2Q21A

Crystal structures at 2.2 angstroms resolution of the catalytic domains of normal ras protein and an oncogenic mutant complexed with gsp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
171
structure length
171
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-H-RAS P21 PROTEIN CATALYTIC DOMAIN
publication title Crystal structures at 2.2 A resolution of the catalytic domains of normal ras protein and an oncogenic mutant complexed with GDP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncogene protein
total genus 63
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 1991-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2q21A00
1OIXA 3F8TA 3IQXA 1R4AA 4IHQA 1VG0B 3HDTA 1G7SA 3CF6R 2PX3A 1OB5A 2C9YA 2JLYA 1GAJA 2B7BA 2FWRA 1E9SA 1KNQA 4DLXA 4KFSA 4IOLA 2ZI3A 4HYYA 2G77B 1N6NA 2N42A 4S2EA 4ZO4A 1GL7A 3TMKA 4EUNA 2DB3A 1ZW6A 2BHRA 4D0NA 1JJVA 3WRXC 2JDID 2XXAA 1IHUA 2JEOA 2ZS9A 3UMRA 1I4TD 5J40A 1W7AA 2VP6A 2CK3A 4W5HA 4EFNA 1FQJA 2ZRGA 2ZTSA 4M8NE 1R10A 4WIAA 4BASA 2QSZA 3KJIA 1DAEA 3HU3A 4FI3C 1KJYA 4Q7JB 3DM9B 1NL3A 5JHHB 4LRWA 2B8TA 5DI9A 3BH6A 3U4QB 5JBQA 3QXJA 1SVLA 2MSCB 4F92B 1TX4B 1XB2A 3VNUA 2HCJB 2BEJA 2IWHA 2IF2A 3VR4A 2IYXA 1CIPA 1UF9A 3VR3A 1AZSC 1RW4A 5DLQC 4DB4A 2BJVA 3PUXA 2F9MA 1P2TA 5CLLA 1A5TA 1ZIPA 1OKKD 3ADBA 3UPUA 3CPEA 3CBQA 3FYHA 5CM8B 3U7EB 4GZLA 4MGKR 2GEVA 3DOEA 2GJKA 2NO1A 2OESA 1CRPA 1K6MA 3KJHA 4JVSB 1DPFA 4EQ6B 3ZGXA 3B5JA 4G5GA 2ZR7A 2VYFA 3TBKA 4A0FA 2JA1A 3TSOA 3FMIA 2XZPA 4P0TA 1IN7A 1E9CA 3WP0A 3PUVA 5JRJA 1M1YE 1BH2A 2CJWB 3B1WA 1NN0A 3BFVA 4Q9KA 5KO2A 1FMJA 5DHAA 4DLTA 3CRRA 1OPXA 1EX6A 1ESMA 1PLLA 3CNNA 4YXWA 4BEJA 4IFBA 4Z51A 2PJZA 4UNQA 2OG2A 4BLPA 1E0SA 2XTMA 3SE0A 1D8TA 1SULA 1GILA 1JNYA 3AP2A 3MAAC 4X8LA 2EYUA 3RNLA 4B32A 1IONA 4DEXA 1N6PA 1XP8A 2GAOA 4HDCA 1GOTA 3Q5DA 3AEZA 2D4HA 2AL7A 2QN6A 2GWHA 2NO9A 3K9GA 1NJFA 1S1CA 1S9HA 3FTQA 4MUBA 2YJTD 2NOAA 3CH4B 2C8VA 1E96A 2R8RA 2FDCA 2B21A 3ND9A 1J2JA 1G19A 1T3LA 1SKYE 3UXMA 1T8UA 1W44A 1EWQA 3RRNA 2R6FA 4A8JC 5D3MB 1XCGB 3IIJA 1J99A 1L7VC 2C99A 5B2ZA 2OBNA 1VHLA 2ZI4A 4AYTA 1CS4C 5E7JA 4D4JA 4JLOA 3AF4A 2ZR9A 4L9WA 2CLDX 4DZZA 821PA 4JLMA 4QHYA 1ZCBA 2VEDA 2OV2A 1ZIOA 3FHOA 4JVLA 2ZJYA 4BLSA 3FKQA 1VYTA 1LV7A 1VHTA 4RFSB 4CW7A 1XNJA 2AFIE 2IS4A 2PBRA 2X2FA 4D2IA 3M1IA 3DKVA 4WXRA 2YWHA 1DG3A 3H84A 1FNMA 2B8WA 1RRCA 1YZQA 2J0UA 4B73A 3KKOA 1Q20A 3AM1A 4G5RA 2J0QA 2JAQA 3WP1B 2PT7A 3QNUA 4XVRA 3TE6A 1O87A 1E2IA 2E87A 1VIAA 4NPHA 3W3ZB 3BFKA 1SVWA 2OT3B 3KX2A 4CEIA 5J4YA 4IDOA 3NTUA 3KJEA 4QGGA 2PLFA 4FWTA 2WJJA 4HAUA 2GBLC 1FP7A 2G83A 5CITA 2F43A 3VR2A 1W4RA 4Q19A 4KFUA 3GMTA 3GEEA 4TL6A 4UJ5A 4F91B 1Q22A 3SBDA 1YJ5A 2H16A 3FKSD 2P5SA 4B71A 3AF3A 3QPUA 1JQJC 4KO8A 4XD7D 4ACBA 3ZVNA 1E1QA 5FBQB 1Z08A 1TU4A 1VMAA 2IUTA 1QBKC 4RFSA 1G7RA 5JWHA 5JI2E 2V4ZA 4XVQA 5TXGA 2GJ8A 4ZI3A 3IPXA 3IQWA 3H1TA 3TVTA 2HJVA 4RCZA 4BFXA 3NXSA 4Q7LA 5FPHA 1IXZA 3THXB 2J87A 1ZP6A 3P32A 2YHSA 3CRVA 4Z1MA 4BLTA 1YZNA 3L0SA 5A0FA 3PXGA 1KI7A 1D2MA 3GEHA 2GCOA 1U8AA 2ZRJA 2R44A 3ICQB 1X86B 2ORIA 2V54A 3EZ2A 3NG1A 2JLXA 2JJ1A 2OUKA 2W6IA 2ZUCA 1UEIA 1CR4A 3X2SA 2W83A 2XJ4A 4PPNA 3U3OA 4M1KA 4C4PA 1CJTC 1ZNWA 2IEZA 2BBOA 2I1QA 1CF4A 1G3UA 3OHMA 1IQPA 4JKYA 2QGNA 4CGZA 2CK3D 2UZIR 3NHBA 4XTRA 1G18A 1RJ9A 1E9AA 4JZKA 1M74A 4KJZA 4BFZA 4NMMA 5L3SA 3TAUA 1E79D 4M9QA 4A8JB 3UANA 4GL2A 2HXSA 2QG6A 2H5EA 5F98A 1E2QA 1UEJA 4JS0A 4V0KA 2G0NA 4DLVA 5AJXA 3GP8A 4HLCA 3OE7A 1HE8B 3QBTA 2J3EA 4II7A 3JZAA 3NDPA 5B57C 3A4LA 1Z5ZA 1TUEA 2ZRFA 2C98A 4DSTA 3QJYA 2DFLA 4EPTA 3ONWA 1A7JA 2OXRA 3LW8A 1JR3E 1MO6A 3EZ7A 3GD7A 3JVVA 4M9ZA 3U3JA 1ZC4A 4US0R 1E2DA 4Q1CA 4Q18A 1Z6YA 3CR8A 4AY2A 3E5HA 2CBZA 1M6NA 1E6CA 4B34A 1N2CE 3BB4A 5AUPB 1L8QA 3LLMA 3W8NA 3TNFA 1SKYB 2J0SA 1F2UB 1NLFA 2V6JA 3D8BA 5E4FA 5EQTA 3CONA 2V3CC 3QY0A 4QJ3A 3NDBB 3T5DA 5BXQC 1GDDA 1W4AA 4LBZA 4QBIA 1TQ2A 4D82A 4YXWD 3QQ5A 4A8JA 2QMEA 2J45A 2QP4A 1KK3A 3VHXA 3W6NA 3WHKA 3ZS8A 1XCMA 5FTKA 1IXSB 2QZ4A 4AKHA 2G3YA 1YQTA 4IDPA 2E1RA 2ZRNA 2VIIA 1KK1A 3RS7A 1TMKA 1EX7A 2GHIA 1CTQA 3TK1A 3FMFA 1GL6A 3B9PA 4B3CA 1C1YA 1SVMA 2AN9A 2REXB 3CRMA 3IBGA 2IS2A 2E9SA 3IO5A 4BE7B 1KKLA 1EFHA 2LWIA 3DHWC 3U44A 4PFSA 1DO0A 2RAPA 4PHFA 2ZE7A 2ECKA 3K70C 2CCGA 4TMKA 1PVOA 1Z8FA 2WKQA 5G41A 2QP3A 1XPOA 2GCNA 2RGNA 1TEVA 4JBWA 1ZAKA 2J59A 2OEPA 1H65A 4MYCA 4EPYA 5IF9A 5JS7A 2QBYB 2XJ9A 4MITA 4D0LB 1KY3A 3B8HA 3LBNA 4ZI2A 2VRWA 4BECA 2ZS7A 2F1IA 3VTKA 2XGJA 4U00A 2GBLA 3P26A 4JJZA 4ARZA 3KB1A 3B82A 5JSZB 4TMTA 1E94E 2EW1A 3VR1A 4W9MC 1LVGA 3TGPA 1GFIA 4D0GA 3EX7C 1YRAA 4NCIA 1CXZA 4EAQA 3RC8A 3OAAA 4M2LA 3C5CA 4JSYA 4LOAA 2D62A 1T9HA 4M1TA 5CM9C 2A5FA 2HF9A 2X8AA 3Q7PA 4KYUA 2G88A 5CIWA 2OZEA 4RD3A 1HY3A 4J0QA 4NHOA 1B23P 3H4MA 1IY2A 3BIFA 4NKRA 2V9PA 4LC0A 1G6HA 1JEDA 3SN6A 4LJ4A 1GRQA 1ELOA 2AHOA 4Q7KA 3IDQA 3ZZ0A 1FPMA 2QM7A 2Z43A 1AZTA 1E2FA 4OK5A 4QFMA 3VR6A 5E7IA 4CZ2A 2WWIA 3W6OA 2WPDA 4BQSA 1E1QD 3EAQA 1AS3A 2RKOA 1G41A 3AVXA 1NF3A 4BLQA 3X1DA 2O8BA 3S1AB 3MWYW 4B75A 2OILA 3THWB 4GI7A 5IHPA 3O8RA 4MYTA 5FL3A 3I62A 4DT1B 2CMKA 