3HJTA

Structure of laminin binding protein (lmb) of streptococcus agalactiae a bifunctional protein with adhesin and metal transporting activity
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
276
structure length
260
Chain Sequence
QGMSVVTSFYPMYAMTKEVSGDLNDVRMIQSGAGIHSFEPSVNDVAAIYDADLFVYHSHTLEAWARDLDPKSKVNVFEASKPLTLDRVKGTLYDPHTWTDPVLAGEEAVNIAKELGHLDPKHKDSYTKKAKAFKKEAEQLTEEYTQKFKKVRSKTFVTQHTAFSYLAKRFGLKQLGISGISPEQEPSPRQLKEIQDFVKEYNVKTIFAEDNVNPKIAHAIAKSTGAKVKTLSPLEAAPSGNKTYLENLRANLEVLYQQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmb
publication title Structure of laminin-binding adhesin (Lmb) from Streptococcus agalactiae
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Cell adhesion, transport protein
total genus 84
structure length 260
sequence length 276
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3hjtA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3hjtA02
3TEFA 1G20A 4K3VA 5BVGB 2M6KA 1K75A 4H59A 3AERA 5KOJB 1MIOB 5FLYA 1PSZA 4OXRA 1G20B 4HMPA 5M34A 1K2VN 3MWFA 5CX1B 3ZK8A 2PS0A 4CL2A 2YNMC 5KHLB 3AEQA 4PAGA 3AEKB 4OXQA 1N4DA 5JPDA 4OVKA 4TKUA 5GGXA 4INOA 3U7QB 4LS3A 1EFDN 4WZBA 5AFSA 1M34A 3EIWA 2RG7A 4WN9A 1QH1A 3HJTA 3K1AA 4WNAB 1FP4A 1PQ4A 1N4AA 3TNYA 3BE5A 1L5HA 4MDYA 5KOJA 1MIOA 5BVHA 2OV1A 1L5HB 4BBPA 2YNMD 2X4LA 5JOQA 5BVHB 2WHYA 5CX1A 4GICA 2XDQB 4PM4A 5KOHB 3AESB 2OV3A 2R7AA 1M1YA 2OGWA 3AEKA 4HN9A 3MD9A 5JG7A 5M2QA 3GI1A 5JJ5A 1M1YB 3U7QA 2QI9F 4ND8B 1XVLA 3CX3A 3UJPA 3ZK7A 4WZAA 5M29A 4WNAA 2AFHA 2PS9A 1KARA 4N01A 1QH8B 4WZAB 2PS3A 2R79A 4FILA 2AFHB 3PSHA 1K7SN 4NNPA 5HDQA 3MWGA 1M1NB 4M7OA 4FI3F 5HX7A 2XDQA 3BE6A 5KOHA 2ETVA 3AESA 2XH8A 1N2CB 4LJSA 2MINA 4MLZA 4NNOA 3NU1A 4UTPA 2AFIB 4TKVB 5M3BA 1QGUB 2MINB 3PSAA 4DBLE 4ND8A 4FKMA 2Q8QA 2M6LA 1G21A 4UDNA 4HMOA 3G9QA 1KAHA 4G09A 1H1LB 2PHZA 1G21B 1QH8A 3PDIB 3LI2A 4FNAA 3HH8A 4WESB 1M1NA 3ZKAA 4UTOA 2O1EA 3MINA 4MX8A 1ESZA 3AETA 4IRMA 3ZK9A 3HXPA 1N2CA 4UDOA 4XPIA 4INPA 3MINB 3AERB 2AFIA 5I4KA 3AETB 1K0FA 3R5SA 1TOAA 4B8YA 4TKVA 1QGUA 4XPIB 2XUZA 2XY4A 4HMQA 2XQVA 3ZTTA 3R5TA 3AEQB 2Q8PA 1H1LA 2WI8A 1KAEA 4TKUB 3PDIA 4G07A 5CR9A 3LHSA 4H0FA 3AEUA 3EIXA 3MFQA 4WZBB 1N2ZA 1M34B 2PRSA 4WESA 5GGYA 4WN9B 1QH1B 3AEUB 4MO9A 5B58T 3TLKA 5BVGA 3K1AB 1FP4B 2XV1A 2OSVA
chains in the Genus database with same CATH superfamily
1FRFS 5H1YA 2HA0A 2FFRA 1VOTA 5FA6A 4O2AB 4RVFA 5F4ZA 4YUAA 4A15A 3AILA 3IUBA 3S28A 1ZBQA 1M2HA 3C6ZA 2X0DA 4OKNA 1GPMA 3H13A 4J1SA 1TUEA 4IKEA 4W9RA 1INLA 3UJ6A 4I1YA 1RLMA 2FFBA 3M89A 2C78A 4IDGA 6REQB 3D54D 3QU7A 1Z4NA 3Q3JB 3W3AA 5CFPA 3VU3A 2YWCA 3EVCA 1LDNA 3HBJA 2D2EA 3D6AA 4IYJA 5G4LA 3S5UA 3TLGA 1F60A 4HG2A 2VJYA 3JS5A 4KLCA 2BGJA 1QV7A 5MGNA 4Q3NA 1YK1A 1VE7A 3SHQA 2PSFA 2Q1SA 1Y4DE 1CUIA 4JGBA 4O2AA 1JAHA 3G8CA 4UVGA 3LXMA 4Q19A 2ODBA 5LZ4A 1NJSA 1WXDA 4HLUA 2FPPA 4GWGA 2C4NA 1HE8B 2H7XA 2R00A 3GRYA 4IFEA 4IV0A 4JJGA 4X95A 5B2ZA 2CSXA 4Q34A 2JIOA 4WWHA 2QK4A 4GPD1 2H1OA 4YAFA 4BO4A 3ER9A 5CIYA 1S0UA 4YJFB 1G8HA 2Q5OA 4FOTA 6REQA 4ROSA 2PK3A 3GLTA 2RCYA 5HP4A 2C5HA 3AVYA 4I6JA 3SYNA 1MZVA 4A92A 5FL7A 3MLEA 2QD2A 2DYKA 3M70A 3FOBA 5C53B 4BASA 1X0VA 2OZLB 3SNHA 3N39C 4RCYA 5K3EA 4HNQA 1Q16A 1YDFA 1D2HA 1FSSA 4YT5A 3VO8A 1A8QA 4EA6A 4E88A 2CXSA 3VH3A 1FU7A 3C43A 3ZJUA 2ZQYA 4ENTA 1IN1A 2XB6A 1RBMA 1Z0IA 4B3RB 3ASUA 4KP7A 1DPGA 3AIOA 1TA9A 1WY7A 4US0R 3TMYA 3UJ8A 3ZGVA 1YE8A 5F3WB 2QRLA 3P4UA 4UXHA 1DXYA 3I2FA 4F60A 4E07A 1DKQA 3ZWWA 3TB6A 4CIXA 4DBLE 3T1YB 2G8LA 3KPVA 1M2WA 4ZARA 5J2TF 5KS2A 1YU9A 3SIWA 1QTRA 2QVCA 4IM7A 2WAOA 4S12A 1X94A 2G9VA 2ZVDA 3M4XA 4FD3A 2QUIA 4MHOA 1OC4A 2OZLA 3FF4A 2BPOA 3Q0IA 4OHCA 3SKYA 3WBKA 2AKEA 5MN5A 1P60A 3DHEA 4G1MB 5K1ZA 4BQIA 3OTWA 4LQCA 1XDWA 2CFRA 4NMMA 1ZI8A 1JU9A 1N5JA 4HWRA 13PKA 4DDUA 4IRMA 2TECE 3FJYA 4C4AA 3FVWA 1D2RA 3HCDA 1GQQA 3WGUA 1NVXQ 2AN9A 2Y71A 1DBPA 3O2NA 5EZYB 2XY4A 4LF7B 3T9AA 4LX0A 2G82A 2IXTA 4M0PA 5CM9C 2J32A 1U9CA 2OHFA 2PRJA 3KJNA 5LZ2A 4N0EA 3E48A 4LNAA 2Z57A 5IUKC 2Y1KA 5DKFA 4DIEA 4FQ8A 4I3FA 3ZC3A 4YB8A 5FJJA 3X44A 4ZK2A 2V65A 3TRHA 3MOSA 4P4LA 5DYYA 2JK1A 2WIAA 4DFDA 5BVGA 3IILA 3QE3A 1VP9A 1RXIA 1QC5A 2VRCA 2HWKA 4KUHA 4QWWA 1UXJA 4KR0A 1E1MA 3SNKA 2UUCB 3E35A 3AY7A 3F5SA 3WZLA 1JBKA 2MIIA 4P4GA 2I2CA 2PRZA 4IHQA 4DCOA 4M2LA 1I0IA 2JAPA 2BN4A 4PAGA 2IW3A 2P4SA 2IELA 3ZVLA 1YZGA 1Z4KA 3C3BA 4JLBA 3K09A 1UQRA 1USVA 3GFSA 4RM2A 1ENOA 3RRXA 2Q1YA 2YYAA 4TM8A 1E6KA 4MCAA 1LI5A 2F3RA 2OB1A 3AY3A 3IUMA 1BFDA 1UXGA 2G0NA 3K7EA 1Y82A 2WSBA 3HP1A 3LXXA 3N2YA 5ECYA 2QVBA 4NBKA 3BWMA 1DQRA 2FJ0A 1S8OA 2WV7A 3WRXA 5FTKA 1ZR4A 1E0SA 2FUNB 2JCVA 3O1IC 4IDNA 3K70B 3EPHA 3W7VA 3NOVA 3OX3A 2ATIA 3WLFA 3AESB 2JDID 1KVQA 2R7AA 5B3JC 1Q11A 4E3WA 2WC1A 1M72A 4N76A 2H51A 4I2NA 4Z51A 3T1NA 3GN1A 4UEWA 3SSAA 1JG3A 3M8KA 5KCZA 2RGNC 4EH1A 2V9ZA 1ESDA 1NDHA 4QT0A 3C6YA 5IAAA 4ID9A 1KA9H 2JIZA 1Q74A 1BIFA 4RD1A 4LFCB 1I36A 2QN7A 4Y6QA 1P4AA 4ILEA 4KVZA 2ZKIA 3A1TA 3BICA 1HYBA 2PV0A 2Z95A 5EJ2A 5KAMA 1PW5A 5JZMA 1YDGA 1MO5A 4Q03A 3SJ7A 4R5HA 4QUEA 2V7GA 2OC4A 1BMFA 1O89A 4NCHA 4PZUA 3AESA 5K3DA 1FZQA 1W49A 3KQMA 3SBDA 