2Q21A

Crystal structures at 2.2 angstroms resolution of the catalytic domains of normal ras protein and an oncogenic mutant complexed with gsp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
171
structure length
171
Chain Sequence
b'MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-H-RAS P21 PROTEIN CATALYTIC DOMAIN
molecule tags Oncogene protein
source organism Homo sapiens
publication title Crystal structures at 2.2 A resolution of the catalytic domains of normal ras protein and an oncogenic mutant complexed with GDP.
pubmed doi rcsb
total genus 63
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 1991-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2q21A00
5IHPA 1AK2A 2ZXUA 2A5FA 4KLNA 2EFEB 2QBYA 3BAFA 1LF5A 5DO9A 2JDIA 5BN3A 5DYIA 1WP9A 5DE3A 4RD2A 2AXNA 5HKKD 2LWIA 1S3SA 2CCGA 4ZDJA 2IYLD 1I4TD 3C5HA 4Z54A 3U3OA 1E4YA 1N6OA 2PEZA 2B8TA 3B1VA 1HE8B 3VKWA 3Q5DA 4BFXA 3RABA 2CHQA 2EFCB 1KGDA 1FTNA 3U44A 4YMSA 2G88A 2RGGA 2WSSA 2J59A 4JJKA 3HYRA 4ILEA 2O0HA 3TW4A 1E32A 5JWOA 1GDDA 3S1AA 1KKMA 4D0GA 1W4RA 2CL6X 4DLRA 1OH7A 1KDTA 4KFTA 3R8CA 1FX0B 5EJEA 4R71A 3KKNA 3FKQA 2C99A 2VH5R 1RRGA 2QAGA 4RD1A 4AYTA 3H84A 2REOA 2MSDB 3DEFA 3BWDD 1E2KA 2C03A 3LLMA 4W9MC 1N6NA 3U7HB 2ZYTX 1G19A 4P31A 4XVRA 1BKDR 3ND8A 3SFZA 3GFPA 2VSXA 3N2IA 1XZQA 4Q02A 3B78A 4C0JA 4HYYA 5C46F 5JZVA 3CM0A 2OCBA 2PZEA 4ZIRA 1NN5A 3A1WA 2WJHA 3CBQA 2IK8A 5FTNA 3M4YA 3RNLA 4AYWA 5JHGB 2F55A 2HCJB 3PUVA 1CJUC 3KQLA 2N42A 3KQNA 3GLHA 5L8VA 2DFTA 3WRXC 4I99A 1NVVQ 1Z6YA 4M0LA 4MYTA 4Q4LA 5EUMA 2JEOA 2W6IA 2D74A 4B3DA 3CR7A 4LBYA 3ZIAD 1F2TA 1E9EA 1WCV1 1FZQA 4RD6A 4TQUS 1BYIA 4Z1MA 1TX4B 1EGAA 5JBQA 4LYAA 4MDEA 3FDIA 3N70A 5K8UA 5ANRB 2BMDA 3GJ5A 1X6VA 2QQEA 3FMPB 4NCKA 5AWFC 5HE8A 3VQTA 2V1UA 2B6HA 5JJIA 5HPYB 1M2OB 4TTPA 3KXKA 2WOOA 4FW9A 5JEEA 4DB2A 4RZXA 4IDHA 1QG2A 2H8KA 3N5CA 4C0KA 2Z43A 1R0WA 3SN6A 1KSFX 3DHWC 3K9HA 4A0GA 2VPPA 2WSSD 2VHUA 2D7DA 1GP2A 4JKIA 1T6NA 3X1WA 1UEJA 2QT1A 1W0JA 3L82B 4FXPA 3UG6A 3EIHA 3TUJC 4GP7A 4LHVA 2FV8A 2P5TB 1WBDA 3K0EA 2PX0A 3FMFA 4CEIA 4M53A 4FN5A 2FSHA 1IOZA 4WW0A 4YDHB 2ZRMA 2PCLA 1JPNA 1S1MA 3HU3A 4WZ6A 1U81A 2VP6A 2QENA 2FFAA 2NO1A 3WY9A 4ABYA 5KHOC 5EXPA 4AURA 3QKRB 1VDZA 3CLVA 4FWIB 3W9YA 5G41A 1OXTA 4MH0R 4HI0E 2GNOA 3UG7A 2RGBA 1AS0A 3QI2A 1HTWA 1S1CA 3H2YA 3GJ6A 2CJWA 3K09C 2HLDD 1H8HD 4D80A 2CJWB 4A2QA 1XMIA 1U0LA 2O0KA 2RGCA 4HZIA 5CIWA 4DSNA 4QBFA 2QRNA 3U4QA 1AS3A 2AHOA 2CL0X 3PIRA 4EPVA 1RRCA 4AG6A 3KQUA 4TZ0A 2AL7A 2WPDD 4BPBA 4GSYA 1N2CE 3K9LA 3RANA 3E1SA 3WHKA 3VR5A 3B60A 1U8AA 3ZZUA 2F7SA 3FGNA 4CEIB 3RWMB 3U3KA 4BQSA 4D25A 4JBXA 2Q9CA 1ZC3A 2WWHA 2G9NA 3BE4A 1ESMA 2WWIA 1JQJC 4BEBA 3L8YA 2HYIC 4DCVA 3GD7A 2HF8A 3KTAA 2AWNA 5FOTA 3T1TA 2PZGA 1AA9A 3THOA 1GTVA 3CNLA 1PV4A 3W5JA 1NLYA 1ZYUA 3AP2A 2ZROA 3D6TB 3U61B 2JIZA 3PITA 4DEYA 121PA 3ADCA 4L9WA 3M1IA 1U9IA 4LHXA 4NH0A 5AJWA 2NTYC 1SZPA 5C4MA 3LQQA 4LV8B 1FQJA 2BDTA 2RH5A 2J1LA 2IA5A 2PCJA 2ZE5A 2GCOB 1XWIA 4I1SA 3IGFA 4QKQA 3MCAA 1NI3A 1XJ0A 4HUTA 2C9YA 4AG5A 4QJ4A 4BFYA 2X19A 1IQPA 4FMCF 2ATXA 1OFIA 1DO0A 4X8OA 1DOAA 2ZRJA 4ACBA 3LLUA 3TK1A 2VTKA 1OH8A 3RYTC 4TQ9A 2ZR9A 3QVUA 1I2MA 1TF7A 2ZJ8A 4JLKA 4EJSA 4UXHA 2QTVB 4D0LB 3ADBA 2IEYA 1JXOA 2CBZA 1OFUX 2R6CA 5GVSA 5KNCA 1YR7A 2F6RA 4JLNA 2GBLC 2LKCA 4TYQA 5TVKA 2NPFA 5FH9A 1TU4A 4DZZA 4ZCMA 1VG9B 1D2MA 1KZ7B 1E96A 1FW6A 2QZ4A 2IS2A 4JBYA 3FKSD 5FL3A 1EFHA 4B3CA 2WAXA 3AF0A 3GQBA 3VR2A 3KXIA 2GZAA 3DDCA 3EA0A 4V0NA 2IW3A 1NP6A 4A2WA 1TQ4A 1VCIA 2IXFA 3X1YA 2VP0A 4NMMA 1S4QA 3AUYA 3QKUA 4IVPA 2P3SA 3VR1A 3VX3A 1GILA 3CPEA 4JKYA 4B73A 3F8TA 1E0SA 1E9DA 1S2MA 1VCNA 3SBDA 1L2TA 1M6NA 3R20A 4RZ2A 1KO5A 4M9SA 4MYUA 3U7GA 1D9ZA 4OHXA 2WWYA 1ZUHA 3NG1A 4MRSA 4WOPA 4EJSB 1YZUA 4BE7B 3NC0C 1ZJ6A 1QRAA 1M7HA 1W47A 4HDQB 1NMXA 4XJXA 1G7SA 2CLSA 4LJYA 3GJ8A 1KHTA 3LQRA 3QKTA 4F92B 5L3SB 3L43A 1Z0FA 1F2TB 1LVGA 1D2EA 4D6PA 1SHKA 5F98A 4IDPA 3GLIE 4EFMA 1CR0A 3Q72A 4PC1A 4PSKA 2UZIR 4WIAA 1EX6A 3TQCA 3LY5A 1E2GA 2PLRA 1FL9A 2A2ZA 5JSZA 1HH4A 1UKZA 1F6BA 4JT2A 1COWD 3AF3A 4IOKA 2ATVA 4P0TA 2GA8A 1ZC4A 3P4XA 4C7OA 2GVDC 2NGRA 1YZNA 1SKQA 2ZVPX 1KI1A 2FFBA 3R9IA 1PZNA 2EWWA 5CB8A 3CPJB 1DE0A 2UKDA 5DNYB 2R9VA 1VPLA 5K8LA 1Y3AA 3L0PA 3IEVA 4ITRC 2WM9B 2OAP1 3BC1A 5DH9A 2FFHA 4W5HA 1E0AA 1NRJB 1RZ3A 1CP2A 1OF1A 2REXB 3HPRA 1Z0JA 2OZEA 1G64A 3I4LA 2ANCA 2BJVA 1E2IA 1EWRA 1FPMA 1G8GA 1UBEA 2JDID 2V7QD 3C15C 4L16A 4A2PA 3A1UA 3VTKA 4ARZA 4B2LA 3LW7A 5BN4A 2WTUA 2D3WA 5E7IA 3C7KA 4E22A 1RVDA 2XSZD 5HKKA 1CR2A 1L8QA 2F9MA 1P60A 2J7PA 3UKDA 2GCNA 3KKOA 2WIAA 3QENA 3AQ4A 2BMEA 2B7BA 1FTSA 1KAOA 3ASYA 5C18A 3QXJA 3VHLB 3LBNA 4U00A 4PAOA 3PR1A 3W3AA 1HY3A 1NMYA 3PUXA 1TADA 3KTAB 4PXAA 1M7GA 1VMAA 4A9AA 2O8CB 2W6JD 4DDVA 1P7CA 3BOSA 4D2IA 2ODNA 4C0SA 3TR0A 5JS7A 3FB4A 4B48A 4HB2A 1DAHA 3SDZA 5EUQB 4CDGA 3SEAA 2P5SA 3IPYA 4YONB 3BJIC 4NTZA 1G4AE 1MABA 2FZLA 2PMKA 1OT3A 3FHOA 2R65A 5FR2A 3THXB 3O8DA 3SU8A 1P6XA 5IT5A 3I62A 3LDAA 2BJWA 2ZI3A 3O47A 1PLKA 1TAGA 2QSZA 3QXCA 2IXGA 4LC0A 2WBLC 3RSOA 1ZCBA 4Y0AA 4OHZA 3UK6A 1CXZA 3VU9A 1F2UB 