 3QMWA 4YPFA 3FYHA 4TMZA 4NBKA 4MKRA 4KQ2A 1ILEA 1XD2A 4CVNA 1XJ5A 1AHIA 3BGOS 3P9PA 1BEUB 1B8PA 4HQRA 4IJWA 1NWHA 3ZK9A 3NJ4A 4B31A 4LG1A 1TKAA 3HJBA 5CDFA 3C4VA 1R0CA 1GPLA 4HB3A 1W46A 2B2XA 2ALJA 4RVCA 4KQHA 1YQQA 3LK7A 4LIPD 2R79A 2O9JA 5JTUA 5LPNA 2ZIEA 3BZUA 2A1TR 4Q3AA 3O0DA 4FFBA 1O5OA 4N01A 2HA3A 3QVGA 1PVOA 4MGYR 2GEFA 3TM5A 1GZ6A 1VYTA 1DAFA 3W5DA 2I4TA 2BHTA 2QGZA 2XVZA 721PA 5IJ0A 2I9KA 4ZAGA 5DBIA 4BV9A 1U3DA 1OH5A 4XOUA 1V6SA 1Z8DA 1SR8A 2BEVA 2C57A 4BE7B 1JIIA 3I8OA 1UK6A 4P5EA 2IZZA 1VKHA 1TM2A 4IOLA 4XWYA 1HL7A 2OBXA 1RM4A 4PG4A 2P2LA 4R8KA 2ZUCA 1Z88A 2VHCA 3O4RA 3CQ9A 2K2QB 1U31A 2O2CA 1J22A 2H1VA 4HGNA 3R6LA 4GGOA 4MVJF 5SV2A 2LPMA 1I80A 1XT6A 5DWVA 1ZIXA 2QSZA 3UMCA 3ROFA 3EA0A 2O0MA 2WIGA 1ODFA 4M0FA 1JLSA 3Q3GE 2OGZA 3NGXA 2XUPA 2OAGA 5FPHA 2J9ZB 2C4UA 3PJGA 3TQRA 3ASUA 3HFSA 4CG0A 1GIAA 2KHZA 5FI3A 3TAXA 4DM3A 4LRQA 4GGPA 3TOXA 4BE4A 2ZJYA 2FRDC 1LI5A 4CV2A 4FEYA 4DY4A 1T5HX 2EW8A 5DYWA 5DI3A 4BGDA 5A3JA 5BWLA 1QKJA 4PAQA 3TRFA 5JZMA 1J2TA 1NOJA 1X7ZB 2FB9A 4LHZA 3JXEA 3BXZA 3NIWA 3GLGB 2ZIGA 3A4IA 2Q41A 1NRJB 3CLRD 5KAPA 3LPLA 3FFAA 2CDAA 1X8LA 1NRWA 4C6HA 2R1ZA 1QTIA 3WLMA 3KJIA 3IMEA 4IW3B 4L78A 4NSNA 5ALDA 3FDIA 2EZ4A 1CLUA 4I6EA 3L18A 4BB6A 5IVIA 3A4VA 2BKVA 1PFGA 1CR0A 4PF1A 4RK7A 4CM1A 1NN1A 5DHTA 3A32A 5BSTA 1XMQB 1BQEA 1CR1A 1UT5A 2JGAA 1XJ0A 4Q3BA 4E4TA 3BULA 1CY2A 1R6TA 3RVDA 5J3JA 1QOQB 1NQVA 1AE1A 1FFEA 2QYSA 4MGKR 2JJQA 5PGMA 1VI6A 1F6BA 3W5JA 3L0YA 1JJBA 1D6SA 1RI2A 2B6NA 3DUWA 1CE8A 1F7UA 3AOEA 3B20A 3E3OA 5DSXA 1EZ4A 1HDRA 2QQ0A 2PX2A 4K87A 3R75A 4AY5A 3H5NA 2M1ZA 5E9JA 4YJ2B 4E5PA 1PD0A 1ZSYA 1JHAA 4FEGA 1KP3A 3QHPA 4H7DA 3VPSA 3ZIDA 5BSEA 5GAJA 4F96A 5A5GA 5L95A 2Q0HA 3ZI0A 5A9SA 1KIMA 2P3SA 3D0KA 3IDOA 5TXGA 5IZCC 1KJ9A 3WMGA 2WPNA 4AQYB 3KFLA 1EFLA 8AT1A 3THYB 3JQ8A 1CEQA 1XA3A 1IBCA 1YUMA 2GJSA 4Y2JA 4B4OA 4DWWA 4CLOA 2W2XA 4X97A 1GTG1 1M34B 2DKNA 1BS2A 3NDIA 2CXQA 1WF6A 4CJXA 3O1IC 3FOFC 2RG7A 1VQ1A 3C5HA 2IS6A 1P4SA 5KNCH 4DJAA 4RYDA 1EFPA 2PIDA 4N0PA 3UH1A 4EKDA 2NQ2C 5AIBA 2I9PA 5B7GA 1CW2B 2HM7A 1W36D 3TNLA 4DEXA 1LQUA 2Z95A 3E4CA 4CLRA 1PUJA 4YP0A 3P0JA 1IQ0A 3DE2X 4BO0A 4DLYA 2XCRB 2UDPA 2UYHA 2IYOA 2WSSD 4JYCA 1CQIA 2PL1A 3HYLA 4PXSA 5F3WB 5DGCA 3JY6A 3OP1A 3R3HA 3TL2A 4PR3A 4BMDA 3MAGA 1WNFA 3IYLW 2ZE7A 1BQ4A 4JWKA 3CY6A 3W90A 3X1KA 2C4HA 4HEHA 3HR4A 5C3UA 4A6XA 5CEFA 3MOIA 2GM3A 2PEYA 4MICA 3K0EA 3DOEA 2A5GA 2PX5A 2VRCA 4MLPA 2JGNA 1T6YA 3BMNA 3V7NA 1TGVA 1YKFA 1GGHA 3KK0A 3UVEA 4QXRA 1YJ8A 1QIFA 4OTZA 4TS3A 4Y9RA 3SBOA 1BOFA 2RHLA 4PLCA 4V02A 4WXMA 1UKZA 2AR7A 2W6OA 4U2DA 4FOTA 4HSGA 1NI5A 2IXTA 2F9FA 3WRWA 2O2ZA 4CR7A 3ETLA 2IGBA 3BWDD 3JR3A 4L28A 1L8AA 3LP5A 4NZNA 4M3NA 5HIIA 1MVLA 4Z51A 5AXDA 4JLDA 4RQBA 5EWLB 1SVUA 2A0UA 1SUPA 2VUUA 4WESA 1D2MA 1JI0A 1S0UA 5DRTA 1BHO1 4PGAA 5K8VA 3U7QB 1RM0A 4NMHA 4ZT4A 4BNMA 1DPFA 3TIGA 3NH6A 1ULZA 4ETWA 3H2KA 4Z8YA 4E22A 1VA4A 2E7ZA 2MOKA 3EQ9A 2QG6A 1D2GA 4NCHA 3AJ8A 2CXSA 4JI5B 4JXXA 3U5TA 2G09A 1VFNA 3EARA 4CEJA 1WOMA 2ZPTX 2GTPA 5JPCA 1RFGE 2JASA 4KQKA 2PR2A 4ZEMA 4MI3A 4F5EA 3I62A 1WV0A 1ICIA 2FDXA 3V4OA 4RTJA 5LMCA 3HCRA 5AMXA 2QMHA 3VMMA 3HMKA 1A0OA 1VJRA 2GD0A 1KQOA 5EKTA 1UZAA 2IYLD 3U44B 2XA1A 2PX0A 2WD8A 1LFAA 4NICA 3K92A 5B36A 1EDDA 3LLCA 3I12A 3VDNB 1SU7A 1UEIA 1N77A 4EUNA 4J4HA 1TPYA 4DLBA 1E92A 1XXHE 4BMPB 4A1FA 4BX0A 4DUPA 3AVXA 1YR8A 4V1CB 3LOQA 2Z2YA 4XWKA 1UF9A 5TQVA 3TJMA 1KPGA 4BB9A 1JQBA 3D6TB 4YJFB 4Z4EA 3GT0A 1EYZA 2GMWA 3BK1A 2A30A 3KQNA 2PVPA 3NBZC 3N2EA 4RKQA 4EVRA 1ZJWA 1XALA 2FFBA 1WQ1R 2BGIA 4FR0A 2A7XA 4ZEXA 3QOYA 4BCCA 2NQTA 4OXIA 4CCYA 2NZJA 3AU8A 3EGEA 3PYMA 3RTAA 1UMDB 3F4BA 4UBJA 2LNDA 5TQJA 4ZHSA 1VKZA 4C0QC 1G20B 4Z8XA 5F4BA 4BX8A 4DAOA 5IRCD 2P6NA 3A0UA 3LDGA 4WA7A 4JLWA 4RA6B 4EFMA 4OFXA 1M6EX 2VT7A 4EB6B 4BU1A 3P27A 2VHYA 4GT1A 4OBEA 3UBMA 4ZHQB 3W6ZA 1ECLA 4UFOA 5IVDA 3UWSA 1LBIA 2X41A 3O8RA 3U4QB 3LCVB 4EPXA 3DDSA 4I36A 1P1CA 4EMSA 5BVGA 1QTNA 4DIFA 7YASA 1RWVA 1XTJA 2PKRA 1O5IA 1ZNZA 4M46A 1DWQA 1X7XB 2GRUA 4EJ2A 3M1YA 1TEVA 3M3DA 1WUTA 2PQ2A 2O59A 5I7VA 3H0EA 2IZ7A 4MW1A 4ZC1A 5C1BA 3ITDA 3CW8X 2XRZA 4WFKA 4Q34A 2WUVA 3A3YA 4QUDA 4BP1A 4M86A 4NK4A 