1YRHA

Crystal structure of trp repressor binding protein wrba in complex with fmn
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
200
Chain Sequence
PVKLAIVFYSSTGTGYAMAQEAAEAGRAAGAEVRLLKVRETAPQDVIDGQDAWKANIEAMKDVPEATPADLEWAEAIVFSSPTRFGGATSQMRAFIDTLGGLWSSGKLANKTFSAMTSAQNVNGGQETTLQTLYMTAMHWGAVLTPPGYTDEVIFKSGGNPYGASVTANGQPLLENDRASIRHQVRRQVELTAKLLEGGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the tryptophan repressor binding protein WrbA and complexes with flavin mononucleotide.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Protein binding
molecule keywords trp repressor binding protein WrbA
total genus 66
structure length 200
sequence length 200
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2005-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yrhA00
2A5LA 1YCFA 3F2VA 4PTZA 3NHJA 5NLLA 2WC1A 5B3LA 2Z9BA 3F90A 4H6PA 1YOBA 2RG1A 1GG5A 1T5BA 1XYYA 2OHHA 3F6SA 1D4AA 4U7GA 5LJIA 1AMOA 2BMVA 3W79A 5EAIA 4ZVMA 5LJLA 2QMYA 1VMEA 1YCGA 2R96A 4J8PA 5FX2A 4R81A 3OWHA 2B3DA 2HNBA 3B6MA 4PTYA 3U7RA 2Q62A 5F51A 2ZKIA 1XT6A 1KBOA 2Z9CA 3ES9A 4QODA 5ULLA 3OX3A 4DIKA 2W5UA 3FNIA 1T0IA 5JROA 1AZLA 4NULA 4PU0A 4U7FA 2M6RA 3D7NA 3L9XA 1AG9A 4QOJA 1C7FA 1CZHA 2OYSA 3SVLA 4GR9A 1TLLA 4XDHA 3NLLA 2QX8A 1NNI1 4OXXA 3NHFA 1J8QA 5F12A 2MOKA 2FAXA 3UXEA 3OJWA 3OX1A 4FX2A 4Y9UA 4YQEA 5LMCA 5EA2A 3S2YA 4DY4A 3FW1A 1J9ZA 2FOXA 4N82A 4HEQA 3KEGA 3NHRA 3B6KA 4CETA 2GSWA 4QOGA 4LTDA 4C76A 5LBTA 1XI2A 3EYWA 2QX4A 3NHSA 1I1OA 2Z9DA 2QX6A 4FGKA 2ARKA 2BZSA 4QOHA 1BVYF 3TZBA 1BU5A 4N9QA 3O2NA 5NULA 3N3AC 3UXHA 4F8YA 2F1OA 1CZOA 1FLAA 2Z98A 2FX2A 4DILA 1KBQA 1QHEA 3N39C 2Q9UA 3HLYA 2X2PA 1JA1A 3K20A 3KAPA 2OHJA 3EDOA 4BMPB 1FLDA 2XOEA 4HS4A 4C0XA 1WSWA 5FA6A 1WSBA 1AKTA 2FZVA 4QOEA 4GQIA 4ESEA 3TE7A 3ESZA 1C7EA 3NFRA 1CZRA 1V4BA 5LVAA 1J9GA 4CF6A 4ZVKA 5FUQA 1DX9A 1OFVA 1SG0A 4C0WA 3ESXA 2X2OA 3GFSA 5LBUA 5A4KA 2FZ5A 2QR2A 4QOFA 2HNAA 4XDGA 1YDGA 3P0RA 1H69A 1QRDA 2MWMA 2AMJA 3KLBA 1FUEA 1YKGA 2FLVA 3OWXA 1RLJA 5F4BA 1AHNA 1AKRA 1X77A 3ESYA 4FGLA 3NHPA 4M0CA 3U7IA 3O73A 3GFQA 4U7HA 4Y9RA 1DXQA 3B6IA 3B6JA 4YAFA 1AKVA 4ICIA 4QOIA 1FLVA 1FX1A 1ZWKA 3N3BC 1OBVA 1AKUA 3FX2A 1FTGA 3OX2A 3ZHOA 1FLNA 1CZLA 5TGZA 1J9EA 1ZWLA 3OJXA 1H66A 2MT9A 1F4PA 1D03A 3QFCA 4H2DA 1CZNA 1B1CA 3K1YA 1XYVA 4FGJA 1AKQA 1E5DA 2R97A 4N65A 4Y7CA 3GFRA 2KQUA 2V9CA 4C14A 1DXOA 4D02A 2M6SA 2KLBA 3NHWA 2FDXA 3KAQA 4LTMA 2V5VA 3NHYA 1AKWA 1CZUA 4YAWA 3W77A 3F6RA 2QWXA 3R6WA 4ZVNA 4YAOA 1YRHA 1JA0A 2OHIA 3FJOA 3NHLA 3L9WA 4LTNA 3HR4A 1TIKA 1D04A 3W78A 1RCFA 2FVXA 3RPEA 2MTBA 2N1MA 1QBGA 3G5MA 3JSXA 2BF4A 3HA2A 1OBOA 3QE2A 3QFRA 4YALA 1RLIA 1RTTA 3NHUA 1CZKA 2XODA 2FCRA 3FVWA 5B3KA 1SQSA 2BN4A 2BPOA 3OVMA 5LLDA 1QR2A 4ZVLA 5EMNA 2HPVA 3LT5A 5BUCA 2V5UA 4GI5A 4LA4A 3W7AA 3GAMA 1YCHA 3NHKA 2QX9A 4NLLA 4YAUA 2D5IA 4LAFA 4S24A 3LCMA 3TEMA 4BMOB 6NULA 1FVXA 2QMZA 1ZX1A
chains in the Genus database with same CATH superfamily
3JD3A 5JAPA 1MRZA 4W5RA 4US2R 3GJQA 5F2KA 3ESBA 2AOTA 1E6WA 2ODTX 4GP7A 1QS0A 4F46A 1DCKA 4EJSB 2B8JA 3AY0A 1XZQA 3IE0A 2BDEA 2VPYA 3V2GA 1SZJG 1SXJC 2FV8A 1JQLB 1YB2A 3BGDA 3G68A 3K9HA 3DMRA 2A14A 2WU4A 3PYLA 1K3FA 3FUUA 1M76A 4OBWA 3GFVA 3GUYA 3CSSA 1U1IA 2Q21A 4DRXB 4YONB 2HFJA 1HSOA 2OQRA 3CONA 3DOUA 1ZXLA 1O57A 1YI1A 2BP7A 4M0LA 4YJFA 4D0RA 2QRQA 3FF4A 2YHAA 2ZQZA 3BB1A 3GHYA 2IUEA 4RU1A 3VYWA 4KE8A 1JPNA 1U2QA 2O0LA 2OHFA 4U2BA 3A7DA 4UZEA 2WEKA 5CCDA 4FP9A 4DCVA 3I8OA 1CUXA 1OUMA 2QDKA 3K0FA 4Q7QA 3CNEA 4Y9DA 3WGZA 3TSCA 1KDVA 4XGRA 3HVHA 1HKUA 4D1YA 1M1NA 1BCRB 3G2IA 4OHPA 4Q19A 5FAKA 2JFWA 1EUCA 3DBRB 4ND8B 3I05A 3JSAA 1AD2A 2ZR7A 1ADBA 1SY7A 4DLLA 2EW8A 2IT1A 2V1UA 3A6DA 3OF3A 1ISIA 1DTWA 2GCOA 5KOJB 4NEGA 3RUEA 3CGGA 3D0RA 2IXBA 2VDNB 4FS8A 1R0SA 3D2LA 1BSVA 1NXXA 4CU5A 4JC8A 1NNLA 2DFPA 4S1VA 3U9TA 4DLUA 4XFJA 1J33A 3T7RA 4H60A 3U7EB 5KKCA 1P1RA 3A1UA 3OBBA 1S02A 1O9HA 1ZK4A 2IRWA 4AYTA 2P5YA 2NUTA 3OHSX 4RJKA 5A4KA 4C4YA 4PZPA 1OGJA 1J2TA 3PVZA 3UB4A 1YVUA 2GZ3A 3KUDA 2D7JA 2X15A 2ZCJA 1P18A 4C7OA 1RWVA 1N2ZA 1VBKA 3OZBA 4BNLA 2ETXA 1KR2A 3ZD7A 3Q12A 3DKPA 1SBTA 4HK4A 3ROMA 3GRKA 3C7TA 1M8PA 1SQ5A 1HSZA 2WU0A 3HXTA 3R9IA 4DXHA 2DPYA 4TVSA 2OFFA 1EAYA 1SXHA 2CFRA 3O1HB 5FWAA 3WRYC 1QX3A 2RB5A 3OC0A 1PHPA 4L73A 4RTSA 4XJXA 2W4MA 2UU9B 2E9SA 3RBXA 3ROXA 5IUJC 5LKRA 1DWUA 4D02A 5B3AA 5IYZA 1YCDA 2EJUA 3KT0A 3NFYA 4NE9A 1AGNA 4UBOA 4EMUA 4HDSA 4LXTA 5B2FA 4G89A 1I3MA 1R15A 1MB3A 1ST2A 4UDXX 4HTFB 4YP5A 1JZTA 2N0SA 4NCNA 4RF5A 4XVRA 1KAHA 1THTA 2HHJA 4F91B 1AUVA 2C3MA 3DCJA 3L4JA 4G0YA 5ALKA 1OWNA 5ENDA 1TAGA 4N48A 1R0CA 2XDQA 2V6MA 1LVHA 1NATA 1T8YA 1JG1A 3PUWA 1H1LB 4I8DA 4PN7A 4KRXA 1DQNA 4C0SA 1E5LA 1RBMA 2GZHA 4P2BA 5C18A 1JECA 3LPCA 1XVAA 4F38A 2P62A 5LU8A 2HN9A 4FJ0A 1PCXA 2IIQA 2IYYA 1GV0A 3IA7A 3I34X 4FU0A 1KK1A 4FGWA 5GONA 3S2FA 4EHDA 2WHYA 2YZMA 2W58A 1EX6A 1QMGA 5EWLA 3ZZNA 2CVQA 4F6RA 4PG8A 4U02A 4N39A 2C5BA 5JANA 1DAEA 2IEZA 5I7AA 3CUYA 3UWOA 1T8UA 1GL3A 4QU8A 4XB6B 4ZVOA 3SDBA 1XN1A 1B8UA 1QG6A 4YP6A 4ZQHA 4FILA 3DLTA 1TL7C 4UEQA 4HDKB 1R27A 4EGQA 5IPFA 1EQAA 4QWWA 