1LB1B 2IWHA 4YC7A 5J4KA 2IYRA 3NWJA 4EPXA 4F7WA 4UJ5A 4XWOA 4US2R 2VF8A 3UWOA 2ZANA 2ZE6A 2NZ8A 4AIIA 2W0SA 1W46A 2K5UA 1ZM3A 4OBEA 1ODFA 3WMGA 4B35A 4CRWB 1T3HA 1Q1BA 1QHNA 4ZKDA 1LS6A 4MITA 4PQYA 2QQ0A 2RKOA 3TKLA 1JR6A 4DCSA 1XXHA 2AFIE 3A4MA 5DIFA 4V02A 3GLFE 2XNDD 4LDJA 4KXFB 3ZLJA 1MKYA 4LI0A 5JJLA 2J41A 3I8SA 2OCAA 2GF9A 2NIPA 4LJ6A 4HB4A 4FMDB 3TQFA 5FTKA 3V4RA 3MAAC 5KSOA 1E9CA 3P26A 2ZIAA 4MKFA 1QHYA 1FMJA 4N3NA 4KITB 2GETA 2HXYA 3DL0A 3THYA 4CVNA 3NDPA 4ASUA 4AKIA 4DHEA 1F60A 2IHYA 3IDQA 3Q8XB 4LJ8A 1AKYA 3QXXA 4D4JA 2GEDA 3KFXA 4DB4A 4Q9LA 4LSGA 3FHTA 2IYUA 1G17A 2QMHA 4JSTA 1Y63A 1HA3A 3SZRA 1T5IA 2C8VA 1NMZA 1ETUA 1ANKA 4RCZA 1ZM2A 1OB2A 4K46A 5TARA 2BEJA 4Q03A 4L15A 4G1UC 4GZLA 3QOFA 2NO9A 1W0JD 1W4AA 3RC3A 1G8PA 1R0XA 2R62A 5SZKB 3CONA 4C7OB 1DAKA 1DAMA 1U8ZA 2GJKA 5JWRA 2CVFA 4B34A 3FMIA 3QE0A 1E2JA 1H8ED 4LBWA 4OK3A 1RPZA 3ZS8A 3IO5A 1E9AA 1YE8A 2D7CA 1CU1A 1Q20A 3GMTA 3LBIA 3AVXA 1KO7A 1E2LA 3WBKA 2XNDA 3KKQA 3H4MA 4DLXA 1GL9B 4KVGA 3WYAA 1KDRA 2MMGA 1HE1C 2AN9A 4TYNA 2VQSA 8OHMA 1YR6A 2GCOA 721PA 4XOIA 4Z8YA 1XD9A 1NKSA 2QT0A 4QXAA 4WVFA 2QROA 1G4UR 1SGWA 3K0AA 4LCBA 5GVRA 2BMFA 5FUWA 3KX2A 2GF0A 2J0SA 5FOUA 3B6EA 2NQ2C 4Q48A 1SXJC 4NP6A 1YZQA 1G7TA 4TSFD 5DSZA 5FI0B 1CBUA 4B44A 1RKBA 1ZU4A 2CMKA 4JLAA 3CZQA 4GZMA 5CDFA 4IDQA 2ZSBA 3EC2A 4JVLA 1J7KA 2D62A 2ZE8A 4AWXA 3QF7A 4IW3B 1XEFA 3UIEA 2D2EA 3FPAA 4NCHA 3WMEA 4X8HA 3K1JA 4HDCA 3QEOA 1MV5A 2J87A 1R5NA 4IOJA 4MQBA 2Q3FA 3WP0A 5IK2A 3U60B 4O2LA 1W0KD 1T3LA 1IN5A 2JIZD 5KUTA 2WICA 5DHFA 1F3OA 1G7RA 5C2JB 3LH5A 1MABB 3AB3A 2DY1A 2QTFA 3Q7QA 4LPKA 4LV5B 3H0KA 4I81A 5DN6A 5KDOA 4DLZA 1CTQA 4LWZA 2F1RA 1Z0IA 2OCPA 4I1VA 1F5NA 1UFQA 3BIFA 4FCVA 1D5CA 5P21A 5DI3B 3IQXA 2O52A 1P2UA 3ZZTA 5DLQC 5DI3A 1Z0DA 1I4DD 4RJLA 1E0KA 1IXRC 4O0MA 5HTKA 3QF4A 4V0OA 2OHFA 4NYMQ 1K8RA 5AJVB 1EFTA 2FEMA 4OJQA 4JYCA 4B75A 4BFVA 2PJRA 1NIJA 2OFOA 2ZU0C 2RGAA 1KO1A 4EPRA 3GFTA 2QEQA 1DAFA 3FTQA 3ZVLA 3TSZA 3LX5A 3PUWA 2EWVA 1UBFA 1KO4A 2AD1A 4I1UA 2JLUA 2JAQA 2DWPA 1OSNA 1JR3E 1XMJA 1ONBA 5EZ5A 5EP4A 3W90A 2GXSA 3LX8A 3AVWA 1P2VA 2WWWA 3IEUA 2C2HA 3AKCA 1J70A 3LA6A 4LK2A 3GJ3A 4Q4JB 1MO3A 4JLPA 4A82A 1GWNA 3BXZA 1ZIPA 1MOZA 3THYB 3MSXA 3OEED 1VG0B 2Q9BA 5CJ2A 5DN6D 3CH5A 4NDZA 3RS4A 3X1XA 4KFRA 5FTLA 5FR1A 1FQKA 5G40A 3SJAA 4IXNA 4CZ2A 1JAHA 3BH6A 4HAWA 1ESNA 2H16A 5BW8A 5D3MA 2XITA 1Q12A 4V0KA 1SVMA 4ON9A 2KBFA 4DIDA 3PG5A 4P32A 1UF9A 1G3IA 1VIAA 4EPTA 2AD5A 4CGZA 2KI5A 2ODEA 3AF1A 3MJRA 4PR0A 5FUYA 2ZSEA 2N1BA 2BCJQ 5FPTA 1KJYA 1XPRA 2OESA 5C4GB 1XCGB 2BM0A 4YDSA 2XXAA 1P2TA 1Z22A 1G8YA 2AKAB 4OL0A 1Q44A 4HLDA 3RS3A 5JSZB 4NYJR 4Q4JA 3AGQA 2ZUDA 5JECA 4NYJQ 3SC3A 1LW7A 3ETLA 5CLLA 1R7RA 5G3YA 2JLYA 2QBYB 2OXCA 2E1RA 2QMOA 4QGAA 3PEWA 3I61A 1GVNB 4GRAA 5IDVA 4G5GA 3GLGE 3U4QB 1L7VC 4KBGA 3TVTA 3U3MA 1OXXK 4EQ6B 2GWHA 1EX7A 4P4UA 2FGKA 1ZW6A 4JLVA 3K53A 2WOJA 2QAGC 4FMCB 2HT6A 5EE5B 2DYKA 3OZXA 3QQ5A 5EE3A 2MMCA 4JLDA 5J40A 2QE7A 2YWHA 3AVVA 1W4BA 4NKRA 4Q7MB 1GKUB 1DELA 2CVHA 2YNMA 2IYYA 4QHYA 4B6FA 4IVQA 2P65A 5FTJA 4MKHA 1G7CA 3B82A 1ZNWA 4IDNA 2Z6VA 4B3XA 4B2IA 4BWYA 1PUIA 3CR8A 3GP8A 4YQFA 3NXSA 5B2ZA 2F3RA 3CF0A 2NO0A 1NN3A 2JJ2A 5JCPA 3NKVA 4B2PA 3FE2A 4M1KA 3AVUA 1CEEA 1O87A 2OFXA 1SVIA 2C77A 3AVYA 3HWSA 2FH5B 2CCKA 4PC6A 5EP1A 5FL7A 1KI9A 2FOLA 2ZJBA 3LO5A 3OAAA 4DLVA 1XEXB 1US8B 3NTUA 1IN4A 4ARZB 2GJ9A 3UMSA 2ZI9A 1FNMA 3ZQ6A 3R8FA 4TZ6A 3KQKA 2XZPA 4MRPA 2Q9AA 1F2UA 2OLKA 2GK6A 2O8BB 1Z83A 4PC7A 1CJVC 5L3VA 5G3ZA 4L4UA 3AP3A 1W49A 3JVUA 4JMPA 4JVSB 4CEHA 2IXEA 2AWOA 2J5XA 3KDSE 4D4MA 2ZYUX 4JT4A 2VHJA 1UAAA 2ZRGA 4IVRA 2GHIA 1XMVA 2FSFA 1DS6A 3IPXA 3B9PA 1XEXA 4F4CA 5BXQC 3DPUA 5CYPA 3NEJA 5FPKA 1AZTA 2WHXA 4C3ZA 1PUJA 1SVKA 4UNPA 3REFA 1MR3F 1OE0A 1N5LA 3IQWA 3E70C 1IY0A 1KK1A 4B6EA 1DAIA 2GILA 3R7WA 1N6PA 1U0JA 4URUR 2O8BA 4PQFA 2TMKA 4E07A 2DFNA 3I72A 2IL1A 1UKEA 1IONA 2HT1A 2DBYA 1G6OA 1ZM9A 2BM1A 4Q1FA 4K8OA 4C0HA 1XCPA 2GAAA 3GFOA 2VP2A 1P9NA 3ZVNA 2X1VA 4MGKR 4US1R 4CEJB 3M0EA 1N0VC 3OEEA 2FDCA 1E2PA 1SXJE 1VIYA 3NVAA 4JLJA 2R44A 3ZVRA 5FBVB 4C2UA 4Q4AA 2DB3A 3TAHA 3TR5A 3WRYC 3EZ2A 2XJ4A 3AF2A 3L0OA 4PHGA 1BO6A 1N6KA 2ZRHA 3VNUA 2O8FA 4QOSA 1Q3TA 4URXR 2WVJA 4A4DA 1KZGB 1DBSA 1J2JA 2Q0HA 5FTMA 2XGJA 4NONA 2NZJA 1KI8A 1V5WA 1TUEA 4LBZA 3EX7C 3OF5A 4HDOB 4NZYA 1QHXA 2IUTA 2P6NA 1CULC 4M9XA 4IXMA 2YC2C 4KYUA 4EJSC 4QGFA 1K5GA 2QG6A 3CX6A 4ZDWA 3CPHA 2PT7A 4M9QA 2D4HA 1FOEB 2ZRLA 4Q1AA 1LV7A 2BV3A 4EFLA 4Z1MD 5L3SA 4DJTA 2O8EA 1SHZA 1OHHA 4QM6A 3NC1C 1CIPA 2F1HA 3GJ4A 4M2LA 1XD2A 2G3YA 2DFLA 1R5OA 4AC9A 1TF2A 4HAZA 4D4LA 3K0FA 2QE7D 2CL7X 4HLUA 1KJWA 1Q1QA 2VHCA 3A36A 3AKDA 1NLFA 3K0AB 4OHVA 2F9LA 2OXRA 1SQ5A 4LJ9A 3L2OB 1N6RA 1IN6A 1II8B 1ZM7A 2YOHA 2EYQA 4N1AA 4Q66C 2A30A 5FOVA 3OFNA 4BFZA 5C1BA 1G18A 4V0MA 2WWXA 4Q4AB 3QXHA 5AR1A 2R6AA 1Q0UA 5J4HA 5IK2D 2F43A 3B5JA 4F91B 3K9GA 3CRVA 1UPTA 1HUQA 5TV2A 4DUGD 2YYZA 2XTMA 3AP1A 1KI3A 2PBRA 4R98A 1P3JA 2HXSA 2ZS8A 4MUBA 3I73A 2Q3HA 4OI0A 5AUQA 5LB2A 1Q1EA 1JR3A 1KNQA 4RFVA 2J9RA 4GOJA 3R7WB 1EWQA 621PA 5B64A 3AVOA 1SULA 2GDJA 4UKDA 1KSGA 