2Q21A

Crystal structures at 2.2 angstroms resolution of the catalytic domains of normal ras protein and an oncogenic mutant complexed with gsp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
171
structure length
171
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures at 2.2 A resolution of the catalytic domains of normal ras protein and an oncogenic mutant complexed with GDP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncogene protein
molecule keywords C-H-RAS P21 PROTEIN CATALYTIC DOMAIN
total genus 63
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 1991-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2q21A00
1AM4D 1CJVC 1S0UA 1VCOA 4GFDA 4TT3D 3QEJA 1NG9A 1R8SA 3BORA 4AYTA 5JJIA 3CO5A 2ORVA 1XXHB 2VLIA 2ZR7A 3CLVA 4QBHA 4ZPXA 2J45A 2ZRAA 2W0SA 4JVLA 1W0KD 4M9XA 5JEDA 1UBEA 2ZSFA 1OXVA 2WMNB 3IQWA 4OQLA 3MFYA 1UBCA 1D8TA 2YOGA 1KAGA 1U9IC 1GNQA 2CL7X 5AJZA 1UKVY 4OQFA 2ZM5A 4HATA 4V0KA 4IHQA 1XEWX 1M1YE 2IYYA 3FKQA 4MRSA 4TMZA 3K0SA 4Q7KA 1E9SA 2G0TA 3RS7A 3E5HA 1G5TA 4L15A 4BZXA 3TNFA 1W5SA 3R8CA 3WNCA 2PT7A 1DO2A 1R4AA 2GXSA 2FJUA 5FR2A 4V03A 5BXQC 4I81A 3U6BA 2IYUA 2VHTA 3LRPA 4C0LA 821PA 4AYXA 2IBMA 1U0JA 1G3QA 1E2QA 1G18A 2ERXA 2PLFA 1I4TD 4DC9A 1Z29A 3GJ3A 1YKSA 4UNQA 3B82A 4GP7A 4D82A 4DSNA 1OH8A 1TQDA 2BIFA 2WSSD 1AKYA 2FOLA 5TVKA 4A0GA 5EP4A 1QRAA 3B9QA 2A5GA 1G4AE 1P5ZB 3ZZUA 2NIPA 2AHOA 3VKGA 4GRAA 4K81B 2NZJA 5AR1A 4B3GA 1SVOA 2GEVA 4JSTA 5CYOA 3NIBA 1WP9A 4K8OA 3JVVA 4KJZA 3VNVA 2QQ0A 2DWQA 3PEWA 3PVSA 2J46A 4PR0A 1P73A 2XB4A 4V0NA 2ZVPX 4NONA 4A92A 621PA 4P4UA 5DNYB 1YHNA 4B3BA 1KDRA 4D0LB 2JLWA 1G8PA 2D7CA 4M9SA 1IJEA 1SXJA 1W48A 1NMXA 1YZKA 3B1YA 4DLWA 4E03A 4TTRA 3EC1A 4OK5A 5ANRB 2CL6X 1W46A 2WWFA 4DLYA 1E94E 2QGNA 4P4TA 1FQKA 2JLVA 2EFGA 1W36C 4KFUA 3I62A 1G6OA 1F2TB 4A8JA 1Z0IA 4AD8A 2C9CA 2WJIA 3DMNA 1AQUA 3X1ZA 4A0HA 4Q1AA 1T91A 1TL7C 2CLCX 3KZ1E 1RRFA 3AH8A 3U7GA 1NN5A 3K0AA 4LJ7A 4RD3A 4EPTA 2GBLA 4TWZA 1DAKA 4QKQA 2OBNA 1ZYUA 3EWAA 1G20E 4ON9A 5CK5A 1K5GA 1IY0A 2WBLC 1K8RA 3HWSA 3PUWA 4RFSB 4LK2A 4V0ME 1Q21A 1JQJC 3IIKA 4D80A 2VHUA 1OFIA 1NKSA 1BKDR 3W5IA 4OHWA 4YQFA 3WXMA 1H65A 2ZANA 2V6IA 2OZEA 1NRJB 1SXJB 3QG1A 4HDOB 4QHYA 4TMKA 1UM8A 3FMIA 4WOPA 5E4FA 2NQ2C 3WP0A 5L8VA 1OXTA 1GRQA 1X8KA 3BD9A 3I72A 3AVPA 4HLUA 1FP6A 1RRCA 1P61B 1COWD 1UBGA 3EXAA 1KI7A 1W0JA 4S2EA 3UMSA 2ZS8A 3QKUA 3LXXA 3REFA 4ACAA 4KFSA 2V8OA 4QJ5A 4RD1A 3W6OA 3THYB 4R98A 2HXYA 1G7CA 4G5RA 2F1IA 1XMIA 4KLNA 1FNNA 3C5HA 3A4LA 4TMVA 5JWOA 4M0LA 1FW6A 2GETA 3DDCA 3QXCA 1E6CA 1AJEA 2QT1A 1T4GA 2BMJA 3CNLA 4G0NA 3U4QA 5JSZA 2G1JA 5SZHB 5KSYA 1OB2A 1XPUA 4QGFA 4IFEA 1N6NA 5J4LA 4BLQA 4D81A 3H4MA 2UVQA 3B1WA 4B34A 5LD2C 1UEJA 1HY3A 2ZE6A 4FINA 4CEJA 2RAPA 1G4UR 3THWA 4YXWA 3QXJA 2OFXA 4FN5A 4OQNA 2W6JA 5JCPA 2I4IA 4JLDA 3WMGA 1G3RA 4GL2A 3RYTC 2G88A 1BMFA 5FTJA 4HSEA 4WAUA 5HE8A 4RD2A 3C14C 1OT3A 2C78A 4PO1A 2HJGA 1G5PA 1D9XA 1R5OA 2BMDA 2CVFA 1XZPA 3C16C 4MYUA 4IDQA 1IY2A 1E0AA 3THOA 1TX4B 4I1UA 2VHQA 4AKEA 3HU2A 3T61A 2R6DA 5B57C 2IYQA 4CRWB 3LA6A 4ZV4A 2CCGA 5AJVB 3U44B 3L8YA 4B6EA 2KSQA 3W8RA 1SZPA 1K5DA 4JBXA 5CDFA 3NDBB 4LWZA 3OAAD 4F4JA 2GJ8A 2WHXA 1IJFA 5JI2E 5KNBA 4IXNA 2CJWA 2NOAA 1KY3A 4LJ9A 1Z06A 3WRYC 1L4UA 1SQ5A 5KDLA 3KFXA 3U4QB 3I4LA 1FX0A 1KY2A 4PC3A 4JT4A 5FUVA 4NPHA 2A5JA 5EUQB 2BJWA 3CX7A 3G82C 4XD7D 2GVZC 3CF0A 1E9RA 3K9NA 2ZJZA 4N0EA 4O2RA 1IHUA 5LB4A 4LI0A 2BC9A 3EZ9A 2QP3A 1JECA 3THWB 2W0MA 1E2GA 3V00A 5FOWA 2BBOA 2ZITA 4XSGA 2QRZA 1I2MA 4XVUA 2GBLC 4I1OA 2FF7A 3W6NA 1NBME 2PLRA 3RS0A 2CHGA 4BEJA 1ESMA 2AK2A 1J90A 5GVRA 1KZGB 4L4UA 4W5JA 1E2NA 1CJKC 1CBUA 5FOXA 1UFQA 2R6FA 5G53C 2BOVA 1GWNA 1T9HA 2GXQA 4XOIA 2ZYWX 2QRNA 4H9GA 3E2IA 4PX9A 3U44A 3NDPA 3PEVA 4JL6A 2QMUA 3P4XA 3NH9A 2E9SA 4M8NE 4ZDIA 3W3ZB 4WW0A 4EDHA 1W2GA 1G9XA 1XF9A 2D3WA 1IOZA 3LX8A 4G3XA 1BYUA 2CJWB 5FI0B 3GJXC 4NCJA 5JWHA 1PJRA 4BECA 4YMVA 4URVR 3TKLA 1NF3A 4LJ8A 3B13B 1EFRA 3IDQA 1MO4A 3A6PC 4P4SA 2IXEA 4ZIRA 4JBWA 3EX7C 1CRQA 5F98A 1Q20A 2J0UB 1LVGA 2RGGA 3GFPA 1E79D 1G64A 1XCGB 2XZOA 1NY6A 4ZCMA 3NBZC 4Q1FA 3L0OA 4TQUS 2Z43A 1ZNXA 4LPSA 1H8EA 4P33A 5FUYA 1IXSB 1P2TA 3T5GA 2WVJA 1Z2AA 5DN6A 3AVOA 2OV2A 3K70D 1DG3A 2WJHA 4M1TA 4U00A 1KI6B 5JMTA 2DWPA 2EQBA 4N0DA 1NBMD 1GL6A 4WXRA 1KI9A 5J4VA 1G21E 4M9ZA 1NLFA 1GITA 1UDXA 1Z6XA 3CPJB 3IPXA 4TL9A 5AJWA 1XEFA 2GTPA 2XITA 1F2TA 3KXLA 4O3MA 2V7QD 3RS3A 1R8QA 3HR7A 2FSGA 1DTSA 2YINC 2XXAA 1VHLA 1SXJD 3THXB 3GFOA 3QE0A 4KU4A 3IKJA 1OJLA 2WJYA 4EFNA 4IEEA 2V3CC 3BJIC 1ZVQA 5C18A 4B76A 2PZEA 3UMFA 2RGEA 1QVAA 2V6JA 3NH6A 1A2BA 1A82A 2JLQA 3X2SA 4OI0A 3UIEA 5IRCD 2NO7A 4P4SB 1YZUA 2P65A 4PZLA 3GLGE 1KK0A 2DFLA 4DVGA 1D9ZA 2O8CB 3X1WA 1ETUA 2JGNA 5LBIA 2WKQA 3BRWD 2ZI9A 4DIEA 2C96A 2OAQ1 3IO3A 2N42A 3WYFA 1JEEA 5TXGA 4A2QA 5JJLA 2GDJA 2OXCA 4X8OA 4B2PA 1DS6A 3ZVLA 4AWXA 2EVWX 3UANA 4LGMA 1JPNA 5JS7A 2V4ZA 2WSSA 1J8MF 1CLUA 5BYJA 3BIFA 2BKUA 4XIGS 5DH9A 1KSJA 2A3RA 2IF0A 2XZLA 3DVLA 4PSVA 4ILEA 1GILA 1OIVA 2GEUA 3CH4B 4L8GA 1YR8A 4JL5A 1XRJA 1XNJA 2JJ2A 2WWGA 1DG1G 5TB5A 5DHAA 2OCBA 4HUTA 1N5LA 