5IYZB 3M4ZA 2ONJA 5CB0A 4RJ2A 4TTJA 3ZW7A 2ZTMA 3OZEA 1H65A 1N8NA 4KIFA 1I2ZA 2G6BA 3NGLA 1JH9A 1UJCA 2PEYA 2QT1A 5BYKA 3BDIA 5DNYB 1PBNA 1IN6A 5H16A 3NWJA 3RV4A 1C3LA 1VDMA 2F8LA 2F3UA 2NZJA 4XVQA 3QGMA 4LDPA 1L5LA 2GAJA 4BKUA 1Q7GA 3D4BA 4BO9A 2FK7A 4ZI7A 3JX9A 1VRVA 1JHUA 3QVXA 1D0VA 3H5NA 3P0JA 1A77A 4M55A 4QYIA 3RSQA 1WU7A 4WBNA 2ZJ3A 1MIOB 2BGTA 5LU9A 4A0QA 2BZSA 1YQGA 3LWBA 1GPLA 1RLTA 2QJTA 3B3AA 4Q3LA 5EP4A 3RYCA 4OHBA 2GEJA 3EF1A 3KHKA 1DCFA 3DTVB 4YRQA 3CZAA 4YV7A 1RZVA 3HSSA 1Q20A 1JPUA 3OBIA 4W9NC 3UBMA 3FOCA 1KOLA 3BXHA 5JXJA 1XPJA 1E2LA 3V34A 2WMYA 1SC4A 1E1RD 2CBZA 5T4EA 5JYDA 2AOVA 2ZRNA 1YGYA 1MGPA 2P7IA 3BGWA 4E14A 4CLOA 1PK8A 3HCWA 4GMKA 1OTHA 4YJ3B 2R6CA 2G04A 4O2AA 3CR3C 4GRDA 3OUTA 4GX0A 5DBGA 1R5BA 4ARZB 2I8CA 1C8BA 1H2ZA 3KZ1E 3CJRA 1NKVA 3ZQKA 5IM5A 1DKMA 3JZFA 3ESYA 1VG9B 2B1RA 4Q01A 4AL4A 1MT0A 4C5CA 4EHHA 2AR0A 3AETA 3C6QA 1FLVA 3G7NA 3FX2A 4PG6A 5LXTB 2CZGA 1BAPA 1ZWLA 3AYXB 1RKQA 3PUYA 4D8YA 3HP4A 3IUJA 3TSAA 4Y7CA 3VNQA 4CF5A 2CK3D 4HWPA 3K4PA 2FZWA 3PC3A 4V0ME 3TNFA 5CK5A 5BSFA 1CUFA 5UKDA 3E5NA 1K86A 3BMNA 1XUOA 3NVMB 4G26A 3HJUA 1IBRA 3KCNA 3C48A 1NVAA 1CY7A 1KJNA 2IHKA 1S1CA 2JDIA 3N86A 4FJ1A 1QYRA 4HUQB 4HWOA 4YO7A 5FT9A 3M9LA 4ZCSA 2RJNA 5LLSA 3HMKA 3RROA 4CM6A 3OA2A 3OZTA 3DLBA 1QTIA 2YVQA 2J9XB 2PKQP 1UMBB 4RPGA 5ALPA 3OFKA 4ZJPA 3RSOA 4ANFA 3ETJA 2CZCA 1WXFA 2W83A 2WU3A 4KQWA 1YONA 5LYJB 3ZW8A 1D6SA 1Y3FE 1T1GA 3PRJA 4OCZA 2D1SA 1RI3A 3P9QA 4JEMA 1M8FA 1WUKS 3C6XA 5IT5A 4HH0A 3EZNA 3VSDA 1QVVA 3UYKA 2RBEA 3OF5A 1KJWA 1O94C 3A9WA 3VI4B 2FUCA 4M7PA 1O08A 1U65A 2FW9A 4HQRA 4RF3A 5TVKA 2AWOA 5JE8A 3ZI7A 5KOHA 2YUTA 5B1HA 1IQUA 4WN3A 3AHIA 1U1EA 2HT1A 4UHCA 4H16A 1TC2A 1XNQB 1XQ6A 3GJ0A 2WYUA 4PGHA 3L7JA 4WZZA 2WVGA 1PL8A 3UJDA 3QEMA 1OC2A 1GDTA 1EFPB 3QFFA 2VTBA 3H9GA 1HL7A 4UE3S 3TB4A 2CB9A 3Q1LA 2HREA 4HNUA 1B4DA 4LV5B 3CX7A 1Q14A 4GC9A 2IL1A 5KQMA 1G8MA 5THKA 2QV0A 4CFZA 1K2VN 4RIIA 3M3PA 1EUQA 5CFRA 4UMFA 2QE7D 3N7TA 1M1YB 4KQKA 4OQLA 5HK9A 3UW3A 1KOFA 3ZWOA 4R2KA 1HNXB 3HLTA 1SELA 4IILA 4LRQA 5CDGA 1JAXA 1BYIA 4B6FA 2AJLI 3K2IA 4XD7D 2W2KB 5C1IA 1N77A 2PUGA 4WZBA 3R9WA 2ECFA 4JUIA 1WPXA 2VSFA 1GZ4A 4MI6A 3AH8A 3KQTA 3QOXA 3RF7A 2BUBA 3NYWA 5BY2A 5DBEX 4E2XA 1M8GA 1PG0A 3O0DA 4H9GA 4QSMA 3E5RA 5CT6A 5JSUA 5J2TB 3LUDA 1HPLA 2G1UA 5JSQA 1PEDA 4BJ1A 1WULS 621PA 5BOSA 3CE6A 2QXTA 2VP6A 4IDHA 4BO5A 3V8PA 4ESOA 5B12A 3QEMB 4XI9A 1OQAA 3ETNA 1A2OA 1JQDA 3D8SA 5EXSA 1HDOA 3V1TC 3CUVA 4IYRA 5JZVA 4IIJF 4DY6A 1YJXA 2JBHA 2QD1A 1RHQA 1YS6A 3A1CA 2JLQA 1CQJB 1JP7A 3B20A 1IQRA 1Y3IA 3O38A 2W42A 1JMYA 4RH3A 2OLJA 1L7QA 2JATA 3SJCA 1Y3AA 2KSQA 4H4DA 5FA8A 3QPAA 3BJMA 4HYTA 1QG4A 2GUWA 2V7VA 2JVIA 2AFIA 2ZR8A 3P4XA 1B0AA 2CNNA 2RFLA 3JQBC 4KQEA 5HRCA 2ESRA 2G9UA 1L5SA 2Y6VA 3IIMA 1R1DA 1RPTA 2P40A 3HU3A 3M6UA 3KWLA 3Q9UA 3R7FA 4WACA 4B7ZA 3EPJA 3LPLA 2ZJ4A 3K8QA 4LRYA 1LDEA 1KAEA 1XELA 2P69A 3C1OA 2VDJA 5ALEA 3NU1A 2OWDA 4BYGA 3S27A 5L4SA 2IZZA 2FA9A 3RE1A 1FDSA 2ZJ2A 1P7VA 3RRZA 1XEAA 4D98A 5C81A 5JBQA 3FBGA 2VPWA 2DR3A 4RGBA 1CRLA 1E62A 2O8DA 2GKSA 2WUGA 5BWMA 1FUIA 3DZGA 1U0JA 1PW7A 2NSHA 4DBLE 3P20A 4OGWA 4MHSA 1PFKA 1R74A 4I8XA 3EUWA 4Z3KA 3W5HA 3RIEA 4OFXA 1RLOA 2ATIA 3C3AA 421PA 4A15A 2XDYA 3KJEA 1XZAA 1F9EA 4E12A 2DRIA 2FGJA 1JLHA 2A0WA 2AF3C 4IZHA 4OL9A 3SF0A 4HPXB 5CNJA 3VISA 3ZTYA 3VKFA 3LDHA 4RORA 1KYTA 4B6SA 4X1KA 2B7BA 3PQ4A 1E7WA 3LOQA 3NH6A 4HAXA 1WMAA 1ZCBA 2WF8A 3D3NA 3LYUA 4PCAA 4QGBA 4YLGA 1PR0A 2OP1A 5H1YA 2W2QA 1F0PA 1GG5A 1TECE 1OHHD 3S44A 1C1DA 4X8HA 5DNCA 4GZ3A 2ZI6A 3IQEA 4MDHA 4OQZA 3HFJA 3H9CA 2NYVA 1PTJC 2YOHA 3GLGA 1JLKA 4CKBA 2ORVA 3PA6A 1QGUB 2P4HX 4KR7A 3RKUA 4ZK2A 4D9KA 2FH5B 4X20A 2QOEA 2RK6A 1RRCA 3HCCA 5DBIA 3IP8A 3L4BA 3OX3A 2EG5A 2BH9A 4GLFA 1P0CA 2QTMA 4HTAA 1SVLA 2WTNA 3UA3A 2C4KA 4BVHA 2DTXA 3ZY2A 3QU9A 5B4TA 4LWOA 4TLBA 4H1WA 4L02A 3RYIB 4FBMA 5C7OO 3RBAA 3VJMA 3E53A 1XG5A 5JU6A 4WNYA 3D43A 2P91A 4YB8A 4CM8B 3AM1A 2ZJZA 1NBHA 3EW9A 3NBFA 3ETEA 5AKJA 1Z2AA 1EFAA 1P8JA 2IYVA 3BMCA 3H5RA 2IEGA 3PGXA 4G9GA 2CMFA 3H2IA 3AIMA 4MQMA 1L1FA 3CVUA 2ROQA 1QHHA 4RQAA 4UNNA 5L95A 3OQOA 1FQOA 2PUHA 3AR4A 2D1QA 4K05A 4LECA 1J2JA 1M0TA 2ZU6A 3RRJA 4IV8A 3HKBB 3KVRA 1LKZA 2Q6TA 2WUFA 3UCXA 2V45A 1BKYA 3D8HA 3N8IA 1KBQA 4MUXA 1NNEA 3R2JA 1Q6YA 4HFNA 2XUIA 1NJ1A 4WVFA 3TNDA 3VU9A 5JDIA 4FHCA 4MS4B 4ZXPA 2I3GA 1TC1A 4B35A 1SVSA 2GAIA 1D7AA 1OLSA 3Q2IA 4ZK6A 1QVZA 3SDSA 3TLKA 3WWPA 1YBVA 1XMXA 1JHXA 1TCBA 1UKBA 2AC4A 5T4HA 4IFTA 3GFSA 3UK6A 3OIGA 3QITA 2FG7C 2L19A 3GPLA 4LRSB 4BQSA 4WOBA 3QKWA 2Z2ZA 3QPUA 4B6QA 1UDRA 2IYLD 3QKUA 2BE9A 5JQWA 1OILA 1EFRA 3MB8A 4P4SA 4U00A 4YO8A 5CLGA 1Q1AA 2FSHA 1I2CA 1UZUA 2O8VA 3NBAA 4JU9A 4YDQA 5KTTA 3QVGA 4IQ4A 2QD3A 4IH9A 4KQHA 1D4ZA 2BBTA 2FU5C 2GFIA 4EL5A 4LGYA 1NL3A 3UH0A 4URVR 1Z16A 2EDCA 3K6SB 1E6CA 4N65A 4TKLA 1GNRA 1U9IA 3GEIA 5JXHA 2OCDA 2ZBQA 4AP9A 3K70B 2FDXA 2C59A 5F3RA 1B6GA 3D8NA 1M5UA 4Z2YA 4JLSA 1P4JA 4DJTA 2JFXA 5JMPA 4C0LA 1U0BB 2OXTA 3L9WA 4QEKA 3ER8A 1QZUA 4ZVUA 4Z86A 3WWZA 1K6JA 1N25A 3DVAA 4BV9A 3PD1A 3FYSA 5TT1A 3BERA 4EA6A 2FF7A 5B3JC 1E3EA 2QB5A 3HRHA 