4XUEA 3GJ3A 4HB4A 1YBFA 2BHLA 2XUOA 3GVPA 3LV8A 1ZVMA 1RW4A 3ON5A 1OR8A 4WKOA 4C4RA 1BMDA 2GKOA 1PTKA 1Q83A 2DTDA 2TMDA 3TRJA 4PSUA 3R0QA 1ZVJA 3GHHA 5DM60 9GPBA 5K6AC 1G8GA 3RK0A 3ZE9A 3NUGA 4JT9A 1EFHA 5DE3A 5JY6A 4ZVTA 4Q18A 5AW9A 5KWJA 2O6HA 3NKVA 2QRUA 4RH3A 2W70A 3COJA 4EYOA 2PGIA 3AQ4A 4L1KA 2Q6IA 2QUAA 1IEQA 1SVOA 3HA2A 3G2LA 5HKAA 4IHJA 3ZY4A 1B15A 4JFRA 3H13A 3TAUA 1L5MA 1I5OA 4NPHA 3UOWA 2AVDA 3EXHB 3FWYA 2HSGA 1IONA 4M8LA 4WGFA 3ZQ4A 2VP6A 1O97D 4LDQA 1KI9A 3EIQA 2P5TB 3K20A 3LCMA 4X0EA 4E5VA 3I04M 4Q4CA 4JOSA 2GJ4A 1GPAA 1RJFA 4M22A 1L5NA 2Q29A 1T0BA 4HN2A 3M9XA 4FGZA 1E96A 1LPSA 1WPQA 4BVBA 3ODGA 1RRCA 1AA9A 3AHHA 2JLWA 4BZZA 2DPYA 2R4QA 3O7MA 1GPUA 3NAQA 4HLDA 1GFIA 4WXHA 1Q3KA 2VDUE 2XZDA 3TPZA 4EI8A 4RM2A 4CM8A 4OYLA 1XD8A 2GA8A 5F23A 1J5XA 5A3QA 3ZHSA 4ENUA 2P0EA 2CFSA 4TXHA 3E48A 2OILA 4LS3A 4Q1BA 2LCIA 5KNCA 3R9XA 3R3SA 3LDHA 2F3RA 2OQRA 5A03A 5IF3A 3VU9B 3BTSA 4QPJC 4BEVA 1Y7IA 3BHNA 1IHUA 1AC5A 1F2UB 1U6KA 3SM3A 1G6OA 1ZAKA 3GW8A 2AXQA 1GGVA 2PKEA 4B44A 2DSTA 5EIHA 1Y98A 4NL4H 3WLHA 2QG9A 1SOAA 1ID8A 3FUTA 4IILA 1JA1A 1L1QA 1A71A 1KDOA 4O29A 4YMSA 4PC2A 2YINC 3TZHA 4QT0A 2NZYA 4H35A 2ST1A 3FZYA 4PAMA 5GM2A 3I5YA 3KLPX 1L7VC 3R0JA 3JATB 1JWLA 1FK8A 2IODA 2QPAA 4NABA 2N0SA 5IASA 5JEDA 2RJ3A 2C83A 4D9BA 1SZDA 4TLEA 3PYLA 2Q4BA 4HDMB 1MQAA 4O2AF 1ADYA 1OYVA 3K9NA 3ND6A 3KJFA 4RKFA 2FRDA 1RWKA 5IKXA 2R4UA 4J16C 2OZKA 4YH1A 3I9JA 1QE3A 1Z7EA 5EMKA 4US2R 1ZRMA 1SXPA 1T4CA 3PC7A 1CYDA 1PI3A 2LR0A 3HWX1 3K0CC 4DA6A 2IV3A 5E7MA 3PPWA 1ETHA 5K0CA 1OI2A 5IJXA 5ICCA 2CSXA 2F3UA 3F46A 4MA0A 3CURA 4B80A 2QUZA 1VJ5A 4JI8B 4N9QA 3OZGA 1GL3A 5MDHA 2J5BA 3ADPA 1ZVQA 2H7CA 4RGQA 4XDGA 1ACMA 1ORTA 2JI4A 4JJKA 4ER6A 3M6XA 1WSBA 3TDKA 4JQZA 2QIOA 4UAUA 4FYKA 4DQ0A 4F2DA 4QYWA 4RTRA 3FSRA 2AR9A 1U9IC 3DOIA 3JAMA 4CMEC 2FPUA 4UDYX 5ALTA 3AWIA 3T5GA 2O8CA 2C61A 2QRLA 5HIAA 1N36B 1DKMA 3AONB 3VOAA 4U2BA 1LBEA 1ZK1A 3EEBA 4OKSA 2EKLA 5LA6B 2QZJA 3LZDA 4MXDA 4ND4A 2D5LA 4HUTA 2W6ID 4R2XA 3L93A 4YYZA 2Z04A 3KTAB 4IX9A 4OLBA 4H1TA 2REOA 1DFIA 3COWA 4TOIA 4Q9JA 5TQ0B 5C1OA 4B7AA 1FQKA 3GMSA 4JQCA 4NP6A 4U9HS 3MPUA 2R44A 2UXBB 4IR7A 5L40A 2VBIA 2GZAA 3TZBA 3RBVA 2G5CA 3AM4A 4IQFA 4YJDA 4E1AA 4Z53A 4ZYWA 4Q47A 1WF3A 3BICA 4MROA 2ZRCA 1KZHA 2IX3A 4B3GA 1YIDA 4RSRA 3VNUA 3JWHA 4Y2SA 4B47A 3FZQA 3I45A 1HE1C 2ZRFA 1T2DA 3H9JA 2FDCA 2ADMA 2CYAA 3I83A 5K51A 1D8AA 3RSLA 3FBTA 5ALKA 5FH9A 3S1AA 2SNIE 3FLEA 3O75A 3AERA 4YCSA 1VL8A 4FLEA 5EZYA 4YP6A 2WAAA 3ECCA 1OBFO 3GJ5A 3GU3A 3MINA 1DX9A 2QAIA 2D1TA 3R6WA 2ZSIA 3ZZTA 3I5XA 4DB2A 5J4LA 3AINA 3KALA 4L57A 1I51A 4QQFA 4YCBA 5BSUA 2BH2A 2DCMA 1KH2A 2EERA 3OHMA 1J00A 4V3BA 1ADFA 1E2GA 1S5PA 1V3QE 3UKDA 3OQ1A 1UL1X 3U3OA 4ETNA 5EFOA 4ZWNA 1XCMA 2J5XA 2J6HA 3DEKA 4OGGA 5HG0A 2C5EA 3NBXX 4DVGA 5KKAA 1GAXA 3P9CA 1PS8A 4YT2A 1UXOA 1RPTA 4FEAA 3A2MA 3CWQA 5ITZA 2ZKLA 2QN9A 5LZ4A 2JJ2D 4IEIA 3MXTA 1ZOSA 3DBHB 4E08A 2FZGA 3UWKA 3OE5A 3VR5H 3M4YA 1I7NA 5D7BA 3M3HA 3M8KA 4U00A 4XQCA 5E6SB 2PFSA 1A8QA 1TRHA 2XUGA 3A1DA 4Q7JB 1Q50A 4KLRA 4ID3A 4LFBB 3FCOA 3DULA 3O73A 4ND5A 1ORHA 1U7PA 4MI9A 1XZGA 2O1XA 2EFGA 2Q46A 1RXIA 4LDAA 4EZIA 1SNYA 2VNKA 2OV3A 5HPYB 1K2VN 4OJQA 3PNBA 5AKLA 2ZTSA 3ZDYB 3EAGA 2HFKA 2QMOA 1K1EA 2C3MA 1RYZA 2QQFA 3R3ZA 3OZAA 4CHGA 5BN5A 1R8SA 5JJIA 1BZYA 5BSFA 2JI6A 1RRGA 4M9QA 4NRDA 5H02A 1DAEA 2X9GA 5KAMA 1W4BA 4M2LA 2C95A 1JB1A 2AS0A 1Q0PA 2WU4A 2Y1LA 3ZIUA 3RK4A 5KOJA 3GFVA 3L43A 3RUIA 4L8VA 3TD9A 1KXJA 1QG6A 1SIWA 3CYFA 4M9RA 4X20B 2WTUA 1ZUNB 5T6MA 3H2BA 1U98A 2OTCA 4MS3B 1OHHA 4D42A 5HF9A 1GV1A 1E2PA 2GTIA 4GOJA 4ZXFA 4FEEA 4CR6A 1U02A 2WFLB 1EFCA 4I08A 4ALIA 4ZRMA 3UQZA 4BBZA 4MP6A 4MUGA 2FHPA 1MC8A 4TXLA 1CG6A 2HLNA 4IXTA 3ZD6A 2IP4A 1KZ6A 3MWFA 1QHIA 4BNVA 3VO1A 5DJ5A 8ATCA 1C8VB 3IJ5A 3DHEA 1NMEA 2Q3CA 3HNPA 2JLYA 1NP6A 4MLZA 1YV9A 3I3OA 3K05A 4TYMA 2V5AA 1DTWB 2W11A 1GNQA 3F6EX 4ZO7A 3T5BA 5B37A 3UYKA 4M49A 5AJHA 2QM7A 4HN9A 1DARA 2OV1A 2WWTA 3FDZB 3KCQA 1GU1A 1P3DA 4JB0A 2BMFA 4IUCS 4NV0A 4QJ4A 4ZA2A 1TJ3A 1NWCA 3RSGA 4PU0A 4UMDA 2FPMA 1YR3A 4ND3A 4UOQA 3HJFA 1Q12A 2Q7XA 3ED5A 1OFUA 3HBNA 2ZSFA 4CM4A 2IUEA 1KFEB 2WT4A 3OM8A 3CRMA 3ZHRA 1NM5C 3RWBA 