4KODA 2CEAA 3DL0A 1E0KA 1GAJA 4A0RA 1Q12A 1W4CA 5JWRA 2IS6A 2QL6A 5JS8A 4LV5B 3KUCA 4QGAA 4AG5A 2B7CA 4KFTA 4PAOA 2WMOB 4D26A 1E98A 5C1BA 1UEIA 3OFNA 4LHVA 2C77A 3MD0A 1NP6A 1OKKD 4IDNA 3ZYCA 1KDPA 1XCMA 4Q18A 1HV8A 2A7QA 4HB4A 1AZSC 3GEHA 4KITB 4LHXA 3B2EA 4JSYA 1LY1A 1MOZA 3ETLA 4DCUA 4AKGA 2QSZA 3I73A 2WWHA 3QEOA 2QAGB 4Q9JA 4C0AC 4LYHA 1AGPA 1TUEA 2VF7A 1C9KA 3TGPA 2GJKA 4OJQA 2WPDD 1W5TA 3T1QA 5L3QA 4JKIA 4MQBA 4LJ5A 2PJRA 2H57A 2OEPA 5G41A 1F3OA 4A9AA 3GJ8A 1GKIA 2P6NA 2F1JA 2QP4A 2RGXA 1RPZA 1VKJA 1Z07A 4RZUA 3IUYA 2D74A 4LJ4A 1F48A 4PSKA 4AG6A 1KTVA 3KFVA 2B7BA 5LDDC 3Q3JB 4EFLA 2V7QA 3ADKA 3RSOA 2QPOA 4TMXA 2VH5R 3KKPA 3KX2A 1HTWA 4LBVA 2W83A 2ATVA 3CRRA 2IUUA 3ZD6A 3SE0A 1DO0A 2H92A 3FMPB 2YYZA 3SOPA 3D3QA 5L3RA 4GDFA 5AJXA 3AP1A 3I8SA 4W7SA 2VBCA 4HAUA 1DE0A 1TQ4A 5FBWB 1CJMA 2GCNA 1KIMA 3SZRA 4UKDA 4QBGB 5DIFA 2FFAA 4HLCA 1JEDA 1YZQA 4C0QC 1Z47A 2ATXA 4ESVA 1E9DA 2ZRHA 4O2LA 3AGPA 4IOLA 3CH5A 5DN6D 4GOKA 4DLXA 2FMXA 1KJYA 4U02A 4F92B 3OIYA 4QBIA 2QMOA 4Q4AB 1BYIA 1ZRHA 3BH7A 2A2ZA 3W6PA 4AY2A 1IN7A 3CB4A 3WBJA 1Y3AA 2W2VA 2J7PD 5HZKA 4B47A 3LO5A 2VTKA 1SULA 3U3MA 3DM9B 4Q4HB 5DYIA 1KHTA 3K8YA 4JLMA 1XP8A 1EFRD 5P21A 1G7SA 2O5VA 3VR3A 4Z1MA 2P5TB 4A2PA 3TW8B 8OHMA 3PEYA 1TEVA 3FTQA 5KUTA 1CR4A 4C30A 5HZHA 5KDOA 3GLFA 1EFHA 4NCHA 3ZD7A 1KO8A 1RKBA 1ZM4A 2HUPA 5AJYA 3X1DA 3AM1A 5F2EA 4XVQA 5L3SA 3LQQA 3X1XA 3B1VA 4WXPA 3BH0A 3IILA 1VG9B 2QBYA 2JLRA 1GUAA 1HEIA 1Q3HA 3QI2A 3NC1C 3QVVA 2CMKA 4RFSA 4OK6A 2O0JA 1NY5A 1Z6AA 2AKYA 4US0R 5TDHA 3IGFA 4EAQA 2XZPA 2R6AA 1YVDA 4YMWA 3CNOA 4DSTA 2I1QA 2FNAA 1Q1QA 3K0EA 3MCAA 4JLVA 5LPNA 4Q4AA 1R2QA 1GDDA 4GZLA 3SFVA 1UJ2A 2QQEA 5J4YA 3EASA 3RABA 2C9OA 1A4RA 4DHEA 1NVXQ 1Z8FA 3PCRB 4PO9A 1RJ9B 3AV0B 3WY9A 2CNWD 5GADl 1E1QD 2VP2A 3BB1A 1UAAA 2X77A 2TMKA 1VYTA 4TL6A 3GLGA 3TSOA 2C5LA 1E1RD 3FPAA 1R10A 1T3LA 2OFOA 3HR8A 4C0HA 4HAWA 1UPTA 3ZIAD 4YLGA 5L3SB 3ND8A 1W4BA 1OIXA 2F9MA 3GP8A 4DDTA 2AR7A 4LZZA 1CR2A 1SVIA 3L82B 1RYHA 3QKSB 2OO7A 5F9FA 4BQSA 4BFYA 1FTNA 1XTSA 3LY5A 1I4DD 5CJ2A 3BFVA 1Z28A 3OEHA 5DI9A 4JT2A 4N1AA 2ANBA 1TUIA 5FPSA 3CWQA 1RIFA 2ZRCA 3N5CA 4IOMA 3RWMB 1XTIA 1TADA 2ZREA 1KKMA 2F3TA 1E4VA 4AI6A 4CEJB 1UKYA 2AXPA 3TAUA 2AL7A 2Z83A 1KJWA 4QL3A 3ADDA 2B8TA 1GKYA 3TR0A 1Z0KA 2R44A 4JMPA 3OAAA 3A1WA 3OE7D 2FFQA 3T1OA 4ZDKA 4K46A 3R8FA 2REBA 1DEKA 4Z51A 3B78A 1E9EA 4ARZA 2OUKA 3A4NA 4UXJA 2BDTA 2B6HA 2FX3A 4CGZA 2O8CA 1ZUIA 1N6LA 3MMPA 2YJTD 3MRSA 3A8TA 4JLOA 4JLPA 2ZAMA 1EFUA 5D3MB 4B75A 2GA8A 5CLQA 1MT0A 3FDIA 5FL3A 2ORIA 3BE4A 1MO3A 1NN0A 3KJIA 1SKQA 3KB2A 1E79A 1S9DA 1GIAA 2ZQ5A 1WB9A 3GJ0A 1R5NA 3WMFA 2DWOA 4JKYA 1HT2E 4LX0A 4LV8B 1TF5A 2OLJA 3AP3A 2IYTA 4UXHA 1XU4A 3VFDA 3KQNA 1ZNYA 1JXMA 4Z8XA 3NBFA 1HT1E 1M7BA 3REGA 5IHPA 3U5ZB 5F3WB 2ZYVX 3R9IA 5F9HA 4D0GA 2I1VB 2VSOA 1KI2A 3AUYA 1G3MA 3OFND 2OBMA 3NEJA 3FHCB 1N6IA 1FPMA 1XB2A 1LNZA 4A15A 1XMSA 1AS2A 1XD8A 3WBKA 4BFSA 2W58A 4RSGA 4D4JA 1LS6A 2J7KA 2Q21A 4H1VA 3AF1A 4DWJA 1ZM3A 1Q1EA 3DEFA 2G0NA 3F3YA 1JR3E 2LCFA 2WSMA 3B8HA 4IOKA 1P2VA 1OPXA 2JJ1D 4I4LA 4IXMA 4IW3B 5L3QB 5EE5B 1FX0B 1GSIA 2NO6A 3RS2A 1CXZA 3MG9A 5CLLA 4C2TA 3BC1A 2JJ1A 1HUQA 5FOSA 4GOJA 2RGAA 4FW9A 1G7TA 4JLAA 4B48A 3O8BA 2R9VA 3GEEA 2ZROA 4E07A 4TZ0A 1PLJA 1XMJA 2MSDB 4GOXA 4LJAA 4QNRA 2QE7A 3BERA 2NGRA 2BVNA 1RRGA 2EWVA 2R6CA 4WBSA 3RLFA 4OHYA 3QNUA 2JDIA 3U6KA 1QHXA 1D6JA 2QMHA 2GAAA 3QXSA 4LBYA 1X1RA 5EZ6B 2WWIA 1E2MA 2QNRA 4Q9KA 1ZBDA 1Q1ZA 3KKOA 1SKYB 4KCGA 4ERNA 2J0UA 3LDAA 3BOSA 3PIRA 3VAAA 1SXJE 1N0WA 1XDBA 3CONA 1VDZA 1OXUA 1SGWA 3G0HA 1OYYA 1AGRA 1PUJA 4NYMQ 1N5IA 4LPKA 2GCOA 4RKFA 2JIZD 1U8AA 1N6KA 2FG5A 2YWGA 5DE3A 3NG1A 3ZS9A 3ONWA 4JVSB 4FMDF 5KNDA 1KMHA 4TYNA 1MH1A 2D4HA 3WYAA 2ZR9A 1EESA 2Q3HA 521PA 1UKZA 4II7A 4MGIR 1NN3A 3JZMA 4HAYA 4I1VA 4Q48A 5J5CA 3Q9LA 4RD6A 4DRZA 4D25A 2QI9C 2V1UA 2RGDA 2NPIA 2D62A 2QSYA 3QBVA 1X8JA 4F7WA 3GLFB 1NSTA 5ELXA 2F1HA 3Q72A 4D4MA 1L8QA 1Q44A 2D2EA 1R0YA 4TMWA 3TIFA 5BN5A 2GRJA 1Y63A 1PLLA 3Q7QA 4MDEA 2VQSA 1SVLA 4TMTA 5JZVA 1F60A 4C7OB 2OSBA 2W2XA 3L2OB 2GWHA 2FGKA 4TL8A 4AC9A 4PAQA 3SQXA 5KU1A 3KB1A 2WIAA 4XJXA 1VHTA 2AFIE 1VG1A 3H2YA 1E0JA 2ZJOA 5FTLA 4DB2A 3RDPA 2WWWA 2ZVQX 4B33A 3SNHA 3K0CA 1S96A 3KXIA 2QY9A 3HDTA 3D8BA 3EW9A 4OI2A 4PAMA 1YR7A 2QBYB 2IEYA 2RGCA 4V0MA 2QG6A 1L7VC 5A4JA 3SEAA 2A30A 1Z3IX 1XD9A 3DZDA 2ZE8A 4RD0A 3RAPR 2OG2A 2OCYC 1DELA 5C4GB 3I5XA 2KI5A 2KB0A 1GL7A 1GG2A 3R9XA 3EPHA 1CKEA 3C5CA 2IYRA 2NTYC 3QXHA 3IO5A 3SI7A 3BWDD 3EIHA 2CE2X 2KJQA 3S1AA 4MGZR 2FPKA 5K8LA 1F2UA 2Y8EA 2HT1A 1X1SA 4XSHA 1MABA 5EP1A 4XWKA 1RJ9A 2FSIA 4RZ3A 2A9KA 1JAIA 2PCJA 4IVPA 2CE7A 1WMSA 1JJ7A 3PITA 5GJWC 4XH9B 1ZINA 2CDNA 1AS0A 2H18A 2JAQA 1LTQA 4AK9A 1OB5A 1EWQA 5KSZA 1EX6A 3RHFA 1G16A 1W1WA 4L9SA 2HF9A 2OFWA 3QKRB 1QHHA 1ZP6A 5J47A 5KSOA 2JCSA 4JIMA 3QXXA 1G19A 3K09A 3CR8A 2Z0MA 2FGJA 2KBEA 5M04A 2BCGY 3IHLA 721PA 1KO4A 1KZ7B 4AYWA 3U60B 4YMSA 5E7MA 1P72A 4U5XA 2OESA 4HDQB 1GP2A 3LBHA 4LC0A 3QF7A 1HYQA 4OL0A 1ONBA 4CW7A 3PUZA 3ZQ6A 4DIDA 2C04A 2HF8A 1G3UA 4I1SA 1CJUC 4LYJA 2ZSEA 1NI3A 2QAGA 4MA4A 4A6XA 