5LN1A 3ZLJA 1ULHA 2P40A 3V4VB 1I6LA 3G0OA 1T29A 3BERA 1YVDA 3LDUA 3D6MA 4EJ0A 2GVZC 5KYTA 2DKNA 3BWYA 1DHRA 1ZIOA 2C9BA 1H8EA 2PQ0A 3QNUA 2R6DA 1QP8A 7YASA 5HSGA 1E4YA 2PHZA 3DOUA 1CLUA 2PX8A 1SHUX 2IYNA 2QRUA 2VBFA 1E1DA 1LBSA 4K9MA 4RDCA 4RY9A 2YWJA 1FBNA 1JEOA 1E1RA 4L3WA 3MXOA 4KJXA 5H59A 1Y5RA 4ARZB 3FMIA 1SVIA 4JAVC 4CMAA 1GG2A 4KQWA 5LDHA 4HWKA 1G9TA 1LK0A 4WLFA 4LWZA 3NEPX 3ADKA 1W29A 3DHYA 2PFKA 4M8IA 2ZAYA 4AUMA 4OJMX 3L46A 1F6DA 1VYUA 4O4IA 4MW0A 5LZ7A 4DDTA 5AVJA 3QH4A 2HIGA 4NI5A 1OIWA 4KMOA 4U2DA 4YMUA 2FDCA 1CEYA 4TV8B 1VLQA 1J00A 1GO2A 3BWEA 3G2LA 4TOIA 2ZYGA 2HU5A 3W5SA 2UZAA 4CIWA 4M54A 1V43A 1ZM3A 2CFOA 2VP5A 5E38A 1P1BA 4ITUA 1F0NA 5K51A 4ARZA 1EYZA 1Y7IA 1HQCA 4AQDA 4B3XA 1AU9A 1IDOA 2FZWA 1E1YA 5GIPE 1WZCA 1EB9A 1DRKA 1K75A 1Z0SA 2W2NA 3ZX4A 2OD9A 4PYQA 1UPAA 4JQCA 2M6KA 1TA4A 2EYUA 3RSHA 4C7VA 1EGHA 5H81A 3LT4A 4MQBA 3F46A 3O4RA 4JL6A 3TW6A 3QEMB 5CT4A 1E5VA 5LUAA 4CKZA 2PWAA 3L8FA 4TV8A 5LCXA 4YY3B 5ISMA 3HQ4O 2EKZA 2OENG 2AWNA 3COYA 2BELA 3F7NA 4GXQA 1SN7A 2C9YA 2PUJA 4YAOA 4WZAE 2HU2A 2PAAA 2G04A 2SECE 4NHOA 5DX1A 1IQPA 1TJ5A 3S1SA 3H18A 4BLQA 4BTLA 1FDOA 3I1JA 3P0IA 1G2PA 1UQUA 1ZWLA 3LLUA 4BNJA 1DBIA 3WLPA 5KVCA 1KDZA 1SUIA 1W2HA 4M0FA 1O1YA 4E0BA 2J0VA 3GYBA 5THKA 3AI2A 3LZDA 3QM1A 2OBMA 3WLLA 1A7AA 4UFPA 4HQOA 5DE3A 5GJCA 2WUEA 3QEMA 4NDZA 1ND5A 4J49A 2ZR8A 4IDCA 4L28A 3ELWA 3REQB 3CRNA 5EGSA 4C7KA 5TMEA 3D8RA 2TMKA 3UG7A 1M1YA 5KJ1A 1QV6A 3O1LA 1NVUQ 2PGXA 4FU0A 4P35A 2JGMA 4YT2A 1XTIA 2IPAB 1L4BA 2YBDA 3PPWA 1S2IA 5DHFA 3U49A 1E3IA 1GZVA 4G0PA 4ZQGA 5KOIA 3A6FA 2ZULA 2I7XA 1Y1LA 4QODA 3UJPA 2YDXA 3WK8A 2PGJA 2VRBA 1NKSA 5DHUA 5I3CA 3Q85A 4MQ6A 5THXA 3H5IA 3DBVO 2FPGA 5CK4A 1AD2A 3UJCA 1X2EA 1VJ5A 2W6PA 3HY3A 1W44A 1YHYA 3REQA 1T8UA 3R23A 4EK9A 3PB3A 2AFRA 2HX1A 3TWOA 3R75A 2J48A 3T9EA 2VZLA 5F1KA 4ZU6X 4OM8A 4A8TA 4Q1DA 5LQMA 1CS0B 1E99A 1L4UA 1RE0A 1TU0A 2IZ6A 3PWZA 3TOZA 3ZW8A 3TLBA 4FLEA 4PTLA 2HLHA 1RLTA 1U9YA 3S68A 3HI6A 1O2DA 3NUQA 1GDTA 3GT4A 3QXSA 3OHPA 1YQGA 4HQ6A 2EAUA 1WHSB 2JEZA 4GKKB 1EVYA 3E3NA 4C4ZA 3OZIA 2DETA 4NFLA 3JYLA 1Z6ZA 3R3XA 4WHMA 5TPWB 1YJCA 3W3ZB 1Y9JA 5HRAA 3RYTC 3R8CA 3M4ZA 3HMKA 5CHYA 1ISRA 1F1JA 3L02A 4D4GA 2A9PA 4FUTA 4DDKA 8LDHA 3DULA 4L72A 2V59A 4DCVA 3LXRA 3SOZA 4C1BA 4U6QA 4G0XA 1SHKA 2PX2A 3E9ZA 3O3OB 1QM5A 4YR7A 2Z9DA 1FJHA 3GLHB 3KUXA 3AM1A 2C2KA 1RYZA 1PFUA 3SVLA 3ILHA 3WAGA 3OECA 4GMXA 1DO2A 4HAIA 1HT3A 3SF0A 1Y3CE 3O4VA 4GH5A 5BXYA 3FUUA 2OV6A 2YHSA 4P32A 1P0FA 1O5IA 3GEBA 3L7MA 5TPWA 5E95A 1EBUA 1P17A 1YMVA 2XZTA 3KHTA 3OPYB 4CLXA 3D8NA 1YFLA 4Q05A 2H9IA 2CY0A 3MT0A 1GRQA 1G8JA 4M53A 3TLAA 3A8TA 2YIMA 3IKLA 3EHEA 3SJUA 3SXUB 4GUAA 3ABOB 1N36B 1RWXA 2P5YA 3RWBA 1K68A 3LG2A 3IELA 3WNBA 2ZR0A 3GLHA 2HMSA 1ZBDA 1Q20A 4JVSB 4NS1A 1Z6GA 2CJYA 5TQVA 2JH3A 1W9HA 3O4GA 4GRDA 2WF9A 1H2HA 4YXWD 1YA6A 1KFJB 4MB0A 1Y3HA 2QD4A 3IBYA 5TB5A 4IAOA 4NCIA 3T4UA 1VL1A 3Q3GE 1Q0HA 2C3PA 2IYZA 3MAJA 2F55A 4RXUA 2G9UA 1IWOA 2NUTB 2ORED 5BQPA 5KCMA 4PU0A 2B7BA 1TLFA 3OMLA 2NV0A 4BBZA 3FGZA 1LQUA 3UFXA 4BGEA 2CDNA 3BFJA 3DDOA 1N4AA 5A9TA 3M6AA 3UFBA 5B3JA 1DX4A 4RVUA 4ZEXA 1MV5A 2O8EB 2GEKA 2I5PO 5E7JA 1A2OA 1PHRA 2D1SA 3SXUA 3TM4A 3BMQB 2PGAA 2RGNA 1JFRA 3K73O 3OIFA 1OH7A 2VJDA 3ZWAA 4BMZA 4UXJA 3ZUGA 3AIKA 1VP3A 2GCGA 3VR2A 2WG0A 1I7PA 1LNQA 1R6VA 4GKBA 1TTPB 1A71A 4QQKA 3M6MD 4ZO6A 1WQ3A 1NOKA 1YS6A 1VRVA 1DUIA 4E70A 3QPCA 4XDZA 1M2FA 1P2FA 2XITA 1T3SA 5CHEA 4BEBA 4DAOA 1KO5A 2YZMA 4P81A 4OX9B 4M9UA 5KWEA 5JCJA 3AEYA 1V4BA 1KAGA 4IP0A 2ZUBA 1E79A 2O8EA 2ID4A 3HU1A 3JU3A 4RMIA 2IZ5A 3G2NA 5HF9A 3TFQA 3UMGA 1SKQA 1F4LA 5JVDF 4JB3A 3Q72A 1RQXA 4N5HX 5BRNA 3B51X 2OHVA 3UUFA 3V8BA 4CI0B 2ZS8A 3GMDA 3ZIAA 3EGCA 3D81A 2PRKA 4EKGA 3PDHA 5H02A 5AUNB 3OU6A 4NABA 3H7IA 2N42A 1XHLA 1E1NA 3ZN2A 5EIEA 2P90A 2W8ZA 2YJZA 4RJJA 1VJ1A 2QNIA 3OU2A 4Q7JB 4CGYA 1REQB 2TS1A 2DPGA 3E23A 1QK5A 1NW8A 4R7GA 4REOA 3QXJA 3K71B 1BMQA 3GXBA 3LYHA 1J23A 2CJWB 2H2WA 2ZP1A 4WIAA 1GSAA 1YVRA 2HRDA 4OOFA 4H1TA 3U7IA 3GDWA 4F71A 2M9MA 3BWBA 2JFPA 4MX8A 3QXHA 3LY5A 4RMGA 2K87A 2COUA 2IU0A 1KC3A 1SY7A 4NBTA 5K0NA 5L95A 1X80B 4ZHQF 2F3QA 1IEXA 2VQSA 2NUAB 3D3KA 1XPUA 2JAWA 2O2ZA 2I71A 4LMPA 1REQA 2DY0A 2R8OA 2ZWAA 3HEMA 1AC5A 6CHYA 4W8HA 4TQGA 3EEOA 1KZ9A 2NMVA 4WUVA 3J81k 1IOLA 2E9SA 1XQ9A 1CHNA 1C8KA 3BGWA 5DH9A 1EA7A 2IRWA 2PT9A 2XYHA 1U0RA 1CW2B 2K4MA 2Q5QA 3IPYA 3S7TA 2CBXA 2QE7D 1SC6A 3X1KA 3B1FA 1U8XX 4KQXA 1Y42X 4FP9A 3AZQA 4BQSA 5CB4F 1U8FO 2CZGA 2DSTA 4WGFA 3T5MA 4D96A 1X80A 5K0ZA 3F6YA 3HXQA 1TL7C 4U8HA 4L8YA 3D1JA 4L5JA 1KKUA 1PJCA 3KEOA 3ZD9A 3NV7A 2XRZA 2ZKLA 4L27A 3K4HA 3FVVA 5CX1B 3GRZA 2B8TA 1NBEA 1FIUA 2C5FA 2QT0A 5CDHA 1Z2EA 1QP4A 1V9SA 2QG4A 1ZCZA 3MVEA 4H0NA 1ECCA 1YOVB 2VSNA 3BA1A 3LVFO 4WXRA 4OXYA 3ETDA 4OQDA 1BRTA 4RANA 4XIYA 4RZXA 1GKKA 3FTFA 1Z28A 2PD4A 3OQNA 3U37A 3MAAC 3UUWA 1I9CA 1LDMA 2C2ZA 1E2LA 3DTVA 3RYHA 3AHHA 2FG6C 3TM5A 1N6OA 5HJ7A 1BROA 3UW3A 5B1HA 1A95A 5IM5A 4C29A 3T3DA 5CX1A 4AF6A 1FQKA 2IDMA 2ZATA 2OGSA 5DOVA 2VCEA 1HFEL 4JP1A 4N8DA 2QTHA 1I30A 2OGWA 3F98A 1AKUA 1L4EA 3AUUA 3FIUA 1PS9A 1OXVA 4IYRA 1KOFA 1YOVA 2W2KB 