3MXOA 2WFMA 2AK2A 3P9PA 3E70C 1WP9A 4ZCQA 3FCEA 3HNOA 4ZVLA 4MUEA 3ZY4A 3KSAC 2VJKA 3CNNA 3B7WA 4DG9A 4QYIB 2ORWA 4PYLA 4ZZ3A 5ESDA 2ZSHA 2IXAA 1RJEA 2P2DA 2UVPB 1FVXA 1T4DA 3O92A 4L1KA 5FOWA 3SZRA 2H08A 4DEVA 2RCNA 1DT3A 5HIJA 1Z5UA 3I6YA 1W35A 3UT6A 4G5XA 3BGSA 3F78A 3GAAA 5JG7A 2B0JA 2OSVA 3TNJA 4CL3A 2A4KA 1IVNA 3MCWA 4OL0A 4LN1A 3CN7A 4KDEA 4EHJA 4WJLA 3UCEA 4Z4GA 4EZIA 2XADA 5BXQC 4TLCA 4P22A 2Y9PB 3PDIB 4ZMRA 4AD8A 1QCDA 3SIRA 1ZNZA 1CDEA 3BSWA 3KYDB 3L0CA 3OIVA 5EJ4A 3LXXA 3OJ0A 1LZKA 2G9VA 4R41A 3AB8A 1TZMA 1SHKA 2YHIB 3U0BA 1ZSYA 4K2HA 3G89A 3HBAA 1G6Q1 3N2GA 4U7PB 5GONF 2A86A 5K0EA 4Z5XA 1BMFA 1SHTX 1G7SA 1M34E 5SZKB 4OYYA 2YV2A 4FX2A 1U7ZA 2EF0A 2Q3FA 1EXWA 4WOCA 1KGDA 2WQZA 1Q11A 3CT6A 1PQ4A 4QPPA 2HIMA 1ODIA 3H9JA 2GH1A 1OH6A 4MAAA 1NM5A 4HEA6 2PUWA 5AWFC 7ADHA 4KVGA 2QP3A 2QZZA 1KSHA 1I1OA 2BFFB 2VH5R 2PX6A 3A6HA 5CVUA 1GCGA 4FLEA 4PO9A 1BCSB 3UYLA 2JARA 3UM9A 3VC1A 3RTCA 2YJ6A 4JITA 4JI2B 4YIKA 2YJ4A 1W44A 1YASA 3HLYA 1L8LA 2C03A 3A4LA 4HQKA 1JHPA 4KLAA 2IYOA 4LZWA 4OEHA 1TKAA 5F3DA 3A36A 4CMCA 4YRAA 3ER6A 3W9YA 4R7ZA 3OFNA 4AF6A 2ZZNA 5FBLB 5REQA 5JYBA 2VAMA 4WA7A 3HFRA 1TJNA 2B0CA 3KVYA 3THWB 3UWSA 2A4MA 3FF1A 4IQ0A 4XAQA 4LZJA 5CG1A 2O57A 1A9XA 2B7LA 4MI1A 1ZGHA 3S3TA 1G8PA 1RAFA 3DC7A 1E20A 3FTPA 4FR0A 4L5IA 2GI4A 1MTOA 2W9XA 2YUIA 1K7SN 3PXDA 4JQYA 1WMSA 1XZNA 1ZMTA 2ACWA 4LYYA 1ZMOA 2I71A 4R51A 2NWQA 1PR5A 1KARA 1NU8A 4L75A 4G5OA 1B8PA 5DHQA 5H82A 5THQA 5TGZA 4MV0A 4QTUB 4JSTA 4M9CA 2EJVA 2L2QA 3OHPA 3SBDA 4GKJB 4KP7A 4LBZA 2MSEB 1ZGBA 4QBGB 1EK0A 3THYA 2IPXA 3FOAA 2A59A 3Q40A 3X1MA 4L95C 4YXFA 4PYMA 2FN9A 2Y8EA 5JPIA 4CG1A 1Y8AA 1TEXA 2H5IA 2QE6A 1GU0A 3F9CA 3NWBA 4YV0A 2II6A 4X7MA 3JD0A 1CERA 1LBQA 1A95A 2QRVA 3A1WA 3DYVA 1L7BA 4L0CA 5AKLA 3S1AB 2BUCA 3TL3A 3ZWDA 3FJOA 3NHLA 3QUBA 4ZOLA 2AR7A 1T9GS 2HPAA 3K9QO 3ZQJA 2CSUA 1PDWA 2RHWA 3UATA 1KO8A 2XE6A 2V7WA 2XUDA 1A9TA 3U1TA 3RWOA 3H18A 4QICA 3A4TA 5KQSA 1DO8A 1E32A 4OFBA 4Z1MA 1T6BY 2B37A 1PGQA 1HWYA 4CMIB 1SA0A 3H6GA 4BRZA 2OBBA 5KTOA 4CDMA 3WFIA 3L7MA 2B8EA 2JH8A 3D7RA 3TEFA 821PA 1FPMA 4PLZA 3KYIB 4KRYA 3T7TA 3U4AA 1QZTA 2YC4C 3D3WA 4U2EA 4RHFA 3LG2A 3HJTA 4OA8A 3U3JA 3PEWA 3HI6A 1P7CA 4REMA 1EFVB 3CIFA 1ORRA 1L7AA 1TEVA 1V2HE 4H3SA 4PHGA 5IN5A 4U8HA 4EVRA 2O2DA 5ITZB 1W73A 4IDDA 5CDSA 2PYIA 3I9LA 3R0ZA 5CW2A 3H5OA 1MJNA 4WZAB 1PJ8A 1X1SA 2A9FA 3NS7A 5MN6A 4IGEA 3UG6A 1PWEA 4G8BA 4HJXA 1JEDA 5IKXA 2JGFA 2KYRA 3COVA 3CX3A 2NACA 3P9XA 3G5UA 3T4EA 2CVPA 4J0HA 1ULUA 1EGMB 3IQWA 1MR3F 3O03A 1FDUA 3LP6A 5F5NA 2QXYA 3PFFA 4ENTA 1LZLA 2J33A 2QX8A 4R9NA 1H4TA 2CYBA 5FOTA 4UXJA 5TF0A 1UDBA 3KWJA 2ETVA 3R0JA 4C7VA 5G53C 4K2AA 4DSAA 1FFXB 3QENA 4UAGA 4C6HA 4TKMA 1S2MA 1MC8A 4ZQEA 3GEHA 4BKQA 3CUTA 3KB8A 4YTEA 3PHCA 1MDBA 3GQVA 3STWA 1WLYA 4ZEVA 5CB8A 5ES3A 2NTJA 1WKVA 3C16C 3E1GA 3LRTA 3PUZA 4IS2A 4YI5A 1VL5A 1M2FA 2OV2A 3UHOA 3MTAA 3V9AA 4DMMA 2XNDA 5EWMA 5HOQA 3C70A 4J43A 4WOJA 1RE0A 2Y4NA 2Q8PA 4RPHA 1IATA 1T9KA 3B3JA 1IOWA 2XRFA 1PTKA 5KOYA 2E4VA 1UBLS 1YQXA 2C82A 4KGZA 1V1RB 4B3MB 4PFJA 4HOYA 2GEUA 1GN8A 1TVEA 3RGWS 1FFEA 2HEIA 1E7QA 2G0AA 5C3MA 1GTJ1 2V98A 4NCKA 5FO1A 1WZIA 5JZOA 3VYSB 2VF7A 4CUKA 1KRXA 2JRCA 4PXYA 4QYSA 2GN6A 3E27A 1MAWA 2PBZA 2Q1TA 3CW9A 3PQ7A 2HU7A 4TL6A 3WQQA 3ZCTA 5D51S 2IZOA 4W82A 1RPNA 1RBYA 1VBNA 1Y98A 5K8LA 2R1UA 2O7QA 4O33A 3Q3IA 4DQXA 2QI9F 3GGOA 3R7WA 1CE8B 1U0GA 3VPGA 1FLNA 1IOVA 2CDRA 4BBJA 1G0OA 2HWWA 1BDIA 4UMEA 2UXBB 4LQDA 4Y2SA 5JADA 2ZBPA 3DVQX 2W11A 3M34A 1WB6A 2EWWA 5A6SB 3LXUX 4B40A 4Z4QA 4OHKA 1ZRNA 4YQZA 5J5VA 4Y7DA 2BKLA 2DMRA 2FFQA 5KQLA 2VBCA 4G8DA 1F6WA 1YRHA 2LNDA 3INYA 5H9WA 4KO2S 5E3HA 1CJTC 3DDUA 3QWIA 1P7PA 4QVKA 5KX5A 1GQ2A 1Z26A 4W5OA 5JDCA 2IV2X 3W4IA 1Q84A 3GH3A 3C6BA 3PXGA 4U8GA 1P6QA 1NLMA 4N8EA 3BXFA 3GMTA 3TLMA 5L7YA 4GRAA 4ZDWA 2VBGA 4OIFA 3L1VA 5K6TA 2YWDA 2R4UA 1HDXA 2QRLA 1U8FO 3LT5A 3W2HA 3DSRA 4G23A 4YCDA 3ADBA 4IQGA 1ABEA 1T5DX 1X0VA 2A84A 3HGMA 4QDKA 5K0NA 1TYBE 2DOKA 2GBCA 2IUSA 4TRNA 4CL2A 5JW6A 1SXQA 2D3WA 5ELMA 4PYJA 3DYIA 4Q9AA 3ETGA 4Y6PA 5DCLA 1L8QA 3BFXA 4B81A 2QMOA 1DAGA 3PGMA 1VB3A 4OYRA 1JHMA 1CYDA 3CZ5A 2H2IA 4B6GA 5CB4B 3ZDZB 3IVAA 3E6AA 2QAIA 1YAHA 4JNCA 5GGXA 5FX2A 1PAUA 1QVWA 2JLYA 3JQAA 4N7RA 4P82A 3PR1A 3ZIAA 2P77A 1MB0A 4XGKA 3PEYA 2HLHA 1HMYA 4I7EA 4IV0A 4OQEA 1Y5NA 4ZU3A 5FTWA 3ISVA 1J1IA 1TLFA 4ZZ0A 2X3UA 3A31A 4Z8XA 1GUFA 3T15A 1APBA 4LF4B 2PNJA 1OB2A 1R0XA 3NLLA 1XNGA 1YB7A 4Q12A 2GO1A 2JKVA 3G0IA 2PA0A 5J58A 2C7VA 2X6QA 4KQ2A 4Y2TA 2XQVA 3VUEA 4ZI7B 2HUNA 3ZXSA 4P7GA 1ID8A 4BGIA 1PIWA 3D3KA 3BH6A 4YWHA 3RS4A 1H8HA 2PZGA 1GD1O 4K26A 2PT7A 5IH7A 4KTVE 1NW3A 3N6RA 1EEHA 3P32A 4QLOA 3GLIA 3PE6A 1CZOA 1VP3A 3L8GA 1I9GA 2X5JO 3SY8A 5A3QA 4ZAWA 3CLSD 3M5DA 4G41A 1G5IA 1JKJB 1UL1X 2BI4A 2Q3LA 3HDJA 4LV8B 4RQUA 5BV1A 3I01M 3ZDAA 2WV9A 1RQLA 4PLHA 3ENQA 5AW1A 3H65A 3FN4A 3T7JA 5ALNA 2AI1A 4LUCA 4D8UA 4KWIA 2VT3A 4MIYA 1E3WA 1JWBB 1ZEJA 2QZPA 3PCTA 4RKQA 2E1RA 1VKZA 2D8MA 5EE5B 1W4AA 3GFOA 4RM3A 2DUJA 4CIXA 4H7IA 5K51A 2WOJA 3B1VA 4POOA 4RWZA 4C4TA 1NN5A 3L0BA 5F51A 4OMFG 3TW8A 3OSUA 1KTIA 3M6VA 4HFJA 