5C1BA 4IEEA 3OZXA 2ZI6A 4H1UA 5AUQA 5HE8A 1JXMA 4LX0A 5LBIA 4Z1MD 2XAUA 3GLHB 2X1VA 2ZYTX 2ZJAA 1P2VA 2QRZA 2AK3A 4KVAA 3MG9A 4B3DA 4XTCS 6Q21A 1A82A 2ZU6A 4KBGA 1UAAA 5TVKA 4PQFA 1VG8A 1QHGA 4HUTA 4ZKEA 2WOOA 4RKFA 2D7DA 4XWKA 1Z0JA 4A2QA 1KHTA 4E09A 1PUIA 1TQ6A 1FW6A 4Q9HA 5FBVB 3LY5A 2W2VA 4DCUA 2C5LA 4Q9JA 4RSGA 3UK6A 5CB6A 4LGMA 4C7OA 3QKRB 4PZLA 1OXVA 1W1WA 4OHXA 2ZJ2A 3C5HA 3K0AB 1T5LA 2WJYA 4IVRA 4DHEA 3K09C 4QRHA 1W4BA 1TNDA 5J4KA 1A4RA 2PCJA 3THWA 1ZD1A 4EFMA 1M7BA 1XJ0A 4IXMA 2HYDA 4LWZA 3ZYCA 2JJ2A 3OE7D 4DT1A 3G5UA 1W0JA 1YR8A 2QE7D 4HI0E 2QORA 2WWWA 4HSEA 2ORWA 3A1WA 4MKGA 3K9LA 2CNWA 2QUZA 5JECA 4LJ8A 2RCNA 3QKTA 4KITB 3GEIA 4R2HA 1AS0A 1NSTA 3AUXA 1JR3A 4ZCLA 3U5ZB 1QG4A 2ODBA 3CW2A 2QI9C 4URWR 5DE3A 3LRPA 1AKEA 2O8EB 2WJGA 2ZRCA 3EASA 3GLGE 2GXQA 5ELXA 2HEIA 2RH5A 5DIFA 4HB3A 3RYTC 2A2ZA 4I4LA 3I92A 4DLZA 2PX0A 3NBZC 3ZS9A 3CR7A 3EARA 1SXJB 1M7GA 1XCPA 2X19A 1SVIA 1T0JB 4KSBA 2C03A 1KYIA 3SBEA 4OQXA 1KJZA 3L43A 4B48A 3T34A 3A36A 2RHDA 2JATA 3PENA 3PEYA 5HE9A 4D6PA 2EFCB 3TKLA 2FMXA 2ZRHA 3T1QA 1KDOA 1X1RA 1UJ2A 4DDWA 3ZJYA 1R0YA 5BYJA 3SYNA 3X1YA 3U61B 1TTTA 2YYZA 5DI3A 3A4MA 1L2TA 5IK2A 3Q5EA 1MO5A 4DLWA 4C2TA 1XZQA 1S2MA 1NP6A 4UQOA 2KB0A 3QOFA 3V9PA 2H18A 3T35A 2OLKA 1KIMA 2ZREA 3RANA 2NMVA 1KMHA 2ZSDA 2W6JA 2DFKB 1S3SA 1OT3A 2MSEB 2FNAA 2ONJA 1A1VA 4HZIA 3MD0A 2H1LA 1OW3B 1WP9A 2OCYC 2ZE5A 1HT2E 3CLVA 1EFRD 1ZM4A 2FU5C 4KCGA 2IBMA 3WHLA 5FUXA 1MV5A 3I3SR 4N3NA 5EE0A 1ZCAA 3P1JA 4NU0A 3W90A 5AUOB 5EJEA 4RZUA 4HLQB 3L0IB 1F5NA 2VBCA 2KI5A 5H8WA 4F4CA 2D3WA 1G5RA 2JLZA 5G53C 2QPAA 1OLOA 1VCOA 4DRZA 1RZ3A 4EJSC 2OM2A 4TLBA 3CB4A 4URUR 5GVRA 5E95A 5KUTA 1BOFA 2ZYUX 4L16A 4PQRA 3C4JA 2CVFA 2R6AA 5EZ6B 4MKIA 4ON9A 4Q1EA 4PXAA 1KO7A 3KUCA 3KXIA 2O8CA 4DDUA 1UDWA 1Z2CA 2FF7A 2AKAB 2HXYA 5BYKA 1RC8A 4TN1A 4HUQA 4WAUA 5F3WB 4O0MA 1WBDA 1V5WA 4ASUA 2BCJQ 2CVHA 2JGNA 2IC5A 3NH6A 1GWNA 4OBEA 3QF4B 1JAHA 3R9IA 3RSOA 2WAXA 1VIYA 4DLSA 1KI4A 1OF1A 3QKSA 1MRSA 4RD6A 3PR1A 4WZBE 1DEKA 2WPDD 2I4IA 1QHNA 1S4QA 3KJGA 3THYB 3LA6A 3GPLA 1DAFA 5DISB 2F7SA 2YZ2A 2Z83A 4LBWA 3CNOA 4MDFA 3NBXX 1ZM7A 1E2KA 1G1MA 2VHCA 3D31A 2IXFA 2ASEA 1J90A 1LB1B 1Q57A 4B6EA 2FZLA 3GJ5A 1M34E 3RRZA 3WYFA 3QE0A 1Q12A 5DGXA 2J7PA 1Q1QA 3K09A 2NG1A 4QJ5A 3CWQA 2OO7A 3OIVA 3T06B 2LKDA 5IDVA 3KDSE 2FE4A 2ZM5A 2OFXA 3CO5A 3K9NA 4RFVA 4UJ3A 2ZJZA 2ZRKA 1X8KA 4BUJA 3T15A 4O2LA 5FOSA 2Z0MA 3MCAA 3N2EA 1YR9A 2FSIA 2GA8A 2VL7A 2ZETA 5BWMA 3AUYA 4UNRA 3JZMA 2J41A 2HF8A 4B3XA 2WAYA 2WSSD 1TUIA 2BM0A 1QVRA 3PEUA 3NWJA 3SJBA 2RGCA 5FI1B 1WXQA 4HATA 4KI0A 3V00A 5HKKA 3HU1A 1CULC 4I99A 4HAZA 3HP1A 3FMOB 4OK6A 3Q9LA 3FE2A 3HYRA 3CF2A 2CNWD 4MYHA 4R7ZA 4NCHA 5BN3A 3GJ8A 1FX0B 1D9ZA 2DCUA 1NVVQ 5K8UA 3PJRA 3CX7A 2GKSA 2PT5A 2GK7A 2P6UA 4D4KA 3TIFA 3EWAA 3HJNA 4UNNA 2IYSA 4LJYA 4OKSA 5TDHA 2EWVA 3P20A 2ZRMA 3U6BA 4BZPA 4D4LA 4D81A 1G8GA 1MT0A 1E2GA 1KI3A 3GLGA 4N0DA 4Q4AB 1DO2A 3CPJB 3UG6A 3TUZC 5FR2A 3TUIC 4MRVA 2FSHA 5AJVB 2FPMA 2ZRPA 2EWWA 5C46F 5K8TA 1ZM9A 1RYHA 1DVRA 3K0FB 3QPWA 1T0HB 4B2PA 5LD2B 1NI3A 3D6TB 1WE2A 1KO8A 4X8OA 4TMZA 1N6KA 1E2MA 4W5WA 4NYJR 5EE9A 1II9A 1PJRA 1W48A 1E9EA 4ZCMA 4DSNA 1ESNA 3P4XA 1JEEA 4NBSA 5K8LA 3SDZA 3WMFA 3L0OA 5A5GA 1OE0A 4Q02A 2ZJ5A 3U7HB 1TF2A 2ZEJA 2DWQA 4A0RA 1SGWA 4MKHA 5IK2D 1KAGA 1OFTA 2AWOA 1U94A 3DZDA 4LI0A 4ERNA 1G8YA 4QL3A 4EJSA 1W49A 2I3BA 1G3IA 4KAXA 4KYIB 2VP9A 3GCGA 5L3QB 5DYGA 1VYVA 5FTMA 5CJPA 1XTIA 2N46A 2OXCA 1E1RD 1P61B 3BERA 4FW9A 4CEHB 4M0LA 1AIPA 4TLDA 2RGXA 4PSAA 3FFBA 1F60A 1IN4A 3K0FA 4JL8A 1OXXK 1IN6A 2W00A 5AJWA 4NYJQ 3WXMA 4C0JA 1VG1A 4ZDKA 2FEOA 2A7QA 5LDDC 1XMSA 4H1VA 5KOYA 3NKVA 3TUJC 1Q44A 5EZ5A 1HQYE 3SJAA 2G1JA 5FTJA 1AS2A 2KSQA 2CHGA 4OHVA 3RS5A 3SC3A 3B6EA 4U02A 1WB9A 4PHGA 4BFUA 3QENA 4EKDA 1R5BA 3UKDA 3VHLB 3MWJA 2P2LA 2GESA 2YNMA 1LFDB 4LHWA 4MGYR 5KDOA 5JI3E 1N0WA 4A1FA 4D26A 1ZM3A 1RKBA 4ABYA 3SJZA 1P60A 1R2QA 3HU2A 4RZ3A 3U4QA 3I4LA 1XWIA 4NYIR 2DBYA 3AVWA 1U2RA 5F9HA 3RAPR 1ZVQA 3DEFA 4OQFA 4MRSA 3A4NA 4KLNA 3TQCA 1G5PA 4R2IA 3QXSA 5H68A 3SJCA 3GJ4A 1X8LA 4AKGA 3RRMA 4P3YA 2FFBA 1I4LD 2VSOA 1YHNA 2GDJA 3E1SA 4PO1A 3B1ZA 3T1OA 3KKNA 2GAAA 2RGDA 2VP2A 3BE4A 3OEED 1ZJ6A 4KHZA 5BQ5A 621PA 2HJGA 4EQ6A 5JEEA 1P73A 3QPVA 4OL0A 1EESA 2OBLA 2ZU0C 1HH4A 3ZIAD 5SZIA 3TVDA 1ZU4A 2CJWA 3LXRA 4LYFA 2YOFA 1VDZA 4BZQA 1L4YA 1XD9A 2NO0A 1B0UA 2QTHA 3IPYA 4NYIQ 3WMGA 5F9FA 4TQUS 1DARA 2DR3A 3ZD7A 1P9NA 4LJ9A 1LW7A 2BCGY 5L3RA 1IAQA 1JBKA 1E32A 4GMXA 2AR7A 3BH0A 4LYJA 5CJ2A 4B33A 4DUGA 2QAJA 2PMDA 1KO4A 4JLDA 3OF5A 2GCPA 4Q1FA 1G3MA 3IUYA 4AKIA 4R98A 2Q3FA 3RWOA 1G21E 4CYMA 3WRYC 2NZJA 5JEDA 2ZI5A 1CR2A 1E69A 2RGNC 2BEKA 4HAXA 2JASA 4L4UA 3SYLA 5HR5A 2BKEA 5FBWB 4O25A 1JAIA 2ZAMA 1RVDA 2QT1A 3IEVA 3HPQA 4PAQA 1P72A 5D3MA 4P31A 4C0AC 4QJ4A 3KFVA 3E70C 2QTVB 3LWNA 2FG5A 4R71A 3KQNA 2PH1A 2ZROA 1AGRA 1LTQA 2FZ4A 2HLDA 1GM5A 1E2HA 1Q3TA 1F2TB 2ANCA 2ZSBA 3AB3A 3O8BA 5KSYA 2P6RA 2VA8A 5FOXA 1E2NA 4JIMA 1TU3A 4QGFA 3ZZUA 1H8HA 2QNRA 4LC1A 2O5VA 3WYGA 1MABB 2NO7A 3TSWA 4G5SA 2XSZD 1N6HA 3ZLJA 2NZ8A 3T61A 2Q9AA 1P7CA 3DL0A 5FFMA 