3NIBA 3W6NA 3CF2A 2VA8A 1ZP6A 2ONJA 2W00A 3DZ8A 1Z63A 3A37A 2X8AA 3DVLA 1T0JB 3CNNA 1ZD9A 4WXRA 2PJZA 5CYOA 2RGXA 4M1MA 4N0DA 3W6PA 1G5PA 1S8FA 1OH6A 2IYTA 1G9XA 2FSGA 1CJMA 4DEXA 1TL7C 2H5EA 3KUCA 1CF4A 1KNXA 1N3BA 3DMDA 2A78A 3GLGA 1KSHA 1NSTA 1ZNXA 4TLBA 3ADDA 4LJ7A 2HJGA 1WDTA 1C4OA 1FP7A 1A4RA 3THWB 2CE7A 4OHWA 2JATA 5BWMA 4RZ3A 4QNRA 4OHYA 4AY2A 3MUFA 2OUKA 4UNSA 4LJ4A 4V0LA 4KBFA 3UPUA 4ACAA 2QU8A 2YC4C 5TMPA 3RS5A 3KZ1E 2IS1A 1P5ZB 4TWZA 5FUXA 3DO6A 4GPTA 3QY0A 3VFDA 1JEDA 3QNUA 3QKSA 5HE9A 4OI2A 5A5GA 1TTTA 2GCPA 4Q19A 3GLIA 4Q01A 4GFDA 1IAQA 1G5RA 1X86B 3F0TA 4PC2A 4Q9IA 1KK2A 1X8JA 4Q4HA 2WJYA 4GL2A 3EARA 4MRRA 1SVOA 1OFHA 1ZM4A 3TMKA 1XPOA 1G291 3AUXA 3PEYA 1D2NA 3W6OA 1MH1A 1VHLA 3P20A 3REGA 3NBZC 4B3BA 2CNWA 4Y0VA 5E7JA 3FFAA 4QJ3A 4O2RA 4URYR 1QHHA 2GXUA 3O8RA 1Z3IX 4N0EA 1PLJA 4PX9A 1XDBA 3FHCB 4NBSA 3ICEA 4PHHA 4M1TA 2FG5A 1E0JA 1TMKA 1GIAA 1WA5A 1WE2A 4EIWA 4M1SA 1Z29A 1UBCA 1Z6GA 4WA7A 1NJFA 1S0UA 2BWJA 4URVR 4A36A 4NL4H 3OEHD 1P75A 3ZD6A 2LCFA 1OKKA 1W4CA 3NEYA 4HAVA 3OIYA 2CHVA 4C9BA 4BASA 2BBWA 5TY0A 5BN5A 2O5VA 2NMVA 1OH5A 5JFGA 3T34A 4BFUA 3SI7A 2VYFA 2C9CA 4KFSA 1NKTA 4Q7LA 4PSAA 1OYYA 2H1LA 3SOPA 2IUSA 1W36B 3LD9A 2WMOB 2D06A 1EESA 1A7JA 1T4GA 5EXTA 3EZ6A 1Z5ZA 3CRMA 1GFIA 2O8EB 1UDXA 2EU8A 3JZMA 5KSPA 1KYIA 3GJXC 3OFND 3PCRB 4DLYA 4UXJA 4AKHA 1VHTA 3BORA 4BZXA 1LF0A 4PZLA 2IS6A 4B74A 4DLWA 1VG8A 4K81B 1E79D 1FUUA 1US8A 5CM8B 3D31A 4TYWA 1OXUA 1Z2AA 4F38A 4DSUA 1T8TA 4A1FA 1JBKA 1YZLA 1G8HA 5CK4A 1E2EA 1P61B 3QF4B 4OKSA 2IYXA 1S9DA 1CJTC 2FFQA 5LBIA 4TQAA 1DO2A 4PO9A 2R6FA 1XXHE 1C9KA 3CX8A 4R2IA 3CRRA 2GXQA 1YRAA 3ZIAA 4S35A 4YLGA 1MO5A 4BECA 2I3BA 2CNWD 3WHLA 5EP3A 4BLQA 4Q21A 1G16A 2VP5A 2ZAOA 3NBFA 1G3QA 4D0NA 4KHZA 3VKHA 4HEJA 1P9RA 2EFGA 3PJRA 1W48A 4W5WA 3QPUA 3FMOB 4NCJA 1R10A 2PLFA 4Q18A 3HYTA 2QGZA 2QMEA 2JLWA 2VF7A 2D2FA 2W6ID 4Q7JB 3WP1B 3W3ZB 2OV2A 2WKRA 4Q1BA 1GRRA 4DBLC 3VU9B 5ELXA 1U99A 4WZAE 3FYHA 3DKPA 4DVGA 4NCIA 3V00A 4AD8A 3M6AA 2G83A 3GLGB 1TUIA 2VP4A 3DM9B 4R9UC 4B43A 1KMHB 1QHSA 4IEIA 1IN7A 2BVNA 1IN8A 4M4SA 1UEIA 3KL4A 4B3FX 4ZV4A 1VG1A 3KFVA 3JVVA 2ORIA 3MMPA 4GNKA 3NBYC 3VAAA 2EW1A 4J0QA 5AJYA 5KU1A 1ZD8A 3V9PA 1XMSA 4Q47A 1Q21A 3SQWA 4KSCA 4CYMA 3QG1A 1XEWY 3RRYA 1E6CA 1NG9A 1R8SA 1W2GA 4Q7KA 3B1WA 2P0EA 1KDPA 2ZJ2A 2AFHE 2IYVA 1E4VA 1SKYE 2QORA 2V8OA 3IKJA 2ASEA 4KI0A 4MYCA 4RCYA 1N5JA 1LFDB 3O8BA 3U6BA 1Z28A 2ERYA 4KLZA 5FPSA 3GEIA 3KJGA 4LOAA 1G8FA 1EFRD 5LD2B 3AKYA 4JLBA 1Z47A 1RYFA 1Q22A 3SYNA 2PT5A 2ZR0A 5F3WB 1T0HB 2WPDA 4I4LA 1KK0A 5CITA 1ZAKA 4JYBA 2PH1A 2P67A 2WIBA 1GRQA 2WZQA 3EA5A 5KOYA 3EPKA 1T91A 2ZRFA 1N5IA 1JALA 1ZRHA 2RMKA 4DLUA 3V4FA 4LC1A 3TSOA 2ORVA 1P72A 5DYGA 2ZRKA 3B8HA 3Q9LA 2P2LA 3QPWA 4DT1B 3ICQB 1KI4A 1E3MA 2XOKD 1KIMA 1QVAA 3EC1A 5HZHA 3ONWA 3SNHA 3CH4B 2JLRA 5E3HA 5GJBA 1VTKA 2NG1A 2AK3A 1ZINA 4NYIR 2Z5FA 1U90A 4MKGA 1UDWA 3QKRA 3OEHA 4BRUA 1JEEA 4A15A 2KSQA 5DI9A 1KTVA 4FMBB 2ZRCA 2QP4A 1UADA 3AGPA 4YMWA 2V3CC 5DGXA 3S1AB 1B23P 2QAJA 2FE4A 1PJRA 3PUYA 4WAUA 2FA9A 2DFKB 4FD2A 1R8QA 2FJUA 4LPSA 821PA 1A5TA 5CLQA 1YQTA 4C30A 4PAQA 4DCNA 2RGDA 1AJEA 2WWFA 5H70A 2OCYC 2Q3MA 4FMDF 3NH9A 4OQNA 2YVUA 3TAUA 1U2RA 2DPXA 1XP8A 2QAGB 3K8YA 1COWA 2X2FA 4HAUA 4PSVA 5E95A 3ZJYA 4C0BA 4BGDA 1P73A 4ZI3A 3IO3A 4LHZA 3TW8B 3W8RA 3CNOA 4A8JA 4ZDIA 3NHAA 3LAWA 4JVMA 1NVWQ 3ZS9A 2JCSA 2V6JA 4UXIA 4ZO4A 3A1VA 1U98A 2CHGA 2XJ9A 3EPJA 1N6IA 3PENA 1D6JA 2CLCX 1Z0KA 4QBHA 4S2EA 1YZGA 3LV8A 3QPVA 1MO6A 2YWGA 4IHQA 3FKSA 3RS0A 2RAPA 4GOXA 1T9HA 1PVOA 3ZQJA 1DAEA 1J99A 1Z6AA 4IKEA 3X1DA 1EFUA 4CT5A 2ZS7A 3LXXA 4G5QA 2ZI4A 4JLOA 1GNRA 1YJ5A 4D82A 1R6BX 3AM1A 4CIDA 4RKFA 4DDTA 2BEKA 2AX4A 2J0UB 1A2KC 1NSFA 2H7VA 2HUPA 1IXSB 1W5TA 4RY2A 2PEYA 1CR1A 4PPGA 4XTCS 4HAYA 4PTLA 3EZFA 521PA 5D3QA 5SZJA 2CK3A 3A1SA 3MWKA 5AUPB 5J4LA 2R8RA 4CEHB 4QHSA 2JJ1A 3JZAA 4KAXA 2J7KA 4G5RA 4W7SA 3GLFB 4B33A 1U94A 3B1XA 4PHTA 3UANA 3GLFA 4DC9A 3QBTA 4JSYA 5AUNB 2XEXA 2ZSDA 3X2SA 4DLTA 5JS8A 1SXJA 1W7AA 2J0QA 1W5SA 4KJZA 4P4TA 5FUVA 1KY2A 3Q85A 3NHBA 1XJQA 2GRJA 1RRPA 4G5OA 5K8TA 1JAIA 2Z4RA 2JLQA 2R2AA 2ZJOA 2RB4A 1E2QA 1QF9A 3BH7A 4NU0A 2IYZA 3WBJA 2ZSFA 2DWQA 4A0FA 2OM2A 1BS1A 2CLDX 4TT3D 2WV9A 5GJVC 4G5SA 1GUAA 2Q6TA 4KV9A 3EW9A 5FBRB 2O8DB 4LBVA 3VKGA 4QJ5A 1QVRA 1Z8FA 1KAGA 2QPOA 4TL6A 1YR8A 1XF9A 2YWEA 1CR4A 3U3RA 2A5JA 1EFRA 3FVQA 3A4LA 5IF9A 3T61A 2VO1A 3HR8A 1E1QD 2H18A 4LYFA 4M21A 4NHOA 3WNDA 1VYUA 2IYWA 3K0CA 2ZI5A 4FCWA 2FF7A 2V55B 3KXLA 4GI7A 3TNFA 2HLDA 4HAXA 5CIQA 2ZRBA 2SHKA 2BOVA 1QZXA 1MT0A 4Q1DA 1DADA 2WWGA 3QKSB 4EQ6A 4TTQA 3KUDA 1Z0AA 3GCGA 3RRNA 4QC2A 3W5IA 2XOKA 2BKUA 3TVDA 3VR3A 3K70B 3CWZA 1GRNA 5KNBA 3SJZA 1EXMA 1GKYA 1WF3A 1UM8A 2ZUCA 1O3YA 1E2NA 2JJ8A 1DTSA 3ZH9B 1OYWA 3CWQA 2GEVA 2GAOA 1KK3A 3MD0A 3BK7A 4DWJA 4F4IA 2Z4SA 3Q5EA 4TL7A 2IS4A 2N46A 2ZRIA 4AK9A 1OLOA 1SXJD 4TT3A 1YHNA 2ZE7A 3HJNA 3PQCA 1YZKA 4XVQA 2W2VA 3U3JA 2A9KA 4NE2A 4D81A 1GNQA 5B57C 3AVQA 1HYQA 1OXVA 2RHMA 1V43A 3NDBB 5JI3E 3LBHA 5HCIA 1HT2E 4PPQA 2LKDA 3VX4A 4P3YA 3I32A 4JS0A 4C0AC 2XB2A 4H1UA 1SVSA 2G77B 3WYFA 4FI3C 