3BTVA 2BMFA 5TQJA 4AYWA 4MR7B 4QQFA 4BNIA 3Q87B 2M6LA 1Y7LA 2XJ9A 5D01A 5DHRA 4LVNA 1KQ3A 1JX6A 3PX7A 3W5VA 3ROFA 1L4NA 1J9EA 5JDCC 4D5EA 1CDOA 4J7CA 1D03A 2ZI9A 2H48A 1FFHA 3QMWA 4TTVA 3ESDA 2WJPA 1AQ6A 1COWA 5I3CA 4C14A 4IIGA 1DXOA 2HB6A 1EXDA 1S5PA 3H1EA 2REOA 1GFIA 1NOIA 3R3YA 3KAQA 4ECEA 1QVAA 3DYBA 2ID7A 2HJSA 3I12A 4BB9A 1JEYA 1I80A 4X60A 1A4XA 4UNQA 1HYQA 1MJGA 1WXHA 4KMRA 1XKTA 4O2AB 4TWZA 5BR1A 5LQNA 2W6MA 1NKTA 1XDGA 2UZAA 3D6FA 3BTUA 1UBTS 3G5AA 4WNCA 4UBLA 1NQUA 2O2YA 4P81A 1Q7RA 1KSGA 5HZHA 1MJ5A 3KWFA 5AJTA 2O7NA 4ZT5A 3I39X 5HIIA 3P0HA 4YRKA 1VG1A 1SPBS 1XALA 3JQAB 4QJ3A 4AO6A 3AHFA 4ZHQA 3FVTA 2NSYA 1NC1A 4KB5A 2FUG1 4BTVA 5EJ5A 1PJ4A 3HCEA 8ABPA 2QYTA 1AS2A 1Z22A 3WIBA 3ABSB 3F6YA 2W8BB 4LAFA 4MYRA 5BPHA 2GJAA 2ZRHA 1UK6A 4YT4A 3OOSA 1BKSB 2IDMA 4M98A 1X15A 2H1FA 3LD9A 2XNDD 3MWYW 4R54A 3RB8A 1DBVO 1Y3BE 1UXOA 4WH0A 4H6PA 5HCNA 1H1DA 2E6UX 3I01A 4U39A 2PZAA 2YS7A 3CXUA 1UFRA 2C77A 4WNAB 1J8DA 4K5QA 4FC7A 4TT8A 3TL2A 3WI7A 1WQ1R 3MINA 3ITEA 4EG5A 3HNRA 1XCLA 4O0LA 4YRTA 1RDFA 2F1IA 3AOGA 5DE3A 5LOVB 3D4NA 1H8EA 1T9AA 1HDYA 3PHLA 3ELBA 1JG3A 1N5MA 3I64A 2QM8A 3PV0A 5B7GA 2XUZA 4YRNA 4DV6B 4NULA 4X94A 3H3JA 1A9XB 4ZO6A 4PLFA 4TMFA 5EY5B 3PGVA 1UDXA 2ZXFA 2FWIA 4YJDA 3OZFA 4MKZA 2Q9BA 1EDEA 1YZLA 2HQRA 3DTTA 3ENKA 3PE3A 2H17A 3FD8A 3KD3A 4RF2A 1GT91 1TXGA 5BV2P 1UFKA 1PJAA 1RI4A 3O9ZA 3WJ1A 1WNFA 4XEUA 3E48A 5JEEA 1VLQA 4HBZA 4JEHA 5K2MA 4CKCA 2Z8YM 2A35A 4WSOA 2XUFA 1KYIA 4OUDB 3TLGA 3K6RA 4A8JB 3L4EA 5I8WA 1LLQA 1JW9B 1QHNA 2FWNA 3AL0C 4BUJA 3AJ8A 1LLCA 2DWUA 3SFZA 5J2UF 2WD8A 1GN9A 3A25A 5NULA 1U90A 2CJPA 2FEWB 3KXKA 3O26A 4PYQA 3T9BA 4DADA 3H8VA 2GK4A 1KPHA 2BGLA 3C14C 4UEWA 3R75A 1OAOA 1OXKB 1TF2A 3CRMA 5CURA 1RU3A 4ZU6X 1IBCA 5FA5A 2V0NA 2W0SA 2ZRBA 1QQ5A 4NXNB 5CGZA 4BNXA 4PIVA 2A57A 2FMKA 2SKCA 3Q8KA 5CH3A 1JHQA 2CXNA 2JFVA 2J0QA 4WINA 2ZKLA 1MFZA 4ITRC 1DX9A 4JIGA 1EIWA 3Q3EA 2GTPA 2MSNA 1LF5A 1JAYA 2ZI4A 3TD6A 2Y0PA 4IIXA 4UVGA 1NYRA 3ITNA 4H17A 2HSEA 4F04A 3TUZC 3GHHA 4C2BA 3KLPX 1L4KA 4J16C 4ETIA 4YIHA 1DRWA 3FB4A 4KAAA 1JWLA 1JLLB 3QI2A 3OOYA 1FXWF 2VUHB 3W3ZB 1JDUA 1IM2A 2DBRA 3E3LA 5ADHA 1HC7A 4AJJA 1QF7A 4PANA 1WZCA 4ARVA 1H66A 1Y63A 1TK9A 4NAHA 3WHLA 1EHYA 1PS8A 3LVFO 2Y05A 3QU4A 3L1HA 4CHGA 5IABA 5JNRA 4GZMA 2I3ZA 4FKBA 2PD3A 4IVNA 4KHZA 1HV8A 4WAUA 1CJUC 1M7HA 1X94A 1V1JA 2HCJB 3GJZA 4Z0HO 3IIJA 2AK3A 4MEBA 4KR9A 4TVBA 5AJVB 3KKQA 3UJAA 3GLQA 2FN7A 4EGSA 1JTEA 5JJBA 5DT9A 3UWDA 1V71A 1U9IC 1SWVA 2DBZA 2PJZA 5KOIA 4DCCA 3KOXA 1FSZA 1M6VB 4IMJB 4ILEA 1N4AA 4EZEA 3C3YA 3EXEB 3H1PA 4B7CA 3VBCA 3JQBA 3VVBA 1JBKA 2QTZA 3GLHA 4LDZA 5HQTA 1RTTA 1F8YA 1MB4A 3OCVA 1SVKA 5EZ6B 1WPRA 2C9DA 3DBHB 3AOEC 4EUNA 5DNUA 3A58B 4RCZA 2X8JB 2WF7A 2Y1XA 4PYIA 1ADYA 5EKSA 4O1MA 4U9UA 2Y2UA 5SZIA 3A27A 3EZGA 3O8LA 2B21A 5EN4A 1FYWA 1N33B 2RAUA 5JBNA 3UWKA 1XJQA 4C0JA 5M2QA 1PZNA 4QULA 1VKOA 1SU6A 2V96A 2OFWA 5EXDA 5LP1A 3G8YA 5LN1A 4EUFA 2W6OA 2O8NA 2Y71A 4UFOA 3M3HA 3CF2A 3KZCA 5IEJA 1V26A 1F8GA 4G2NA 5FLKA 5C35A 1EXMA 3CVOA 4R8MA 1QM5A 1YQTA 3RU7A 5KNCA 4C3ZA 1PG2A 2H07A 3T0GA 4EMTA 5FL3A 3B53X 3FHCB 2O06A 3OOWA 3FFWA 1T3LA 3A4MA 2Q45A 3DTVA 1NP7A 4G0MA 4KUGA 4Z9FA 3T8YA 1PDVA 2GN4A 4YMGA 2UYCA 4E5PA 2VCHA 4O4LB 3DZIA 3V5NA 3DCIA 4E5UA 4Q4CA 4A73A 2P9FA 4QUAA 4ALLA 2GASA 3CPEA 4PPNA 5IFKA 2A58A 3UMVA 4DAEA 2R00A 4E6EA 3FDFA 2ZRAA 3GT7A 4KX5A 4LI3X 4TXMA 1PJZA 4BU0A 2WHEA 2QW0X 3PQ3A 3H2HA 3CTMA 2XNHA 2BFPA 4EFDA 4YAGA 2OYRA 3N76A 1GFWA 3ZZTA 3U37A 3LA8A 1E1CA 4C03A 1Y42X 2FSFA 2PN1A 2ZVJA 4RIGA 5GADl 2NSLA 5TQ0A 2CBXA 3CVYA 1ZN9A 5ALZA 4AP5A 4ZYVA 2F1OA 2NU9B 4Q47A 1W47A 2JGNA 2HPHA 4QJ4A 5M7EA 2BLNA 1XPRA 4XCXA 1PLKA 3L6UA 3S2UA 4A2PA 1U3CA 2ZAMA 2VTBB 1BVRA 1ZMBA 2OGZA 3KAPA 2CB0A 5D5QA 2F3TA 1A2KC 4XVCA 2WUWE 2OCIA 3GVHA 2FZCA 4UNPA 1H42A 3C8MA 4B1FA 1O4VA 1W4CA 3FCSB 4UDNA 2Q4EA 3NAZA 4CYMA 1OFVA 4YFVA 3UMJA 4YUAA 4A0RA 2RCYA 1E61A 2JA2A 3AR7A 5DHFA 1NUAA 1SQ0A 3R3HA 4FN5A 2EBHX 2C9BA 1CUVA 2V7BA 1U0TA 2PLRA 1CR1A 3WK5A 1QS0B 2JEOA 5B4UA 5JWRA 3WWCA 3JATB 5AI5A 1QHGA 5I5GA 4WTOA 1X7GA 4P3KA 4B84A 1O96B 5BVGA 4AUEA 2WSBA 5EJIA 1OMOA 5KMGA 1XU7A 1Z4KA 5EJAA 4OX9B 3CA8A 1OYWA 1YBHA 4DNPA 2I2CA 4TKUA 3DZJA 1U6IA 3GFGA 1QYIA 3DWFA 4NCIA 3R3VA 1W9MA 1Z08A 3WTBA 5ICEA 1ZH2A 4GX1A 1F2UA 1RAHA 3C6MA 3F6CA 5HJ2A 4A1OA 1S96A 3H99A 2PWPA 3ZLBA 3TF5A 4F4IA 4RPCA 3H5TA 4PHCA 4W9RA 5K2OA 3UJCA 2OGUA 2A1UB 3LECA 1NXQA 2NUAB 3ZHYA 1JV2B 3T5GA 2RHCA 4KH1A 3AR5A 4H0FA 3OC6A 4I1IA 2YV1A 3DOIA 3EH1A 3FVWA 4NFYA 3V1LA 1KEEB 4DIFA 3SFTA 1SUWA 1CUAA 2IY7A 1DAKA 4MJ3A 3V7UA 4C88A 3K70C 1V5FA 3GJRA 4HFMA 2X2EA 1GUBA 3LL4A 3ORQA 2HMSA 5ITVA 2Q28A 2WIGA 2YH2A 2A6PA 1EFLA 1NUHA 4LQLA 3WNVA 3SJ7A 3ZU6A 4DR3B 2O14A 3R5TA 1C3OA 4YJGB 1KIFA 2YHBA 3AF4A 1XYYA 1BHO1 1AQLA 2AXNA 5G02A 2WP8J 4GXNA 1X8KA 3NGXA 3OE1A 3JASA 5D5PA 1MZPA 1M1YA 1HTWA 5FPHA 4J8PA 2C4WA 1PT7A 2PKXA 3NUQA 3GR6A 2RGWA 3G7SA 3OM9A 4JGIA 4NP6A 3OQIB 5A9SA 1QOZA 2BOVA 1KEWA 3ZWQA 3Q6NA 1TOAA 4AW9A 2K6GA 1C4WA 2J09A 1XOIA 2M6RA 1V41E 2CK3A 2RH8A 2E5LB 1CZHA 3HSKA 1L4BA 4KQJA 4LX0A 4IX1A 5AXCA 2YJZA 1CHNA 3FBWA 