4B3FX 4GSYA 4K81B 1XD2B 1DAIA 4TTQA 3N5CA 4C0QC 2HUPA 1I2MA 4PAOA 4EPVA 4YQFA 1SVKA 3VMFA 3AVVA 3OIYA 2GF0A 4EPRA 1US8B 2ORVA 2WWXA 1IY1A 4PQYA 3SFZA 4TMWA 1W36B 1XZPA 3A37A 1O3YA 2IYLD 5A4JA 4KFRA 1E0AA 3R9XA 2WJHA 2ZR0A 1EFTA 1GP2A 4XH9B 4G5QA 4YDSA 1NLYA 4C0HA 1GIAA 2IYRA 4QKQA 2C77A 3DMNA 3EPJA 1XPRA 4LHZA 4PANA 1JXOA 2OCAA 2BBSA 3CZPA 3GQBA 1D9XA 4I1VA 2ZPTX 3X1XA 1W46A 4RKEA 2PLRA 1E9DA 4LCBA 1OV4A 2YINC 3GLHE 1CU1A 4QC2A 1KKMA 2KE5A 3THXA 5BW8A 3PFIA 4AG5A 2A9KA 1CLUA 3TW8B 3AV0B 1II0A 4U7DA 4A4DA 1FL9A 2DWOA 3WNCA 1Z22A 1VKJA 2P5TB 4Z54A 3LDAA 4QGHA 1P2SA 4WZ6A 3TLXA 2GEDA 1FTNA 5FPYA 1Z2AA 4QBGB 1NKSA 1XFAA 3WY9A 3R8FA 2WKPA 1YE8A 4RY2A 4DLRA 4LHVA 1OHHA 3L8YA 1QHXA 4B43A 4GOKA 2O8DB 1DOAA 1XX6A 1RPZA 3PITA 1G8HA 2TMKA 4DWJA 1P4SA 1UBFA 4TT3A 1HT1E 2ATVA 3UMSA 3NHAA 2V1UA 4MH0R 5TARA 2J5XA 4PZZA 2QP9X 3AKYA 3C15C 2YC2C 2A5DA 5GJVC 4OI1A 4CVNA 2Q3HA 1Z6GA 3EA0A 4OI0A 4AURA 1ZC3A 2AK2A 2JIZA 1GSIA 3AGQA 2ZRIA 1J8MF 1D2EA 3H0KA 2YWGA 2YVUA 1PLKA 5F2EA 1NG1A 5TB5A 2IUUA 1U81A 4ZIRB 3U3MA 2RGAA 1P6XA 5FR1A 3X1WA 2OSBA 3AF0A 4PSVA 3FOZA 2Q3MA 1EGAA 1M7HA 3IGFA 5EE1A 4JBXA 4POAA 1RE0A 1F2UA 2J0VA 3TQFA 1N5LA 2A30A 4UNPA 1SXJE 4AK9A 4KBFA 5FL7A 4LYAA 1J7KA 2QMUA 4B74A 2WWYA 1E0KA 2BDTA 4JSTA 4BRUA 4AC9A 3TH5A 1GKYA 1LY1A 2ZE6A 3LVRE 2IS6A 3ADKA 4Q66C 2BBTA 3ZVMA 4Q01A 1DTSA 1QHYA 1HYQA 1FMLA 4JLKA 3RC3A 2YC4C 2J46A 4OQMA 5JWOA 3R7WB 1SHZA 5KU1A 1BYIA 3IHLA 4P4UA 2IYTA 2ZVPX 4MQBA 1GRNA 4GOJA 5IRCD 2D7CA 1OXSC 2VH5R 3GJ6A 4TZ6A 1ZNXA 2V7QA 4A9AA 1U90A 4GNKA 4TQAA 4HLUC 2X2EA 4TMVA 1R0XA 1II8B 1YVDA 3RABA 3LXXA 3V4RA 1SXJC 2LCFA 3QG1A 3ADCA 3I72A 1C9KA 2B92A 4JVNA 3KZ1E 4DSOA 4FD2A 4AWXA 4E22A 4US2R 3UATA 3O47A 2FSFA 4B6FA 3W6PA 1VCMA 2BBWA 4S35A 5IT5A 1E9RA 2CDNA 2BOVA 2HLDD 3EPLA 3VKWA 3AVQA 1Z0IA 2AFHE 3ND8A 4QGAA 2QBYA 1KSFX 3QUSA 3MUFA 3L82B 4DVGA 4AKEA 1WDTA 1YZLA 3SU8A 5L3VA 3HR7A 1ONBA 1HQCA 5AK0A 5JSZA 2IXGA 3MWLA 3MWKA 1OXUA 5AJYA 3AH8A 3BWDD 3LNCA 1RRGA 4CF7A 4HAYA 2L0XA 5HCIA 3GJ0A 4ZCIA 2IA5A 2IL1A 2R2AA 5CK5A 4AIIA 4YMUA 3DO6A 5EUQB 4LUCA 5KYKA 5EP1A 1SZPA 3PIRA 3BH7A 3A1UA 3A58B 4W7SA 3TR0A 1II8A 1AQUA 5JZVA 1SVOA 3GJ3A 4MGIR 2O52A 4YDHB 1EXMA 2JJ1D 2W6ID 4O3MA 2WJIA 2OAP1 4RCYA 4GP7A 5LB4A 3LFUA 2FH5B 1AN0A 2F3RA 1G4AE 3E2IA 2PZGA 2XB4A 1PV4A 1XMJA 1XEXB 4TZ0A 4B35A 1G8FA 2FEMA 4KFTA 1NIPA 3U3RA 1S0UA 4YC7A 3SS8A 4UKDA 5FOUA 1YU9A 1KAOA 2FA9A 3S1AA 3G0HA 4KODA 1JPJA 3BB1A 3PQCA 4KSCA 3P27A 3EIQA 2GEUA 1MR3F 1Z0FA 1OFUX 3EW9A 3WBJA 3I1FA 1MRNA 3ZD6A 4XOIA 5CYOA 3GLHA 4NYMQ 4TYQA 3KQLA 4HAWA 3WBKA 1NN5A 1KI9A 2OFWA 2QENA 1UKZA 1KSGA 4EFLA 2N1BA 4JT4A 2QAGC 5C4GB 1NN3A 5C4MA 1NLZA 2XZOA 4E5UA 1DADA 3CKLA 3F5FA 1MKYA 2EFEB 3GJ7A 1XEWY 1LNZA 4Y0VA 3ECCA 3AKCA 4OHYA 2J7KA 2RGEA 2QTFA 3A1VA 3B9QA 2W0SA 1U8ZA 3KL4A 4BWYA 3R8CA 3QKRA 1R0WA 2D74A 2Y8EA 4TYNA 3EIHA 4OI2A 1N6OA 1Q1BA 3K0AA 4TT3D 5AWFC 1U0JA 1EFCA 4M1MA 3GLFB 4WW0A 3KQHA 4TYPA 2BVNA 2H57A 1V43A 1RRPA 1KZGB 1TF7A 3Q72A 1Z29A 5DO9A 1WCV1 1ZRHA 4LV5B 1TEXA 2F1HA 1HA3A 4EDHA 4BFVA 1G7TA 4PC2A 2XNDA 2EFHB 2Z6VA 5G3YA 3U3KA 4M53A 3RVBA 2V8OA 5KSPA 5JLJA 4C2UA 4V0OA 5HTKA 1PUJA 4X8MA 2IF0A 4URZR 4C3ZA 2NQ2C 3C41J 4DCSA 1P62B 5ANRB 2O8EA 1XU4A 3NBYC 5FOWA 2G6BA 1G16A 1CJUC 1CRQA 2H92A 1SQ5A 1KSHA 1WA5A 4W5JA 5JJKA 2D2FA 1IBRA 1ZUHA 4HLUA 3RLFA 4OHWA 2F6RA 2JLSA 4CEJB 5TY0A 1SXJA 2EVWX 4A0GA 2P67A 4RD0A 2JDIA 5EP3A 5L8VA 2QT0A 2WHXA 2XTZA 1QZXA 3B13B 3F0TA 3Q8XB 1E9BA 2FX3A 2PL3A 4FXPA 4C30A 4WVFA 4BFSA 5C18A 2F1RA 2XX3A 5FTLA 2PCLA 1YZTA 4TLEA 2O8FB 4D25A 4IJMA 3TAHA 1S96A 1Z6XA 2WM9B 3AKEA 3OAAD 3PUWA 3QVVA 4MUAA 3ICEA 2ZVQX 1FP6A 1XMIA 2O0KA 5HCNA 3IEUA 1YZGA 3IIKA 2C9OA 4O2RA 4QG7A 5DH9A 3AF1A 1Q1ZA 1UKVY 1GKIA 2FGJA 3LBIA 1OKKA 2WWHA 1E4YA 4WZAE 5LD2C 3I32A 1YKSA 4TLCA 3W8RA 2QU8A 4BEBA 4FMBB 5JWRA 4GDFA 1UKEA 2GRJA 2QAGB 2VO1A 1W0KA 3CWZA 4DDVA 5JS8A 3U6KA 3FWYA 1OSNA 1L4UA 3AVOA 5J4LA 4IFEA 3RS4A 3AVUA 4BLRA 1ZD8A 4IW3B 3VKGA 1TPZA 1E2LA 1R5NA 2UKDA 4NCKA 4PPFA 3GLIB 4TQ9A 4LJ7A 4FCWA 4MDEA 5DYIA 4AYWA 3NC0C 4LPSA 4Q1BA 3EWSA 3MJHA 1E2EA 5JRZA 2O8FA 3AF2A 1D5CA 5G40A 1BIFA 1D2NA 1XPUA 4N1AA 4JJKA 4Q48A 3UWOA 3KQKA 4JLNA 1S9DA 5AJZA 4Q1AA 2ZSFA 3TR5A 4AYXA 2WJVA 4JL5A 1K5GA 5DN6A 1T8TA 2OCPA 2ZRAA 2JLQA 2KWIA 2OFOA 1E98A 1NVVR 5UKDA 1C4OA 4FN5A 3B60A 3EZ9A 3RS2A 2R6GA 3M0EA 5KSZA 3HR8A 4Q7MB 4F7WA 2BV3A 4Q4LA 2PEZA 4K8OA 1GTVA 3QF4A 4Q4HB 2FFQA 4TYWA 3M4YA 3CX6A 2QAGA 3ASYA 3SZRA 3AGPA 2A78A 3CRW1 3VU9B 1XTRA 1OH7A 4C0LA 1P5ZB 2OLJA 3NVAA 2FPKA 3B85A 4JLVA 2XB2A 3ZH9B 421PA 4KXFB 1WMSA 3THYA 1NNEA 1OB2A 2VP0A 4Q00A 2CL0X 5J5CA 4OJKA 1ZU5A 4NZYA 3BGWA 1NMYA 4URYR 1XXHB 3ADDA 2JJ2D 2G9NA 1W0JD 1N0UA 3BS4A 3JVUA 3MSXA 4HZUB 2IHYA 3LV8A 4JMPA 4LYHA 2FGKA 3EC2A 1Z28A 2A5JA 4UXJA 1KSJA 2RB4A 5EP2A 5SZKB 3ZZTA 2F9LA 4BPBA 1FUUA 1DELA 1LF5A 1J8YF 2ZYVX 3LX8A 2FJUA 4DIDA 1JR3D 2H8KA 4XWAA 3EZFA 1NBME 1OYWA 3ZDQA 1OH5A 4BZXA 2YWFA 2QGZA 2CL6X 4A92A 1EK0A 4DDTA 2GETA 4GRAA 4HB0A 3B1VA 3C16C 3RHFA 2AD1A 5FBRB 2KJQA 4IDHA 4PPGA 2Q9BA 4XSHA 4Q4HA 4CRWB 2XTNA 3MMPA 2IXEA 4B44A 1G291 5DNYB 1E3MA 