1MJNA 2F64A 1OX6A 3EGXB 2YWXA 3RS5A 1ZS9A 2QTVB 3X1ZA 1YL7A 4HAVA 5BXYA 4GLOA 3CF2A 3OMXA 4X9XA 2FPSA 4KUHA 4QE3A 4X64B 1NBWB 2VT3A 3AFGA 1QZUA 2R11A 4HLNA 4KSBA 5EUBA 2XNCA 1Y4UA 5KX5F 4U7HA 2J4FA 1HQDA 3E22A 4Y1RA 2Q3LA 2H1WA 2FK8A 3PXCX 4JUBA 4D7AA 4ESEA 3HVIA 2AQIA 2PSHA 3UJ9A 4Z54A 4CIAA 3IUNA 3OZWA 3HEMA 4I55F 5CH5A 5IBCA 4PBRA 1L3IA 5BW6B 3VR4D 1EVIA 2IK8A 5ELXA 2O2IA 4KNWA 1XC7A 1S89A 2VJAA 5IN5A 3NLLA 3ZS9A 4GKBA 3DJYA 4KI0A 5KTTA 3STVA 4IH9A 3WL6A 1K5HA 2PQ0A 5ALLA 2HMSA 1NTOA 4O8ZA 4AZ3A 2OESA 3GZNA 4PR0A 2WYIA 2C7OA 2IPOA 1CNEA 2F1KA 1OA1A 3A3OA 1G3MA 2PLFA 1QOPB 2C84A 3H17A 3SIWA 1NJ8A 2CCGA 2P3QA 4ROTA 4FU0A 4MWOA 1AQUA 1QYWA 1XVTA 1TAGA 1YVEI 2YJTD 3FGPA 4EATA 4ZGGA 3PGVA 2NP6A 1X1EA 3IDFA 3W77A 4QDKA 4EK9A 1D2CA 3V48A 4HTFB 1TUBB 4Z7QB 1OGYA 1RWXA 3CZCA 1R4NA 1H0SA 2G9UA 1XAIA 4TRNA 4Q05A 5CDTA 3PX7A 3ZWAA 2Q5CA 4DJ5X 1R0RE 3JQAB 1QGAA 4GYWA 2W6ZA 5K6AA 4RZ2A 3T12A 1H0HA 4MUNA 1HKUA 3MRXA 1E3IA 1K88A 2OBLA 3E5MA 3E9QA 3EIUA 4O4LA 5JWRA 1X9GA 4WOPA 3FAZA 3PPXA 4MWCA 2ANCA 4Q37A 3O4JA 2GQ0A 3GEMA 3QXHA 3R6TA 3DVAB 3EIOA 3EMBA 2JVKA 4V0RA 3WHLA 4CKBB 1CUGA 3VYVA 3GAFA 1NQAO 1OGJA 1ZVKA 2EF0A 4B7XA 1VOTA 3G68A 5B7PA 3DNPA 3L0ZA 4DM4A 2ATIA 4TMWA 1QFSA 4NDZA 2JFUA 3N8IA 3MWEB 1QHGA 2V6GA 4E2ZA 3O2SB 2FW1A 3EQ8A 3ILSA 2FVXA 2PT6A 4W5NA 4ALNA 4G0YA 5IVKA 5A0VA 2VWGA 2ORWA 4HPXB 2HSWA 3VC2A 3WGOA 1BDHA 1RPNA 2AL7A 1J7KA 2XX3A 2LE0A 3S3TA 4B6JA 2A57A 4Q24A 3K9QO 4PNHA 5M5BA 1A8IA 1DAHA 4PXAA 4CUZA 3TMKA 5IF9A 1HT3A 2B30A 3RKUA 4BV2A 4MGZR 1W73A 1NBAA 1PHPA 4G4SP 4G67A 1QFJA 3DB1A 1USUA 3NVDA 3T0FA 5JFTA 1MBZA 1KHTA 3C1AA 4KK4A 3MUEA 1C1HA 5GZ6A 2FEKA 1RQPA 5E8RA 5KHLB 3LGSA 3N2GA 1R9GA 1NP3A 1EUCB 4FKBA 2X76A 1PQPA 3QVMA 4L6AA 3LY7A 4XX0B 1W8IA 1M2VA 2O50A 4UMEA 5TNXA 1XJWA 2P4QA 1RQGA 4BWGA 2ZW9A 1F4LA 1H2EA 2QLLA 3ESBA 4MUJA 3N0VA 4K88A 3ONVA 4P54A 2HRRA 2PYIA 2RHWA 3M34A 1DIRA 3OSUA 1OU0A 3W2HA 3VKWA 1AXRA 1JGTA 2D7CA 3KEMA 1RYBA 4HAIA 1DTEA 2DTXA 1XBTA 3CUYA 2G9QA 1O9BA 4Q1CA 3WQQA 4BQNA 4E32A 2PNFA 3PHHA 3ITEA 1KTVA 4G5FA 1GPKA 3VR5A 3HLKA 4CCSA 1Z6PA 3TTUA 4QFDA 2JFNA 2ZR0A 4J16A 3LQYA 1ESNA 2R4TA 1XKTA 3KSUA 2HQOA 3T35A 4LQLA 3INYA 1IZ9A 2ACKA 1BS1A 3LA8A 1QHSA 4J4BA 2VZLA 4X1YB 4N3AA 5TGTA 4WJLA 4HLUC 3K0CA 3KQMA 2VDLB 3FDFA 2C4TA 1VKRA 3IBCA 4MJXA 3TXYA 3A6FA 3MUOA 4EUEA 3TUIC 5KYXA 4BNYA 2D3WA 2QL7A 1DKNA 2R6HA 3JZFA 4JKOA 4LHVA 2CMFA 2J9YB 3NU1A 4M1QA 5LB2A 3R7WB 4BQRA 4QARA 4I1RA 1DMSA 1HQYE 1Y4SA 1P3JA 3KB2A 2JLAA 2IZOA 3GLHE 4FLFA 2XI4A 3PDIB 3LSTA 4MR9B 4XCXA 3VV3A 4Q4AA 3ZW8A 4MV3A 5K8TA 2JIOA 3A6HA 1TIPA 1KVSA 3BSFA 3ZWWA 4B2IA 3CE6A 1Z17A 5EL0A 1C9EA 1U9IA 1YGPA 3ICCA 3JYOA 4JLUA 3CF6R 3U3JA 3U7IA 4C5CA 4JA0A 2B83A 4KUGA 3T1VA 1EXDA 3LS2A 5CFZA 3TDNA 4YT8A 4KXUA 4ZDKA 3G0HA 1RZRD 1JR6A 1NXVA 1ST2A 1YZFA 1ZD5A 1ZA1A 3AF1A 4B81A 4ZYUA 1LI7A 9ABPA 1E2EA 3CEMA 3T9FA 1W9MA 3O4HA 4P33A 4N0QA 1EK1A 4D9CA 1EWRA 3JASB 3R6DA 4DLVA 3HV2A 1VLVA 4GSKA 1NT4A 2H0RA 3QMVA 4YECA 5H80A 2X0DA 4CQMD 3V42A 2WK1A 1VSBA 1O6ZA 4U02A 4KK3A 4RF2A 5ENVA 5IC6A 5CFMA 2CZCA 3S27A 5AVTA 2UVDA 1ZG3A 1DCFA 4GOND 1AD2A 3O82A 3D6AA 5CB8A 4KG7A 1S4MA 3NB0A 3FTFA 5FA8A 3N07A 3TG8A 3DV0B 2V8OA 3PK0A 4FT2A 4PQFA 3W7VA 1T8SA 2IHTA 1K7EB 2ZBVA 1KNXA 3BIJA 3MYRA 3TLJA 5A2QA 2H7YA 4UUNA 5FKJA 5FLEX 1WMEA 3SHFA 3CBGA 5D8DA 2PMCA 3H1GA 4TTSA 5JNWA 1JG7A 5FPTA 3GN2A 4LYJA 3CT6A 1RKQA 3QKSB 2NP7A 4IFBA 4C9BA 1ZIOA 2Q3EA 3IALA 5LJLA 4Q6BA 4LDPA 2OCXA 3EYAA 4PW0A 5COQA 3RVLA 3F6BX 4KDCA 5BUCA 5IS2A 2J1LA 1FDWA 1W85B 2IXGA 3FPHA 3ME5A 3HB4X 1SB8A 3PDCA 1N6IA 1NI4B 3LQ4A 4G56A 4L3VA 4MNTA 4BV3A 3SC4A 1IPFA 5IKOA 1AHNA 1GITA 3OJEA 3SQNA 1Z7BA 5BV8A 2WB2A 2HMVA 1Y1PA 4RSHA 2GXUA 3AR9A 5DLEA 2IH4A 4NDAA 5BSVA 3QPVA 1SUWA 1J4AA 3U39A 4BUJA 2O6LA 4BGUA 1X0XA 4C08A 1PLKA 3BJZA 4J91A 3AESA 2C5AA 5CJJA 2FPIB 4YBZA 4ZAWA 1Z62A 3GOHA 4RHFA 2CEKA 1QU3A 1SKQA 3MJEA 1XL1A 2CLKB 4DA8A 1E1NA 3I8SA 2KYRA 1DV2A 3NHPA 4M38A 4Q15A 4GXNA 2BDTA 1ANKA 4PEVA 4B3FX 1XAHA 4EDHA 5HM8A 3WGIA 4ZCLA 3UMSA 4C3VA 3QY9A 4D9MA 1CUEA 3GUYA 4EX7A 3AHIA 2JFYA 2Y1WA 5JJBA 1V4NA 1LUAA 1XNJA 2BBTA 3RFFA 3NC4A 2QN1A 2WZQA 3DQPA 4B6GA 4AN0A 5IVPA 1QBGA 2WOJA 