4TM8A 4FOPA 2CUNA 4CQNA 4PRZA 4LHXA 5JVDA 3PXXA 1YB1A 3O84A 1U81A 4X8OA 1FTQA 1KJ8A 1QDEA 4NBUA 2R8PA 2NYUA 4AYXA 4B9EA 1E9RA 3B5IA 2E85A 4HQ6A 3EE6A 2IOHA 3B6KA 1Q0UA 2IZ1A 2NZXA 2FKNA 2PX4A 3A6EA 3WNQA 3M6XA 2D0IA 1XNHA 3JQEA 2VCYA 5L7TA 1RTKA 2BAGA 2VT7A 4C5AA 4RMJA 2AOUA 4Q6WA 2OEPA 3ZS9A 3FCUB 3PJDA 3WDSA 3DB1A 1JU4A 1YVPA 1DCTA 2ZIXA 5B4VA 1ISPA 4IG4A 4KNVA 3IAXA 1NVWQ 1K68A 2WUEA 2X2PA 3KT6A 4FC6A 5FB3A 3QSGA 5TF4A 5CD1A 2HKIA 4Z49A 1JJIA 1NM5C 5CDYA 4C2UA 2ZWAA 4WLFA 4CN9A 2J9RA 1UK8A 3BSFA 3E5MA 1QKJA 3RTAA 1ZQ9A 4QWMA 1OXVA 3L01A 3WS7A 5KVCA 3LK7A 4WY2A 3P2KA 5HBGA 3B1YA 2PUDA 3FOZA 1JR3D 1XKQA 2ZSDA 2GF9A 5IAAA 1XDDA 4JUCA 4XDGA 2JBAA 3K9LA 3MJRA 1YOVB 3AUJB 2P5UA 2L69A 4WK6A 5DLDA 3G1WA 1GFZA 4DA4A 3HL0A 1KQPA 4M0CA 2V7TA 5KQRA 1JAIA 2IYTA 3WK4A 2G28A 1AKEA 5DKFA 1KYQA 4LKOA 2HWKA 1C2TA 1IHPA 1R37A 1YKFA 2XW6A 3SZGA 3LAWA 4G0PA 1P9RA 1XRRA 3KKPA 1L5FA 1E2FA 2AKAB 5KVQA 3DVRX 4F1WA 2V9CA 5AVRA 3TM5A 5GM2A 5KWEA 1VQ1A 5BT9A 3W2TA 1SU4A 1FNMA 1BOFA 2I80A 3PUKA 4MUAA 3GVXA 1QO0A 2QWXA 2YWCA 4EF4A 3AWDA 4CFSA 1G3RA 1Y1PA 3DE3X 1NW9B 3V4SA 1Z4LA 4DA8A 1LI5A 4DCTA 1HRDA 2ZYIA 3GD7A 1Z7WA 1SOUA 3ZH2A 3RS3A 3U40A 2PH5A 3N0RA 5CK4A 3ZNOA 3NORA 1USIA 1XCOA 5AI6A 2F9LA 2C2WA 1QGUA 3P9KA 3CNOA 4OU4A 3DDWA 2LCFA 3BD8A 2VK8A 2EFGA 4EJSA 2V7QA 4JLOA 5JTUA 4EG3A 1NG1A 3U80A 3MLBA 2MDTA 2LIPA 4PQRA 3EB9A 3ZHVA 2BP7B 4YJFB 1L5RA 3QXCA 2IHVA 2KBFA 4HG2A 4NDNE 4NMXB 4O2LA 4O63O 4YAJA 1R5OA 5EUQB 5KJ1A 5E0KB 3TR0A 3COSA 2QT0A 4BL5A 4BNNA 1TGYA 3ZGXA 5ERXA 1GSOA 1FYEA 1I33A 2PGXA 2P6NA 2OVBA 1Q0QA 4OF4A 5JS2A 3T99A 1ZC3A 2VHWA 5I7HA 3KE9A 3U44B 2QGZA 3W2IA 2ID8A 3GBVA 2BFNA 4OXKA 1SBYA 4BEVA 5A5FA 3IBTA 3EXG2 1U8ZA 4BPRA 2ZXUA 2C4TA 5CDHA 4M1TA 3A2LA 3A28A 2W6JD 4JVNA 4O4JB 1CEEA 4TVOA 3EZ2A 4CW7A 4QDTA 5I3ZA 1OWLA 3EDRA 5KYGA 2IOYA 2QZ4A 1QTRA 3IVXA 3JWJA 3AG5A 1RBZA 4RV5A 3ZWVA 1JLLA 1Z74A 2J85A 2Z43A 1MEEA 4ROSA 1SMKA 3AR6A 3FKQA 1FNDA 3RTBA 1SAYA 1JVBA 2XITA 3DL2A 5JSHA 1C0KA 3GC6A 2X0JA 3ML1A 1U7TA 1RQNA 5ARDA 3VR6H 4HAIA 4N5LA 2GJ9A 2WPNA 4DQDA 1NMYA 1SXJB 1H0RA 1X7ZB 2XE4A 2Z9DA 4P32A 3BQNB 4RKYA 5CXXA 1QHFA 3HVRA 1P9LA 2W2OA 3CZCA 1Y8ZA 3PXCX 3C2QA 3JPYA 1LK0A 3BJIC 3N3AC 4JBNA 2IKSA 3SS9X 2Q5HA 3A4VA 3KSMA 5IDQA 1UPCA 4JJZA 3BH0A 1Z0IA 2Y77A 4ZAZA 2PANA 1E9AA 1Z4MA 2H2GA 3CH6A 4ZO7A 4I0WB 3QQ5A 1PR2A 1GNQA 2Q5QA 5AM1A 3KQUA 3UGTA 4PLPA 4DA7A 1T4MA 4BN0A 4AZ0B 1B8OA 5KWJA 3LYHA 4GGMX 1VPLA 1AKMA 4TV9F 4H7DA 3WYFA 3CVXA 3TLAA 3V3KA 1JIIA 3ZE7A 3UNXA 1YE5A 2H29A 3JD2A 2A1IA 3QVLA 4HQ0A 4O5OA 4OUKX 4B44A 4GICA 1JR6A 1SCNE 3T06B 4M54A 5HF5A 3U44A 4OQ4A 3UCFA 2X7JA 4DMLA 2PAFA 2VEOA 2X1MA 2G07A 1DC5A 1SCUB 1XF9A 2BCGY 2WKQA 2DE0X 1V9SA 3NNSA 4L16A 5AK0A 3SVZA 4AZWA 2A1TR 3N2GB 1QLWA 1N3BA 3D9QX 3TW6A 4NMMA 1TA4A 2IIBA 3S1SA 1PFYA 4MICA 1QIMA 1WM1A 2SICE 1KAMA 4HVCA 2BGUA 1NQ5A 5KSOA 3LX6A 2P27A 3L3BA 4GIBA 1CUBA 3ESAA 4WESB 3SBOA 1D2EA 2BGKA 4YBRA 4MQEB 1EX1A 5TVGA 1E4OA 4N47A 3WGOA 1MNAA 2I0FA 1E4EB 2HRBA 3RR2A 4E46A 2FN8A 3A37A 3IAFA 5E4JA 2FVYA 1JIXA 2VA9A 2HBRA 1NQWA 3NHYA 1LC3A 4IHAA 1ESZA 3WV4A 5JZMA 1TQHA 3DKVA 2J3HA 5ESXA 3SE7A 1KJYA 1AM4D 1N2CE 1CQXA 2ZUEA 3OESA 3DOFA 3FWNA 2YZ7A 2HHHB 2VZEA 1N7GA 1N2CB 2W6NA 2ZB8A 3L04A 3KQOA 4HLNA 4HDMB 3KUXA 3QFRA 3S2SA 4JJAA 4JYMA 2NO4A 3WL7A 1EDBA 2WWXA 1TW2A 2H8KA 2PS0A 2QMHA 3TIFA 4LJRA 2XCOA 2PMEA 1M83A 4OP1A 1CB7A 5JBIA 1YFKA 1ULAA 2WK1A 1JNYA 4ZVTA 2PO5A 3FOWA 1E92A 2RONA 4MVJF 4P5EA 2IE0A 1CUGA 4Q9LA 1KYZA 2UZIR 4CTKA 3JAMA 2ISQA 1QDUA 3ZWMA 4RE6A 2YVUA 2NT3A 3G79A 4Y2YA 2B82A 3D7LA 1OE0A 5FLYA 4R4JA 3LTNC 1V8BA 4AZSA 3D3EA 5BWLA 2GD1O 3JQPA 1OLXB 4L5BA 1QORA 1O9GA 4WI1A 3JV7A 5B1IA 5H59A 1Z15A 1LI7A 2CE7A 3WKBA 1T34A 3K05A 2AZTA 2DZDA 3PGKA 1WQ4A 3HN6A 4NJEB 5LZ5A 2QTVA 1M7BA 3PDHA 1U0HC 2ZS9A 4KV7A 2OCBA 2R8ZA 3S70A 4BDSA 3MWJA 4ENVA 2PCLA 2JD0A 4LCBA 3HCAA 4FWIB 3TGPA 3KKEA 1F14A 5J3JA 1RBQA 5EJGA 3M70A 5IG2A 4GOND 1PSZA 1KI9A 2YC2C 3LT4A 2GFQA 2HRCA 3IHLA 3WGQA 1KY5A 1AMUA 3WGIA 1KI2A 2QR5A 1I51A 3GFTA 4YT2A 4FYYA 3CSUA 4CV2A 2NVBA 1H4SA 3E3NA 2PSHA 3CFYA 1M8KA 1TZKA 3KZXA 4RKWA 4YRDA 4EY7A 1A71A 3ADOA 1UOQA 1K3TA 1PNQA 2HRRA 3HZRA 1DRUA 3O3MB 3W6OA 2QTAA 5F23A 3I6ZA 3N8KA 3ZXYA 4OHVA 5BSGA 1AZSC 3K3PA 4HQNA 4M7RA 4R16A 5B57C 2BEKA 2JW5A 1DIOB 2V03A 1DXHA 3LRPA 4ARZA 3CX8A 1ADFA 2P6RA 2HHAA 3KR2A 1E9BA 5HW0A 2IHNA 4YASA 5DWQA 1BDMA 5HF9A 2O7SA 1RXVA 1JAZA 1IXYA 2JAHA 2R47A 2FZVA 3EZFA 1UPFA 3OM8A 5CVEA 1FSGA 2DFVA 1XHEA 3QNMA 5DM1A 4D9JA 5FWNA 4W9NA 3H0KA 2FHSA 3C3JA 1C3EA 1SIBE 1GEGA 3LBNA 4RL6A 5G0UA 2A9JA 4JBWA 3UOWA 5H70A 5TPWB 1GQOA 3C43A 2C5EA 5ECWA 3RU9A 2PUVA 4J49A 3QV1A 3LW8A 3X43A 4MV6A 4U0JA 3NAGA 3EXEA 4I50B 3BFKA 4PNZA 4RXTA 5HFJA 1JYFA 4HDMA 5BW5A 4GZ5A 1GSIA 3AF3A 2CV0A 4YJGA 10MHA 3BWCA 1CJKC 4XSGA 1NJ8A 2PJDA 2PX3A 3BD6A 3VKVA 4F97A 4PICA 3M2PA 3UK2A 4S05A 2DPMA 1F0NA 4BO4A 4D9MA 1E2BA 4L08A 1PFWA 2JL1A 3FNHA 1TVKB 2KQUA 3R5JA 3TXYA 1ZKDA 2K2QB 3ETLA 5FXMA 4CU2A 3J80A 3MBKA 2RGNA 3QVKA 4L3OA 1E1KA 1XX6A 2IF0A 4RY8A 4A0HA 2XB9A 1KE2A 3S55A 5KYWB 3AY7A 2W98A 1QAQA 2HA2A 3EY4A 2Y68A 4MJ7A 5EQTA 