3MRSA 3RWMB 1H8EA 1F3OA 3BJIC 4M22A 4YONB 5FTNA 2WTUA 2QPTA 2XXAB 2WICA 3B1YA 3K70D 4RD1A 1Z07A 5CLQA 3KUDA 2ERYA 1TL7C 4D4MA 1XXHA 3KB2A 2OBMA 4KV9A 4DIEA 5EE5B 3FKSA 4IOJA 5E7MA 1KY2A 4DLYA 3DDCA 4HZUA 2I1VB 3I5YA 4ZDWA 4I1SA 3W5IA 4DC9A 3LH5A 5DHFA 3LO5A 2AXPA 1FX0A 2JJ8A 4DLUA 1IJEA 1N25A 1NMXA 2YKGA 4NH0A 3TRFA 1BKDR 1KO5A 2GZDA 1NKTA 2B6HA 2W6JD 2IT1A 2QSYA 4DCTA 5FPKA 3I8SA 3W3AA 3SR0A 4H9GA 4B3GA 3W34A 1X3SA 2FV8A 2GZHA 2IX3A 3AQ4A 5EXSA 3PEWA 4RVCA 4E07A 4IDQA 3I61A 2V6IA 4DSUA 3V4FA 4Q4AA 1Y3AA 4QHSA 3IHWA 3KKPA 5AR1A 1T4GA 2ZE8A 1SXJD 1MH1A 2CHQA 1FOEB 4Q21A 4F93B 4Q1DA 3QSYA 3NBFA 1IN8A 1TQ4A 4NTZA 1XTQA 2EYQA 1OH8A 1NG9A 4M9SA 3DM5A 4IXNA 1NY5A 4OYHA 2HCBA 3KXKA 3GFTA 4RJLA 1VTKA 1HE1C 4PTLA 1E79A 2BKUA 2IS1A 2WZQA 2C96A 2GXAA 4PHHA 5EUMA 2WV9A 1XJCA 2R9VA 4V0LA 4R9UC 2IHBA 3EPKA 4WBSA 1E2PA 1JB1A 5TMPA 2VHQA 1XDBA 2WMNB 1CJMA 1U8YA 2O0JA 2ZJOA 2DFTA 1JECA 4P4SB 1M2OB 1UBCA 1GG2A 3A1TA 2NPFA 3NC1C 1AGPA 2GF9A 3M6AA 2R6DA 1M8PA 3PCRB 1GNRA 1IXRC 2ZIAA 2PEYA 1XBTA 521PA 5L3QA 1U98A 1ZINA 4IDNA 4ASUD 2IEYA 5CYPA 2WIAA 4QXAA 3FDIA 1G9XA 4CEHA 1Q1EA 2JLUA 1W0KD 4JVMA 2DFNA 1CP2A 2CLCX 3CZQA 3LLUA 1UADA 4KU4A 3SOPA 5GVSA 1G8PA 5J4VA 1WRBA 4YMWA 1DAMA 2RHMA 3NEJA 1W36C 4OI4A 2RGGA 4MRRA 1G17A 4BLOA 4G5OA 4ZDJA 2HYIC 2OE2A 3LVQE 1KNXA 3OEHA 1KDPA 1XEFA 1SHKA 4PO9A 4B2LA 4A2WA 2J9RA 4PX9A 1R8QA 4M21A 1XTKA 2QM8A 3PVSA 2J7PD 4QM6A 4PC1A 4RZ2A 1ODFA 1CR1A 1DE0A 5FPSA 5DN6D 1F6BA 4P4SA 3T12A 3QXCA 4L8GA 4QBHA 4XIGS 4HB2A 5SZJA 2GNOA 2J0UB 3WNDA 2K5UA 3KFXA 2JLRA 1YRBA 3DOFA 4PZYA 2BIFA 3BD9A 4QNMA 3RS3A 1R8SA 1AA9A 2ZYWX 2AWNA 2NTYC 1GITA 1FTSA 3U7GA 2XZLA 1MOZA 1AJEA 4CEIB 4A15A 1JR6A 3R9WA 3K53A 4FCVA 1E9FA 1XMVA 2RGBA 2H7VA 5JCPA 4TSFA 1TADA 1IY0A 2F43B 5HKKD 3A6PC 2EFDB 1R0ZA 3KTAB 4URXR 4OK3A 3SHFA 5TV2A 4EPWA 2YOGA 1ZUIA 3QXXA 4NONA 4LDJA 4TLAA 4AD8A 1ZNYA 3K0EA 4HDOB 1I2DA 3PEVA 4M4SA 5KNBA 1P9RA 1NVXQ 2ANBA 4QHTA 2F55A 3QEOA 1CKEA 1GUAA 1X8JA 4M1OA 1N6LA 1W4CA 2MMCA 1GNQA 4MRPA 2ZXUA 1ZBDA 1NBMA 2BMFA 4JKIA 2GCOB 4A6XA 1NMZA 3A1SA 2IYYA 1UM8A 1H8ED 2SHKA 3AVTA 2WVJA 3K9HA 3BAFA 2GJSA 1HURA 1LF0A 2BMEA 2HT1A 5EXPA 2JLVA 3BXZA 2IYUA 3RSLA 5KDDA 1ETUA 2ZRDA 2GILA 4JL6A 2CE7A 1RJ9B 3KTAA 1Z6AA 1EWRA 2DPXA 4I1OA 1KI1A 5LPNA 2ONKA 4G01B 3SNHA 1T91A 5L3SB 1KI6B 2QA5A 4M1SA 1QDEA 1IM2A 3AP1A 1XD8A 4JYCA 4WXPA 1JPNA 2CXXA 3GJXC 2UZ3A 4E03A 4PPQA 1UFQA 4MRNA 3UG7A 2R65A 4BRWA 2ZJBA 3T1VA 2CE2X 2P6NA 5JHGB 3U7FB 3RS0A 4TMXA 1FZQA 1W2HA 1F2TA 5GJCA 5KDLA 2FFAA 1NN1A 4XSGA 3B2EA 2GJAA 3SYKA 3QXHA 3L8ZA 3PUYA 4HDQB 4C0SA 4Q03A 4DB2A 5H1YA 4OHZA 2VF8A 1Q3HA 4NDZA 4IOKA 3DZ8A 1EFUA 3D3QA 2GJ9A 4IVQA 1S3GA 2NIPA 1YR7A 1KZ7B 1MABA 1JQLB 5FOTA 4FMDB 1Z06A 4L15A 2EFGA 2IYQA 5B30A 2BJWA 3F3YA 4K46A 3GFOA 4Q9LA 4MYUA 1XRJA 3EPHA 4XWOA 2QRNA 4JLAA 1XD2A 1CEEA 2P0EA 2XOKA 2IYWA 5P21A 1UDXA 1EG7A 3K1JA 3Q7QA 4HB4A 4PC7A 1KI6A 2W2XA 2IUSA 2ZUDA 3QIAA 5HPYB 3MLEA 2KBEA 2KBFA 2HT6A 5JJIA 3BBPA 2GXUA 1US8A 4F4JA 2O0HA 5K8IA 3FFAA 1Z3IX 4UXHA 1A2KC 3UWKA 4TYYA 1MO4A 4ZPXA 2QE7A 2REBA 5KTYA 1XTSA 4XJXA 5FPTA 4GP6A 2QY9A 4I1UA 1E2JA 4MA4A 2ATXA 3CUEF 2VP5A 3SEAA 4DXAA 4D80A 4X8HA 4B47A 1PZNA 1U9IC 4KLZA 4LHYA 3AVYA 2Q6TA 2Q21A 2F1JA 1GVNB 1E99A 2ZI9A 3QKUA 1VCNA 3U44B 1K5DA 4TL9A 4FMDF 1WBBA 1E4VA 5FBLB 3VAAA 3CM0A 4EIWA 1P3JA 2C78A 2GXSA 1ZUNB 2ZQ5A 2VLIA 1LS6A 1YR6A 4LK2A 1P9WA 1T3HA 2A5YB 3EC1A 1DBSA 1DG1G 1A2BA 3KKQA 2D06A 4PC3A 3OEHD 3LQRA 2JCSA 2IW3A 1IOZA 1DS6A 3DMDA 4V02A 3QVUA 4QBFA 4NL4H 2GZAA 1QHHB 4ARZB 4TL7A 4YMSA 2ZS8A 1JJ7A 3SFVA 5G3ZA 1IJFA 2VSXA 1G4UR 1DAKA 4B76A 2ZJ8A 4DEYA 3GLFE 1AK2A 3Q3JB 2O8DA 1KDTA 1XEWX 1K8RA 1U0HC 4PHTA 1I4DD 3VR5A 1UPTA 3VQTA 3K0SA 1NRJB 1W2GA 2C04A 3N70A 4Q4JB 4LJ5A 2Z5FA 3CNLA 3IBYA 1ZYUA 1XF9A 1NVUQ 1TAGA 1HV8A 1CJVC 2ZRBA 2CCKA 4ESHA 4G3XA 4DUGD 3THOA 3VX4A 1GZSA 4TSFD 3ZVRA 2WWFA 3QEJA 1EFRA 4N0EA 4CT4B 5JCZA 4V0ME 1NIJA 2H17A 1QF9A 4BGDA 2V1XA 4ZIRA 5HZKA 1Q0UA 3ZQJA 2OAQ1 3WMEA 4GMDA 1BMFA 1FFHA 4FCTA 3QF7A 1G64A 1QHHA 1GL9B 2O8BB 4QOSA 3LX5A 4IOMA 4IVPA 4BFYA 1QHIA 2MMGA 4NP6A 1N5KA 4A36A 1G3QA 3DPUA 5BN4A 4NCJA 1WF3A 2WIBA 2XITA 2ODNA 1ZD9A 2FPLA 1Z47A 2Z4SA 4M1YA 2FN4A 5FUYA 1OIWA 1NBMD 1G7CA 3BRWD 2FOLA 4P33A 4Q4JA 4V0NA 5DSZA 4DBLC 1KTVA 2FFHA 4US1R 3UMFA 4RD2A 2AD5A 3AKDA 1H8HD 1OJLA 3C7KA 3H86A 3NH9A 4UNSA 1R6BX 3R7WA 3RRYA 3WNBA 1GNPA 3ETLA 2IWRA 1N5IA 4Q5IA 3EA5A 3CX8A 3U60B 2J1LA 2ZRLA 4M9XA 4QNRA 3W9YA 5KNDA 1HUQA 2NO6A 4CDGA 1W5TA 3DVLA 4NE2A 4NYMR 5GADl 1LS1A 1RRFA 2OHFA 2WKRA 4C7OB 4L5BA 1CBUA 2VP4A 3AP3A 4LY6A 1IN5A 3QG5A 1OXTA 4C0KA 3LQQA 2WOJA 4YLGA 1CR0A 3B1XA 2CHVA 3ZQ6A 2REOA 1QHSA 5EE3A 2MSDB 3CIOA 4ZDIA 4UXIA 5B64A 3VNVA 2YWEA 1OFIA 2W2TA 3X1ZA 1MO3A 2CL7X 2ODEA 4XVUA 3GLIE 3HWSA 3DKPA 2GVZC 5M04A 3OESA 2VPPA 4Q9IA 1KJWA 4P32A 1AQYA 4V03A 2DY1A 2G1KA 3MJRA 5CIQA 5KPDA 2RMKA 1COWA 3FHCB 3FVQA 2PZFA 2VQSA 2ZUBA 2X77A 2BC9A 4GOXA 2V55B 3RDPA 2GTPA 4JBYA 1Z0KA 3REFA 2GVDC 3KKMA 2R62A 1N6RA 1U9IA 3L2OB 5CDFE 1Z6TA 1R7RA 2CCJA 3BC1A 3REGA 2VHUA 3KXLA 2XOKD 2B7CA 4TTRA 4CT5A 4RZXA 4TTPA 4BFTA 2A3RA 1CJKC 