2GVZC 2GTPA 1A2BA 1GOTA 2J3EA 2QGNA 3ZDQA 2AXPA 4XD7A 2WKPA 3SQXA 4PQRA 4QGHA 3UATA 3WNCA 1WB9A 3SYKA 3LVQE 1NNEA 1H8HA 2IF2A 2ZSAA 1XTJA 3B1YA 1AZSC 2R6GA 2OT3B 1X8KA 1GNPA 2W58A 4MGZR 2YJTD 4B47A 4WBSA 1G20E 3DKVA 1HEIA 2NOAA 2WSMA 3WMFA 1CRPA 2VSOA 4P4SA 2FWRA 3EPLA 2QM7A 2OFWA 4P4SB 1NIPA 1ZBDA 2C5LA 2F43B 3TH5A 4DSTA 3ECCA 1M1YE 2YKGA 3F3YA 3QJYA 5KSZA 5AJZA 4ASUD 4QGGA 2QP3A 3BFKA 3FWYA 2ZJ5A 4XVUA 4TYPA 3TUZC 3HR7A 1E98A 4TL9A 4Q1EA 1TQ6A 1OPXA 2A3RA 1W0KA 5BYJA 1TEXA 2B8WA 3T12A 4NYIQ 3IILA 1U9IC 2OO7A 1XTIA 1SVLA 2DR3A 5B30A 2J46A 1WRBA 1RRFA 2OBLA 3GJ7A 1E9RA 4A0HA 2J0UA 4DIEA 1E69A 1JXMA 1FMLA 1KI6B 1XJCA 3IIKA 2QL6A 3GEHA 2B92A 1G21E 4Q4HB 3EWAA 1RIFA 2IX3A 1Z6XA 1II9A 1NVVR 2F3TA 1D9XA 3GLIB 1CS4C 4BRWA 1E2FA 2ZITA 3DOFA 3RSLA 2A7QA 5JRJA 4TL8A 1E9SA 2W0MA 4M1WA 3I3SR 4E5UA 4BEJA 2C78A 3N2EA 3K70C 2C9OA 4PFSA 3BB1A 2ZJAA 3UMRA 1A82A 2QNRA 3W34A 2V54A 1W36D 4TLAA 1T8UA 3RLFA 1VCOA 4DLSA 4EUNA 4XH9B 1KMQA 4AYXA 3SYLA 2GK7A 2RCNA 5JWHA 3T35A 1RC8A 2HYDA 4TN1A 1P4SA 1XTSA 1NY5A 2AR7A 3C16C 1NG1A 2GJ8A 3T1QA 1E9FA 1XX6A 2IHBA 3L8ZA 5LDDC 2Q21A 1YRBA 3GLHE 2ZUBA 2W6JA 1R0ZA 2QN6A 5KNDA 1NVUQ 4YXWA 3WYGA 2BKEA 1RJ9B 1XCMA 1BOFA 2GZDA 1FNNA 4OQXA 5BYKA 4P33A 5GADl 1KSJA 2EYUA 2KBEA 4O3MA 2W2TA 2NO7A 2J7PD 5HR5A 1E9BA 1XU4A 2OSBA 1E2HA 4QM7A 1DVRA 1D8TA 2A5DA 1QHGA 3CIOA 1DG1G 4BLOA 1ELOA 2CEAA 2ZI7A 3LVRE 4PO1A 4HLUC 1XNJA 3T15A 3U2QA 4EPYA 1F48A 1YKSA 4L5BA 3I5XA 4QBIA 2VIIA 3TIFA 1C1YA 3HDTA 1TEVA 3ADKA 3TE6A 1CJKC 5L3QB 3A8TA 3ZYCA 4PPFA 1JB1A 1AQUA 1WQ1R 4IRUB 2NPIA 4TLDA 2FN4A 3THXA 1NBME 1KKLA 1NLZA 1RFLA 1N6HA 3F5FA 4M1YA 2PMDA 4C4PA 1IJFA 4V03A 2WJIA 2ANBA 5KPDA 1OJLA 1J90A 3EAQA 3SFVA 3L0IB 3I8XA 3IBYA 1ZCAA 4LZZA 5A4JA 1QHIA 4NYMR 1OIXA 4PO8A 2MSEB 3LRPA 2KWIA 2UZ3A 1N6LA 1SXJB 3KKPA 3P1JA 4US0R 5JLJA 2C95A 4LJ5A 2RGNA 4BLTA 4ZDKA 3EWSA 2PL3A 1OHHD 1KI2A 1JPJA 1P9WA 4BFSA 4EPWA 5CB6A 2YOFA 3VMFA 2VSFA 1ZVQA 1DEKA 1I4LD 1MRNA 1Q3HA 4L8GA 2G0TA 4LV6A 5KPJA 1EFCA 1K6MA 2XTNA 1J8MF 2OBMA 2DHRA 3LW8A 5CJPA 1Z08A 2CE2X 5EQTA 1HT1E 1E2DA 2CCJA 2V7QA 1NL3A 2JLZA 4MDFA 3UMFA 4WZBE 3P27A 2ZTSA 4UNRA 1JJ7A 2REBA 3T5GA 5H8WA 4B76A 4BZPA 2HCBA 3CRQA 1AIPA 2CK3D 1LNZA 5J4YA 2JJ1D 4IDOA 4XIGS 1AKEA 5FL7D 4Q00A 5EE1A 5EXXA 1X1RA 4DDUA 1UKVY 3G82C 4HLQB 1SVWA 1KJZA 4PC3A 4TMZA 4URWR 1HV8A 3B13B 4MRNA 1IHUA 2R6DA 2H17A 4PZYA 4EFNA 1IY2A 3ZGXA 2G1KA 4GOKA 4I1OA 3NBXX 4W5JA 2X2EA 5FPHA 1H8EA 4FWTA 2ZM5A 1HQYE 1XTQA 2UVQA 2V9PA 5TXGA 2F1JA 4XWKA 4R2HA 2O8DA 3QEJA 4PHFA 4IEEA 2ZU6A 3DM5A 2O0JA 2JASA 2O8CA 2HEIA 4HUQA 2F1IA 2C98A 5KDDA 1Z06A 2HF9A 1GKIA 1X8LA 2AKYA 1GM5A 2VRWA 2OILA 4HSEA 4JL8A 2JA1A 2Y8EA 3HU2A 4NPHA 4PPNA 3IIJA 5L3RA 1XD8A 5AUOB 3R9WA 2BIFA 2JGNA 2CXXA 4AKEA 4RFSA 5F2EA 3AF4A 3UWKA 2YINC 2VBCA 3MWYW 1W1WA 4IJMA 4LYHA 4TSFA 1VYVA 4XWAA 4TMWA 4XTRA 3MWJA 1ZU5A 5FFMA 1TQDA 5JI2E 4C2TA 2IWRA 5L3QA 4II7A 3D7MA 3QSYA 3CB4A 1DAGA 1P2SA 3FFBA 5LPNA 4LHYA 2ZREA 1IJEA 1OXSC 2G1JA 4JJZA 3T1VA 5FBQB 2XAUA 2H57A 1AM4D 2QP9X 1VKJA 2KE5A 4E03A 2IUUA 2ZAMA 4QFMA 4URZR 1IY1A 1E1RD 3E5HA 3RHFA 3RS7A 4FCTA 3EXAA 5HCNA 2VL7A 4UNNA 4NCNA 4OQMA 1WMSA 5DHAA 3ASZA 3K70D 3Q3JB 1HURA 3A1TA 3CZPA 1OW3B 2FPLA 2J0VA 3BS4A 1L4UA 2BCGY 5CDFE 1JI0A 5K8IA 2YHSA 3EPHA 4LY6A 4F4JA 4B32A 3KJHA 4OQFA 1AN0A 4R7ZA 4TLCA 2QPAA 2VLIA 3MGCA 3U5ZB 3J81k 3K0FB 4JZKA 6Q21A 4LYJA 4ZIRB 3KB1A 3KJEA 3RS2A 3BB3A 2ZRPA 3QUSA 3BBPA 2E87A 3E2IA 3KKMA 3WNBA 5E4FA 1M74A 2ZR7A 2JLXA 1TU3A 1CRQA 4XD7D 1JJVA 1IBRA 3PVSA 1XB2A 4LX0A 3EZ7A 4HZUA 1GL6A 2C96A 1IXZA 2I1QA 2IF0A 4JIMA 3AKEA 5AK0A 3PV0A 3FOZA 2GXAA 1EG7A 5KDLA 4U7DA 2FU5C 1G3RA 2ZPTX 2BBOA 3AH8A 4MGIR 4DCUA 1YVDA 4QG7A 4O25A 3EG5A 1XRJA 3D3QA 3BH0A 2V6IA 1BMFA 3TUIC 3KJIA 1IM2A 1E1RA 1H65A 2HV8A 3TRFA 1XZPA 1RW4A 1OB5A 1II0A 3BB4A 2XSZA 4BUJA 1XFAA 2BBSA 2ZJYA 5M04A 2KB0A 4YMVA 3GEEA 3ZZ0A 5IRCD 5B58C 1GG2A 2NO6A 3QG5A 4JL5A 3PXGA 5TDHA 4G01B 2G6BA 4TTRA 3T5DA 3PUZA 5BQ5A 1VCMA 4KCGA 4UNQA 2B21A 1TPZA 3P32A 4CEJA 4KU4A 1A1VA 4OI4A 4ZPXA 1DARA 2FPMA 2ODBA 3B2EA 2QTHA 4DUGA 4ERNA 5DISB 2RGNC 3MG9A 3AVTA 4LJAA 2PZFA 3A58B 1CLUA 1Q1ZA 4KSBA 3TBKA 2XXAB 1JNYA 2FZ4A 4OK5A 4A6XA 2ZI6A 3CKLA 2O8FB 3EASA 1R5BA 2J45A 4UQOA 1W36C 4A92A 2XZOA 3MFYA 2X77A 2XNSA 4PANA 2EVWX 1ZUIA 3U6KA 2V1XA 5FOXA 1ZIOA 5CM9C 3K0SA 3ZVMA 3OESA 4E09A 3U7EB 1QBKC 4Q9HA 3G5UA 4B71A 1XTKA 2P6UA 4DKXA 3LFUA 4X8MA 3CO5A 4Q9JA 1E94E 3BRWD 2XTZA 5JEDA 1N0UA 1UBGA 4KVAA 2P6RA 4DRZA 3IBGA 3B7GA 1S96A 2GEUA 3CW2A 3L0SA 5EZ6B 4DDWA 3U7FB 2KJQA 5EP2A 5KO2A 1TNDA 4DT1A 3W8NA 3O8CA 5AJXA 1WXQA 4FIDA 2XZLA 1M34E 3EIEA 1L4YA 2QRZA 5JMTA 2VHTA 2E9SA 2OAQ1 1JQLB 1RE0A 4JLMA 2ONKA 2I1VB 2VHQA 4CF7A 4RFSB 4BZQA 5F9HA 1FFHA 1NVXQ 1LTQA 1Z6TA 1GZSA 4H1VA 3TJZA 2ERXA 4JVNA 2JJ2D 3MWLA 4MA4A 4EDHA 4RKEA 5CK5A 1ZNZA 2IT1A 2YZ2A 2HDNB 2IYQA 3AVPA 2FEOA 4HZUB 1AQYA 3LXRA 1T5LA 3AEZA 5EXSA 4MKIA 2OG2A 3KB2A 3UXMA 4DXAA 4BLSA 2XB4A 1W44A 2WJGA 3LNCA 3K9NA 3MLEA 4PZZA 4TMVA 3OIVA 2IYSA 4KODA 1S9HA 4HLCA 2BHRA 2HJVA 1G6HA 3HP1A 4TMXA 4A8JB 4F93B 1S3GA 4MGYR 4JBWA 1YZTA 2ZQ5A 3BFVA 2ZRDA 2ZYVX 