2Q21A

Crystal structures at 2.2 angstroms resolution of the catalytic domains of normal ras protein and an oncogenic mutant complexed with gsp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
171
structure length
171
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-H-RAS P21 PROTEIN CATALYTIC DOMAIN
publication title Crystal structures at 2.2 A resolution of the catalytic domains of normal ras protein and an oncogenic mutant complexed with GDP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncogene protein
total genus 63
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 1991-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2q21A00
4DXAA 3LX5A 4TMTA 3CRQA 4MRPA 3AVVA 1UM8A 1DAHA 3TLXA 2JLXA 4CEJA 5G53C 4JBWA 4RZ3A 3LLMA 4CVNA 5F3WB 4A8JA 1Z2CA 4WIAA 4B2IA 1Z08A 4OI4A 3I4LA 1Z0KA 1JBKA 3ZIAD 2NO6A 4HATA 4BEJA 3IIKA 4FI3C 2Q6TA 2V55B 2Q3HA 3AUYA 5KNCA 2BV3A 4A2PA 1H8ED 3R8FA 3IKJA 1IN7A 2Z4SA 3OEED 3UMSA 3HWSA 3NVAA 4DLZA 1IJFA 1IJEA 1KSHA 2OXCA 4AI6A 3D8BA 4UXHA 4OQXA 3PUWA 1MOZA 2O8FB 1PLJA 4Q9IA 3U3MA 5FTLA 3B82A 2QGNA 3DOEA 1UKYA 4UNQA 2ATXA 4C0BA 2C2HA 2WAYA 4JIMA 3L8YA 2NQ2C 4P4SA 4DLVA 2C98A 1EXMA 3VR4A 1G17A 1E2MA 1Z6AA 4KV9A 2J0VA 3BIFA 2GJAA 2H1LA 2CL7X 4PAMA 1D6JA 3A58B 3GJ6A 1HURA 2QROA 4F4IA 4F93B 2VIIA 3K9GA 3LBNA 1NN5A 3V00A 2P6NA 3A8TA 3CNNA 3JZAA 1G8GA 3QENA 4Z1MD 2VTKA 4KBGA 3U2QA 3TJZA 2FF7A 3PUXA 4OI0A 4HAXA 4BWYA 1KDRA 1XMVA 1DVRA 5TARA 2ZE8A 1E4YA 4C0HA 2IX3A 1T3SA 1G8YA 1A2KC 1VCMA 3CBQA 2WOOA 2QAGC 2ODBA 1F3OA 1R2QA 2HJGA 2VHJA 3MWKA 1NP6A 3LXXA 3N2IA 5EE0A 4NCIA 1UDWA 2GJSA 4IVPA 1FTNA 5LB4A 2WJVA 5HCNA 1UADA 3E1SA 1E9RA 3HDTA 4B3BA 3K70C 1KJWA 1Z06A 3LQQA 2KE5A 1SGWA 2F3TA 1KI7A 1JR6A 1Q1QA 2A9KA 3IO3A 3TR5A 2G0TA 2Q9AA 2GXAA 2VRWA 2ORIA 4Q21A 4Q01A 4B44A 3THWA 2ANBA 1FMLA 3KDSE 3QXSA 1PJRA 3VNUA 4XVUA 5AJYA 2GXUA 3SHWA 3QSYA 1IONA 1GIAA 3B85A 4FMCB 3PXGA 2JASA 4RCZA 4M2LA 3V4RA 2J0UB 4LWZA 4O2LA 1RIFA 3VTKA 3GP8A 3IUYA 4EFNA 2AXPA 4B35A 5BN3A 2IWHA 1KTVA 3GFOA 1RKBA 5BQ5A 2K5UA 3GLIA 5FOUA 3AKEA 4TMKA 1R5OA 2XXAB 3BOSA 1XEXA 4HZUA 3MJRA 2GBLA 1N25A 1S8FA 4EQ6B 4AKEA 4POAA 3UATA 5DN6A 2WJYA 3QPVA 3OIVA 1CIPA 3FFBA 4AC9A 4WA7A 4DLYA 2BM1A 1XD8A 1Z0IA 2PMKA 4KHZA 4M1OA 4TSFA 4URVR 3GLHB 1F2TA 1JECA 3NDBB 1TQ4A 2AKYA 1BMFD 1QHSA 3CB4A 4OQNA 1G7SA 2GILA 3OESA 2AHOA 4B3GA 4WXPA 1AS0A 3QNUA 3CF2A 1KI8A 1P61B 1BOFA 3GLFB 2GZHA 4QJ3A 2P0EA 3UIEA 1WXQA 2YJTD 4C3ZA 1E6CA 2CXXA 2R44A 2QM7A 1Z3IX 1GILA 1OYWA 4AIIA 1KO7A 2BBWA 3RWOA 4EDHA 4TYNA 4Q9LA 2P3SA 3KXLA 4MGZR 4Q00A 1IN6A 2C99A 1X3SA 4LV6A 1EFCA 1IN8A 4I1SA 2AFHE 1QHHA 3QG5A 4DCVA 1K5DA 4QHTA 3SNHA 4NYIQ 2Y8EA 4A92A 1OH8A 1OIXA 4QJ4A 5SZJA 2A78A 3GD7A 3M1IA 4M9ZA 4X8OA 1R6BX 5M04A 2NMVA 2IYLD 2DCUA 2ODNA 2V4ZA 4IFEA 1XMJA 4TWZA 3OIUA 1RFLA 4LV5B 3BWDD 3FOZA 5AK0A 1VHLA 4OK3A 4X8HA 1OLOA 2WKRA 4OHZA 1LTQA 1DO2A 1E1QA 3AP1A 4PC7A 1IM2A 2OCBA 5HTKA 3J81k 4A8JB 3ZD7A 1II8A 2AWNA 5FUVA 3AM1A 4IDNA 1VG9B 2UVQA 4OQFA 3T61A 4B3FX 4ZI2A 2G1JA 4C2TA 3TH5A 5HZKA 5KSZA 5SZHB 3HU3A 2KI5A 2VH5R 4RD0A 3IILA 3QKSA 5AUQA 4HZIA 2F1JA 2P65A 3BE4A 1P6XA 4Q47A 1V5WA 3CF6R 4Z8XA 2OLJA 1P75A 3LWNA 2HXSA 4G0NA 4C0KA 2XOKD 5L3SA 1W48A 4TTRA 1YR6A 5LDDC 4ASUD 2C9OA 1D2MA 1G21E 2FNAA 4D6PA 1Z0DA 5HKKA 1LB1B 3A36A 2WZQA 4NHOA 1JXMA 4MYUA 3SEAA 1EFUA 2GEVA 1TQDA 1WA5A 4P4SB 4CW7A 3AVTA 2SHKA 3WYGA 3I32A 3ZYCA 2CMKA 1XWIA 2C77A 3MG9A 5JHGB 1FOEB 4C30A 3D3QA 4M21A 4UQOA 4JLAA 3ZQJA 3RSOA 1OFHA 4MUBA 2FGKA 2CL0X 3IDQA 2AWOA 2WIAA 3P1JA 3KUCA 5F9HA 4PO1A 1Z29A 1AQYA 4LJ8A 5EP2A 2WWIA 2FFBA 1DS6A 3P32A 3WNBA 3K0SA 3RC8A 4WXRA 1M2OB 3K53A 1KNXA 2HLDA 5FTNA 4PX9A 3TIFA 4P32A 1UBEA 1EFRD 2JIZA 4IOLA 1TF2A 2EU8A 3K0FB 4ZDKA 3VHLB 4HAVA 2VEDA 3RRMA 2GCOB 1DOAA 3SR0A 3I61A 1QF9A 1ONBA 1P72A 4O2RA 4ZCMA 5HR5A 1R0YA 4GMDA 1QDEA 2E87A 5JI2E 2BC9A 4RD2A 4AYWA 1M8PA 2O8DA 2ZRAA 1IN5A 3OFNA 1NL3A 3A1TA 2RCNA 1E99A 5FTJA 1AA9A 5FPKA 1DE0A 3SYNA 1Z47A 4L8GA 4EJSA 1N6LA 4XVQA 4DLWA 2NTYC 4OHXA 3NH6A 2W83A 4U5XA 2H7VA 1W5SA 1E0KA 2BOVA 4HLUC 4MKGA 4DUGA 4QXAA 2NO0A 4ACBA 2ZVPX 3NC0C 4FD2A 3ZS8A 4G5QA 4B6EA 3VQTA 5FL7A 5DNYB 2FV8A 3PITA 1CULC 1LS1A 1W0JD 3LY5A 1YJ5A 4NONA 5JSZB 3VHXA 3KKMA 4HUQA 3UPUA 1IXZA 2ZRLA 4B33A 1XD2B 3QXXA 2W00A 3FGNA 2NGRA 3LRPA 1NLFA 2XAUA 3W34A 5JEDA 4DB2A 4BQSA 1IXSB 5DISB 4D0GA 4YQFA 4CEIB 2FH5B 4DDVA 1CJTC 3HYRA 1K5GA 3T1QA 4KITB 3LV8A 4DIDA 3CONA 3EZ7A 3I8XA 4Q4HA 3UG7A 5C4MA 3CX8A 4C0QC 2BM0A 1UDXA 4RD1A 4M9QA 5J5CA 2IYVA 4B2LA 2YC2C 5P21A 3AV0B 3KQHA 1QBKC 1U8AA 1F2TB 3CPEA 2CLSA 2ZR0A 3KTAA 2WJJA 4FWIB 3RS4A 3TR0A 4HB3A 3PIRA 3QXHA 4DCTA 4HYYA 2W2XA 4M1SA 1CEEA 3UANA 4Q4LA 5HCIA 1Z28A 4OK5A 1OFIA 3QF7A 4BECA 3T12A 1GAJA 1M7HA 4ACAA 3A1UA 4I81A 2B8TA 2GEDA 2CVFA 1E2QA 2VHUA 1UEIA 1JPNA 3SC3A 1G6OA 5CYOA 2OE2A 4OQMA 3W5IA 3EIQA 1OV4A 5CITA 1E2HA 1FL9A 4P33A 1QHHB 5KDLA 2MMCA 2Z5FA 2EFDB 4KSBA 4UNPA 2RHDA 1OHHD 1NVXQ 4EAQA 3FHCB 3L2OB 3IIJA 3P4XA 4IDHA 4W5HA 3CLVA 4BEBA 3X1XA 4QM6A 4URWR 4MDEA 1I4DD 4BFWA 2W2TA 3U44A 1RW4A 1ZMXA 3JVVA 3NEJA 2ZPTX 1O3YA 3O8RA 3SBEA 1KI9A 1EX6A 