2Q21A

Crystal structures at 2.2 angstroms resolution of the catalytic domains of normal ras protein and an oncogenic mutant complexed with gsp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
171
structure length
171
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oncogene protein
molecule keywords C-H-RAS P21 PROTEIN CATALYTIC DOMAIN
publication title Crystal structures at 2.2 A resolution of the catalytic domains of normal ras protein and an oncogenic mutant complexed with GDP.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 1991-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2q21A00
3CRW1 3P1JA 2CL7X 2W2TA 2HUPA 1SKYE 4E5UA 1OYYA 2QGZA 5HE8A 4PPNA 4PHGA 4RZ2A 2ZYTX 4WZ6A 1VCMA 4XWAA 2ZRLA 4XD7A 4CIDA 4CZ2A 2IA5A 3THOA 3ND9A 1JXOA 3AM1A 5H8WA 5E4FA 3MSXA 4L9WA 3D8BA 1NL3A 2ODNA 2O8FA 3NC0C 2PCLA 1MH1A 4JYBA 4Q5IA 4ZO4A 1N5LA 2JLWA 1W47A 1YR9A 2SHKA 3RSLA 4RCYA 1HT1E 1E96A 3KTAA 4DDTA 2G83A 2GWHA 1BOFA 3ZVLA 4N1AA 3VTKA 3EPLA 1NKTA 1RJ9B 1XD2B 1SZPA 3TW4A 4OQFA 2JLZA 3VNVA 1W44A 2FMXA 2J0UB 5BYKA 2QPOA 4TSFD 1S3GA 3FE2A 3NXSA 4UJ5A 5AUPB 1LW7A 1DAHA 4IKEA 3K09A 3IQWA 1CR0A 2ZSDA 1OB2A 5FPHA 2FEMA 5JFGA 4B74A 3WNDA 4JLPA 3THWB 2GCNA 4KFTA 3AVYA 3BOSA 4QOSA 4KITB 1CEEA 3IIMA 1E2KA 4Q47A 2ZE6A 1CU1A 2PZGA 1KDRA 2QPAA 1X8KA 2IEZA 3EXAA 1M8PA 2G1JA 1XU4A 3PUVA 4KCGA 1ZCBA 3FFBA 1C4OA 4AKIA 4PC7A 4IVPA 4DCSA 4H1UA 2BBSA 2ZITA 3T61A 5EE1A 2G0TA 3VR2A 1GKYA 2FA9A 2YWGA 2VHTA 5JRZA 3GCGA 4KYIB 2FGJA 4A4DA 4KU4A 3VHXA 3OEEA 2BCJQ 2GJSA 2EFGA 1OH5A 1WP9A 2CLSA 3WP1B 3KQUA 3UMRA 4BLSA 2BOVA 1N5KA 2V6JA 4D4MA 1NN5A 3WBKA 4R7ZA 4TTRA 3FPAA 4Q4HB 2GEDA 3QF4A 4D0GA 5CITA 4QM7A 3BC1A 2N1BA 4FMDB 3FB4A 2G9NA 2IYWA 5G3ZA 4EJSB 1COWA 1ZD1A 2PJZA 2P6NA 1FFHA 1G41A 1OXUA 4NDZA 4LYJA 3K70B 4AY2A 2V9PA 5GJCA 3LBIA 3I5YA 2G3YA 4YLGA 1QG4A 3SNHA 3M1IA 2W0SA 4Q1FA 5FUWA 2GZHA 3L0SA 4FWIB 4BRUA 4ZCMA 3QY0A 2NO7A 1GAJA 5CLLA 4AKEA 1YR7A 2V6IA 3PJRA 2VL7A 3DZDA 4OHYA 3C8UA 3ZD6A 3R20A 2LKCA 4PZLA 1OV4A 2GF9A 4Q18A 4GZLA 2VA8A 3RLFA 2RGGA 3CWQA 2ZEJA 3QXCA 2ORIA 2CCGA 3P4YA 1U99A 4I1OA 4TYWA 1ZM7A 2KBEA 5KOYA 1AN0A 1CJTC 4XSGA 5H70A 1TQ6A 2YC4C 2HCBA 3OEHD 1HH4A 4EUNA 2F9MA 1XDBA 4BLRA 3L8YA 2GCPA 1Q20A 1XX6A 2C5LA 4KLNA 1WA5A 5C46F 5GVRA 2AK3A 3BK7A 5IK2A 2IF0A 1BS1A 1GZSA 3KQHA 1UBFA 1U90A 1NG1A 2EYUA 3W3ZB 3VX4A 4DLXA 2YKGA 3KKPA 5F3WB 4BFYA 1AA9A 4FMCB 3LRPA 3I61A 3UG7A 2ODWA 2I1VB 2DWOA 4LI0A 2X19A 2IS4A 3DEFA 3NHAA 1EWQA 5KNDA 4PC3A 1CRPA 3B8HA 2ERXA 1XBTA 2WKPA 4X8HA 5JJKA 4FD2A 4KFRA 1P3JA 1YE8A 3I8SA 4AURA 3VKHA 2CJWA 5BN3A 4JT4A 5GJBA 1N2CE 1T3HA 4PQFA 5JEEA 1ZC3A 2VHQA 2FE4A 3PITA 4C0HA 3MFYA 1E2HA 5BYJA 3HYRA 5JZVA 1RKBA 2C95A 1WCV1 2GJ9A 4Q03A 2OLJA 1G3MA 3W34A 4WVFA 5J5CA 3VR4A 1ZYUA 2CEAA 4MDEA 3DHWC 1UKVY 3N5CA 3X1XA 1Z07A 4R2IA 3A4MA 4UNPA 2Q3FA 1KNXA 3MWKA 1X8JA 3CUEF 1JPJA 2ZS7A 2VQSA 3IIKA 4TMXA 4QKQA 1Z0JA 1Z8FA 3GLGA 2Q3MA 3VU9B 2JEOA 4KODA 1XB2A 3QF7A 4HATA 1KI8A 3ADBA 1G8PA 1OKKD 2MMGA 3SC3A 4BZPA 2A5YB 3CRVA 2ZUCA 5FFMA 2JLUA 3VNUA 2H16A 1OFHA 2J45A 3LX5A 4HAYA 1N0UA 1OFTA 2P65A 3CNNA 2YOFA 2JJ1D 3W6OA 4GDFA 3ETLA 1R8SA 2F43A 3K09C 4DDUA 2CK3A 4B35A 3RWMB 4TL9A 4CVNA 4URWR 3U7EB 1Z06A 3IO3A 4DCNA 2HJVA 5BWMA 2KE5A 5FH9A 2IS1A 3EA5A 3BERA 1FX0B 4P33A 1MRSA 3I8XA 4HUQA 2EFHB 2WWWA 4GI7A 3R7WA 1XEXB 1P2VA 4LYAA 3AVVA 4OBEA 1R0YA 3GJ0A 4DWJA 1XTJA 3I92A 3LBHA 3EZ6A 2A7QA 1L4YA 3L2OB 4IDPA 2ZM5A 5FPTA 1ZVQA 4Q9LA 4M9QA 1RZ3A 3U44B 4CDGA 3ZLJA 5KHOC 4A15A 2A78A 4XJXA 4IDNA 1NRJB 1BIFA 3ZVMA 4W5JA 1KTVA 1AJEA 2I3BA 1J90A 4Q01A 1G20E 5EXPA 5UKDA 5FTJA 1FPMA 2BMJA 4FIDA 5DIFA 2FPKA 3RS7A 2JDIA 3AVWA 4TT3A 4PAMA 4WAUA 3LBNA 1E1QD 3LNCA 1ZNZA 4MH0R 1OJLA 3L8ZA 5CK5A 2ZPTX 4B76A 4XH9B 4PAQA 1XPRA 1FZQA 4GP6A 5B57C 621PA 3UKDA 3SJBA 3T5GA 2CMKA 3LO5A 2JJ2A 4LJ6A 4JLVA 4US1R 2NMVA 4C2TA 2ZRAA 1IHUA 4R98A 3TRFA 3RYTC 1UEIA 3NDBB 3TVTA 1CTQA 4JMPA 2AHOA 3N2IA 4KSCA 2QAGC 4GL2A 3SEAA 4WXPA 3VHLB 1ZNXA 2W6IA 5F98A 1Q3HA 1SKQA 2BWJA 4Q4JA 3FVQA 4CGZA 3EX7C 1L8QA 3OIYA 1VG1A 4JT2A 5CYPA 721PA 4YMUA 3S1AA 2WPDD 5DHFA 3VX3A 1OW3B 2BV3A 2C8VA 4PO1A 1YR6A 4QHSA 1KI3A 4MKGA 4LJ8A 3DOFA 1D8TA 2BC9A 3GEEA 5BN5A 3THYB 1VYUA 2QUZA 2AN9A 2MSCB 4P31A 1OIWA 2IYTA 5G40A 4L16A 2GTPA 2OZEA 3U7GA 1US8B 2BIFA 3RS5A 2C9OA 4V0MA 4ILEA 2ZRCA 1FTSA 4H9GA 4B3BA 1KK3A 3OZXA 2OM2A 1OXXK 1CJUC 1Q22A 2ZU6A 1P2TA 4N0DA 1DAIA 2IC5A 3IPXA 5C1BA 3K0CA 4K8OA 1TQ4A 2J1LA 2FSGA 2NQ2C 4GZMA 1MABA 4C0QC 3GLHB 2JIZA 2OCAA 3SYLA 4NCKA 3TVDA 2QQEA 2XITA 1CJMA 1IONA 4Q4AA 1S4QA 3CLVA 3PCRB 3AV0B 4ARZB 5JLJA 1TMKA 2OO7A 3CRQA 1Q3TA 3LLUA 3PVSA 2ZJYA 5B2ZA 1IM2A 2QTVB 3SYNA 5LD2C 4KAXA 2VHUA 3ADKA 1LTQA 3UANA 5C4MA 3SQXA 2B21A 4LYHA 4PO8A 3ZZUA 1S8FA 1UKEA 3UXMA 4QBIA 2O0HA 3GLFB 1JB1A 1XPOA 4Y0AA 1S2MA 3VR6A 5AJZA 1IAQA 3LV8A 5J4LA 2J3EA 3Q5DA 1OLOA 4MGIR 4OK3A 3NH6A 4DB4A 1QBKC 1N6KA 1TUIA 2QENA 1VYTA 3ZVRA 2YINC 5JCPA 2AFHE 2VP5A 1QZXA 3BFVA 4PZYA 4Q9KA 4I1VA 1RE0A 3CB4A 4NTZA 4V03A 3X1WA 2C96A 4ACAA 1XXHB 3FTQA 3AGQA 1J99A 1HUQA 2XTNA 2C98A 1QVAA 2GCOB 1E4YA 1JAHA 4AG5A 1E9SA 