421PA 2ORWA 3R9XA 2ZRAA 1JR3D 4GMXA 1SKYB 4HATA 2IEZA 1GL7A 4V0ME 3SHWA 4TMTA 3SE0A 5J4VA 5EE0A 3LWNA 1U0HC 1XXHB 5HZKA 2IC5A 5JHHB 4X8LA 4TYYA 4QBGB 1XEWX 2Z0MA 4CW7A 1TF5A 1UKYA 3IHWA 1KI6A 4LUCA 3C8UA 3RAPR 2ZETA 3Q7PA 4OQLA 1G41A 1MRSA 1OV4A 4MRVA 3GJ0A 3WXMA 3PEVA 4YXWD 4XSGA 1KOFA 1M8PA 1N25A 1BMFD 1E99A 3THWA 1DPFA 1M7BA 1OIWA 1R0YA 3CF6R 3VR6A 4G0NA 4GP6A 4BFWA 2OEPA 2QI9C 4TMKA 4EKDA 4M1OA 1E2MA 5SZHB 1XTRA 2IBMA 3VHXA 4G3XA 2WKQA 3GLHB 2ODWA 2VP9A 1XPUA 2BBTA 4Q1CA 4GMDA 5KYKA 4M8NE 2H92A 1LS1A 1TQ2A 2W2XA 3SJBA 3OAAD 3QXSA 1ZUNB 2JLSA 4RD4A 2BC9A 4RSGA 5E7MA 3QBVA 4QRHA 4D4KA 1I2DA 1OIVA 1J8YF 4ZI2A 1FUKA 5EE9A 3SJCA 1KO8A 1DG3A 3C5CA 4IOLA 3ZD7A 2EFDB 3QIAA 3I92A 4IOMA 4OJKA 4MYHA 2OBNA 1OFTA 5FPYA 3D8BA 1UJ2A 4Q5IA 2QY9A 1II8A 3T1OA 3K09A 1VECA 3CRW1 5GJWC 2ZYWX 1W2HA 4XSHA 3EZ9A 1RYHA 1QHHB 1OKKD 4GDFA 3VNVA 3SBEA 3I5YA 2C04A 3RC8A 4Z8XA 2A5YB 3B9QA 1Z07A 3RRMA 2ZVQX 4EAQA 4Q9KA 1XD2B 5H68A 4D26A 1NF3A 4B3GA 4YMUA 4JL6A 4RD3A 2CDNA 4YMTA 5GJCA 2GJAA 4OI1A 4UJ3A 4KFUA 4RZUA 3OE7A 2FGJA 1P62B 2QMUA 3A4NA 4KO8A 1Q57A 4PAMA 3TSWA 1KY3A 5FOSA 3IUYA 5FOWA 3BGWA 2FPKA 4ZCLA 3QVVA 4DSOA 1GSIA 1ZNYA 1Z2CA 4CT4B 3GPLA 1FX0A 4QHTA 3AV0B 2QM8A 3C4JA 1FP6A 1YU9A 4KYIB 1NBMA 2QA5A 5KSYA 2DCUA 2L0XA 2MSCB 3SR0A 5JRZA 1BIFA 4BFTA 4WXPA 2OE2A 3DMNA 4FINA 4ESHA 3A6PC 1X3SA 4M9ZA 4ZKEA 2FMXA 4RVCA 1N5KA 1JECA 3HU1A 4A6PA 1NJGA 3H1TA 4BLPA 4C0LA 1VYTA 2FSIA 4GT1A 4RD0A 4HB0A 2EQBA 3DZDA 5J5CA 2I4IA 2ZEJA 1K5DA 3PEUA 4LRWA 3HPQA 4M22A 1YR9A 4A0RA 1QG4A 3IHLA 1ZMXA 4DCTA 1R2QA 5TB5A 2EFHB 2QSYA 2Z83A 4Z51A 1E79A 3H86A 1E1QA 2A5GA 4LHWA 1G3UA 4U5XA 2QUZA 3I1FA 4L9SA 4ESVA 1AGRA 2ZRNA 5FBLB 3RVBA 3MJHA 1AS2A 2V4ZA 4OK6A 1G5TA 3OHMA 3P4YA 2ZS9A 2BMJA 2WAYA 3SS8A 3KQHA 5G53C 5D3MB 1CKEA 3T06B 2RHDA 3NH6A 5KTYA 3OE7D 3OIWA 4POAA 3TGPA 1XBTA 5LB4A 2YV5A 3G0HA 3EIQA 4GBMA 1BH2A 4QL3A 3OIUA 3MRSA 4U02A 3SHFA 4LGMA 3VR4A 1U8YA 2JLVA 1NN1A 2ECKA 1MO4A 3IIMA 3X1ZA 1GITA 1KDOA 2FX3A 4OYHA 4HB3A 1WBBA 2G0NA 2GJSA 1R4AA 4H9GA 2YOGA 1GAJA 2VEDA 3PFIA 3C14C 3C41J 2ZJZA 2B7CA 4IFBA 1B0UA 2FNAA 4MUAA 2PX3A 1T3SA 3ND9A 5JCZA 4QNMA 2DWOA 2WJVA 4ZCIA 5J47A 2XX3A 3CUEF 5LD2C 2W83A 4TLEA 1BYUA 1QDEA 2WJJA 3DOEA 4AI6A 3B1ZA 3CX7A 3BERA 3B85A 2GESA 1NN0A 2GKSA 1LY1A 5SZIA 3RRZA 1EK0A 1NBMD 4BLRA 1HQCA 3TLXA 2GZHA 1PLLA 3RWOA 5F9FA 5UKDA 221PA 1RJ9A 3K0CC 5H1YA 2GBLA 1G1MA 4IFEA 5FBWB 2OLJA 2QPTA 1KMHA 4C0QC 2WMNB 5FI1B 4A8JC 3U44B 5A0FA 5JJKA 1N0WA 3RDPA 2RGEA 1AGPA 3BFXA 4HUQB 4AKGA 1KI7A 1X1SA 2YWFA 1G3MA 2AK2A 1NY6A 1ZD1A 3BD9A
chains in the Genus database with same CATH superfamily
5IHPA 3DKKA 2Q2VA 4WXMA 2XKKA 3AVYA 3HKBA 2NZYA 2A5FA 2WINI 2FSVA 3B3JA 4DANA 1SD1A 2QBYA 1KXZA 4LVOA 3KPUA 4QBKA 4FLMA 4TUYB 3ULKA 3PZBA 1ZZGA 3NRCA 1NJ8A 5DYIA 4WBNA 3F6SA 2IW1A 2VXOA 5DCUA 2BAGA 3WZ2A 1GTL1 3EJWA 3KZCA 3O92A 2PY6A 3RTEA 5F5NA 5SYMA 5HKKD 1Z37A 2OPBA 4IZHA 1YJAA 4EG5A 2HJ9A 3WB1A 3OO0A 4DNFA 1ONNA 4G0MA 1ISMA 2XMSA 3VKWA 1I9CA 3HCOA 4B4WA 3RABA 4W7HA 5IYZF 3D4NA 2CUNA 3AM4A 1L4MA 3U44A 4NOLA 3S2EA 3C48A 2H5IA 1NHGA 1Z45A 2FZWA 3FUXA 4FGJA 3KDPA 3KHSA 4NHEA 2J59A 3HYRA 4M54A 4ILEA 4P38A 4JI7B 2O0HA 3TW4A 1IZ8A 3IQIX 1JIXA 3M6FA 3LKBA 1C50A 2OV6A 3P71T 4I5FA 4D0GA 2CL6X 1P0PA 1KDTA 4KFTA 1Y6RA 3F6BX 4ZODA 2B83A 1WCYA 4RIEA 1FFCA 3N7UA 1C1DB 3FKQA 3M6WA 3O75A 3TLZA 1RRGA 5BYAA 4AYTA 4DPLA 2NO5A 1WP4A 4WJZA 1XVVA 5HEKA 4MWOA 1RIIA 1TZCA 1DWOA 2Y3IA 4DDMA 4IIYA 1KARA 2C03A 3A06A 2M6LA 3VPDA 3LLMA 4UU7A 3NR2A 1IMOA 4INJA 1XKLA 3BRQA 1P2FA 1T35A 5IWCA 4P31A 4XVRA 4LF6B 1BKDR 4BQEA 1E0DA 3HVHA 3BA6A 3GWGA 5ES4B 3GFPA 2VSXA 5CNJA 5IAOA 4C0JA 1G5IA 3EVGA 3F4KA 5I51A 3NIFB 2Q5EA 4F3KA 3ELWA 3GA0A 3MINB 3KR0A 3DP7A 5EPOA 1NN5A 3A1WA 4M89A 4J3NA 1JXAA 3D3WB 4UZSA 2C7QA 3CBQA 4Q12A 6ABPA 4AYWA 4WESA 4TV9B 4UU1A 4YRNA 5EGNA 4PVDA 2HCJB 2F55A 3KQLA 1C3JA 3C7TA 2C1ZA 5ENVA 1QCZA 1V5FA 3Q3HA 1MZVA 4H6VA 4HDNA 1Y1KE 1Z6YA 2OB2A 2R86A 2HO4A 2QTCA 3IB6A 1L5LA 2W6IA 2ID4A 2LNDA 2DFPA 5IU6A 2EL7A 3CR7A 3HBNA 4KPUB 4O5AA 1R0CA 1JBEA 5K8CA 3IQHX 3RJZA 4OMDA 1J09A 1YTLA 2D0OB 3EZNA 1U0SY 3VR4H 1F9AA 1BYIA 2BY4A 2HTFA 4FDVA 1TX4B 1JDNA 1EGAA 1M1UA 1WDMA 2VNSA 3BGSA 3LGSA 3UKJA 5JBQA 1A8PA 1H6DA 1SJ9A 4MDEA 1SKUA 2V5VA 3N70A 4XEUA 3WIBA 1RYYA 4P4GA 2BMDA 3FMPB 4NCKA 3GGJA 1Y82A 1H5NA 2YS7A 1CERA 1AKMA 4GX5A 4PQEA 4YIKA 1A4XA 1WCWA 4P86A 5FFFA 3S99A 4QDOA 5TRTA 2WOOA 3CS3A 4DB2A 3W2HA 1GT91 2JBAB 5BSHA 3OZRA 1CG6A 1PZHA 3KL2A 3NPAA 3WLKX 2IGTA 3SF0A 1N2CA 3N5CA 1CD5A 2C4TA 5CBPA 1RCUA 4YDQA 2OC4A 1SKMA 4PGMA 1R0WA 2C4VA 1JA9A 2GFHA 3S68A 4F9FA 5KWJA 3HFSA 4A0GA 1NI5A 3UJ3X 2B4AA 2GZSA 4FYIA 4OV6B 3ZDFA 2D7DA 4AULA 3CQ9A 4QODA 1T6NA 1X9IA 3B1JA 2ZWPA 1Y4ZA 3MQ4A 2QT1A 1UC5B 1W0JA 1H2HA 3L82B 4FXPA 4JP5A 3EIHA 3TUJC 4GP7A 3UG6A 4QYIB 2R66A 5LMCA 4GRDA 2HU8A 2H1OA 4FN5A 3RTDA 4E33A 1H0HA 2R6HA 2ZRMA 3FVTA 5IPFA 1L4FA 1PD1A 3ZI7A 2IV3A 3D7KA 5GTDA 2DEUA 1U81A 2FFAA 1LD3A 2QRHA 3OCYA 3R09A 2V7VA 4IMRA 4LX8A 2SBTA 3AEQA 4EYOA 1U6JA 1OXTA 4HQRA 3WKEA 1WD7A 5GQSA 4MDYA 4X1KB 4MHTA 3EGXA 3OX4A 4RHFA 4MKRA 2RGBA 2XD9A 