4RC9A 1GPBA 2R1UA 2XEDA 4X3OA 3V80A 3DLBA 3GFPA 6LDHA 5ESRA 2FCAA 1OCEA 2HMYB 4ND8B 3RAJA 4HYTA 2R5WA 2HJHA 4RGVA 1NKVA 2ZSBA 3WGLA 3FWNA 3GUCA 2PS9A 1UJ5A 2VOJA 3C6KA 3E7WA 4D25A 5A4KA 4F7WA 1V35A 3R3WA 2X2EA 3FTQA 4RIFA 2YIJA 3NTOA 4OGFA 4JUAA 3RUEA 3T4XA 3WE7A 4AUKA 2P9GA 2D5BA 1ZD4A 5JEDA 4OL9A 4TZKA 4R9UC 3RFVA 4OIMA 1T1SA 2R4QA 4JQOA 4I5IA 4KTVE 3WYEA 4UD6A 2WUWE 1Y6RA 2VQEB 1YF3A 1SXIA 1ODKA 3TW8A 2D7CA 3OKFA 3M3HA 4M1QA 2EGUA 5KQGA 4NE2A 3ZCTA 2A1UB 4HVLA 1CF4A 4ND8A 4P3XA 3AIMA 2DH6A 4AJJA 4COOA 2FW7A 3D6NB 3CR7A 5FR2A 3ZIUA 4AJNA 1Z0KA 2XUAA 3NG1A 3QEJA 3PGXA 5ILOA 4LN1A 1XXLA 2OVFA 1YHZA 2OXRA 4N03A 1TF7A 1QHYA 3BGVA 1HY3A 3LM8A 4P3PA 4NVRA 1N5IA 4BO7A 2P6MA 1NXWA 4MKXA 2O1WA 1X86B 4ESHA 3HM9A 3VJRA 3DDZX 2B34A 1MLDA 2C0QA 5EMMA 3HNRA 4MCHA 5KJCA 3DE3X 3LQKA 3P5SA 2GJSA 4IIJA 4PG6A 4CM3A 2J87A 4LYJA 5IG2A 1FVFA 2V1XA 1D8TA 2A1UA 1RZ3A 3PWSA 1P1CA 3AUKA 2J3LA 2G80A 3IR5A 4YCAA 3QF7A 1XZJA 4O1MA 3O8CA 2DAPA 4MJLA 1KAEA 2B4YA 3M5CA 1I24A 4YEDA 2V6JA 3PUKA 4I50F 4D02A 4PTZA 3DPUA 3IDZA 3PA8A 4RESA 2ZE7A 2OGTA 5B12A 1T8YA 3GZNB 3N74A 4FYKA 2FN3A 5B58T 2ZR9A 3LPNA 4IG4A 1MOZA 1Y9ZA 3MN1A 3N1UA 1Q1AA 3GNQA 2JI8A 3GT3A 3DKRA 3ZNQA 1IRIA 1O95C 4EAAA 2XGGA 3PEFA 4CVNA 1MHPA 1PX0A 4MI3A 2GGSA 4LXUA 2FZ4A 3K8YA 3G79A 2NAFA 2OOKA 2QMZA 2K5UA 3IPLA 4QDXA 1MD9A 2WIBA 3BRQA 3FHLA 1YC2A 1YRQA 2WJ4A 1QGOA 4GFDA 4KK3A 4IICA 4MYRA 4OVKA 5F4BA 1WXQA 2BBWA 3RTCA 1FPQA 3IL2A 1GKLA 2Y93A 4ZTUB 3WLRA 2MU1A 1P19A 5TQJA 3FPHA 4ZYXA 4WLEA 9LDBA 3A2MA 3L8ZA 1AZLA 2CVHA 3G2MA 3RGGA 4BOYA 3RS0A 5ADHA 2LVBA 5EZ5A 1M2KA 1B41A 1SA0A 5AVOA 3SKVA 1X77A 4UTNA 1T2CA 1YONA 4YREA 3KXPA 2CNKA 4N82A 1CF2O 2ZRKA 1I7LA 3HCFA 1TPZA 3RUPA 1B6TA 4QZVA 1Q91A 2WJVA 3K1TA 1SG6A 1UT5A 2AMLA 2X5KO 2G36A 4IIYA 2D7DA 5EL0A 1Y1PA 3KTAB 3FCXA 2EHJA 3HL4A 1UDXA 2HIMA 1O4VA 3OVMA 3OUZA 3PZRA 4KGDA 5JPIA 5T5QA 3V1TC 1ESEA 4GSKA 5A4AA 5AWFC 4JLKA 5C1DA 3PV0A 1OFTA 5KNCH 2R84A 3UMVA 2YHAA 4B84A 1E61A 2WWHA 1XEWX 4LSMA 4H16A 4HB3A 4NE9A 4IL5A 2GAIA 3D4IA 4RVGA 2HA7A 3C3PA 2YRFA 4L2IB 4RZ3A 5L7YA 5FD8A 2GEBA 3I01A 5EKSA 2QTRA 3K0CA 2AZXA 2AFHB 2Y1XA 1D5WA 1IDN1 1L2TA 3LV8A 5KREA 5DN6A 3RK1A 1GZHB 2AMJA 4CV2A 3GBVA 5BO5A 2J3EA 1ZUIA 2NPIA 3GO4A 4XXHA 4ZOLF 5CEFA 1GUZA 4P31A 2JIDA 3UJ3X 2PL9A 3KTAA 2BZ0A 4TUYF 3ESDA 1XMOB 2XUPA 3MJFA 3A4MA 5EXPA 2HT1A 4WKGA 1M34E 1PWEA 2ZJ5A 3SM9A 2DHDA 3CJQA 3GCDA 1V3QE 4AL4A 1QVAA 1YJQA 3SMVA 4YJ2B 4GGMX 4EYKA 5KTNA 2VZ8A 1U5CA 1YIOA 2EF1A 2Q2QA 3WOVA 1WTCA 5FWDA 2ONJA 4DQVA 3VC2A 3A70A 5CDGA 5L7TA 3EISA 1P1JA 5ICEA 3UBTA 1W4BA 3TE7A 1MIHA 2AC2A 2O1EA 1MO6A 2QGNA 2DFLA 4ITVA 3PHHA 2AZTA 2B37A 1FUUA 3ONWA 3T99A 5H8WA 1N3IA 1VB5A 1W1WA 1W4LA 2B35A 3GEIA 5BYJA 1JL3A 3X0DA 5HRUA 4C04A 2WKRA 5DXAA 3EDCA 2D0DA 2AC4A 2IEZA 1KK0A 2O3JA 1SXJC 4RPKA 5D7NA 2WAXA 1FNBA 5JJKA 4BFCA 3O91A 4YJ2A 1UJ6A 3OTHA 5DNYB 2PZAA 4QYIA 3GGJA 4TWAA 3R77A 1XA3A 4YDRA 3BD6A 5F9MA 2IIPA 2KSQA 2R3SA 2F9FA 4JUFA 4XE5A 2UYOA 2YX1A 4ZGBA 1QK4A 3QZUA 5C7OO 1ZIPA 3BHMA 2RHDA 3TQTA 3ZW9A 4NDNE 1NVDA 2IYPA 3K8QA 3ZWDA 5I01A 4IJKA 1SEVA 1CVRA 4M8NE 4KFSA 5D8DA 1J1IA 4MXDA 1LW7A 3BTOA 2PPVA 4QJIA 2Q6TA 5CGQB 4WXPA 5HMMA 4MHTA 1P0MA 2VJMA 1DAGA 5A2QA 2I62A 2QW8A 4KVAA 1Q17A 1Z45A 1V3UA 4AJEA 1QZZA 4OXIA 3UPTA 2JNWA 3RLIA 1IFXA 2PSDA 3ND7A 3B3FA 3KYDB 4KNVA 1QCCA 1W46A 2C5GA 2HYIC 3OX1A 1KZ7B 4PAWA 1V16B 3GF4A 2BE7A 3IEIA 4RD2A 1XTKA 4MW6A 4B6EA 3U5TA 1JQJC 2ISSD 2W6OA 3D6TB 3K05A 3M3DA 4FHDA 4C7OB 3EA4A 3PLRA 1G42A 1RPNA 1NUPA 4KUGA 2BP7A 1K8XB 4OHBA 5EJ9A 1M67A 1RCFA 2C4HA 3PL5A 4L0MA 5IF9A 3OI7A 4QYWA 3UQYS 3RVOA 1XWIA 4N3CA 2IPNA 5ALJA 5ENDA 3V1NA 1HBJA 4DM3A 5GVSA 3T5PA 1ISFA 2WWRA 3CNNA 1TQ8A 1YZUA 5AKGA 5KHAA 5DWDA 2YRWA 4AO8A 1GGMA 1F7UA 1Q1GA 4M38A 4FMPA 3V6MA 3AWDA 3CZCA 4D9MA 2C8KA 3AINA 1YT5A 4IWNA 4NMLA 2QP4A 3TTSA 1RAGA 1D0SA 1GTJ1 3KYDA 1DBWA 4X6XA 1V41E 4AECA 1P7PA 5C8YF 1PEKE 2EFYA 2YUIA 5I4IA 1V16A 2OCKA 3E82A 4TXMA 5JAOA 3I9LA 3RC3A 1W4ZA 3WVNA 4NZYA 5KX5B 4C7OA 2XRYA 2VXBA 1ZLYA 2BFEB 1KO1A 1J25A 1NR5A 3AO0B 4LGVA 3WTBA 3HADA 2PU5A 1MHTA 4I7EA 4BX9A 1I7SB 1QH8B 5DBIA 1YZTA 3IHTA 2VCHA 2EZ9A 2I8LA 3DMHA 4OI1A 5I7RA 2QTLA 3IVCA 4ZDWA 3W1WA 2PVSA 4LA4A 4Z54A 2X86A 4IQ4A 5G1PA 2Z0MA 3A4LA 4TTVA 4EMSA 2G7MC 4F04A 2CW5A 2KS6A 1T10A 3L43A 3TR6A 4XJTA 3IUNA 3WKAA 3EZ6A 5CP8A 1P2VA 3NU1A 4ENPA 5EJ8A 4ZCLA 4ED9A 1DGQA 5K3OA 1ZR2A 3NAQA 1GCUA 1V25A 2CMKA 3AJDA 3B9QA 5ELLA 3WMGA 4XR4A 3AJRA 1MAAA 2BFEA 2JZNA 4ESVA 5ALNA 2X8JB 2EW2A 2MYTA 3W3AD 2RG1A 1QH8A 3CE9A 2ZSHA 5K8IA 1ADJA 1Z88A 3KOWA 4NQRA 3CC8A 1BHJA 2GF0A 5EJGA 3M6WA 2OO7A 5BQOA 5KTRA 2ROQA 1BN7A 5G0WA 4OP2A 1SKYE 4G8CA 2BFAA 4QPJC 3C16C 3SGLA 2OQVA 3H8JA 4UDOA 2ZB2A 3GVCA 3PQ5A 5FCDA 1G6OA 2FQYA 1OWMA 3WGZA 1N8TA 1NX9A 2BHRA 2FRDC 3UVEA 2ZWPA 1AMOA 1KZHA 3LTNC 1NBIA 5A0VA 1Q21A 3L18A 1Q95A 2JLCA 1FSFA 1WVIA 4R1UA 3R7FA 3SPXA 3A9CA 4EARA 3IJPA 5KDOA 1L7EA 1THZA 2X8JA 2ZE8A 5CR9A 2RK4A 3N0WA 4J1NA 2PMDA 1PEDA 2IL1A 1WMSA 2NQ8A 1DUSA 3IAXA 1MGPA 1O95A 1Z07A 2QR3A 3QVXA 5FL7D 2OAP1 2AK3A 3G2QA 1NNSA 1LSSA 2A58A 4LF5B 2IYXA 9ABPA 4AFNA 4M4SA 3GHHA 2WY2D 4TYYA 1GV1A 