4CRWB 4QJ3A 5EUMA 2WHXA 1YRBA 3IQXA 4ZKEA 1VCOA 2AR7A 1EX6A 5FOWA 2QBYB 3LVRE 2VIIA 1JR3A 1LS6A 1XTRA 3D3QA 5KUTA 2OBLA 1II8A 1PLJA 1W5TA 4YQFA 4DT1A 1PLLA 1XTKA 2QP3A 3MG9A 4PC6A 2PMKA 4GP7A 4Q4LA 2BHRA 4RD0A 2QN6A 3QOFA 2WJJA 5CIWA 4AK9A 3T12A 1DS6A 1FQJA 4LJ7A 4F93B 4NCJA 121PA 1JECA 3FMPB 4K46A 4NU0A 1F2UB 1D2MA 1G7TA 3K9HA 2PLRA 3ONWA 2D3WA 1DO2A 1P2UA 1UDWA 4I1UA 4DUGA 4HLQB 1OFIA 4QGAA 1SVLA 1Z63A 3QSYA 2HF8A 1NY5A 3P27A 2JAQA 3KX2A 4TQAA 2QTFA 2B8WA 4MRVA 4ABYA 3IDQA 3BFKA 4A8JC 2ZJ5A 1S9DA 1EFTA 4Q7LA 1LVGA 1JXMA 2EFCB 1U9IA 2FFQA 1XCPA 3QQ5A 3GJ7A 3EC2A 4PHHA 5JJLA 4DZZA 4QM6A 1M1YE 1YU9A 1KKLA 4TSFA 2NPFA 1VECA 2BMFA 2QROA 5JI2E 4BEBA 4B3DA 1E2NA 1BKDR 4QBGB 2HT6A 1Q1ZA 1G291 1E4VA 2XZPA 3U7HB 3JZMA 5EE0A 2BBTA 4M1OA 5FOSA 3T1QA 3NVAA 2BJVA 4FMCF 4JSYA 4PR0A 4E09A 2QA5A 2VP9A 2YOHA 2B6HA 3VKWA 2ATVA 2C9YA 1FMLA 3SS8A 3FKQA 2P67A 2FSIA 1JALA 2FPLA 2GXAA 2GEUA 2OHFA 4IDHA 1GILA 3F3YA 3O47A 5FBRB 1IXSB 4TQ9A 4NYMR 2GK7A 1G8FA 1DOAA 4BASA 2ZANA 4TLCA 2FX3A 4M21A 2J0QA 3M6AA 4V0LA 1NSTA 5DNYB 3SE0A 2D4HA 2ANCA 2V8OA 2GESA 5DLQC 1XJ0A 4LHVA 3O8CA 4RD2A 1DAFA 1E0JA 3QF4B 1KO1A 1WXQA 1LS1A 2HJGA 4OQMA 2A5JA 2B7CA 1XZQA 1CIPA 4WZBE 2BKUA 5J47A 5L3SB 1UAAA 2IUSA 4FCVA 4CYMA 1KIMA 4CEHB 4O3MA 2R2AA 5DO9A 2GETA 1HE1C 4A0RA 4PQRA 2DFTA 5DHAA 3CM0A 4MGKR 4E03A 4KSBA 3K0FA 2QAGB 4LPSA 1Z0DA 5AR1A 4EFLA 3TMKA 3MMPA 3GLIB 1WB9A 3KFVA 1W2HA 1WF3A 1LFDB 4DB2A 1VMAA 4XVQA 4LJ4A 4AI6A 3AF2A 1KSHA 5FBQB 4NYIQ 2RGEA 4B2PA 4PAOA 5CM9C 3EAQA 2AXPA 1U8AA 4LBWA 5FTMA 1F48A 3PUZA 4GOJA 3AEZA 1E2LA 1G19A 1P75A 2OXCA 2GBLA 3SU8A 1AQYA 4D0LB 1SXJC 221PA 4ZPXA 3Q72A 1XMJA 4NYIR 3PQCA 4EIWA 2R44A 4B3XA 2FG5A 3OEHA 4M8NE 4MYCA 1AZTA 3SHWA 4HLUC 3GFPA 2F1IA 1UKYA 2GF0A 4Z51A 4NE2A 1QHYA 2QM8A 3TE6A 2QEQA 4A82A 2OBNA 3UWKA 4LPKA 1X1SA 5EXSA 4JLOA 3N70A 1DE0A 2JLQA 5DI3B 2IEYA 5F9HA 3RS4A 1H8HD 4JLNA 4QBHA 1NBME 3DO6A 5CDFE 4JLAA 5KO2A 2KSQA 2E87A 2GAOA 4S2EA 3ZQJA 2VPPA 2ZXUA 2WJGA 2IBMA 3CONA 3WY9A 3U3RA 1CF4A 3A37A 4HB3A 4HDCA 4C9BA 1GL7A 3U3JA 2ZI9A 2OE2A 4M22A 2EFDB 1VPLA 4PSVA 4V0OA 2JCSA 4LWZA 4U00A 5JCZA 5JSZB 4TQUS 4OK6A 2REBA 5JHHB 3QVVA 1V43A 2CHQA 4ZIRB 1JAIA 5LD2B 1VKJA 3A8TA 2XXAA 2REOA 4M53A 3V9PA 2WWHA 3CX6A 3KXIA 1OFUX 2QMEA 3LW8A 2H18A 3MWJA 4OK5A 1Z2AA 5DN6D 2R6DA 3EASA 4LDJA 2WSSD 5LDDC 2GNOA 5KYKA 1NBMD 4HUTA 1TEXA 1NMZA 4TMWA 1XWIA 1TQ2A 4Q9IA 1NLZA 2CBZA 3SR0A 3OIWA 2NO1A 5SZHB 2Z4RA 1OKKA 4HZIA 4BZXA 5K8LA 4IOLA 2O8CB 1KMHB 3SHFA 4IXMA 1ZCAA 1XNJA 4TZ6A 3HWSA 2ZRIA 4HEJA 4GMXA 4DUGD 2A3RA 4ACBA 1F60A 4S35A 5KSZA 1XPUA 2PX3A 1M7BA 2QSZA 4YONB 2F43B 2JJ1A 4Z1MD 4ZDJA 2GXSA 4ZDKA 4XVUA 2UKDA 3K0AA 5L3QA 4O25A 2ZSFA 3LQQA 1NN3A 1AK2A 4G3XA 3KL4A 1E3MA 2AWNA 3DL0A 1LF5A 4V0KA 4GMDA 3HDTA 3CR8A 4RFSB 2C9CA 5AUOB 1G3UA 2JGNA 3RNLA 4KVGA 4TYQA 3R7WB 2IYUA 2ZJ8A 1KYIA 3L82B 2ECKA 4DHEA 3NBZC 2R9VA 2WIAA 2CNWD 2WVJA 2G77B 2Z5FA 2X2EA 3H2YA 4HAXA 3MD0A 2QU8A 5CM8B 5DISB 3QEJA 2WTUA 3G0HA 1DAEA 4JIMA 3WRYC 1GRQA 2Z43A 3AF1A 4F92B 1XTQA 4C7OA 3CNOA 3ZIAD 1GM5A 3DKPA 3X1DA 3IGFA 1FUKA 4EPWA 2PT7A 1G9XA 4A8JB 2CE2X 1E1QA 2J7PD 4Q9HA 4L4UA 4Q48A 5EQTA 3C4JA 2GILA 4ITRC 4PPGA 3IUYA 1GRRA 1NKSA 4QGFA 4U02A 4WXRA 4LC0A 1RW4A 3LXXA 4LOAA 3PIRA 4OI2A 2MMCA 3B85A 2GK6A 2DWPA 4A0FA 3BFXA 3TJZA 1EX7A 4P3YA 2AXNA 1NN0A 3QENA 4QGHA 1MO3A 1A4RA 5C2JB 4BE7B 3HPQA 3BORA 3BWDD 1KAGA 3KKQA 3AUYA 4RD1A 4A2WA 5HE9A 3MWYW 4RKFA 3ZS9A 4BGDA 5DI9A 5JJIA 3MJRA 1TF5A 4OHZA 5KDOA 1QHSA 4F38A 3RAPR 2A5DA 2AD1A 4NBSA 3AF3A 2WPDA 3RC8A 2WMNB 5EE3A 4B73A 1CJKC 5KSOA 5C4GB 4TTPA 5KPJA 3C7KA 4EQ6A 1BYIA 2YJTD 4D6PA 5AUNB 2VP0A 4BLOA 4DLZA 1OXTA 3GLHE 2AK2A 1M74A 3THXA 1VYVA 1Z6AA 2PL3A 1DAGA 3P32A 3U61B 1GRNA 4B6EA 4EPVA 1IY2A 3BBPA 1GNQA 4XWOA 3KZ1E 1T0JB 2ZR7A 1Y3AA 3KJEA 1CP2A 1CULC 1RYHA 2HYDA 2WOOA 3W5JA 3C41J 4YDSA 4IFEA 1GKUB 1G64A 2RGNA 3U4QB 3K9NA 4DC9A 1Z3IX 1CJVC 5ELXA 1KK1A 2TMKA 3FHCB 4LV5B 4Q00A 1R6BX 2BJWA 4JL5A 3NG1A 4HI0E 1MABB 1L2TA 2Q9BA 2O8EB 4RCZA 3I1FA 3GLFE 5HR5A 1KI6B 1XJCA 4AKHA 2ZTSA 5E7MA 2P3SA 3CZQA 2HLDD 5G41A 3ZVNA 1D2EA 4Y0VA 2ZS8A 2VHCA 1NJGA 4YMWA 1KDOA 2VSFA 5IF9A 2JATA 3GEIA 5FOXA 2IW3A 3LFUA 4R2HA 2X1VA 1K5GA 2QMOA 3KXLA 1EG7A 3OE7A 1SVIA 1P6XA 1KDTA 1Z83A 2ZI4A 2IUUA 1X1RA 1PZNA 4OHVA 3CW2A 2A2ZA 1OPXA 2JLYA 2BDTA 1XXHE 4YMTA 1GUAA 1G5RA 1S1MA 3CNLA 5J4YA 2BBOA 2VH5R 2PEZA 5DE3A 5JECA 4DKXA 2FJUA 1ZIPA 4CEIA 3LLMA 4W5HA 1SXJB 2IUTA 2QGNA 1G8HA 5EXTA 2J0SA 2Q0HA 2JLSA 4HZUA 4OKSA 2NGRA 1E2MA 3SFVA 1P9RA 4EPYA 1KI1A 1N5JA 3HR7A 5FPYA 3H1TA 3ZDQA 3AF0A 2WKQA 3A1UA 5SZJA 3BB3A 3FKSA 4DSOA 5KDDA 2FPMA 3T15A 1NP6A 3EPKA 4NL4H 5G3YA 3B60A 4LHZA 3U3KA 4A9AA 4XIGS 1IN8A 1ZAKA 2ZRKA 5H1YA 1A1VA 2DB3A 1UF9A 4B3FX 3QBTA 1R0XA 2YC2C 1Z0KA 4A6PA 1KK0A 1YQTA 3LW7A 2O8BA 1AGRA 1P72A 5FL7D 1T4GA 3RC3A 2IYVA 2DY1A 3CBQA 1EFRD 1D2NA 4TL6A 5J40A 4JJZA 1QF9A 1P61B 1T5IA 1Z6YA 2NO0A 4TLDA 3UPUA 1W7AA 2OESA 3B13B 3HPRA 3D6TB 5EZ6B 3OESA 1MO4A 3W6PA 2H92A 2FEOA 1HQCA 2W58A 4F4IA 1ZINA 3IKJA 5AJWA 3K8YA 3AVUA 2XSZD 3ECCA 1RFLA 1G4AE 4CW7A 5JMTA 2QZ4A 3UG6A 1D5CA 3KDSE 4CT5A 