3W8NA 3W90A 4OYHA 1FTSA 5KDDA 2GWHA 3V4FA 3GLFE 2BEJA 2PJRA 5JWHA 4HAYA 3T1VA 1VCOA 2J41A 4MDFA 1LF0A 3QKTA 5TVKA 4QBGB 4A0RA 4JMPA 4C2UA 2IXFA 3FFAA 2FSFA 3WRYC 5C1BA 4KJZA 2ZE7A 1CR0A 2DWPA 3ZVNA 4TL7A 4ZKEA 4KVGA 2FPKA 2CJWA 1JJVA 4HAUA 1HQYE 1US8A 4A15A 2H92A 1VMAA 1HA3A 4FN5A 4E5UA 3RS5A 1Z2AA 4KYIB 4XSHA 2YYZA 2GCNA 4MQBA 1ANKA 4NP6A 2HF8A 5JLJA 4ARZB 2JGNA 1CXZA 1Q0UA 1DO0A 3K0EA 4URXR 2WWXA 4AKHA 2R65A 4FIDA 1FMJA 5F98A 2QG6A 2ZJAA 2GXQA 4A8JC 2H18A 3SE0A 3TE6A 3BH7A 3IQXA 3FB4A 4ZKDA 1KK1A 2ZIAA 5FPHA 4II7A 3ZZTA 2N42A 2CVHA 2YV5A 3TSWA 4MKIA 4BLQA 5G3YA 3KJHA 3KJIA 2ZM5A 2O8FA 1N6HA 4PHTA 2PZEA 2WKQA 4RKEA 1U9IA 4QBIA 1TQ6A 1R8SA 1T3LA 4CEHB 2BKEA 1Q1ZA 3NHBA 1NVUQ 5DSZA 4BGDA 5HZHA 3MWYW 1TAGA 4NYJR 1MT0A 2ZYWX 2IW3A 2ZI3A 5CIWA 1N3BA 3WMGA 4QL3A 3C16C 1DAEA 1E9SA 3QG1A 4DVGA 2Z83A 1ZUHA 4LRWA 3RRYA 4NKRA 5K8LA 1DBSA 1R7RA 3CX7A 2GCPA 2XTZA 3CH5A 3KKOA 2V1UA 3Q72A 2PZGA 4YDHB 3TW8B 3RLFA 1RJ9B 1NY5A 1R0XA 1T91A 2OCYC 1YZQA 4DEXA 1NN0A 3PUYA 2XNDD 5L3QB 2CNWD 4E09A 3WYAA 1ZNYA 2B21A 3ICQB 1OB5A 2IYYA 2QRNA 2OLKA 2WJIA 3PG5A 2CCKA 2NIPA 3CRW1 4UNRA 1W1WA 3N2EA 3DZ8A 2FSIA 3EZFA 3OIYA 2QN6A 1OFTA 3WBJA 4D4MA 5CLLA 2A5YB 1LFDB 1FX0B 2QE7A 2TMKA 1E9BA 2CLCX 1YKSA 3UWOA 3W6NA 4FWTA 1X86B 4LC1A 3U7EB 2DFNA 4FMDB 4QC2A 2QZ4A 3U60B 4D26A 3X1ZA 5CYPA 3K8YA 4WVFA 4Q4HB 5HE9A 2ERXA 3QI2A 3A1VA 3U3RA 1XEFA 1Z6TA 4M1TA 2OM2A 3A1WA 4IFBA 4YLGA 5EP1A 4DDWA 621PA 5J47A 1NN1A 3CW2A 1VECA 5AWFC 3SFZA 5JRJA 5ELXA 4B74A 1YZTA 1XNJA 2FE4A 3K0CA 4TYPA 5H8WA 1NIPA 2WWHA 2GEUA 3EARA 4Q1CA 2QMHA 5JRZA 5JI3E 1EWQA 2DFTA 3NDPA 2QL6A 2ORWA 2VLIA 4C9BA 1NI3A 3AGQA 4HLDA 4IDQA 5HE8A 2IT1A 4DSNA 1R5BA 2BWJA 2J0UA 2EVWX 1LW7A 2GESA 3VFDA 2OZEA 1S3GA 4XD7A 1IY2A 3W3AA 3T15A 1DG1G 2NZ8A 3R9WA 1ZAKA 1NG1A 821PA 2BCGY 5JWOA 1GDDA 2XXAA 4K81B 1JR3D 5DE3A 2OAQ1 2IYRA 1EWRA 2YC4C 4KSCA 5IHPA 4PSKA 1ZW6A 1FZQA 1E9CA 5EXXA 1CTQA 1ZBDA 4ZCLA 1RRFA 3F0TA 1N5JA 3HJNA 4NMMA 5JCZA 4DRZA 1P60A 5IDVA 2GBLC 4X8LA 3EXAA 4BLRA 3FHOA 4PPQA 1ZM7A 3PUZA 4F38A 2A30A 2FFHA 2VF8A 1VIAA 1E79A 5AJWA 2OUKA 1J2JA 4QJ5A 3A6PC 2ZYTX 4PQRA 4BLOA 2J46A 3WYFA 2IBMA 2BCJQ 3CH4B 3RRNA 1G3MA 2W6JD 2WSSD 4Q7JB 1Z0FA 4Q1FA 5IK2A 1SULA 2KB0A 2VPPA 3N5CA 2BMJA 3GLFA 1QZXA 4RSGA 1U8ZA 2F3RA 1ODFA 1N2CE 4LOAA 1P2VA 4A2QA 1KJYA 5SZKB 4MITA 2B6HA 2E1RA 2W58A 1KZ7B 3RSLA 5FR1A 4AURA 3M0EA 2P6RA 1Z83A 4FCWA 4M4SA 1E96A 4JVNA 4H9GA 1G8HA 2QM8A 4RFVA 2Q9CA 2DWOA 1QHYA 4B47A 4IOMA 1Q57A 2CJWB 1AGPA 1YVDA 2WWYA 1KNQA 1FQKA 3I92A 1QHGA 2YOHA 2ZRIA 2Z0MA 5JMTA 2QP9X 2ZS9A 2V7QA 1XJ0A 2HJVA 2ZRCA 3KB2A 4W7SA 2OG2A 4DCNA 2I4IA 3DM5A 3T35A 1C1YA 1HT1E 2CE2X 4M8NE 1UPTA 4LJ9A 1DG3A 4RZ2A 1Z6YA 2ODWA 1XPRA 4GSYA 3EC1A 4W5WA 5IT5A 3I5XA 4LK2A 4CT5A 1II9A 4G5SA 5KNDA 3B1WA 1GNPA 4PXAA 3NIBA 3VR6A 3CKLA 4JJZA 3WP0A 5JWRA 2EYQA 1I2DA 5CLQA 1JQJC 2PL3A 3VR3A 4MGKR 2WPDA 5KUTA 1G8FA 3LXRA 4GZMA 4XVRA 4JYCA 2G9NA 5K8IA 3AF3A 1ZM9A 2P5SA 4K46A 5FI1B 1CF4A 4C0SA 1XEWY 3L0PA 3UK6A 4C0LA 4Q7KA 4LJAA 4XJXA 4ON9A 4QBHA 1KI1A 3K1JA 4JLOA 3B1ZA 4JL8A 3BFVA 2JAQA 3IPXA 2ZS7A 1ZNXA 2ZI5A 3PQCA 2PBRA 4RD4A 3REGA 3T5GA 4BFTA 1YQTA 2H8KA 1OJLA 4YXWA 4KLZA 3NBYC 3TAHA 2IHBA 4BLSA 2J7PD 1J99A 3NBFA 2VSFA 1H8EA 4I1OA 1PUIA 1L4UA 4PC3A 4AY2A 1MABA 2IEZA 4ESHA 1IBRA 2QTHA 3KXKA 4LV8B 1A5TA 2CHVA 4AD8A 3ZVMA 1JI0A 3G82C 4Q4JB 3K0FA 1FP7A 1XX6A 1MO3A 4ZDWA 5JBQA 1E4VA 3SDZA 2O8CB 4JKIA 2GCOA 1VPLA 2QTVB 4KO8A 4M53A 4Q1BA 3TSOA 1JEEA 2XEXA 1E2PA 5KSYA 3W3ZB 3KXIA 5E3HA 3U5ZB 4D25A 4EPRA 1RRGA 3RS2A 2IXEA 2RGDA 5E7MA 1W4RA 4LHYA 5B58C 4QNRA 3T5DA 1W36C 3MWLA 2ZVQX 1FNNA 2ZXUA 1E94E 4LYJA 2GK7A 4FMBB 5A5GA 1VYTA 3FMPB 3OHMA 3FKSA 1Q21A 4M1KA 5C46F 2MSDB 3K9LA 4A6XA 4TZ0A 1E0AA 2I1VB 4LJ5A 1SXJB 3QEJA 2P2LA 4JSTA 4EJSC 1ESNA 2JLUA 1II0A 2GAOA 1VYVA 5B57C 2FPLA 1E2KA 1E9AA 1KO4A 1CLUA 3AVQA 2ZI6A 3MLEA 4Q9HA 5A0FA 3RNLA 4H1VA 2R6GA 4A82A 2PCLA 1Z6GA 3A4MA 3AKDA 3NTUA 8OHMA 2F1RA 5JSZA 2V54A 4UXJA 2XB2A 2QMUA 1XD2A 5B2ZA 4LHWA 4C4PA 3M4YA 2PT7A 2ZRJA 1W5TA 3U61B 1OE0A 4NCJA 4JLVA 3PEUA 3L0OA 3Q7QA 3IBGA 3RHFA 4PC1A 4CEIA 3T34A 1U0LA 1G7RA 3HU1A 1C9KA 1X8JA 2BIFA 1G9XA 1XCPA 4QHYA 1Q1BA 4YMVA 5C18A 2AD5A 2F6RA 4ZDJA 3W5JA 5SZIA 1MH1A 3VNVA 2VHCA 1NVWQ 3C7KA 1JEDA 2JJ2D 1NBMD 4JLPA 3U7FB 2QUZA 4LSGA 4P0TA 1ZD8A 1KMQA 1J70A 1NF3A 3WY9A 3JVUA 1OIVA 4Z54A 3BB1A 1DTSA 1M7GA 4PO8A 1A7JA 3SN6A 2JLWA 5FOXA 2AR7A 4LY6A 5KSPA 1IAQA 1XZQA 1GKUB 5H70A 3IHLA 3U7GA 2LKDA 1XTSA 1GVNB 1OSNA 2MSCB 4H1UA 5DGXA 3TAUA 4MYTA 2C96A 2GJ9A 3DPUA 1WF3A 3CIOA 4I1VA 2VYFA 1PUJA 1T9HA 2ZJZA 5KSOA 1SVOA 3P27A 4TLBA 3CPHA 3AP3A 2R9VA 4XWOA 4DLRA 2RGAA 4A0FA 4EKDA 4ZIRA 1ZCBA 2GHIA 4MH0R 4PZZA 1Q12A 1EK0A 2EFEB 3CRRA 1YU9A 4YMWA 3EPLA 1W46A 2WHXA 1SVSA 3RDPA 4DEYA 3AVOA 2F1IA 3HP1A 1ZNZA 2WMOB 4TMVA 1E1QD 1S9DA 3EPKA 4EPYA 2FSHA 4KCGA 4A36A 3HPRA 4BZXA 2XJ9A 3JZMA 1HEIA 2R6DA 2R8RA 1QRAA 2RGGA 4LX0A 1Z0AA 2IYQA 3TGPA 1Q3TA 1IHUA 3SHFA 3WXMA 5J4HA 3O47A 1NMZA 4DLTA 2WWGA 2DFLA 2DPXA 1UBGA 2G0NA 2ZJBA 2LCFA 2ZREA 2GVZC 3D6TB 4TTQA 5EE1A 3K09A 5FPYA 3C8UA 4PZLA 2L0XA 1SVWA 1XTIA 1G7CA 