2IK8A 4YC7A 1H8HA 4R71A 3AF4A 3A4MA 4EPYA 3W5JA 2PX3A 4G01B 1HE8B 3AVVA 2PH1A 2FDCA 4Q01A 1KDOA 5EE9A 4URXR 3MWYW 1J99A 3TBKA 2F6RA 4C0KA 2F7SA 3K0CC 3T06B 3GLIB 4XTRA 4MYHA 1OE0A 1SVSA 1Z6GA 1QVRA 3B5JA 3P1JA 4PPGA 3FFBA 3L43A 1U90A 5TY0A 1YZGA 3UMRA 4OK3A 3I3SR 3PENA 1E1RA 3WMEA 3AF3A 4RD4A 1VIAA 4IJMA 3BFXA 4YXWD 2W6ID 1QG4A 2CBZA 4JS0A 2OBLA 3FHOA 3X1YA 4A1FA 3QSYA 1OFHA 4F91B 1GRNA 1T0HB 1E2PA 3SN6A 1R0WA 4HZUB 1VECA 2BMEA 4V0OA 1L4YA 4M1WA 2IA5A 5HPYB 3ICQB 4QC2A 1NG1A 4M1MA 5IDVA 2FSHA 3QENA 1FNMA 3H84A 2ZI4A 4XVRA 4OYHA 4LHWA 5G40A 4GMDA 3EG5A 1ZJ6A 2JASA 4DLTA 1V43A 2SHKA 3T15A 4LJ6A 3BK7A 3LFUA 2ZRMA 1W49A 1VG0B 4EQ6A 4ZI3A 1QHSA 1J70A 1Q22A 5JECA 3ICEA 1PVOA 3KJGA 1E1QA 3K09C 4PPQA 1G1MA 5FL7A 3ZJYA 1G8GA 2JLSA 1CEEA 2GF9A 3LLMA 4OKSA 1EGAA 4UNSA 1XD2B 2MMCA 3FB4A 4NP6A 5CM8B 5AUQA 4UNPA 1ZM7A 4XD7A 4QNMA 4E22A 2GJAA 2LKCA 4PPFA 1TPZA 4PC7A 5FFMA 3M4YA 2XGJA 2X2EA 4FXPA 4P32A 4HZUA 1EFTA 1KNXA 4JVNA 2QM8A 2XSZA 4M1SA 4EFMA 1NMZA 1P2UA 2AKAB 1T3HA 5B58C 3PXGA 1AK2A 2GCOB 4JYBA 1ZC4A 2XX3A 4NDZA 4M22A 2RHDA 3CRQA 3GJ6A 2HCJB 2D2FA 2OLKA 4OJKA 3O8CA 3QJYA 3P27A 1G3IA 1M2OB 2AK3A 3GJ4A 2IYWA 3TH5A 3FMFA 4Q00A 1SVMA 4M4SA 2WIBA 2VEDA 3VR6A 4LDJA 5JCZA 3TQCA 1XX6A 2HCBA 1D2MA 2W6JD 4MKFA 3TAHA 3TQFA 2YOHA 3FVQA 1KO5A 4OQMA 4A8JC 5UKDA 2XNDA 5KTYA 2RCNA 1ZD9A 4QFMA 1E2LA 1YJ5A 1E2JA 5EP2A 3UG6A 3Q8XB 1EWRA 2GZAA 1WCV1 3KDSE 4FMBB 1SHKA 1R0XA 4OI4A 4PXAA 4NCNA 4L9WA 1KSGA 2BEKA 1DAHA 1E9AA 4NZYA 3IPYA 4A6PA 4BASA 2ZRJA 3DMDA 4IKEA 3SYKA 4DCSA 3OEED 3IBGA 1JALA 2FSFA 4B44A 1II8B 3VNUA 1V5WA 3OF5A 2O0HA 1GTVA 2VO1A 1X6VA 4UQOA 3OEEA 5FPYA 1RYFA 2HDNB 2RH5A 2GILA 4DEYA 3Q85A 3RWOA 5CDFE 1U81A 2P0EA 5GVSA 1DAGA 2X2FA 3LV8A 1BIFA 2CHQA 3A37A 1KGDA 2ZI5A 4HB3A 2ZS7A 4B3CA 2C2HA 1KJZA 1E9CA 2ZI3A 1T6NA 2DFTA 3NWJA 4PQYA 2NMVA 1J2JA 2V54A 4I99A 2O8DB 3CZPA 4X8HA 4JJKA 3B1ZA 2CXXA 4LYAA 2FEOA 1ZNZA 2IEZA 5JSZB 5E7IA 2GF0A 3UWOA 5D3QA 3OEHD 3NBYC 1W4AA 3UG7A 4CVNA 4BRWA 4ABYA 1G8HA 5HTKA 4BLSA 4TSFD 3CUEF 2HXSA 4GI7A 1XTJA 3AF2A 3W8NA 4RZXA 2JJ2D 4B71A 5E3HA 2XB2A 4F38A 2PMDA 5HKKD 4NYMR 3EIQA 1D2EA 4CYMA 2CCJA 2NO1A 2OT3B 2JLYA 3VX4A 3CW2A 3KQKA 3P32A 3LXRA 2RB4A 4YDHB 1RE0A 4M21A 2O8EB 2PEYA 2ZTSA 2O8FA 1IN6A 3AB3A 4DDWA 1T0JB 3AKDA 2CLDX 3D31A 1O3YA 1P9RA 1ZM9A 4PHFA 4RKEA 1P9NA 3LVRE 4BLTA 3J81k 4Z1MD 2IUSA 4ITRC 2IT1A 1XXHA 1CR1A 1GRRA 5BW8A 5A0FA 4AIIA 2WWYA 2IS2A 4TT3A 1S3SA 4LJYA 1W44A 1NJFA 1TEXA 1X86B 2OXRA 3CF6R 1AN0A 4QM6A 5FUXA 4LSGA 4Q4HA 4YDSA 2W6IA 1NVVQ 2QMEA 3NHBA 2GHIA 1ZCBA 2QM7A 5AUOB 2ZRNA 3VU9B 2Q6TA 3VKWA 2O52A 3A1VA 4MRVA 3TUJC 1N6OA 4NL4H 2ZSDA 1Z08A 1Z63A 2HYDA 3R9WA 4CEIA 1RC8A 2Q3MA 4QBFA 1GNPA 2WAYA 1W4RA 2WJGA 5BWMA 5JI3E 4W5WA 2G77B 2YC4C 1KMHB 2ORWA 1KOFA 4M1OA 3UXMA 3GLIA 5FPHA 3EPJA 4FI3C 4DT1A 4YMUA 2IS4A 3L8ZA 3OIUA 2ZUDA 4PHHA 1Z0JA 4UNNA 4KSCA 3QVUA 5C4MA 1TF7A 2JEOA 1E96A 3FFAA 2OCPA 3LWNA 4BEBA 2EW1A 4GNKA 4OQXA 2V1XA 4HEJA 3LLUA 4B3XA 4UJ5A 2K5UA 4DSUA 1XMVA 5EZ5A 1T8UA 5J4HA 2IS1A 4CT5A 1NLZA 2REOA 3TLXA 1QG2A 4TYPA 2UZ3A 2OHFA 1T3SA 2WAXA 3SFZA 3VU9A 3ADBA 3E1SA 3KQUA 3PJRA 5H8WA 2WOOA 3PUYA 2DCUA 4UXIA 3EIEA 1NN1A 121PA 3MWJA 4HLQB 2IYLD 4M1KA 2A5DA 2F3RA 3A58B 1DADA 2WZQA 3QKSA 4GP6A 4BLRA 2A5YB 1WE2A 2EYQA 2H7VA 1CS4C 3SS8A 3EZ6A 1GZSA 5CITA 1CULC 2VIIA 1Z6YA 3K70B 3DKVA 3BFKA 4R7ZA 5FBLB 1GL9B 1SHZA 4A0FA 2G3YA 3TSZA 2VL7A 3FKSA 4PHGA 2MSCB 3ASZA 2X19A 2G83A 1E99A 3K53A 2BJVA 3A1UA 1KK1A 1WA5A 5SZIA 3SJCA 5FOVA 2QENA 1JJVA 1QHNA 2ONJA 2ZJAA 1N5JA 4QHSA 4E09A 4Q19A 3KL4A 1CJTC 2Q9AA 3IBYA 2GXAA 5D3MA 1E4YA 1LS1A 1GM5A 2IF2A 2HV8A 4MUAA 2IHBA 5H1YA 1II9A 3FKSD 4LY6A 5BN3A 4TYYA 4N3NA 4URYR 4DBLC 3I92A 4KFRA 2XJ4A 1OF1A 3MAAC 2IX3A 3FYHA 1WRBA 4IOJA 4DEXA 2HYIC 2GAOA 2IC5A 3GCGA 2AN9A 4JZKA 3PFIA 2BWJA 5K8IA 2B21A 2VSXA 2ZRIA 5GJBA 3GLHE 2G1KA 4TLAA 4NBSA 4BWYA 2ZUCA 1II8A 2P2LA 3SJAA 4FWTA 4GBMA 1Z83A 2ZE7A 4NYJR 4DXAA 2ODWA 3RVBA 3FMOB 3KUDA 4BFVA 3V4FA 2W2TA 3AKEA 3ZZTA 4S35A 1Z0AA 5KO2A 2AD1A 3IHWA 3ADCA 2YKGA 2ZE5A 5TV2A 5JRZA 2PT5A 3QKRA 3UATA 2ZSBA 3AKCA 3D7MA 1QHHB 3MSXA 4LCBA 4A4DA 3LNCA 4KVGA 3N2EA 3EZ2A 4X8LA 1N0VC 4L5BA 2GNOA 2GK6A 2DB3A 1OLOA 4MKIA 5E95A 3CPEA 4PSAA 1XTQA 1U8ZA 1PZNA 2VPPA 4TLEA 4C3ZA 1OFTA 1IONA 2QTFA 4B2IA 2FWRA 1ZU4A 4DLVA 2F55A 1XZQA 3G5UA 1TF2A 2ODNA 1IXZA 4OHVA 1U2RA 3B85A 5FUWA 1D5CA 2FPMA 2J3EA 2MMGA 2ZSAA 1U0HC 1XPRA 2YWHA 2J0VA 2QN6A 4F4CA 1DARA 1QF9A 3KJEA 2RGNC 1Z2CA 2XJ9A 3H86A 3CM0A 4TTPA 3KQHA 3BGWA 3QF4B 3AEZA 3EPKA 3K0FA 2O8FB 3QG5A 3DO6A 4YONB 1COWA 1ZCAA 4NTZA 5LD2B 1KO7A 4KHZA 3WHKA 1JPJA 1JQLB 2ZRPA 2ZEJA 1LF0A 2ZU6A 1KMQA 2BBWA 1S1MA 1NLYA 3LH5A 3ZDQA 2PMKA 1OH5A 3U3RA 4DKXA 1DBSA 1AA9A 4L16A 2XOKA 2JIZA 3RC3A 2ZYUX 1GNRA 4GPTA 1E2KA 2F1RA 3U3JA 1S8FA 3RNLA 3NTUA 3WNDA 5EE1A 1P3JA 2KBFA 4RZ2A 5J4KA 4OHZA 5AUNB 2HJVA 4X8MA 2ZJ8A 1DAEA 4XWOA 1HH4A 2GK7A 3CWZA 4KYUA 3RRNA 3D6TB 2ZXUA 2VP4A 3LW8A 4HYYA 2VRWA 3RRMA 4EJSA 3MJRA 3GEIA 3OESA 1FMLA 4JLKA 1OH7A 1A7JA 5IF9A 4BFUA 5FOTA 3EARA 3U7HB 3F5FA 3PUXA 1W36D 3QF4A 4DJTA 4ZIRB 1DPFA 1Q57A 3CPHA 4KO8A 3ASYA 1E2IA 