3DPUA 1AM4D 1GKIA 3TAHA 4W9MC 5EUQB 1ZBDA 4IVRA 4B48A 4R9UC 1G5TA 5M04A 1F2TB 2D2EA 3DDCA 3SJAA 1VCIA 4Q1BA 4EKDA 3BD9A 1JNYA 5AWFC 1KDPA 4HB4A 1D9ZA 1R0WA 4IXNA 1AS0A 2KJQA 1EFCA 1IN5A 2CXXA 2V7QA 3E5HA 2J9RA 3V00A 4BECA 1UJ2A 4KXFB 3BH6A 5G53C 2ZVQX 2XGJA 5FOTA 4OI0A 1RJ9A 2VP2A 2ANBA 1EGAA 1W4AA 2WV9A 2ZSBA 3EPJA 1SKYB 1DADA 4MYUA 3UK6A 4FXPA 1T3SA 3FYHA 4BFTA 1Z0AA 1OE0A 3VR1A 5HPYB 3H84A 3G5UA 1SVMA 2XNSA 5JBQA 3THWA 2I4IA 2V1UA 1ZUIA 2ZQ5A 4C0AC 4M9XA 1R5BA 2ZR0A 4RVCA 2XJ4A 4Q19A 1OSNA 4L9SA 1GIAA 1OH6A 4V0NA 5HKKA 4MRRA 4IW3B 3EARA 4ZCIA 1NF3A 1W46A 1IN7A 4DXAA 3GLIE 4JKIA 2OG2A 5JWRA 2Z6VA 4XTCS 3TLXA 1MKYA 3CF6R 1G17A 5B30A 1UDXA 1T6NA 3KUDA 1N3BA 3QIAA 3R8FA 2VTKA 5KTYA 1NLYA 4NPHA 4AYXA 2V3CC 3AVTA 3NWJA 2C2HA 4Q4HA 2BM1A 1FMJA 2J59A 821PA 5TXGA 2IL1A 3AKDA 4D81A 3EIEA 3PEWA 1JPNA 4P4SA 4EAQA 4A2QA 3B1WA 5B58C 2F3RA 4M1WA 4EJSA 2WWFA 2EVWX 4ZCLA 2AL7A 4NCHA 2QE7A 4FI3C 4F7WA 2ZSEA 4IDOA 3VAAA 1I4DD 3U6KA 4B32A 2WWIA 4PXAA 1VIAA 1E0KA 4E07A 4F4JA 1WBDA 1R7RA 1GP2A 4Q7JB 1U0JA 5BW8A 2DCUA 1Q21A 1P73A 1YZTA 2J7KA 5L3VA 1EFUA 2YV5A 3EG5A 3L0IB 1W4RA 4HAVA 2O8DB 1XFAA 3G82C 3GFOA 3BAFA 3SBDA 3QXJA 3FHTA 3B1ZA 1A82A 1NY6A 1NSFA 1XZPA 2X2FA 4P4UA 3GD7A 4HB0A 2GJKA 2ZYUX 3CPHA 1NI3A 1U0HC 4Z54A 3FHOA 3OE7D 2VF8A 3E1SA 1UM8A 4IRUB 4LZZA 5J4KA 1TU3A 4C0LA 3ASYA 4PHTA 4ZDIA 4RSGA 2IXFA 3NHBA 1YRAA 1L4UA 1E94E 2A30A 3F0TA 5GJWC 3I4LA 5KSYA 4CEJB 1M34E 4M9ZA 3FFAA 2HXYA 3LY5A 1MV5A 1W1WA 5EP3A 1ZU4A 1T8TA 4MYHA 4TLEA 4R71A 1Q44A 3QXXA 2CCKA 4B6FA 1VHLA 2YWFA 3IHWA 2DYKA 1T8UA 5D3MB 4RD3A 1VCNA 5LB4A 4BLTA 3CH4B 3NTUA 4HLDA 5CIQA 1FW6A 1H8HA 3KFXA 5CYOA 4G5QA 3EZFA 3HJNA 3QKSB 4BQSA 3BGWA 2H1LA 3X1ZA 4LYFA 4PC1A 3GPLA 3LA6A 2WWGA 1ANKA 1G16A 2P5SA 3FKSD 4KJZA 1XMVA 4LRWA 4URXR 1O3YA 1Z6GA 1E2DA 2FN4A 5E7JA 3GMTA 3M4YA 1DBSA 2ODEA 2P0EA 3CF2A 2CDNA 4ZDWA 3IPYA 3WMFA 1F3OA 2RKOA 4MKIA 1KI9A 2WSMA 1I2DA 5E95A 3QPVA 1M2OB 1W48A 3OAAD 3U6BA 1ZD9A 2XB2A 4DLWA 4I99A 4OYHA 1EK0A 1YR8A 4B43A 4DSTA 3T1TA 1Z6TA 1J8MF 2NG1A 5DN6A 2V55B 3KUCA 3RANA 2WSSA 3CWZA 5FOUA 1NVUQ 1NBMA 4M1MA 5CDFA 2R6CA 1YZLA 2MSDB 3TUZC 3TSWA 1JQLB 2IK8A 2JA1A 3NDPA 2HDNB 3ZJYA 3BS4A 4OQLA 3WP0A 1Z28A 3A1VA 1ETUA 3EIHA 1GTVA 3H4MA 1K8RA 1GVNB 2IYSA 3NEYA 3K9GA 4D0NA 2DWQA 3DVLA 4G5RA 4WW0A 4QNMA 1II9A 1ODFA 1OIXA 3ADDA 4NYJR 1T91A 3CR7A 4A1FA 1G21E 2OCBA 2UZ3A 3K0AB 5FTKA 4Z1MA 2O8FB 3MGCA 1P2SA 1KJZA 2EU8A 2VSOA 1PVOA 3A1TA 2FV8A 2G6BA 4Z8XA 5TB5A 3KTAB 5AJYA 3TQFA 1JJ7A 2V7QD 5TVKA 5E3HA 2ERYA 2ZRHA 2J41A 2QORA 2QMUA 1KNQA 3FGNA 4A92A 3QXHA 1W36C 4JSTA 1FX0A 2NO6A 4L8GA 3W6NA 4Q7KA 2W6JA 4URUR 3GJ6A 2ZE5A 2GRJA 1G4UR 4H1VA 1EXMA 3AP3A 2QP4A 1E69A 2J5XA 2CNWA 2G1KA 1KJYA 1QRAA 4UNSA 1MR3F 2C77A 3UMFA 4AG6A 1E9RA 2EFEB 1JEDA 1JEEA 1U8ZA 2FZ4A 2X8AA 2ZVPX 2YWHA 2R6FA 4O0MA 4DLVA 3U44A 1N6LA 2ASEA 3QKTA 4OQXA 4NYMQ 3HU3A 3CZPA 3ICQB 4Q1EA 2DBYA 4MITA 2ZRGA 5KSPA 2WJHA 1DAKA 2PEYA 3UIEA 8OHMA 2YVUA 2ZROA 2ORWA 1G8YA 5GVSA 1E2EA 1XF9A 4NMMA 1RRGA 4M1YA 4D26A 3ZIAA 4PX9A 3AF4A 4OI4A 4ASUD 4U5XA 3RRMA 4UJ3A 1N6OA 2L0XA 1LNZA 2J7PA 3RRZA 5HKKD 1P9NA 3RS3A 2C99A 2CHGA 4KHZA 4JLBA 4O2RA 4NH0A 4C0KA 1OXSC 1S1CA 5H68A 1Z2CA 2ZYVX 2OLKA 2XTMA 3AQ4A 4Q66C 1LV7A 1YZKA 4G5SA 2RGDA 1DELA 4BUJA 1MT0A 2OFXA 2WICA 2CVFA 3D7MA 2Q9AA 4RKEA 2AKAB 2ZE7A 3SJCA 1E99A 2IYRA 4W7SA 1R5NA 1TF7A 3QKRA 4AWXA 5J4VA 5F9FA 3SBEA 1R10A 1SVSA 4AKGA 4LJ9A 4UXJA 3REGA 5JHGB 1WE2A 2ZAOA 4KVAA 4WBSA 4UKDA 1U8YA 2CVHA 3C15C 1ZUNB 3C5CA 3K0CC 4JBYA 2FWRA 4WOPA 2QE7D 4MGZR 3RHFA 4U7DA 3K70D 5EP1A 4B33A 1LY1A 2E1RA 4II7A 1TX4B 4C0BA 1HQYE 1YKSA 2W83A 1E2JA 3EC1A 3SJZA 2IX3A 1H65A 1K5DA 4Q02A 3THXB 2XZLA 4TYNA 2VYFA 2QMHA 4JVMA 4LK2A 2REXB 3TIFA 3WNBA 2XNDD 4QJ4A 2D2FA 3U7FB 1QHIA 3RWOA 3WRXC 2QT1A 2W2VA 2QNRA 2GEVA 2NIPA 3QUSA 4M4SA 3THYA 3JVVA 1T5LA 1W4CA 4POAA 5FUYA 3LQRA 4HLCA 4Q1AA 1JR6A 4QNRA 1R2QA 1Q1BA 2DFNA 2ZJBA 4TLBA 1M6NA 5FI1B 2QRZA 3WMEA 1W0KD 3V4FA 3GJ5A 1US8A 2IYLD 5EZ5A 1Q57A 5EXXA 1HYQA 1T9HA 2ZI3A 1KY3A 3O8RA 1SXJE 2DPXA 3M0EA 3B1VA 1U81A 2Z83A 3EZ9A 3ZH9B 2HLDA 3GLHA 3JZAA 1KO8A 5BQ5A 2AKYA 3VQTA 5HTKA 3IHLA 3MRSA 3NIBA 1E32A 1R4AA 2UZIR 2F3TA 4PQYA 4ARZA 4YMVA 1G8GA 2QI9C 521PA 3WHLA 4WA7A 2QY9A 1EFHA 2CJWB 1N6HA 3B6EA 3T1VA 3W3AA 2XB4A 1CS4C 1YZUA 3KQKA 4YXWD 4TL7A 1SQ5A 2P6UA 1QVRA 4OJKA 4G1UC 5FUXA 4HDQB 2XX3A 3AVXA 3AGPA 4I4LA 4Q21A 1BH2A 4G01B 1SXJD 2OV2A 5FUVA 3QPWA 2PMDA 3OIVA 1M7GA 1YZGA 5SZKB 3TQCA 3O8BA 1YVDA 4HAUA 4LX0A 3AKYA 3SI7A 3WNCA 1WMSA 2ZJAA 3DOEA 3PG5A 4JVLA 1FP6A 2YWEA 3LWNA 4YC7A 4BWYA 1V5WA 1A7JA 1OB5A 4YMSA 4QG7A 1Q1QA 2YOGA 4EPXA 3KQLA 3OF5A 5IT5A 3GLGB 1E1RA 2BMDA 2LKDA 3U2QA 1XD9A 2FOLA 2QSYA 4PPQA 1XXHA 4DDWA 1CLUA 1XTSA 1OH7A 1PLKA 1X3SA 2O0JA 2OFWA 1G18A 1K6MA 2F7SA 2GCOA 4DBLC 1QHHA 4DJTA 1JI0A 3I73A 2RAPA 4IOMA 2VRWA 1W2GA 3QNUA 4LBYA 1XEWX 3EIQA 1UPTA 3EWSA 5FL7A 4B47A 1U9IC 1SULA 1EFRA 4G0NA 1CKEA 2N42A 3RS2A 3IIJA 2CLCX 4QC2A 2QBYA 3QXSA 3OIUA 1U98A 1UKZA 3GJ8A 4GRAA 4KFSA 4NCNA 5P21A 2ZU0C 1T3LA 2ZSAA 2DHRA 3A58B 2NO9A 3ASZA 3A1WA 2XSZA 3NBXX 3K0SA 1E2IA 2QT0A 3B82A 