1VP9A 2H08A 2PGNA 4RSMA 3FCXA 2I4OA 3ZCTA 1YDMA 2PM8A 4E5YA 2FR0A 1XFDA 4A2QA 5CIWA 4HZIA 2QRVB 3ZN2A 2QRNA 5A71A 3SX2A 5CXUA 2EG9A 1E66A 3PIRA 2JGLA 5CB0A 3H5NA 4TZ0A 2VZ9A 2AL7A 2WPDD 5I9MA 3V48A 4NC9A 5K3FB 1AKUA 3OPVA 3E1SA 3ICWA 1YVPA 3VR5A 4ZICA 3O3OB 4WBNB 1IK6A 3P45A 5MN4A 1E5QA 4LMBA 4RKYA 4MAAA 4M6WA 4D25A 3BBLA 4JBXA 2Q9CA 3QUCA 3R3WA 4LIPD 2G9NA 2BMWA 3WIOA 5JQGB 3UK7A 3ZK9A 1A2QA 1MNQA 1Q0LA 4CM9A 4BEBA 4YRFA 4F5ZA 3LOQA 2QXUA 3EGCA 2HYIC 4DCVA 2X7HA 1QFJA 1I4EB 1F8GA 1ZIDA 3KSUA 1AA9A 3L6BA 5DWVA 5E1OA 5AOBA 4BKQA 2CZGA 1JTFA 1MAAA 1Y7LA 1GAWA 2ENUA 4ESEA 1QP8A 4MAMA 1KYXA 5BN1A 2PMFA 3D6TB 4FWBA 4R69A 3WJAA 2DPLA 3ADPA 3MF4A 2Q5FA 4MCIA 4U7PB 1T36A 1WUIS 5AJWA 3ZLUA 4E14A 1LPPA 1FF9A 3QNWA 1SC4A 2B1IA 2WTAA 3E9MA 3GOHA 3QOXA 3RQIA 5C4MA 4C4XA 2RH5A 4XASA 2IA5A 2YYSA 3O2JA 2WHEA 1XWIA 1L7BA 3IGFA 1UMDA 3VHQA 4IV0A 4HVCA 2QTNA 4Q7EA 4F96A 2C9YA 2G4LA 2VOEA 3QHPA 4Y1EA 2VJBA 2X19A 3GY0A 4M7WA 4C04A 4FMCF 2ATXA 1HDEA 5AJHA 3D54D 2MSKA 5C35A 3CLTC 2VTKA 2VHVA 3I0MA 3C8MA 1O94C 3IUJA 3H4TA 2ZR9A 2ZYRA 1I2MA 4FFRA 1TF7A 4K6CA 1A98A 4OBXA 1E6WA 3RFUA 4IX1A 4P98A 4UXHA 3FLBA 3LDUA 3MS2A 4MQMA 3ZXYA 4ER7A 5IASA 2E21A 3HBFA 3P52A 2CBZA 2R6CA 4V2IA 4PRLA 5KNCA 3LPMA 1YR7A 2GBLC 3WLTA 1CY1A 3R0IA 3D1LA 3PC4A 2CDAA 1YA6A 1JKJA 4J0KA 3TLGA 2QZ4A 2WJAA 3GRVA 3RSCA 1OX4A 2I1WA 4EB3A 3GQBA 2WUGA 5KJEA 4Y3UA 2JI7A 2PRJA 3AY3A 4AX4A 5LZ2A 3TSWA 3X1YA 5EJ8A 1I2BA 2AZTA 3GJRA 2YDXA 3AUYA 3INGA 2P3SA 3VX3A 2CXOA 4XQEA 4JKYA 1WPRA 4B73A 1PCXA 3CUKA 1E9DA 1VGVA 3CEJA 1L2TA 3RVRA 5IH7A 3R20A 1EMDA 1XCBA 4M9SA 1EWVA 1IFXA 3PPWA 5CNIA 2WWYA 1UC8A 3O2NA 2WNHA 2PBFA 3BRCA 4RMHA 1JHVA 1JJFA 1YZUA 2ZRQA 1W8IA 2QRKA 2AYYA 4LQCA 2LZ0A 4UTXA 1TVKA 3AF5A 3S1SA 1I7NA 1Z0UA 4I55F 5E2BA 2W37A 4RWEA 4P5EA 5BSMA 5L3SB 3BGDA 4AN0A 1VMIA 5KJCA 3TCXB 4L9AA 3TINA 3RTCA 3L4BC 3GLIE 4C03A 2CXNA 2I34A 5D6NA 5DYWA 4Z6KA 4RV5A 2JFHA 4WIAA 4JP2A 4BMCA 1EX6A 3FCSB 3FYCA 2NV6A 4BO2A 3TQCA 4NU8X 1FL9A 4Z0TA 2A2ZA 5JSZA 3KEMA 3RUHA 3CEMA 4XR9A 3N6RA 2NU8B 4PYNA 4WOJA 4ZHQB 3JVEA 4ROTA 1V3TA 3WIDA 1J56A 4C7OA 3LQKA 2UUBB 1DO8A 2GVDC 2RHGB 3LT5A 4K26A 4R1OA 1SKQA 1YZNA 2ZVPX 4JOQA 1IQ0A 1OQAA 4MW2A 1DGQA 1ZI8A 4AW9A 2BUCA 3LKVA 3JTMA 1Y3AA 3IEVA 4ITRC 4KR2A 5DASA 2UVPB 3BC1A 1UKAA 2PVSA 3NC4A 1NRJB 2O6LA 4CTOA 4Z49A 3OF3A 2V7UA 4RL4A 3ZV7A 1ZX1A 5FA5A 2H59A 2OZEA 3I4LA 2O3UA 1EWRA 1G8GA 4U0KA 3CWCA 1UBEA 2JDID 2V7QD 1K3FA 1XZMA 2BSAA 2I0FA 3NT4A 5EL0A 5FLKA 3ZLBA 4R51A 3ACDA 3IVAA 2I22A 2ICAA 1O57A 1U0GA 2WTUA 2D3WA 4MR8B 3TQHA 4E22A 2GBGA 1UMCA 3DD5A 4LSWA 4RXTA 1CR2A 4I4NA 2BGNA 2JKVA 2YYAA 2YVKA 3HEMA 1FA9A 1QDLB 3O84A 3UKDA 2IHNA 1LJ8A 1WSBA 3GW8A 2B7BA 5C18A 1E1KA 1HG1A 3EQ8A 3W3AA 2CZQA 4C88A 1HY3A 1QO0A 3KYIB 4HN9A 3IOYA 3I9OA 3IOEA 1VMAA 3ORSA 4PXAA 1K98A 3U40A 1P7CA 5H83A 3TTXA 1C9NA 2ODNA 5H80A 4EUEA 2JCBA 2ZWMA 3CUYA 1PT8A 4C0SA 5JS7A 1LLCA 2BR4A 1IBLB 2ORED 2Z2YA 1QC5B 4ZVUA 4AX8A 4V39A 4ENWA 1T1JA 4CDGA 4FHDA 2IE0A 4INAA 3L5KA 3BJIC 4ZT5A 4ZZ3A 3EZGA 2OKGA 2OHVA 2ACWA 5K0FA 3MZ0A 4WACA 1Y48E 3SIXA 3DB1A 1MTZA 1ZY2A 4RZIA 2L69A 1W85A 3TR6A 1JAXA 1KJ8A 3G5TA 4B7ZA 1E59A 3R4CA 3VBCA 1V9LA 5G0VA 5THXA 5GIPE 4ZAFA 2WW8A 3ROPA 3UK6A 4J94A 2BRUC 2D1QA 3VU9A 4OM8A 4X6YA 2CHFA 5J4KA 1LB1B 3PNOA 4V3BA 1Z8HA 3NWJA 2IELA 2Z2KA 2G71A 4TTAA 2VYCA 2H4JA 2ZANA 4L73A 4QYXA 5AJTA 3KUXA 4KWTA 4AIIA 4J7XA 1RI2A 2HSGA 1W46A 4Y67A 1U1IA 1ODFA 3WMGA 5AVUA 4YMGA 5LN1A 3C6BA 2I3ZA 1T3HA 3PSHA 1U7UA 4I19A 5G1PA 1QHNA 4JXZA 1DV1A 4KQIA 1BMQA 2UZ0A 3KLNA 3D81A 4N5HX 1S7CA 2QQ0A 4PQYA 3TB4A 4DCSA 3F67A 2E7ZA 2YJ5A 4L0DA 1OZGA 2AFIE 3KELA 4QYIA 1Q74A 4V02A 2XNDD 4PGHA 5A6VA 3ZLJA 2XY4A 3SQDA 5TQ0A 2NVUB 4LJRA 4TQGA 5EKSA 5E6SB 3I8SA 4JLUA 1S4MA 3R3VA 4FMDB 4H16A 1N36B 3TQFA 1S3IA 3V4RA 3H6HA 1BGXT 2NVOA 4DA9A 4XB2A 1QHYA 2FZCA 1I3NA 3FCUB 2VA9A 3FNRA 4YI5A 3THYA 5CEFA 4KL8S 2FRDC 1FS4A 1L7PA 1GPJA 2XF8A 4WKOA 4ASUA 1QP0A 4BKOA 3JWJA 4D4JA 1AKYA 4UBIA 4DB4A 5ITSA 3FHTA 1M10A 3HDJA 4Q9LA 2A3NA 4IIBA 2B7LA 1GPYA 2QMHA 3IB3A 4JSTA 1KYQA 1SC3A 2JAOA 2BR3A 1Y63A 1LX7A 1MBZA 1XZCA 1XQWA 4NBWA 3R0VA 5E9QA 4HQLA 5L9AA 1OB2A 1ZM2A 1RWNA 4IKOA 4KPUA 4XIJA 1MVLA 4G1UC 1T5BA 5JPIA 3ANLA 1RXEA 4I5GA 3MTEA 3RC3A 3K15A 5JAOA 1RQNA 4OUDB 3CT6A 5SZKB 3DMHA 2CFTA 3WBFA 4C7OB 3UNXA 1LBIA 1KEVA 2GJKA 5JWRA 2ZDQA 4RENA 4K9KA 4BNKA 3OFKA 4NBRA 5J2UB 3T3IA 1USIA 3AOGA 3GU3A 1E2JA 3HXKA 2M32A 3I09A 4NG5A 3S8YA 5EJGA 1RPZA 3EIWA 4IGKA 2JLAA 3HJTA 4PYIA 1B2LA 2D7CA 1CU1A 1U8EA 3GMTA 3GJQA 3L93A 3AVXA 3EVAA 1U2SA 1E2LA 4WA8A 3W8DA 2XNDA 4BLWA 4BMVA 4BCBA 2PV7A 3KQOA 3KE9A 4NI5A 3JZFA 4D43A 1ZR4A 3DZCA 2W6MA 3BCSA 2OMKA 2JZNA 2ZBVA 4FEAA 1M73E 4PV7A 1EGMB 1HYGA 1XD9A 1ESCA 2PRKA 4TV9F 3SIPA 4QXAA 1C1DA 3AIMA 3C3MA 1G4UR 1SGWA 3KLBA 4LF4B 2NU7B 4N5IX 5KYYA 3K9FC 3QA3E 2BMFA 2HB6A 1WQ3A 2Q8PA 3KX2A 5L6MB 4N48A 2A88A 4ZJUA 5FOUA 2ZUEA 3E18A 3W3AH 3K5PA 1ZK1A 5JANA 5FI0B 4HS9A 5EIHA 5DULA 1RKBA 1ZU4A 4WCVA 4JLAA 5HRCA 3F9RA 3CZQA 5HJ2A 1JI3A 1WLYA 3P9CA 1J7KA 1USUA 4WN9B 4B7UA 1L5SA 4E08A 1W5AA 3T5MA 1XEFA 2OGUA 4BOYA 3DBOB 4HDCA 4U7FA 