2GD0A 4BB5A 2DP4E 3I6QA 3DWIA 3LMKA 1P2TA 5TB5A 2ZUBA 4CM3A 4BAGA 3G5MA 5IS2A 1T10A 3TSYA 5BV7A 4EHFA 1MBZA 1P0MA 2F64A 4QTXA 4UM7A 3EC1A 5G40A 1JPJA 3DEZA 3OVMA 4N6GA 4UE2A 2G7MC 4B73A 5GGYA 2PX2A 4ILKA 3S81A 2WYHA 4TUYB 4XWAA 1X7YA 4HEJA 1G4HA 4FDUA 4MVJI 2Z6QA 1NN0A 4N5DA 4NCBA 3O94A 2FSGA 2PWZA 2ZREA 3CNQS 3LUAA 4WL0A 2WWRA 2AFHE 4FFOA 3UAVA 5KDLA 2JA1A 221PA 3H4MA 1OF1A 3RRNA 3WL3A 2Q0QA 5FWYB 3R0XA 2LWIA 3KQQA 3MMNA 3EHDA 1QP0A 1YNOA 2FYTA 3U13A 2YXBA 3GQBB 4H31A 4H7EA 5JSZB 4Q3KA 1G4UR 3DV0B 1ORHA 3EAQA 2W4QA 1UJ5A 3DZKA 1S2OA 1A8SA 3DP9A 3O9VA 1BD4A 3WGUA 3T0IA 1HQDA 4M49A 4C4OA 3V6LA 3JVDA 4A8HA 4LKRA 3TTTA 2W8BA 2C9OA 1OTYA 2D2IA 3VHRA 2C1XA 3Q5GA 4DF3A 4F12A 4L7QA 3D6VA 4EYGA 5JSYA 2EG9A 4LCJA 2MU1A 4WKNA 3NIDB 3G85A 3FW1A 5FUBA 2B1QA 2IXEA 1HI9A 2IZ5A 3L7NA 4TYQA 3MWGA 1ZIDA 1FP4A 2KWIA 2Q7XA 4YRFA 1L9KA 1NPYA 4Q4JA 1VCIA 1GZHB 4UTVA 4MGEA 1N5OX 1RXWA 3IR7A 5FLXA 4D81A 2WJ4A 1MOZA 4RHUA 3B1WA 2XCUA 4OQYA 3ABIA 1HZZA 5DBOA 5EIBD 3S2GA 2MINA 2RK4A 1GDDA 4BMPB 1RWNA 1NYQA 4BCCA 4QOEA 1DC3A 3GFFA 1QJCA 2RSLA 2FPWA 1N2EA 4X6UA 5LVAA 1BGVA 1E96A 4J2OA 2ZITA 4LXIA 4RJIA 5J2UB 4UUNA 1X3SA 3GGDA 2HL6A 4HDOB 5DTMA 3WAKA 3X2FA 4FINA 5DP1A 2CLHB 3OM1A 3HL4A 4JT4A 4IFEA 4CM7A 2I6TA 1PWXA 4G5SA 4QNNA 1HEYA 3A0UA 3DMPA 3OE7A 4AI6A 3KR1A 4R8LA 1L4MA 1R4NB 3VR6D 1VE7A 1Z8NA 1EHCA 3HABA 2F8MA 1W5AA 2GM9A 2PZ8A 2XYQA 1TU3A 3BREA 2B35A 2P6UA 2XQGA 4MZXA 1PR9A 4WNAA 1I7LA 5I7RA 2R8EA 3ZZUA 3L0SA 3IRUA 3DHYA 1IB0A 4O4HB 1E60A 5LP6F 3HO1A 1ENOA 1PK7A 5ARBA 3VC2A 3D6HA 4L8WB 2W00A 3PVCA 1KI1A 4ZWNA 3N6XA 4QDOA 3D59A 2X1LA 2V8OA 1G5TA 1V48A 1AK2A 2O2XA 1PVDA 1AZTA 2WAXA 5AHXA 2XGJA 1TM4E 1U0NA 1ZM2A 3KAKA 5FL7D 1ZAKA 3WIEA 5IAOA 2AZMA 2GXSA 1Z2CA 5HEKA 1YR6A 3HO8A 3KNZA 4DMUB 4R69A 2OHVA 2R1TB 1P31A 1UBEA 1KY2A 3HA2A 3RBZA 3M1IA 5KREA 4UUMA 4JOQA 3A2NA 3IXMA 1F4VA 4JCOA 4OPMA 4ER3A 3UPDA 4IOJA 3FOEC 1NMZA 3NDPA 4EFKA 5D84A 1QLJA 2J3DA 2QQEA 3GX1A 1EFDN 1HE1C 2EAUA 2AMYA 1X38A 2AW5A 1MHPA 4MV3A 1GLVA 4E03A 1N0UA 1RKVA 1VZ2A 3MYRA 2X40A 3OLCX 2AZXA 2XKAA 4EG7A 4NATA 1LRJA 1RJDA 4XTCS 3RVSA 2EDAA 3JQ7A 4ZC1A 1I1NA 1UWCA 2Q1XA 2G8NA 3JYQA 2I2WA 1BJKA 1ZIPA 5J1SB 2B3TA 2D2XA 2KB0A 4UEOA 1NVGA 4CKYA 3BMCB 3KFLA 1EDZA 2F90A 2BMVA 2IP2A 4KPUA 3E3AA 4HSEA 2LCIA 4X0EA 4CM8A 1Y5IA 4O02B 2H63A 1FTNA 3TO5A 5K9ZA 1DO0A 3F4KA 3UAXA 1LPNA 4MPJA 5EHNA 1I0ZA 4KZPA 3NO4A 5CP8A 1GCIA 1M3SA 1ZOLA 1CUIA 2QTRA 3GUHA 4ZDIA 5JIBA 1SPXA 4XE5A 4L9SA 2XUJA 2K5UA 1C7FA 3DC2A 3DOOA 1N2GA 5L3RA 1L3BA 4JROA 3WWOA 3MJHA 5KCZA 2Z2JA 1FVHA 3ODPA 3F2IA 3GMSA 1M6NA 2C9CA 4A23A 3H9UA 4DB2A 3OJWA 2C54A 1E89A 1M2WA 3IESA 4S0ZA 1PEKE 1J70A 1WKBA 3LGAA 2QUIA 4LYEA 3VO9A 2HFKA 2ZWIA 4TWAA 3FUCA 1U0RA 3FVQA 5GY7A 2R1TA 4GMFA 1V3TA 3B60A 4QT4A 4B3GA 1ZCFA 1RWOA 5GJVC 1HE5A 3V4ZA 1IE3A 2HJ9A 4MIOA 3EOAI 5IC5A 5AJHA 3H2YA 2YFKA 1EGHA 4DOMA 4EJFA 2WJAA 1C7QA 3AP1A 5AK3A 3HJCA 1Y89A 5DIFA 5L3SA 5L51A 4HH4A 5JXWA 3TZ6A 2EU8A 5IDYA 5K0CA 1NAIA 1Y9JA 2AMLA 3I2FA 3RFVA 2JJQA 1XRJA 4Z54A 4GPIB 3BD9A 5SV2A 1QWSA 1NRWA 3DLCA 1X80B 3BL6A 3FCYA 4G37A 4Q1BA 4K9PA 4XWOA 2W7TA 4YX9A 2Q2NA 1L1RA 3L1JA 2HSGA 4PAWA 1AN9A 1TM2A 2VXOA 1ZOSA 1OFIA 1QH1B 3K5IA 3T38A 3VV3A 3SHOA 3EZYA 1I3CA 1N5IA 1XZHA 1Z2DA 3HB9A 2ZUWA 1JR2A 2GA9A 2IGTA 3HB4X 4OHOA 2ZUTA 1GXSA 1C0PA 1OHHA 3GLRA 1LLUA 4EABA 3V7YA 4UCXA 1T8PA 3RG8A 1AKVA 4NHEA 3VU8A 1Z18A 3AR9A 2AT1A 2BELA 2H57A 2YIDA 4Q03A 5FO0A 3COJA 1TMKA 1VSTA 2F43B 1I32A 1UP7A 4HZUB 1AKQA 2VNSA 3VJLA 2WYOA 3UTCA 4II2A 2JGMA 1QB7A 1ICIA 4LTMA 1T35A 3DVSX 2FPXA 1A82A 5D1HA 5DGCA 2PKRA 4K8OA 5DTIA 1QRUA 3CCCA 5CA0B 5EIEA 5KS2A 5EWMB 3VVLA 5EJ6A 3ZJVA 3SIXA 2O3TA 1U8TA 5DJ5A 4WK2B 4XD7A 2HF8A 3Q10A 2ZP1A 3LUBA 3MTBA 2NU8B 3VQTA 3W78A 5AW0A 3VO8A 2HMTA 3OE7D 4PSDA 4YPVA 3M9WA 2W6ZA 4Y2GA 1N6NA 5AJXA 3WGVA 4S2EA 3MINB 4EQ6A 1T9BA 3AB3A 3M82A 3KQVA 5HKAA 3PQCA 5L4LA 4YMSA 3V8MA 4DV2B 1LDYA 2IZ0A 4GEKA 3NHKA 4HRXA 2PR7A 3B82A 2CJWA 1Y3DE 4HNAA 5ARCA 4PCLA 1W36B 5ALSA 1LBHA 2R8RA 1Y8CA 4M89A 1MO5A 4AF7A 3QWHA 1TUEA 4B4KA 4NCHA 3R3JA 2AEMA 2PNFA 4I19A 1N7IA 3P9CA 3OU2A 1IUPA 3P5SA 4KJXA 4O29A 5LQMA 3D1JA 4LW8A 3KR0A 3I5XA 2PH7A 3EGDA 4MLPA 4MV7A 4RD6A 3OKFA 4B48A 1RI5A 2ACKA 4MUFA 1QTNA 3RH0A 3GXBA 4NFLA 4EP1A 3WLTA 3ZZ0A 2WTAA 3ACDA 3COZA 4HNHA 1H6AA 7REQB 2V6JA 4AJKA 2WKWA 3JATA 4I4TB 2WJ3A 1JZQA 4ER5A 4WLOA 5KAPA 3WQBA 3T41A 4RTLA 2C2KA 3DLAA 4RA6B 1PGOA 2GZRA 3NHFA 5GV8A 3VPSA 5IXYA 5LZ4A 4HC4A 4P84A 3WYAA 1XMQB 1XLTA 4PGAA 3JYNA 4MQ4A 4MRMA 1KORA 1PGNA 4N82A 5DYTA 3RVLA 1I1HA 1JDNA 3FYTA 3DE5X 4RJTA 4Z9BA 3EPRA 4HAOA 1M33A 5C7IO 5CLJA 3HBMA 3B8HA 3N8NA 4HGNA 5JWOA 2HGZA 1GIAA 1M2EA 3WLOA 3AESA 2CBGA 3EVZA 2XKJE 4M1OA 3SDZA 1FU8A 1ZYUA 2GPTA 4MMZB 1YS4A 1NTOA 3BE6A 3H3FA 1WZUA 1WLSA 4YPOA 1T0HB 1N78A 1H2BA 2GEFA 3FKJA 4LYHA 2QL5A 3P8ZA 3U7HB 2CDCA 4BVFA 1QPGA 3LX8A 4QGHA 4YJ2A 2FQQA 2V7GA 3ZUPA 5GZ6A 5K0SA 3OIDA 1DOZA 2PL3A 4U6NA 3FHTA 4KO1S 2DX7A 4INJA 4FYXA 3SPXA 4MVJA 5BWCA 5FNVB 1RJFA 2L17A 1E6UA 3GRPA 5TT0A 1X8JA 2JLBA 1KVUA 2JHCA 3P97A 6REQB 5FFFA 1OPRA 2XT0A 1T24A 3KVVA 4CBVA 1SBHA 4X7BA 2EYUA 3IHKA 