2H08A 3ZNPA 1B74A 3UWMA 16PKA 1OPXA 1VCNA 2AA3A 1UR5A 4IYRA 4XSGA 2PS1A 1D9XA 2H2IA 3E5RA 2YJNA 2CVOA 3EXIB 2WY2D 1JDJA 5A3SA 3UWOA 2FETA 4KRXA 1ML3A 1Y80A 4DL9A 1RHQA 4YP7A 3B51X 2DFLA 4CKWA 3G6KA 4B6EA 4O5OA 4AKHA 2NZWA 3ZZUA 1Z12A 1GGJA 2R1TA 3EPPA 1SD5A 3C85A 3FSGD 4MULA 3IVCA 1KC3A 2IVFA 3TBHA 1A7KA 1CY6A 1QZXA 5DBEX 2ZJ2A 2ZWVA 3MEQA 5IK2D 4C14A 2YXLA 1DQZA 3RYHA 1K7YA 4JVLA 4ASUA 1DEAA 2O5RA 5DMHA 1LZKA 1YHYA 2ENUA 1H1LA 3JCZA 1YRYE 1XEAA 2Y9MB 3MIIA 1BFUA 1QXSA 4H2DA 2JIZD 1Q3HA 4QD3A 3TBKA 2NU9A 4CKCA 1C3OA 2QZSA 4JI4B 2VUSA 4TTQA 3FTEA 4WWHA 1OBOA 3FKJA 2FWJA 1NM5A 1OFVA 1GQYA 1I6MA 3CH7A 3OCCA 4II3A 5IUJC 3WMEA 3II6X 3M2PA 1UPUA 2QVZX 4N6GA 5JTTA 1PT6A 5KX5B 1GRQA 2FUCA 3S7ZA 2R6CA 3KLMX 3L7IA 1JA0A 1X8JA 3EF3A 3OWOA 5DW3A 5L3QA 3ZDBA 1QVRA 3ZIAA 1N2ZA 1HURA 2YVLA 3OZ7A 5SZKB 4R41A 1NVMB 3G89A 3OEHA 4L0QA 1M1YB 3A1FA 4MWSA 4UEOA 1UBHS 4I55B 3CF4G 4KAFA 3KXKA 1FMLA 3UKOA 4BJHB 1E1CB 2M2IA 3IR6A 1M6VB 1TU0A 2LTAA 3H99A 3E2MA 5LOVA 1NA5A 3GDWA 4WZAB 4AROA 1I0IA 5E2BA 2XCOA 1W1WA 1IMJA 1LWNA 1G5FA 5CAEA 2P3LA 3GN1A 3NHSA 3HVJA 1JG4A 3D7NA 1UFOA 2GH1A 2J30A 1DO8A 4U5QA 2ATEA 1II8A 1N2OA 4EG1A 4EMBA 4KQMA 4OHYA 2CF5A 3UG6A 4R8MA 1IN6A 4DIMA 4DJEC 2QTBA 3D8HA 1F9AA 2R1UA 4MWZA 3OG9A 4BFVA 2YXNA 3H86A 3MCZA 1QM5A 5G1PA 4B84A 4EFNA 5CT5A 5DM0A 3W1VA 5C8VA 1I7SB 5K01A 1KI3A 2HT6A 1EGVB 3PTLA 3I1YA 2HK8A 2JCYA 4FDAA 4MWEA 2R85A 4BFSA 1U3TA 4EFKA 2I4IA 4QXQA 1FFAA 4TN1A 3V3KA 3TLAA 4C7OA 4DQVA 4Y7DA 1QCCA 1TKBA 2YWGA 4EKIA 2UZ4A 4A8TA 1ZC4A 3LH5A 5HUJA 5IU6A 2HIMA 3L40A 1E0DA 3AJDA 1DUVG 1MO4A 1U2RA 2UKDA 1OTYA 3AQIA 1IOLA 2VF7A 4YO8A 4EY5A 1TZ2A 2AOTA 3H2SA 4Z7NB 1PJSA 2HU5A 4QXMA 5K6RA 2WHXA 3ZK7A 4PPFA 5ECGC 4DJJA 2EYUA 3CXUA 5E4FA 3VX3A 3FPBA 2PDAA 5JAIA 2DGDA 2AEJA 5AUQA 3RC9A 3D4NA 4JKYA 3JTMA 1GFWA 4W9MC 3S2EA 2I55A 5KJFA 4JWTA 4KR3A 1ZGJA 1ISRA 1E9SA 1EGMB 1H1TA 5EZQA 1OX4B 5EI5A 3SJAA 2LKDA 4LZNA 3A58B 1XP8A 5LIPA 1E2KA 1A2KC 1X7WB 3OWXA 1EM8A 3PFBA 1XCLA 2V6FA 2PSFA 4EECA 2FJUA 5K7SA 4PQEA 2HC9A 1DV1A 4RS4A 3ZDEA 4CODB 3QOXA 4WI1A 4B43A 3IODA 2OD2A 1FVFA 3GL9A 1EIWA 3Q85A 3CEPB 4NZYA 3WWEA 1EDEA 1JEEA 3G0DA 3S29A 5HMMA 4QYTA 4ER7A 3IXQA 5F5NA 1U7UA 1R64A 2PXXA 5AW3A 2V45A 4JYAB 4D4IA 3WYFA 3BQ9A 2AJLI 1GSHA 3W1WA 4B8ZA 2GJ9A 2CWWA 4D4LA 2CVPA 1HG1A 2ETXA 2FPOA 1IUNA 4MDYA 5F21A 2H4JA 3O6VA 4ZGWA 4B8WA 3K0AA 1POXA 2MU1A 3LQQA 3ZWNA 1K6MA 4NBUA 4BP8A 5LZ9A 4OSEA 2VP3A 3GLFE 4OHZA 4DA9A 4RK5A 4DLPA 7MDHA 1PFVA 2WE8A 1KAEA 1CY7A 3JD0A 4DLUA 4OLFA 4TMXA 3B9QA 5A4IS 4MDEA 1DBPA 4J03A 4D97A 1MH9A 2Z3ZA 5AHKA 2QX6A 1EFTA 3HH8A 4R1LA 3THOA 1Z4JA 4GAEA 3WFIA 3BWBA 3PHGA 1PJ4A 4FFVA 5HE9A 3ZGYA 1RTKA 1J09A 2IY7A 4L2IB 1QHNA 2Q3HA 2XUQA 3WYGA 2I8AA 5DBFA 3ER8A 4NDNE 5LZ7A 1X1QA 5EN4A 1QRAA 1BVYF 1EP2B 1NE7A 5AOVA 3ZV5A 1G0OA 2NTVA 4DEYA 2ZJ0A 3CEJA 2IS2A 1LSOA 4XB2A 2FX2A 1XRNA 3Q7EA 5E95A 2C78A 5F35A 1E5QA 4HLUA 2J9XB 4G4GA 1Q19A 4CMBA 5I8WA 1JKFA 1Y63A 2HGZA 2D1FA 5A4DA 1NJ6A 1T4DA 1W75A 2GPAA 3SQLA 4O2BA 3CW2A 4W6ZA 3R8FA 1QIGA 3TMAA 4LYFA 4ZYXA 1FYDA 1LPBB 3NRBA 3OM9A 4WIAA 2QQEA 2GBPA 5BYBA 2J9GA 2X14A 1K98A 2VDMB 4TV8F 1P5JA 5J9FA 3STWA 3UO8B 4LXYA 4KV7A 3PEYA 1REQA 1FL9A 1M2FA 3CU5A 4X65B 1P5HA 4Q5IA 1KP2A 1XZDA 1DPGA 3FYUB 3PDJA 3ZTWA 1MDBA 1GSOA 5FNVA 3R4VA 1P8JA 4QYIB 1MGOA 3LLMA 1J0AA 1GQFA 3UICA 2X5JO 4DLZA 3MCUA 2BGWA 2VDKB 4NZPA 2XEXA 2DFVA 4D3FA 5JI3E 1CC1S 2J7KA 4I4LA 4ZPJA 2AN9A 1EWKA 2PYDA 4CQLB 3H04A 1E9EA 1SQSA 4GX0A 4AJ4A 2PLWA 4EF4A 1I2DA 2AI2A 5ES4B 1C0LA 2ZI9A 2PV0A 4ZT5A 1U65A 4B4KA 2QTCA 3LBYA 3PNVA 1PKEA 2RDMA 2WM2A 3DZKA 3NIBA 1DB3A 2Q1UA 4K6GA 1J9GA 1YCFA 3E5NA 3HL4A 2DHCA 3FSJX 3L7OA 3CVOA 4NULA 2V9ZA 5BSHA 2IBTA 3SZ3A 1UAYA 3ORHA 5CBKA 1E58A 3FI0A 3T3DA 1KQPA 3HBJA 3F4KA 4RHXA 1LK0A 3WMXA 2UVPA 10MHA 3E7XA 4NK5A 5GONA 5LCXA 1X7GA 4UUBA 2D3TA 1S02A 1XTUA 3L01A 4G0ZA 4BNIA 3K5WA 4WAUA 4XJXA 4DIBA 2CL6X 1WPXA 2XWPA 3C8MA 2OG1A 3BMQB 3IBYA 4C89A 2FK7A 2BONA 2GR9A 2IHVA 2VYVA 2Q4RA 3TCXB 4AJIA 2ZETA 4LDZA 1DG1G 2PUHA 5H70A 1C4OA 2Z3VA 4DIEA 4HDCA 3RW9A 3DZIA 2IS1A 4LXQA 4E12A 3LQKA 5I7OA 1JIKA 5SZIA 4D99A 1JQ3A 2PXHA 4OQEA 1EJ0A 1RAGA 3I04A 4DDUA 4GXQA 2O19A 4P35A 