1DQYA 1R4ZA 3QEOA 2OFFA 4MQBA 1HNXB 2P6MA 3I23A 5IK2A 1EE2A 2UYOA 3K0HA 2V9ZA 3G49A 2QN7A 4V0QA 3Q7SA 1IBCA 1XQ6A 2DUUA 2JIZD 1PD0A 2O6HA 5KUTA 5MN6A 4YJFB 1QYRA 3DAFA 2EC5A 1Y3FE 1Z7GA 5KNDH 4LZZA 3TOCA 3S44A 5C2JB 3LH5A 1MABB 3Q7QA 2QTFA 4LPKA 1C9JA 1DEXA 5C31A 3AWIA 3KKLA 1DJMA 3IPLA 4LWZA 1F3LA 4L72A 3ZCQA 1HLPA 2C2XA 1RAFA 1Z0IA 2CLMB 1I3LA 1WVMA 1HGXA 2NXEA 2ZG6A 2XMQA 3BF7A 3BIFA 5JS1A 1U8XX 4RELA 2N75A 2D2VA 5DI3A 1JS1X 2R47A 3AUUA 3D0QA 4G4IA 1RZUA 4MS3A 3ZIUA 5GPBA 2X76A 3OH8A 2XVMA 1ISHA 1F20A 2GM4A 1UOQA 5HTKA 4V0OA 2OPHA 4CMIA 1SNYA 2OHFA 3E3LA 3LP5A 4NYMQ 4UHEA 3FF4A 3O3NB 1MD9A 1SOMA 3NCTA 1K8RA 4IVNA 1ZI9A 5IMSA 1F8UA 1SH7A 2FEMA 2C4KA 4BFVA 3VSDA 4WESB 1KQNA 3RT7A 2C59A 2Z5GA 1E4OA 4FFNA 2GPWA 3ZBPA 3GFTA 4EPRA 1KAQA 2RAUA 3HBLA 5DNEA 3DVSX 5JI3E 3P2JA 1QWSA 3L7OA 1H1DA 4S1OA 4N7BA 3UJHA 3TSZA 3LX5A 3PUWA 1QGAA 2AD1A 3R77A 4MPPA 3HR4A 1NA5A 3W5CA 4EH1A 2B37A 5C0OE 1JR3E 3AETA 2WR8A 1ONBA 4M86A 2B35A 1T9AA 2QE6A 5AVJA 4AZ0B 4O2BF 3P0IA 1TKBA 3LX8A 3SSOA 1EQAA 1QIEA 1Z36A 3IEUA 5LZ8A 4AF8A 5G1NA 4YT4A 3UAZA 4OLHA 1V45E 4EP1A 1JF8A 2JJQA 1GZ7A 3HUUA 2OVFA 4HDAA 3UFXB 4D3FA 1J7JA 4JLPA 2EOAA 5KTKA 4KH0A 1ZIPA 1MOZA 2O7NA 1NUUA 1O95D 5FBZA 4BX8A 2QJOA 4PCAA 4B40A 4WBNF 2J3KA 4XLTA 2DXIA 2IZZA 1P45A 3X1XA 4O2BA 1XDZA 3SJUA 5FR1A 3HYLA 5I9NA 5IS2A 2CSXA 1U7OA 4Y1RA 5AESA 3JQBC 3CZ4A 4TMFA 1Q12A 1YNOA 2XUZA 3KS9A 5G2OA 3PUHA 5GM1A 3ZK7A 4W9RA 1FYDA 1N2XA 1BAPA 3AM5A 3GAFA 4DMLA 3T4XA 1HE4A 2O4UX 4TKVA 2YRXA 4BP8A 2AD5A 1DXQA 1SBQA 2PXXA 3FDZA 2KI5A 3FPEA 3NHKA 3RB8A 1WXWA 3AF1A 3ZG6A 3OOHA 1JSLA 1KR2A 3CX3A 1OBFO 2GUGA 3RS4A 1IOWA 4GQAA 1K4MA 1YRLA 1Z22A 4ZHSA 1Q44A 4F4UA 4IJVA 4MVWA 2OD9A 3OJFA 2MYUA 4U9HS 1M66A 4ZAYA 3ETLA 5G3YA 3L0CA 4ZARA 4EG4A 4EX6A 3OOYA 5D1NA 2QBYB 4OHOA 1XRRA 1KE2A 2GTIA 4WVLA 3I61A 2XUFA 2F8TA 5IDVA 3QSGA 4LXTA 3GLGE 2JH9A 2D1YA 4RXMA 3U4QB 1UWCA 2GSDA 1P31A 3CNQS 4MQEB 3TVTA 2QTTA 1EX7A 2J3MA 1V5EA 4P4UA 2FGKA 4IBOA 4RJ2A 4X84A 1D2GA 3K53A 4GUAA 4QNNA 5B3AA 1ISFA 2ZB2A 3C3DA 5T5QA 3WB2A 2B1RA 3K2QA 5AW0A 1RJGA 2PKQO 3QQ5A 5EE3A 4HNTA 3R5JA 1T5TA 2B20A 2QE7A 2W48A 4G63A 4CDRA 2ARKA 5B3JA 3WGHA 4AJ1A 1R9NA 3NBMA 1GKUB 1O94D 4MV5A 1DELA 3DR5A 1H94A 3MMSA 1L5RA 4IVQA 4YRBA 2P65A 5FTJA 3WLNA 2I2FA 4IH4A 4HT3B 2ET6A 3B82A 2WYUA 1THTA 3HABA 3C3XA 3KSRA 3GP8A 1SU8A 2AFHB 4PBTA 3F5DA 3JASB 1X7DA 2NO0A 4RGVA 2PR7A 3IOCA 4L08A 5ALMA 3VO9A 2I87A 1GFZA 1O2DA 5JCPA 4IJWA 2RHTA 4IHJA 5CVCA 3ID6C 4ND1A 2FF5A 1O87A 1PR1A 1EH5A 1SVIA 4RORA 3R75A 4BLUA 1GCAA 2CCKA 3WLHA 5FL7A 2FOLA 2HMYB 3LLCA 3K8QA 5KINB 1U8CB 2FWPA 3B2NA 3HRKA 5GIOE 1LZLA 1US8B 3NTUA 1IN4A 3QUQA 5KAPA 5K8VA 2AJ8A 4C5BA 4CN8A 3TFWA 2ZI9A 5LA6A 5A3SA 1QPBA 4KGXA 4P54A 5A3QA 3OQIB 4ZQHA 3E9DA 5F1YA 1B00A 1B6RA 3R8FA 3KQKA 1T1SA 1S2GA 1TM3E 4KXXA 4MRPA 1AF7A 2B4QA 5LIRA 4Q82A 1KDYA 5C1OA 3VKVA 4M7RA 4MEBA 4OXIA 4XDYA 1J2YA 2FPGB 3I0NA 2GEBA 4FT2A 1P1RA 4W6ZA 4KAAA 2RHLA 3W77A 2R84A 3CLKA 5ECGC 3JVUA 2O06A 2CUZA 4EO7A 1UANA 3QVKA 2ZZKA 5TPZD 3UCXA 1N75A 3KDSE 4FDTA 3OHPA 1VJ1A 2ZYUX 1VYHA 1NATA 2D0IA 2VHJA 4JI4B 5G4KA 1JLKA 1VL8A 3LCCA 3Q6NA 3OZEA 1PWZA 4B8WA 4ID9A 2W42A 1I94B 3C1AA 1DS6A 1TW2A 3MMZA 4OGFA 1A7AA 4XYGA 4YVFA 1UEXC 4DR4B 3QEKA 1A69A 4A3SA 3HYCA 3H5OA 4XWGA 4R41A 1EDOA 5C8YB 4HXFB 5CA0A 3W7BA 4EJ2A 3ZJVA 3HN6A 2FPIA 2OAEA 1KK1A 3FKJA 4B6EA 1DAIA 3HZHA 1IDOA 1TTHA 2Y05A 1N6PA 1U0JA 3JVIA 5HFAA 3QVJA 1PJCA 3VC2A 4DXDA 5EJ5A 4JJ4A 3M3PA 1ZIXA 2Z3ZA 4F21A 3PDIA 1UKEA 2WMYA 4P6VF 1I7PA 5CMLA 2Q1TA 3DW1X 2DBYA 4YAKA 1YQXA 4RS3A 3PX2A 4C0HA 2DJIA 4UU8A 3OKCA 2I6FA 3OSUA 1M6HA 2HL6A 5BR7A 2DTDA 1TK9A 3PWSA 3HMQA 2Z3VA 3E9NA 1Z56C 1PX2A 1QK4A 1S8NA 4RZQA 4EW3A 3M0EA 4Z53A 2AYZA 2FDCA 4AKTA 3MT7A 4OXNA 2L42A 3IXMA 2A4KA 3LT0A 3RFCA 4E5VA 2FKAA 4OLBA 5FBVB 2QTZA 1J2TA 3BL6A 3ZVRA 1DRWA 3JQ9A 1O5IA 2BKLA 1BX3A 1DKUA 4C2UA 2DHQA 1O08A 4B7CA 1DFIA 3O2QB 5TQ2B 1GEGA 1VJ0A 3VNUA 3B12A 3HZOA 4URXR 4YA6A 4ZRNA 3ZY3A 4HWGA 1E6EA 4UUOA 3TMAA 3AHCA 5FTMA 1JIJA 1PR0A 2PQ6A 2NZJA 3S28A 3M5CA 3W7VA 1KC1A 3ZWDA 2O23A 1GAQA 1RPTA 5EIXA 3Q8KA 1OLUB 2B3DA 1RWWA 1V39A 4WK2B 4CLOB 2YC2C 1XZEA 1KJIA 2OZKA 4H4DA 4ND8A 3PE3A 3CPHA 1Z5VA 2X7JA 2D4HA 3BWCA 5IJWA 4Q1AA 1MVNA 1LI4A 4MVJI 3QELA 5BQ3A 1N32B 2O8EA 1M75A 2PWZA 3D0OA 1QYIA 4GM4A 1SQ0A 1EX1A 2F1HA 3B48A 3GJ4A 5JJBA 4PZUA 2DFLA 1MIHA 4OHPA 5FJJA 1R5OA 3QYPA 1J4AA 2AFIA 2VJPA 1JIQA 1P7VA 3FROA 4HVAA 1ATZA 3I9FA 2IIVA 2WHYA 2ZW9A 3R40A 4HAZA 3K9QO 3W78A 4CBVA 2XI4A 4DA0A 1JB9A 5C8XA 1KJWA 2R1VA 2VHCA 4OM7A 3UHFA 3WK9A 4EB0A 1XK6A 5JH7A 3LTEA 3AHFA 5DGTA 2ZDHA 3NAGA 4EARA 3WJ1A 3G02A 3L2OB 1VE1A 4QQFA 5JYBA 4UDXX 1DV2A 1PS0A 2QI9F 3BQ9A 2EYQA 1PW7A 2JLBA 3NP7A 5F7ZA 4KLAA 1Y4SA 3U0VA 4CHTA 1C81A 1EJ0A 3Q3CA 1UZLA 5C1BA 4BNJA 2WWXA 3H9CA 1VBFA 4R40A 1RLOA 2NADA 3DWFA 3FGOA 3W1EA 4P5PA 4F04A 4XYLA 4ZGGA 1WETA 4ZT2A 3U7IA 1RTTA 4CR7A 2R8OA 3RADC 4FIZA 2YY7A 5IZCC 1X77A 4MR8A 5K0NA 3UM9A 5LNK1 2A0XA 1RMQA 3IURA 3B5JA 4IJQA 3K9GA 4Q4CA 4S0ZA 1R9GA 5FHRA 2DG2A 1ZSYA 4DUGD 1J0CA 1Y6QA 2YYZA 3U9TA 2RHOA 4BX9A 1GPMA 3G23A 3DE4X 3TW0A 3JQ8A 4BXOA 