1JZTA 5E3IA 2Y3IA 3FAKA 2UUAB 3ZHBA 4FYVA 3KQVA 4Q7QA 1WS6A 1DDOA 3Q1LA 5CFNA 4AG6A 3QW4B 5IANA 4RVDA 4ZVQA 1QPZA 4JLAA 2EW8A 3SBEA 4ENRA 3B20A 1RJEA 5ESDA 2Q6LA 4FDMA 3O0DA 3P0HA 3U7QB 2B92A 2J5XA 1S2LA 4B34A 1XZHA 2EDCA 2ZIGA 3OQOA 2QROA 1GCIA 2O7VA 2GZ3A 4K86A 1NDUA 4L6CA 1FNCA 4MYTA 4P3YA 1LPNA 3WB2A 4D81A 4Z4IA 2J67A 2FMFA 3NOOA 4QFBA 3G0GA 5DCLA 1G8KA 2H57A 4BGUA 5L53A 1XKLA 2A9FA 1GL6A 4P4SB 1GIAA 4RHXA 4BE4A 5KU7A 5LNK6 2VRWA 3RBAA 3A1NA 2Z5FA 4HN9A 3U09A 1FDRA 4RLHA 4LSGA 3ZYCA 1P3DA 2XGMA 4NICA 3UY4A 4BN0A 5M2QA 5IYZF 2G1AA 3DEIA 3IUQA 3O31A 3U7QA 3UT0A 3ZHUA 1U1GA 2BBTA 3QWHA 1RHUA 3ELDA 1KAMA 2X76A 4HAZA 3GCZA 1D7AA 3JR7A 4ZRDA 3TMAA 3ZTWA 1LJUA 1A9TA 1Z83A 1LZLA 3F5MA 1WEKA 1THGA 1NT2A 1X8JA 2PS3A 4GAEA 1TKRA 3IIIA 3V8MA 4Y2VA 1AUPA 3B1XA 2HY7A 3LBYA 4DW8A 2F6RA 2MR5A 2I0FA 4ZAVA 4C6SA 2IU6A 4BVFA 2VRCD 2ZJ1A 2FMUA 1Q6ZA 3JQDA 3SVTA 4Y2QA 2O5CA 1SXJB 1TQ6A 2HU8A 2IE0A 2H3HA 3GP3A 1NVVQ 3ZR4B 3KR0A 4GC5A 5CVJA 5FPPA 1L5WA 2FWAA 1LDEA 2LDXA 2WOOA 1I10A 3VPCA 2J5BA 3AP3A 4LDQA 4QSMA 1EHCA 4KPGA 4A2WA 2YV2A 4XUEA 1GTG1 5D1HA 3AI7A 5A6SA 5JRZA 1YZLA 3OJFA 2IYEA 3S40A 1A4XA 2X1HA 3G68A 3CJTA 2O2HA 3NT4A 1JHVA 3FPFA 4C0JA 5K8UA 4CEIB 1CY2A 2GJAA 4FMCF 4JP2A 3QYJA 2G40A 3WWCA 1IMOA 4IXTA 4EHIA 5A03A 2D8AA 1JMYA 1CE8B 3E2IA 4IR7A 4MRMB 2JFZA 1SXJA 3GGSA 5SY4A 4X45A 4INPA 4PR3A 1E94E 1YR6A 2GR9A 2VL7A 3R3JA 3VUEA 1Q83A 2JFNA 1X1DA 4LWPA 4M1OA 1UXIA 4LZJA 4WK0B 1XXHE 1RPTA 1XQ6A 4JBXA 1ISJA 3UA4A 3ZV5A 1PE0A 2ODWA 1EJ0A 1J6UA 1E6UA 1QLWA 2BMDA 2AV6A 2WM8A 4RKQA 3TLCA 1SWWA 3MTQA 2AJLI 2JLWA 4EI2A 1RQ7A 3KWFA 4S1TA 2BISA 2JCYA 1NVAA 3DBLA 1C4OA 4O0MA 5GZ6A 2P3SA 4XB2A 1KYQA 2DHQA 2JIZD 4ALJA 1KI7A 4CEIA 3IV9A 2XMCA 5H9VA 1XP8A 4LQDA 5CFLA 2JLAA 3LUFA 1CE8A 1Y8CA 4QXPA 4MRMA 5E2IA 2HO4A 2G17A 3NHUA 4LJYA 4R2JA 3IKJA 1EJ6A 3NUGA 2Q3DA 3WMFA 3OTIA 1G20B 1SBCA 2VXCA 2IYSA 2N9UA 3WIUA 1YHNA 3OQIA 2PZLA 3IJEB 3KPWA 1MW9X 5ED4A 1JWLA 1JHRA 2JGJA 4Q7KA 4J3NA 3EARA 3LQYA 4JDPA 1JZQA 5JD3A 1E5XA 4XYLA 5IJZA 2Z6AA 2YJTD 3NYIA 5EHIA 5CH3A 3CPHA 2D5LA 4ES6A 4PGHA 2O3RA 2GZMA 2V6IA 1B4DA 1CXZA 3A6HA 3VNVA 1H8ED 3RS5A 2GN4A 4D0LB 3RT7A 2WMNB 3VTAA 2W8BB 5KVQA 4DA4A 2EIXA 2HXGA 1K5GA 1N7IA 3H87A 3HKCB 4FBMA 3L0YA 3NBKA 1E1RD 4HZUB 1RZRA 4ON9A 1F8XA 1EI9A 4HDRB 3STTA 4XCQA 4A0HA 3GMIA 4E32A 5T4BA 1JSXA 1Z7GA 4DNXA 3DR5A 3K5PA 3OUTA 2MCFA 2ZRBA 1CVLA 1N9GB 2PMBA 5LUBA 2B99A 2M98A 4W5QA 2ECOA 1ISMA 4MV7A 5ILQA 4K8OA 3K9QO 1JSCA 3CEPB 5FTWA 3EYWA 3ANTA 3FWPA 1NJGA 3H2SA 3LOQA 4L78A 3F8SA 4B0OA 2MR6A 2BTEA 4UNIA 5IBCA 2DBYA 1GM5A 2W8BA 1X8KA 2OFOA 2Z2JA 1KZ6A 1UPUA 3NHJA 1JHAA 1SCKA 2R1ZA 3HKCA 1SVKA 3I09A 4FKZA 4JA0A 4E2WA 3NNSA 4O4JF 4LGYA 3T3OA 1COWD 2XLBA 3H5TA 1PSWA 5CYPA 1A9XB 1GPJA 4HZUA 5ALUA 1OX4B 4Q1VA 5TS2A 3V8VA 4M8LA 2C92A 2LGJA 4BUJA 1V6AA 3L0SA 4HDRA 3L7YA 4NC9A 1M1NB 5KHOC 4I19A 2XGJA 3IBSA 1LPPA 2WKSA 4OJNA 1N9GA 3PWTA 4PRYA 4KOEC 4AYWA 4LF9B 1E3DA 4QQNA 3TVDA 4ZYLA 2QQFA 4TRMA 7AT1A 2C4MA 4GM4A 1K5DA 1QSGA 2DFNA 3EWIA 1KNQA 2DCMA 3VKGA 1W19A 1E63A 2X5JO 4ERNA 5KC9A 3SIXA 3NC0C 5JQWA 2CDAA 1SXGA 2CXUA 1KPHA 1XZDA 1Z5VA 2B5WA 2V6FA 4C7XA 5KNBA 1MVNA 1XZMA 3BGOS 3CLUD 4U1RA 4CWAA 2CXPA 3M2TA 1BWPA 2PT7A 3FRIA 5AHOA 1A9XA 1OX4A 1SBYA 1LBTA 2DBRA 4PPFA 3ESQA 4XJVA 4ZI3A 1AY0A 2CUZA 2IKSA 2NM0A 1M1NA 2CLFB 3KX2A 1VFNA 3ESZA 4A27A 3PUWA 4PCLA 3ZGOA 4CV3A 2W6MA 2ZK7A 1I1NA 4DUPA 2XYQA 4X7RA 4HATA 4UCFA 5DN9A 2N46A 2CHQA 3VTKA 4RVCA 2BI4A 2NOAA 3IEMA 4LY9A 1J4AA 3TDKA 4CM8B 1W7AA 1WBJB 2YICA 4R41A 5H83A 3T12A 4DLNA 5AXAA 3O8RA 4OYRA 1HK7A 2P1DA 3PC8C 2I29A 4B6RA 1ZICA 3LX4A 1BE1A 3G0BA 3OD1A 2V7WA 4R2IA 3ZHVA 3G2KA 4EG6A 2YJ3A 2GK4A 1JNYA 4D2IA 4GMFA 4NZPA 5DRYA 5IPFA 3GMTA 4FNOA 1H94A 5CLIA 1OZAA 4OHOA 3V4LA 4XA8A 3CH5A 2I6QA 4NOMA 3L4BC 3ZJYA 1RYHA 1VA5A 1QRSA 2H5LA 3E9EA 1WMBA 5AJHA 3O7MA 1L5KA 3T52A 1ZVQA 2XB9A 1OC2A 3L4KA 4KVGA 1OVMA 3H2KA 3LVRE 4R31A 4N5IX 3BB3A 4LPSA 1HEYA 4TTRA 5ALLA 5REQB 4UU7A 1LQTA 4L9SA 3ZK8A 2E5LB 5A1JA 4TMKA 2WYWA 5G0SA 2OT3B 3AF4A 1RZVA 1TLLA 1P9OA 2EFGA 3PK0A 4X8HA 1YK0A 3WG9A 1VM6A 3TW4A 2F3TA 3NORA 4MW9A 3BRWA 1D2MA 1ZKDA 2FSUA 4B75A 2EU8A 2Q5LA 3CRQA 1G4HA 1MZPA 4EA8A 4Z7JA 3TPZA 2HMWA 2Z4RA 2YBEA 4UKDA 3CFYA 1N2GA 3SC4A 1OFVA 1MXHA 3M9LA 5AKLA 3A3YA 2CMGA 4HR7A 4NOLA 1C0IA 1ICEA 3ML1A 4R8LA 1PF7E 2ES4A 4X62B 2R6GA 1ZI9A 3GBSA 3CUWA 1A7KA 2I1LA 3FOCA 5GTDA 3SJBA 2LW7A 1K66A 1M7GA 4D0SA 4KWEA 2PLNA 4WLVA 3DE1X 1Z4MA 3VTFA 3OFVA 4YAUA 4B6PA 5CXUA 1S2GA 3CRW1 5DTQA 1XNJA 1AMNA 4ZZ2A 2X3YA 2IGTA 1NFFA 1R3DA 1W35A 2FRVA 4K6OA 4CG3A 5BY2A 2BW0A 2DERA 1Q22A 2E5FA 2R5NA 1USIA 3PENA 5FPTA 2XDYA 1EDBA 3GGCA 2RI6A 3I42A 3KZVA 5EJIA 4Y1RA 4K6CA 1B3RA 4KR9A 2HTFA 3EJ6A 1OASA 1E2JA 3L6RA 4KXQA 4WBXC 5L3ZA 3TCNA 4B1FA 1GZ3A 4XR9A 1DXHA 3P0EA 1B3BA 4S1VA 2H1LA 3G9UA 3NIDB 3SQDA 3T41A 1E9SA 2VDNB 1KR5A 4N48A 3W0LB 5DEIA 1UWKA 1XB2A 3RJMA 4C6RA 4DGSA 2HRRA 4F3YA 4G5SA 3PYLA 1OFUX 1G7SA 1Z2DA 1NPDA 2BF7A 4MUXA 4G09A 4JI3B 2R85A 4MQFB 2V7EA 4PSKA 3W6NA 1TVKB 5JSUA 1TE2A 1R0KA 3PDIB 1GDDA 3UA3A 1E98A 1SHLA 2OBBA 3TGPA 3JQAB 2BEVB 3ZV6A 4P80A 4G37A 1ZMTA 4UUAA 4GVLA 