5EXTA 2WSSA 4DCVA 4IRUB 4LBVA 3K70B 4MKFA 3WYAA 3FHTA 3N2IA 1VYUA 2EQBA 1W36D 1X6VA 2BM1A 4PO8A 2ERXA 2PJRA 1XEXA 1OHHD 4URVR 5C2JB 2ZSAA 4HAVA 1XJQA 5H70A 3W5JA 5FH9A 1BO6A 4ESVA 4PR0A 5DI3B 1KK2A 3LD9A 4WOPA 2P3SA 4GPTA 3OFNA 1XXHE 4KVGA 1NY6A 1VPLA 2QQ0A 4A2PA 2QQEA 2IYZA 1KMHB 4NCNA 1T6NA 2JLWA 1SVSA 4Z8YA 4JLBA 3I5XA 5JJLA 2QROA 1D6JA 4PC6A 3MGCA 3MFYA 2QEQA 2JIZD 3EXAA 3I8XA 3K0CC 2GK6A 3CH5A 2NPIA 2QMHA 4ZKDA 2ZANA 3NIBA 4U5XA 1G5TA 1VCIA 2R6CA 1OH6A 1OIVA 1YZUA 4F4IA 3P4YA 5KHOC 1RYFA 3SQXA 1P75A 3PG5A 1P2UA 3EZ6A 221PA 5AUNB 5FOVA 4GT1A 1NJGA 1FUKA 5FL7D 2VSFA 4ILEA 3T5GA 4A6PA 4TL8A 4GBMA 3GLFA 3TW4A 1KDRA 4B3BA 4YMVA 4HLDA 4LHXA 2WMOB 2O8CB 1AM4D 2HDNB 4OJQA 2W58A 1KK0A 2VF7A 4EPXA 1AKYA 3ZVLA 2QMOA 5HZHA 4GFDA 3O8DA 2G0TA 1J70A 1ZNZA 4HUQB 2XNSA 5EP4A 2Q9CA 8OHMA 3BORA 3BOSA 2F3TA 2XEXA 2V7QD 4ITRC 1E1RA 4LPKA 2PZEA 4B2IA 1DAHA 2BMJA 4Z8XA 4ZV4A 5EXXA 3QKSB 1U0LA 3EIEA 1JALA 1KOFA 5GJWC 3VKHA 5J47A 5J4HA 4V0MA 1BMFD 1FNNA 1SKQA 2FSGA 4OQLA 3CPHA 4JLPA 3SQWA 4C9BA 2YOHA 3BK7A 4OQNA 4BFWA 3I73A 4WA7A 1Z0DA 1ZMXA 4AG6A 4LJ6A 1PLJA 1UBEA 4CEJA 2ZSEA 2QL6A 4LV6A 3B78A 3FMPB 2ZITA 4YMTA 1BYUA 1N3BA 3LW7A 1QG2A 5KNCA 4JT2A 2VTKA 1OFHA 3TJZA 2W0MA 3A8TA 2ZAOA 2AKYA 3ASZA 2VHTA 3C8UA 4QM7A 1E0JA 4FMCB 1TQDA 2Q0HA 5CB8A 1N6IA 2DHRA 3LAWA 1S8FA 3GFPA 1S1MA 4PSKA 5BN5A 5B58C 4G0NA 1RFLA 3G82C 4CIDA 4DCNA 1WQ1R 3CF0A 2ZI7A 2C95A 3EG5A 4DJTA 2BMDA 1Y63A 4LZZA 1QVAA 4M1WA 3VFDA 3BB3A 3R20A 4A82A 1N0VC 2P65A 5KSOA 3FPAA 2WBLC 4A0HA 2YV5A 3C14C 4JLJA 1YZKA 1BS1A 1KGDA 1Z83A 121PA 4IKEA 1X1SA 2LKCA 4Q47A 721PA 3K8YA 3UIEA 3QBVA 3KQUA 2WWGA 1KO1A 2Z4RA 1TF5A 3OEEA 5LB2A 2NGRA 4F38A 5GJBA 4RD4A 1Z0AA 1VECA 3HYTA 3VX3A 2QPOA 3FB4A 2C9CA 3O8CA 3SI7A 3GLIA 2DWPA 3IILA 4MGZR 1HEIA 1ZM2A 1NVWQ 3U2QA 2VHJA 3ZIAA 4LSGA 2ODWA 5KPJA 3L0PA 4TWZA 1COWD 3QI2A 3NEYA 2OCBA 3LBHA 4FMCF 4P4TA 5JMTA 1JI0A 4IEIA 4C0BA 5E3HA 1W47A 3TSZA 3D7MA 1NSFA 1T5IA 3PV0A 1DAGA 4GZMA 3Q85A 1N5JA 4FIDA 1R5OA 4HEJA 4LBYA 1GKUB 3IIMA 2AXNA 1ANKA 3GLGB 1U99A 5CDFA 3OIWA 2CLSA 2EU8A 2WSMA 1QRAA 2D2EA 1RIFA 2IK8A 5FI0B 5JFGA 2PMKA 1KI2A 1KI8A 3T1TA 2AX4A 3K0CA 1G20E 3IKJA 4LV8B 2A5GA 1G3RA 1FQKA 3VU9A 3AVPA 2BWJA 1OYYA 3OIUA 5CK4A 4I81A 3B7GA 1XTJA 2IYVA 3BFXA 4Y0AA 1HTWA 1F48A 3PUZA 1Q21A 5D3QA 3IO3A 3OFND 3CRQA 1VG9B 1UBGA 4PAMA 1W5SA 4FWIB 3HPRA 4FINA 2DYKA 4LJAA 3H2YA 4ACAA 5FUWA 3FGNA 2HV8A 4EJSB 1Z63A 2CEAA 1GRRA 4XD7A 5FUVA 1KMQA 3SHWA 2UVQA 4L9SA 2XNDD 4AI6A 4DKXA 1G6OA 3J81k 4JYBA 4G1UC 2C2HA 5SZHB 1UKYA 1T3SA 2XSZA
chains in the Genus database with same CATH superfamily
2Q4OA 5FJJA 2REQB 3UQYS 2J5BA 4XYGA 3CF6R 1OB5A 5JNRA 3AWDA 1BJTA 3UWMA 2IIQA 1SHJA 1GAJA 3R7SA 5BURA 2WJAA 4EI8A 2FWRA 3UAGA 5IXYA 4KFSA 3V4VB 1FIUA 3BVPA 3I83A 4IOLA 3S29A 3TNJA 4A26A 4HYYA 4I8XA 1N3IA 4OLJA 4DW8A 4R51A 1L8OA 4EUNA 3PT5A 4FP9A 4P58A 1Z36A 1U0BB 4GEKA 2JDID 3E9DA 2XXAA 1IHUA 2JEOA 4L22A 2UXCB 4YQYA 3FSEA 2VP6A 2CK3A 2M6LA 4W5HA 4GF5A 4EFNA 5AVWA 1MH9A 4M88A 3Q7EA 1X7WB 3UT5B 4DMCA 1MN6A 2ZTSA 1XJ5A 1DWPA 4JNCA 2HU7A 1F6WA 1R4MA 3KJIA 4BASA 3GBSA 2I03A 4JXKA 2RONA 1Z4PX 5JHHB 1CQWA 1NL3A 4HDKA 2OVBA 2Y71A 1OCEA 3P2MA 5DI9A 4D6XA 2FVXA 1GZVA 2PGIA 3N6VA 2MSCB 2B34A 3C3YA 3LIPA 1TCBA 1XB2A 2BELA 2BEJA 2IWHA 2PMEA 5JZBA 1UFVA 1MENA 3RG2A 5U4QA 2REQA 4ISCA 3JQ9C 1RI2A 4DYDA 3PUXA 1YJQA 1P2TA 1ZI6A 4Z9XA 1TRKA 5JS2A 2BFDB 4MP3A 5FBHA 3FYHA 3U7EB 3ZE1B 3LSYA 5IH7A 1YJXA 5FHQA 1H85A 2VSYA 2I3ZA 1F4VA 3E84A 2OESA 2DBZA 4WL0A 5TRTA 5I7SA 1K6MA 3KJHA 1VL8A 2W6OA 4LAFA 4UEJA 1EZ4A 2P3LA 4G5GA 4MUEA 1P74A 4QECA 2WA2A 4DUPA 5KJ1A 2JA1A 2VHWA 3QWFA 2C2OA 4L5CA 1GU7A 5AVRA 2HWWA 2JCVA 2G04A 1IN7A 1E9CA 1MAWA 4QREA 3WP0A 4RMHA 4Z7JA 5TC4A 2Q2NA 1M1YE 3BFVA 2CJWB 3EW7A 1EX6A 1RIIA 1SOVA 2OC9A 1M8JA 3CNNA 5JR3A 2EX1A 2NVUA 3CJTA 3IE0A 3ECSA 4C76A 3ZGZA 1V41E 3DUWA 1SC3A 5JAZA 4FFNA 1DC7A 1E0SA 1VC2A 1HMPA 3SE0A 1AV6A 2OXTA 4MW6A 4LVOA 1M2KA 1D8TA 4X8LA 1SK9A 3FLBA 2ONYA 5DWQA 3WQRA 4ZCRA 3CJRA 1JTEA 1C5KA 1MXFA 1VE6A 1XP8A 2ETXA 1BDBA 5JZMA 1KRHA 3GDWA 1MVLA 1A95A 2D4HA 3BMNB 2BFOA 4ZYLA 2GM4A 2QN6A 4HG2A 2GWHA 2NO9A 1N5OX 3G9XA 3K9GA 1AUXA 4HX2A 1DKNA 2C00A 3H13A 4OQDA 2NOAA 5KREA 3DAFA 1ZN7A 2XKAA 2VWGA 2AMYA 3C0KA 5BSTA 1I7PA 3E9QA 3ND9A 3IVAA 4Y9DA 3U0BA 3AL3A 2HU5A 1T3LA 4QZVA 2YZ7A 2RB5A 3U7QB 3ANXA 5T6MA 2HMWA 1Q3KA 2C1XA 1W44A 3QPCA 5JQGA 4A8JC 1D1QA 4NENB 1J99A 3WG9A 1TYZA 5AKXA 2YV1A 2PSHA 2C99A 5GQSA 5GINE 3F7TA 1CB7A 2I99A 4JLOA 3HNPA 4L9WA 2W4QA 4JLMA 2XB6A 4QHYA 4YCAA 1ZCBA 2VEDA 4DREA 4WMLA 1YUNA 5DTMA 5IM4A 2VDPB 4BAGA 2J8ZA 2OV2A 3O3CA 3FHOA 3RFTA 3FTFA 4O8ZA 4BLSA 3FKQA 1ZK3A 4R0MA 1LV7A 4LMBA 1TJ5A 1RCFA 4DM3A 1JS1X 1KE1A 4ZTBA 1RQRA 2X2FA 4HGNA 4O5AA 4WXRA 2YWHA 5EWLA 3SC4A 2DUUA 2PYDA 3LT1A 1NE7A 4LZAA 5I9LA 2X8LA 4N41A 2J0UA 2W37A 2LCQA 4DNFA 3L40A 5KJFA 4DUZB 4NFLA 3ANNA 5LP6B 2DZDA 1OX5A 2J0QA 2XPCA 1T9AA 2XA2A 5E3IA 4WBNF 1ISSA 4NF2A 4OXRA 4ZXFA 2QK4A 3LYLA 1O87A 2E87A 3DE2X 3L1KA 2COEA 4KJXA 5FI3A 4DR3B 3KX2A 2OT3B 1WD5A 5AW3A 5IKPA 2VJMA 4I6GA 3MIZA 2HK9A 3B51X 3MQ2A 4GI2A 3NTUA 4GE0A 