4PFSA 4QGGA 1S1CA 2HUPA 4WZBE 1MRSA 3ONWA 4V0KA 1MO4A 3NHAA 2FFAA 5HKKD 1ZNWA 2ZRKA 2ZSDA 3OAAA 4PPFA 4PC6A 2EWWA 2GF0A 3I3SR 5DO9A 5FOTA 1WBBA 2GKSA 2ZRGA 2DWQA 2D4HA 2OCAA 4IEIA 3VR2A 2IYTA 3IQWA 1QVAA 3OE7A 4XWAA 2G1KA 1GUAA 5A4JA 3ZJYA 1QHIA 2JA1A 4A0HA 1AQUA 1GG2A 2H5EA 4NU0A 3EAQA 1P62B 2ZR7A 2WICA 3EZ6A 4V0NA 5TXGA 2X1VA 3AVWA 2IL1A 1E2IA 1S2MA 1N6NA 5CK5A 4KXFB 1UKVY 3ND8A 2B8WA 4ARZA 5HPYB 1BH2A 1E2GA 5KHOC 2JIZD 3DOFA 3VX4A 4KBFA 2W2VA 4OJQA 1MABB 1PVOA 1G3QA 3MMPA 2HYIC 3DVLA 4GDFA 2ANCA 3LQRA 2KJQA 1E1RD 1W36D 4IEEA 4PANA 1NKSA 3O8DA 4IOKA 1U98A 3BJIC 1KIMA 4JLMA 3K70D 3LD9A 1YR9A 3KQLA 2ZETA 1IY0A 1DPFA 2GJ8A 3AKCA 3OFND 3GJ3A 2O8BA 3BORA 5KPJA 2PEZA 6Q21A 4CEHA 3C5HA 3GFTA 1AKEA 2VA8A 3BBPA 1YZGA 4P4UA 2LWIA 4B75A 4MRNA 1U9IC 3KJGA 2XSZA 4DUGD 1V43A 2X2FA 3EPJA 3C4JA 4UKDA 1QHXA 5AR1A 3AH8A 5FL7D 1EFRA 3GLGB 1R0WA 1GITA 2EFCB 4TT3A 2Q21A 5GADl 1D2EA 1RJ9A 1NKTA 1VKJA 2ORVA 2REBA 2X19A 1J90A 3HYTA 5L3QA 3UKDA 2BBSA 2PX3A 1H8HA 2QSZA 4Q03A 4TLEA 2ZRHA 3FMOB 3H1TA 2QPTA 1G41A 2QORA 3E2IA 3OF5A 3M6AA 4AG5A 2WTUA 2ZRMA 1D9XA 1FP6A 5JEEA 4QRHA 1XTRA 2BKUA 1WRBA 2IK8A 4LJYA 1WBDA 1Q44A 2IYXA 4B76A 3B9QA 1FX0A 5TB5A 4EFLA 1T3HA 2OILA 1GM5A 3FE2A 2J0QA 4TN1A 3CZQA 2JDIA 1UKZA 3O8CA 3B1YA 3P4YA 2GETA 1X1SA 2ATVA 2Z4RA 3AKYA 1AZTA 3RS0A 4JYBA 3CPJB 2DYKA 2J59A 1VCNA 4XSGA 2VL7A 3LH5A 1VG1A 1BO6A 2CEAA 2ZQ5A 4RZUA 4NYMR 1OW3B 4DT1B 3MJHA 3LFUA 3BERA 2OCPA 2WWWA 2J0SA 1SXJE 1KKLA 3FPAA 4GL2A 1GSIA 1KY2A 4BFZA 1CR4A 4AYXA 1P2SA 2WM9B 2O8EB 2CHQA 3B78A 2J1LA 1G1MA 1G8PA 1X1RA 5CM8B 5FBVB 2D06A 3K0CC 3A4NA 2IUSA 5GJBA 2C5LA 1ZU5A 2RGNA 1E9EA 1XF9A 4N0EA 4Y0VA 5FTMA 1P9NA 521PA 3NH9A 1W2GA 4L9SA 5CJ2A 2WMNB 4PAQA 2NO7A 4OQLA 4OI2A 2A5JA 1XU4A 1ZUIA 4XTRA 5LD2B 5LB2A 3KFVA 3R8CA 4HAZA 3AF2A 2JLVA 5KPDA 2R6FA 4ZIRB 2WKPA 4MKHA 2R62A 2ZSFA 1OKKA 1E9FA 4HEJA 2XTNA 1KAGA 2JCSA 3Q9LA 4NCNA 3K9NA 2FX3A 3BB4A 4IJMA 2FDCA 4LDJA 4MKFA 4D4JA 4G5RA 4ZDIA 4IVQA 1HY3A 4LBVA 2AK2A 1BYIA 2W6IA 3CX6A 1P2TA 4QHSA 1BS1A 3BAFA 1XCGB 1ZP6A 1YZLA 5FBLB 1Z22A 2D2EA 4R9UC 3QF4A 3UMRA 4DC9A 2WWFA 1W44A 2BEKA 3KQKA 2OBNA 3KKPA 1CR1A 1Q20A 3ZDQA 3THXB 1VHTA 2O52A 2DBYA 2WJGA 2MSEB 4CDGA 1CJUC 1OFUX 2OFWA 2JLRA 2FZ4A 2AL7A 3QKRB 3GQBA 2C8VA 4CIDA 3KL4A 4G1UC 1UAAA 3NWJA 2P67A 4Q4AA 1G4AE 3X1YA 2C04A 1YZKA 1ZIPA 2Z6VA 3RS3A 1CJVC 1NIJA 2VBCA 4R71A 5DYIA 3MRSA 3TQCA 4DCUA 4DCSA 3RANA 2JJ1A 3CR8A 3TUJC 5CJPA 1TPZA 4R7ZA 4NE2A 3LVQE 3WRXC 4A4DA 1AKYA 3WNDA 5TDHA 1OT3A 3KKNA 1COWA 4V02A 4EFMA 3PV0A 3SJBA 1ZINA 4B48A 5EQTA 4KU4A 5GJCA 4QFMA 5KNBA 4DB4A 3DMDA 1P9WA 2N46A 3KKQA 3QJYA 1LS6A 3I5YA 1MR3F 4RY2A 1CRQA 4L4UA 5CM9C 5E4FA 2IF2A 2RKOA 1N0UA 2HT1A 3HU2A 4DJTA 5IRCD 2CLDX 1ZYUA 4LHXA 4K8OA 3AVPA 1W7AA 2J45A 4B34A 4MRSA 1XTKA 2OSBA 3FMIA 4UNSA 4AK9A 3LO5A 5H1YA 2C9CA 1NSTA 4I1UA 4ESVA 1ZM4A 2X77A 3BH0A 2EFHB 3TKLA 1XD9A 1QVRA 3B2EA 3RRZA 1TU3A 2O8BB 4LHVA 1HQCA 3I62A 4D82A 1P5ZB 2AFIE 4LJ4A 3SJZA 2ZANA 1T5IA 4QBFA 3NG1A 3X1DA 4D0LB 1W0KA 1KGDA 3MFYA 1B0UA 1M1YE 2YZ2A 1MV5A 2ERYA 3FMFA 3PVSA 2ZAMA 4IHQA 3TQFA 5L3RA 4AWXA 4BFXA 5BW8A 1A2BA 2JLZA 1HT2E 2VQSA 3IPYA 3QVVA 1X8LA 5GVRA 3X2SA 2QPOA 5JHHB 3C5CA 5K8TA 3AVXA 3AGPA 1AS3A 2QRZA 5ANRB 3BS4A 1XZPA 4M22A 4Q4JA 4MRRA 2XITA 1TX4B 5E95A 4A9AA 5L8VA 4QNMA 1W4CA 1CS4C 3DHWC 4V0ME 4A1FA 2O8CA 2AX4A 5EP4A 5BN4A 2QE7D 1ZC4A 4QOSA 3LW7A 4Q9KA 2UZIR 4R2HA 4W5JA 1DARA 2QENA 4U7DA 4BPBA 1HV8A 1CJKC 4NPHA 4Z8YA 1YZNA 1F2UB 4C0JA 2VF7A 4BZPA 4C7OB 2Z43A 5L3VA 4Z51A 2PJZA 3OEHA 3ZQ6A 3FTQA 5D3MB 5DLQC 2PMDA 3DM9B 5CB8A 1GFIA 1UBCA 3SJCA 4G5OA 4D80A 4L9WA 2RHMA 1F6BA 1SXJA 2A5DA 2AKAB 2BBTA 4LYAA 5FR2A 2QPAA 3U4QA 4B3DA 4FMDF 1KO5A 4ITRC 3GLGE 3GJ7A 4HB2A 4PQFA 1EG7A 1LY1A 4GNKA 4DSTA 1GOTA 1WCV1 2CL6X 2X2EA 1Q1EA 4P3YA 721PA 3SOPA 1OIWA 4LBYA 1ZJ6A 1M34E 2UKDA 4F91B 4TMZA 4RJLA 3W6OA 2OFXA 4TYWA 2F9MA 4B2PA 1QHNA 5C4GB 1G64A 2QI9C 5KOYA 1F5NA 3LNCA 3BFXA 4BFVA 3L43A 4B43A 3W9YA 5F9FA 5LBIA 2PH1A 2C03A 1GRQA 5F2EA 4RD3A 3LBHA 2RB4A 4CGZA 2J7KA 3DZDA 3AF0A 5FOVA 5AUPB 1E98A 3ZVLA 4DLUA 1KZGB 2VSXA 4YMUA 1RE0A 3H84A 3IEVA 2G3YA 3LAWA 3R20A 3GCGA 4PQYA 1EX7A 3CRVA 4LJ6A 4TZ6A 4DZZA 1E0JA 4JLDA 4Q9JA 2YNMA 3PUVA 3H86A 5EXSA 3SQWA 2CK3A 4JLBA 1U0HC 3EWSA 4Q02A 4M1WA 1EESA 3L8ZA 1KMHB 3QBTA 3AEZA 2HCJB 2QA5A 4JVSB 3CR7A 3QF4B 1OH6A 1L2TA 2XGJA 3R7WB 3QQ5A 1N5IA 2VP2A 4FCTA 4DIEA 4TQAA 2ZI4A 2A2ZA 4F92B 5G40A 5J4KA 3EA0A 1VDZA 2OEPA 2ZJ2A 4Q19A 5GJWC 3VX3A 1G5TA 1HH4A 4I4LA 4Q4AB 1UKEA 3CWZA 3ETLA 4BRWA 3EIEA 4JBXA 4PPNA 1SVMA 4G01B 4EPVA 2YWEA 3V9PA 3H0KA 1HTWA 1NBME 1JNYA 2H17A 2PCJA 1KOFA 3GJ0A 1YE8A 3TSZA 5LD2C 2V7QD 2ZYVX 2WSMA 5DHAA 1E2DA 3CO5A 3OZXA 4ABYA 2OAP1 4LGMA 5DI3B 3TUIC 1E2FA 5JJIA 4JL5A 2W6JA 4WBSA 4N0DA 1TEXA 2FG5A 2NPIA 1ZU4A 3WHKA 2UZ3A 2W0MA 1ETUA 4HLQB 4HSEA 5J4LA 2ZTSA 3PEYA 1G20E 4FXPA 1FUKA 3D31A 4Q18A 4NYJQ 4KAXA 2ZJOA 2AK3A 5FOSA 5C2JB 3TUZC 1SVIA 2ZUBA 3C41J 3THYB 1TTTA 3QKUA 2VP6A 2YHSA 4F7WA 2YKGA 1N6IA 1KO1A 2GDJA 4GOXA 1W47A 1ZCAA 5DI9A 1ZRHA 4HUTA 2PEYA 1OYYA 3KUDA 2CBZA 1RYFA 3DKVA 221PA 4A6PA 1G19A 3K09C 4NTZA 1KI2A 