3VTZA 4ZODA 3PD7A 1V8BA 1J8MF 1FLAA 3OTGA 3MGAA 1O97D 3RC1A 3OAAA 4E11A 3B3QA 2FSGA 1GUDA 1U3UA 1ZM4A 2YV3A 4MVJF 4D0RA 4X6YA 3RKSA 1NL3A 2RHCA 3MINB 3P9YA 1C41A 1TOAA 2EFDB 1K9SA 3NHYA 2ZI5A 1Z6TA 3R3ZA 3FVTA 4IXWA 4PRZA 3KLPX 4I5GA 2XHZA 1UK7A 3VR2D 2FR8C 5ER6A 3W9UA 2RMKA 1TTHA 4MQFA 3L8EA 1TVKA 4KQKA 3D7NA 3PDIA 1E1CB 3NETA 4MWOA 3T5BA 5C46F 1NIJA 2BFNA 2BBSA 1LPAB 2BEVA 1NIPA 1S01A 3JQAA 3VU8A 4ALIA 1DRVA 5IT5A 2ERYA 3N8HA 4I55B 4N7JA 1NLUA 5JCJD 4F8YA 5EWMB 1FMTA 4F4CA 3TN7A 1E79D 2JGIA 1AS2A 3JYNA 4PIPA 3T5TA 4D98A 2G88A 1UT8A 1JECA 2CXXA 1C3XA 3IB3A 3OIYA 4GZ3A 3NPMA 4PYMA 5WRFA 4AW9A 3JZIA 4N7RA 3ZIAD 2A57A 4UHBA 4CL2A 2YNMC 5TMBA 4FWTA 3M6LA 3QRWA 3WMXA 4HK4A 4A10A 3W8RA 2GPBA 3PFHA 2QPTA 4MV0A 5F1YA 5AXDA 4F86A 4QGSA 5T41A 5JSQA 3R20A 1QVWA 1E1CA 1UBFA 4FC6A 4FN5A 2A7XA 4PFSA 4LY6A 2NZ2A 4R1TA 3DEHA 3RCBA 3RFFA 1QS0A 3DEYX 1LI7A 2OTCA 2ONCA 3F6BX 2B83A 2YYYA 4ID3A 3ESBA 4I55A 4LBYA 2QJRA 3KSZO 5F77A 3VYRB 1E3TA 5EWMA 1LGYA 1WE2A 1JXQA 4MV5A 2FXIA 5J4VA 2DU8A 1YS7A 3ISVA 1XN4A 1ODTC 4S1OA 3QG5A 1E4VA 4Q9KA 4M7PA 3V34A 4YAJA 3TQHA 3W9BA 2ETXA 1DEHA 5TVKA 4CF6A 3Q2OA 2QSYA 3GUUA 3R0XA 4KLNA 3GG9A 2R6FA 1LLQA 1ENZA 4JBHA 4ZOBA 1EPUA 2QTMA 1EB8A 3CKLA 3MWDA 3PVCA 4HTFB 4NYJQ 4PBSA 3GUHA 5J5VA 4B5KA 1YV9A 3AOEC 3PCXA 3CT6A 3PLNA 4QOFA 3UQZA 3AY0A 2QOEA 4UCXA 5EJ7A 3GDHA 4DKXA 4GKJB 1PDOA 5F2EA 1O9HA 1UXHA 4KOAA 4PFKA 2XA2A 4CKEB 1J9ZA 2Q9CA 3L05A 1QHHB 3DE5X 3Q9UA 1UANA 3H2IA 2AC7A 4JELA 4D79A 2ZRPA 4CL0A 5AW7A 5L3QB 1BXKA 2IYVA 1V39A 3DLCA 2G1KA 4Y67A 1HLGA 4KYIB 2WIKA 1MRNA 3FMPB 4G9EA 4Z9XA 5GPBA 5TLSA 4HWGA 4QECA 1Z8HA 1N0WA 3HYNA 4PCUA 1TAHA 1XQXA 3M9WA 3ITKA 4P08A 3RRBA 4B3CA 2F67A 4HTFA 2WU0A 4R8RA 3UC9A 3WDKA 1V26A 3NVDA 2NZWA 2R7LA 3TIXB 2BDUA 3V55A 3CX8A 3GA7A 3TG2A 1T8RA 1UJ2A 4BRUA 5LR6A 4WW0A 4X3CA 2IYWA 1OXXK 1NUUA 4MDHA 3DWEX 2QVGA 1QHHA 1UDBA 3S7ZA 1HLDA 5JBQA 1FXUA 4MW5A 2E21A 4RO0A 1TECE 2CEKA 3C7KA 1M5UA 3M83A 2FZKA 4E7OA 4MW1A 1R4MA 3OQ6A 3DTVD 3OM8A 3CW9A 3T7SA 1CUFA 1NHGA 1M2GA 3PC8A 3QXXA 3KVVA 4B8YA 3MJEA 3RADC 3DS8A 1ZJ6A 1R50A 1RXVA 5HEKA 3BIWA 1EXDA 2SKCA 3F2IA 2IS2A 1U9JA 4ZZIA 5LQNA 3U61B 1M2JA 4TVKA 1WVMA 1J90A 1KI6B 1UJBA 4QICA 1UFOA 4F93B 1P2SA 3VZQA 1ZDMA 3GLVA 2WF8A 3FOAA 1U7XA 5E2AA 1PO7A 2GZAA 2G9QA 2PX6A 4ZCSA 2I8AA 1WMEA 3OA0A 3ZDDA 2VI5A 1QXSA 3FDFA 3WDSA 1O0SA 3WWOA 4RE6A 3L0ZA 2JA1A 1FP4B 4K9PA 5JZSA 4RTJA 2J9RA 1GQOA 4F0JA 2GBPA 4LTDA 1WA5A 1R0WA 1ZUHA 1CZKA 1B6RA 1NP6A 1Z3CA 4IDHA 3RQIA 1C7RA 1U7TA 4IJVA 2F3PA 3O3NB 3LYAA 3EE6A 4B3TB 2R751 3H4VA 4M0CA 3TLXA 2OKGA 3KPJA 3N87A 2CV0A 2FK7A 2O7RA 3IB6A 2G9ZA 5FPKA 1MC4A 3PPIA 4HGRA 4QXOA 2RGAA 3KV3O 1ONPA 4JJFA 4RV9A 4BZXA 4DMRA 1C4XA 1WSWA 5ES4B 4RTNA 2X1MA 3NVMB 4JJ4A 2X8LA 2XTZA 3MGKA 3OMXA 1OPRA 4XQGA 2HQ1A 4PYRA 3PITA 3H04A 1FP4A 1UXOA 2PIAA 4GMGA 4E6EA 3ORSA 4BN5A 3CZPA 1YJAA 1NBWB 2VSOA 3NW9A 5TR9A 3NJ4A 4ZXPA 4RLSA 2R4UA 4Q9HA 1SHTX 1PU2A 3CV3A 2KBEA 3DNMA 5NLLA 2CNWA 4B3BA 3DH0A 5CYOA 2J6IA 1P7YA 5AVKA 3SQOA 1HG0A 1TMOA 4DY6A 3DF9A 4EA7A 1ZJ4A 4HAWA 5TT0A 2RHLA 1K2WA 2ECQA 1BWQA 1MV8A 1OXSC 2FN9A 2ZVQX 5C51B 2DXIA 3PHLA 2VBIA 4U63A 1ISHA 3UGJA 2ZRQA 5DTEA 1PS8A 4BP9A 3BCHA 3CF4G 5M29A 3LK6A 1W9MA 1H2ZA 3HVJA 1KARA 1Y8RB 3T6KA 1L8AA 3RAGA 3RO7A 2FWJA 2D5AA 1ITZA 2C0CA 2GPSA 3UB2A 3B1VA 3IQHX 4EFLA 3ZZNA 2AG6A 2XOKA 2XXAB 2QRVB 2RC5A 5JARA 3OPYI 4PIMA 4DANA 3DGFC 3RC7A 4GXRA 3H3JA 2MINA 5PNTA 5M7EA 1SWVA 4BQQA 3MW8A 3NKLA 3QPAA 4EKYA 2EBFX 5FOTA 4Y0VA 3HO1A 2K7ZA 4Q18A 2VDWB 4R16A 5C0OE 3JR3A 5D6NA 1D4OA 1Z2CA 1U98A 1ZSYA 5IEJA 1I94B 1Y8RA 2QN1A 4PFQA 1TC2A 4YT4A 4Y7DA 3WS7A 4X24A 4N9WA 4NYMR 1FX0B 1EUDA 2Y1FA 2MWMA 1F12A 3W2GA 4WESB 4JVNA 3FPJA 3WQRA 2XXAA 2MSKA 2OCIA 3IUSA 1SURA 4Y2JA 4NU6A 1A5AB 2RH5A 1L9KA 2X8BA 3CE6A 5IH7A 5DBGA 5GONF 2FR8A 3GP8A 5FO0A 4K03A 4DCSA 4C07A 2GZHA 4EGFA 3IFSA 3UHFA 1CY8A 2ZDHA 4KV7A 1GPYA 2H92A 3MSXA 3IMEA 3ZE7A 3ZE1B 4AY4A 3MZ0A 2WM3A 4OV6B 4NCKA 1TKBA 3F9IA 4F3CA 4AM8A 5GZ3A 3E9RA 4TTIA 1SG9A 3P4YA 5DM4A 1XCLA 2QL9A 1FX0A 1BG6A 1EUCA 2ATVA 1T0IA 3OX2A 5IM4F 4WESA 4TLBA 2JEOA 3R7NA 4A1OA 2VNHA 1KORA 3A6JA 2PZBA 1ZOSA 3OE1A 1WDLA 1P5FA 4X41A 4LDJA 4AWBA 1PKEA 5DN6D 1MFPA 1XV5A 1FP1D 3W5HA 1SELA 4QYTA 1NSTA 3FKJA 2ZB4A 4DDVA 1T3HA 2Y0PA 4HMPA 2XT9A 1N9ZA 2YXBA 3PQCA 4YLEA 3C6QA 1FQWA 3SC2B 3C98A 5AJUA 4EYQA 2WF7A 3FYUC 4K9KA 3RC9A 2BSQA 3SZRA 4AJKA 4DEVA 3HMQA 1YB1A 2CUTA 1P8AA 4FX5A 4LOHA 4RK1A 4YR9A 5AJWA 2WWXA 2I6XA 3C2QA 1E20A 3ABZA 1RMQA 4ASUA 1IHOA 3CX4A 2O7NA 3UYLA 1QHSA 4JBNA 3SJAA 1W76A 4JX9A 2X6RA 2ZI6A 2XNDA 3OT5A 4GYKA 1ORVA 3F5DA 3HJTA 2FWBA 4JL5A 3I8SA 4NU0A 1XPJA 2R8XA 2WJJA 1M1XB 3LSYA 4QJBA 5SZIA 3CEHA 3DNPA 4X7PA 3A1SA 2I9PA 3FPLA 5E0OA 1OYYA 2PVCA 3DHNA 4QARA 3GLGE 3EH2A 4CG0A 3FNRA 1XMIA 5CLQA 3AOEA 1HYEA 1B76A 1FDVA 5EG5A 4JI5B 1LDGA 4MS1B 1F2TB 5K3CA 1KEVA 4OFXA 4FYPA 5CU7A 2ZAMA 3OZUA 1SUFA 1GEEA 1R66A 1G2QA 2I2BA 2NZ8A 5F1PA 1BX0A 2KE5A 2HDNB 3QLEA 4L1KA 5DI9A 1D2GA 2HUPA 3HYSA 3R0VA 4RCZA 4TWBA 4WA7A 3W8FA 4GXTA 2Z5GA 2JI4A 5G02A 3I4CA 3Q88A 3VR6H 2GQ0A 1EX7A 1XYGA 2BGKA 5KSPA 1UM9B 1R4AA 2VJQA 1JDVA 2PR7A 1FSGA 