4Q21A 1M7HA 1BS1A 3DZ8A 4A8JB 1CP2A 2CHVA 4HLDA 2EYUA 2CLSA 1MRNA 5DSZA 1KDTA 2ECKA 5AUPB 2C9YA 3K0AB 4CEIB 3IEVA 1ZUHA 1CU1A 1QHIA 3QOFA 4TYWA 4YMTA 2ODBA 2Q3FA 4P3YA 3RS4A 3CBQA 3BB3A 5EUMA 3VMFA 1PV4A 5LB2A 3AVTA 1OSNA 4KXFB 4IDPA 1MR3F 2F43B 2RMKA 4JBYA 4ZKDA 4MKGA 1P60A 1YZLA 4HUQB 3U2QA 4BFTA 3PR1A 3AVXA 1OV4A 1QBKC 2Q0HA 4PZYA 3C41J 1ZW6A 3QPUA 1R0ZA 4ESHA 2QTVB 3S1AB 2FU5C 4Q7MB 3VR1A 3QBTA 4R9UC 1NIPA 1US8A 5FPTA 2PX0A 1F2UB 5KSPA 5FBVB 2OE2A 4R2HA 1GVNB 1MABB 2WJJA 3PG5A 2XNSA 2NO9A 4U7DA 1AS3A 2VF8A 2IUTA 2QPTA 3THYA 4BLPA 4J0QA 4BZQA 1FZQA 1OYWA 1KSFX 2EU8A 5BN4A 4V0LA 2R62A 1N3BA 1OIWA 5CJPA 4DLUA 4Q1CA 4EPWA 2C98A 3THXA 1RVDA 4UNRA 3MJHA 3CRW1 4B2LA 3NEYA 2R8RA 2H8KA 2IYSA 1DAFA 2YVUA 1W0JD 3KKMA 2QPAA 4HAVA 3B1XA 2ZAOA 1ZIPA 4NE2A 4R2IA 2J0QA 1WXQA 4NH0A 3QQ5A 4Q7JB 1VG8A 2Q9CA 1XJQA 5SZJA 4MYTA 2FZ4A 3KKQA 1PLKA 1P75A 1UF9A 3ZVRA 4MKHA 5KOYA 1P4SA 1LV7A 2WTUA 3A1TA 2FPLA 1NL3A 4ZI2A 2IYZA 2VP0A 3JZAA 1KI3A 1NVVR 1AQYA 3RC8A 2H16A 4D2IA 2P6RA 2CK3D 2IW3A 1M74A 2J1LA 1ZUNB 1UDWA 2QU8A 2IWRA 4EKDA 5L3VA 3ZQJA 1J7KA 4US1R 2O8DA 5JJKA 3SC3A 2IXGA 4HB2A 4WIAA 3P4YA 2FEMA 2J87A 3DPUA 3A36A 2F9LA 3K9LA 2BCJQ 1E2FA 3SJZA 2IHYA 3IEUA 1W0KA 1KK3A 1MV5A 4BLOA 1RZ3A 3CRMA 3B9PA 4UJ3A 2J41A 2QT0A 3AF0A 3TRFA 5JLJA 4KAXA 1OW3B 4RY2A 4GMXA 4ARZB 3CIOA 1U99A 4FCTA 3VR2A 4C2UA 5FTKA 4ASUA 4RVCA 1W7AA 2EFCB 2O8EA 6Q21A 2QP9X 3PV0A 4JJZA 2PJZA 3EPLA 2J0SA 3DOEA 5CYPA 3HPQA 4A36A 1IM2A 2P5SA 3I1FA 2ANCA 5FTMA 4CF7A 2H5EA 4F4IA 4LBZA 5KHOC 2ZU0C 1G7RA 4FD2A 3H1TA 4WZAE 1CR0A 1N25A 4IVRA 2IYVA 1M34E 2HLDD 3I8XA 5KDDA 1YRAA 4G5SA 4AKIA 1TMKA 2AX4A 4URUR 3ZVMA 5DLQC 3OZXA 5EXSA 2AWNA 4CDGA 3WNBA 4DLRA 3HP1A 1IBRA 3FHTA 3O47A 2J5XA 3SDZA 1M6NA 1KAOA 4KBGA 3LBNA 1IN5A 2P6UA 2YNMA 3BBPA 1BO6A 5DO9A 2XTNA 2QAGC 3I5YA 1W47A 1ZD8A 5EE0A 3FE2A 1KKLA 2B92A 1IY1A 2PZGA 3AKYA 4QG7A 1II0A 4TLBA 3B60A 4JLBA 4Q1EA 1P9WA 4NKRA 4DDUA 1KI8A 4NCIA 4Z8YA 3K0FB 2QA5A 1Q1BA 1AKEA 2BMFA 4MRPA 4NYIQ 1NMYA 3WYGA 3UPUA 2ZPTX 1KYIA 2AD5A 4Q03A 1YQTA 2EFDB 2ZRGA 5IK2D 3K70C 1Z22A 4D6PA 3MGCA 1A2KC 4DZZA 5CIWA 2ZRDA 4B3FX 4PQFA 221PA 1S9HA 3HYTA 1QHYA 2C95A 2A78A 1OKKA 3L0PA 3PEUA 3EWSA 4Q9LA 1VMAA 3OIVA 4IEIA 3CNNA 1SXJC 1LB1B 4HAXA 4BZPA 4FMDB 3ZVNA 2CVHA 4ZCLA 1J8YF 4C9BA 1JI0A 1XEWY 4BPBA 3HJNA 4MRRA 4V02A 4EUNA 2PCLA 4KSBA 1BOFA 4LC1A 1IXRC 3TR5A 1B23P 1Z6TA 4EJSB 2JLZA 5B2ZA 1N6HA 3C4JA 1S2MA 3EZ7A 1XTRA 5AK0A 3TUIC 3AVWA 2JJ8A 4H1UA 4BGDA 1HE1C 2XSZD 1N6PA 5H70A 4Q1BA 4ZCIA 1CF4A 2CK3A 5HE9A 1YU9A 2GEDA 2PEZA 3CF2A 3TMKA 1OXXK 2ZJ5A 2DPXA 4TSFA 3HU1A 4B6FA 1N6RA 1YE8A 4PQRA 3MLEA 1UKEA 5FR1A 5JEEA 1X8LA 4QJ4A 4CEHB 1JR3D 4URZR 2R65A 2ZRKA 3SBDA 2FV8A 2D7DA 2AXNA 3GJ7A 3VR4A 5IT5A 1US8B 3GLIE 3KKNA 1R5BA 2RKOA 3ZLJA 4KBFA 1QDEA 4C7OA 1YZNA 4LHYA 4WVFA 5EXPA 1LF5A 2WICA 1KNQA 4EJSC 2J7PA 1DVRA 2QEQA 2V55B 2W00A 4G5OA 1GOTA 4MITA 1IN8A 4Y0VA 4DCTA 3AP2A 2BBSA 3FWYA 5K8UA 3IQXA 3NVAA 4HUQA 4QXAA 4C0BA 1P2SA 2XOKD 2C8VA 1U98A 2BBTA 3NHAA 1XBTA 1LFDB 1E32A 1ELOA 1OFUX 4Q4JB 5DI3A 3VX3A 1NNEA 2WM9B 3GQBA 4A82A 2GKSA 2H1LA 2QROA 3W3AA 3LBIA 3T12A 4RJLA 2DHRA 2REXB 2QZ4A 2ONKA 2YHSA 3OE7A 4TQ9A 2BM1A 3RRYA 1HA3A 3SYLA 4JYCA 3VTKA 2ODEA 1TAGA 5EXXA 3FGNA 3LAWA 4MGKR 1O87A 2FZLA 1FUUA 2RGNA 2I3BA 3GD7A 4M2LA 3Q5EA 5G3YA 1AIPA 1P6XA 1EX7A 4HAZA 1EXMA 3OIWA 5FBRB 1Q0UA 2BKEA 1G5RA 4US2R 4EPVA 2LKDA 5FI1B 2VP9A 1UBFA 2P67A 5SZKB 3ZS8A 4KI0A 2GZHA 4Z54A 4C4PA 3GLHA 3U7EB 1L2TA 4Q47A 3Q7PA 2H17A 3U3OA 4AKHA 1ZD1A 1HQYE 3BB4A 1NJGA 4BFZA 3P26A 3WRXC 1ZNWA 2CL0X 5CM9C 3GFTA 4OI1A 3B7GA 4CT4B 3KJHA 3SQWA 4XTCS 2O8BB 1F5NA 4PO8A 2WWXA 5CB6A 1WBDA 3TJZA 1GKUB 2CNWA 3GLFE 3ZIAA 3KXKA 1XPOA 1H8ED 1M8PA 2X8AA 1X3SA 1N0UA 2VSFA 1QHGA 4BFWA 2YWEA 1ZAKA 4B3DA 4TYQA 4B74A 1FP7A 2C99A 3KTAA 3MUFA 1EFCA 1T5IA 2OAP1 1XCPA 4RCZA 2FFBA 1A5TA 4MUBA 1VCIA 4LHZA 2KE5A 1JBKA 3DOFA 5FL7D 4DUGA 3LX5A 1TU4A 4MRNA 2IXFA 4M53A 3TVTA 1E2DA 2R6GA 1R7RA 1E9BA 4KVAA 1YR9A 2YC2C 4TZ6A 4P31A 3VHLB 2YOFA 1EG7A 2UZIR 3HYRA 3CKLA 3GLHB 4D4KA 3QKTA 4C0SA 1UADA 1MRSA 1SKYE 2BHRA 2ZJ2A 3RS5A 3SBEA 3SHWA 4Q5IA 1M7GA 1G8FA 2QTHA 2YV5A 1FMJA 1HURA 3DKPA 3CRVA 3K9HA 1W2HA 1XJCA 3MWKA 2FH5B 5EE3A 3EA0A 2VYFA 1JB1A 4LUCA 2EFHB 4TTQA 1N5KA 5KPJA 2EFEB 2PL3A 3I32A 3P20A 3CX6A 3GPLA 1A1VA 4HB0A 5AWFC 3AVUA 3SJBA 1OH6A 3SR0A 3L0SA 2E87A 1MO5A 3LD9A 1KI1A 3LVQE 3AVYA 2NG1A 1MKYA 5JRJA 2A5FA 3C8UA 1ZIOA 5E7JA 1Q3TA 1E69A 5DHFA 1P7CA 1IAQA 4NYJQ 5CK4A 5TARA 3GJ5A 5HCNA 1TQ6A 1ANKA 5KNCA 4DDVA 1XTKA 1AZTA 3T35A 5CIQA 2E1RA 3K1JA 3FOZA 4FIDA 4QRHA 1KK2A 3M6AA 5FBQB 3R7WA 5A5GA 2F43A 3B6EA 4TL7A 3T34A 4M9QA 1ZM2A 1E3MA 1FOEB 4TQAA 1T5LA 2GESA 4Y0AA 5H68A 2ZJBA 1I4LD 4G5QA 1WBBA 1FUKA 3ND9A 5DYGA 1JNYA 1KO1A 1U0LA 3JVUA 4ZDWA 3U7FB 4QGHA 3WHLA 2GJSA 1CRPA 3NBXX 5HR5A 1OHHD 4MH0R 1P62B 2WOJA 3OHMA 5K8TA 2WPDA 2ZS9A 3QUSA 4JLJA 4PPNA 2KWIA 5C2JB 1VCNA 2ZI6A 4ZKEA 1NBMA 2UKDA 1XFAA 3HU3A 1NKTA 4LRWA 3AUXA 3RSLA 4WZBE 2JDID 2AWOA 1NIJA 5G3ZA 5B64A 3VHXA 1U9IA 2Q9BA 2DFNA 4NHOA 1F6BA 2ZETA 4DUGD 2QE7D 4Q9IA 421PA 2MSEB 4KV9A 4EIWA 3NKVA 1C1YA 