3U16A

Structure of base n-terminal domain from acinetobacter baumannii bound to 6-(p-benzyloxy)phenyl-1-(pyridin-4-ylmethyl)-1h-pyrazolo[3,4-b]pyridine-4-carboxylic acid.
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
435
structure length
433
Chain Sequence
KQLIEFVRWSPERAQHYRNKGYWIDQPLTRILTVGVQSHPHSLAIICGERQLSYIELDRLSTNLATRLAEKGLGKGDTALVQLPNVAEFYIVFFALLKAGVVVLNALYSHRQYELNAFIKQIQPKLLIGSRQHEVFSNNQFIDSLHDVNLSPEIILMLNHQATDFGLLDWIETPAETFVDFSSTPADEVAFFQLSGTGTPKLIPRTHNDYDYSVRASAEICGLNSNTRLLCALPAPHNFMLSSPGALGVLHAGGCVVMAPNPEPLNCFSIIQRHQVNMASLVPSAVIMWLEKAAQYKDQIQSLKLLQVGGASFPESLARQVPEVLNCKLQQVFGMAEGLVNYTRLDDSDEQIFTTQGRPISSDDEIKIVDEQYREVPEGEIGMLATRGPYTFCGYYQSPEHNSQVFDEDNYYYSGDLVQRTPDGNLRVVGRIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Peptide arylation enzyme
publication title Structure-Activity Relationship of BasE
rcsb
source organism Acinetobacter baumannii
total genus 155
structure length 433
sequence length 435
chains with identical sequence B
ec nomenclature ec 6.2.1.-:
pdb deposition date 2011-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3u16A00
3IERA 3NYQA 3VNRA 4GR4A 5KEIA 4FUTA 3C5EA 4GR5A 3DAYA 4R1LA 4FUQA 5BUQA 5BSWA 1ULTA 3IESA 4M46A 2WD9A 2Y4OA 3RIXA 3L8CA 4GS5A 2V7BA 4LGCA 3VNSA 5BSTA 3EQ6A 5BSMA 3IEPA 4OXIA 3ETCA 3NI2A 5BSUA 4IZ6A 4ISBA 4D4HA 4W8OA 4DG9A 5GTDA 4G37A 5D6NA 4D57A 1V26A 2VZEA 4RVNA 3IPLA 3NYRA 4WV3A 3ITEA 3G7SA 4GXQA 3LGXA 2Y4NA 3U16A 1V25A 5E7QA 4D4IA 3QYAA 4R1MA 4IR7A 3IVRA 5BSVA 4R0MA 3TSYA 3T5CA 4DG8A 3E7XA 5BURA 4RVOA 5BSRA 4GXRA 3VNQA 3WV5A 3E53A 4D56A 3DHVA 5DWVA 3WVNA 3WV4A 5BUSA 3PBKA 3E7WA 3GPCA 3O82A 4PZPA 3U17A 4D4GA 3A9VA 3RG2A 3O84A 3FCEA 3R44A 3T5BA 3FCCA 3T5AA 4E5DA 3O83A 2Y27A 3B7WA