4IDOA 5J4YA 4NENA 2HBZA 2OHGA 1TCCA 1A76A 2ID4A 2ZYAA 4FWTA 3AQIA 3DCIA 4NY1A 4RIIA 1FVHA 4JXZA 1QRDA 4RACA 3C3WA 1TXGA 4HD8A 3OZIA 4IG4A 5ARCA 4N8EA 3VU0A 1J42A 4UJ5A 1I51A 1YJ5A 4EVSA 3FKSD 3AF3A 4DLPA 2Q0QA 5A4DA 4MS3B 4YLEA 3H19A 1QBKC 3IQHX 1RT9A 5AQ1A 1G7RA 5JWHA 4X92A 4OHKA 5K6TA 1XKTA 2V4ZA 1DRVA 4XVQA 4M0EA 4PQEA 1TO2E 2GJ8A 3CZ4A 3INYA 4MINA 1OROA 2HJVA 3TVTA 5BN1A 2CT8A 1SUWA 4JELA 4PCUA 4Q7LA 3ZY2A 3KFLA 5M3BA 2XCUA 2CSUA 3RTGA 4AAYA 3P32A 1I33A 3CRVA 3I6ZA 4RY9A 3LZ6A 3WGZA 5BRJA 3MMZA 1KI7A 1HXHA 4BB6A 4EG6A 3PWSA 1OAAA 3BDIA 2MIIA 5ALWA 3ICQB 1P8AA 2R44A 5C7YA 3E35A 3G8BA 4D99A 4TV9F 1X86B 5CAEA 2JLXA 2W6IA 4UAUA 3JQ9A 2QV7A 4CV0A 4OHPA 1ODJA 4FS3A 4N49A 2C4UA 3AI2A 4PPNA 3I4CA 2BBOA 5ITWA 2QGNA 1XYYA 2P11A 3NM4A 3GVIA 3VV3A 4ALMA 4CQLA 3DAHA 3NHBA 5CD1A 3O93A 1NFFA 1RJ9A 2C84A 1A9OA 2BZGA 2FQYA 2NYUA 5KTNA 3Q40A 1MGOA 1TDJA 4BU0A 1MF7A 4BFZA 5AXDA 4TTTS 5AW0A 1WOMA 1K7XB 1E79D 4M9QA 4XD2A 1JSZA 3EEYA 3UANA 4A8JB 4X0EA 1T9CA 1T2CA 2QX9A 2H5EA 5H81A 3NT5A 2BFFA 3IOYA 4K5QA 4DLVA 5AJXA 2QLNA 1OX4B 3OJWA 3UJNA 4KQ9A 1HE8B 3UC5A 3L84A 2J3EA 4II7A 4BCDA 3GB9A 1SG9A 3GUVA 3RB8A 4FQ5A 1LVUA 2VH2A 4DMGA 4ZT4A 4HDAA 3W5UA 3OQ1A 1Y5RA 4GIBA 3KWLA 1A7JA 3ONWA 1T36A 4JKOA 4YRDA 4ZAVA 4W8GA 3EZ7A 3GD7A 3U3JA 4DR5B 3OQNA 4US0R 4BNJA 3RADC 1Z4NA 4V39A 2YWJA 1ZVMA 3F9RA 2AXEA 4ZVNA 8ABPA 4A5OA 2PUEA 4B34A 4R1UA 3MTIA 5HS6A 5AUPB 1L8QA 1LJ8A 3WYEA 3A9RA 2PQ6A 3EWNA 5CEEA 1DWOA 4L8FA 1L5HB 1AY0A 4NX2A 1B00A 5K2OA 3QVXA 1NLFA 3HSKA 3JR3A 2Q5QA 1VFNA 1C7ZA 1MXHA 1P1BA 4KNVA 3SXJA 5J43A 4JNKA 2JJYA 1D1PA 1M1YA 4YXWD 1COZA 3UOWA 2NSLA 4A8JA 1LK5A 2QMEA 3MRXA 1Q7CA 3WHKA 3ZS8A 3BRCA 3DLCA 3LMKA 3HM2A 1THMA 3K1ZA 2EJBA 3OBIA 4TTIA 2FZGA 2QZ4A 3A3KA 3TLYA 3Q5GA 3HXOA 1B4DA 4RHFA 2NADA 4ZQEA 1IQ0A 1MB0A 3E3LA 4PGFA 3MUNA 1Y6GA 3TOSA 1KK1A 3RS7A 1TMKA 5C35A 4CM9D 1WXDA 1OVGA 2GHIA 5DX1A 1RSZA 3OCVA 1GL6A 4HY3A 1JV2B 2FQXA 4B32A 2X0IA 2VUHB 4Z4IA 4QPDA 1AUOA 3L4JA 1Z7BA 1ACMA 4ZVOA 3PNMA 3D8RA 4QPNA 4EKGA 4FYWA 4WXEA 3UFXB 1DO0A 3C1AA 2RAPA 4B80A 4ECAA 1T8RA 1W76A 4KXVA 2YJZA 3WWOA 1B3RA 3EXG2 4PHFA 5BSRA 3K70C 1L9KA 1PVOA 2WKQA 4EJ0A 1W30A 1XRRA 3K9QO 1LLFA 1U1IA 1KS9A 2BGIA 5H7XA 1LBHA 1LX7A 1OMOA 2ATIA 2GCNA 2KX7A 2O5RA 3OETA 2XYGA 2XNKA 5L51A 3KJZA 3C70A 1M2NA 1KEPA 5JS7A 3RYFB 1DIHA 4UDOA 3EISA 2XJ9A 4IMJB 4MITA 1ZD3A 3M34A 1ZCZA 1M67A 4MQEB 1KY3A 4AS3A 2VA9A 4FOTA 4BECA 4PFQA 2XGJA 3OTWA 4LFCB 3KB1A 3B82A 5DK4A 4TMTA 1ZI8A 4DA9A 3ZTTA 3FCYA 5G4KB 3LYAA 4DDKA 5K0ZA 4W9MC 4IICA 2NP7A 3D7NA 2ZXEA 4WX2B 3TR6A 1XZBA 3DQZA 1FQOA 3F5DA 4AJJA 5C51B 3OAAA 2HSJA 3C5CA 2Z6QA 2PVSA 2ACEA 2QSUA 3LPNA 2ZKLA 1IAVA 4A1OA 4M1TA 2P9TA 2GBCA 1M2EA 3DNPA 1HQKA 3HB9A 4P86A 2G1UA 2PPVA 3OUZA 3PPXA 2LGJA 3NTXA 4E11A 3SYRA 1VXOA 2FRXA 2Y1GA 3FPHA 3H4MA 4K9RA 4LF4B 3PFGA 2HRDA 3N39C 3T4EA 2V9PA 5BV2P 1YAJA 3DONA 2B36A 2PS0A 4KIJA 2Z43A 4G0OA 1SCKA 1USKA 4KXQA 1AZTA 5ERGB 3VR2D 3VO8A 3RYFA 4A10A 2VBGA 1UPBA 3WBFA 5AVQA 3DBRB 4RORA 3EGDA 2WPDA 4MQEA 1E1QD 3UK7A 2DX7A 2FQQA 1ECGA 1G41A 2C4HA 1E8NA 5E2IA 4U7FA 2YDYA 4B75A 4PLTA 2VG8A 7AT1A 3F97A 3NYRA 1V8OA 1U7WA 4TXNA 4Y3UA 5FL3A 4DT1B 2CMKA 4YXFA 2JHFA 1RYYA 4IEEA 5C1BA 2NQTA 4C88A 5HE8A 2XKKA 5LQJA 1JXMA 2EKQA 2ONCA 4LX0A 1Q1NA 3H4VA 5LBIA 3ZNQA 2IDKA 2TECE 4MP8A 3T0FA 3DS8A 4MB6A 1I5RA 5T4HA 1CVIA 5KTPA 3U5TA 5CFRA 1VG8A 1UPAA 1H6DA 3DWIA 3M6FA 5EPOA 1YRYE 2HLHA 4HUTA 1U2EA 4UAJA 4EDFA 4YUZA 5JJ5A 4HX5A 4F4HA 4E09A 3JRNA 2OECA 3LUCA 4DANA 1H4TA 2Q2WA 5CBPB 2PGJA 3CNQS 1P91A 4GM0A 4J29A 3QE9Y 3C8HA 3RSGA 3LCJA 3LY5A 5HDBB 1WOYA 4RSGA 3SKXA 1V71A 1VYHA 2H1SA 1CY8A 4QDKA 3HXQA 1DC8A 4F5DA 4ROTA 3MINA 1QH9A 1SELA 4OHXA 3HO8A 3HKDB 3IC5A 3K0AB 3C3BA 1YDWA 4IVRA 4KZKA 4CQMD 2AB0A 2FWMX 3QIVA 4DHEA 2WQ7A 1DC4A 2VKQA 1QO7A 5J4KA 2WU4A 2Z6AA 2AI2A 1NP7A 3ZYCA 2JGEA 1MJ5A 1NYTA 1W0JA 1WHTB 1YR8A 3DMTC 4FE3A 4HI0E 1QGOA 4OMDA 2WNIA 4AX4A 1YZYA 2Z8XA 4G5FA 4LJSA 4TTSA 4BB0A 3K9LA 1O5IA 2QUZA 3QVSA 4RF3A 4WESA 5JSHA 4MPRA 2Q50A 3I52A 4PICA 2CDRA 4PXYA 5KOHB 3Q9NA 4DTCA 2JNWA 1P0FA 2JGFA 4XJTA 5BNIA 3F6RA 2RK3A 1JLSA 4PVCA 4L0QA 4O63O 2UYYA 2IZ5A 3CW2A 1UXHA 3HMKA 5DMHA 3CZMA 2O8EB 1QV9A 3A2KA 1X9HA 1ZICA 5HG0A 3GLGE 4TUYB 2PKWA 3ABIA 4F2HA 3NHYA 4HB3A 2A2ZA 4AWAA 1H1DA 4I4LA 10MHA 1U5BA 3EUEA 1HE4A 3ETHA 2PX0A 3I92A 4MUXA 4PR3A 4EKNB 1FZTA 6PFKA 3ZS9A 2A0KA 1JA0A 1SXJB 2BFAA 4KX3A 3LL4A 4L02A 4AY3A 4TMYA 2C03A 1X1TA 4O02B 5LN1A 3SBEA 1KJZA 3L43A 1L7NA 3N8HA 4WN9A 5B6JA 3PIIA 3T34A 4BL5A 5B6PA 2RHDA 3G9TA 1FFGA 2I8LA 3OA0A 3PEYA 5GM2A 3TKLA 1VLLA 4IWXA 3I42A 4HVCA 1YVRA 1UK8A 2QN9A 2Y76A 3JALB 1GTG1 3C8MA 3F71A 1OA1A 3VNAA 4BKPA 5BYJA 1S5PA 1YS2X 4JBNA 1I2AA 4M76B 4DWOA 2FWAA 1CUFA 1TGVA 3FZYA 1T1EA 5TQ2A 2BFPA 3NP7A 5IK2A 4DLWA 3TBHA 2KB0A 2TMGA 1QCCA 4P3NA 4RLFA 1KMHA 1J2UA 4U7WA 5LMCA 5REQB 2W6JA 2DFKB 2GUGA 2YV3A 3MMXA 1A1VA 1Y1LA 4H7IA 2J6HA 4KLRA 3EXIB 4LZNA 3TQOA 1CNFA 3IV6A 2CXPA 1PL7A 2H1LA 2OCYC 3VHQA 5JW6A 5JVDA 4IUDS 4B40A 4TUYA 3LKBA 4JQYA 3CPSA 3PJDA 3EFEA 3A6LA 4EHAA 2O9JA 3OZSA 4O1MA 3H1AA 4G25A 1G2IA 1N4DA 3H3FA 4MI9A 1KL7A 