3ZH9B 2PBRA 1SVWA 2N46A 1VIYA 2DBYA 4PC1A 3AGQA 5BQ5A 4GZMA 1W36B 1NVUQ 1FL9A 4FMCF 5KYKA 2XXAB 5FPKA 5HKKA 3BS4A 3VR5A 3TUZC 4HZIA 4MYCA 3BH6A 4HI0E 2R2AA 2XAUA 5FTNA 3WP1B 5C46F 1B0UA 1BH2A 2QGZA 2NO0A 4PANA 3ZGXA 4RFVA 2D06A 2DYKA 4XWAA 5EP3A 4LYFA 3R20A 3RANA 4QGGA 1YZTA 1Z0DA 2CCKA 3AQ4A 3EAQA 4WA7A 1I2DA 4BE7B 4M1YA 4Q02A 4GSYA 1NVWQ 2XTZA 2FFHA 2LWIA 2ZJYA 4NYIR 1KSHA 2JLUA 2NZ8A 4IVQA 4CZ2A 4KYIB 4Q4LA 3T1VA 2ZRLA 3NXSA 4ACBA 4DCNA 4EPXA 3ZZ0A 4Q9HA 4HDCA 2GZDA 1E2EA 2ZUBA 2O0KA 2XTMA 2P3SA 4DB4A 3CR7A 1XEXB 1RFLA 3BAFA 3F0TA 3V9PA 4BFXA 5GJCA 3O8RA 3EC2A 1BMFD 1SVKA 1XJ0A 3IIMA 1H8HD 1VPLA 5B30A 4B73A 1WQ1R 3I61A 4A2WA 3M0EA 4JVMA 5CB8A 2FA9A 2J9RA 2XNDD 2VP5A 4Q1DA 2YZ2A 1S4QA 5FH9A 4DSOA 1OXSC 3K9GA 5BYKA 4QJ3A 4FMCB 1D2NA 1G291 3DM5A 3CX8A 4TLCA 4Q66C 5JHGB 4WZ6A 2C03A 1GFIA 3UK6A 1CIPA 2ZRFA 3RRZA 2OILA 1XXHE 3U61B 4OBEA 2IYXA 4G1UC 2HEIA 1ODFA 1RRPA 2QAJA 4IFBA 2L0XA 3CZQA 3QPWA 4EQ6B 1TU3A 3M1IA 4IDOA 1XEXA 1VTKA 2G6BA 3W9YA 4OHXA 3MWLA 4DLSA 3IIJA 3ECCA 1NSFA 2PZFA 3AVQA 2XEXA 2ZI7A 1XWIA 3H0KA 4MGYR 1FQJA 4P0TA 2WV9A 2ZR0A 3SHFA 1G41A 3VKHA 5TMPA 1G17A 2VP6A 4Q7LA 3NC0C 4O0MA 2FN4A 1YRBA 4B43A 1JAHA 4W5HA 3N70A 1JR6A 2WKPA 5GJVC 2VHJA 1WF3A 4JL8A 1FFHA 3Q5DA 2ZYTX 4BUJA 2J59A 4QOSA 4TLDA 1K6MA 3W34A 4DT1B 2ERYA 1E0SA 4AURA 1TNDA 1IN4A 3PQCA 4POAA 4IDHA 4PC2A 4PTLA 1G8YA 2WKRA 1KI4A 4GT1A 5JHHB 1ZU5A 2V9PA 4E5UA 4ZO4A 3LW7A 3QPVA 3EA5A 1G6HA 2GJ9A 2VA8A 1DOAA 1XD2A 2RGBA 4O25A 2GXUA 5IK2A 5JFGA 1KI6A 1ZC3A 2Z5FA 4PHTA 4URWR 3T5DA 4C0JA 3PUVA 1IQPA 2RHMA 1RW4A 2JA1A 4LBWA 2YWFA 3VQTA 4F93B 3R7WB 1VYUA 1U8YA 3E70C 1OHHA 3O8DA 4B32A 1R6BX 4PZZA 5DGXA 1Z0FA 4FWIB 2JLXA 3V4RA 2GVDC 2BEJA 4W9MC 4CEHA 3L0IB 5EJEA 1DAMA 2HT6A 2N1BA 5DISB 1WDTA 4DCVA 4RCYA 1VCMA 2JATA 4NCKA 1N2CE 3GMTA 3SYNA 2X1VA 4D4LA 3T1TA 4PC6A 2IWHA 1QZXA 2NPFA 1VYVA 2QUZA 1S3GA 5J40A 2EWWA 3QIAA 4ZDJA 2AFHE 1YR6A 2Z4SA 2Z4RA 4JLNA 1CTQA 2HLDA 3U3KA 1MO6A 3A1SA 3C7KA 1TQ2A 2ASEA 4NU0A 4CIDA 4QHTA 1S1CA 1U94A 2BV3A 3F8TA 4IRUB 2OM2A 4Q4JA 5DI3B 3KQLA 2DFKB 2OCAA 1EK0A 4FCWA 3TW4A 2DY1A 4NMMA 3BXZA 2WJVA 3UKDA 5EXTA 5HCIA 3TSWA 4MDFA 1HQCA 4BRUA 3W90A 2B8WA 4G5GA 3TVDA 4D0NA 4ASUD 3GLGB 2BM0A 1LW7A 2QORA 2VHCA 4LOAA 5FOUA 1JR3A 4B35A 2DR3A 2IL1A 3N2IA 4DLZA 2Z6VA 1DAIA 4EPRA 4HLUC 1E2HA 3SU8A 2O8BA 3DHWC 1JXOA 1T8TA 2FE4A 4KLZA 4QM7A 1ESNA 2G9NA 3HPRA 3C15C 1E9FA 1C4OA 4PFSA 3EZFA 3TE6A 2ZIAA 4TN1A 5JBQA 4LV6A 1ZMXA 1TTTA 5KPDA 5EQTA 4FCVA 1PUIA 1FTSA 3KTAB 3UWKA 1Z5ZA 3LQRA 3QY0A 2ZRBA 2GCPA 3TK1A
chains in the Genus database with same CATH superfamily
1AM4D 1GTJ1 2OCDA 1PEKE 2Q5QA 4PLWA 1VCOA 3GGCA 5GZ6A 3NLLA 3V4LA 5BPHA 4YWJA 1R8SA 2GLXA 3BORA 5JJIA 1L9XA 4CF4A 2ORVA 2VLIA 2FPPA 5AHWA 2ZR7A 4TKUA 1PZEA 5FF9A 5SY9A 5J23A 3A6ZA 4ZPXA 5KHAA 4B79A 4KR7A 1T8RA 2ZSFA 2BJHA 3IQWA 5KWEA 5IULC 3MFYA 1Q17A 5F5XA 2IDJA 4MVJG 2WYOA 4IDBA 3U09A 5DBFA 2DERA 3ZU3A 3O8QB 3ZXSA 4AKTA 3PFHA 1UKVY 5AK3A 4M6WA 3AIKA 2OKCA 4JCOA 3PE3A 2JB9A 1M1YE 4DYHA 5DIZA 1KOLA 2BT4A 2G0TA 1G5TA 3JQ8A 1W5SA 4QXRA 4HNSA 2MR6A 4AY6A 2PT7A 3R0JA 1QB7A 4OMCA 5K3CA 5KKNB 1NM5A 3V1YA 3AB8A 4I8IA 3VOSA 2WNIA 5GONA 3U6BA 1SOAA 4LHSA 2BGRA 2VHTA 4WOKA 2J6HA 1ZK4A 2C4KA 1U0JA 1R4ZA 1JIJA 1CERA 1G18A 3AW9A 4AJHA 4F2HA 1AXRA 5DW0A 1Z29A 3N8HA 1TC2A 2I6QA 4KSYA 5I9TA 3RHSA 1AUPA 2WSSD 3DOHA 3G59A 4PYOA 4JXJA 2J9FA 2POCA 1QRAA 4EMBA 4AULA 2AHOA 4GGPA 4W4TA 2ZIXB 2QS9A 5KX5F 1T8PA 4B3GA 1OVGA 1DFHA 9MHTA 1MC1A 4WLOA 5HS6A 1P1IA 3IBSA 3KLPX 1P5JA 3MWEA 5CYOA 3V8QA 3E4DA 4KJZA 4PZCA 1RPNA 3HM2A 1J49A 4WTOA 3ZOZA 3VNVA 1HX7A 5C3UA 1ATIA 1Q7GA 2B4QA 3PEWA 3ITEA 3BULA 4JC4A 4DR7B 4H15A 2WP8J 3ZE7A 2HA5A 5EVJA 4V0NA 5NULA 621PA 3R41A 3D6MA 4G0QA 1K75A 3DMYA 5K0SA 4ZMBA 1XELA 4MQFA 3SBOA 5K03A 4B3BA 1KDRA 4D0LB 1K97A 3MJVA 4M9SA 1SK8A 1XZAA 5EESA 1IJEA 5KTSA 2PH3A 1NMXA 4G1MB 3CLUC 1FTQA 2M32A 2RAFA 1IATA 1N57A 3IJPA 4F2PA 1JTEA 5JISA 2ACKA 3EC1A 2N3ZA 5KHLB 3B3FA 2PPVA 4JOQA 3SHQA 7MHTA 3D0OA 1GPKA 4DLYA 1E94E 2QGNA 3N07A 2PJUA 4S04A 1FQKA 2ZR8A 2EFGA 3KAQA 5JJBA 1FFCA 1L5NA 5I8WA 4RKWA 1Z0IA 4FLMA 4EI9A 1W4ZA 2C9CA 3L1KA 3ORSA 2WJIA 3DMNA 3T7CA 1AMOA 1PNRA 1AQUA 3I4CA 4L5CA 3X1ZA 1TVMA 3LE8A 4NBWA 2BSXA 2F62A 2CLCX 2XMCA 3KZ1E 5FOQA 3BSWA 2ZJ3A 1SU6A 3WGIA 2GBLA 2QSUA 2YJZA 3D5EA 3Q8KA 4QGBA 1OYOA 3E18A 2NTEA 2LXNA 4QKQA 2XGSA 3HYLA 7MDHA 2GBPA 3EWAA 3NAGA 3HUEA 5JYCA 4ON9A 4XYBA 2IE8A 5CK5A 2OENG 2DLCX 1BW9B 2VZLA 4MVJM 1U2TA 3IFSA 2PGDA 4DNPA 1E7RA 5EUCA 3ZYZA 4FS3A 1JQJC 1CYDA 1D4FA 3IL2A 1FLNA 5AVVA 1YDFA 3W5HA 3K6SB 3IR7A 5AKEA 4KVZA 1JLRA 4FGSA 2WG1A 2RJ3A 3C3DA 3PT5A 1A27A 1SZJG 3WXMA 4YQFA 3ELYA 2ZANA 1QDUA 4TMKA 4GO1A 2P4UA 2QTVA 3DBRB 5L8VA 2NQ2C 3SQMA 3R5JA 1GRQA 3MWGA 3T3HA 1HR0B 3D3KA 1YOVA 2QUKA 4TS9A 3DMHA 2C7QA 3EXAA 4AY5A 2C31A 1M2KA 4U2FA 5JH7A 3PPIA 3E1KA 2VCEA 3ZHSA 2ZS8A 4ACAA 1T4MA 3WFJA 3O4JA 3THYB 1ISFA 1G7CA 1SU4A 2F1IA 2I55A 3D81A 1YI8A 1C8LA 3PPVA 4G5RA 1L7QA 1SHTX 4KMSA 4KLNA 1ENZA 1AKMA 5HFJA 3A4LA 3VVLA 4RLFA 2VDQB 1JWBB 1AC5A 2YH2A 1ZMOA 2GETA 1AKUA 1VHDA 4RV9A 3E5RA 5FHQA 3WNZA 3OUTA 