chains in the Genus database with same CATH superfamily
3Q7RA 3N59A 1Z5OA 2NV0A 4U3JA 4TXHA 2IBTA 2V6BA 2CDNA 1G8MA 5KJFA 2JLXA 4X8HA 3TRJA 3PI6A 3BGWA 1NJ6A 4NOKA 2QG9A 4FMBB 1NVFA 2IHUA 1ISGA 1R15A 3PC2A 4MS4A 4AROA 1NQXA 4BMDA 3VTFA 1AF4A 1WZEA 1Y1RA 4XSGA 1FP1D 1P1IA 4A7PA 1BWRA 1SZCA 2NU9B 1KIMA 2O1WA 2WD9A 3LC0A 4LF5B 2YXPX 4ANFA 1O95A 3LCMA 4BEBA 4CKCA 3C3YA 4Y2RA 2YVLA 2HF7A 1P7YA 2LCQA 4FZ5A 4CI9A 2V45A 1ACJA 1MZVA 1Z5VA 4RLSA 3D3KA 4DXAA 5IZCC 4A0QA 2D54A 4ZTBA 4K03A 5TQ2B 3EG9B 4AZ0A 4OHXA 2HAEA 4TTRA 7REQB 3K8QA 2K2QB 5I5EA 3CRW1 3PDUA 3QW4B 2AOUB 3BL6A 1I3LA 2FFAA 2XGGA 5DGTA 1BFKA 2QQEA 2Z8YM 3MK31 3SG0A 3WO1A 4PSVA 4QVIA 1GRNA 2PL5A 5M7EA 4GUDA 4DIEA 3N8DA 2R1TA 2SKEA 3I2HA 4HWOA 4LX8A 4D8UA 1YAJA 5IMSA 1UDAA 1BXKA 1WUYA 4GOKA 2ZUUA 4IFBA 2I2CA 1WU8A 4JVLA 4C0BA 1HG0A 4BBJA 1QO9A 3RSZA 4CKXA 1QX3A 1MX5A 2QM8A 1P19A 1T2FA 1I6WA 2W0SA 1YZKA 4WN9A 3UOGA 5C8ZA 1QS0A 1HT2E 4FGJA 4LZPA 1DIBA 2E5FA 10MHA 2JDIA 5AKKA 1YHNA 2P9BA 1YDMA 1MC4A 3GFQA 4PZUA 4YRLA 5EPUA 5JLAA 4ALNA 3N2GB 4UHCA 1GA6A 3REGA 1ZA2A 3ETDA 3DMFA 1TTPB 4MGYR 4CM4A 4K86A 2QPLA 2H9IA 2JASA 3LD9A 4LX0A 1EEHA 2EFGA 2LUOA 4DSOA 3VO9A 4Q93A 1CERA 3B5EA 3C6KA 1OE0A 2BKXA 2EBHX 2XUFA 2Y05A 4YUWA 1KGSA 1NHWA 2I7TA 3IMEA 1R88A 3N39C 4RENA 3W5HA 3GIDA 4FQ5A 1YS9A 4EABA 2DSNA 1E2KA 4E70A 4D82A 3GDOA 2C3PA 2QV0A 4B3XA 2VYVD 1DP4A 1XL0A 2EKZA 5EEGA 3AFIA 4RA9B 1NL3A 1RQLA 5C52B 2JL1A 2ZKLA 5CD9A 4QYSA 1P1BA 4FZ3A 3C87A 4J07A 3TSOA 4I9UA 1BCRB 1FVFA 2JF0A 3UPUA 1GZUA 4H7PA 3SNKA 4JLBA 4CMCA 1U4NA 5CBPA 1RLUA 2FW8A 3WBFA 2PS3A 2Q1UA 2PKYX 4AMZA 1NP7A 1D2GA 3W2EA 4AY2A 4C0XA 1DQSA 3OX1A 1SGWA 1XUOA 1YRBA 3MLEA 1OFIA 1TQ2A 1EBUA 3RB8A 3PHGA 1PQPA 3WDLA 2WF7A 5MHTA 2Q6LA 4RPKA 2QNBA 5KHLB 4EPVA 1ZGZA 