4HUQB 1G6HA 2JLRA 3Q9LA 3WHKA 4M1KA 3TUJC 6Q21A 1KSFX 5K8IA 1F2UA 2W6JD 3TSZA 4BPBA 1Q1EA 1FP7A 2GAAA 3TKLA 1A2KC 2DFKB 3F5FA 1GOTA 5CJPA 3MWLA 3KQNA 3NH9A 2WZQA 3WBJA 2GVZC 3N2EA 4PFSA 4XOIA 1E6CA 3D31A 1J70A 3F8TA 4LCBA 2RGCA 1Y63A 3UATA 1HV8A 5EP4A 2O52A 1M7HA 5LBIA 2OUKA 1TL7C 2QM7A 4N0EA 2VP4A 2MSEB 1JBKA 5L3RA 2FDCA 5CB6A 1VG8A 2JJ8A 3EW9A 4M0LA 4EDHA 1ZM9A 3AH8A 1P9WA 2WBLC 5HCNA 3PENA 4L15A 2HV8A 2ZETA 4IJMA 4OJQA 1ESNA 1VG9B 1S96A 1F5NA 1Z08A 2CE7A 4GSYA 3X2SA 2P5TB 1W36B 1Z5ZA 1BMFA 2R65A 1XP8A 5A5GA 4V02A 1OT3A 2DR3A 2PZFA 5FI0B 3ZYCA 3BH0A 1KO5A 1E2PA 1GFIA 1Z22A 1XMSA 4J0QA 4LHWA 4PPFA 1Z0IA 3KB1A 1OH8A 1OYWA 2IXGA 4Q4JB 3L0OA 1NN1A 1NJFA 3MLEA 5TARA 2GJ8A 2PZEA 2QTHA 3DM5A 2ZYWX 4G5OA 1WBBA 3S1AB 4ZKDA 4BLQA 4ERNA 4EPTA 4JJKA 3B5JA 1KSJA 2GXUA 3TW8B 2XOKD 3FMFA 4DLSA 2IHBA 3BE4A 3FOZA 4MYTA 3RABA 3LDAA 4OHWA 4DSUA 2Q3HA 2F55A 2ZI6A 1SVKA 2BVNA 2XAUA 4LUCA 1AQUA 1RRPA 4HDOB 2GBLC 4IOKA 4FWTA 4XWKA 1Z6XA 4GT1A 3RVBA 1N6NA 4US0R 5K8UA 1D9XA 2RB4A 4UQOA 3R9XA 3P26A 4P4SB 2F6RA 4B34A 4O2LA 1BO6A 5L3SA 4YDHB 2HCJB 3B9QA 3KB2A 4LJAA 2OCPA 4G5GA 1NIPA 4IEIA 4RY2A 4CEHA 1DG1G 4DIEA 5FPKA 4JBXA 2H57A 3QI2A 4BLPA 2V1XA 4DEYA 3RRYA 4C0JA 1Q0UA 1G6OA 4E22A 2EWWA 4FCTA 4FINA 4DCUA 2KB0A 1E9BA 2QAGA 3GJXC 3GLIA 2J46A 2FF7A 4BZQA 5AJVB 4QFMA 2B92A 1OHHD 2WOJA 2ZS9A 4Z8YA 4BEJA 1ZU5A 1PUJA 5EE5B 4BRWA 4B71A 4XSHA 4NZYA 3BIFA 3W90A 3V4RA 1JQJC 1QHGA 4TLAA 2HF9A 3AP1A 1RC8A 5DGXA 3CX7A 5E7IA 1VHTA 2ZI7A 3B1YA 4GPTA 4FW9A 5IDVA 1IN4A 4QBFA 4Q4AB 1GG2A 2ZRPA 3I32A 3I3SR 4FMBB 3TSOA 4KO8A 3AUXA 1U0LA 2ZRJA 4LHXA 1ONBA 2IXEA 1R0ZA 2NTYC 2C78A 1TNDA 1E79D 1ESMA 4MGYR 3NC1C 1TADA 2J87A 3AB3A 1CBUA 1E0SA 1HE8B 3CIOA 4IEEA 4MRNA 5F2EA 4MRSA 4B2LA 5TY0A 1S0UA 2V4ZA 1KK2A 3CPEA 1KHTA 1E2QA 5EJEA 2PJRA 3QG5A 2GDJA 1KO4A 5EP2A 1FQKA 4NKRA 1S3SA 1ZMXA 4I1SA 3R8CA 3T1OA 3AKCA 1AS3A 1HURA 2NZJA 2RGXA 3PFIA 4A6XA 3PXGA 4LV6A 3O8DA 3GP8A 1N6PA 5DI3A 2IS6A 3WYGA 2AWOA 2ORVA 4JLDA 1BYUA 3IBYA 4NONA 4URYR 3R9WA 3AP2A 4EFMA 1W0JA 2QPTA 2Z4SA 3BRWD 1CR1A 3P4XA 1XD8A 1E1RD 4TN1A 1G3RA 1NG9A 4X8LA 3BH7A 4C4PA 5CB8A 2HEIA 1P4SA 3LAWA 4AYTA 4D4KA 2JLVA 1UBCA 3OHMA 5GADl 3NBYC 1CRQA 2OAQ1 4NP6A 5ANRB 2H7VA 3H0KA 5JSZA 3GQBA 2F1RA 4UNQA 3RDPA 4KV9A 4MRPA 3PR1A 2WWXA 3OAAA 5LB2A 4ZIRA 2XTZA 3B1XA 2ZUDA 1II8B 4DT1B 4UXHA 1W49A 1R5OA 3OFND 1PV4A 3T5DA 4RZ3A 3QPUA 4PHFA 2WJVA 3QE0A 1RRFA 1ZC4A 2R62A 2QG6A 4ZI3A 4N3NA 4IOJA 4JBWA 2IS2A 1XCGB 3VR3A 5FPSA 4LV8B 1XMIA 1SHZA 1NNEA 3QG1A 1NLFA 1RVDA 2J0VA 2AD5A 4F91B 1HTWA 1UBEA 2W0MA 1SHKA 2IYZA 2ONKA 2VP6A 4WIAA 2O8CA 4RD4A 1KMHA 2VHJA 3C5HA 3IO5A 4B44A 1KI7A 3I62A 4DVGA 5HZHA 4JS0A 2R8RA 3I72A 4XD7D 1VTKA 4Q1CA 3NEJA 4PO9A 3FWYA 3ADCA 2A5FA 5FTNA 1G3IA 4GFDA 3PUWA 4DLYA 1E9EA 3KJGA 3SQWA 3DM9B 4DIDA 2RGBA 1UADA 3WMGA 2RGAA 2RHDA 2WIBA 3RRNA 5JWOA 2LWIA 2RH5A 1HEIA 4RFSA 2OFOA 2R6GA 2G88A 5FBWB 2IHYA 2VBCA 2FSHA 1XD2A 1FTNA 2ODBA 4URVR 2J0UA 2KWIA 5JWHA 3WYFA 1OF1A 1HA3A 2N46A 4BFXA 1IJEA 4PZZA 1YZQA 1N0WA 4NCIA 5JI3E 1Q12A 1FOEB 3MAAC 1FL9A 1LB1B 2OXRA 1MRNA 4L5BA 2KBFA 3TNFA 3VR5A 4B75A 1PUIA 5DYGA 4X8OA 1R8QA 2YNMA 1G7CA 1BMFD 1MO5A 2ATXA 4X8MA 1MOZA 2IF2A 3U3OA 3SN6A 1LF0A 3Q7QA 1XRJA 2ZJ2A 1ZJ6A 3WYAA 5GJVC 4ASUA 1X86B 1C1YA 4LBVA 2ZUBA 4LY6A 4MDFA 2VSXA 1E9CA 1P60A 4A8JA 4TYPA 1WQ1R 4QHTA 3FMIA 1KGDA 2ZR9A 1KAOA 3OEED 3CX8A 1FUUA 1TTTA 3HR8A 4XVRA 4AYWA 4LHYA 5TDHA 2BEJA 3U3MA 5JEDA 1VDZA 3U5ZB 4D25A 2C04A 1XTIA 2QRNA 4TMTA 1ZD8A 2FGKA 4P4TA 5DSZA 2C03A 2V54A 3QKRB 3K1JA 1IQPA 2QQ0A 4KBGA 3Q3JB 1GITA 4RJLA 1DO0A 1DG3A 1SVWA 3EZ2A 4Q7MB 2OEPA 2Q6TA 2D7DA 2RGNC 4PC2A 3SDZA 4A0GA 2FNAA 4KYUA 4NHOA 1E98A 1KY2A 1VG0B 2CL6X 3JVUA 1O87A 1GSIA 1CR2A 1COWD 5TV2A 1P62B 2Z0MA 3P20A 5IRCD 3C16C 5FBVB 2BBWA 3K0FB 1ZRHA 2OILA 5K8TA 1W4BA 1TF2A 1CR4A 2NPIA 2PLFA 1OXVA 2F1JA 1TUEA 3EZ7A 4RD6A 4M1SA 4ESVA 3A6PC 1Z29A 3ZZTA 4BFWA 4DLRA 4OQNA 2XNDA 1ELOA 1TPZA 3H86A 5FBLB 2FFHA 5DH9A 4KBFA 1H8EA 3TUIC 4TWZA 2CHVA 1FNMA 4B2IA 3AVPA 2IWRA 1XJQA 1W0KA 5L8VA 4JKYA 1N0VC 2ZI5A 3KKMA 2YYZA 1G1MA 4HYYA 1I2MA 2UVQA 2NZ8A 1UEJA 4A2PA 2IYQA 1U94A 3KXKA 3U4QA 2WM9B 1KKMA 3ZD7A 1QG2A 2A5GA 1GL6A 4RZXA 3TH5A 1ZM3A 1SGWA 3SYKA 1RPZA 5IK2D 1IXRC 2D62A 3E70C 2O0KA 2YHSA 2O8EA 5IHPA 3TK1A 1KI6A 2E9SA 1E0AA 1KSGA 1TEVA 1I4LD 2OCYC 3AVQA 4CT4B 1ZNYA 3W8RA 4I81A 1KZGB 3GJ3A 2FSFA 5FR2A 3TGPA 2B7BA 1E2GA 2G0NA 1GDDA 4BFZA 3GLGE 2BEKA 3R9IA 3A4LA 5HZKA 1ZP6A 4C2UA 1KI2A 2PCJA 2F1HA 4LJ5A 1QDEA 1N6RA 1GNRA 1W0JD 2A9KA 1YZNA 3DMNA 3KJHA 4W5WA 1NVWQ 1IN6A 4YXWA 5DYIA 2XEXA 4JYCA 4MUBA 2FU5C 2AFIE 4TMZA 3A1SA 1EESA 2HXSA 4M1TA 2GJAA 1SXJA 3QJYA 4C30A 4GNKA 5KDLA 2OT3B 2XXAB 3PV0A 2X77A 4US2R 4GOXA 4OHXA 4HLUA 4D82A 1NMXA 1G3QA 5BN4A 3B78A 4M2LA 3IEUA 2HT1A 2WAXA 2OSBA 3PEYA 4LSGA 4RFVA 1NVVQ 4Q1DA 1QHHB 4NYJQ 3TR0A 5FL3A 1GNPA 2GHIA 3ND8A 3LD9A 3VU9A 5JS8A 4B3GA 5JS7A 4C3ZA 2CL0X 3UWOA 1AKYA 3PUYA 2H17A 1YJ5A 1X8LA 2CCJA 3LX8A 2LCFA 1NVVR 2PBRA 5JRJA 4FMDF 1Z0FA 2D74A 2EWVA 1WDTA 4DCVA 2AX4A 1TAGA 2IYXA 4EPRA 5BXQC 5L3QB 4HAWA 2ZRBA 5KNBA 5HCIA 4URZR 1D6JA 2CK3D 