4MWGA 1D7AA 4Z86A 3SF8B 2YQ5A 5B58C 5C35A 4IJUA 3F6SA 5KOYA 1T2FA 2A1UA 1VMEA 5HCUA 2PZJA 2AN5A 4ARZB 3OPYA 1BX0A 1YJXA 5SY9A 4H15A 2I6GA 4MCJA 1ZRHA 2NGRA 1YR6A 2XF8A 3BMXA 4FQ8A 4QNMA 4QEKA 1Y1QA 2H16A 2WYVA 4QVKA 4RZIA 1GFSA 2M32A 3AHCA 4YFYA 4XB1A 3SIXA 2I2CA 8OHMA 4PRZA 1VIDA 2RGEA 3MRTA 5A4AA 1U2DC 2FW8A 1QE5A 2OO7A 3EGOA 3HZZA 5B58T 1PR2A 3KT3A 3UMMA 2FSIA 4UTXA 5IEBA 1I6WA 2XKJE 1SVIA 4LNUA 3VU8A 1KI2A 1ZLYA 1JDBC 3ISVA 2EFCB 3KXLA 1HTTA 4DNFA 1R10A 4QXOA 2QB5A 1WUYA 3EW9A 3ZDZB 4FYWA 3MFQA 3EFHA 4HNAB 2DECA 3DBVO 1PO7A 2CN1A 2X6QA 3PEEA 4WRRA 1MN6A 4BNUA 1O6BA 2PMDA 1PKXA 2ZTMA 1AXGA 3E2PA 2ZULA 4DV0B 4MV1A 4IDBA 3KQWA 4MK4A 4MO9A 4YLGA 4P4GA 1YL6A 3UFBA 3WZLA 3TFWA 1N2CE 2XT0A 2DCUA 3DWIA 3IJRA 5LBIA 3DE5X 2B94A 5C32A 1YACA 3C41J 2OT3B 2DPGA 2R86A 5LNK6 2G82A 3AF5A 2FSPA 2GFQA 1M7GA 3IILA 3K70D 1CY0A 1OI3A 3H9QA 3JR7A 3P9YA 3SKYA 1HTWA 3W2GA 2JHFA 4AP6A 4EKYA 5MF6A 3DOHA 3EUWA 4AI6A 3I4LA 4YCMA 1H1DA 3U7JA 1DQYA 1MAWA 3HXTA 1L5RA 4KE8A 3NHFA 2QTWB 3BK7A 1JYFA 3EMDA 1ESZA 4JSYA 4LGMA 4EKGA 1KIFA 4R3NA 4XGKA 3C3KA 3PKZA 1JZTA 2XA2A 1U5AA 2DZDA 4PIMA 4IIJB 4ZQGA 4TM7A 5LXTA 2JJ1A 2IHKA 3W5CA 1FDOA 1QDUA 1T2VA 3AOGA 3EFBA 3AG5A 4WVFA 4ZVLA 3R74A 4AMGA 2WF8A 1KR5A 3VKHA 1U2PA 3JQCA 3PRKE 4IUYA 5KKNB 2JG3A 4ZREA 1G6HA 4RA9B 5FORA 7MHTA 1TO2E 1S96A 2VTKA 1VJ0A 3AKDA 2V7GA 3ZGXA 2VXOA 3EOBI 3C16C 3ET5A 4V38A 3AEKA 4YPOA 4KTTE 4P1ZA 4PINA 4DUZB 2VRCD 1ZIPA 4O4HF 1C9MA 2OZLA 4AJLA 4UJ3A 4M21A 4PBSA 4AUKA 4BQQA 2HTEA 3G2QA 1HORA 3D7RA 4IQ0A 5A6VA 1G8MA 1K5GA 7REQB 5JNVA 3VISA 3BWYA 5BNFA 3CNBA 1IJFA 1Y7TA 4M0MA 5DCWA 3X1XA 2HZ7A 3FXAA 1E9CA 4D8TA 2VHXA 3URMA 1ACJA 4FXOA 4EJ6A 4PLWA 2WE7A 4NCAA 4IRMA 1V35A 1XDBA 2ZDHA 3A9CA 3L0SA 3CGGA 2L19A 1LSJA 1E5XA 4HQFA 4U7TB 2JAOA 2W0SA 2ZAYA 4XKJA 4KACA 3DZBA 1JDSA 1GKYA 1SUCA 2N3ZA 4H6WA 3RKSA 1H65A 3CUUA 1NUQA 2HADA 1GGNA 1MJGM 4UW9A 3EGDA 1XG5A 1JKJB 4OQYA 1BXRB 1VHLA 1UMBB 4KQ9A 2GASA 2FPWA 3JWJA 1KJNA 5JS8A 1FNCA 1T5TA 4X44A 5HDBB 2IYRA 1UDRA 3VC3A 4UQLA 4J2TA 5EINA 1NYLA 2B21A 4LGVA 4PWZA 5FQNA 3A6ZA 1I14A 2I91A 3ZUPA 2A9QA 4PS0A 1CDEA 3PPIA 1NDQA 1USGA 1R4ZA 3GRZA 1J1ZA 3L6RA 1VE7A 4C3UA 3BDAA 5AYVA 2ZR8A 1K27A 5IULC 1EXVA 1EQUA 1W0KA 4QO8A 3T38A 2NAFA 3KVVA 4X8MA 2E18A 3CLUC 4FI3F 4U0KA 3MT8A 4WKCA 2OGTA 3BE8A 4J3NA 4CMHA 4X85A 5LQNA 3ELUA 4YRKA 4DV2B 5EJ8A 1GN9A 1U8UA 3EDRA 5A3VA 3U49A 2PH1A 4J0QA 1NYQA 2OUIA 1NBHA 3CLHA 5FX2A 2ZUEA 2P4UA 1NKTA 1QLWA 2WF6A 4H4EA 4YLYA 2Z5VA 4AF8A 2BFAA 1K0UA 1FUKA 1R88A 2XWJI 1I7DA 3HCEA 4PE5B 3IP3A 1JR4A 1L1RA 4KRYA 1OZFA 4CL2A 5HW0A 1TX4B 2R96A 2VJCA 1M2WA 3LYUA 5AHOA 2IE0A 3GLFA 1ULHA 1U2QA 2MINB 4IGIA 4KFUA 1TLTA 3ORQA 4HZUB 1VMIA 3NBKA 3ELDA 1XDSA 2I7XA 3O9ZA 5B6IA 1N7HA 3P9IA 1F8FA 1K8RA 3RYIB 5CB4A 2WILA 1UFQA 2ZRJA 4ZK2A 2EYQA 3DUFB 2XZPA 1GG5A 4NECA 4IEFB 2XBMA 1NOKA 4KCGA 5P21A 1DRVA 3PTAA 4AJKA 5HRUA 1W1IA 3VJRA 3VAYA 4WUTA 3BBPA 3H4TA 3IV9A 5JBNA 2G28A 3G82C 3E4DA 1ABEA 5GM1A 3UH0A 1D3AA 3H3XA 3H5VA 4IWNA 3MTAA 4MYHA 4BX2A 4EGQA 5TMPA 3LO5A 3OEEA 2Q27A 1I3CA 3FRJA 1P4RA 4JLNA 3UB4A 3SC2A 3ZQUA 3L6UA 4WW0A 2JI7A 3WNQA 2B99A 3ZBQA 621PA 3AR2A 4JJGA 4I4TF 4KQWA 1XPJA 1LKZA 4UM7A 5BQPA 3NDRA 1WVMA 4ZVPA 4IV0A 4NV1A 3A1EA 1O95C 1XWFA 4QODA 1B6SA 1CCWA 2EZTA 4POAA 3UV3A 1Q1BA 3R41A 3FD8A 3G7NA 1A7AA 3B6MA 2C31A 1F2TA 2AFIE 4OLJA 3NCHA 1M7HA 4L4YA 3SX4A 3EVDA 2JBWA 4IP0A 1IYZA 3KV1A 3PFKA 3ORRA 4JKIA 4KLCA 4UTZA 4G0VA 2HF2A 3MBIA 1AKQA 4LK3A 1M2HA 4C5AA 1SD1A 1UJMA 2Z2IA 4JGGA 4FKZA 1VE6A 3S1SA 4LE2A 1JIQA 1WB6A 2REXB 3A9VA 5I7AA 3D4BA 3IAHA 2AUNA 3JSXA 5EQFA 2BYTA 3DKRA 3ABZA 2B98A 1EUDB 2PLNA 4WK2B 5U4XA 1TQ4A 1KI8A 2J09A 4P08A 4TV8B 4HO1X 3ESCA 1JHOA 3CCCA 4S24A 1AS0A 2HJVA 5DI9A 4X90A 1X1TA 1IOWA 4UHEA 1B0UA 2GEKA 4YMHA 3MCAA 2VK1A 2HIGA 3TWOA 2ZUSA 3NBUA 3IR7A 1NVEA 1G8PA 1U9YA 4DSZA 1GNPA 2XGSA 5GOTA 2J67A 1AB5A 2WM3A 1HEIA 2II6A 2HAEA 4A2WA 5AQ1A 5BV7A 5BPFA 1SVNA 4CNQA 3NVAA 1KZ9A 1WJGA 1PJ2A 1ES9A 2B7LA 2JIBA 4KXNA 2I2AA 3BE5A 4EG6A 1E18A 4N5IX 1P3Y1 1MW8X 1COWA 5TVGA 1YZ3A 4GRIA 4B9EA 5H82A 1IVYA 4RHCA 2C4NA 1IAQA 3R4CA 3A06A 4BEJA 4HNUA 3KTFA 1W2HA 3LLSA 3OF2A 2I6XA 4B3HA 1J8QA 3FBGA 5KOHA 2CJPA 