1LLQA 5BVHB 3QXCA 4OM8A 1E6CA 5ALZA 3LFHA 1SWWA 4EB6B 1AJEA 2JLAA 2QV0A 3PGMA 1Y6QA 3H8WA 5TE9A 4P80A 4ZV9A 4YA6A 1OB2A 2WT9A 4P81A 2WM8A 2JFBA 4IFEA 3IMCA 4QGFA 4BNJA 1C4WA 4D41A 2PBLA 2XCLA 3VSBA 3GDWA 4BLQA 1JHAA 2V7VA 3H4MA 2UVQA 4CM6A 2GI4A 3EZGA 3IQHX 1Z56C 2IY7A 5LD2C 1GYPA 4KW7A 1KP3A 1G20B 4Q39A 4WFJA 3KO8A 2JHFA 4FKMA 1D1TA 5HJ5A 3QXJA 5M29A 4G2NA 4O0LA 1CT9A 1U8TA 4JLDA 3WMGA 1F20A 4JQCA 3VPHA 3PHGA 3VJLA 1DKOA 4ALIA 3ITKA 1VHJA 2ID8A 4LWOA 5C32A 3C14C 1MLDA 3CRNA 1ND6A 2C78A 4A3SA 2HJGA 4JJAA 3NQ41 1G5PA 2PL1A 3C16C 3O9MA 5AICA 1JKFA 2LV8A 4RTQA 3KSAC 2QRLA 3ENZA 1TX4B 2XMDA 4TROA 4ZRMA 3THOA 4XX0B 3TZLA 4AKEA 1EUZA 3CZ5A 1JIQA 1KVTA 1FDIA 1LV8A 3U37A 1PW7A 1QDLB 3AHJA 4GPAA 3LA6A 3PXBA 2FRDA 2J6BA 3GUCA 4ZALA 3QVLA 5AJVB 4B6EA 1AXGA 4NCBA 1T9GR 2KSQA 4EHBA 3NDBB 3ULKA 2IQ5A 3N9IA 3W3AD 3LUCA 3T5BA 4X3CA 4G23A 2Q46A 4BP9A 3LJKA 1IJFA 1BEUB 5K20A 1GPAA 2YXLA 4LJ9A 4YVFA 1GSAA 1UMCB 2HADA 2ZIGA 1HPLA 3F5QA 3KFXA 2PTGA 3I4LA 1FX0A 4XR4A 3SZMA 2RHGB 1RKVA 2NO5A 3IKMB 5EUQB 5LQNA 4EB8A 2BJWA 1WXXA 4D96A 1QJCA 3JWEA 1J0DA 4H6WA 4MLPA 3QJ5A 3Q8LA 2GVZC 1OWLA 1AMNA 2CMGA 1E9RA 3GFRA 1C3OB 3KEQA 4LKOA 1SCKA 1SZDA 3C7DB 5EPOA 1L5LA 2AW3A 2JLBA 4O2RA 3GNTA 4IFTA 4LI0A 1ULTA 2HWKA 1JG2A 2O5EA 2L2QA 3THWB 3TQIA 1UC4B 3IAHA 1MHPA 3V00A 5FOWA 3TG8A 2WF6A 2ZITA 1M1NB 2G82A 5CUQA 2ZYRA 5LDGA 4RGQA 2GBLC 4I1OA 3W6NA 1VE7A 1BU8A 2A4KA 4DBVO 2PLRA 4OEHA 2ZUTA 1P5RA 1W52X 2AK2A 4LGVA 3RT1A 1QO9A 2GM4A 2W6QA 3F90A 4W5JA 3USZA 4BGEA 1CJKC 1CBUA 4F6RA 5SICE 1R18A 4ARSA 2D00A 3FW1A 1T5BA 4NV3A 4DQUA 4H9GA 3E2IA 3VV2A 3WI7A 4OLBA 3NDPA 3HI4A 3GAMA 3RROA 3RT9A 4YUVA 4IWNA 1AKTA 4KVFA 4EDHA 4NFYA 4EB0A 2D3WA 3REQA 3BTUA 3GGGA 1NJ2A 1NW7A 4UUNA 4BVJA 4JJ7A 4RKQA 4YMVA 1M1YB 4GEKA 3AK4A 4LJ8A 3AHDA 5C31A 3P2MA 4O5AA 5EWLA 4A0SA 2VK8A 5JFTA 5JSQA 3A6PC 4JBWA 3BF7A 3HBJA 4PFKA 3G8CA 4IRMA 2Q6KA 1OAOA 1XTPA 1Q20A 2J0UB 3BMOB 3GFPA 3K9CA 2G04A 4NICA 4W5OA 3LDFA 1G64A 1XCGB 2BGIA 1DC3A 2FTKE 2XZOA 2P9GA 4Q1FA 4UAGA 5C53B 1H6AA 2CV2A 2J3MA 3HDYA 2NM0A 5AQEA 4P33A 1H8EA 3W9BA 4MUYA 4GF5A 3CWCA 2P7IA 3WX0A 1K5PA 2JCYA 1KF0A 2DWPA 4N0DA 3EAGA 5JMTA 1RABA 1NBMD 2IU3A 3I0MA 1PQWA 3OCCA 2CDBA 4JFAA 4NZZA 1XMQB 2WINI 3NBQA 5DZSA 4GKJB 4HWPA 5FHRA 3IPXA 1DC5A 1XEFA 2EJVA 4O3MA 4F06A 1UJ6A 4ZYLA 3RS3A 4ZMRA 1PGQA 3ZU5A 4CMKA 5F23A 2WYUA 2QZZA 2YHBA 3RUCA 3I6QA 3THXB 1BROA 1ULBA 3DGEC 3QE0A 1JSRA 5C9ZA 3IDFA 5B37A 4IJWA 4GRIA 5DGCA 1C7EA 2EKBA 2R8PA 4Z3DA 4AKSA 5C18A 2CV1A 3OY7A 4OI0A 1ORWA 2JLQA 3C6QA 5CAEB 1P1JA 2NUBA 4YP6A 3WA6A 4BMNA 5IRCD 4F11A 1K98A 1IIBA 1BMTA 1QPGA 2EW8A 3ED5A 5ULLA 3FZNA 3G2LA 4YI5A 2DFLA 4RVOA 3SF8A 4DVGA 1TZCA 3X1KA 1CVIA 4C1NA 4FU0A 1FSSA 2C96A 2PKEA 3FSGD 2N42A 2VYCA 2C2BA 4R5MA 2JH3A 1JEEA 1T0PA 2A92A 3UOGA 3ZU4A 2JFNA 4CQMA 4EJ6A 1DRVA 1HE2A 2YIJA 3IAS1 4AWXA 4CCSA 4FHZA 3WGYA 4QFDA 1JYFA 1DWUA 4LGMA 1J24A 2QGFA 5AM3A 4UOEA 4Q3KA 1TK9A 3COPA 4PXSA 4ZO8A 5JAMA 2BKUA 3I45A 5DH9A 1JKJA 1X7WB 2V7PA 4K9KA 2IF0A 4I6JA 2RBEA 3DVLA 3FTCA 3KQWA 3G49A 5CB4B 1YL6A 4ILEA 5LMNB 3H9GA 1HDYA 2C84A 3LWBA 5CCBA 1DQZA 1OIVA 1XA3A 2W6CX 2LDBA 4PYQA 2BR4A 1NQOA 1XPJA 3NONA 4JL5A 4EI7A 1DT3A 3DQPA 3NIWA 2Q07A 3ED1A 1HEYA 4OUKX 5DHAA 4YJ2A 1EUCA 1SELA 2C0CA 2NVBA 1NA5A 4HUTA 2GZMA 2JEYA 2CEAA 2XYHA 3DL0A 4HFNA 4QOIA 2IS6A 4D44A 1W4CA 4FE7A 2QL6A 2C20A 2FZCA 4LV5B 2DM6A 2OGWA 4G1BA 4RLHA 4XQGA 2FUG1 1QFMA 1DZ3A 1JJBA 1RLUA 2WMOB 3M9WA 3NKLA 5C1BA 1KAHA 1UEIA 4D26A 2WYHA 3D4PA 4GVLA 2EC5A 2C77A 2HK6A 3MD0A 4NWIA 4IGFA 4R69A 3QU4A 2YUTA 5C5CA 1L5HB 3D7KA 1PZFA 4K6CA 3ZYCA 1MFPA 1XCMA 2GHTA 1Q11A 4Q18A 1H2FA 2LCQA 4HB4A 2P68A 5IJ9A 1FTWA 4M99A 1PT5A 3VC7A 1E4EB 3B2EA 1JBEA 4EHNA 1MOZA 1SHUX 2O2JA 2QSZA 4C0AC 2P11A 2XQVA 5IAOA 2PRIA 4LWQA 1AGPA 1BZYA 1RXYA 3C85A 2YHIB 4GZ3A 4FM9A 4OJQA 3I4FA 1N0HA 4MVJA 4UUMA 3L7KA 1GL3A 1Z8NA 2OEPA 5G41A 2XUGA 2C92A 4A9AA 4CG1A 2ZB8A 1RWVA 4Y18A 3S8YA 2GN8A 4DXDA 2MSKA 4KTTE 5G4LA 1RPZA 1C7ZA 4TSRA 4OXQA 4G0YA 3IAEA 4NMWA 1F48A 4PSKA 4U8HA 3ZQ4A 1KTVA 2W7TA 5JQGB 3CN7A 4YT8A 3VI4B 4D8TA 5LDDC 3Q3JB 1QU2A 5DEIA 3ZTYA 2HNAA 4EBFA 4X91A 1ZD4A 3JYHA 3KKPA 3DEIA 4M1EA 4REQA 2O2ZA 5T4FA 3DC7A 1PVVA 1R0SA 1TW2A 3FMPB 3JQPA 4PGMA 3D3QA 2BLLA 4RF5A 4X00A 1DEHA 1P3DA 2I3AA 2HHJA 4K3VA 4YRIA 3WS7A 1SJ9A 1ID8A 2I1WA 4D74A 3GY0A 1DE0A 5FBWB 3IE0A 3HDHA 1KIMA 4JDUA 5TS3A 4E6EA 4F0JA 3HNPA 4QBGB 4KE9A 4UCQA 5DIFA 2FFAA 2V3VA 4HLCA 5LMUB 4TM8A 5HFAA 1FVHA 1Z47A 1A76A 4UCWA 4NEHB 4YP5A 5DMHA 5L45A 4DUYB 2XI4A 3ASVA 4O4HB 5DN6D 1NRXA 2QT9A 1YB4A 2X40A 2DZDA 5ILOA 4XWWA 4UU0A 3B6KA 1KJYA 2AC4A 2BFFB 4KXMA 4U02A 5D86A 1KDVA 3STHA 4F92B 4J49A 5JZ9A 4C3VA 5AVJA 2VUSA 1ZRHA 4DV4B 2A2ZA 1C1XA 1EK1A 1FJ2A 1W25A 3LL4A 3RVKA 3CB4A 3W6PA 1Y3AA 3WBJA 2J7PD 1L5RA 4RADA 2RGYA 4Z3KA 1WM1A 4YAGA 3DLAA 4KX5A 4U9IS 2ILTA 4O2AF 3L7DA 5I9MA 4Z6KA 2WJ6A 1XP8A 4JLMA 1EFRD 2XVAA 4F21A 1HDRA 3K72B 3TRJA 1LBIA 3EVTA 4IIJB 3I6MA 4Z1MA 3MELA 2UU9B 1Y37A 3YASA 2Z1NA 5I47A 3PEYA 5LWQA 5KDOA 5LP6C 5HZHA 1V25A 1RSZA 1NR7A 1EFHA 1Z4JA 1IHYA 1IUKA 3DEZA 5KB3A 2HUPA 3ZD7A 3AM1A 2G9VA 5L3SA 