3GJ5A 1UF9A 2BJWA 1WE2A 4A0GA 4US2R 1VG0B 2IYWA 1KDTA 4U02A 4PHFA 4YXWD 1U99A 3LX8A 1PLKA 2FFQA 3AF1A 3E70C 4JT4A 4LPSA 1AS2A 2Q3MA 4NYIR 1F48A 4B32A 3TW4A 1KI6B 3AUXA 2F43B 1SKYE 2FN4A 3ZIAA 1CRPA 5BYJA 1OF1A 4XOIA 1KK3A 3I72A 1ZIOA 4R2IA 4N1AA 4GT1A 3OEEA 1P9RA 1L4YA 3EASA 3ADKA 4HAWA 2GTPA 3B6EA 1KY3A 2BVNA 3SI7A 2VHTA 4V0MA 3QXJA 4ZV4A 3AVUA 1K8RA 3N70A 1JALA 1GZSA 4RFSA 4BZQA 3HR8A 2FA9A 2ZI7A 5GJVC 5JJKA 4B73A 1P3JA 2RMKA 3B5JA 1TEVA 1DAFA 1IOZA 5CIQA 1X6VA 3L82B 4OHVA 3EC2A 4BUJA 1XDBA 3VKGA 3FDIA 2RGEA 2QGZA 1P7CA 2XB4A 1ZM2A 4GBMA 4GP7A 1E2NA 2IS6A 3FKSD 1XXHB 2R6AA 2J7PA 3T06B 3FKQA 5TV2A 2ZRBA 1G3RA 2HXYA 3P20A 2VSOA 2ONKA 4GOJA 2VP9A 4URUR 4MYCA 4IXNA 1CP2A 1JAIA 4TL6A 1PV4A 2FEMA 3W8RA 3DEFA 4L16A 1TADA 1KJZA 1G6HA 1AGRA 1E0SA 4Z1MA 3RVBA 3SZRA 3GLGA 2QT0A 4BFSA 4DSOA 1E2JA 3U4QB 2WAXA 1G16A 4EIWA 2VP0A 4RKFA 2BMEA 4NCKA 3GJXC 3T1TA 4O25A 4PC2A 1GKIA 4RD6A 5EUQB 3QBVA 4ZI3A 4TTPA 3U3JA 5BXQC 3QVUA 3EX7C 3EZ9A 2MMGA 5IF9A 3UMFA 5JFGA 1XP8A 2NPFA 1GTVA 1J8YF 4HLCA 2J87A 4DBLC 2G77B 3G0HA 1KI4A 2YWFA 1Z8FA 2O0KA 3BD9A 4MRVA 3CF0A 2AN9A 5B64A 1GKYA 2QQ0A 1UBFA 3VU9B 5DN6D 2P6UA 1G18A 1IN4A 4FMCF 3Q5DA 2RGBA 3E5HA 2REOA 4CF7A 2JATA 3AQ4A 4RZXA 3PENA 4TSFD 1HE8B 2WV9A 3DDCA 3EZ2A 5H68A 4DDTA 2NG1A 3IIMA 3ZD6A 2REXB 3BC1A 1TU4A 2D7CA 1TUEA 3DL0A 3VR1A 5AJZA 4BE7B 4AG6A 4LYHA 4YDSA 2A7QA 1UJ2A 4IXMA 1YRAA 4JKYA 4YONB 4JLJA 4XH9B 3B1VA 3SFVA 4DT1A 5EJEA 2BJVA 3QOFA 1SQ5A 2YWGA 4OKSA 1SHZA 2XX3A 2IS2A 4Q7LA 5FUWA 4IKEA 2O8EA 1G5RA 4GFDA 4RVCA 2ZSAA 4L15A 4OJKA 3VKWA 4CYMA 1CBUA 4QGHA 1VG8A 3B8HA 3RS7A 1QG2A 3B9PA 1NVVR 3C15C 2WVJA 3CRMA 1S96A 2A3RA 1IXRC 1N0VC 2RGNC 3I8SA 1KK0A 2AXNA 1AK2A 4FCVA 2IWRA 1Q22A 2JJ2A 3W6PA 1NBMA 1RVDA 1OXVA 4KVAA 2QMOA 3C14C 1KKMA 1I4TD 5FOWA 4JSYA 5DH9A 2ZJYA 2XTMA 1W4AA 4TLCA 3MGCA 1BMFA 4JVMA 4NL4H 1RYHA 4LJ7A 3OIWA 3S1AB 4MUAA 4WZAE 4EPWA 3VAAA 4A2WA 3GEIA 2CHGA 2OV2A 3P26A 1LVGA 2LKCA 2ZE5A 5JS8A 1AM4D 4KYUA 2YINC 5JECA 1Q3HA 5TMPA 3U6BA 2V9PA 1XPOA 1N6KA 5EE9A 1RRPA 1N5LA 1GNQA 4EUNA 4WW0A 1F60A 3THXA 4GPTA 2ZJ8A 1MO5A 3IO5A 4M0LA 1C4OA 3VMFA 3QKRA 3OAAD 2HCBA 3Q8XB 4J0QA 3WP1B 3ZVRA 3SYLA 5AJXA 1KSJA 4CEJB 1R10A 2IUTA 3QE0A 3TBKA 4D4LA 1RZ3A 2QU8A 3OE7D 4CRWB 2FMXA 1RRCA 4GRAA 3QY0A 1SZPA 1YRBA 2FZLA 1P4SA 1XEWX 2CCGA 4KFRA 3D7MA 1Z0JA 2PLFA 3NEYA 2ZE6A 2OHFA 1AN0A 2GA8A 1NMXA 1S9HA 3EIHA 1G7TA 4TLDA 3MWJA 4L5BA 1XRJA 1Z5ZA 4N3NA 2O5VA 3LW8A 1XJCA 1T4GA 1ZD1A 1T0JB 1UEJA 5EUMA 4M1MA 2Q3FA 3G5UA 3Q3JB 3DMNA 4ERNA 2FWRA 4URZR 2BMFA 4IRUB 1OXSC 1WQ1R 2IA5A 4OI1A 5KO2A 1XMIA 2IS4A 1AJEA 1BKDR 1D8TA 2HLDD 4URYR 3AB3A 2P5TB 2CCJA 4Y0AA 4ZO4A 2BHRA 4LBZA 2ONJA 2XZPA 1CKEA 1WP9A 2VO1A 1OXUA 1KDPA 4MGIR 4U00A 3EA5A 4WAUA 3DO6A 3QUSA 5CB6A 1N5KA 1WDTA 3PFIA 2XOKA 1R8QA 3NBZC 4P4TA 4V0LA 1R0ZA 5FBWB 2VP5A 5TY0A 3TVDA 3WBKA 4QM7A 3RWMB 4ASUA 1W49A 4YMTA 4RFSB 1Z07A 1Y63A 4US1R 2DFKB 3SS8A 5CDFE 2B7BA 1DAMA 2QBYA 4PTLA 3KQUA 2IYZA 3EW9A 4D2IA 4XWKA 3BFKA 2J5XA 1YR7A 4NH0A 4JL6A 1QG4A 5AUNB 1JXOA 2IS1A 5BN5A 2XSZD 2F7SA 3EG5A 3ZLJA 4WOPA 1ZVQA 4LC0A 4DLXA 2ZSBA 5DHFA 4FW9A 3KJEA 4IVRA 3I1FA 4F4CA 3ZZUA 2ASEA 4CT4B 2FJUA 2CDNA 4TT3D 2D74A 2EYUA 1AIPA 2IEYA 2QAGA 5G3ZA 5KTYA 2J9RA 3H2YA 1Z63A 1X8KA 2IYUA 1E1RA 1HE1C 2QNRA 2YVUA 3F5FA 4B3XA 1H8HD 3EWAA 4AKGA 4M9SA 4YMSA 3CNLA 2C78A 4NZYA 1R4AA 2DB3A 5FPTA 1KSGA 4P31A 1VYUA 3QEOA 4UJ3A 4NCHA 4BFUA 1YZUA 4JS0A 1MO6A 5FUXA 1W2HA 5J4YA 2V6IA 3LLUA 4KI0A 4OHWA 1FNMA 4FINA 5AJVB 1KYIA 1G291 2ZSEA 2F9LA 2JDID 4D0NA 3ASZA 4TMWA 4M1YA 2IF0A 2FU5C 2QY9A 4AYTA 3THWB 4KFSA 3ECCA 5DIFA 1ELOA 1F2UA 2RAPA 3K0AA 3RABA 1N0WA 4C7OA 4ZCIA 1GL9B 3B1XA 4BLTA 5EXTA 1XXHE 4B3CA 2HEIA 2JLQA 4E07A 5D3MA 3SYKA 3UWKA 2HF9A 1NVVQ 2GZDA 3AP2A 1NJGA 4GMXA 3VR5A 5FI0B 1E3MA 4E03A 4G3XA 4TQUS 2OT3B 1W0JA 4MGYR 3GJ4A 2XNSA 3ND9A 3ADDA 4G5GA 1XFAA 4M9XA 1IQPA 1BIFA 4YC7A 3GLIB 1FFHA 1NRJB 2CE7A 4LZZA 1E32A 5DYGA 3FYHA 3PJRA 2V6JA 3WNCA 4V0OA 3MD0A 1XEXB 4HZUB 5FBQB 3TRFA 1CU1A 1SXJC 2ZU6A 3LA6A 4TLAA 3LBIA 3B60A 3PEVA 1EFHA 1H65A 4HB4A 3SU8A 4X8MA 1GRNA 3F8TA 3WMFA 2ODEA 3KQNA 3BRWD 1N6PA 3DKPA 4LYFA 1S0UA 2VHQA 2QQEA 3A4LA 2KSQA 2D7DA 1E69A 1LNZA 4V03A 2B7CA 4TYQA 3WHLA 4PSVA 3O8BA 3SQXA 1OKKD 1T6NA 2A5GA 4GP6A 4TQ9A 1YHNA 3TNFA 4HDOB 4UJ5A 1I4LD 1P73A 5E7JA 4NDZA 2DR3A 1IY1A 2GJKA 2W6ID 1G3UA 2DHRA 2KBEA 4PAOA 5B30A 1EFTA 2BMDA 4EPXA 3B13B 2ZR9A 1VCIA 4JVLA 3L0IB 5EXPA 3GPLA 3ICEA 1TQ2A 4PR0A 2EQBA 1TL7C 2JLSA 2KBFA 4GZLA 1GL7A 1PZNA 1KMHA 4PPGA 2OBMA 1G5PA 2D3WA 2RGCA 4JZKA 2JJ8A 4JBYA 2IYSA 2OESA 3R7WA 5AUOB 1XPUA 2IUUA 4KFUA 1LF5A 1E2LA 2AD1A 2NOAA 3MCAA 4ILEA 1JR3E 3ASYA 2QSYA 4B71A 3B7GA 2OFOA 1T0HB 1A4RA 1OHHA 3Q7PA 1YR8A 4KODA 2F1HA 1U90A 4HI0E 3SBDA 5KU1A 3RC3A 3GLHE 2JJ1D 3QXCA 4D81A 2BDTA 1XJQA 2QP4A 1DAGA 1COWD 4TYYA 5LPNA 1II8B 2X8AA 2GAAA 1NLYA 5EE5B 4CZ2A 3TVTA 3RYTC 4IOJA 5DI3A 4IW3B 1JAHA 1SKYB 3IEUA 4PSAA 1CJMA 2ZYUX 3FHTA 3QKSB 4DLSA 2XZOA 1NG9A 4PHGA 4UNNA 3IBYA 2YOGA 4HB0A 2ZRNA 2RGXA 3K9HA 3KFXA 3NXSA 1M6NA 2ZUDA 1JJ7A 2D62A 5L3SB 1T8UA 2HV8A 3ZZ0A 4OK6A 2PT5A 1GRRA 3PCRB 421PA 1NSFA 