1P4GA 4TMFA 3K2QA 1I4TD 5LC1A 2FQXA 5HQTA 2IUFA 4LDRA 3ZU3A 4MS1A 3E70C 3F97A 4ZO8A 1XMSA 5LLDA 4C0KA 1PZGA 2DT5A 3C5WP 1NV9A 1Z2PX 5FPHA 3AG6A 4RV4A 1RKVA 2PANA 2Q5HA 3PPYA 2J09A 1N6KA 4N47A 2F64A 5KOYA 2REQB 2AOWA 3H9QA 5IUNC 4MWSA 1YL6A 3KOOA 4LUCA 2XDAA 2AFVA 4HWPA 3I62A 2FSFA 3DQQA 4JLOA 1CUUA 3CJRA 1JQEA 4G1EB 4LYHA 1AXRA 1B15A 1FVHA 4MUGA 4N6GA 4WFIA 3VR5A 5K0CA 1UM9A 1YL7A 4JP8A 5E4FA 1E1LA 1TUIA 4FE3A 3PZBA 5J1TB 1WNTA 4DCGA 2IJGX 3RROA 2AJCA 3EDOA 1V11B 5JH7B 4IHJF 1C7QA 5LA6B 3AFMA 2O5EA 3H2HA 5IDYA 4X0EA 1GGKA 2GWHA 2Z98A 1N3LA 1OZGA 1ZU5A 3ITEA 5BSKA 3I1FA 3IQFA 4UDXX 5GJWC 4LJRA 4KGZA 3UK2A 1Y7HA 4QXRA 2F1RA 3IDAA 4BNUA 5IKXA 2XWBF 2REQA 4RH0A 4KO4S 2JI6A 3I3OA 1CIPA 3JXEA 2XECA 3H2GA 3I1IA 3I9KA 4QUHA 1Y8ZA 4JI1B 4AJ2A 3GLIA 2YS6A 3DFKA 4JLDA 2O50A 4GECA 1QH1B 4L9RA 5CLLA 5BN1A 5EJEA 2FWNA 3FNEA 4KN6A 4MEJA 1R0XA 4MP6A 1NASA 4LK3A 4OAOA 4EM6A 3EBPA 2BZGA 5DLEA 3UOWA 5LA6A 3SR0A 3VZRA 4CDMA 1HSZA 4BKOA 1ZH6A 3LBFA 3S29A 3UXMA 3CUUA 4RA6B 3RE1A 5BWMA 3EZYA 5DSXA 3ZUPA 3FM9A 1J0BA 4XW2A 4QKQA 3RS4A 3ZHXA 5CK5A 4EKDA 1WUTA 1ADYA 5COAA 3A4YA 5C5IA 1ID8A 2EWWA 1II0A 3E3AA 5FTMA 2Q7DA 4DNPA 5HKAA 1UAAA 2ZIFA 4FFWA 1OHHA 1UBKS 1EVIA 1KDVA 1II9A 3FMVA 1YE3A 1Y80A 1MRZA 1QH9A 2CF6A 2FZCA 3EIWA 3ESYA 4J43A 1QH1A 4RDIA 5AK0A 4C4YA 5KC8A 3MAGA 4K6MA 1HC7A 1EHIA 2YY5A 3ZNNA 4RF3A 4MQMA 4EMTA 1KJ9A 3Q3CA 1KRWA 3ONFA 4ZVNA 4RA6A 1S3SA 4RGYA 3RG8A 4HDQB 4KFUA 1OW3B 4YA6A 3WYDA 5ALZA 1VPLA 1CFJA 1H0KA 1H65A 4G5OA 1O9GA 3IR6A 4IOJA 4D44A 4ARVA 5HNKA 3OTQA 3DVQX 3G5MA 3P9RA 4XD2A 2HB6A 4ZOEA 3W5JA 2A84A 2YINC 3AW8A 2PMEA 3KAKA 4BP1A 1E6EA 4DIDA 3KSMA 1QKJA 1S9HA 1V1RB 1PWHA 3KL4A 1O87A 2B9VA 1HDEA 2UV8A 3L0PA 4X9XA 2D1YA 1YBMA 4KAXA 5ICSA 3R44A 1TM1E 4Q21A 3DZ8A 1IZZA 3WJ7A 3CO5A 1SU6A 3K0SA 1YB7A 3V8PA 1O95D 4C6TB 2OKCA 1O96B 3M1LA 1V37A 4MHSA 2JFFA 1Y9AA 5ARBA 4U7TB 3FETA 4OGGA 5LDGA 1V8DA 2J7PA 2UZ0A 4JLVA 4WLNA 1QQ5A 1VIMA 4CTOA 4ZEVA 1SC1A 4G07A 5JI2E 1RWNA 3Q5EA 1OFGA 2AS0A 3P2YA 1ZXLA 3CNQS 5EIOA 5EHQA 1XVUA 1OTXA 3NHSA 4DLRA 3AXTA 4DMUB 3GX1A 3QITA 1SVMA 1IUNA 2ZBQA 4KDEA 4L4SA 2OXCA 1V1RA 2CDRA 2DUMA 1R27A 3JASB 1YB4A 3I30X 4R4JA 4MB6A 4UDNA 5KKAA 2XKKA 2ODTX 3CPSA 1LRJA 1RC1A 1B42A 1NLZA 2PX5A 3WL7A 1UXKA 4A6DA 4CQMB 2O19A 1WB9A 5KNDH 3PQ2A 4RETA 3TRFA 1ZJWA 1P5HA 5EP4A 3R6TA 4H9GA 1ABFA 5HM6A 2V0CA 4FB5A 4R71A 1ICIA 1GGNA 1ESZA 2OCPA 2ZJ2A 4H7FA 5IJXA 3FYUB 3MT7A 3KLBA 4D5EA 1YRBA 3H5WA 1B00A 1X19A 3BBPA 3G17A 3QKSA 4UHEA 4O2BF 2O1XA 4HGPA 4OHYA 3H1EA 3OWOA 3Q11A 3U7GA 1BVRA 4E5PA 2DULA 1NI4B 2E55A 2JRCA 1WMFA 2R7KA 4ZD6A 1BDBA 1U1FA 4CQMA 2XT6A 1NUHA 4WTOA 4ZI7A 3EIXA 4MROA 3UXEA 3CZQA 1JHQA 1PFGA 3DKKA 3FFAA 4B6QA 1FA9A 5HUQA 5FTJA 1D0VA 1JDNA 5DYIA 4FZ5A 3H2ZA 3BSFA 1NQTA 2XV1A 2YMQA 5IJ0B 4HNUA 1OWPA 1U6IA 2B25A 5A3SA 2C2WA 3FYUA 3B85A 5J2TA 4EF4A 4NJEB 3NCTA 3IO5A 1VSQA 3B48A 3ANYB 4MGEA 5FNVF 4RK6A 4Y2SA 2FFAA 1NI4A 4PWYA 3WGIA 2AX3A 3W34A 5DULA 2D2VA 2FMKA 1JI0A 4OJQA 3ROFA 1VL0A 2ZUCA 2EX1A 4P54A 2YS7A 4N5NA 4QFMA 3DBOB 3I83A 1T8TA 2BZ1A 4HUJA 3EGOA 1L1EA 2ORWA 5EIBC 4X65B 1YDHA 3EGDB 4XZ3A 4ZYVA 5KYGA 4KHZA 4G63A 1R4ZA 3HJCA 3P0JA 4H1VA 2X22A 1DUVG 2FVYA 4NJEA 5DGDA 4HADA 4P2BA 1HGXA 5KSOA 3D0RA 3H3XA 4CKWA 1QORA 2B61A 4JLSA 3U9TA 1SXJD 3HHEA 2D6FA 1UBNA 1SZPA 4OIFA 1FXWF 2YXLA 1QHIA 4KYUA 5JQGF 3KB1A 3Q7PA 4FBLA 4ZQFA 4CW7A 1WW3A 3CW2A 2O8FA 3L6OO 4OAPA 1R64A 4MRVA 1KJZA 2AQIA 1KDPA 3HI4A 1E1QD 5EI5A 1VXOA 4M9RA 5EZYF 4CGZA 2BMAA 2BR4A 3MCTA 1HLPA 3UM9A 4ZOQI 4QM6A 3H19A 2ERCA 3EGDA 3GG2A 2C61A 2Q6VA 3ZQ6A 1TD1A 1EDOA 2FN4A 2VAPA 2ZWOA 4Q12A 4UVIA 1BD4A 3GT0A 4JSTA 1VG8A 1DKOA 3HJGA 4AT1A 2B8JA 4RL4A 4XOIA 3UZUA 2GSWA 1A8PA 4GR9A 5K3BA 2GN9A 1VMDA 1TRKA 4BB0A 4BFYA 4YS6A 5BYKA 5EHXA 2G9RA 1ZMXA 2IIQA 3C6MA 3IR7A 1VBMA 3S81A 2PL1A 3BE6A 5FTNA 3RS2A 1FW8A 4U9UA 4EENA 2GBCA 3TL2A 2GHIA 4S04A 4RFLA 5ARDA 1RP1A 3BOSA 4I8XA 4RH1A 1Q7TA 4EY6A 4J29A 3EFBA 1QX4A 2PQ6A 4X20B 2GZDA 1Y5LA 1EK0A 4JVOA 1G21A 4HWSA 2FG7C 5IH3A 4R0MA 5AUQA 4G67A 1TU4A 5GV8A 1DXQA 1Y7LA 2CJXA 1XJ5A 2VG8A 4BFSA 3KQHA 3FUTA 2ISQA 2YV4A 3LF2A 3THYB 5GWXA 3WNZA 3BEDA 1VJDA 3GRVA 2Z3VA 3EQ6A 3JAWA 4AIIA 4OLBA 2QN8A 3DZDA 1C1HA 3T38A 1ZW6A 1CPYA 1AGNA 1SVWA 2W6JD 3EGIA 2HUNA 2ZTVA 1U11A 3SBOA 4JT9A 3AETA 1RZRD 5EP2A 3H17A 3D0OA 4KXXA 1XBTA 4BC1A 1JDTA 1G64A 1D6JA 4JJ7A 2H29A 3QX9A 2OC9A 2R87A 3FW1A 4D80A 2GRAA 5ETJA 4LE1A 2PG3A 4KI7A 5LQUA 2X1VA 5KQLA 3ZCSA 3ZJ4A 2PZEA 3TZBA 1CZHA 3V8RA 4DIMA 2ZM6B 2YVUA 1NUTA 2AEMA 2JFVA 2XXJA 5IZ4A 4A1FA 5EIXA 2HHCA 4FOSA 5EE9A 1EUQA 2H11A 3T35A 3THYA 4MW2A 2M2IA 3G2OA 3MUEA 3QFFA 4BIIA 1EIWA 2WM2A 1ZH8A 3A0UA 4J1QA 4YHBA 1N5KA 3ND5A 2ZDGA 3MUNA 4NFSA 5HRCA 4QDUA 3KR2A 4WY2A 2XD4A 4ECAA 1A04A 5JRDS 3LOPA 4JZKA 5A7GA 3RANA 3RS7A 3ETNA 5DOZA 1DJNA 4L7VA 1HQDA 5JBNA 1W2GA 2NVBA 4LJKA 2RDMA 2YCLA 3MBIA 3ER6A 5ERYA 4KPFC 2CLKB 3Q4GA 2J4FA 5EN4A 3C5EA 2I3ZA 2H1FA 2FSHA 3F6PA 5CH8A 1FTWA 1G7RA 1V48A 2NPOA 1A5BB 2JKYA 3LQRA 4OL0A 4EG1A 5ICGA 1QU3A 4HDAA 3B2QA 1DQZA 4BRSA 5B3KA 4L5YA 1X7HA 2PKYX 1T4CB 2C2YA 4PV7A 5ICMA 1JSLA 3FLMA 1R5BA 1OIXA 2CBZA 3CZ4A 1LUAA 2AF3C 