5KTPA 2I66A 1GPDG 3X1XA 3B1VA 4EWLA 1UOOA 4PS0A 4WXPA 3RD5A 3D2AA 3ZNPA 1CJSA 3BH0A 2XE4A 3IILA 1KOGA 1JHQA 1SPBS 1EINA 1G21B 4IMRA 4UBNA 1GUAA 2PTHA 4U9HS 1O0BA 2D5CA 4X7BA 4BMPB 4BMVA 2IZ7A 5A71A 2QUAA 3IOMA 4C89A 4HDSA 4DOMA 2X76A 2PUAA 3PBKA 3EFOA 3OUZA 2H31A 4IQFA 4OK6A 4PLZA 5BQPA 3V1MA 4US0R 3VPFA 2AKYA 3TF5A 2YV1A 5DBGA 5FLKA 5FI3A 3MRTA 2HU8A 2R6AA 1YVDA 3P2JA 3VR4D 2BELA 3ESZA 2NV0A 3MTBA 3QVSA 2F1KA 2NXEA 3OT5A 5G0SA 1TMGE 4C0XA 3DH0A 4DIUA 2ZJ0A 4FTWA 1CP3A 4LVOA 5C4IA 2YVAA 1XVUA 2ZVDA 1CEQA 1R2QA 3OE5A 3P5SA 1HKUA 1UJ2A 4GZLA 4J8PA 3SFVA 3W1WA 5J4YA 2OHVA 2PK3A 1ZCJA 2AXQA 3AR9A 5DGTA 1A4RA 1ZO8A 4F71A 1DWOA 1GPMA 2FN3A 3AV0B 3BHMA 3FIUA 3MVEA 1N2OA 2FUG6 2VDWB 2VP2A 4GKBA 2AUTA 4H35A 3NAZA 4IGIA 1Q0TA 3OJLA 4RSMA 4RHCA 3VPGA 4CKEA 1UDRA 1PJLA 1WUJS 2V03A 1Y9AA 3QX8A 4FGKA 1DJOA 4P35A 5AVSA 4F7DA 4FQ8A 3HR8A 2OFOA 1I3NA 3KVVA 3W0LB 1UPTA 3T3GA 5FEUA 1NFFA 4M0DA 5CGQB 5L3SB 1B8VA 1CUFA 3ND8A 5BT9A 1M5TA 1TT5B 4PYJA 6REQB 4P5PA 3C1UA 2MIIA 4OXRA 1ABFA 3GBPA 1PNTA 2FEXA 1KEVA 1DXHA 1XTSA 3EVNA 3KEOA 3L7YA 4I5EA 4EUEA 5BSWA 5A4FS 1QTNA 2Z57A 5DDIP 2BKLA 5FPSA 1IPEA 1NURA 4RGYA 4PZUA 1NC3A 2F3TA 3DAOA 4CEJB 2O6HA 1A4IA 5IJXA 3K6KA 3TAUA 2DJ5A 5KOJB 1RWXA 2B8TA 1Q0HA 1OFGA 1TVCA 4MR8A 1Z0KA 4JMPA 3R2JA 1MDBA 1EKXA 4JR0A 3A1WA 5LLDA 3T1OA 2R6R1 5GIOE 5EIAA 1XCBA 3EDYA 4ARZA 1E9EA 1R9MA 3M1LA 3CW8X 2QTAA 4M1QA 1CZOA 4HDRB 4LX8A 5CP8A 4UXJA 3QU9A 4AN0A 5BPFA 1M6YA 5AMXA 5EEGA 5H3LA 1Z82A 3MMPA 4B75A 3ADPA 4JLPA 4I50A 2XCIA 2O48X 3DEHA 1UFRA 1YXMA 4QUHA 2EGGA 3BE4A 1MO3A 1NN0A 3OMXA 4UTPA 1SKQA 3P0FA 5CRIA 5AJTA 1NYLA 1S9DA 3R0ZA 4EUFA 2BUBA 1WB9A 2G0AA 2Q8QA 2R751 3TO5A 2WYVA 2FCRA 1TF5A 1FTGA 2LW7A 3AP3A 3G85A 1PTJA 1XWWA 3LIIA 4R1PA 4TV8A 3UMVA 3ZCRA 3IQZA 5F9HA 3REGA 5IHPA 2OVBA 4FNOA 4XARA 1QIIA 3R9IA 3LL7A 3D8SA 4L8WB 4UBMA 5ETJA 5D84A 3OFND 1KAMA 3EHEA 4D99A 4DIKA 2H4HA 3NEJA 3FHCB 4F3KA 4TKZA 3V4ZA 1A72A 4KWIA 1SCBA 4H7KA 3DDZX 3V32A 3G8BA 3GGOA 4BFSA 2W58A 3I0ZA 3ACBA 2IW1A 5LZ5A 5IABA 4RSGA 4D4JA 1C9DB 3CVUA 1M1NA 3L84A 4WZBB 1HC7A 3I52A 3DVSX 1Q1EA 3RSFA 3F3YA 1N32B 1QYCA 1TRKA 4YAIA 2LCFA 3ZHQA 3QW2A 2R6HA 3O84A 4IXMA 1CUVA 1JGTA 1OPXA 1VRCA 1WL8A 4I4LA 3QUCA 4R3NA 3I2FA 4X7MA 5EE5B 1FX0B 5T4EA 4HRXA 2NO6A 3IPCA 1CXZA 1W9MA 2X2PA 2IHVA 3IAUA 3LUGA 3MG9A 3NRJA 1FY2A 4WKCA 1WETA 4B0PA 1VP9A 5AHOA 2AMJA 3ZW8A 1RQXA 4G63A 3ELDA 4ZZIA 1PLJA 2MSDB 2QN3A 4XPIB 3JASB 2CF6A 2PSJA 5JFOA 1GUZA 1NNSA 1H6CA 2H4JA 5AKXA 3RLFA 1O54A 4F5DA 4DV2B 4CI9A 3N2ZB 5AT1A 3H8JA 1PT8A 4UVGA 3L7LA 3U6KA 1QHXA 3G5LA 1D6JA 3QXSA 3H7IA 1F14A 4ZT5A 1X1RA 2X5NA 4UMFA 2Z4TA 2QNRA 5ERGB 1QIJA 1ZBDA 2H2WA 3HL4A 4UASA 1Q1ZA 4I3FA 2QIOA 4B3HA 1QK3A 2PU5A 3KKOA 4KCGA 3WL4A 2CFSA 3PIRA 4JJIA 4ERNA 1HYEA 4RZSA 3CGWA 1DKNA 3NHZA 1LK5A 4NBUA 1OXUA 1ZQ9A 2XBUA 5BSUA 4K88A 3OZEA 1N5IA 4LPKA 1R66A 4IWYA 3DVAB 1JFLA 1NV9A 4KIFA 2YWGA 5DE3A 2DHDA 5ADVA 4EL5A 1X80B 1XQ6A 3BG5A 1H1TA 4BJ5A 4RTRA 2JVKA 4KQIA 3ZS9A 2QVCA 3IYLW 2WQ7A 4XIIA 3ESCA 2HBRA 1KMHA 4KOEC 5IUNC 2M6RA 4DQXA 1EESA 1SBZA 2Q3HA 1MOPA 3JZMA 3RTBA 4D97A 4F96A 1QH8A 3FI0A 3CUTA 5CHEA 1GJRA 4DNFA 2QI9C 4IO0A 3T0IA 3QBVA 1VA4A 4JLWA 3O3MB 2IJGX 3DDWA 4U8GA 1GPNA 3C74A 5KMGA 4BXOB 2I4NA 2XE6A 2C4WA 2P69A 3LUAA 5CPFA 3SHVA 4LXIA 1LWNA 4J91A 4RGVA 3TIFA 2VJOA 1THGA 4LZLA 2Y1WA 2KMLA 3Q7QA 5ITZB 2O4UX 3KU4A 1SVLA 2HRCA 4KN6A 2XWSA 4TMTA 4D9HA 4DSZA 4DPKA 1OT5A 4C7OB 4J16A 3CS3A 4LRQA 2R1VB 4EHKA 5B12A 1H94A 2DCMA 1I6LA 3DQQA 2D5IA 2E5WA 4HFMA 4R2WA 3VSEA 3SQXA 5GM2A 3LUKA 4E1BA 3IMKA 3V2GA 5FIUA 3UWMA 1BMDA 5KU1A 4FOPA 1VI6A 1G4HA 2AFIE 4PIPA 3D1JA 2ZJOA 5FTLA 1XCOA 4DB2A 3QX7A 4NNJA 5IC5A 3RDPA 2ZVQX 3LI2A 3A1FA 1S96A 4ITVA 1N7IA 2GNPA 2EG5A 1V7QA 4WT7A 1M2WA 3D8BA 5CVEA 5KOIA 4OY3A 5DHTA 5WRFA 2ORYA 3U4IA 4RL4A 4B7ZA 2QBYB 1WJGA 1X7XA 2FUEA 4G0XA 2QG6A 3M4XA 2C8JA 1NUAA 3HXQA 1SFRA 4DRXB 1QVWA 1L7VC 1ORHA 3NBUA 4Z4GA 2O3SA 3FTNA 3GROA 1RM5A 4KRGA 2ZE8A 2OG2A 1JFSA 2OCYC 4TSKA 4UBKA 4GBED 3FWPA 5C4GB 2PXHA 3C3PA 1RYMA 4IJ5A 2J9YB 3R9XA 2RBKA 5H3CA 2I2DA 4IIYA 5TQVA 1QQAA 2PLWA 1JFFB 4JKOA 3IO5A 3SI7A 3M6IA 2YMQA 5DFAA 3KOUA 4J0HA 1LH0A 4X45A 2XB6A 1S02A 2WILA 1BCRB 1KQOA 1NJ6A 2FSIA 1QQ6A 1U1EA 3KR2A 1ZWKA 4J1SA 1CS0A 1UBTS 2GVNA 3FUXA 1WMSA 1JJ7A 3ZH2A 4J7UA 5GJWC 2VYQA 2Q7DA 1CJCA 2CDNA 1ZN2A 4NHEA 2O8BB 2EHDA 3FTFA 1W85A 2JAQA 4AN4A 3G2NA 4DCMA 1YQWA 1OB5A 4GUDA 3U49A 4O4JF 3OC0A 3RHFA 3ZHZA 1G16A 3KYCB 3UJCA 3QKRB 5TMBA 2ZYHA 4K03A 1QHHA 3ZGNA 1J8FA 5KSOA 2JCSA 3QVKA 3QXXA 4JR1A 1G19A 1L4KA 1VFPA 3BMQB 2XW6A 3GC6A 3UK1A 4C03A 2DHEA 3IEKA 4EARA 4U2KA 721PA 1KO4A 1KZ7B 3KNZA 3N3BC 3U60B 3DMPA 2OESA 2C4VA 2ZP1A 2G9ZA 3BE8A 2P0AA 3NOOA 4LC0A 3QF7A 1HYQA 1TZJA 2ZKIA 2O1WA 3E9NA 2OSVA 1MFZA 4RHUA 3VSAA 1XOIA 4FVTA 4JP2A 1RCFA 4QTTB 1KIAA 1NP7A 2HF8A 2JGIA 1G3UA 1YJAA 4I1SA 4DIDA 3OC6A 1NI3A 2KLBA 2HHCA 2OHGA 2IK8A 4JA0A 4A6XA 3ZBPA 3AF4A 4LJLA 2BGUA 1UBRS 4BP1A 1I36A 1ZN9A 3JQFC 4OMFG 2RK4A 3SZOA 1JAZA 3FRIA 4QU9A 3W5JA 1CIVA 1D5WA 1VE9A 1BHSA 1EFKA 1HZJA 1NUTA 3EVGA 3F8WA 4XYMA 5GONF 3MCUA 3FDZA 1CQJA 1RAFA 3N39C 5AVWA 