1S1MA 1O87A 3WMEA 3ZGXA 1XMSA 3KX2A 2VP4A 3THYA 5J40A 2DY1A 1WB9A 1ZM3A 1TF5A 3UG6A 1CR2A 4DSUA 5CDFA 2H57A 4BRUA 4E22A 1T8TA 2XZLA 1RC8A 4Q7MB 2GRJA 2G83A 4GOKA 4S2EA 2XJ4A 1FQJA 2A5FA 2FGJA 3Q5EA 4OBEA 2QBYB 2FEOA 3CUEF 1A82A 2EFGA 2OXRA 2ZI9A 1W0KD 4C0AC 4NBSA 1N6RA 4Q1DA 1DAIA 1M7BA 2ZEJA 5FL3A 1R5NA 3I73A 1G3IA 1MKYA 4BFYA 5JCPA 1DELA 2G88A 1KI6A 2YWHA 2F43A 2QAGB 4QGAA 2G6BA 2OO7A 5UKDA 1XCMA 2V8OA 2ZRDA 1NNEA 1HUQA 1UFQA 2ZS8A 3U3KA 1W36B 3KB1A 2GZAA 2I3BA 4HDQB 4KFTA 3K70B 1JPJA 4GI7A 4JLKA 2WBLC 1ESMA 2Q0HA 5GVSA 2O8DB 2I1QA 4JLNA 5FPSA 1XBTA 1E9DA 5JJLA 4O0MA 2ZROA 4LBWA 4Q66C 4HLUA 3R9IA 4NYMQ 1GNRA 1LV7A 4EJSB 3AF4A 2FPMA 1JB1A 4WZ6A 5CK4A 3NKVA 2PZFA 2GF9A 2B92A 3EPHA 3Q85A 4R98A 2QEQA 4TL9A 1GL6A 3OEHD 1U0JA 1T5LA 4I99A 1KO8A 3K0AB 1XXHA 3CZPA 5EZ5A 4KLNA 2ECKA 4Q5IA 2WIBA 1DADA 4PHHA 3CWQA 4DDUA 3MUFA 2WJHA 2GK6A 2HYDA 1SXJD 3ZS9A 4D4KA 4EPTA 4O3MA 1OXTA 4HUQB 2W0SA 3GMTA 2XNDA 2CNWA 4ZPXA 2FOLA 2YOFA 1RPZA 2IXGA 2R2AA 1S4QA 3PEWA 1OB2A 3BH6A 1J7KA 3L0SA 3UXMA 1ZUNB 2NO9A 5EE3A 1PLLA 4OHYA 1GWNA 3ADBA 4W9MC 1U8YA 3HPQA 5K8UA 3KZ1E 1NJFA 2J3EA 2R6CA 3NC1C 4BLPA 4AKIA 4XD7D 5BWMA 1S3SA 2GXSA 1ZC3A 4QKQA 4MA4A 2F55A 1SHKA 1NLZA 4Q1AA 5G41A 3TMKA 2E9SA 3ADCA 2WOJA 2PX0A 4LI0A 4OL0A 1OH7A 5KYKA 1U2RA 3X1WA 3F3YA 1L8QA 5JZVA 1Y3AA 1XB2A 1W4BA 1U94A 4JJKA 1A1VA 4BASA 3U6KA 3PR1A 1D2NA 1M74A 3VU9A 3IHWA 5FTKA 2HT6A 3SJAA 4DKXA 3AVYA 3U7HB 4LPKA 5FBRB 3KTAB 2QTFA 3NBXX 3GFPA 1JQLB 3BGWA 2EWVA 2H16A 2GVDC 1DAKA 5KDOA 1AZSC 2QAJA 2ZITA 2C95A 4IDPA 3R9XA 1TUIA 2CK3D 1E79D 4PZYA 1XTQA 2QP3A 121PA 2IC5A 4TMXA 2NZJA 1VTKA 3IGFA 1N6OA 1BYUA 1L7VC 4US0R 3T1OA 2OBLA 5FH9A 3QIAA 3GEEA 2JLYA 1NN3A 2BBOA 1D9ZA 2ZJ5A 3THOA 2FSGA 4RCYA 1KDOA 3QPUA 4DHEA 5IK2D 5J4VA 3GLIE 1FPMA 3GEHA 4MYHA 4EQ6A 4Q1EA 3QPWA 5FUYA 3CM0A 4IDOA 1ZD9A 4B6FA 1JR3A 1SVLA 3U3OA 1VIYA 3BK7A 1HYQA 4DWJA 2NO1A 3A1SA 1NMYA 4XIGS 1OPXA 2KWIA 4Q48A 5D3QA 3RAPR 4QGFA 3A37A 3FVQA 2O0JA 2Q9BA 1D5CA 1K6MA 3GLHA 5FFMA 1B23P 1E2EA 1DEKA 1MRNA 2V3CC 2ZRPA 2QT1A 1KSFX 4TL8A 3U44B 2EW1A 1TF7A 1U81A 3HR7A 1G4UR 1FUUA 4UXIA 4F4JA 3REFA 2PLRA 1XTJA 3VKHA 5E7IA 2ZUCA 4HDCA 1EGAA 3TK1A 3H4MA 1GP2A 1TMKA 3LDAA 4XTCS 1TNDA 2ZU0C 3S1AA 1KI3A 2WSSA 3MAAC 3ZH9B 2QMEA 3BB3A 4LCBA 3BXZA 2O0HA 1Z6XA 5EZ6B 3LVRE 5JS7A 1OH5A 1SVKA 2ZRFA 4JT2A 1I2MA 1NY6A 2C9YA 1KAOA 1OXXK 4PO9A 2JEOA 3CNOA 4LUCA 2IHYA 1KHTA 3FWYA 1P2UA 1WMSA 1KK2A 1FW6A 2HDNB 4LHZA 1SKQA 3GJ8A 5EP3A 2V1XA 2RH5A 2WPDD 3MSXA 4S35A 5BYKA 2D2FA 2ZAOA 1US8B 2N1BA 1J8MF 4QG7A 2GNOA
chains in the Genus database with same CATH superfamily
3IULA 3EA4A 1U1CA 2P62A 2SBTA 4CEJA 1DJPA 2FWIA 3A1FA 1DQPA 2YN2A 4MQ5A 2OB2A 1BA3A 2GD2A 1PL7A 3W77A 3LLMA 4YMIA 3KXPA 2NAFA 1E1YA 3OWOA 1Z2CA 2OXIA 3OICA 3BMOB 4B2IA 3X1JA 4PG4A 5C80A 3TOVA 3RHZA 1SIBE 3IXLA 4NV1A 1ZCFA 3GAFA 2NO6A 3AEKB 4GDMA 4K6FA 5KQSA 1CDZA 3EH2A 2G07A 4CDNA 4FI3C 3R0VA 1PDVA 2Q6TA 2V55B 4UUAA 1ZN2A 4E14A 1NVTA 4EB0A 5LQJA 2BLLA 1EBUA 5AICA 3L6UA 1C0KA 3OEED 4D0SA 3HWSA 1RLJA 1P6UA 3NVAA 4BC0A 4DLZA 5BORA 2F48A 4CIYA 4AP6A 1GUBA 4QYMA 3PUWA 1MOZA 1TYZA 3LUPA 1YFLA 4M38A 2P8SA 3MLBA 3B82A 4H59A 3EXFA 1YDMA 2ID4A 1ABEA 1ISMA 1FF9A 2GN4A 4EA7A 5D1NA 4CKCB 3L8YA 1RZUA 4P4SA 4WADA 5T4EA 3SDBA 4FGLA 1YTLA 4DLVA 1CRWG 1B6TA 3NRJA 4YP1A 4MLPA 3VR4A 4XPIA 1X70A 1YQXA 3ZXSA 2Z6AA 2J5RA 1JBQA 3NZEA 2ZYSA 1NUPA 2H1LA 1D6JA 5E1DA 4M60A 4CU5A 3GJ6A 2K4MA 1ZLXA 3VVBA 4LXYA 1V4NA 5AXAA 4AJOA 2VP3A 2H63A 2QJOA 2QTAA 2VIIA 2VUHB 3BBLA 3LBNA 4KLRA 3ITKA 4I4IA 4U7TB 2HGSA 5JR3A 3AR4A 3F4KA 4IRMA 1D4ZA 4ZU6X 3T94A 5JNUA 3AHGA 4CQLB 2X0FA 4O4IF 2ACVA 3QM1A 1P4HA 1SFRA 2VTKA 1SBYA 4GYYA 4KBGA 3DLBA 1KMNA 4LZOA 2C82A 3TG2A 3OJ0A 5FT9A 3PL1A 2C61A 1LBIA 5CH8A 3DPIA 3F6CA 5CFMA 2IX3A 4HWRA 3RADC 4BRSA 3CBQA 1A2KC 2RI6A 2WHRA 4X3CA 2WOOA 1CK4A 1N8TA 2QAGC 1OXKB 2JB9A 2ODBA 4ZA2A 1F3OA 3GR6A 2JIMA 3KD3A 1VZ3A 1NP6A 3LXXA 2XT0A 3FWNA 5DEIA 5EJGA 4NCIA 1UDWA 4V1CI 1FTNA 5TQ2A 3QE3A 1QFJA 2OXEA 1NATA 1UADA 3B3AA 1E9RA 3E1SA 1BD3A 1E3WB 3DV0B 1KJWA 3ED1A 4GR9A 3RRFA 3WGKA 5L6LB 2KE5A 4GLOA 1SGWA 4I66A 1GN9A 3ZLTA 4QU0A 3C3PA 3WJ7A 1FRNA 3GG2A 3HLTA 1GYQA 3EDOA 4U2FA 1YAJA 4HDNA 4J7CA 4BL5A 2RBGA 3RSSA 2Q9AA 3TR5A 2GXAA 2VRWA 4BVBA 4YAIA 4V1CA 4Q01A 4B44A 1DBWA 1HFJA 2ANBA 1KDYA 2GS9A 3ZXUB 1U63A 3SMVA 5A5DA 1ZUWA 1PJRA 4WGFA 2NU8B 4MVJH 2NSYA 1B8PA 3HBFA 1SH7A 1J8FA 3ZV3A 3Q9SA 1BCSA 2R8XA 3SHWA 4BJ1A 4D9JA 3FETA 1NQ5A 5ALVA 3K9BA 4M2LA 1IAVA 1MJGA 4GMKA 1KPGA 2PKQP 2J0UB 3AOGA 1U8TA 3CMMA 1W88A 4LWZA 5CT5A 3Q3EA 4ZRMA 1Q7RA 3M9LA 3MIIA 2AF4C 4EFNA 3WOVA 2I55A 2O6LA 2AXPA 4WJKB 4IWNA 2OOKA 4DLAA 2HMUA 4B7ZA 3B3GA 5DGDA 2X8WA 4JROA 5IZCA 4PNZA 2Q3EA 2QVYX 5EJFA 3ZX4A 1MNQA 3KVVA 4BNMA 4LNUB 3E7WA 3MUNA 4RKQA 2GBLA 1N25A 4ZT4A 4EQ6B 1DJNA 3P9CA 4GKBA 4P6VF 2ZGVA 1QTRA 1V16B 3QLEA 1F8YA 4EDFA 2FPIB 5ERYA 3P45A 4WA7A 3QE2A 4P93A 4QO7A 5IWCA 2CHFA 1KJ8A 1XD8A 2GHTA 2YYAA 4UDXX 3TQQA 1CIVA 2RK4A 1N2ZA 1E5DA 4J7UA 5L9AA 2JD1A 3GLHB 3TQRA 4DAEA 1F2TA 3DD1A 4KPUA 1KEUA 5C8XA 1JECA 3TCKA 4WOCA 3NDBB 1BMFD 2BELA 3KYDB 5KCZA 4EMUA 