5AHWA 5FRDA 1L4EA 3NEPX 4GMFA 4RFVA 1E6LA 1JG3A 1LVUA 1J0XO 2Z9BA 2BFEB 3I37X 4GIBA 2YIDA 3AVOA 3DV2A 2GDJA 1JFFA 3NHPA 2FR8A 3DXZA 3M7IA 1IIBA 1JP7A 3PPVA 4UKDA 2Q2WA 1FSGA 2VA8A 4N47A 1K8YB 1ZP6A 2V7GA 2XZDA 1CY2A 5IMBA 3VR5D 4YO7A 3O0DA 5K09A 1XLTA 4O2AA 1GQOA 4PFKA 1UUFA 3TQRA 4C7VA 4KB5A 2W2LD 1AK9A 5CYOA 3H6KA 4HP8A 4LKRA 3W6PA 4JY7A 4WDQA 3D6MA 5JSUA 5IANA 5H9WA 2QT9A 4JUDX 2ADOA 5TF0A 2CLEB 2WAOA 5JO9A 1CF4A 1N3BA 1U2PA 1BEEA 4NU6A 2MHCA 4H15A 5E6SA 3WLFA 4F85A 3GLGA 2RGUA 2EEPA 1DP4A 2NXWA 1ODCA 3IDFA 3WLAA 2HJGA 4EUFA 2G9VA 3AERA 2WTXA 4MLDA 5LKRA 3ELBA 4ZP1A 3QKIA 2HBRA 4YRDA 4H17A 5BWMA 1AHNA 2P2DA 3DUWA 3ZWMA 3F6RA 4CMBA 1CQJA 1OA0A 2WP8J 2XUJA 3PNPA 2P5UA 4OHYA 4AY2A 3MUFA 2RBKA 2ONYA 1TOAA 2O1EA 4MVJA 4LJ4A 2B0JA 3KZKA 4RTKA 2YC4C 3F98A 5TMPA 3KZ1E 1QQBA 5KQPA 3SC2A 1J07A 4X20A 2HCFA 3G1WA 1RM4A 1H9AA 4HYQA 5FUXA 4IIDA 4C3UA 1AMNA 3VFDA 3GQBB 1JEDA 1SQFA 1G63A 3QELB 3QLJA 3VH4A 4BX0A 1I7SB 5HE9A 2UU9B 4D46A 2HXGA 4C3VA 5ELMA 4Q01A 4DMGA 4AUMA 3A3OA 4Q9IA 2DC1A 4MV3A 4X71A 1L1FA 2FMKA 1WXIA 3IESA 2WJYA 3MCWA 3EARA 1Z35A 1SVOA 2XZTA 3B7WA 1XPOA 1G291 2J4CA 2W6NA 3AUXA 3LYUA 5HS4A 1RVV1 1MH1A 3W6OA 3P20A 3M5WA 3NYQA 3REGA 4C6HA 4B3BA 4CM8A 2CV1A 5FWNA 5AW7A 5JRDS 4QJ3A 3H2BA 4O2RA 3M81A 4URYR 1QHHA 3NOVA 2W2LA 4IDEA 1A96A 4F3NA 2RJNA 4N0EA 4QA9A 1PLJA 5JSQA 3GUUA 3R0JA 3UT5A 4NBSA 2AC7A 2PPLA 1XHLA 1PVDA 3V4SA 3AB7A 2FG5A 3HLTA 1E0JA 1Y9ZA 1PSZA 3DQZA 5LOVB 5E4JA 1U1GA 3BJRA 1SUSA 1RSZA 4JJIA 5DVZA 1ZL0A 4B80A 1NJFA 1S0UA 1R8JA 2IIBA 2CVPA 3IUEA 5B3KA 2I4NA 4NL4H 2QUKA 3R7FA 5K3OA 1T2DA 1P75A 1W76A 2JZOA 2LCFA 4Q9NA 1U0OC 5AM0A 4QUHA 1IEQA 4HAVA 1PZMA 2J9YB 5A05A 1KPIA 5B4TA 1FFYA 3AZOA 2BBWA 1RFGE 2NMVA 1OBCA 4O4HF 1NRIA 1NFRA 3IV6A 1SOVA 5BSWA 3AG6A 3CZCA 1Z5PA 1OX5A 2C9CA 4BUZA 4PSAA 3KOZA 1PO7A 3NV9A 1O8CA 3AHIA 2O2DA 1ID8A 2DAPA 1HL7A 3KOYA 1DMRA 2OP0A 5K3CA 3JQBA 3WLIA 5IM4F 1Z25A 2CLHB 1BJKA 3EZ6A 1Z5ZA 3CRMA 3NAZA 2O57A 1PT5A 4FSHA 1H2FA 1UDXA 3ETJA 2E82A 3K6RA 3RK4A 3JZMA 3PUIA 1JFTA 2EF0A 1XYGA 4DLYA 1J5PA 1P2DA 2HOQA 2JC3A 2F48A 4YJ3F 3Q2KA 2Y77A 3H8VA 1UIRA 1VHDA 2CFOA 1ONPA 2E89A 3BIJA 1YKGA 4PZLA 3IPCA 2B1QA 1XVUA 1M8KA 4B74A 5LLDA 2G17A 2ISCA 1E79D 5DNAA 4LKOA 5CM8B 3GN2A 1OXUA 2G5PA 4JH0A 4F38A 2EP7A 1T8TA 2VSYA 5DM4A 1JBKA 4BAZA 1SBZA 4MUJA 1G8HA 1IM5A 4CM4A 1E2EA 1TK2A 1B8VA 3UJBA 2Z8YA 3COPA 2VPWA 3B52X 3O8QA 4IH9A 1IXKA 1MDFA 3D5EA 4UD6A 4IUCS 1DIGA 2HA3A 3CLUD 2YQ5A 5BQPA 3GP3A 2Z08A 2VAXA 4OJYA 2OCGA 3CRRA 4PBSA 5DDIP 1W0CA 5GP1A 2DR0A 2Z2JA 1EEHA 4BECA 3A1FA 3WHLA 5JPCA 4R01A 2QYHA 2Z8ZA 4R81A 2ZAOA 3WGLA 2ZBRA 3W6ZA 2PK3A 3N87A 3PJRA 4W5WA 1S2NA 2QTBA 4I9GA 3RSZA 7YASA 1SIBE 2Q4TA 1RXWA 4NULA 4GKBA 3L6EA 5JCOA 1E4EB 3L7LA 1HDOA 2X86A 1JEAA 4Q7JB 3L8CA 3M6MD 5DP1A 3W3ZB 1W35A 3GGPA 4DREA 2JFWA 2PIDA 3BA1A 3HN2A 4Q1BA 3AEUA 3WGJA 1BVUA 2BUBA 3DKPA 3V00A 1CJSA 1NXVA 2G83A 4AD8A 4CE6A 1FFAA 3GLGB 1KAMA 2SCUA 5LQSA 3F4BA 1N8TA 3V1MA 1KMHB 1Y80A 3X3HA 2XWPA 3QHQA 4DIKA 3ZE7A 1Z75A 2BVNA 3DAPA 4M4SA 1UEIA 3B6JA 4OFWA 5G1OA 3WGOA 3VR4D 2OHIA 4QQKA 4ZOLB 5REQB 4MIEA 1X1QA 4GNKA 4I9NA 4PLGA 3WSVA 4QPJC 4TWRA 4ZO7A 1G2QA 1C1HA 5BSEA 1N2JA 5BUQA 1WMDA 2A1UA 1NQXA 3CBGA 3KZNA 3O9ZA 5LQKA 3EHDA 1D0VA 4L6CA 1DDGA 3OZAA 2P2ZA 1ZS9A 4F1JA 1KC3A 3JWIA 4FHGA 5DX0A 5CH3A 4Q7KA 2YH2A 2PUVA 1BXRA 1XI2A 2Q1WA 2YJNA 3GXOA 3BDAA 3L6RA 4UEQA 4Q4AB 3TQIA 3JZIA 3MB5A 4KDFA 2H7YA 1NXSA 4PLWA 4R1PA 3EF3A 3B6IA 1LFAA 1KZHA 1OLXA 2ERYA 5H3CA 5CFPA 4BBZA 2Q2NA 4ZEVA 4JEIA 5BNWA 2O3QA 4LC9A 4PTYA 4ERXA 4J7CA 4XQGA 3T6KA 4CI9A 2PT5A 1XN4A 5DXAA 3ZCXA 5F3WB 1GNVA 2JAUA 1KK0A 3DCIA 3KCNA 3L77A 1GU1A 4LRQA 4I50F 2C92A 1KEZA 2P11A 2PH1A 3FRJA 4M1EA 4PCUA 1WHSB 3EA5A 2WZQA 4MIKA 2QRLA 3H16A 4EX7A 1C9EA 2CHEA 3OPNA 1JALA 3BTVA 5BR4A 4LC1A 1P72A 1UMKA 2WWRA 2I6UA 2VAPA 5KYNA 2ZIZA 3Q9LA 5IBCA 3ASUA 4L74A 3QPWA 4D3YA 5M34A 1RQPA 4DT1B 1D2HA 1E3MA 2X5KO 4QE3A 1KIMA 1EZ1A 1QVAA 3KP1A 4X6UA 5HZHA 3ZUGA 4UTRA 2P4SA 1VTKA 4JB3A 4L9RA 1NR7A 1PSWA 4UUMA 5JQGA 4FEEA 1U90A 3S5JA 4DM7A 3AM3A 3K2EA 3QKRA 3OEHA 2GS9A 1JEEA 3PNVA 3UWDA 1OWOA 2QDKA 1EP2B 3O4JA 4PS1A 4O8CA 2P2NA 3U7QA 3SXUB 3E5MA 2PZ8A 5C8DA 5JH7B 2QP4A 3BE8A 3L7KA 1B23P 3GL9A 3VM6A 1NVDA 4NMWA 3V1LA 4FD2A 1V8OA 3TX2A 5JAUA 2QM3A 821PA 4Y9TA 3TXXA 1JN0A 3R5FA 1JAZA 4C30A 4DCNA 4NXNB 3L40A 2ZCUA 3EAGA 5H70A 1MFZA 4JKOA 2HSDA 2CYBA 2PKYX 5IKMA 3WBBA 1XRQA 1ZMBA 2OZPA 2WT4A 3IS3A 5DBFA 2NYVA 3TAUA 4C7MA 1X1EA 2DPXA 3KPJA 4O5OA 3FCCA 3P9QA 5JDIC 2Q6IA 3IP7A 2RB5A 5MFZA 2AOUB 1BW9B 4ZVQA 5E95A 4NNJA 4C0BA 4BGDA 4L22A 5D8DA 1E3LA 1Y8QB 3IO3A 1RC1A 1ABEA 4LHZA 5TE9A 4EHJA 4GKJB 1VLLA 3CNOA 3W8RA 1TM5E 3HFRA 3C87A 4FI3F 1PJ4A 3ZS9A 4FHCA 3EFEA 4ZO4A 1TK3A 2XJ9A 3G8AA 2VZEA 3PI7A 3SDBA 1D6JA 1RRVA 3FTCA 1Z0KA 4QBHA 4XFDA 1LSUA 2JJYA 2TYSB 2WB2A 4U39A 3I2HA 1MO6A 1TC2A 2RAPA 4GOXA 1SUPA 1X8XA 3EMDA 4LMPA 1Y7PA 1Z6AA 2P1RA 3OPMA 2G36A 1T0UA 4PG5A 4DGQA 1L5NA 4LOLA 3V46A 3WK4A 1H2AS 1BMTA 2ZS7A 1V26A 3LXXA 3TE7A 2BYTA 1BCSB 4UOQA 5CT9A 3MCUA 2QN1A 1U8FO 3SM3A 1TRKA 4BN5A 2EIHA 1JFVA 4BU1A 2E48A 1XKXA 1HG0A 2BEKA