1QP0A 5ALEA 1QYRA 2I22A 1QRRA 2FZVA 1ODLA 4C0HA 2NUPB 3AG6A 4OP2A 3T95A 2A2ZA 1RNLA 3NTOA 5KYNA 3BL6A 3L0CA 3I4CA 3VPAA 5K99A 5KNCD 3W8DA 4CRWB 1JI3A 3FX2A 2A4MA 3FUWA 3MJSA 2O1SA 4KPGA 5E7JA 4PRLA 4TXMA 1B43A 2F1JA 3UAOA 2P9CA 4LRSB 4D26A 4QBKA 3SZLA 3ZQKA 2DOKA 1GTVA 4LXUA 3I23A 2ATXA 1YQWA 3W4JA 3NXKA 4DSAA 3DV2A 2G67A 4KW7A 3CZPA 4FSDA 4NFYA 2V4UA 2O8EB 1SOMA 3IMFA 2FZLA 3Q98A 1BW9B 2NQ8A 1EZ1A 4LE1A 2GCEA 1MG5A 1YDMA 4X95A 4ZVVA 1HNZB 5A04A 1F48A 5UKDA 1LDBA 1ZOIA 3DMNA 4UVDA 3IO3A 3D3JA 3DG9A 4GH5A 4V2UA 4NQRA 4Z9BA 2VUIB 1FW6A 4RL6A 2WG0A 1NJ1A 1TQ6A 2WJWA 4NEGA 5ILOA 1G8YA 3NBQA 1W6RA 2CNDA 3THWB 3M6LA 4Y1FA 3S44A 4NMMA 4PQGA 1O96A 2KS6A 1MC4A 1FP2A 2ZRGA 1OXMA 1SOWA 4RGBA 4UHFA 3FA2A 1EINA 1UKBA 1E1MA 2F9MA 2PBFA 3PE3A 4RETA 3JARB 1Z5ZA 1CSEE 5J4VA 5KDOA 1N2CA 1LBHA 4G4SO 3ICEA 5IWCA 1BMFA 2C5HA 4DQXA 1Z28A 4FILA 5I6DA 1XHFA 3NKFA 5BN4A 1ZI8A 3GD5A 2PGDA 2PUJA 3Q5EA 1V6AA 5LU8A 3AUSA 4DW8A 3EY4A 1DC4A 3TLYA 4PC7A 3TX6A 1I01A 4Q9IA 1C7ZA 2FPLA 3DO5A 3P26A 4DHWA 1FQOA 5L3SB 1ONNA 5EE0A 1II9A 2RG1A 3HGQA 4JEIA 5DM70 1Q7EA 2XHEA 4CMIB 3OZVA 3FYTA 1IL0A 1EBUA 1I0ZA 2BUAA 4Y0NA 2X9VA 4AZSA 1FPMA 3IQFA 3RS4A 3TI9A 2D5IA 3KKPA 3MTBA 4O8CA 5DT9A 2P7HA 1EAMA 1UFKA 1Q14A 1ADCA 2ZYUX 1TK9A 1ZUD1 1VG1A 2J9RA 3D8BA 3DXZA 3FCEA 3PQ8A 4HDQB 4Y9TA 3TEMA 2X2EA 4N54A 2P9BA 1U6JA 1S3IA 3OT1A 2E0IA 4FYVA 2PM8A 2ZWIA 1K6JA 2R8XA 4AS1A 5AFSA 4F1KA 1C7FA 1HM5A 2FVYA 3F8SA 5CM8B 3P7MA 5FUWA 1N6HA 4DLKA 1IN4A 2YQ4A 4UBOA 2GK6A 1O8BA 2QY6A 3EA5A 3ZWDA 1MHPA 2FZEA 1Y33E 4ZYLA 1EAYA 2BD0A 4KLNA 4OJYA 4CKCB 5KIAA 4OA8A 1DKPA 1B3BA 1GG2A 1XDUA 5HFNA 1HDGO 5KYKA 1XI2A 4FYPA 3RYCA 5HCIA 1AN9A 2CE7A 4HMPA 2O7SA 3OCUA 4WK4B 1FS4A 1BN7A 4IH4A 1DKOA 4AJHA 4ZANA 3CF0A 3RVJA 1H42A 2D1RA 2NUTB 3X3HA 1N4DA 2Y2UA 3DQZA 2NU6B 4J9UE 4MJLA 3TPFA 2V6IA 3LOUA 2WKWA 3INNA 1OWLA 2H63A 3HB9A 2WSBA 5D01A 3VPHA 3Q7SA 3WMRA 1SBTA 4YR9A 4WXEA 4R2KA 4GECA 1M1NA 4GS5A 1ZM7A 4XLZA 1XJCA 3NGLA 1NF8A 1NNUA 4OI0A 6CHYA 4A8JC 1Y6FA 2ZRQA 2AWNA 2YJ3A 4BVHA 3K2EA 2ACWA 3LUFA 3BDIA 1PUIA 3E7FA 3G13A 4PYQA 1ACLA 1G21E 5EHZA 4EJFA 1V16A 3ISJA 2IKQA 5KMGA 3PRHA 3HCPA 3S5UA 3TR6A 4ZDWA 4DCJA 2Z6AA 1WDLA 3SHVA 3TYXA 3P9NA 1D4ZA 4HS4A 1AK2A 1Z0SA 4I9UA 5CT4A 4QRHA 4EUKA 4KNVA 2NTNA 2Z83A 3B1ZA 4GEKA 4BLQA 3D8RA 2DT8A 4RV4A 1U7DA 4PFJA 1CDZA 2I54A 4M53A 4PLVA 5E8JA 3KPJA 5AJTA 2BOVA 3WYEA 3QG5A 4BAGA 4DRYA 3O31A 4CCAA 3DC7A 1T26A 2QRQA 3P2YA 1O2DA 3AYZB 1XEWY 3BRWA 3MWJA 3AR3A 1FFXA 3BA1A 9ATCA 3WTBA 1N2IA 3AR6A 1CJUC 1P2SA 1THZA 2I99A 1SIUA 2WHYA 3QGMA 1XMSA 3DEFA 3U19A 5FLXA 1H2BA 5AJWA 3Q1KA 2HHLA 4D9EA 3NDJA 5I9IA 1J6UA 1XNQB 1V11A 2HPVA 5C4GB 3UGJA 1B6TA 1P8AA 3GFFA 2Q28A 4IDCA 2BDEA 2KMLA 3HG7A 4R2HA 4UVEA 5CX1A 3VJLA 4V24A 1E4YA 2QRKA 1EDBA 1XZPA 1H93A 2D1QA 2QV7A 2TRSB 2VJMA 2Z4TA 4R40A 3RVQA 2I2FA 2WIBA 2Y0BA 1JZSA 5T41A 3ZLUA 2UZ0A 1CDOA 1SU4A 2XH8A 4O4IB 1XVUA 4MI6A 4YP9A 2OLJA 4L85A 2HRZA 3OIUA 3Q8LA 3EZGA 1G59A 2UV8A 4WOKA 4QELA 2F8TA 2BEJA 2Q3JA 1A88A 3T3OA 1IIRA 1XDGA 3SLKA 4JN6B 4UJ5A 2B7CA 3QE3A 2A1IA 3HU1A 2BFOA 4W5JA 1Q2XA 4NYJQ 4E15A 2IY9A 4EGAA 1N2SA 1IRXA 3KQPA 3F7TA 6ADHA 2NV2B 1J0CA 1EMDA 5CR9A 1BXGB 2R2AA 3RFCA 3RAFC 5J1SB 1FXSA 2CDNA 4TKLA 4LOIA 3MBOA 4M1TA 3RT7A 1L5HB 2VDPB 1Z0UA 2B3DA 5TX7A 4LSZA 3KR9A 5H9VA 1JT9A 2I4OA 3QELB 1X1AA 5EKDA 2ISQA 4DT1B 3NOOA 5CIWA 2YVQA 4MPPA 2O2JA 3SYKA 2EZUA 2GEDA 3PD7A 4MRNA 1BSVA 3K7EA 5C2JB 4E5NA 1MKYA 3BXHA 1Y82A 4MR7A 3BH0A 3LQRA 4DUYB 2ZAIA 2QI9C 3PC4A 3FWNA 5DN9A 1EHIA 4KQ1A 4QOGA 3O9MA 3RTEA 1YAJA 5FWYA 5EFZA 3JQ6A 3A1UA 2CZGA 2Y1KA 3LCRA 1IPEA 1S2MA 4FS8A 1J2EA 3DOFA 4W8OA 3WC4A 1JIUA 1XVVA 3QIVA 4RFSA 4C4AA 1FP4A 1NW8A 1OASA 1TYDE 2C9DA 3E8XA 5EGSA 4BLSA 1CP3A 1K75A 2A1TS 1G7CA 2BKAA 3A3PA 4I4TB 4AJJA 1QU2A 2NG1A 2W98A 3B6KA 4HDKB 1AURA 1ZDMA 2QA5A 3EFOA 5KWVA 3FW1A 3TKAA 1VJTA 4P58A 2WBLC 2VS1A 2VAXA 1ABFA 1O95A 1TQ8A 3GGDA 4GXTA 1Z0ZA 2RGDA 1JS1X 2BMEA 4FX5A 3T7CA 3LG2A 4RS3A 4CMGA 1GQ2A 1BVUA 1FXWF 2A9FA 3ILYA 3PICA 5EJEA 2PD3A 3L6CA 4S1OA 3L4JA 3BS4A 1ZZGA 4FD3A 1M74A 1LRKA 1TYBE 2RAUA 3IOBA 1WU7A 3MSCA 1KYVA 3CRZA 1HYHA 3QZUA 4G0MA 1YO6A 4LBWA 4PYIA 4V0NA 1FS5A 5EG5A 1NRXA 1UOPA 