5HZKA 5I6DA 3C41J 5A4IS 1J06A 1QO9A 3I5UA 4INZA 2QRVB 2PX8A 5EJ9A 5KBYA 1KZ4A 5LLTA 1PEYA 4G5QA 1TF5A 4DMCA 5B64A 4WW0A 3BGOS 1MDFA 1C8KA 4DLNA 4AMZA 2WNHA 5EP1A 4URYR 3LDFA 5CUQA 1MPXA 1UZAA 3W3AH 4G1UC 3M9XA 2CJWB 3RWMB 2QNRA 1GGHA 1SFRA 5BN3B 1X8XA 3ESQA 4W4TA 1GY8A 3P2IA 4IGAA 3R6WA 3KPVA 5AKHA 3EPLA 2AFHB 5L45A 1DINA 4GX5A 3KLNA 5E6RA 3NJ8A 4QJIA 2Q4BA 1JJAA 1XPOA 1NW5A 3MJEA 2JJ1D 4MQEA 1T5SA 2J5XA 3GLKA 4A92A 3ZJTA 2PWBA 3IMFA 3CO5A 3CF6R 3B3QA 3AF6A 3SC4A 2ZM6B 2CMHA 2C04A 4W7IA 2X6RA 5DV9A 1IUKA 1T2EA 3VVMA 4K9DA 3ZHTA 4DMHA 2YVKA 5ER9A 3M1AA 2JGDA 2HTFA 4F7WA 4DCPA 2YN0A 1BHQ1 2EWMA 1EMDA 1QU2A 5CT9A 2AJCA 3ABQB 1ODTC 4F3RA 3T4XA 3BF7A 1KF0A 4MJLA 3IVGA 5BOVA 3I6MA 1M6VA 2VRCA 4I4NA 5ISMA 1LPAB 3K9BA 4IKOA 4GOKA 3I5YA 4QU9A 3TQIA 1DDIA 2XOKA 5HIKA 3HV0A 1YCGA 1PJ3A 2A7XA 2ZYTX 4EF5A 3HGTA 3OWHA 5DX8A 3U9SA 4CQMB 3G23A 1CY1A 1GQFA 2ECKA 3K15A 4NU0A 2NMVA 3FH0A 4K81B 4X71A 1F0YA 3DR3A 2RH5A 2YZKA 3O75A 4TTAA 5KTRA 1KO4A 1GNLA 4IH1A 2I55A 3KU4A 4WN9B 5EOVA 2IXGA 3TJZA 4HGQA 1K4YA 1VKRA 3GJYA 4UZFA 4RUKA 3RUFA 1N5JA 3HHPA 3DE2X 1VYUA 1VMKA 4MUBA 4WLUA 5K0ZA 3A70A 3R4VA 1X1TA 4QEDA 2BRUC 2PJUA 3PQFA 1SOMA 3OJEA 1RYMA 1A96A 4B45A 1ZXXA 2Q49A 1SVUA 1YRAA 4L28A 3U81A 3WWYA 5BNZA 1CLEA 4IIEA 4GFDA 4B33A 1NLUA 3PDIA 4OQMA 5E1BA 2N42A 3PWZA 2I33A 1JQ5A 2MYPA 2EIHA 1FK8A 5DLYA 4CM4B 2AW3A 1QYVA 4XQCA 5DW0A 1ZUNB 4OG2A 3ZLTA 1UKZA 1L5OA 3NDIA 3EMVA 3IUNA 3ZHXA 1LV7A 2DCUA 2G77B 2BHNA 1SB9A 1U4SA 3FG9A 2RAVA 4IUBS 2XWJI 1WOYA 2PFKA 2WABA 2WD7A 3NBYC 2OXFA 5EVJA 5GWXA 5L53A 1ESCA 2CMGA 3QKTA 1LBIA 3G17A 5F7ZA 3TZQA 4BVAA 4CMJA 5B6IA 5I4CA 1BX1A 1MX3A 1TDJA 5DRYA 4HF7A 3PNLA 5HJEA 3GL9A 4C29A 3OQIA 4BE7B 2X5NA 4NYMQ 3VZCA 2DHEA 1ZICA 4HN4B 1I3NA 4EG4A 5K3EA 3KQMA 2IZ6A 1KU0A 5K4AA 5JR3A 1CUZA 1UT8A 3NVKI 1KDPA 4S04A 2CJXA 2RHOA 4RTMA 5E1DA 5KYWA 1Z8HA 5CM8B 4A0GA 5E6SA 1W1UA 3RIHA 4UW9A 1W5TA 4D97A 5KKNB 3DDSA 1TD1A 3G02A 1N1MA 3NP9A 4PQFA 1NT2A 2Q6OA 3AL2A 5EEGA 2G9QA 1F3OA 2B61A 1CFZA 1QH1A 1ZL0A 4O4JA 2FF5A 3WLAA 1P3DA 1TUBB 9ABPA 1VRWA 3MBIA 1WDWB 4NBTA 5LWHA 4LXGA 1F60A 3QSYA 3QOYA 1TM7E 1Y0BA 1C81A 1EM8A 1XTBA 5EKUA 5T67A 1XEXB 4KWEA 2OK7A 1F3LA 5D3ZA 5IASA 4FKZA 4LYGA 1EVKA 3QXJA 1O6BA 1FXUA 2P0YA 3UUWA 2JGLA 1KJJA 2HMUA 5JJ5A 4LXUA 4MMXB 4ACBA 1G18A 2H3HA 4US0R 2ATXA 4FMDB 3VZBA 4NTZA 4UNRA 1JHZA 2F59A 1LDMA 2QX9A 2Y1WA 3IQGX 1UZNA 4WXEA 3BE8A 1LSUA 1EVJA 2V6IA 5CTAA 4X7PA 2Z6VA 1QP7A 4MQUA 3KK0A 1WS6A 3SMVA 3SOZA 5BSMA 1N5KA 3NCHA 4DLTA 3L6BA 2JHGA 1QO7A 3QTLA 1U1CA 4EATA 4Q1EA 3O47A 3IUYA 3F5SA 4UFNA 5T57A 1ZBDA 1A2BA 2HU5A 2REQA 2ZIWB 6YASA 3DT8A 2PSDA 3R5KA 4M9QA 2H5EA 2BTOA 2P65A 3PSHA 1E5QA 4RQBA 5C1PA 2JFPA 3IDZA 2FRXA 2Q62A 2O1SA 3GCWA 3I0NA 4F1KA 3DEHA 1WMEA 3L8DA 2EEZA 4JXJA 4ZJYA 4BP8A 3NBQA 3X1JA 3E81A 1NFFA 1KJ9A 2NN3C 1TLLA 2R7KA 3A9SA 3ZGYA 1G8YA 5CCEA 4I9UA 1PRYA 3ETHA 3PQEA 3DQZA 1BFDA 4JH0A 2XNSA 3U3OA 4A16A 4M0PA 5ALXA 3SZMA 3QBEA 1OXMA 2FAXA 4AWBA 4CL8A 1VECA 4EHKA 1WXEA 2J9YB 1GLGA 2O7RA 3G0GA 2PGDA 1D1SA 1W5SA 1TAHA 2JGEA 2LZ0A 3PHBE 4AF8A 2JBAB 2GNAA 4OB6A 1OLXA 4MA0A 3R7BA 4FIZA 5HYVA 1DJLA 1A7KA 4OHFA 3E3OA 4P7FA 3UXHA 1P0PA 3G88A 1I14A 1OFUA 3T3DA 1D6NA 5TS3A 3WKAA 3K0SA 2OA0A 4DILA 3SC2B 1F17A 3BWBA 3UANA 4MV4A 4OGKA 1L4GA 4IIHA 1L7RA 5D6NA 2IX3A 2X0RA 4NH0A 1E63A 1BX0A 4OAQA 1GILA 1VHJA 2CXHA 3EGVA 3LHDA 4HNSA 4LHZA 1AKNA 2HRDA 3LZ6A 2PXAA 1M72A 4F2WA 2F6RA 3OZRA 2I7DA 5SZHB 4F60A 4FCWA 4PSVA 4U2KA 2RKOA 4IIUA 1JKIA 3E18A 4WZAE 4Y1GA 5JMTA 1RLJA 5IX8A 1YK1A 2QGFA 2QRHA 1E2GA 2BMDA 4MZDA 1FP1D 3NRBA 1ZI6A 1V11A 3KAJA 5DX1A 2R4QA 3NBMA 4F92B 2ZRJA 2P9GA 4N7BA 3H2KA 3ZHOA 3EA0A 1B15A 1U02A 3VPXA 2DFKB 5DLQC 1UIRA 2JLWA 3OJXA 3QFCA 2O2EA 4H2DA 3FYUC 2PQ0A 2ZBUA 5FTNA 4QUEA 2R97A 4LHVA 1Q91A 4Q05A 4E5VA 1U63A 1C29B 4FW8A 5DHAA 3PA8A 5GJBA 1HA3A 2IIVA 2Z5FA 4KLNA 4RTQA 1MQ8B 4QPNA 4NCAA 1ZD3A 3EH2A 1PX0A 2GPNA 2B4RO 1FZQA 2J59A 3GPDG 4I08A 3MGBA 5I9BA 1HNZB 5FP0A 1EDDA 4LE0A 2ASEA 4X6XA 1NLZA 1UPTA 2CCGA 1SKYB 2BFEB 1A8HA 1SKAA 2IYXA 2FFJA 3KO8A 4NENB 3GJXC 4JYCA 2C3YA 4NL4H 2R2GA 4QT0A 3QNWA 3GP3A 4TMYA 1WCWA 5DIZA 4EELA 4GUDA 3HVIA 4A82A 3FNFA 5BMVF 4HPWA 4KYIB 3K8OE 2NO5A 4AJEA 4ZYUA 1RACA 4JLNA 5C5EA 3U5ZB 3EXIA 2GBLC 3F5QA 5BUCA 2P9HA 5EUBA 2HDWA 2VAXA 2OV8A 2RGXA 1TD9A 3LLCA 2WDPA 3VR5A 1E3LA 3INTA 3CKMA 3L1IA 3GRZA 1AUPA 1SC9A 3KJHA 3NBXX 3H5IA 4G36A 4BNGA 1ZX1A 4DSOA 1O3YA 1ZK0A 2VPIA 3TUJC 4EDHA 4N7JA 5LWQA 3T7CA 4AKEA 3FLEA 2CVOA 4OBEA 5BN4B 4R8SA 3QEOA 1PWZA 1YFZA 2MSDB 4IDAA 4EX6A 3U4CA 1J5XA 5JAUA 3OIWA 1EG7A 4RLQA 4PNHA 1K63A 5FFMA 3CH4B 1JKMA 3AVXA 3OZCA 1RWXA 1I0IA 2RB4A 2LDXA 3I9JA 1WV1A 2H52A 1X7ZA 4I2NA 1CJCA 1VM6A 2ISSD 2J67A 2V7EA 3CLUD 1HDIA 3CEMA 3LY7A 4WOPA 4GAEA 4PCVA 2ONKA 1W52X 2J48A 2JHPA 4YI3A 2VRCD 1HTTA 3ZY3A 4YUWA 2H54A 5GIOE 3OO1A 2L0XA 3NH9A 1HLFA 5EE3A 1OU4A 2YHSA 4BJ3A 1T8RA 2BBWA 2Z6UA 2PTHA 4RVOA 3HN7A 5K01A 4B3CA 1M6WA 2IHTA 3HKDB 4RYLA 1ZOPA 4FFDA 4QPCA 4DRYA 1C9KA 2IK8A 2OOSA 4CQJA 5J63A 2VT2A 1M2JA 5KU7A 2NQTA 4LRTB 3DMHA 2HM7A 2JCBA 1M34A 2BKXA 3AERB 5CEFA 3ZD8A 5C34B 4BV3A 5IKPA 1J0XO 3GGCA 