3LXRA 4TTQA 1IY0A 3VKGA 3REFA 2Q21A 1DVRA 3QKUA 4Q9JA 3K9LA 3PEUA 1AZSC 4JLJA 3RSOA 5AUQA 3L0PA 1C9KA 5D3QA 3QEOA 5EE9A 4QRHA 3TBKA 3EWAA 2WJIA 5J4HA 2W00A 1UBGA 4LGMA 3T35A 1AS2A 3KKNA 3CH5A 1XEXA 1EWRA 5CLQA 4QHYA 3RS0A 1AIPA 4TYYA 1F2TA 3A4NA 4JLKA 1ZUHA 1UFQA 2YZ2A 4F4CA 3QBVA 5TMPA 4KLZA 3ZQ6A 1XEFA 4C7OB 4P0TA 3ICEA 4MKHA 2IT1A 2WKRA 1W5SA 4LC1A 2ZRFA 1L7VC 4KI0A 1GL9B 1YHNA 3CKLA 1HT2E 2JDID 2EYQA 2PT5A 2VEDA 3Q85A 4TT3D 3W8NA 5FR1A 1A5TA 4DLUA 1IOZA 3IILA 3BXZA 1NVXQ 2JASA 5AK0A 3BB4A 3NBFA 4A36A 4JZKA 4D4LA 1N6IA 2GZDA 1XCMA 4DCTA 1N25A 1ZNWA 4WZAE 2BCGY 3ZGXA 3DKVA 1TU4A 3NKVA 2JJ2D 1KZ7B 5CJ2A 3Q5EA 1NMYA 2PX0A 3T34A 4EJSC 1W36D 5KNCA 3K70C 3I5XA 5B64A 4GOKA 4DRZA 2ZJZA 1QHXA 4TMKA 4QL3A 1ZM4A 2ONJA 2ZRMA 2IWHA 2W6ID 1II0A 1FNNA 1T0HB 2ZJOA 1E9DA 4ON9A 3CRRA 4V0ME 3EA0A 1TQDA 2K5UA 4OI1A 3K0EA 4ZV4A 2VLIA 5A0FA 3GFTA 4UNRA 3FMOB 1DTSA 2FFAA 2XOKA 3KJIA 2HYIC 2FFBA 4LJYA 1IXZA 3X1YA 3CRMA 4PTLA 1ZM2A 4EQ6B 4GBMA 4BFVA 4FCWA 4MKFA 4HB2A 2BM0A 2O5VA 4JL8A 3HU2A 2GKSA 3Q7PA 2RMKA 2WMOB 3W5IA 4D2IA 3HP1A 4IVQA 4UXIA 3PUXA 1NIJA 1DEKA 4TMVA 3CPJB 3DZ8A 3LVQE 4LBZA 2GVDC 3QVUA 1F6BA 3DMDA 2D06A 2NOAA 3Q8XB 3AVOA 1H8ED 1KJWA 2Y8EA 3FDIA 4IFBA 1G7SA 4UNNA 5KU1A 4DDVA 2H5EA 2QL6A 3ZS8A 3IEVA 2VO1A 3PEVA 1B0UA 2EW1A 2FZLA 1P7CA 2P2LA 4CF7A 1RRCA 3K53A 1X6VA 1J8YF 4TL8A 1QHNA 4ZI2A 2QP9X 3MUFA 1ZIOA 1OHHA 5FTLA 4PANA 3U60B 4HAZA 2W2XA 4EFNA 2ZE8A 4B3CA 2O8DA 1HY3A 4FN5A 1B23P 2JIZD 3VMFA 1E2FA 4MA4A 3B9PA 3IBGA 2DFLA 3VFDA 4D4JA 2GZAA 2ZREA 5SZIA 1IBRA 2RCNA 1I4TD 3ZZ0A 4HSEA 3SFZA 2GA8A 3EPHA 4QXAA 5CK4A 2QAJA 4RZUA 4IDQA 3SOPA 2CLDX 1P5ZB 4M9SA 1E79A 2XJ9A 4JVSB 4JLMA 3SZRA 4KFUA 2JLXA 2OBMA 3B7GA 2Q9CA 2WAYA 3C14C 4AD8A 1ZW6A 4CEJA 4OL0A 3HYTA 4CEIB 1RYFA 3L43A 4MQBA 3W9YA 4DEXA 2GXQA 3GEHA 4QGGA 2WJYA 4ESHA 1JR3E 4HZUB 3GLFA 2P6RA 1KO7A 2IYYA 2FH5B 5D3MA 4MUAA 5C18A 1S9HA 1U2RA 2RHMA 1AKEA 1J2JA 1WRBA 3AKEA 1GWNA 5AJXA 4AC9A 2WWYA 2OAP1 4QJ5A 3QKSA 1E9FA 2ZRDA 2EQBA 3J81k 1DARA 4A0HA 1KMQA 1OIVA 2PH1A 2ZIAA 1Z47A 4XTRA 3A36A 3BJIC 1DAMA 3HU1A 2XZOA 4IHQA 1IJFA 2ZAMA 1XEWY 4P32A 1DPFA 2O8BB 1JJVA 3WXMA 3T06B 5FOVA 1G5PA 3GJ4A 1A2BA 1CXZA 1G7RA 1MO6A 3KKOA 1RIFA 2F9LA 2R6AA 4PSAA 4C0SA 2KI5A 1PJRA 2BMEA 3CF0A 3MCAA 1SVOA 3UMSA 421PA 1JR3D 1AGPA 4TZ0A 4JVNA 1E9AA 1VIYA 3LH5A 4JL6A 3MJHA 4AIIA 3OFNA 2BKEA 3CO5A 4DSNA 4D80A 2I1QA 3TAUA 5KPDA 2D7CA 3BB1A 1KI4A 3TR5A 5LPNA 3E2IA 4DLTA 2B8TA 4PSKA 1KOFA 2H8KA 4K81B 1J7KA 2VF7A 1N5IA 2ZRNA 5A4JA 4BFSA 4BFUA 3B2EA 1IY1A
chains in the Genus database with same CATH superfamily
3QM1A 1T2FA 1I1HA 4QU5A 4XIIA 2HUPA 3NO4A 1X1DA 4TKLA 1JXQA 1G8JA 3RYCA 4PPNA 3DDOA 4PHGA 4RZ2A 2AI2A 1A9XB 2RHTA 1QH1A 1VCMA 3GAZA 5E2IA 1OPRA 3R5FA 4CZ2A 5DV9A 2IA5A 2Z95A 3ND9A 3OT1B 3THOA 2BZGA 4K0KB 4WDRA 2FN7A 1M1UA 4TV8A 4Q3BA 4RV4A 2FG7C 1EIWA 1G8KA 1N5LA 1R8XA 2YXEA 3R0VA 3EPLA 4N82A 2JLWA 1XZFA 3RSLA 3ORQA 4DFDA 2GWHA 3PU6A 5B2FA 4Q12A 2ZULA 1BN6A 3O8OA 5K03A 1BH6A 1KC1A 4UM7A 2JLZA 2FMXA 4D92A 5BYKA 2QPOA 1S3GA 4JR1A 3FE2A 5FYQA 3R8XA 4TUYB 2WWRA 4J9VA 5EHGA 4R8MA 3N28A 1YB5A 4D98A 4J0EA 2DQSA 1WKBA 2XUAA 3VPGA 3GWGA 1NVKA 1VA4A 4I4CA 2UUAB 1MB3A 2G6TA 3DAPA 3S2IA 2FEMA 2YJGA 4B74A 2FMKA 1IHXA 1L4FA 2IKQA 2PZMA 2GCNA 3OY2A 4K6FA 1E2KA 3QU9A 5ICGA 4QXPA 1C2TA 4XRRA 4IIVA 2QPAA 4X85A 1BMDA 1YB1A 3EXAA 3C85A 1FNBA 3OTWA 4AKIA 5DU2A 6NULA 2F3QA 2BBSA 4I4IA 5FORA 3MEQA 2G0TA 1NLMA 2R79A 4Q34A 2JFBA 3I64A 2K2WA 1U2SA 3E8SA 2FA9A 2YWGA 3PVZA 4PNZA 1NAHA 4KYIB 3CPSA 4NS4A 1WZEA 2B2CA 3OEEA 2BCJQ 4KU4A 4YREA 3VHXA 2EFGA 3VJMA 3CA8A 3ZKWA 2GX6A 2XE7A 4D46A 3KQUA 3QK7A 4JOQA 2XZTA 4R1OA 5JCJA 2QG9A 2B5VA 2BOVA 2MHCA 2MDTA 2V6JA 4D4MA 5KYWB 2HZBA 4KYVA 4R7ZA 3DVSX 2O2GA 1VPVA 3ZQ4A 1NV8A 4Q4HB 5IZCC 2H00A 4CM9D 5JZSA 1V8FA 4L02A 5LQJA 1LTHR 4D0GA 4QM7A 3BC1A 4FMDB 3NZEA 1E1CB 4WA8A 1X0XA 3E7PA 4KFCA 3M6WA 1COWA 1ONPA 1FFHA 1G41A 4NDZA 4LYJA 2PMFA 5B7PA 1PR0A 1B00A 4KE8A 1OFVA 1CZHA 3ZWVA 1P4HA 2C82A 1ZUNA 2JI9A 4D97A 3ZCSA 4LF6B 3OZTA 4O4IF 4YLGA 4A26A 3A11A 2O5RA 3SBXA 4GBGA 2C5HA 3SNHA 1SZDA 3R74A 2O8DB 5H82A 3M4JA 1BWRA 1RHQA 5SV2A 3SXJA 4DE5A 4IZ6A 3ETEA 3L0SA 4FWIB 3NBQA 1PWZA 4D9MA 1RJFA 3QY0A 1JHQA 1SN7A 5LKAA 3I04A 4D6XA 2VS1A 2HBYA 3DVQX 4HX9A 4AKEA 1YR7A 3EXG2 2VL7A 1NYTA 4HP8A 2CNDA 2O1XA 1SA0B 5BV8A 4I50B 1QV9A 3C8UA 3O1IC 4MUIA 3R20A 1JSRA 4ETIA 1PU2A 1THGA 2NU7B 4ENPA 1C8LA 2BRUA 2D59A 2X2PA 2XVXA 5TJ9A 4EBFA 4OFXA 2RGGA 4RYLA 2K6GA 4I1OA 2ORIA 2CCGA 3P4YA 4H17A 3X1KA 4D4GA 5CEFA 4MVYA 1QIEA 1JL3A 1CNMA 4NV3A 1DWPA 4M38A 1AN0A 2EBFX 3INTA 1XMPA 3TZCA 3OEHD 4YJHB 4I2NA 2GCPA 4L1KA 3DO8A 1Q14A 2DMRA 1EVZA 2H59A 4OFZA 4YAJA 4KHPB 5IK2A 1BS1A 2BGMA 2ETXA 3DDUA 5CVCA 5LOVF 2I2CA 1C1DB 3PC6A 1VKNA 4L8VA 3VX4A 1JHXA 3GEMA 3KKPA 2CZGA 3V46A 1P4GA 1TK9A 2WPNA 2F4NA 3ZIUA 5CLFA 2LW7A 2DWOA 4P81A 1Y5NA 2X19A 3KQTA 4ITUA 4IV0A 4O3FA 4PSDA 3SE7A 4F9FA 1ADJA 1Z8HA 2BW0A 5KNDA 1PEDA 1CRPA 3V2GA 1LDEA 1E64A 2WKPA 4RK4A 4X8HA 4YBRA 4BC0A 4ZGWA 3VC2A 3ER8A 4CV1A 2HNAA 3MTJA 4EB8A 1YMUA 2ABWA 5D85A 1LCIA 1N2CE 1T3HA 4PQFA 5B37A 1ZC3A 