1Y5LA 3CB4A 1F0PA 2GYVA 1XAIA 2J9FA 4YP7A 2AHOA 5HQ3B 3LYAA 4D8XA 2HJWA 1BOOA 3CF2A 3QNUA 4MTLA 1KI8A 1T6XA 3N07A 3GLFB 3OOJA 1H9BA 2Q3LA 3GEPA 3HBLA 3ZWDA 2DPMA 2R44A 1JTFA 1TM5E 2VDRB 5ENVA 4B09A 5AOBA 4EMBA 2FPUA 4ZO6A 3V2GA 4K2AA 1D2RA 4LV6A 4I1SA 1ILWA 3QG5A 4P84A 3AIMA 1M2JA 4PNPA 4AJ9A 1RHRA 3U80A 1AZWA 1EJBA 3WADA 1M0WA 4NYIQ 4QREA 1OIXA 1VLVA 1SG9A 2MR5A 2PMFA 2BKLA 4KN9S 4WN3A 4QJ4A 1CQZA 5TR9A 1UBHS 3GD7A 1NW7A 3D8HA 3TB6A 2IYLD 4MW4A 4OQPA 4WTOA 5I8ZA 2ZUTA 2UUBB 1Z4PX 4OIFA 4TWZA 2H0QA 3SFTA 1RFLA 3VAYA 4DY6A 5AK0A 1VHLA 1V7CA 1S2GA 3NHRA 2CV0A 1Z16A 1HQKA 1E1QA 5FQNA 3HB9A 4PC7A 1G2QA 1NU8A 5HTKA 1TOAA 4QOGA 3J81k 4A5OA 4N5IX 5TMDA 3ZD7A 3L77A 1RXIA 5FUVA 3HKBA 4IDNA 3RRJA 3T61A 4B3FX 1Y8QB 2CLIB 4EI2A 1PJBA 4ENWA 5HZKA 4GC5A 3E9MA 3LTNC 3G59A 3EXEB 4HVAA 3BREA 4F5DA 1SOMA 2IEIA 4RD0A 3MHTA 1OV6A 3V2UA 3VYUB 4HZIA 5JH7A 3BE4A 4KHPB 1RWPA 3HRHA 2JC3A 1UXOA 1U5BA 2QL7A 4JQOA 3C87A 5I9IA 4G0NA 2W6PA 3NXKA 5G4KB 5LN1A 1I0IA 2FPRA 1GT6A 4TYYA 5CD9A 1HRDA 4F97A 3DXZA 3N75A 3SXPA 4QEKA 1YR6A 4NLLA 3E03A 2FNAA 1G21E 1JP7A 1BEZA 1SHLA 2CW5A 2RE8A 4GEGA 1WXWA 2OQIA 1BKSB 2YRWA 1ULBA 3OEYA 4KQGA 1W0CA 2CSXA 3S2IA 1QU2A 4HWPA 1EFUA 3EEOA 4PF1A 8ATCA 2TS1A 2WUGA 3JALA 4Y2UA 5EWLB 1I5OA 3EAGA 3I32A 1NQVA 2TMDA 3AF5A 1XWIA 2C77A 3MG9A 4RH0A 4CETA 1FOEB 4C30A 4M21A 3KVOA 2G5TA 1RXEA 3D6UA 5JHGB 1ADBA 5I5EA 3D7LA 3ZQJA 2I7TA 3RSOA 1UBKS 2H31A 1OFHA 3C5VA 2BT4A 4MYDA 1V5IA 4MUBA 1LC0A 3IDQA 4X7MA 5T8KC 2G5CA 3ZW7A 1U3CA 1GLGA 3FCEA 5F9HA 1YA4A 3U40A 5I7SA 4UU1A 4HPXB 4XA8A 3GX1A 1U6IA 4IEFB 1DS6A 4O59O 3RC8A 3IAS1 5M5BA 4DG5A 3DBVO 4G0OA 3JV7A 4AN1A 2JH3A 3ZBUA 3MS2A 1KAHA 1RJFA 2O7SA 2Q0SA 2A86A 3D43A 3KEMA 4JUIA 4M55A 4MYSA 1EFRD 2B36A 4D6XA 4IOLA 1XYGA 1TF2A 1KVRA 1VMDA 3ICPA 2C83A 3MWEB 3LVBA 4WKBA 2ACKA 2FZGA 4JP3A 2P5UA 4HXYA 3ETGA 5JJBA 1JU3A 2OD2A 1ZRNA 4O5AA 4ALJA 3CT6A 4TWIA 3PLAE 1ORHA 1P72A 1RWNA 3LHDA 4I36A 4RACA 4F1JA 1YDHA 3OT1A 4ZCMA 5A04A 1H94A 1X39A 2G80A 4QULA 3ZUGA 1Q0QA 5JI2E 9GPBA 3BGOS 4AYWA 3SQOA 3D5QA 1B43A 1FJ2A 4L2IA 3PQ3A 2O8DA 3AHJA 4ND4A 4NBKA 5K6TA 5K0SA 2RCNA 1E99A 1GARA 3FYCA 1PU2A 4M98A 2PUDA 1SU8A 3SYNA 3VPGA 5J9FA 4L8GA 1VHDA 4E5DA 4EJSA 1N6LA 3IP5A 4XVQA 5GWXA 4UHBA 3TGLA 3B36A 4I9NA 5AVVA 2ODQA 3NH6A 4AZTA 2W83A 4CV2A 2O48X 1M2EA 2H7VA 2G7ZA 5U4QA 1W5SA 1OZGA 4BKPA 1C80A 5DCLA 5CM2Z 4K28A 1WKBA 1C0IA 3EVCA 3DP7A 3FCOA 4FD2A 3HCNA 4G5QA 4B3HA 3HM9A 3VQTA 4O4JA 4C08A 1MDFA 5DNYB 1QYXA 3PITA 3KSBC 1D0SA 4ARCA 2ZPUA 3D4NA 1FTQA 1FC0A 4BQQA 1PFGA 3P9SA 4D9NA 3KKMA 4JGIA 1GVHA 4D79A 2ZRLA 5CCDA 2C57A 3EEBA 3U37A 4OBXA 1CUXA 5EYPA 2X8JB 1Q17A 2W00A 4IIJB 5AJHA 1FYWA 4GI3A 3IBFA 1L4EA 3MOSA 4M1EA 1PYGA 3EB9A 4LDRA 4CKYA 4WBNB 5KOIA 5LXTA 3OCYA 1WXIA 2FZ5A 2P2ZA 2UYHA 1RPJA 1PI3A 2HO4A 2FH5B 3ET5A 3ND7A 1FUIA 5CT4A 3HYRA 2BKXA 4DIDA 4M7RA 2CVQA 5A1TA 2XTAA 1M2HA 1WTAA 4TXMA 2X23A 3CX8A 3SBXA 4C0QC 3LCMA 1LDMA 2C2WA 2Q46A 3K8ZA 4RSRA 3TNJA 4D97A 2VYNA 4M9QA 5F21A 3L01A 5J5CA 2XYRA 3WLFA 2IYVA 4Y2SA 1Y4ZA 1BTOA 2NLOA 3AV0B 1LFAA 1U8AA 3HMKA 3L04A 3O74A 1WIWA 2CLSA 3UF0A 1ITZA 2J30A 2WD8A 1SXGA 1Z74A 2WJJA 4FFSA 5C5CA 4NZ9A 1THTA 4DQXA 3RI3A 3QXHA 3RAJA 2PZMA 4Q4LA 5HCIA 3NHLA 1EX9A 2PQ6A 1Z4NA 4R2LA 3AINA 1M7HA 4ACAA 4YMHA 4G97A 2GEDA 1N92A 2W5UA 1BQ3A 1ENPA 3AUJB 3CLSD 3MZ0A 1UEIA 2JLAA 2QQGA 2FUNB 3SC3A 5CYOA 4J0HA 1L7OA 4HQKA 3EXIB 4OQMA 2AOTA 3NHJA 2AFHA 5DF1A 1IHOA 1O9BA 1ONNA 1OV4A 1RS0A 2PM8A 3F5DA 4JEUA 4I8XA 4N39A 5KDLA 3VSBA 2Z5FA 4KSBA 4UNPA 2TRSB 4EEXA 2XCRB 2RHDA 2B7LA 3Q3VA 3WSWA 4QUDA 1RI3A 5H3HA 4ZCRA 1JDPA 1YQUA 4EAQA 4ZYTA 4DM4A 1EGMB 3DDNA 3L2OB 1PS8A 2G5GX 4AXXA 4QDZA 2HU8A 2CGEA 1GSAA 4W5HA 3CLVA 2Y93A 2JIBA 3A3YA 1E6WA 1RPNA 4IIDA 5TRTA 1JQ3A 3HJCA 1RYEA 2PS9A 3ZD9A 3UKOA 4IDGA 1ABBA 2I33A 5HM6A 1LDNA 1KY5A 1ZMXA 4ZJZA 2ZPTX 3KPUA 2VPZA 3M83A 2G9RA 2I99A 4U2GA 2A4MA 3C74A 1C3LA 2VTEA 4ZHSA 3OFJA 4DQUA 3UO8B 2CJPA 2ASVA 1EX6A 4JC0A 1MA0A 1W5BA 3QVLA 4IGKA 5F7JA 1VHJA 5TEWA 3RVPA 4HH1A 1VI6A 2CXQA 3GLFE 2PJRA 1WDLA 3OM1A 3RTBA 1W2WB 4H35A 2DBQA 4O63O 1Z75A 3FPJA 4HAYA 3WKBA 1ZR2A 4FI3F 4P9NA 2F4VB 2PO5A 4MIYA 3EGOA 1ZVMA 4TGLA 3TD9A 4N5NA 5TVKA 4QQFA 4N3CA 1LDEA 2E5WA 1KBQA 4GPZA 1C4KA 2CHUA 4IMIB 5JG7A 2XRFA 1G8KA 1V7PC 2ZE7A 1W96A 4AECA 2CDRA 5BRJA 2Z2ZA 2ZZMA 2EEPA 2RFLA 4KVGA 2D2XA 2WMDA 3K96A 3MUOA 4HAUA 2F62A 2AKEA 1PUXA 3F4LA 1US8A 2EXXA 4ZAYA 3R9KA 3DE0X 4Q3BA 2A0WA 1TVKB 2YWXA 3ZDEA 2H92A 3LUJA 1VMAA 4X97A 3KSAC 5FAKA 4QLOA 2O7NA 4JGBA 4X3OA 1Z2AA 1JF8A 4KYIB 4NI5A 3U13A 4BUCA 4F3YA 4YYZA 4XGNA 1QMGA 4ZC1A 1DTEA 3ZHTA 1UT6A 2I78A 5CBPA 3AL3A 1K0UA 1ZFNA 1JDUA 4K6MA 1ZK1A 3KZOA 2J3MA 1NMEA 1Q0UA 2NT3A 1AD2A 4AJLA 4EZIA 2IKSA 3K0EA 1UL1X 1LQUA 1UPCA 3SBOA 1NQAO 1U7UA 1E4EA 2ZJAA 2CF6A 5CRIA 2WMYA 4C06A 4BWFB 2H18A 1NQUA 3BH7A 2J3IA 5F76A 2EJUA 2G76A 4ETMA 5KTOA 3D8RA 5HMMA 4EM6A 2CY0A 3OMXA 1MU0A 3CNHA 4GOOD 2JVJA 4UBMA 3WHPA 2ZM5A 2VTBA 3KJIA 1IM8A 3HK2A 5HGJA 3RROA 4RKEA 4Q3LA 1IPFA 4DRXA 3MT7A 1U9IA 2P79A 1OAOA 4M9RA 2QU7A 5DNUA 2PJUA 1IE3A 2X22A 2BKEA 3NHBA 4KBYA 1NVUQ 3ZKWA 3VYWA 1TAGA 2B9EA 