1EEXB 2AN4A 2RDMA 5HXAA 3U5TA 5TPZA 4AFNA 3BT7A 3MWYW 1SY7A 4NBVA 1Q0LA 2Y66A 3KV1A 1O6BA 3TBKA 4CL8A 7AT1A 3GLIB 4YCAA 1FSZA 4BVGA 1QVRA 3KWFA 1WXIA 1XRQA 2G07A 2IHTA 2A7XA 2A86A 4L3VA 3PD1A 1K4YA 4CCAA 3DW3X 3EVZA 3OF3A 3FLAA 5FJJA 4DCPA 3VPSA 4WV3A 4RD4A 3D4BA 4IJMA 4G0UA 1XCJA 1PWZA 1QG4A 2AFVA 3LK7A 2OBLA 2QD5A 4WXHA 3P97A 5IM4F 3QSYA 1OFHA 1E7SA 1GRNA 1HDGO 2M6SA 5BOSA 3MYYA 3GPIA 4NENB 3ZLTA 4D9KA 1WU7A 2BLNA 2X1MA 1G8AA 1VMDA 1BWQA 2W4MA 3H5OA 1D04A 3JD1A 3N28A 5HPYB 3DLCA 2IYPA 3B7PA 3ICQB 3KLBA 3CNHA 4HX5A 1ISMA 1FYVA 5IDVA 1B8NA 1XRPA 2VOJA 3U7QA 5DGDA 1ZS9A 5H9VA 4WZBA 2CBGA 3PGXA 4HADA 4OYHA 1S5PA 4LHWA 4M8SA 4MDHA 3KYIB 5G40A 5ICCA 1AQIA 1L7RA 1NPTO 5GONB 3C3KA 2VZ8A 4H4EA 1TTPB 4U6SA 4DLTA 2ZXEA 2JGLA 4LOJA 4TLLB 3EQ6A 2AI1A 3LFUA 4K05A 3ST7A 2DPGA 1YQXA 1OX5A 2XYQA 2Q4OA 2ZB4A 3AFNA 4EDFA 4MCHA 1Q22A 4BYGA 1EFVA 5KYYB 3CX3A 5TR9A 4G41A 3ICEA 2VDNB 1PVOA 4KDRA 2YY6A 3PXDA 1QO0D 1A8SA 1G1MA 5FL7A 3D3EA 5IYZF 3UKJA 2KYRA 1G8GA 3A6FA 4D9NA 2JLSA 3QLVA 4ITUA 4K86A 1B43A 1ZA1A 5JNWA 4OKSA 2Y0BA 1XNHA 3LGXA 5BQXA 1AF7A 1XD2B 2W93A 3CYFA 4NP6A 5AUQA 3SDSA 1GFZA 2XCSB 4XD7A 4L2IB 1XLUA 4BUZA 2APJA 4PZEA 3GFBA 4CQLA 3K2BA 2XGGA 4K9QA 4PC7A 3FVVA 3M4YA 2EJUA 4TTJA 2FQQA 4FXPA 1YBVA 2I22A 3PPWA 4FFDA 4Y9UA 5F52A 5CFOA 4C29A 3J7AC 4B6QA 4QOGA 5KAMA 2GYYA 1EQUA 5U9CA 1EDDA 4ENRA 5TS2A 3STVA 5BR8B 2AKAB 5BN3B 4FFWA 1JEQA 4CV0A 5EZYF 3K35A 4QUIA 4HP8A 3ZNOA 5LQDA 4JYBA 4GXTA 5AM5A 1EH5A 1L4LA 1WR8A 2DGDA 2G72A 3K1ZA 2A57A 3HO8A 2D59A 4FFSA 2D2FA 2FSVC 2OLKA 4PS1A 4CTNA 5D5PA 4RVUA 5IHXA 3O8CA 1H2AS 1Q7RA 3P27A 5EMMA 3X43A 1J9ZA 2Y4OA 4IIDA 1OTHA 3EGCA 3U31A 1SVMA 2QTLA 2NSJA 4M4SA 2BEVB 5DU2A 2HTFA 5JCJD 5DWVA 5K0GA 3VR6A 4LDJA 1V4VA 4LISA 2L17A 3RBAA 1ABBA 1V7CA 5ALOA 5JXHA 2M1XA 1LQ2A 1XX6A 3EUEA 3GT3A 4F2WA 4KAJA 2FRDC 4A8JC 2YOHA 4GECA 2JKZA 3WB9A 2RCNA 5IASA 3D4IA 3WGZA 4YCLA 2C1EA 1E2LA 1EGQA 3Q87B 4E5VA 3BA6A 1O57A 1JZTA 5LOVA 2GZAA 3KDSE 1SHKA 4PXAA 1ZUD1 1FPQA 2IY8A 1GZHB 4J94A 4NCNA 3UQZA 2VPWA 4XM2A 3IPLA 1VMIA 1WB5A 1E8MA 3JQAB 3TZCA 3ZDBA 1N33B 2PZAA 4GBJA 1LLDA 2ZYAA 3SYKA 2V97A 3PX7A 3I01A 1SPXA 2VDKB 2XUDA 4HNGA 2FSFA 1XZBA 1II8B 5HKOA 1U4OA 1H66A 2AR0A 3I5MA 1MC8A 2VO1A 4YWHA 1NOKA 3DV0A 4HYQA 2GZRA 5IBRA 2JPDA 3VZDA 2GILA 4NBNA 2A9JA 1U81A 5GVSA 3UA3A 1X2BA 2P2DA 2XDYA 4UAVA 4D02A 4CXMA 5HGXA 2XUHA 4K9NA 2Z2IA 4BQFA 6GPBA 4HB3A 1RLOA 1DMRA 2BR5A 4D9FA 2IEAA 5DWDA 1B1AA 1JLLA 5FV4A 3HKDA 3TTSA 1PUXA 1XZIA 2ZI3A 2BTEA 3NWJA 5B1DA 4V38A 2O8DB 4K9RA 3KTOA 4X8HA 4MIYA 1U28C 3VGJA 2QTRA 1A8PA 2JZCA 3PNMA 5DV9A 1ZNZA 2E4ZA 4BX8A 3DAHA 1SXIA 3OEHD 3UG7A 4P7BA 4CVNA 3VM6A 2P35A 4KACA 1PK8A 3FY4A 5HKAA 5JDCA 4J6FA 4TSFD 2CXRA 2TMGA 5CFMA 5J5VA 4OXNA 1K3FA 2FR0A 1XTJA 4UTZA 3EXIB 2A59A 5K0CA 3EIQA 1L1RA 3NGMA 5EY5B 4Y9TA 1DC6A 2H6EA 3EXFB 3LT0A 2HREA 4ZWNA 3VX4A 5L7WA 2JLYA 3AR8A 3KQKA 3BCUA 1LD3A 1RYDA 4CM9A 1POXA 2GM3A 3PP8A 2O8FA 2PX8A 3AB3A 2BH9A 1SN7A 4TV8F 4Y2SA 2QM0A 4DARA 5KTMA 3AL3A 2WAMA 1O3YA 1P9RA 1ZM9A 1P9NA 3LVRE 4Y9SA 2FP4A 1ORDA 4LVNA 4YCNA 4ES6A 3PNVA 4JBNA 1MHTA 1FLDA 2XYRA 1GRRA 4D9IA 4WNIA 2IS2A 1YZVA 4P2GA 1RHUA 3ID6C 3UNXA 1FDOA 1S3SA 1TKAA 2Q0QA 1TCVA 2JGAA 1Z38A 4LJYA 1NJFA 5KJFA 2OXRA 1AN0A 4FSXA 4QUEA 4Z4IA 3VUFA 1G55A 1B26A 2HO5A 3HDJA 5BSEA 4R4JA 3ZNNA 1JG7A 2VWHA 1O9HA 4MLZA 3WYCA 1KMNA 1NVVQ 1JA9A 3A6EA 5DBOA 3M49A 3VKWA 4CLRA 2KQUA 1FFAA 5J2UF 1DBVO 2E4UA 5AW4A 3ROEA 1IUNA 3AOGA 1NQAO 2ZSDA 4QFCA 1V96A 2HYDA 3R9WA 2B7LA 3EQ7A 1ORRA 3ROQA 2J3QA 3OF2A 1D03A 1C4XA 1W35A 5BWMA 3ICOA 1PL6A 4FJ1A 4M8IA 2G77B 1EP2B 3JQ7A 2HW8A 1GTG1 3OX2A 3PTLA 1PGPA 4M1OA 1V5FA 3GVPA 2OKGA 4M1ZA 4TV9A 2NU9B 3UXMA 3NV9A 2JGRA 3GLIA 1TA4A 5FPHA 3VDQA 3U26A 4DT1A 4LF8B 1LFAA 4BCDA 4YMUA 1VIMA 4CTOA 4UHCA 1Q7BA 2VAWA 4EO4A 1O08A 3KUXA 2JEOA 1E96A 3PXXA 2CZCA 4OKNA 2ZIUB 1EWTA 2EW1A 1WMAA 3O4RA 4OQXA 1JB9A 2E6KA 2V1XA 4NSNA 4DMMA 1KYXA 3LLUA 4AY3A 3KKZA 5EZ5A 1T8UA 2V4UA 4E12A 3DDOA 2JFGA 3GPCA 1YSCA 4CT5A 4B80A 5GOTA 1RTTA 1QG2A 3NPAA 1FRNA 1VLQA 2OHIA 1IMJA 3LLSA 1Y8QA 1A04A 1I2CA 1TKRA 1PX0A 1T3SA 3QYPA 4L4RA 3KJQA 4MLDA 4G0VA 3SFZA 4E2FA 4COOA 4CM8B 1GEGA 3RVPA 2WOOA 3EDCA 4KO2S 3UC9A 1NN1A 2W71A 3LOUA 2BFNA 4Q3AA 4MHOA 1C7QA 5CW2A 2FZKA 1RJDA 4H27A 1DADA 3KUUA 2PZMA 4LDRA 4BKOA 1E2UA 1T8WA 2ZPUA 2ZWOA 3AY3A 1U28A 1UM9B 5JSKA 3SM3A 5CG2A 3ENNA 3SS8A 1IQRA 1LPPA 1F0NA 1GZSA 2R5FA 4PZPA 1K7YA 3SCZA 2YZ7A 4R6WA 4KYTA 2FCAA 5EMHA 5CITA 1CULC 5AM2A 1KTIA 4KHPB 3LWZA 3ZN2A 3DKVA 1PS8A 3BFKA 1R12A 2H2GA 3CO0S 4KGXA 5FBLB 4A0FA 4RETA 3Q12A 2GUWA 4AWBA 3FKSA 3KT0A 5CYGA 5I7UA 3WHPA 2YXNA 1LTKA 1JHZA 1J7JA 2Q99A 3HZOA 4YV1A 1C50A 2X19A 3UK7A 1E99A 1NJ5A 3LUJA 3A1UA 1XAJA 3SJCA 3RG2A 4NK5A 1BCSA 2ONJA 4UC0A 2OZVA 2NSLA 4E09A 2G67A 2H2AA 4GBGA 2Q9AA 1QONA 3IBYA 2FUKA 1E4YA 2JFHA 1WUTA 2RARA 2H29A 4RQBA 3RU9A 4MUAA 2WF8A 4J7AA 4LY6A 3FKSD 5CHYA 5H1YA 4D9BA 2ZTMA 1O1YA 5IAEA 1TRHA 4DBLC 4MMXB 3PSHA 4KFRA 2XJ4A 4GYKA 3L1VA 5HKLA 2LDXA 1OF1A 1HFKA 2C3MA 2IX3A 4DEXA 4L6CA 4JBGA 1F51E 1DTWA 2AN9A 4JXXA 2JGKA 4P2BA 4QPDA 4RGBA 4E08A 4GEGA 4HHEA <