3LY9A 1T10A 2VHQA 4K2HA 4PLCA 3PITA 5IARA 3MFYA 4X92A 5EJIA 1E2HA 2PBZA 3M2TA 2XV1A 4JN6B 4KN9S 1RKBA 2AVNA 1WCV1 2CHUA 1TT5A 2C95A 1MQ8B 2XUFA 1NFQA 3BFPA 1G3MA 3U40A 3W34A 2G17A 2P75A 4PZ0A 1E0DA 2MCFA 3EBOA 4Z3OA 2RAVA 3BM5A 3A4MA 3K6SB 3M6LA 4UNPA 2Q3FA 4BXOA 3GOHA 1KNXA 3A3YA 3MWKA 4L4YA 5CYGA 3CUEF 4DDHA 1M6VB 4KXYA 1NVBA 4ID9A 3TM4A 3NVDA 4FYIA 3LLVA 1EHYA 1IHDA 3DZJA 4AJEA 2PYIA 3EDCA 2IU3A 5CURA 4FKZA 2PUAA 2UVPB 4KODA 4RORA 4QLOA 3ZVKA 1ZH0A 3OJXA 3DAGA 4J0IA 3P2YA 4KIUA 1NRXA 2DHEA 1DBQA 4IDBA 3SC3A 4BO9A 2A5YB 3CRVA 5FFMA 3QV2A 3MCVA 5ITWA 2XCIA 2QIOA 4YJ2F 4KLCA 1SXHA 4HH3C 3PC7A 1RI2A 3E58A 4HAYA 4L0DA 4URFA 2GYVA 3BCSA 3DBIA 4RNDB 4S04A 2F17A 3L0ZA 3L1UA 2QE6A 1E7YA 2JJ1D 2DSNA 2G5PA 3G8YA 4LE1A 3W6OA 4GDFA 2BPOA 3O75A 1KZHA 3K09C 3RVKA 1UBSB 3I52A 2YDXA 4OUDA 1IVSA 1PZGA 1QIJA 3PZBA 3LKBA 2C3OA 2EX4A 3U7EB 5KYYA 1Z06A 2IS1A 5H4GA 1JBQA 3EK2A 3EA5A 3OLXA 3VSAA 2D5IA 3B7PA 4K26A 5JATA 1W87A 3O3CA 4MUXA 3Q9UA 4GI7A 2ID9A 3MQFA 1G2IA 4J9UE 1B3RA 2GEFA 3TPZA 4U2DA 2CHEA 3DZBA 1HNWB 1KVRA 1JHZA 1R0YA 4EYSA 4C3UA 3I92A 3PLAE 5FPTA 2NAFA 5EKTA 3U44B 3NBKA 4CDGA 4BBJA 3ZLJA 2OC4A 1XZIA 1EDOA 5BSGA 2TMYA 2HWKA 3C3MA 4H16A 4IKOA 4PGHA 2GBCA 3RM3A 2PUBA 1L9XA 2B5WA 2B82A 3ZVMA 4W5JA 1QIHA 3BXOA 1VJRA 1Q2XA 1G2QA 4FIDA 2OZPA 2VWQA 5K3OA 3ZE6A 1G5HA 5DIFA 1OROA 1ZJJA 1Z4OA 2JDIA 1HT0A 1NU8A 5G1PA 1RHUA 1TK3A 4FOSA 2Y76A 4IQ0A 1BMQA 2G08A 3FHJA 1XQXA 4KRXA 3GFBA 3LNCA 5CK5A 1K92A 5HK8A 2ZPTX 1YRQA 3VR5H 4XH9B 3ZDXB 3R3SA 4FNGA 1LZKA 1XPRA 3SJBA 1S7GA 5EWLB 3LO5A 4IHJB 4GVPA 4S2UA 4US1R 4UU1A 4C2TA 1IHUA 1MIHA 1PR4A 2P35A 4DMFA 3AUUA 4RJJA 1CUCA 3RYTC 3WE7A 4B7AA 4DA0A 5BQ3A 4KXXA 2F3SA 1UPUA 1K4MA 2YFKA 4TRNA 3R9KA 4B4WA 1L5ZA 2AJ8A 4CM8A 1BW9B 3CZ5A 3I34X 6GPBA 2BL4A 2VDNB 3VZDA 3DKKA 1OC2A 1ZNXA 2A57A 1ONNA 3WMRA 1WDLA 3T3IA 4U7FA 2MYUA 4BV2A 4N5DA 1LLDA 4H2DA 1E6KA 1TLLA 4N18A 4NG5A 1VG1A 2KQUA 2HI0A 721PA 4YMUA 2QR2A 2WPDD 1DQZA 4WY2A 2ADMA 5DHFA 3TOCA 2OCGA 3WGJA 4CMJA 5DW3A 4W99A 2YY6A 3PFKA 3STUA 5LZ7A 2WP0A 3DNFA 2WG0A 2XQJA 3QPDA 2I7DA 3KALA 5SY4A 3JARA 4YLEA 3CRZA 2LP4Y 4UPVA 3FZEA 5CTAA 3EMBA 3BJRA 3GEEA 3DWFA 3MRXA 2V0CA 1E3QA 3E7FA 3THYB 3KLPX 1BDBA 4X61A 4ZOBA 2Q3CA 2W5UA 4R2JA 1UKBA 2Y6UA 3KJZA 4U4AA 3LFHA 1RWBA 4U9UA 4YR9A 4L16A 2DAPA 2FXVA 3LM8A 4GZ6A 4BQNA 4BVAA 4KQ6A 4IIJA 2BIFA 1M6EX 4AJKA 1W94A 1A1SA 1P0QA 4V0MA 4ZOCA 1WU7A 5E2BA 3TMAA 2XY4A 1JA1A 1FTSA 1Z8DA 1JEQA 3MN1A 5DEIA 3BMQA 3OZXA 3STVA 4IMRA 4ZEVA 3ZZNA 2IC5A 4UUBA 5B7QA 5C1BA 1QR6A 1PZHA 2J1LA 3M81A 1MABA 3EQ9A 4OHKA 4DA7A 5JXIA 5EWJA 4Q1VA 3KLBA 3CC8A 4NCKA 2VKTA 4WCDA 5IAKA 3PTAA 2DR0A 4GBJA 5T67A 3EY4A 1D6SA 1K27A 2QQEA 3ENKA 3HSKA 2N47A 3HYSA 3I76A 2XITA 4Q24A 1CEYA 1CJMA 1IONA 4Q4AA 3FRIA 1YV9A 2BF4A 2FUEA 4CQNA 5JC1A 4LWPA 3JASB 3VH2A 5F35A 2WJPA 2B1GA 3PVSA 2CDRA 3V8NA 4OO3A 1QCZA 5LZ5A 3SYNA 3FOBA 5LD2C 1E89A 1J8QA 2AH5A 3UANA 1Y3CE 1HK7A 4TTTS 4MRAA 1KL7A 4KUGA 2COUA 3IKVA 1A5AB 1CUHA 3UWPA 3RRBA 1DXQA 1UKEA 2ZDHA 5TQ2A 2Q3EA 4RHFA 5JAHA 2O0HA 1JB1A 1WCIB 4Y0AA 1S2MA 3VR6A 3F6YA 5AJZA 1IAQA 5K05A 2HJHA 1I7NA 2QN7A 2J3EA 3V5NA 1OLOA 3HR4A 2VWHA 2NP6A 4WL0A 5J43A 2I7VA 4UU7A 4LIPD 2HWYA 2RHRA 4CQLA 3DE7X 2NNLD 5FNVF 1YAJA 2YINC 3SNKA 5JCPA 3ORYA 1MXHA 1ISMA 1H0KA 1GTG1 1NXTA 5CNIA 4PZYA 4I1VA 1RE0A 3CB4A 2BZSA 2HFJA 2XKKA 1ESCA 5C5CA 1BHQ1 2JEYA 4UU0A 4I9FA 1HUQA 1LA2A 2YXDA 1ZK3A 4IWNA 3N87A 1QVAA 2AZDA 4QDZA 3UMGA 1G8SA 1J21A 4CLOA 3DL4A 3GH1A 4BVEA 3UH0A 2J9GA 2R8YA 3W4KA 1MGOA 2GH1A 3FUTA 3NJ8A 5CG2A 3D0RA 3FOEC 4G5FA 4JHLA 5KVQA 3T3DA 4E1AA 4W5NA 4XYLA 3MILA 2CF6A 4GL4A 2AR7A 5FOWA 1D6MA 3G2OA 2QBYB 3ICPA 2VIIA 3LVRE 4AQDA 2RD2A 4EECA 1HDRA 5AI4A 1E20A 4M6WB 5FAKA 2GD0A 1YK0A 2ZJ4A 5JROA 4GLOA 4HNUA 3DMTC 4S1TA 3AI3A 2H2GA 5DBIA 3ZWMA 2NSLA 1V4VA 3MUEA 3ZLBA 4Q4LA 3CKMA 5ESDA 5AW9A 1N0IA 4EY3A 2Q2QA 2GN8A 5DLDA 3FTDA 5K0TA 1JSLA 1NDQA 4LJ7A 4PGGA 5JAIA 4Q4DA 1QH9A 1L0BA 3EIFA 3FMPB 2YNMC 1TGVA 2WF6A 1D2MA 1G60A 3NUGA 3MUNA 4K46A 5HFJA 5HOEA 3ONWA 5FA6A 2QRPA 1E7RA 1DO2A 1KMNA 1ORRA 2V6FA 4W5OA 2WQZA 4DUGA 4HLQB 5HQJA 1OFIA 1YNSA 3IUQA 3NHYA 5EHQA 1Z63A 1E2BA 1XZJA 2JB9A 4HX2A 2ECQA 2JAQA 3P27A 4LDNA 4FHCA 4N5MA 2B1QA 4FQ5A 4LYDA 4E2ZA 1ZH6A 5CFQA 3RRJA 2Z8XA 2G76A 4OKNA 4A8JC 5IW8A 5LQUA 2A7XA 3RYHA 3VZCA 1L1QA 4J0KA 2OHIA 1GU7A 1Q1GA 2WIFA 2YVAA 4ERXA 2M6KA 3HJFA 1CRWG 5CTJA 1A0OA 1WMDA 1WV1A 1CY0A 4IHAA 3TCNA 3X1MA 4YCMA 4PHHA 3U3DA 5A5FA 3A10A 1YJBA 3GRPA 1INLA 4CCSA 1KEEB 1M1YE 1KKLA 1YU9A 4TSFA 4QQ8A 2NPFA 4O4JF 4CUKA 1FJGB 3S2SA 4BEBA 3FCCA 1J09A 1U3UA 4QBGB 1W6RA 2CT8A 2I4OA 2PMBA 2RI1A 3OE4A 4DIBA 2QD5A 3JZMA 4G65A 3D9QX 2H9AA 1BJRE 1MG0A 4XUEA 6YASA 4M1OA 1AQJA 2NU6B 3VZBA 3T1QA 4PR0A 4FMCF 4E09A 1PQ4A 1UZUA 2A88A 1EJ6A 3W5AA 3H04A 1DJOA 1Q11A 4M83A 4DYVA 3GX1A 1JIXA 3ONVA 2V7XA 4D9GA 4G56A 1FMLA 3SS8A 4CG3A 1OAOC 2FVYA 2FSIA 1T4MA 3GJZA 2VKQA 2OHFA 4QO7A 3RF6A 3HZOA 1ZCZA 2G72A 1GL3A 2M2IA 3O47A 1QZZA 2H2WA 3OPMA 4TPKA 3RUPA 5KYXB 5DYTA 4AN4A 1AKWA 4LX8A 1Z3CA 1MG5A 3RTDA 3OMWA 1GKKA 3NQ41 3ESCA 4L6CA 4QODA 2FX3A 2XQVA 2J0QA 1NSTA 