3U4AA 2ZJFA 4IX1A 1XE3A 2IW3A 3NT5A 2IEAA 4KP7A 3WMGA 3KSUA 1F9AA 5FLYA 1XAGA 2ECOA 1GGVA 2EZ8A 1M1UA 4NKRA 4AWBA 2AXEA 5ALWA 2GCPA 3Q72A 2FFRA 4BGEA 4UVIA 3IOCA 4YDHB 2EQ5A 3RVRA 1HLFA 1ODSA 2XYPA 4D46A 5AOVA 1LSSA 4M0KA 1T91A 4R31A 2HHHB 5L3QB 4P4GA 4I1YA 3EAFA 2R1VA 2QSUA 4WNYA 5GMOA 5IJ9B 1T0UA 1ESEA 1V3QE 4LZWA 1AUVA 2AW5A 5F5XA 1DV1A 2DBZA 3OZTA 1YQ9A 4RLHA 4ZQIA 1WCWA 4EAAA 1T0IA 1TJ5A 3Q88A 3V9AA 1MMFB 4LKOA 2O2DA 2Y1CA 1BQ4A 2YASA 1OFTA 2P90A 3I4CA 1NA5A 1SCUB 2R7LA 2WSIA 1H4TA 3EVFA 5CLLA 4XR9A 5HKLA 4KRYA 3UWPA 5BVHB 3OQNA 3ITEA 2CLCX 2VKQA 3PPVA 4LJKA 3QU4A 3UWOA 1NHGA 4OQQA 3U7EB 3BCUA 4EA9A 4UNIA 5HIMA 3U60B 4D26A 5CYPA 2FHPA 4GQIA 4PLPA 4QSMA 1X15A 1Z45A 5D87A 4Q4HB 4N8DA 3N05A 3QI2A 3DVRX 5EP1A 3ISVA 4PZPA 1H5UA 2C5BA 5J47A 1NN1A 3ROMA 3BULA 2FY8A 4FM9A 4G36A 2VRCA 3DUFB 4JP2A 3F3KA 3IVGA 5HRAA 5KJ6A 5T3UA 1EX1A 3JW8A 4U8HA 3GPIA 3CG0A 5AXDA 2QMHA 2UUCB 4G0VA 1SHTX 2XMQA 1PV1A 2DFTA 2HHLA 4H7DA 2QL6A 5AKKA 3SYMA 1W85A 2VLIA 5BQ3A 4KPEC 1NMQA 5SY6A 3AGQA 4HLDA 3UJ7A 3UOGA 4C9BA 2IT1A 1JH9A 3RYHA 1JFSA 2P9HA 1D1PA 1AHPA 3UHFA 4UUOA 3T15A 2LTAA 5BSRA 5CX1A 2NZ8A 3GRFA 5FNVF 3GFSA 3PCXA 1RWOA 2QXTA 4R2XA 2P9CA 4Z9AA 2H3HA 2YIVX 1GDDA 3M2PA 4HWKA 3ADOA 2JGLA 1K7EB 4J0JA 5AOAA 1JG6A 1X1DA 2H06A 2Y2UA 3WLQA 4J4TA 1EXVA 3OIDA 3P2OA 2RONA 3F0TA 1N5JA 3UCXA 3DFIA 2VXOA 2H00A 2ICAA 4MUHA 4BLRA 3EXAA 2DR2A 3FHOA 4PPQA 4JV5B 3PUZA 1S8OA 1QQAA 1P5JA 1WUYA 2REQB 3WNZA 4F38A 2A30A 2NP7A 5CW2A 3LLCA 2C9DA 3IUNA 1VIAA 1E79A 2P68A 5AJWA 2DG2A 4KOAA 4ND5A 1XVAA 4QJ5A 4TVOA 4PQRA 2X4LA 3SSNA 4F6RB 3IUEA 4RHFA 2XYGA 1LTKA 3JAWA 2J46A 1HBJA 1JU4A 2AQHA 3QWIA 3GGJA 4G8DA 1P29A 3WIEA 5MGNA 1G3MA 3HEBA 5EWMB 3KDAA 2VK8A 4BMXA 4EB6A 2WFLA 1E3SA 1QE5A 2K2WA 3HKCA 3I42A 1SULA 4OP2A 4Q1FA 4UE2A 4ZOCA 2ZSUA 4JI6B 3VSCA 3E9ZA 5CW1A 1JPUA 4DA6A 1ODFA 1WOMA 3CEAA 1MFZA 1KJYA 1UQUA 2HNKA 2SCUA 2XQJA 2WSBA 3D6NB 3K8QA 4MITA 3RSLA 5L4NA 1NXSA 2HSZA 2Y0CA 5DBGA 2P6RA 4IDBA 1X87A 4FCWA 3RR2A 1GPWB 2AQ8A 4H9GA 3QLTA 1G8HA 4RFVA 5F5NA 3OQIB 2DWOA 1L4HA 4NCAA 2EBHX 3HB0A 2Y68A 4PYRA 3MSCA 2R6HA 2QRJA 3ZCTA 1EFDN 4HQOA 3C8MA 4ZJPA 1Q57A 2JZOA 4HNGA 2LZ0A 1K9SA 2X9NA 3ORSA 1AGPA 4JWTA 2W2MA 1YVDA 3P9YA 3PDIA 3U9TA 1KNQA 5K0ZA 3I92A 3NT4A 2WWYA 2CV1A 1OGYA 2YOHA 9ABPA 1Z73A 3U4DA 2QP9X 1C7FA 3AU8A 1USWA 5THKA 5BSGA 2FUG6 2XBLA 2E4UA 3VBEA 3GGGA 2AJTA 4UEOA 1EVYA 1PBNA 1GRCA 1LW6E 2GBPA 2V8BA 2CE2X 3LLSA 2GHRA 1BX1A 4M8NE 2UYCA 1PO7A 1X2EA 3Q6NA 5KYXA 5EMLA 3GARA 3L7OA 3W7AA 2ODWA 2W2PA 2DXIA 5IT5A 5KNBH 2EF0A 3I5XA 1F8XA 4LK2A 2NZUG 1II9A 1P1BA 4OGFA 3B1WA 3KYBA 4PXAA 4XB6B 1JYEA 3WGOA 2YMMA 3R7AA 2A9QA 3E7XA 4OFXA 5JWRA 1I3LA 2HU5A 1XLTC 1I2DA 2BEUB 3VR3A 2CXUA 4MGKR 1KHHA 1QE0A 3TECE 4GZMA 3F5QA 2QTGA 1A9PA 3AC0A 4BCCA 1YNOA 1EFKA 1UMBB 2B8JA 4J0IA 4KEAA 1IRIA 4PCUA 3AF3A 4E0BA 3C6KA 4K46A 4XIJA 2YJGA 3OZAA 4KXLA 1TK9A 4P58A 1VL2A 3F71A 5L6MB 4ON9A 4YRMA 1F3LA 4JL8A 3B1ZA 2FEKA 4YP0A 4C5BA 3UEOA 3RT9A 2GQ0A 1ZNXA 2EF1A 2ZI5A 3T4UA 1HZZA 4C04A 5ETJA 3REGA 4K9KA 4BFTA 4IGIA 5BUCA 4QU9A 2EAUA 3LOUA 4ER6A 4ZK2A 5JISA 5KYWB 4I2VA 4GL4A 1KFEB 4OA5A 4BO5A 2XNJA 3TAHA 2O2GA 2IHBA 5K3CA 5TPZA 4BLSA 2J7PD 4GWGA 1I33A 2P4EA 2WYWA 5IDXA 3NUGA 1H8EA 1DFIA 4OPMA 3LVFO 2JIOA 4IJKA 2PUTA 4AY2A 2DX7A 2BZ0A 4ER5A 2XUAA 1UK6A 1L1QA 4KX5A 4A0SA 3H1AA 2NYRA 4M0PA 5IZ4A 1A5TA 2CHVA 3GIDA 3QEMB 4U7PB 4ZAGA 4KO4S 4TN5A 2MOKA 3IP1A 2RHCA 3KQVA 1FP7A 4HWOA 3U17A 4KRXA 1PK9A 1KZYC 5AHKA 4ZDWA 1PP4A 2FWPA 3SDZA 4BAGA 5BN4B 4XB2A 5JBQA 1Y7LA 1UZMA 1QC5A 2JFXA 2VT7A 2XW6A 4CM9A 4F12A 2XEXA 1E2PA 4I5DA 4QUIA 4F2HA 3RFVA 4D25A 4M8KA 1WX1A 2C7PA 3G2JA 3G23A 1WXDA 4KGZA 3SDSA 1RRGA 2WK1A 3V7WA 5B3KA 5H9WA 3ES9A 2B9VA 4GW3A 3OZDA 2R25B 4QX6A 4X44A 2HIMA 4LHEA 1Q1GA 4B6QA 3FOEC 4QNRA 4I4NA 2ZAYA 3I64A 4PHCA 2HSWA 1USGA 2DHDA 1FNNA 2ZVQX 3MUEA 5CU7A 4B3RB 1RMYA 2XKAA 2GK7A 3NKFA 3SSAA 4R8MA 4LOLA 1Q21A 3BX1A 3RYIA 4P86A 2JAXA 4INAA 3MB8A 1M1XB 1N7GA 1YASA 2YIDA 1E0AA 3EQZA 1R9GA 3PD1A 4F3KA 1SXJB 4C87A 3P0HA 1JV2B 4UHKA 5THXA 3DP9A 5BV0A 3TOXA 1W52X 1KO4A 4Q9HA 3MLEA 7REQB 5A0FA 3T0IA 2W2OA 3EFEA 2XR1A 4HS9A 5GPBA 2I1WA 5EMJA 1YZYA 1W4ZA 4NJMB 3TR6A 2B98A 3AKDA 2EJWA 4IQ0A 3L18A 4NBNA 4UULA 3UH0A 3UMJA 4F0JA 2HMYB 4RH3A 4BTVA 4WESA 2X0EA 1J8QA 2M98A 3VVMA 1GAXA 3LTEA 4K3UA 4ZT2A 5U4XA 5H80A 2PT7A 2XYQA 3U61B 2ZBFA 3DTVB 3MJEA 3WLSA 2NP6A 4JYMA 5IJ0A 1W5AA 4HN4B 5KMGB 2BTQA 3TMYA 3UGKA 5K3EA 3DWIA 3A70A 4POOA 5BRNA 1XELA 4E13A 3TWOA 1X8JA 2AOWA 3G2HA 4M7OA 4CFSA 3OUUA 1X13A 2BIFA 2IU4A 1G9XA 2E85A 1Y9JA 2OWEA 1XCPA 3DTYA 4BGVA 2QE6A 4QHYA 1BXRB 1Q1BA 1OJ7A 2RHLA 2F6RA 4MS1B 3PC4A 4IUDS 3W5JA 3KALA 1A4UA 4XAQA 1JS1X 2IUEA 1JEDA 5B7GA 1WQ4A 1N5OX 3W9UA 3I4FA 4HYEA 4LSGA 4Z4CA 2I2WA 5CDTA 3BD6A 3T9AA 2J0SA 1NF3A 2R00A 5U1PA 1SN7A 1OIVA 4FEGA 2PKRA 3BB1A 1M7GA 2V0GA 1A7JA 1AGNA 2DUWA 1QNFA 3SN6A 3BMNA 1QFZA 1DKPA 2AR7A 4JENA 2E5LB 4C4RA 1MIHA 2BFBB 1UIMA 4Y6GB 4J43A 3ZHZA 5H70A 3VKUA 2C7GA 2LKDA 1GVNB 2X0JA 5DGXA 3WZMA 1GQ2A 2WSLA 4MWGA 4MYTA 2KQUA 2RAUA 3TD2A 1ONOA 1DXYA 2RH4A 4MV0A 1PUJA 3IYLW 5KVSA 3MBKA 1PFWA 