3OCUA 3ZKWB 5KNBD 1QB7A 2OXEA 3G0HA 2CHUA 1DFGA 1POXA 2HJ9A 5B7NA 1JKJB 1ZX1A 2FMXA 1W87A 3GGDA 1CNFA 2XCTB 1PVVA 4IZIA 4CMHA 2V98A 2LUOA 3Q10A 4GGOA 2I4MA 4E1VA 5BRAA 1CUJA 4B7AA 3TW0A 4NF2A 3P27A 5IDWA 3HFGA 4MR8B 5PGMA 4G26A 2P9HA 4M9CA 2VNKA 4CT0A 1HMYA 3WXMA 5D5HA 3G7SA 5EKTA 4YV7A 3SSNA 4XD7A 4BX2A 5KJ6A 1QGYA 2IYYA 4U3JA 2HCRA 1JKFA 3KQUA 3PE6A 4DZZA 5ARCA 3BD8A 4QOGA 2XE8A 4QOIA 3W5BA 5FXMA 2R60A 8MHTA 4GG1A 4BO5A 1ONOA 3ME5A 3MS2A 3PXAA 4MICA 2P1RA 4ALMA 3ZHZA 3H1TA 3ZKWA 4HAXA 2OQIA 3FDZB 2DSNA 4EKEA 1JKJA 5IF3A 2FEAA 1TTTA 1MB9A 2CHFA 2BMFA 2XCQA 2G4CA 1TAUA 4ZVOA 3ZHQA 1HZJA 1XI2A 4ZV9A 4QG7A 2ZETA 3MTDA 2Q1UA 4WERA 1U0FA 4M22A 2WWVD 3SP1A 4OP3A 4UTZA 4MR8A 1YZKA 1ZH0A 2PM8A 1DL5A 1UEIA 3BILA 4P38A 2QRPA 2VZ0A 2ETVA 2VP3A 4C0XA 4HD8A 1ADBA 1B1CA 2C03A 5JXHA 4RTPA 2UVQA 4JFRA 2JJ8A 3M5DA 2WVJA 3N3AC 4HN2A 1WUJS 4PYIA 1IYZA 1UK9A 1NBMA 3L49A 1GL7A 1T9HA 2PFSA 1A4IA 3PGLA 3OQMA 3P1JA 1T36B 4LZNA 1E92A 1Q3TA 3FDZA 4K5QA 3WQSB 3UGQA 3E6AA 3BRWD 2P9EA 4A73A 2XVZA 1AQIA 3REOA 4BV3A 2XTJA 3H1PA 3SLGA 3ESXA 2VHEA 1B23P 1IK6A 1R74A 2XKJE 1WZEA 5B37A 3V1YA 4BB9A 1N34B 5I3ZA 3GJSA 2PMCA 1DHTA 2LV8A 4NBLA 2RSLA 2A9RA 4UDYX 4XDYA 1KFKB 3N5KA 3ANNA 2XIQA 3BGDA 4KE7A 1UP6A 2C4TA 3WQQA 4CG2A 2AOTB 4NPAA 3ZZ0A 4J0GA 1AKYA 4XI9A 3UEOA 5AW2A 3NGLA 4QEKA 1ZOIA 4N54A 4E08A 4AYXA 1ISPA 1OD6A 1MEOA 3NJ8A 5AO9A 4K3UA 1CSEE 1M0SA 2J4DA 4KE8A 5DYNA 5E7MA 5GOTA 5IAGA 1YQEA 3HRHA 3VU1A 4PYJA 4W1QA 4WCFA 2JFUA 6ADHA 4IJUA 1ODLA 1CQPA 1YI1A 1C1XA 1RXEA 2V7PA 1UPBA 5LZ5A 1VSBA 5BQFA 1SQ5A 1D03A 2IEAA 5IP5A 4LQ4A 3T06B 3DZJA 5K2OA 3CBQA 1FP7A 1P91A 3DJYA 4C89A 1YCDA 5DTIA 3ZDAA 1G8MA 3WB1A 4YPFA 2AOTA 4RZQA 1G0NA 1II8A 3JSAA 4LNHA 3V32A 5FOUA 1IIRA 1XPRA 2H4WA 3DMTC 2WWGA 5SYMA 3VI4B 2P79A 3RYHB 3SF8B 1N4DA 4NX2A 2B98A 1TVCA 2WFLB 4XWWA 3A6PC 3DFFA 3V4FA 2ADMA 2P11A 2ZYIA 1K7FB 4UBIA 1Z9BA 4TYWA 3BK2A 1D1PA 2Y68A 3D0QA 3MILA 3R5JA 5TGDA 5CDTA 3MWEB 2FF5A 2D3TA 1DKPA 2FDXA 1WCXA 2GPWA 5BUSA 2P75A 3D2LA 3PXUA 1NRJB 3UF0A 4QELA 3ZHRA 1MABB 1JEDA 3L0IB 4RA9A 4TLAA 4D0NA 1NP7A 4B35A 1R8XA 4CLHA 4NV0A 1MPXA 3OAAD 1WWKA 1MU0A 3G2IA 1QCYA 2WJGA 3QPBA 4FGUA 2BFCB 5H7XA 4JC8A 3MQFA 4GUDA 4ZMSA 1JYSA 2II6A 3MTJA 3QFRA 3WLNA 1LC3A 3QKIA 4CMCA 1W0JA 1MNQA 2NSHA 2OZPA 1WV1A 2P2YA 4QPCA 1CJBA 1GPKA 2J3IA 2Z9BA 4JXXA 2WFLA 3KSUA 2BM1A 3WC4A 1ADFA 4KTTE 2QI9F 4ZVTA 1RKBA 1Y4AE 1D2NA 4FTWA 1MC8A 2YZKA 4UUQA 4HEQA 1GLVA 4DIOA 3MWEA 3FWKA 4FHFA 1QYIA 2BE9A 1N2BA 2PUTA 3EA0A 4TL7A 4OG2A 1NJ1A 3JQAD 1RXWA 1ST2A 5KYUA 1E6CA 2LNDA 3BH0A 2WU3A 4FHEA 4KACA 4L8LA 5AIAA 1LX6A 5T4HA 2NVUB 1EVJA 3K0FB 4WOPA 3ZWQA 3PP8A 3IIKA 2BFCA 2VXOA 3NRCA 3OM1A 1VYTA 1SPBS 2MT9A 2PZ8A 2JGKA 1VBFA 2BWJA 2EZTA 1Z18A 1WG8A 1IEWA 3EVDA 3N86A 3NYWA 1Y3FE 3Q7IA 4M60A 3SM3A 4EGAA 1JQBA 2OEPA 1C14A 2TMDA 3W2FA 3K30A 5KU1A 3RLFA 1SFRA 1ZZGA 1URPA 2EDAA 5T67A 3ZYZA 5JS1A 1BXGA 1ZD8A 2O3SA 3X1JA 3C15C 1XIVA 1NQOA 3EAGA 3R8FA 1FE8A 1S1CA 1KYXA 1YO6A 2Q4BA 4HXYA 5JVDB 4AO7A 1QQ6A 1P0CA 4DLSA 2ODNA 3RWOA 1CJVC 1HWYA 2B20A 3QFHA 4AICA 2NVUA 2FTKE 3K0FA 2V4UA 4E1BA 1VDZA 1RBQA 2BFPA 3E05A 4CNQA 3DB1A 5DBEX 4IVQA 2GVDC 4WQMA 1EFVB 2HA4A 1WSDA 2Q3HA 2ZJ3A 4QTUB 4YRLA 1L5VA 1T6NA 1NYLA 3EF1A 3IAM1 4Q1FA 4DSAA 2GA9A 1QFZA 1WDKA 4AZ3B 4UQLA 3O3MB 3OTOB 4PG4A 4AKIA 3G02A 7REQA 1MAVA 1DWOA 1VKZA 4OHPA 5JVDA 3AC0A 3IERA 1WSBA 3ZY6A 4V0QA 5I9LA 2VJPA 2ZIXB 3C8HA 4MRNA 3PVZA 3CKKA 1RM3A 1GA1A 1FFXB 2BEUB 2C59A 4QQFA 4WV3A 4ZHQB 5GZ1A 5CRIA 5DRTA 3ROPA 3HUFA 1EFVA 1PI3A 5IWCA 1WB6A 1MIOB 3MGBA 4F2PA 3UWMA 4M46A 4G1UC 1KZ4A 3ANXA 2EARA 3C4QA 4CCYB 1XRRA 3LF1A 4GF5A 4ODIA 3SDBA 3S70A 3OT1B 1GOTA 3R6GA 2DX7A 3MWFA 1ILEA 2C2BA 2EZ4A 1L5FA 3U9LA 1ECBA 4HDMB 2AHOA 4MQLA 5AM5A 4OXQA 3OE7A 4JL8A 5AW3A 5JI3E 5IULC 2P9JA 1FMCA 5LOVF 1KK1A 2ZIXA 1EP3B 3DEFA 3I04M 2CT8A 3LCCA 3O6VA 1Z0ZA 3VOSA 1F2DA 1YC5A 1XD9A 2WYUA 5DM2A 1T26A 3GJ7A 1RKXA 4D46A 4ZHQA 2BCGY 2BTQB 5CD1A 4G0ZA 2PJDA 4NV1A 1WY5A 2E3JA 3FSRA 3MRVA 4MWGA 1QHEA 2DUWA 3VKFA 1DOZA 4S0ZA 1DO0A 1VLLA 1MIOA 2VF7A 1WB5A 1NNI1 4RQUA 4N5LA 4CCYA 3QSGA 2YWGA 4PZ9A 3OJOA 3OT1A 4I5EA 2RJ3A 2WV9A 4LZLA 5G1OA 4U7PB 2I6SA 1LLUA 3QTBA 4GZLA 4JVMA 1GP2A 4PLTA 4HDMA 3UUGA 1H9CA 3W04A 2PIDA 5K4AA 4C6HA 4EPVA 5CB4A 3IT0A 1KYIA 3MMSA 1XZBA 3SOPA 3HO8A 1XU9A 4DVGA 1OX6A 2FZVA 3PNPA 7ABPA 2BTQA 4KLRA 3HXMA 2UZIR 1LXCA 2B4QA 2GBFA 3W6PA 3IBFA 2ZM5A 4KZKA 5K0LA 1GCGA 3HN7A 3L7KA 2J45A 2IOHA 4WMLA 2Z6UA 3DZIA 1N2XA 2H2DA 2HV8A 2V8OA 1MX9A 2VF4X 2QAGC 4FJ1A 2AQHA 4MQ4A 2X4DA 3N59A 3NEYA 1N7JA 4UNRA 5IJWA 5IXYA 5CJPA 1T3ZA 3OIGA 4YRFA 1YJXA 2Q3LA 5A4DA 3UNXA 1AE1A 4L8GA 5MGBA 2A92A 4HMOA 5JZOA 1I1QB 4J1TC 1T9GS 1HPLA 3W1VA 1ATIA 4QUAA 3E0XA 3OWXA 2RHTA 4MUIA 3KO8A 2R2AA 4L76A 1L5YA 3STYA 1YI0A 2D59A 2VDJA 2HRZA 4I81A 4JENA 4W1PA 2B1GA 4DY4A 2FR1A 3FOEC 2B7LA 1XDBA 2RBKA 2Z5LA 5KKNB 1CUCA 2QY6A 1NMEA 4GDMA 4H3HB 3CW8X 4ZJUA 3IP3A 1L4YA 1FFEA 5HE8A 3V7UA 1E2NA 4FHCA 3K9HA 3MJHA 2FGJA 3IDSA 1RRKA 1X7WB 2VK8A 4IZOA 3SQMA 4HJXA 1Z12A 1K0UA 3JY6A 1YS2X 1V7ZA 1GFSA 4X8LA 1B16A 5E6SB 4KFCA 4L8VA 5FV4A 4MV8A 2QZSA 3R5XA 2A5DA 5U4QA 2ISCA 3GQVA 