2IFTA 4K2AA 3G2PA 1NFRA 2D4HA 4EYEA 3EVEA 2BTQB 1T5BA 3HUEA 4H7DA 5DLQC 1O89A 1W93A 1OWLA 3SX4A 1HG1A 1AMNA 2HJGA 4YJ2B 2A5JA 3L8FA 4HDSA 5K51A 3GGOA 2B7CA 4CKWA 1XZQA 3FTCA 4HFRA 3FF1A 3SKVA 5J47A 1UAAA 1X7DA 2IUSA 1XRQA 2VI5A 3QQPA 3WWPA 2QPLA 4Y7CA 1B6TA 3CW9A 1HE1C 4A0RA 3NONA 3DLBA 4RW0A 1QAQA 2GWRA 1EGHA 4OSPA 2Q4DA 2CLFB 5HQTA 3TLZA 4EFLA 3K0FA 4LPSA 1X80B 3VKGA 3GIDA 3VZSA 3TMKA 1DFIA 4INJA 1WB9A 1UL1X 1GLGA 4J3JA 2R8OA 3GFVA 2H1RA 1I6KA 2R1VB 4DB2A 3FCOA 4K86A 1YOBA 3RVOA 1KVTA 2LPMA 4KDFA 2QNIA 2Y1FA 1KSHA 1C3LA 1E4EA 4PTYA 2JAOA 3IKMB 5BORA 1VE1A 1POWA 1X7YA 4LOJA 4NXNB 2D1SA 4XGRA 2WM8A 4MHSA 1T1RA 2R7KA 2JI4A 3T0GA 3VOAA 1CEQA 1CCWA 2Z3WA 5FTMA 3AUTA 4FSHA 2Q6LA 3F47A 4ER5A 4QBKA 5CA0B 1UXIA 1LLCA 1E3SA 5KB3A 3K8OE 4M88A 1XMJA 3R6WA 3VVMA 4A5SA 3LKDA 4EIWA 3IH5A 4G4JA 3KOXA 4C6HA 4IF4A 4F8YA 2MSLA 2XUHA 4G97A 3BVPA 3SHWA 1XVVA 4M76B 3I9V1 3T9FA 4HLUC 5A1TA 1I2ZA 1IB0A 1TVCA 3F7MA 2F1IA 4I3FA 2C31A 1JQEA 3LMKA 4R3WA 4GKAA 2QM8A 5BSTA 1L5LA 3TE6A 2AZMA 5EMKA 3G9TA 1T4CA 1G8MA 1WZ2A 4P80A 4A1OA 1X1SA 2ZAGA 4JLOA 2FSVC 4BFLA 1R88A 2A1UB 2V6MA 1U7UA 2RKWA 3DBHA 5DI3B 3UXYA 5CD1A 1NZDA 3MHTA 1K7FB 1PHRA 2HMUA 3RS4A 1P7YA 4JLNA 1FK8A 1S2GA 2QJRA 1K0UA 3HA5A 4QBHA 4WLEA 3VH3A 4G8DA 4WXEA 3L77A 3DXFA 5DNAA 1VL8A 1FJXA 2CB9A 5JUWA 1HRKA 2PU7A 5JY6A 2VDPB 2WJGA 2PRYA 1JPUA 2IBMA 1PZMA 1YVPA 1JLMA 1YRLA 3S70A 3W2GA 2ES4A 2E82A 2I4RA 2OK8A 4BBPA 4EMTA 2O6LA 1M34B 3AG6A 2RHHA 2FP3A 1JR2A 1JAYA 1OBOA 4TQUS 2X0FA 4ED9A 1A9SA 1UJBA 1EXVA 3LGAA 4ZHQA 2PGNA 1XAGA 3QVVA 2QK4A 3E3OA 4Y9DA 4M89A 1FFAA 4JUAA 1V43A 3SEZA 4ZVTA 1JAIA 1I3LA 4MVJP 3LNTA 4XIYA 1T8PA 5J5VA 4EATA 3BXFA 2I54A 3E9YA 2OD7A 4JY7A 1KEUA 2XXAA 3V9PA 1L5VA 2D5CA 2UYCA 5EFOA 4G0QA 1OFUX 2Y3IA 3LW8A 2XRYA 1NT2A 2HDHA 4MYRA 4UVEA 3VTZA 3R09A 1KF0A 1CSEE 2E89A 1PIWA 3FNFA 1NBMD 4UD6A 4F71A 1NMZA 4LGCA 5MGBA 1XWIA 1FFYA 4D6YA 2Q1TA 3ZNOA 5EPUA 4ZJYA 4KRGA 2QRMA 4Q9IA 2CFSA 2WZDA 3SR0A 3KP1A 1F14A 3QMWA 4M0UA 2WT9A 4CIBA 5FWYB 3DOIA 1Z7EA 3OZBA 4IOLA 4HV4A 2O8CB 4OBXA 4IXMA 2V9ZA 5EZSA 1XNJA 2EGGA 4IHKA 2JFXA 4PCLA 5LQNA 3QVGA 4BZZA 1XKTA 4HEJA 1GAQA 2R25B 2A3RA 5KSZA 4FGZA 1QORA 3R7AA 2PX3A 1NF8A 4P36A 3FGOA 2QU7A 1VXOA 2F43B 1I3CA 1IDN1 1YMVA 4BVKA 3RODA 7ADHA 2ZIGA 2OORA 2KX7A 4QTXA 4YUXA 1NN3A 4E2XA 5BXYA 2VUUA 1CUVA 1DQPA 1TTPB 1Z6ZA 4HO1X 4J2TA 5CPBA 3DL0A 2GD1O 2WILA 4RFSB 2JGNA 2XKJE 1IM8A 2FWAA 2OBYA 2R84A 1FP1D 4K8RB 4Q6BA 5LA6F 3KPVA 4WOJA 2FFRA 2ZJ8A 1YIAA 4QYMA 3AM5A 1GXSB 1RP7A 1U80A 1A9YA 3W8EA 3LVBA 1M75A 1WB6A 4UMFA 2E4YA 4A6EA 4B3RB 3D0QA 2Z8YM 5A4AA 1NR7A 3H05A 5ECYA 1SJ9A 2G77B 3HCCA 2QD3A 3LUDA 3H2YA 1VSQA 3K71B 4K9RA 5KQLA 2QU8A 3DBRA 3H1GA 4DLNA 1E8MA 2WTUA 1F5SA 2VJBA 3JD2A 1TE2A 3L7JA 3Q3GE 4JIMA 1I3NA 3MMZA 2PFSA 2WP8J 1ZXBA 4GUAA 3AF1A 4O2BA 1KJ9A 4R54A 1UPFA 2WK1A 4D9NA 1QNLA 4C7OA 1BJKA 3IJPA 1PI3A 1Q50A 1NHWA 2I1WA 2XYPA 1REQB 3L8DA 3OECA 2X76A 3ZIAD 2ZYDA 4ZMRA 4B81A 3RS9A 1KJNA 3NR2A 3TI9A 4DW8A 2FLWA 3WKAA 1P2GA 5L45A 3GLSA 4S1WA 3JY6A 5FNVB 3GNLA 3K1AB 4P82A 3DEKA 4N3AA 3PXAA 4ITRC 4IDAA 3IUYA 4PPGA 2BN4A 4QGFA 4EG4A 4AP9A 3ZCQA 3SSAA 3ANTA 3ZCRA 3IAS1 3RC2A 1RW4A 4YAGA 2D1YA 3PIRA 4M0PA 4WMLA 3B85A 4DV3B 1C3OB 2ILTA 3PIIA 1T9AA 1EX7A 3EAFA 4NNJA 1LZLA 3BGVA 4GEKA 3DGFC 1FU4A 3ZHXA 4ZTUB 1A4RA 1G6Q1 4CF6A 5P8WA 4B4KA 1JVNA 3BORA 1E6EA 3BWDD 1KAGA 3D6MA 5IXJA 1HZJA 4BCCA 2AMYA 3LVFO 3MWYW 4RKFA 2UYOA 5DI9A 1SB9A 3D7SA 3NTVA 4NZMA 2BE9A 1A50B 2XUKA 3G0CA 4GR9A 4PXYA 4OHZA 3P0HA 5BSRA 5C1DA 4GDMA 4WASA 1M6WA 3RAPR 2A5DA 2PD3A 3O38A 2AD1A 3F8SA 4FHDA 4FWBA 4JVOA 4NBSA 2LD4A 1OILA 2WMNB 3TL2A 1MPXA 3BE6A 4JGIA 1XTTA 5EE3A 4KXLA 4F11A 3NXKA 3RU7A 3CXRA 1SU6A 3CUSA 3AXTA 3C7KA 3AL3A 3IV9A 3JXEA 5AHKA 4HAOA 1BYIA 2YJTD 4Z9XA 2BFNA 4OF4A 5ITZB 1ATIA 2GGSA 2VP0A 1KZ9A 1PJAA 3Q5GA 4KGVA 3GLHE 4HZGA 3SIRA 4B0PA 5BN1A 3HB7A 2ST1A 4C01A 1QONA 3EB9A 3G1UA 1UM9A 1AF4A 4X94A 1U6KA 4YO8A 5F23A 3CNQS 4XWOA 3ENZA 2YMLA 2RC5A 4IGKA 5K6AA 2HRRA 2PO7A 5A6SA 1HTTA 2ZIEA 3FSJX 5DNCA 5LP6B 3V32A 2JGFA 2Y71A 3GF4A 3W5JA 3QVWA 2Y4NA 3I6YA 4IFEA 2QVBA 3BDAA 3E9NA 3U4QB 1NUAA 3K9NA 4N0MA 4O4LB 5AVOA 5ELXA 1KK1A 4TV8F 2ZBDA 3RC1A 4IIFA 3LYHA 1K7SN 5DOVA 2GK4A 2WTEA 1L2TA 4ENSA 5JH7A 2NTEA 1N1MA 4JBHA 5HR5A 1KI6B 4ZV7A 2H31A 5E7MA 4DCPA 4F5YA 1YBFA 1RRKA 5G41A 5B3KA 4P92A 4YMGA 1RM3A 1Z5WA 2VHCA 1KDOA 1EFPB 1M1NB 2VSFA 3GEIA 3ZXXA 4LYYA 1A8UA 2E6KA 1K5GA 2MSWA 1EG7A 1Z83A 4MV7A 4UPDA 1T6YA 4Y6SA 3KETA 1IY9A 3R7LA 1FJ2A 1H3EA 1QH8A 2DZDA 3IEXA 4BJHB 5J4YA 2BBOA 4JWTA 3GBPA 1IB6A 2CYAA 2VH5R 4X1KA 4EYQA 5JECA 1J97A 1SWWA 1P77A 1S02A 1VL5A 4EBBA 5GY7A 4CEIA 1AHNA 4X1YA 2E4WA 1Y1KE 2IUTA 3KWFA 1DKQA 5DBOA 1I4OA 4R8RA 1JG3A 2HMSA 3I8OA 2I4NA 1CY2A 2Q0HA 3CU5A 1FXSA 2O20A 3IPLA 3N6VA 4MARA 1U9CA 1XQ6A 4OKSA 5KNDH 2F1KA 4BVGA 4HH0A 4WKNA 3D6FA 5BN4B 1KI1A 1XTUA 2QX8A 4G25A 3G9ZA 4L22A 4HN4B 2JFQA 5SZJA 3A1UA 4BB0A 3GLTA 1AO0A 3JZIA 5IKXA 3N6XA 1Q5PA 1RI3A 3EYAA 4JHXA 1YL7A 1ZD5A 3IQGX 3EPKA 5G3YA 4A9AA 1XELA 4Q3AA 5A03A 1IEVA 1ZAKA 4BQRA 5H1YA 2FE1A 4HWRA 1JR4A 5YASA 4X62B 1M2WA 1GNTA 4UM5A 