4KQGA 4O0LA 3IPAA 4LSGA 5KNDH 3K9LA 3HA5A 1RE0A 2IUSA 3HEBA 4JMPA 1I3LA 4KBFA 3E82A 4CZ2A 2IIBA 2PZ8A 3WLLA 5BSGA 5DGXA 3BH6A 2ZZKA 4S3MA 4LZJA 4ZCTA 1R5OA 3JQGB 1FLVA 5IYZA 2W6JD 1AGYA 3JWPA 1ESCA 1QBKC 3UJDA 3SAJA 2FMIA 4NZMA 2O2SA 1G6Q1 3D3KA 4WBSA 4BWYA 2FXVA 5F77A 3P4YA 2EOAA 1VSTA 5EZSA 1Z5VA 1KZ4A 2HD4A 1GLVA 2F3QA 2HXGA 1O9GA 2YZNA 3UJHA 3KDAA 3M5CA 2Q9UA 3TTTA 4CDNA 4GOOD 3UPTA 4IZHA 3ZDAA 2J85A 1L7PA 4RAOA 3W5HA 1KO7A 4UEWA 3WE7A 2XADA 1RJ9B 1UWLA 2VJBA 1VHDA 3JQDA 1I5EA 1NBME 3OOEA 3V1KA 1PR1A 3M9LA 4GSYA 4HATA 4JROA 4URZR 3ZI4A 2ZEJA 2WP8J 5G1OA 3M6IA 2NT4A 3AEZA 1JPVA 3HDTA 2QP9X 1JQKA 3ROXA 5F64A 1N33B 4FKMA 1NV8A 2H2AA 3V8RA 1GFZA 1K9SA 5KYGA 2YV5A 3HJTA 3WSVA 3PFNA 4LXIA 2XAAA 2CNWD 1EBBA 5EJ6A 1I1NA 2SKDA 5KYYB 5JASA 1PV4A 4AKIA 1IBLB 5I8ZA 4TT8A 2IOQA 4YYEA 3ZCSA 3K35A 4QUAA 5T8KA 1OLXA 2VPXA 1FRNA 3AF4A 4JL5A 4GP6A 1NR7A 5BNIA 1C3LA 4G81A 5TIIA 5E9WA 5JZ9A 4KWIA 3W3ZB 1YMUA 4EQ6A 4Q3DA 1H23A 1T1JA 3DCJA 3RT9A 5IANA 3C6XA 1Y8QB 4UNQA 4WZBE 1XQ6A 1ZL2A 3BB4A 4RHUA 1JJ7A 2GZ1A 3MWYW 5F51A 3B2EA 2X5XA 1OKKD 1I2CA 3OY7A 3QA3E 3H4IA 3SEQA 3QUBA 1E9RA 1PLJA 3ZNQA 1R8JA 3E9MA 3VKGA 3K0FB 2Z5FA 3MCTA 1OZHA 3JAKB 3QI7A 1F4VA 1Z56C 4ND1A 2AR0A 5EC8A 1T6XA 1NC3A 5BQOA 3D6UA 3HUTA 3CPJB 3DR3A 4QNRA 4RIEA 3ZE1B 2QLNA 3IUEA 5L4SA 3EYWA 1E77A 3L1HA 1PIWA 1YMQA 2UZ3A 4L4ZA 1J1IA 1OZ0A 5EUQB 2JLCA 2C1ZA 4IDFA 2IXEA 1S2NA 1V25A 4TQAA 1JFLA 4EPVA 3R8CA 4NU6A 4FWTA 2P2CA 1Z6YA 4R01A 3NWJA 1E7WA 1SK9A 4TUYA 2XGGA 4IVQA 4ZT2A 2V4MA 3NIGB 2MSWA 1FSZA 1LLUA 1YTUA 1XO1A 4ND8A 4P82A 5FQOA 2OCGA 3LVQE 3KQKA 3A11A 1PJRA 1T4BA 2E85A 5J5AA 5C8ZA 3T0IA 1G19A 2XQIA 2YWFA 1KO8A 4RULA 3A4TA 5ETJA 1CUXA 1SMKA 2ACEA 3FFWA 4GZ5A 2VHZA 3L41A 2A59A 3KTDA 4S0XA 2PNJA 2JNWA 1BE0A 3OP4A 2HMUA 2OV4A 1Y1KE 2E4VA 2VUTA 1W88A 4IHQA 5HQ3A 5KNBA 2X1MA 3DFZA 4OM8A 1N75A 4LC1A 2VWPA 1O3YA 4YVFA 3B6JA 5D6NA 2RONA 4LRYA 1PZFA 2BC9A 4N6NA 1ZYUA 4DJTA 5KQSA 2C7RA 4FYIA 5CXXA 1TJNA 4OPMA 3QWFA 3TGPA 3U2QA 2WJ3A 1OY1A 4RJKA 5HJ5A 4CLRB 1GPDG 1R4MB 5DNEA 1A2OA 2FRVA 1DO0A 2FSUA 4HSEA 4OA5A 2O7QA 3UYLA 3I52A 3IEIA 3SFTA 1P7WA 4RADA 3X0DA 4MIKA 5CLGA 3V8NA 1X7DA 2F3TA 2B34A 2O3TA 4RPLA 2NZ2A 1MIOA 2GM4A 2BM0A 3HKBA 4NAUA 5DHUA 4ZVOA 1N7IA 2IZ5A 5LNK1 4RO0A 3PENA 4BRWA 2XMBA 4MQBA 4Q4JA 3A6GA 1YR1A 3NORA 4LQ4A 5B53A 5F1KA 2H0QA 1BVRA 5TS2A 2FPPB 4JLAA 2GCOA 2PLRA 1XYGA 3KSZO 4WNYA 5CW1A 4NLLA 1VPLA 3AVPA 4OREX 4R1UA 4TVOA 3WTCA 1PSWA 1I4WA 3EH1A 4Q4LA 2KX7A 2A6PA 3RC3A 2J0UA 3DM9B 3THRA 2AW3A 4QPPA 2IOFA 4LJ7A 4XTCS 1SIOA 5BPHA 4GGMX 3N7UA 3DLTA 1CX9B 3E3AA 4LDRA 4MQ4A 1ZL0A 4AZTA 3I92A 2WR8A 3WL8A 2H4YA 2VSYA 3GRYA 5TPZD 4HXGA 5FPQA 1KJQA 4HH1A 5IT5A 3H1AA 4H1HA 4WLNA 5JS1A 1UBOS 3MMNA 4RFVA 4CI9A 1IEVA 1N0WA 2JGFA 2G63A 5DIZA 2DB3A 1HEUA 3KQVA 2UZ1B 1DWUA 4J75A 3KS9A 4E5MA 1E89A 3CJTA 1FVXA 3VHXB 1JEQA 4P2BA 4F4FA 1R0SA 4PG8A 5ARCA 2J5KA 1SUSA 2ZFUA 4ZI7B 3FRIA 4HLQB 1PDVA 2RJOA 1Z06A 4EM6A 1U1FA 8MHTA 4EA6A 1G5TA 4OEHA 1DBQA 1WG8A 3ANMA 3OI7A 4YQZA 3FHCB 4LV8B 3IDZA 1Z22A 2C2OA 4TMYA 2P6PA 3O92A 4WY2A 4CIWA 2OENG 3S28A 1KO1A 1OUMA 2WHPA 2WWFA 2C2XA 3Q6NA 1QYDA 5DHAA 4AQDA 4YCLA 1QRUA 1C1XA 2QRJA 1SXHA 3KWLA 4OVKA 4DRZA 2XWBF 4NU5A 2YV2A 4JT8A 1G5QA 4OJTA 4U7JA 2OLEA 2C2YA 4II2A 4P5DA 2XE8A 5DEIA 4YQEA 3JQFC 3L7JA 1EXWA 3TTSA 3KVOA 5KNDA 1NMQA 1QMGA 3G5AA 4HAWA 3ZH2A 3ZV6A 2AXPA 2OE2A 1SC6A 3KYBA 2AFHE 3KSMA 1P60A 1RXCA 1A95A 3U4AA 4KYUA 3B1JA 1P1JA 1QHHA 1YWGO 3AF2A 4MEJA 5IG2A 4HVAA 5BR1A 2NUAA 1GT6A 4A5OA 4WH0A 6GPBA 4FLMA 5BQ5A 1TAHA 2NU7B 3PXXA 1EK2A 2VBFA 1GV0A 1QR2A 1MA0A 2EQ5A 3LDUA 1XCPA 3OPNA 2ZSAA 3ONNA 2CL0X 3DLAA 5DHRA 4DNOA 2QN8A 2XAUA 1C3JA 4GU5A 3WGYA 2O8FA 4F2GA 4R69A 1ISSA 1Z4PX 3R9WA 2ERXA 4OKNA 4PVDA 5BSRA 2XTJA 1U8EA 4O02B 2ZQZA 2RSLA 3DW1X 3OF5A 3TE6A 3TXXA 4KIWA 3SFVA 3GVCA 1VPVA 2I80A 3QNUA 3F5FA 1IN7A 1ZX1A 4L0CA 2PZFA 1G7SA 3UT0A 5BWCA 2FPGB 2XWQA 2ECKA 4L51A 1R2QA 2V55B 3ZLTA 2NXJA 4NPAA 3ZWCA 4KO8A 2V7XA 2ONYA 1OI4A 2FXIA 2VJLA 3IKTA 4MIEA 4IJMA 1PE0A 2PUDA 1HYQA 5BNTA 3Q15C 3F2VA 1G42A 2GBCA 3KT8A 4IOMA 1I3NA 3DHWC 4YRLA 2ZU6A 5EXXA 3WNCA 3EDYA 3TQFA 4BNFA 2XSZA 4CIVA 5LD2C 4JI7B 4HDOB 4K2HA 3TJZA 