3GLFE 2GHQA 2A33A 5JISA 4YMTA 2RGRA 2K2WA 1HSOA 5FI0B 5F3RA 4YYEA 4CKYA 4JYBA 2FDRA 3AJAA 4FFSA 4QFDA 5A2GA 3TEFA 1T1GA 2OAEA 3E2PA 4HQNA 1PJAA 2W22A 2XOKD 221PA 2NU6A 3LKDA 3AU9A 3OCZA 3RSGA 2P3OA 3SC3A 4FEEA 3U81A 3BWDD 3ZIDA 4I50B 1X7WA 3C1TA 4BMXA 1P45A 2V9CA 4U8GA 1RTKA 1G6HA 3V42A 1YZ3A 1WDWB 1V5IA 2K6GA 2LIVA 3GW8A 1XEXB 2R48A 4M8KA 3IMKA 2G09A 3FNIA 4PC3A 1CFZA 3K3PA 1ABBA 2QL6A 1OX5A 2IEIA 4FMDF 4TTQA 3K9GA 3UHPA 5JYEA 4I9GA 3CXUA 1EJ2A 2GZRA 2OCXA 4I4NA 1RQLA 2HREA 4ME6A 5LMZA 5JBIA 2FX2A 3VVCA 1ONNA 4QRDA 1PT8A 3TNYA 1TC1A 4WUTA 1XNHA 5JS7A 3ZEAA 2NWQA 3VOAA 4FEGA 4DBLC 2XNCA 4N65A 3OH8A 4U02A 4F12A 4E2YA 4JJ8A 3QELB 2AB0A 3FWHA 4I50A 3R7LA 2B69A 3KTOA 1PGOA 3NT5A 3QVSA 3UW1A 3VNQA 3WDMA 3RUIA 1WPRA 2HRCA 3COSA 3T7TA 1TVEA 1XTJA 1ZAYA 3WIOA 1XEXA 2PN1A 5I9MA 2CK3A 2IHZA 3AR7A 2ZCJA 3OFKA 3E7DA 2B6NA 3O38A 3R1IA 5ICFA 4MEBA 1DFHA 5A3VA 1NVFA 2FP4B 4RLFA 3BAZA 3TTUA 4B44A 4BNGA 3ZWYA 3KZXA 4BGDA 1SD1A 3BTUA 3VAAA 1OB2A 4HF7A 2WU1A 2QENA 1RQNA 4DA0A 4HB2A 4NNJA 5AI9A 1HT1E 2BM0A 2X77A 3QELA 3NT2A 3DZKA 4XWGA 5KDLA 3T7IA 4C14A 3U31A 5ITVA 1ZVVA 2W48A 3AP1A 2W58A 4QPZA 4A0GA 1J2RA 3OKCA 4I4CA 4RHYA 5G0TA 3RS8A 4MVJG 5FADA 2IHUA 2J41A 4BLRA 4Z9YA 1E9DA 4RSRA 4BU0A 3QPWA 4RY0A 4BTEA 4YRSA 3O47A 3NTXA 5KWVA 4R81A 3CR8A 3TE6A 4FKMA 1H2EA 3PG5A 2HW8A 5TY0A 1G5HA 5F12A 1A72A 1RCTE 1IY8A 1R0LA 1FZTA 4E1AA 5JZVA 4RDHA 4ABYA 121PA 2XCIA 4ASUD 4JBIA 4L74A 3TBHA 4QGGA 4ZOLB 4ARCA 4GE3A 1PGNA 4RQTA 5AICA 1F6WA 2XNDD 4MV4A 2RJNA 3BD9A 1M1UA 4QU0A 3ADPA 1WQ1R 1XRSB 3OU7A 1U2TA 4YMIA 3INRA 2XUGA 3PHIA 1E2EA 1OXBB 2JFBA 3PFFA 4NCXA 1ZINA 4L5CA 4EG4A 4KE6A 4YRDA 4L22A 4D9JA 1NNUA 1XRLA 4ZYTA 5JXWA 2ST1A 2FWMX 5I9BA 4UHKA 5FLKA 3H65A 5EPUA 1QAOA 3I3SR 3AEQB 3KKLA 3AHIA 2GTHA 1V0JA 3V1LA 1EVQA 2B9EA 3MOIA 4PQGA 4QREA 3EOZA 5AMXA 1JEYA 4D9GA 2QR5A 2A86A 4GI2A 4ZOLA 3LH5A 5K99A 1VPWA 2BGUA 621PA 4YV1A 1DAOA 1JFVA 2F9MA 4IRXA 4TUYA 4EIWA 1QGAA 1J09A 2CF5A 1HDRA 1JB1A 1RNLA 2ENUA 3HFRA 3N28A 3EIUA 5H4GA 4NTZA 4Y9UA 4XAQA 3THRA 1DLIA 2C98A 4OHZA 4RPIA 1YASA 3KBOA 1SEPA 1UFQA 1QBKC 3NDIA 4HBZA 4RZ2A 5LP6C 5EE1A 2ALJA 5IT4A 4CMJA 1M5TA 5GINE 2GCNA 4REQA 2XMPA 3AHCA 2DQYA 3EULA 1JG1A 4KGXA 3WWPA 3IOCA 2FA9A 2Z3WA 3AEQA 1G3MA 4A9AA 4AXXA 2NXJA 4XTCS 1Z7YA 4AXBA 1Z7WA 4A2PA 3UN1A 1EFLA 1PEYA 2GCIA 3BKWA 2GO7A 3IQWA 4S1PA 5C31A 1OV6A 5LL6P 1UP7A 3EUAA 3NI2A 4XVQA 3DFZA 4BGIA 4JWKA 3FNQA 1XEAA 3FFWA 2QYHA 3DFUA 1P1FA 1WOYA 1SOWA 3DDHA 2QN9A 3HB9A 4HAUA 3AVVA 4E33A 1VGRA 2DPMA 3CLRC 3V4PB 3E5HA 3JAMA 1G7TA 1P7ZA 1G9XA 2QAGB 3VR5D 3GLQA 1ETUA 1FMLA 3CNHA 3QOWA 1T2FA 1JSZA 5TJHA 5CM2Z 1SU4A 1Z8DA 2H6EA 2YY7A 5HS6A 3WA6A 3LDFA 3AKDA 2FQ1A 3G1UA 4OFZA 5L51A 1NYQA 1AZSC 1VCNA 1Z0UA 4LE2A 5C1IA 4ALLA 5KQSA 1NN0A 1QE3A 1E4OA 2WYHA 2JFWA 5EERA 4BC0A 1DMSA 2ODEA 2Y92A 2AI1A 2WF5A 1K4KA 2LCFA 4NBUA 3ZOZA 1KVSA 2ZJ4A 3EZNA 5K8LA 3U44B 3UUEA 1LB1B 3DLPX 3LA8A 4HOYA 5BUQA 3TSWA 1U4OA 2HK8A 4O5OA 3WL4A 4DMFA 5K09A 4FYMA 3I64A 2IZZA 3QTTA 4QHSA 2QZ9A 3HWX1 1H5UA 2W00A 1T13A 5B7PA 3FX2A 2LCIA 2QAGA 2AJ8A 4C43A 4FGKA 1QTQA 4RY2A 3C8MA 3GDGA 2V6GA 1R0ZA 3OCWA 3OJXA 1H9AA 1A9YA 2BZSA 3D3JA 5IMSA 1PJLA 3LPAA 1OGIA 1U6KA 2I76A 4JC0A 2FPWA 5BQXA 3WJ1A 2HDOA 1PAUA 4J1TA 2F8MA 4C4OA 3IPRA 1CUEA 3TPFA 5YASA 3J80A 3U44A 4D57A 4ADSG 4ZVKA 2GLUA 2QZPA 1DC4A 1U8ZA 3F3MA 3KP1A 4B6FA 4KPYA 3IBGA 3N76A 2CN1A 1XTZA 1U0JA 1OHHD 2D54A 2I4TA 2X9VA 4KWHA 3AR5A 3OIWA 3QW2A 5GVRA 4MKIA 3WWZA 4P82A 1HNZB 3K0HA 1KJIA 4CLRB 4IUBS 4KNYA 4Y2GA 2IWHA 3KWLA 3U7EB 2OHOA 5EXSA 2A0WA 1RI3A 2F3SA 3NAZA 1DOHA 3GJ3A 1CUSA 2DRIA 3GDFA 4G89A 4R83A 4XGRA 5DSTA 4NAVA 5C8YA 5AVSA 4HFNA 4LXXA 4NBNA 2V6MA 1E2HA 4IJWA 1UFVA 1QWSA 2NYUA 1AUQA 1U3CA 3GH3A 3O9MA 4O2LA 2RI0A 3IRUA 4BP3A 1JR2A 1PUJA 2V6BA 3BSWA 1ZH4A 2PCJA 1OTHA 3FY4A 2O2GA 2AG8A 5G4KB 3P2MA 1J21A 1M2NA 1PZNA 1ZA2A 2BEKA 2C9DA 3Q1KA 4J0JA 4G1BA 5H70A 5JSZB 3QUSA 4POOA 1K3FA 3EF0A 4KR6A 1JXMA 1O0CA 5K4HA 4K2HA 2CYAA 4UQOA 1XAJA 3C7DB 3HVHA 1AQJA 5AI4A 3OF5A 3WGJA 5B4UA 4CLRA 1O94C 2NO0A 3UK6A 2WJ6A 3DD5A 2JIBA 3V8EA 1YTLA 4EEXA 2Y1OA 3L4SO 3MT9A 5ALGA 5KX5F 4HYQA 3TJMA 1TZCA 3CGGA 1XQVA 3LRTA 1ODFA 4IUDS 3ZU6A 4ZCTA 2C1ZA 4PNZA 2H2AA 3MOGA 3LUGA 4INZA 1BQ4A 1M1YE 1V8FA 3KDPA 2HK6A 2Q49A 3O8OB 3KALA 4QGAA 3QBEA 3G5AA 3ZNPA 4GU5A 2VP6A 2AZDA 1EFPB 2HV9A 5G4KA 2B21A 3UTCA 3ZHTA 2I1QA 4DNQA 4PPGA 2WNSA 5AKZA 2VDLB 3CRMA 3B6KA 4NL4H 5JSZA 4G0VA 1VBNA 4JOBA 5BSEA 6PFKA 1LC0A 2QAJA 2YMPA 3U3MA 3PTLA 5BUCA 2OBFA 3DXXA 2G08A 1UK8A 5CFOA 2JK0A 1TFUA 3PGKA 3E2MA 5DLQC 3VGPA 3MIZA 2HJGA 4R84A 2FSVC 1DAMA 4ZIRB 2F59A 4LYFA 1RWWA 2PZJA 2W43A 1KIFA 3BE5A 3FUXA 4PYKA 1MJFA 2H85A 4B2LA 3MTGA 4FGWA 3QE2A 4IFBA 1U1EA 5F2KA 1LLFA 4BO8A 4BVEA 3O8OA 3MHTA 2HJRA 3HKEB 3K9CA 3WGNA 3DDNA 3HFJA 4M1TA 3RW9A 1BDIA 1EFPA 4WK2B 3IKTA 3QY9A 4GD3Q 4GICA 4RK5A 3MMXA 4QOEA 3VFDA 3PNOA 2E4YA 3WHIA 1K4YA 1NZFA 3SZUA 2AMFA 2JFHA 4Z0HO 4TROA 2EJWA 1N8KA 2F43B 3F47A 2GXAA 4L4YA 3RU7A 3RRMA 4JYZA 1RZUA 3MQ4A 4QLOA 1OY1A 5TGZA 1D07A 3HCBA 2PA3A 1ZOOA 4ETMA 1BKYA 1XCOA 1T5SA 3AJ8A 3TI9A 3GJ6A 2FEPA 3GQBB 3ZG6A 4CQMD 4ZIRA 3FAZA 1XZKA