1ZM4A 5AESA 3RK0A 2PBLA 3X2FA 5IPFA 4Q0MA 5FD8A 2RHTA 1MV5A 3P2YA 5D6NA 2WTAA 3FYUB 1ZCAA 2AFHB 3FZEA 3P1JA 2J85A 4YJHB 4C4RA 4HKTA 1U65A 2B4TO 2CV0A 2ZBGA 1F5NA 3OFVA 4RPKA 5DBGA 1WXXA 4LIPD 4F4CA 4CQNA 1L7EA 4H1WA 1ECBA 4JP1A 1OLSA 2D3WA 5TPWB 5ALZA 4YUAA 4M37A 3JALA 1OLOA 4CF6A 1SCDA 3PCXA 4EJSC 1RZ3A 1C3VA 4OIFA 4PLPA 4TLBA 2QB5A 5E95A 4B4WA 1CEQA 5KUTA 2HW8A 4L16A 4PQRA 2CVFA 1KMNA 1NW8A 4ON9A 3R6WA 3KUCA 5HKLA 2JCXA 4DDUA 3HA2A 1B0AA 3AJRA 2HLNA 2ZIZA 5CDTA 1L3IA 3DV9A 4RLQA 1V1RB 2FF7A 5REQA 4D8VA 4ZFNA 4PPYA 4QFDA 3UJ3X 1GARA 3LI2A 4F8EA 1IZYA 1K7CA 5EN4A 3H5AA 4DKJA 4O0MA 4IYRA 1V5WA 5I9MA 1UDAA 2OKCA 3PL1A 1K08A 2JA2A 2IC5A 3AHIA 1GWNA 4TX1A 5JSKA 3RSOA 1LLUA 3W9SA 4DLSA 1KI4A 4YQZA 3RQSA 3T52A 5EWJA 2OD2A 1DNPA 2AFHA 2G5PA 3DAGA 4HQ0A 4ILKA 1QHNA 4YJHA 4DPMA 2BGWA 2H4HA 3KJGA 2VFAA 4GXTA 4NARA 2QXYA 3LA6A 2FCRA 3GPLA 2D5AA 4M8KA 3S0JA 2YZ2A 2Z83A 4MDFA 3ER8A 3HEAA 1ZM7A 1EAYA 2IXFA 5TPWA 1LB1B 2HJ9A 3F4BA 2OC4A 1IOWA 2JFUA 1WM1A 3AC0A 4JVOA 3N8IA 4LZOA 3PYMA 4Q37A 4ZEOA 3WWYA 4FR2A 4J3FA 4W8OA 2JGIA 2Q8NA 2JI7A 3RRZA 2PH5A 4WNCA 1Z34A 2DQ4A 3PS9A 5DGXA 5E4TA 2G08A 2NG1A 2JFQA 3EVBA 4RNCA 3ZGOA 1E7SA 1RQXA 4HBGA 3LT2A 3PRJA 4YH1A 3FTCA 3DMTA 1V1RA 4MQ5A 1L1EA 3HCAA 3ILXA 1SU8A 4HH1A 5CBKA 2OFXA 1PEKE 4UJ3A 3ZW8A 4B4OA 2H7XA 3JTEA 4JXXA 3ZU5A 4ZC1A 5K8JB 3RAFC 2VF4X 3LG2A 1FFXA 1FRVA 4O2LA 1EAMA 2Z0MA 3OWXA 2SKCA 4IDDA 1PCXA 3I45A 3VZDA 1YR9A 2Z30A 3B5IA 4JAVC 4M9UA 2FSIA 5AI4A 3KR9A 2D5BA 2OQVA 2VL7A 3UJAA 1GLNA 2CXSA 1P1JA 1DB3A 1JQAA 2A92A 2QUKA 3LHFA 3DHYA 1EUDB 2YJ4A 2WSSD 5K0JA 1TUIA 4OVKA 3DO5A 4RKQA 4U2GA 4HNUA 6LDHA 1YAHA 2GERA 3TOXA 1KGSA 4J8PA 2DRIA 1QVZA 4UOZA 4KI0A 3KP1A 1D4AA 2PZMA 1CULC 1ZK2A 5HGXA 4HAZA 4X84A 4DJFC 1ST3A 5DM1A 3HYRA 3BJRA 3CF2A 3BK1A 1NRIA 4TRMA 5CR9A 3NMUF 2O57A 1XYVA 3ZE0B 4R7ZA 3AJ8A 4S3MA 1W96A 3C8ZA 5K3OA 3Q15C 4KV7A 4K8RB 2WM8A 1D6SA 1NVVQ 1N1MA 4XLZA 1HG1A 1O6ZA 4FLEA 4CE6A 2PT5A 1GFZA 1E5LA 2FKNA 2GK7A 1RHRA 2PY6A 3K0KA 2GN8A 1UPCA 4G5HA 3DOJA 1ZGBA 3ZLVA 4C7XA 1SCJA 3ACCA 1ZCJA 1BXGB 2ZWVA 1V8FA 3KQWA 1L5OA 3WNQA 2KM1A 2PRKA 3CTPA 3GL9A 1ZMOA 1P39A 1K8QA 2ZRMA 4FGZA 3ZNOA 3U6BA 4D4LA 1U1FA 5IAKA 1FFEA 1G8GA 3CUUA 4D81A 3SZMA 5KB3A 1U7PA 5LWHA 3ROFA 3GLGA 4O4HB 3PUJA 3EBOA 4DLNA 1O8CA 4A7PA 3R7LA 1EUDA 4IZ6A 2SICE 3LQ2A 2EWWA 4YUYA 4ER0A 2P41A 1W93A 2ZT7A 2HBQA 3BFJA 3QPWA 4RA6A 3EYAA 5P8WA 4LRTB 2V97A 1PR2A 3AUAA 4NOLA 5B58T 2DY0A 4X8OA 1L5YA 3PQEA 3I2IA 1QHEA 1E2MA 4W5WA 3GA0A 3ZKWB 1RM3A 1D6MA 2VVTA 1E9EA 2XGOA 2YCLA 3NV7A 4IX1A 3UICA 3V8RA 1UZUA 4M1ZA 4ZCMA 5EI5A 4ZVTA 3OJXA 9ABPA 5L4NA 3F5SA 5K8LA 3WMFA 1C81A 2IXAA 3ONNA 1R74A 1OE0A 4Q02A 1TKBA 2ZJ5A 1KYQA 4NC9A 1SBYA 3ETDA 3BFPA 1QLWA 1SGWA 4FFLA 3Q0EA 5DCWA 1Q17A 3V1NA 5I3ZA 1L5RA 2MYPA 5C1PA 4OLFA 4LI0A 3TYXA 3HJTA 4JT9A 4DIUA 1K9VF 4EJSA 1W49A 5IJAA 4KYIB 1KIAA 1DKRA 1ZK1A 3TLGA 1ZSNA 2Z3WA 3AOGA 2O19A 3QHQA 1XTIA 2N46A 3EXHC 2DTEA 3LCRA 4FW9A 3LUHA 4M0LA 5KNCH 3QUCA 1RP1A 4KQXA 3WLFA 4GM4A 4RQUA 1F60A 4M8SA 5K0GA 1RU3A 3NR2A 4PAGA 1W19A 3A9CA 3UMVA 1OXXK 1YSCA 4FOPA 5AJWA 1PJBA 2OBFA 3OCZA 4LHSA 1NUQA 5AVSA 1VG1A 5K51A 2FEOA 3IAEA 1XMSA 4H1VA 5A7HA 1FYDA 3NKVA 1D4FA 1WSBA 1HQYE 3BSSA 3KQTA 3KQSA 4YRSA 4LF5B 2EATA 4OM7A 3A28A 2QX8A 2IZ6A 3JAMA 1AS2A 2KSQA 2W9XA 5T3UA 3PXEA 1JAZA 3T7CA 1SBIA 3OZWA 3SC3A 4QYIB 1JT9A 3K31A 2H59A 4H7FA 3K71B 3E4CA 3WGMA 4BFUA 4CLRB 1R5BA 1TKCA 2QJFA 3UKDA 5CNIA 3FROA 3VHLB 1I32A 2I76A 2ZLBA 3CEPB 2P2LA 4MGYR 4LHWA 4EARA 4BNMA 5IAEA 5JI3E 4YCNA 4D26A 2J9ZB 4R2XA 4ZI7F 2XH8A 3GLQA 4PLYA 1F0PA 5JCJA 3HU2A 1EUCB 4JC5A 3BSWA 3PQ4A 3I4LA 4DMLA 4EB0A 3U4QA 5DTRA 2FP4B 3OZUA 1N5DA 1DBQA 4ZYZA 4DJAA 5HGJA 4EY5A 2GI4A 4IJ6A 1PWHA 3ZK7A 3U1TA 1ZVQA 4HZGA 3DEFA 2FPSA 3C1UA 3BA6A 3L1UA 2FR0A 2O3TA 4K1LA 4MRSA 3CSSA 4BVHA 5CA1B 4RULA 1LK7A 1Y9JA 1GHTA 1WDWB 4QJIA 3TQCA 1UWLA 3QXSA 2I78A 5H68A 4E51A 4MW4A 3DVAA 2HDOA 4AICA 3PQ8A 4GPIB 1KBQA 1PK7A 1X8LA 4FS8A 5A5EA 3LM8A 2FFBA 5MGNA 1RYNA 4HXYA 5CLIA 4AP9A 1RNLA 2RGDA 3OEED 5BQ5A 5MN5A 5D5HA 621PA 1ESEA 1TUGA 4EQ6A 1QKIA 3GV0A 2H4FA 4I55F 3OE1A 2OBLA 3FG9A 4CLRA 3EJ6A 4L08A 4TRNA 4ARIA 2Q4EA 4H3SA 2GBPA 3I09A 4UAGA 3FFWA 3TVDA 3LXRA 4JUBA 4LYFA 3DW1X 3HNRA 4CKBB 1VDZA 1L4YA 3B20A 1USUA 2NO0A 4RF5A 3SLRA 5LBTA 5BSMA 4CM5A 4DBZA 1MPXA 1IBMB 3WMGA 1EUCA 2NZVG 1DARA 2FP4A 1PP4A 4LJ9A 3BN3A 3CKMA 4OSEA 1LW7A 4B5KA 5ALYA 4DNQA 1J0BA 2C83A 1RWOA 2PH7A 4O4JF 4RFLA 1IAQA 4F46A 4EX7A 1DAPA 1T35A 1TKRA 4P3PA 5CA1A 2PH3A 3B1JA 3IV7A 2UAGA 4PY2A 5CJ2A 4B33A 2JFOA 5B1EA 3KQQA 1FTQA 2I8AA 1FMTA 1ZWLA 4E5MA 1KO4A 4E14A 4JI5B 4YO8A 2GCPA 4X3OA 3IUYA 3IELA 2Q3FA 3RWOA 3KPJA 2PKXA 4N7JA 3GFQA 3WRYC 4CYMA 2ZI5A 1CR2A 2QW0X 2BEKA 3ZIUA 1X87A 4V0QA 3SYLA 2BKEA 3SE7A 5FBWB 3KD2A 5DP1A 2EIXA 2JHCA 4O25A 3U17A 5A4KA 1JAIA 1YFZA 2G4VA 2CMFA 4FEAA 5B3JC 3E8XA 4TTAA 3RC7A 2MR5A 2Z2YA 2QN1A 4P31A 2YVQA 4QJ4A 4BNZA 3PQFA 1R8XA 4D97A 3ZG6A 3WLRA 2AMVA 2R84A 3G02A 2F67A 1AGRA 2A5LA 2HLDA 2Q4DA 2WPNA 2ZROA 1R9MA 3ASVA 1Y89A 1OI3A 4G07A 4OHBA 1HDZA 4I36A 1UBOS 2ANCA 4LDPA 5BVGA 2P6RA 1ENYA 3ZUPA 1F5SA 1PWXA 