2YUIA 1XVIA 1X9GA 2XYPA 1UBHS 2A9KA 1T8RA 3BXPA 3Q9UA 1QF7A 1DMSA 1JLMA 3IE0A 1X1QA 3DZJA 1KSGA 2VUHB 2ZW9A 1FX0B 2Q5FA 2Q0HA 3SX0A 1XZHA 5TEVA 5KOHA 2IYQA 3V32A 3GRKA 1YQXA 5EOVA 1HT1E 3GFVA 3FNBA 3PZBA 5ECDA 4CM9A 5JBNA 5MFZA 1QR2A 1D2CA 1MVLA 2OO5C 3PX3A 5A5GA 3L46A 4BKOA 1YE3A 3UOAB 4BMCA 3UMMA 5FORA 1MC8A 2A0WA 5EUCA 4ZVUA 2ODTX 1GTSA 1V6AA 3H1PA 3BGOS 3I9V6 1WWKA 3QP9A 3VR6D 3EAGA 2ZULA 3CZQA 4KMSA 4MVJA 1NNEA 4IX9A 4QASA 2WD7B 2HHAA 4R7ZA 1A5SB 1GTJ1 3NFRA 5EIAA 4YAGA 5EIHA 4PO9A 3RWBA 4LI3X 2BGUA 2FJUA 3ANSA 4NPCA 4FM9A 1NTRA 2PTHA 3FRHA 3IBGA 4R8RA 3ZQJA 2EZ9A 4U7TB 1M0WA 1MLDA 4AQDA 5F23A 2X8JA 2WVAA 2Y76A 2F9MA 3FGPA 3LOUA 2C2KA 4WKOA 5DI3A 1PGNA 4QYWA 5DX1A 5KYUA 4HNUA 5CYGA 5LDDC 4IJ6A 3PZRA 1T6YA 1FB5A 1LDNA 3M83A 2XGOA 4QUIA 4Y2UA 1SKMA 4I4LA 3COYA 1RLJA 3E3LA 3UJPA 1XDSA 3MT8A 1IBKB 4UPDA 1ZUIA 3T8YA 1CR6A 3DZGA 3I5MA 3CPSA 1L5YA 3P8ZA 4OH1A 4DUYB 1RZRD 4DL9A 4JAVC 3GB9A 5CNKA 2QDXA 4NV0A 5IUNC 2FZEA 4J6FA 1ZIOA 3M9XA 5KQGA 1E9VA 4HAXA 1S1MA 3RUIA 3X43A 5GIPE 3G7UA 1SAYA 1WDMA 2EDAA 2IC5A 3FUCA 4QNRA 2ONJA 1GADO 3TWOA 1TM3E 5KTRA 5JYBA 2OSVA 3EXAA 3STUA 3ZLBA 3HUUA 4NDZA 2JIRA 3K2QA 3THSA 2ZRMA 4AK9A 2WK1A 1ZD4A 1LZKA 1D4AA 2NSYA 3SX4A 2QN6A 2XNCA 5DULA 2E7ZA 2Z6VA 4Q6WA 5TX7A 4U0JA 4DCGA 2YHSA 4NCIA 1A5AB 3VKFA 1M2GA 1QTQA 2ORYA 3FOZA 5M04A 4EKGA 3VR4D 2IV3A 4F45A 5JAIA 2LE0A 2QX6A 3C1OA 3NUZA 4Z9XA 5TARA 3DZFA 1LSOA 3CN9A 4E88A 2NU7B 3WKAA 5EHXA 4I55B 1B8PA 3ENNA 2NO9A 3X1YA 1Q91A 2PX8A 3QUTA 3BE6A 3I09A 1P1CA 4B6FA 4FGWA 4TTJA 2XYVA 2WIJA 5JDIC 3GNQA 2QTZA 4KITB 4QVGA 4R69A 4RD0A 2D7JA 1EG7A 3EC2A 1Z2NX 3M1LA 4OVKA 3KWMA 3ROXA 2F1KA 4ZOAA 4AT1A 2Z3VA 3Q1LA 2OZEA 4I99A 3R7NA 3U17A 5FR1A 1O5TA 3PC3A 4K6OA 4AI6A 1V16A 1HQDA 2H1RA 3CH6A 