4HDMB 4B3FX 5D86A 3QBTA 1UWCA 2O07A 3JALB 2KM1A 4QJBA 4A6PA 1DOHA 3LW7A 1AGRA 1D7OA 1GQFA 1HFJA 1P72A 3JQCA 3PUHA 4NG4A 2A92A 3RC3A 2IYVA 3CBQA 1EFRD 5CB4A 1Q74A 4WFJA 2GPBA 5KYUA 1QF9A 1N2IA 2Z2YA 4ES6A 1P61B 1T5IA 2ONYA 3CT4A 2ZSKA 3MVEA 3IQFA 3B1FA 1SEVA 3OE1A 5EZ6B 1MO4A 3IT3A 3TTUA 1QBGA 5GIPE 4KXVA 3CG4A 5CP8A 4P7BA 4H3HB 4AX4A 4F0JA 1KY4A 4YHBA 5DHSA 4BMYA 3OM0A 4ZVRA 3IOMA 4LF9B 1QO7A 2FWJA 2QZ4A 2W8BA 2PX5A 4XUGB 5AT1A 1AM4D 2GR9A 4AJIA 4M98A 3T3HA 3AU8A 3AR9A 4F6RB 1ZBDA 4OB6A 5C37A 4GH5A 2BFDB 4RO0A 4YCDA 1XVUA 3HN7A 5I45A 2FPPA 2VNSA 4L78A 1F2TB 2EDCA 1Y3FE 3DDCA 2P9YA 4Q1BA 2PSJA 1FMCA 3BD9A 3D3NA 3SMQA 1JNYA 3AIIA 3EGWA 4HB4A 3UZUA 1RYDA 2E7ZA 2GPWA 2J3KA 3Q10A 2GCIA 3OKPA 3I0MA 3RGGA 1MDFA 3H99A 1IN5A 3WMWA 5EMJA 4L76A 3E5HA 3V00A 3I4CA 3QTBA 4KXFB 3VU1A 2IYOA 4QFDA 1YF3A 4TYMA 1O77A 2W8ZA 4QO8A 2OZKA 1TFRA 1M0SA 2XGJA 1N2OA 2PKCA 5FOTA 1RJ9A 1ADFA 1AUXA 3FAKA 3GG2A 3CZRA 4ZT7A 3VNBA 1W4AA 2AUNA 1SUCA 4HN9A 4AJ9A 1HSZA 2FUCA 1U1EA 4D79A 1QU2A 1QFJA 4DHWA 5G1OA 1CQIB 1GGVA 4MDYA 5T3YA 3HG7A 1OXBB 1VIMA 1GPYA 3F7NA 1NQAO 1H94A 1K68A 2YIDA 5AI5A 4ARBA 5BQXA 4AZ0B 8ATCA 3EXEB 1Z39A 4KPFC 2BP7A 1X1QA 3Q7EA 3UH1A 5A0VA 3DE2X 1RM5A 3R0IA 2AMFA 2QTMA 3AEKA 1L5WA 1PSDA 2XNSA 3BCUA 1X7GA 1NBAA 3DBOB 4NATA 5JBQA 1ESEA 1JKJB 1ZUIA 1VSTA 2Z04A 2ZQ5A 3LZDA 5E8JA 2ZR0A 3OKAA 3FD8A 3MCTA 2XE6A 1JIJA 4Q19A 4TV9A 3BRQA 3OPYA 4QLAA 1K3UB 1JSZA 1CP3A 2PJDA 1PDWA 3EDMA 3H75A 3SC2A 5HKKA 4B9AA 4EHDA 3EARA 4JXZA 4BU1A 2HRCA 5E6SB 1NF3A 1C8KA 1W46A 1IN7A 1LSUA 1VP3A 5FULA 5ER9A 2Y1XA 1M8KA 2XIQA 4XGNA 4K9KA 3N8HA 4EZIA 3S40A 3GLIE 3FPFA 3N2GA 4F3TA 1IVYA 5JD6A 1LQTA 4WERA 3H19A 5F12A 4MW6A 4HWGA 5T4EA 2EF1A 1I6LA 2GKOA 2JIDA 3LHFA 4MS4B 4PYOA 4ZPJA 1HZZC 1ND6A 2DUNA 3KPWA 4N6NA 4CM1A 3ZKAA 1UDXA 3ZDAA 3F5QA 3QIAA 4GE0A 2DR2A 4EA7A 4ZANA 2BM1A 4HFNA 2J59A 1R6VA 5TXGA 2P2DA 4D43A 2HHCA 3DUFA 1XA0A 4DL9A 2HA2A 4P4SA 3NBMA 2XWJI 1OX6A 3B1WA 5I7HA 1P2DA 2WWFA 1VBNA 2EVWX 2GN4A 5KVVA 4IDCA 3JTEA 4FI3C 4IDOA 3V1TC 1PGNA 1PR1A 1KYYA 3L7LA 2WWIA 4LNUB 3TE7A 2DBRA 2ECOA 4D02A 5DPMA 1E0KA 1Y6RA 5AW7A 1MAVA 1V3UA 3AEYA 1R7RA 1TD9A 1FDSA 1GLVA 5LA6B 5TF0A 5BW8A 2WV7A 3FY4A 1YZTA 3GL9A 4BN0A 4F86A 4LDQA 4KOEC 2X0IA 3QBEA 1PJZA 2YV5A 1QZTA 3EG5A 3O73A 2VNAA 1XFAA 2W4QA 4HAVA 1YDEA 2JIMA 1KWKA 3AR5A 2H5IA 1ORWA 2B36A 4I5DA 1UCFA 2H29A 2JFZA 3L07A 1A77A 2PH7A 2ZYUX 3FETA 3PKJA 1XI2A 4WZBA 3E2MA 1T0UA 3VZQA 5D5QA 1U9ZA 1J07A 5B55A 1PZXA 5LZ4A 1YFJA 1HLPA 1L4BA 2HC9A 2WZCA 3E1SA 2DFPA 2IW1A 2XQFA 5B1HA 5I9IA 3JATB 1TU3A 1OGJA 1YXMA 4C0LA 5J4KA 3R3WA 4RSGA 1H2FA 5L51A 1NE7A 1YRAA 1L4UA 1UFOA 1UMBB 1BCSA 1E94E 1CFZA 3HY6A 5GJWC 3DQPA 1EXDA 1YB2A 5LC1A 3J7AC 1Z4QA 4ENVA 1XVAA 3NT4A 1LDGA 5IC6A 1ZU4A 1N5RA 1CDZA 1OGIA 1T8TA 2VJLA 2VJYA 4KE9A 2H2HA 3FSRA 3ISTA 3BIWA 3GJQA 1NE2A 1W581 2YWFA 5ABPA 1GUYA 5JFOA 4EY4A 3ZTYA 3WRWA 3VTFA 1KYTA 3FX2A 5LB4A 3W77A 1XHLA 1IOLA 2NU8B 4MPDA 3CH4B 1T0BA 2B9EA 1FW6A 4GVXA 5CYOA 3P9RA 3HJNA 3JWJA 3L6EA 2F3UA 2E3JA 1CQPA 2H1LA 2QD2A 3UJ8A 4PC1A 3WGQA 2RARA 1FTQA 5CD9A 2IPAB 2YRXA 2WHPA 2WWGA 4JA0A 4QECA 3PHJA 5CRIA 4XR9A 1USKA 4O1IA 2Q6OA 1O3YA 2HA5A 3G8AA 3ICVA 3K2EA 4CIVA 1HETA 4QWWA 1EP2B 4YAEA 2P8SA 2FN4A 1EB8A 3GA7A 2ZBVA 3VR6H 1IQ0A 3OKCA 1AVTA 1WULS 2E85A 1KJ8A 3OTIA 2ARKA 4QQFA 1F3OA 1RAEA 4WEOA 2GRUA 4UTRA 4DGQA 3AM4A 1FFSA 1W48A 3ZGNA 3U6BA 1N7JA 1ZD9A 3HUFA 4DLWA 1EK0A 3DH0A 1RLJA 1VIVA 2AC7A 4TWAA 1Z6TA 3H6GA 1GUDA 1AKTA 1N3YA 4GR5A 3DZHA 1OZHA 1NRIA 5DN6A 1OR8A 3ENWA 3KUCA 4CIAA 2WSSA 3G49A 1RHJA 4KPUB 3Q2OA 1CX9B 2AXEA 1FNDA 3GELA 4J91A 5DXFA 5CDFA 4BLWA 2QTNA 4K9DA 3OTQA 1GR1A 1YZLA 3BCRA 3CUYA 4EUSA 3TQRA 2EWMA 2FX2A 2AR0A 3G9XA 3TSWA 2D0IA 2PL1A 1N2CB 3NDPA 2HDNB 3BS4A 2DPMA 2DLNA 2PS3A 2O05A 3FZQA 3H4VA 1M33A 2RIRA 4RKWA 3GGGA 3NEYA 4U6QA 4WJLA 3ZGZA 1QH1B 2ZYRA 3N2NA 4G5RA 4CQJA 3Q3CA 5BR8B 4DNOA 3M82A 5FA5A 1ODFA 1OIXA 1Z2PX 1SOMA 5AKEA 3VXKA 5SY6A 1TZMA 1T91A 2ZKLA 4KQWA 4TV8B 3D6VA 5FTKA 4Z1MA 1F0KA 3G0IA 4CODB 3D2BA 4I4NA 1S2DA 3TW0A 2EU8A 3ABRB 2VSOA 1PVOA 3FNRA 3A1TA 4UBNA 3F96A 1B0ZA 3H9QA 3N0RA 3Q7SA 4IIJF 4XIJA 1YACA 2AYXA 3WHIA 3WQHA 2C4NA 1IHYA 2FVXA 3O8OB 1U65A 4UTZA 2ZWIA 3DWIA 2A1IA 1N4AA 5JD3A 4K6HA 3SDBA 1GG9A 2HBZA 1N8KA 2K87A 3QXHA 3P9NA 1DC6A 2PX8A 1ZSVA 2W6JA 4J4TA 2ZZMA 3DDZX 3GJ6A 4N3GA 2XXJA 2W98A 1IY8A 3MPUA 4H1VA 1EXMA 1AKMA 1E69A 3FSGD 2CNWA 2G1KA 2HQ1A 4MMYB 2NYRA 1MR3F 3IKTA 2YJNA 3VTAA 1HFEL 1R37A 3HVKA 2JFFA 2YWHA 1KEKA 3AF5A 5I9TA 4DLVA 3ZWPA 3PB3A 3G13A 2P6MA 2ASEA 2HMAA 3EGXB 1GNVA 3NEPX 4OQXA 5D6NA 3JQDA 5ER6A 1JLLB 3ICQB 3UMBA 4Q1EA 2DBYA 5FI5A 4FGJA 3UIEA 8OHMA 1X14A 3IEPA 2YVUA 3FRHA 1EFDN 2D0PB 4K6GA 4D26A 3PQ7A 4WJKB 2F3PA 4YUWA 1ECPA 3AF4A 5DULA 4AL4A 4ASUD 3WIEA 3RRMA 1I7QB 1N6OA 2HLNA 4GICA 2FI1A 1XQ9A 2L0XA 3UJPA 4AZTA 2J7PA 3IT1A 3AW9A 3OOEA 5I51A 5DM70 4MROA 4ARCA 1H1LB 1T9GR 3DLTA 4JLBA 3VHXB 3RW9A 3F6SA 2AN5A 1Z2CA 5JSYA 5L7WA 1L4MA 4CHGA 1RBZA 2WG1A 1R0RE 2DQKA 4LN1A 1GVHA 2R00C 5EIAA 3S7ZA 2RGDA 1WLYA 3DSRA 3IMKA 1OU4A 2Q1XA 3P0EA 3QOWA 4G0ZA 4ND5A 4NBLA 6AT1A 2Q7OE 2Q29A