1SVOA 3F5SA 2C1EA 1I1HA 3O1IC 5LQCA 3GDOA 1RM4A 2FYTA 4PBSA 1E3EA 1M67A 3N39C 2R9VA 2IQ5A 4LGYA 3ZHXA 4D8TA 2HI0A 2RGAA 1K0FA 3RJ5A 4DWJA 3KVNA 5JMWA 2I2XB 3EXG2 4HXGA 4MHSA 3QYAA 1C7IA 4MH0R 4PZZA 1BWRA 5J63A 1EK0A 3EGCA 3CRRA 1YU9A 4CUJA 3GEGA 3EPLA 2WHXA 1SVSA 1BFUA 1GZ5A 2QJTA 4DEYA 3NDJA 2F1IA 4EG1A 4FJ1A 2QLJA 1DRJA 2WMOB 3PU6A 1E1QD 1S9DA 3ABSB 5BQPA 3PGLA 5TX7A 5H59A 3WGGA 2WF7A 2HLPA 4F6LA 1YR1A 3UGJA 4A36A 1FMCA 4MKXA 1E6UA 1MV8A 3ME5A 1LPOA 4UQPA 1QANA 4ZXFA 1AV7A 4LX0A 5FNZA 1UJNA 3IALA 3PFKA 2X0IA 4PLHA 1IHUA 3SHFA 4QGSA 5J4HA 1YUNA 1NMZA 3O47A 3I23A 4IMJB 3WV4A 5DBHX 3D6TB 1Q11A 3WICA 2C97A 2GVZC 1EK6A 4M88A 2NXJA 4NZOA 3DW3X 4CLOA 1E8MA 3KM0A 4W7HA 4RY9A 3ZCXA 5TQ0B 3ND6A 3QUBA 4LF5B 1XTIA 1G7CA 3IC5A 4QGGA 2H3EA 1QK4A 1MX5A 2HUPA 2QL5A 3F74A 4V0KA 5JCOA 1KXZA 1TTHA 2FFAA 4ZAWA 5LA6B 2ZRKA 4MQMA 2OD9A 3F6SA 3OAAA 3KSRA 3UWDA 3FM9A 1M6VB 3R09A 1XCLA 2IOFA 3ZU4A 4C78A 3Q7RA 2DWQA 3GZJA 4ZGWA 4CKWB 1PZXA 1QPGA 2IYTA 1EDBA 3IQWA 1QVAA 3JARB 1GUAA 3T41A 1YC2A 3U48A 2GYUA 2C31A 3Q0IA 4I55F 1NRXA 4Y2YA 1H5NA 2VDWA 4R84A 1UJMA 2JA1A 2R85A 4L7QA 4RK7A 3QVGA 4RVGA 4NU0A 1RLIA 5AVJA 3UICA 1KH1A 1P62B 4R1QA 3ZWKA 5KINB 2WICA 4N7JA 4RHUA 5ALMA 3G9UA 5EJ4A 3GEBA 4PLGA 1ATIA 2CLEB 2NWQA 3O21A 5TXGA 4M8LA 3D1LA 1E2IA 3EOBI 4OQDA 5B36A 1DUSA 2IOHA 1N6NA 4IDDA 4WI1A 3ND8A 1BH2A 1E2GA 3ZCRA 2C4UA 3VX4A 2W2VA 4OJQA 1YRQA 2XCLA 1YVEI 3NOXA 3MMPA 3W5SA 3HVRA 2HYIC 4Q4DA 4FUQA 5JAQA 3D2BA 1NZJA 2I66A 1CRLA 2ANCA 3HN7A 5JYCA 1C5KA 1O6BA 3LQRA 4ZI7A 4DA4A 1E1RD 5M29A 1K86A 1W36D 5J1TB 2WVAA 4IEEA 4BWVA 1ZJJA 1MC5A 1NKSA 2JFUA 3PQ7A 4IOKA 3E53A 3BJIC 4YP6A 3UAYA 3V4ZA 2CC2A 4BO4A 2BDEA 4EGCB 4E2WA 4AQYB 6YASA 4KAAA 1CUIA 2YWDA 3D6FA 1PWYE 3HUUA 3H5VA 2JGMA 5JAZA 5LNK1 2QKYA 3HI6A 4RIEA 4CKXA 1TO2E 4IIGA 2VUTA 3AEUA 1CP3A 2O8BA 1VGRA 1WHTA 2PEZA 3GLKA 3Q1LA 3DTNA 3HB1A 4HYTA 1KP3A 5G0WA 2VVTA 1S2NA 2JD0A 2OGUA 5JS2A 3T1YB 4MRNA 2E2WA 1GPBA 1T5TA 2XSZA 4R1MA 1Z5NA 5K3DA 1XZEA 4AJHA 1TZCA 1FSZA 3ZWCA 1V43A 4AQ7A 1QVWA 1LPAB 2CMFA 3ILYA 3C4JA 2W22A 3DULA 1J5XA 1QHXA 2FQQA 2YV1A 3AH8A 2P6OA 3BTVA 3GT3A 1ZESA 4L22A 4ZJUA 5IT9A 3L7JA 4BQIA 1H9CA 3JQCA 2OFFA 1GITA 3W6UA 1LZLA 5K8JB 4F7DA 2Q21A 5I4KA 1NJ6A 5GADl 1RJ9A 1VKJA 3HB7A 3HJUA 4X24A 2HR1A 4FXOA 5AQ1A 2XB9A 4NPAA 1E1NA 2QIPA 1ML3A 2V59A 5EIXA 3H1TA 4MDHA 7MHTA 2QORA 4M9CA 1PJSA 1YCDA 1YJ8A 1B6GA 2ZBQA 4L3OA 3B5EA 4FJ2A 5E9WA 1WUKS 2ZRMA 3TW0A 4ANFA 1KEZA 4PTYA 2FP4B 1WRBA 4LJYA 5DPMA 2VYVA 1M2NA 3PT5A 3EQ2A 1WBDA 3QLVA 4GF5A 1NW9B 3TEMA 2DQYA 3AWIA 1L7QA 4OHKA 2CUZA 2OILA 2BDUA 4FTWA 1YT5A 5AKEA 4F72A 2AB0A 4JP1A 1XT6A 1L5VA 1CQJA 4S12A 1ORVA 3P4YA 4D9KA 5IM4F 4ZO8A 2C2BA 1Z5VA 2VYND 3PUIA 3JQBA 1OYVA 2DYKA 2HMAA 3BA6A 3K2EA 3NUQA 3G88A 2H11A 1VCNA 3O2QB 4PG7A 1O97C 4JK3A 3LH5A 1VG1A 1EPUA 3DWEX 5T57A 3SF8B 1OW3B 2X3YA 4WINA 2GCIA 4BBJA 2FSPA 1MHTA 1P91A 1EUDB 1SXJE 3ZC3A 2CN1A 1I7NA 1KY2A 2RI1A 4WNAA 5FEMA 4AYXA 1BRMA 3ANMA 1P5HA 3ZWPA 1HNXB 2W2KA 5IC4A 4E5PA 1XEAA 2OORA 4PEVA 3ZNOA 1JKMA 3QVMA 4JDPA 1G8PA 2V0NA 2IE0A 4YX9A 4L4YA 4FDVA 1FFCA 2AG0A 3HN2A 1ST2A 1K7CA 3K32A 2DTDA 2JCBA 4IDFA 1ZMRA 3QOYA 5C31A 3RCBA 3CVVA 4DPKA 2YZMA 1XF9A 4A16A 3ICWA 4N0EA 4ZYXA 2B6NA 521PA 2PMCA 4ITUA 3S8EA 3H0EA 1W2GA 3LA8A 4U4AA 1XZ8A 4E4RA 5CJ2A 2WMNB 1X77A 2RK3A 3KZXA 2PJDA 4BE9A 2DFDA 2JIQA 2W6MA 1YB1A 3EBLA 4X91A 3A6HA 4GLLA 5LD2B 1UH5A 2A0XA 4ZJYA 3GJSA 2PHZA 5AKZA 2AZMA 1D0VA 2QRPA 3I9OA 2NTNA 1KP2A 1T1RA 2C1XA 1Z4IA 3KQTA 16PKA 2MYTA 3OU6A 4G09A 4M87A 3CBGA 4BX2A 4ZIRB 4UEJA 5KPDA 3H8JA 3U4CA 1X1AA 1FVOA 3QWAA 2R62A 4H7PA 3UYKA 1OKKA 1E9FA 3V46A 1G6Q1 3EIOA 2XV1A 3L7AA 2JCSA 5BW5A 5HKOA 5A5FA 4KE9A 2FX3A 1XFDA 3N8NA 4LWPA 4ZVNA 4YRZA 3OFSA 1NLMA 4IVQA 1Z15A 1TRKA 2W6IA 4UVEA 2BTOA 3PHJA 2EQAA 3CH6A 4IHJA 1WV0A 1YO6A 3FDZB 1BS1A 1R6DA 3RB8A 1G20B 2RHTA 4BVJA 2R97A 4UVHA 2QRQA 4DC9A 2D13A 2WWFA 2A33A 2OBNA 1L4NA 2PY6A 3DDHA 3O03A 1VE7A 1J8VA 4RV9A 4YAWA 1KQOA 3S55A 1XA0A 4P5DA 5K0CA 3AUUA 4OFBA 1CV2A 2VJCA 3R7NA 4R3NA 1FSSA 3RFFA 1BHSA 2NPOA 2JD2A 3LQFA 5DWQA 4LTNA 4XSVA 1ZD5A 2UUPA 5ALIA 1RQGA 3S29A 1LH0A 3W8DA 1J7JA 5IX8A 4F06A 2G4VA 3FUCA 3KL4A 3N2KA 4G1UC 2P67A 3CVJA 3UKJA 3EIUA 4P3OA 5BOSA 2ZT7A 1YZKA 2Z6VA 1MQ9A 4BKQA 1SCKA 1CJVC 2WNSA 2YY7A 3E05A 1NIJA 2WNHA 4HDMA 3H1FA 3CGGA 3DJFA 3SVZA 3LKBA 1YBHA 3ZR4B 2BL4A 4ND6A 4B81A 4DCSA 1ACJA 2NU6B 4UHCA 2IITA 1U31A 5CJPA 1D4FA 4NE2A 3W06A 2Q28A 1XDUA 2W8BA 2NTEA 4A4DA 2ATEA 3SLGA 4EFMA 2Y67A 4V02A 4YK7A 3O4VA 1K4YA 1SQGA 1UQRA 3SJBA 2DKNA 3AM5A 3CF4A 4QFMA 1XQWA 5JZ9A 2FETA 5I9NA 4DB4A 5I01A 4YHHB 1JWAB 3A4VA 4XM1A 3BQMB 2VYCA 3C7AA 3DYBA 1GQOA 3KKQA 4TV9F 1BC5A 2UZ1B 1MVOA 3PDJA 3R75A 1DLJA 3I5YA 1ISJA 4JUCA 4HX2A 4IG9A 4L4UA 1VHQA 2OK7A 5E4FA 2WG2A 5HJ2A 2E4XA 2RKOA 4QRDA 3WMXA 5IBRA 4DXDA 5IH7A 3OH8A 1U0RA 4DJTA 1JWLA 1CQXA 1YNSA 1RAHA 4UAVA 4ILKA 5EEHA 2ZVJA 3OE5A 3KVYA 3GVPA 4D98A 5E6SA 4UNSA 4AK9A 4CM7A 1NSTA 4MRMA 3L6BA 2JCVA 3BK2A 4JBLA 4AT1A 4D9EA 3AR5A 5CD1A 3TKLA 2X77A 3NIGB 3HL4A 1V9LA 1R9MA 2Q8PA 3B2EA 4X93A 1GUFA 2IKQA 3C85A 3STYA 4DPLA 4B8YA 3RT1A 2EN