3V48A 4RVNA 1ZR4A 2ZTLA 3HJGA 2ZATA 4R2JA 1DU4A 2EOAA 3C39A 4L9WA 2DG2A 4NNOA 2A2ZA 3C97A 3B1ZA 1G2IA 2JB9A 3HY3A 2EFCB 4FZ5A 4Z1OA 2IBTA 4EI8A 2XBLA 2FUEA 2IH2A 1X6VA 1L7EA 1NONA 6AT1A 2QBYA 5J2TF 2W2XA 1IVYA 2IEIA 2ZT7A 5LDGA 2JLXA 1UQRA 1L4EA 4J0FA 4IZOA 4CMEA 1NJSA 4N9WA 2OPHA 5A4JA 1IAQA 5C8ZA 2CLIB 3O4VA 2I3BA 3JXEA 1H2XA 2QEQA 3EC2A 4QTTB 721PA 4B46A 1S2DA 3PXUA 4P4LA 5L3ZA 3LUHA 2BHTA 3EIEA 4KMSA 3ZBQA 2ZSBA 3C3XA 1PWYE 3GMDA 3EIUA 3A6JA 4A8JC 5HIAA 1G8KA 5FQOA 3IPAA 4M6WB 3U62A 2A7QA 2OGWA 3NHPA 3TIGA 4BV2A 2KW5A 2NOAA 3BMNB 2NU6A 1HFEL 1DXQA 1Y9DA 2WJZB 1MPTA 3BXEA 1GHTA 3D2BA 3SKVA 5IF3A 3GB9A 2QRJA 4PPGA 4BRUA 1KK0A 2VP5A 4R71A 1K6IA 3ZHRA 4BO3A 2QGNA 1RM0A 5LZ9A 4Y0VA 3A05A 1PDOA 3EEBA 1D0IA 2WDZA 3RBVA 3QMMA 3FOBA 1MH9A 3I76A 5ECGC 1ILWA 2VJMB 4C7BA 4DYHA 3USES 3EFOB 1PN3A 1YMVA 1YS9A 4WLEA 4ZKEA 2G4LA 1PUJA 5B58T 3Q1KA 1BQ3A 2J46A 1K6EA 1KS9A 1T5OA 2Q07A 3I1FA 3P2EA 1EUCB 2PKEA 3EWSA 4NMWA 3COYA 3HCRA 4FFBB 4PRYA 4A91A 1QGOA 4G1MB 2PLAA 1T8WA 5DYGA 1O5TA 5CTJA 1K27A 1XNJA 2N3ZA 4Z4HA 1LBTA 2ZBGA 5CD9A 1NBIA 3RT7A 2XUQA 4FFLA 4K9SA 1XZLA 4NNPA 1DKRA 3CW2A 3O93A 2LUOA 2ZRCA 2HU8A 2FW7A 4MIEA 4PS0A 2GETA 2JLSA 2QLJA 1K7EB 2HXSA 3KE8A 4J9UE 4XOUA 5ED4A 1X7DA 1MC1A 3PPYA 5LNK1 3D5TA 1L5KA 2XXJA 2WAYA 4UQOA 2X8LA 4FMPA 3KRTA 2K2WA 2O2IA 3K30A 2EW1A 2E4UA 4EMBA 3W79A 4XWYA 3VDMA 2GZDA 5J4LA 4L4RA 4UU8A 1TQ2A 2IEDA 1UKYA 2QORA 2RG7A 4PSUA 3STUA 3TNLA 3UJPA 5LOVA 3G0CA 3GK3A 2R3SA 1SUEA 4AX8A 1RJWA 1F5SA 3K1JA 4X3OA 1DX6A 4KQIA 4DR4B 2WWTA 2NYRA 4PU0A 3S40A 5J47A 3O8NA 1AG9A 4HWGA 4OH1A 5CPBA 5JNLA 4LF7B 4GKVA 1NF8A 3HCPA 4YMIA 3LX4A 1V7ZA 2P41A 3ABZA 2PSEA 2V9PA 3Q8XB 4GP9A 5EE9A 1RXYA 5LXTF 1UPAA 1WV0A 1ORWA 3THXB 3KG2A 2PGIA 1BRTA 3KU1A 3WICA 5HILA 3BORA 4TS4A 5HNKA 4YJ2F 5ALUA 2JI6A 1CDDA 2CXPA 1JIJA 2BM1A 4CKCB 2NP7A 1J2EA 1ODKA 2C3PA 1JG7A 2GNPA 2NXEA 3QPDA 1ZSNA 1N9ZA 4QNMA 4NBRA 4PQEA 2EF1A 4HMPA 3GGJA 3NM6B 4I6EA 2HOQA 1K6XA 1K9SA 4GVXA 2EARA 1JFFB 1IU9A 4PWZA 4IUDS 4QOSA 2ZQYA 3FSEA 3IB6A 4HEHA 2VL7A 1I3KA 2DKOA 2WA1A 3BPSA 3I04A 3KWMA 3STHA 3E7PA 5IBRA 2RIPA 3ANSA 2CXXA 4JBHA 2COKA 2GDJA 2QVBA 2WFAA 2BFBB 3BJZA 1WU8A 4GNKA 3ZYZA 4OB7A 3V4LA 2J3QA 1XAHA 4TSFD 3TPCA 1N2IA 2Q46A 4RNCA 5K03A 2C29D 5CFMA 9LDBA 3TXXA 1CY8A 3PD0A 4W5WA 2ZVQX 1GYQA 3JQCA 1Q77A 1D5WA 3JQ6A 3PKIA 4QHSA 4UPVA 2ZB4A 1GAQA 3IULA 4WKOA 1FUEA 5HVNA 3ZHZA 1WPGA 2R6JA 3K0KA 4V3CA 2E2WA 2AGVA 3NIGB 4N8SA 3WR5A 2Z5GA 1OWMA 4HYEA 4OBBA 2QF7A 1U4OA 2OVFA 5J1TB 4XCVA 5L3SB 3E4CA 4RDIA 1S3FA 2VA8A 2OILA 3EYAA 3GEPA 3UBTA 4OIMA 2F8SA 1P0IA 1P5JA 2I34A 3LQQA 3OAAD 1DT5A 2QENA 4GYKA 1I7PA 2Z0MA 4I1VA 5TXGA 1CUUA 1MJFA 2RMKA 2R7LA 3THXA 3DTVD 2XYGA 5C4IA 5IYZF 1Y80A 3L8HA 1KI4A 1QQ7A 3HUEA 2RE8A 4PAOA 4ABTA 1U7XA 2V3WA 3TJRA 1MO3A 4BQEA 1EUYA 3VNUA 2TMKA 4IWXA 2ZETA 1MX1A 3ZE2B 1TI7A 1G64A 2YMMA 3I2KA 3H2JA 4AJHA 1UUFA 3VH2A 3EJ6A 4J2TA 2HA4A 1KWKA 1YZTA 4LF5B 4R8KA 4RPJA 3NXKA 3VTFA 1RLIA 2JEZA 3OEWA 2YVAA 4GWGA 3L4KA 5KNBH 1QC5A 2WF6A 1JHRA 2Q9CA 3PNSA 4FFVA 4Z4CA 4KPGA 3U61B 4U2GA 4ZKDA 1E2MA 1AQIA 2OECA 2JZOA 2P30A 3HQ4O 3VMFA 2HDOA 2J0VA 1WOMA 3DHVA 4IUCS 4Z53A 3SM3A 1K5PA 5BYBA 1XZCA 3G0OA 3F0TA 2QMZA 5U1PA 2GFHA 1USGA 4DABA 5JXGA 5G3ZA 1EK2A 3E2IA 4L3VA 3QW2A 1VZ3A 4JI5B 4QXMA 5MN5A 4U7DA 1VTKA 3GT3A 3QJ5A 4RIFA 3TRDA 4NZOA 5HGXA 3L7CA 2R68A 2XD4A 1LX6A 2VZ8A 4N12A 2XT6A 2N9UA 2NV2B 1NKSA 1U2GA 3E7DA 1H8HD 2HX1A 3EQZA 3JQFC 3HYNA 2ZYRA 4GQBA 1N75A 1HOXA 2JIPA 5ALWA 2OFOA 1P17A 2ZUDA 1E1QD 1NULA 4WCFA 4Z4IA 4AJPA 5EJEA 4RDXA 5JY1A 3GGGA 1MQ9A 4OHRA 4CIYA 3W3AA 5LNK6 5A2GA 4JUAA 2BI8A 4O4LA 4I4TF 1C3VA 1MG5A 3G8CA 3INGA 4P86A 5CLIA 3UHJA 2J4DA 3ZVLA 2IY8A 3ZXIA 4F9FA 2D0DA 1B43A 4Y9TA 4DNXA 4LNAA 3ZIAD 3OLXA 3KDPA 3JQGB 1UC5B 4JDPA 3WLNA 5CFQA 4XQ0A 1RD4A 2CUTA 3R7NA 2GCGA 1G5QA 3FNRA 4PSAA 3ZKAA 3CGWA 4C76A 1IUNA 2DQKA 2H2HA 2E4YA 4WDRA 1PLJA 2BKVA 2C61A 2QPLA 5ECDA 4BDTA 5LIPA 4MA4A 3S2ZA 2Z08A 1FVOA 1O6ZA 3D3WB 2GK3A 4KN9S 2EZ8A 2NZUG 3GPCA 3QPCA 2HYIC 1GVHA 3VX3A 3DAHA 5JQGB 4FI3F 2GKOA 4F3YA 1YOVA 2BVNA 2GF2A 3LJKA 2QVGA 1HLPA 4S12A 5ALYA 3AF2A 3SSMA 2AG8A 1D2GA 2OK8A 3BB4A 4RW0A 4R7TA 1BCRA 2OORC 4UEKA 2ADFA 1GG9A 2VZLA 1D1QA 2WMDA 1C9JA 3JYLA 4DG5A 1QPZA 1TU0A 1ZEMA 3SHQA 3V7WA 2J3EA 5JAQA 3OQBA 1P73A 3P45A 3CUKA 1C8LA 1P2UA 1CVIA 4BLRA 2X8AA 5B58C 3V4FA 2AQ8A 2ZYVX 3EK2A 3EOZA 3SXJA 4BP9A 2VSQA 1YUNA 2CDNA 4FEYA 1J99A 3QA3E 4JI3B 5F3WB 4C7KA 1DBQA 4Q1CA 3H5VA 4YDHB 2VLIA 2XEDA 2BONA 2DSNA 2WKRA 2IODA 3GUVA 3I1YA 3OTQA 4MYCA 5EP3A 5IJXA 1W9HA 5JO0A 4P33A 2JD1A 1G3QA 3KALA 3EMBA 1DQRA 1RI1A 4MYTA 1X9GA 4QUIA 3RS9A 2ZUFA 1STOA 5JI2E 3ROQA 5BYAA 1G21B 1Z39A 2FXIA 4K1XA 1T6ZA 4Z9AA 1U7DA 2AQHA 4DIMA 4FJ2A 1FMCA 2KLBA 3MGGA 4KO8A 4JENA 2REBA 1QYWA 4KWCA 2ID9A 3OQ6A 3PHGA 3R09A 1WXIA 4JKYA 1RQPA 1L8AA 5BW6B 1EE9A 1G4AE 3CLHA 3OECA 3PX3A 3FLMA 1SR8A 4A1FA 4B85A 2B5WA 1AB6A 2MTBA 2TRSB 4IJUA 5EMNA 5EGSA 5FYDA 4ZAVA 1JRLA 4PW0A 2DHQA 3QP9A 4MRMB 2DYKA 4CTOA 1IAVA 4KV9A 1GNTA 4KWTA 1GZ6A 3A1EA 2VBFA 4ZI5A 3HWSA 1K6MA 1UZMA 3PIRA 1ZUIA 5TEVA 1UEXC 1XP8A 1MB2A 1QPBA 3FIUA 3KQYA 1KY3A