4DILA 5B3LA 3FOFC 4L07A 4GBGA 3MD0A 2X0DA 2J9FB 2NN3C 3OFVA 3BGIA 1E7MA 4LRSB 5FV7A 4PZAA 2Q6TA 5I9TA 1F5NA 1GPMA 3THYA 1IOVA 5GMOA 4DLAA 3ZE9A 4E5UA 3V7NA 1ZINA 3P9ZA 2BFOA 1Q1BA 3AERA 3I45A 2AEMA 4AW9A 3NONA 5D51S 3RTBA 4ND6A 3NBMA 1WZIA 3ESBA 3Q3CA 4DY4A 5KYTA 1N3YA 3LXMA 4ZXPA 3O2NA 4TYYA 2PBLA 1RM4A 4I50A 1RXCA 1XTSA 4JBIA 1GRCA 3LY7A 1FU8A 5JWOA 5K8VA 1D6SA 2WFLB 3IV9A 2XSZA 1UF9A 2ERCA 4P83A 4BE4A 3IL2A 3LCUA 2Q6OA 4XE5A 1G6Q1 3CTPA 3MRXA 4X6XA 5TGDA 4RO0A 2HHJA 3G2QA 1VG0B 3TLJA 2GEKA 2QLLA 4INOA 4AKGA 2CFOA 5FV4A 5EJ7A 1Z0KA 4TOIA 5F12A 5FTLA 4KP7A 3KOWA 4OAPA 3FOCA 1TM1E 4FR2A 1P2VA 4I4TB 4JITA 1JQBA 4GS5A 2WU0A 3KUDA 4JDPA 3PX7A 3MYRA 2RHWA 4Y2HA 5FNVF 4CKZA 5CA1A 4G4IA 1SO8A 2YASA 4ENSA 1UBSB 2H2WA 1YIDA 4FJ0A 1PT5A 3UAVA 2ZROA 3CINA 4IZ6A 4QVKA 4ICIA 3SQXA 5B3AA 1JTEA 4NJOA 2HRCA 3UMJA 4AF7A 1NUAA 1VZ3A 4RF5A 1YQWA 1E5LA 4E6EA 4OLBA 2BYTA 2Q3JA 4WVFA 2D0OB 5FWYB 3I23A 1WLSA 4S1TA 1J8DA 1T0IA 3WICA 4EW6A 4A8PA 4RTSA 4TROA 3UFBA 3MMNA 3WNZA 3WYEA 4D4KA 4FHCA 4I36A 1LPBB 3OTGA 1QIKA 3CTMA 2VHCA 4J1TC 1C1YA 1JTFA 1TADA 4JUIA 4NF2A 3ERCA 3BAFA 5JNRA 1TEHA 1I94B 4A3SA 3EPPA 1DMRA 2DAPA 2QN2A 2V5UA 1SHUX 2N3ZA 3PFHA 4LBVA 3IOBA 3LA6A 1QIHA 2JI8A 4MV0A 1P62B 1C7EA 3IP5A 4GYWA 4UUMA 4UVHA 1OAKA 1GYQA 1PFUA 3GEBA 3G2HA 5DB4A 3T4XA 4BFXA 4GXTA 3WGGA 4BO2A 2DQZA 5B57C 4BLOA 3TFQA 1KP2A 1SBHA 1E96A 1T29A 3SK0A 1P72A 3SD7A 1ZVQA 3PS9A 4UBOA 4W7IA 5AR1A 3EIFA 4Z49A 2ZRIA 4L4SA 4DDTA 1SUFA 1V4BA 2O5VA 4DV7B 1CW2B 2X15A 1PK7A 3WYBA 1DO8A 2YR0A 5KJ1A 1NQOA 4JLJA 5ULLA 3TW6A 5EKSA 1RHRA 3FKJA 5EVJA 5B6PA 2E85A 2X5KO 3KHSA 1FFBA 1R66A 5DN6A 2ZDQA 1GZ3A 1FFAA 2QSJA 1FXWF 3LV8A 4J6EA 3FOWA 5DEOA 3TQTA 3NO4A 4KR3A 1K6MA 1TO1E 2XUDA 4BO3A 2OAP1 2WTBA 1VYHA 