4OFZA 4WFJA 4UQPA 3GGSA 1V45E 1TU3A 2XGGA 2XW6A 3HGTA 3LS2A 3CNHA 4QGFA 4BNDB 4FT2A 1OBOA 1U6JA 1QAOA 5LLTA 1QZ3A 3NDIA 4FYJA 1MABB 4D9KA 1N6HA 3CYFA 2NZ8A 2EKBA 3P45A 1DIBA 4Q3DA 5G0WA 3WB1A 2NU6B 3LF2A 3A7DA 5JPCA 1QM5A 1UOQA 1XD2B 2PIDA 3EXHA 4TKZA 4MLDA 5BWLA 3FM9A 2HUPA 4EB8A 3CNBA 1W5BA 2XBMA 1SXGA 4DMRA 5HM6A 1SVKA 3KXDA 2AI3A 3FCXA 3ZWYA 2GF0A 3V1YA 4EYKA 2XMGA 4EPRA 3HRIA 1US8B 1V0JA 4X20B 3HKCA 2JCGA 4LDQA 4Q3LA 2TS1A 4GYKA 4M1EA 3KBOA 3VR4H 1Q91A 2Z08A 3W05A 1YQEA 1XZPA 4AUMA 4AO7A 1GPBA 4XR9A 1R6TA 1P33A 1QG0A 1E0AA 3R76A 3SF8B 3PRKE 1YACA 4BGUA 1XL1A 1GP2A 1Y8AA 4QFCA 4XH9B 4OAQA 1U2SA 1UBRS 3GEPA 1JILA 3KNZA 5B55A 4OY3A 2CEKA 3WQBA 3L1VA 1KYVA 1NLYA 1RRMA 4IIHA 2VRBA 3VPXA 3R0ZA 4KRXA 1E7WA 4BUCA 2V5VA 1TVKB 4MS1B 2BBSA 4EQZA 3KTOA 1D9XA 4I1VA 4GR4A 1RVV1 1W46A 4RKEA 1U2PA 1E9DA 2WAMA 4NOKA 2ID9A 2KE5A 4MJXA 4CKXA 1DBIA 4O2AA 2QAIA 2VUSA 2BKAA 3F90A 4QUKA 1RRVA 4AG5A 4BO3A 3AY0A 4U0KA 3CO0S 3TW8B 5KSWB 1D07A 3SZOA 4C06A 5DNDA 3BDVA 1FL9A 4WSOA 3QTTA 4LXUA 1KZ9A 3INGA 4C2BA 4LE2A 3TM5A 4IQ0A 4Z4GA 1QMGA 2JRLA 1UC8A 1B8VA 3F78A 3LDAA 1JI3A 4YCCA 1M1UA 2PT9A 3HK2A 3RF7A 5FPYA 2XT9A 3UAOA 2I80A 4KWTA 1NKSA 3WY9A 1H9CA 4WN3A 1XAIA 3R8FA 1L5FA 2ZT6A 4AUNA 5ADWA 2FW9A 4YCJA 4LHVA 2QRVB 4PE5B 3SF8A 5KQSA 3L8YA 4ZHQA 3CBGA 1XX6A 2CC2A 1G8HA 1KJ9A 2ZIUB 1Z88A 3V7UA 3AIOA 3CRZA 1GN8A 3H04A 2V1UA 1FJGB 1FU8A 2I7DA 3JQ7B 4MS1A 4FGKA 3R2JA 5GJVC 1MRZA 1XLTC 1YC5A 4QDTA 2J3JA 1P31A 2TYSB 4U8GA 3E9CA 2BY4A 3GPBA 4JEHA 4OI0A 1HLPA 2JIZA 1GSIA 2XCOA 4QPPA 3RRBA 5JARA 3L7NA 1J8MF 5KEIA 1KJJA 4C0XA 3O0DA 3EGXB 3KAQA 2BP7B 1H6CA 1Y7HA 1PLKA 2M32A 3BRQA 4U63A 3TTUA 3QJGA 4YEDA 1E6WA 2FR8C 3JQBC 1P6XA 5CJJA 5IT4A 1QS0B 2WT4A 3AF0A 3RYHB 1WZCA 4PSVA 1E4EB 2Q3MA 4BAZA 4EKIA 4KTVE 5FNZA 2BTQB 7MDHA 1YDEA 4WACA 4UTPA 5CDYA 1AO3A 1UM9A 3VO1A 1UDRA 2XBLA 2V98A 4UDYX 3M1YA 2NXNA 4P7JA 3TQFA 4A8PA 1PFQA 3NZEA 2BFEB 4AK9A 5BN4B 4LYAA 1TW3A 3GA5A 1R0BA 3H18A 3KSRA 4E2ZA 1R66A 2VT2A 3GVXA 1GKYA 2ZE6A 4EI7A 1V3UA 2V7XA 2Y6UA 4FFSA 2NV0A 2MOKA 3ZVMA 1DTSA 1QHYA 2QD3A 2GWRA 1TZJA 2AE1A 4LSWA 2RIPA 3M33A 4F21A 2J46A 1YFJA 4X66B 2J48A 3WGLA 3AG5A 3MYRA 2NZYA 1XA4A 1JGTA 1J9EA 3DGEC 4J0GA 3M9LA 4P4UA 1YVPA 1W5AA 4ZQHA 2ZVPX 2P27A 4MQBA 1S3FA 3CURA 2JGDB 2HPVA 3IODA 3GJ6A 2O8NA 2VH5R 3PNSA 3I1IA 4BNNA 4O2BB 3HDYA 4A9AA 3EGXA 2YMPA 1U90A 5EKXA 4KVZA 3OO1A 2NSHA 4TMVA 1R0XA 1II8B 3FOFC 5LL6P 3FCCA 1Q2XA 1WG8A 3LXXA 5CFOA 3HY4A 3N1UA 4AO8A 3R5JA 1Q15A 1H93A 3O4FA 2QTCA 4MW9A 3I72A 3QWBA 3GZ4A 4W1SA 1YOVB 2G72A 4LXQA 4US2R 2P68A 3E9MA 5DGTA 1ENZA 1W0CA 9ATCA 2BMWA 2F8LA 1E9RA 2BFEA 2A3NA 5CH5A 4WLUA 3SQLA 3EPLA 2QBYA 3HS3A 3PKJA 4MS4A 3KUKA 2A94A 4P4NA 1PVDA 1RI4A 2M6KA 3W77A 5HVNA 3L8DA 2Y0EA 2VRNA 3QUSA 1GUYA 3MUFA 4QU0A 4WKBA 4DVGA 3SU8A 2B82A 3HR7A 1NMSA 1XCOA 2IXGA 3MWKA 3QYPA 1OXUA 2ZZNA 4KDEA 3KUXA 3H42B 1O0CA 3B38A 1RRGA 1TM7E 2YY7A 3O91A 4HAYA 3ZR4B 3A3OA 3GJ0A 1DC5A 2R2AA 4HK4A 4BNUA 3DO6A 1Z4KA 4JQZA 2CLMB 5K7SA 3U9LA 1FYEA 3BH7A 3FOAA 5F2OA 3A1UA 3WDMA 3OHPA 1II8A 2RHHA 2X9NA 1SVOA 4R2JA 5JZVA 3MIIA 1B73A 2I2AA 3FUUA 4ZEWA 2PMBA 2O52A 1YA4A 1XCJA 2W6ID 3QU5A 1RZVA 4RCYA 3VGJA 3HHEA 4OLAA 2I2CA 2WF6A 3MCVA 5HOEA 4J4BA 2VDMB 2BPOA 3O8OB 1G4AE 4IUBS 4Y8VA 1NZFA 4XZ3A 1B14A 5A6VA 1BKYA 2XB4A 5E1OA 3BREA 3URMA 3ZLTA 2GBGA 4CR7A 2ZSHA 1KRXA 1DDGA 1XMJA 2XVXA 1PV4A 1U1CA 2FPXA 4B35A 3DAOA 4YAGA 1IZ9A 4JP5A 3P4UA 3VJRA 5AKGA 4BNVA 2C59A 3U3RA 3CEHA 1S0UA 3MVEA 4HEQA 2B1JA 3S8MA 5HJ5A 1HDOA 3DVRX 3EODA 4FX2A 4NBWA 2X8WA 3G0HA 1GGNA 3AB8A 3BB1A 4GICA 3LHKA 3EIQA 2C7QA 1MA0A 1NT4A 3WBJA 2RBGA 2XB8A 2VP3A 4WD3A 3D6HA 3OO0A 4LRYA 4XM1A 1R8YA 2VJYA 2YWDA 4Q7QA 1MRNA 1Z2NX 4TRJA 4DUYB 3J7TA 2OFWA 4FZVA 1NSYA 1KSGA 4DM4A 1J2RA 1NLZA 1XLTA 2NVWA 4QEDA 4ND4A 3OOSA 5AW9A 1J09A 3CKLA 2KPOA 4LE0A 4F0JA 2RSLA 2BEUB 3ED1A 3N8DA 4RS3A 3A11A 1YE3A 3N75A 3ESBA 4H7KA 2YN4A 3ECCA 4KLAA 2OHOA 1G9TA 2R25B 2QTFA 3A1VA 4MQLA 1IBKB 4EZBA 3ZEAA 1U8ZA 1WNTA 2VZEA 3K8ZA 2VAVA 3FZGA 3TSCA 4BWYA 1E5VA 2FR8A 3JQBA 3NPAA 1YIOA 3A6DA 4OI2A 1E8MA 1Q1BA 3D8SA 4TT3D 3GLFB 3PGJA 4MUKA 3KQHA 4NJMB 3BJEA 4TYPA 1T4BA 1V43A 1KZGB 4IHJB 3Q72A 2IYNA 1J24A 5DO9A 3EZNA 3CCFA 1BA2A 2J67A 2JLAA 3N2LA 1FS4A 5IC6A 3TDKA 4LV5B 1TEXA 3LUKA 5JBNA 1BQEA 1M6WA 2V0NA 2P2ZA 3II6X 3NTQA 4BFVA 1GYQA 2XNDA 3Q98A 1J20A 4KN6A 5DEOA 1CETA 3RVBA 3RVPA 1UKAA 2GYUA 2J5RA 2IELA 3G23A 4HMQA 4J91A 4MKRA 5AHXA 4G84A 1FNDA 2IF0A 1HDXA 2PUJA 2ZSJA 2LCIA 2NQ2C 3OT4A 4FKMA 3GGCA 1YHZA 1M2FA 1P62B 3Q10A 5ANRB 5CM2Z 2OQRA 3RYCA 3O31A 2NP6A 4X63A 1DHTA 2G6BA 5GONA 3FN4A 3F47A 2AVNA 1CRQA 2H92A 3H4TA 4OB7A 4W5JA 5DPMA 2W2KB 4FJ0A 1IBRA 1ZUHA 2CHFA 2PGNA 2PQMA 3ICOA 1FSSA 1G60A 3AINA 2D1RA 3L8MA 4MIOA 3GA7A 2JLSA 4BX0A 3GMIA 4JA2A 1W9MA 4RD0A 5ALLA 1KOJA 3CIFA 4JD5A 2G71A 4NJMA 2QT0A 4NBNA 5BR1A 5MF6A 2LV8A 3L0YA 2XTZA 1QZXA 2VZ0A 4IL5A 2J3DA 4IHJA 4BXOB 2DSTA 3AR3A 3BBLA 3QVMA 5K3AA 4C4XA 5FTLA 1YZTA 2LIPA 3FWHA 3IVXA 1JIJA 2O8FB 1C14A 2EJWA 1Q14A 2X41A 1LZLA 3AEUB 5ALRA 1Z6XA 5JNUA 5JZSA 3V97A 1EEHA 3OAAD 4MUAA 4TPKA 4Y9TA 1E59A 3ICEA 3ENZA 5G1