5TGDA 3KQOA 3VOSA 3GPCA 4LJKA 3ZTYA 3DFUA 4M76B 3F73A 3DBLA 4OHRA 1PRYA 3MTGA 1JQLB 2AOWA 2RE8A 1BS9A 1DJNA 1N2EA 5AJVB 3PR3A 3UANA 1W96A 4MRMA 5EXEA 3RHSA 5WRFA 3RSCA 1PNVA 1RWOA 4I1VA 3V9AA 3D3WA 3QWHA 4AJOA 2Y92A 3EXEA 1EVQA 4EYQA 2BFDA 2IQIA 4PLPA 3M9WA 1FTSA 1ILWA 1WULS 4DR2B 3GRRA 1JV2B 1D4AA 2ZB7A 3OQIB 1YGYA 1NF9A 2AG8A 1CY4A 2QTRA 3GC6A 3KB6A 4HGOA 2NXWA 5HYVA 4REOA 2ATCA 2H1OA 3VTZA 2AOUA 3G2OA 2VYQA 5IH3A 2IH2A 3QTBA 3UXEA 5K3AA 3GEEA 3FKSD 2J45A 1HQKA 1ZO8A 1N6RA 2E5WA 1WCYA 4U5XA 2AUTA 2EL7A 1ISFA 1YRLA 4KGVA 4N40A 2J6IA 3I2IA 2LVBA 3WWYA 5ES3A 4NESA 4QHSA 2PUGA 1IJEA 3OCXA 4XLTA 3O26A 3KZCA 2WD7A 1U4NA 2XUKA 1XPRA 5CT8A 3KWJA 1NW7A 2XNDA 3IMGA 2ADFA 1U94A 5CVUA 2R47A 1VIAA 1NJ2A 2ODNA 2X4DA 3L82B 2DEUA 1E61A 1DIBA 3W6NA 4A0QA 4I50A 1QGUA 2AD5A 2ZR7A 5D85A 2HFJA 4FFBB 3C2QA 4ZD6A 1NG1A 2ZXFA 2R60A 1UBRS 5CDUA 2P3OA 1WP4A 3IAS6 4IYJA 3PBKA 4ILEA 4W99A 4DG5A 5IJ0B 1ENYA 3NQ41 2QZ4A 3T5MA 2F8SA 4TKUA 2J0QA 5AVJA 3ROMA 3IT1A 3LRPA 4PG5A 1XLVA 1ZLXA 4LV5B 1BE1A 4AJ1A 5DOZA 1V96A 3LT1A 2X8LA 5ICSA 1E2LA 1QQ6A 2IYUA 1Y34E 4LWZA 1S2DA 1ZH6A 3IUBA 3OQOA 2PFGA 3NHMA 4Z9FA 3GFRA 4A3SA 4CG3A 3PFFA 4XGRA 3C3XA 3OJWA 3HWWA 1V7ZA 1MJGA 3BRSA 5CU7A 5JCXA 1JU4A 1PEAA 2WG1A 3DMFA 4KO1S 5DHSA 3WK8A 4KC0A 1LFDB 2RBEA 4I8IA 1JIXA 4P0PB 3LIPA 3T0GA 1V95A 1EVEA 1ZP6A 2HMTA 4REQA 3SJBA 2WUEA 3T3HA 2HBZA 4XOIA 1U2SA 1JEDA 4L9SA 5T3YA 1SHKA 3N8DA 4F06A 1ECGA 1F12A 4D8XA 5JWOA 4DCSA 4OXXA 5EXSA 2PU5A 2RHHA 2X9NA 4RENA 4N6OA 4WN3A 2SKEA 3GVXA 1SKYB 4DLTA 4I1PA 3PNKA 3QPAA 2UAGA 5KJ6A 1EP1B 4XYLA 1IHDA 3U16A 1CY1A 2E4WA 1ONSA 3G2HA 4LKRA 3RS2A 1UT6A 3I58A 2VH1A 3BEDA 3K6JA 5BWNA 3IQZA 5A05A 2DWCA 1QVVA 1XRJA 3ESAA 1GUYA 3KHSA 1RLUA 1XF9A 3HGMA 1YZUA 1GQSA 3E8SA 2A35A 4LDNA 4XX1A 1F38A 4HGQA 5EE3A 3QM1A 2G5PA 2IYNA 3WK9A 1NRIA 2DPHA 1JAYA 1O58A 2NAPA 4P80A 3QENA 1VGQA 8ADHA 2IU3A 4ROSA 1M75A 4E09A 2BKEA 2F59A 2IUFA 2JIRA 2NPOA 3A8TA 4ICIA 4Z0PA 4ZVNA 5HBGA 4D0NA 1P29A 1UWVA 5DNWA 1D2EA 4DR7B 3ZHYA 4GL4A 3T9BA 2LXNA 3ILXA 4JBHA 4LGCA 3ETJA 4E7PA 5BQFA 1JHXA 3WQRA 3F9IA 4HRXA 4JUFA 4LBYA 5DK6A 3K5PA 5H9WA 3M3PA 4C7KA 3W78A 2G77B 2OCLA 1D4FA 3HJRA 4JLOA 2XYGA 2PFKA 3DV9A 1CE8B 3ILVA 1U2ZA 1WM1A 3OC0A 1W35A 3WQSB 4AX8A 3JRWA 3VR3A 1KGSA 1RZ3A 4P3XA 1QIMA 1KEPA 3DFKA 2ZJOA 3FWHA 3OH8A 4HQKA 1I8TA 2UUOA 4TTAA 1JYSA 3ROGA 1YD7A 5BV0A 1XMVA 2ABWA 1MO3A 4REMA 1BDMA 1MJ5A 1AK9A 3QU5A 4YJ3F 4R83A 2RHDA 2P0AA 3JQ8B 3UAWA 4RMHA 5C8YA 4YMTA 1NLMA 4NBLA 3QVWA 1I30A 3A28A 1QRTA 2RGXA 2X1VA 2F7SA 1DEXA 1J99A 2PK3A 2YY7A 4LQCA 1E64A 1BGWA 3B6EA 3KELA 4NMLA 2NV6A 5FPYA 1EFPB 3L92A 4BEBA 5JMTA 1OLUA 4HJRA 3EUAA 3SC3A 3IEVA 1SQ5A 1FNDA 3PSHA 2I78A 2WI8A 2WTNA 3BSYA 3DTNA 4S35A 1ZESA 5EZYF 1Y6RA 5C8DA 2IE8A 3U9TA 1XLWA 2B69A 3OCWA 2BLNA 1CQIB 2FR0A 4KN5A 4FJ1A 2C4WA 2PL5A 1I1OA 2ZRDA 1UMCA 1XCBA 1XDWA 5BR4A 2E82A 1I4LD 2X15A 3HSYA 5IWAB 4TSKA 2D7JA 4X8LA 4IFTA 1J0XO 4PICA 4C7BA 4EHIA 1KEKA 1WBBA 3VMFA 1LVGA 2ZVPX 3JALA 3WZ2A 3BMNB 4NCNA 1X7HA 4NS4A 5ARBA 1P4JA 2PE5A 4M99A 4GR5A 4JC0A 5B1HA 1NHWA 2IU6A 1CP2A 2WWRA 3GLKA 4H3HB 2XZTA 3O1LA 1KIAA 3KJGA 4CU5A 4MUMA 4DCPA 3NHLA 1GCIA 4XIGS 1BD4A 5ESRA 5HJEA 1X1DA 4QGAA 4Q3NA 1NN5A 1XZ8A 1TQHA 2YV3A 3K0BA 5TF0A 3UJAA 4ZIRB 1SQFA 2I4NA 4FM9A 3CO0S 1C80A 2CY0A 4FOPA 2PUCA 1Q22A 4MMXB 1A7JA 5MGBA 3LUCA 1XWIA 2JH9A 4Q12A 4WESB 3D7LA 1N34B 2HA6A 3L1IA 3SKXA 2V5UA 3D31A 3WGJA 4B2YA 2JD2A 3FDJA 4ZN6A 4YRTA 4HV4A 1EPUA 1XDDA 3VR6A 2XVYA 3RAPR 4RC9A 3VSCA 5KWIA 1FIUA 2PZBA 3HXPA 2PRJA 4CEJB 3N59A 2VTBA 3Q7RA 2Y1GA 1U9CA 2AJCA 1IY9A 1ZGCA 2AFHA 4G0PA 1R16A 1FTGA 1Q95A 1RKVA 3R7DA 3JZAA 2Q8QA 3UTDA 1N2HA 2GCPA 5SY6A 3RVPA 3JYHA 2I6QA 3OVMA 1EE9A 3E9DA 3F3SA 4CGYA 1CZRA 2J6CA 2X2OA 2QVYX 3DPUA 4IICA 1YBAA 4LISA 2XVMA 3MT9A 4UC0A 1QQTA 1KK0A 2IEAA 4M7WA 3V1UA 3KZ1E 3WRYA 2P40A 1IATA 5KVVA 4RIGA 3EPJA 4D5GA 4HC4A 1YUBA 2MSKA 1U1EA 3JQFA 3PUYA 4TTVA 4B6QA 4X6LA 4RE6A 4AMBA 2HRDA 5IX8A 4UTVA 3HU2A 2N1BA 2CXOA 2VZ0A 2ZSBA 1LRLA 2C7BA 2ODWA 5DP2A 1KI6A 1MOPA 3NEAA 3FYSA 4XDHA 4F3KA 3ENNA 4Y6QA 2W93A 1UKAA 1UAAA 4IGAA 1NVUQ 3ROKA 2Q5JA 4AF7A 4CN9A 4PPYA 1A4UA 2CUKA 5IAJA 1W7AA 3C5WP 3EIFA 1ZH0A 2Y67A 1O87A