4IINA 1ODIA 2VH5R 3O7MA 4NU5A 2D2IA 3RTGA 1BX0A 2NU9A 3OPMA 1CZUA 1IXYA 2B8WA 3IQFA 1XR3A 2P9EA 3NC1C 4BKPA 2WSYB 3KOMA 3DE6X 1D2EA 4A15A 4X71A 2R7AA 2VJLA 3Q2IA 2EJBA 1R8SA 5DGXA 4H3KB 2BHTA 4OI4A 3UFXB 1WXDA 3L0SA 2RBGA 3EG9A 3Q3HA 5TQ2A 3F78A 4LTDA 3VSAA 7REQA 1YUNA 4UQLA 1SY7A 3JZFA 2WM8A 4ENTA 5KPDA 1H6DA 1Z38A 2AOUA 1C30B 5FR2A 1FUIA 5K0EA 2W6ZA 3KAPA 4I1RA 4WGFA 1YJXA 1F48A 4FT4A 2WT4A 1HYGA 2O50A 4LYFA 4PICA 1LWOA 1EAMA 1Z7BA 4ZT2A 1LBEA 1G8YA 2QT1A 1VI2A 2ZUTA 1EFLA 2NZXA 2CBXA 3U13A 5E0OA 4HF7A 2G7ZA 4HFNA 2JKYA 2PS1A 3LT1A 4CJXA 1Z6QA 3GT4A 1QDUA 1QYVA 3PQCA 3OKAA 5E3JA 5H59A 1RPJA 2WM2A 1TLTA 2HW8A 2O8DB 3MTGA 4BQPA 4DZRA 3PFIA 3GA7A 1PT8A 3HXKA 2QLBA 3ANXA 7AT1A 2NQ2C 1UINA 3VJKA 5HCUA 2VPWA 2CMKA 3TJZA 1JSRA 3KZKA 1EDBA 4RL6A 4RVCA 3CIOA 4QHSA 2OG1A 1LPAB 3PNMA 4KO1S 5U4XA 5HIAA 1N0WA 2FK7A 1KEVA 1Z6PA 3IEPA 4IRMA 4Q01A 3WK9A 3SBDA 5CG2A 3DO8A 1F7VA 2XUZA 2Q27A 4UARA 3T3IA 5B2EA 3UXHA 5L3QB 2DH5A 1FDVA 3ZLVA 4JJFA 2ECFA 2B4YA 3D7LA 1Z0AA 2OBLA 2VC2B 2ZJBA 1RS0A 3HDQA 3LDHA 5FPYA 3UEOA 4DN6A 5IVKA 4XQCA 5DGDA 4DMCA 1Q0QA 5HA5A 1VGRA 3VMMA 2CYBA 4LCBA 4V0RA 2OBFA 2ZBPA 4ZZ2A 2GETA 1K9SA 4KPGA 4O3MA 4RA9A 3KSZO 2GZ2A 2NUPB 2VDJA 5LXTF 5K6RA 4JY7A 5L3SB 3I4CA 1RWNA 4MYCA 1BCRA 4UVGA 2F8MA 1SKAA 2FEPA 4PAGA 3WYDA 3WGLA 1RT9A 2IYWA 1WXWA 4KWIA 1MA0A 4EG3A 4JSTA 3LZDA 3KJIA 3OAAD 4UMEA 1R0YA 2RHOA 3TOXA 4BMSA 1HA3A 2D2VA 2X5NA 2PX3A 1CJTC 4EBFA 1F6DA 4NZ9A 2FSGA 4GZ6A 2H59A 1YT5A 1H6AA 1TEXA 1RFLA 2P5YA 3E22B 2B4AA 1Y81A 2Y1CA 2RGBA 3O2SB 2WYWA 1FX0A 3LBYA 5BMVB 3IUQA 3ELUA 1WCWA 2EZTA 4G26A 4MVJG 4MI9A 3V8MA 1JEJA 1QE3A 4B45A 4X8OA 2B9VA 1XPOA 5JTTA 1VE1A 2PMBA 3DEJA 1ORHA 2YNMC 1WHSB 1Z4OA 3PBKA 3SZMA 1VLHA 2CUTA 5K2MA 3KZVA 2OTCA 3G8DA 5JNSA 3J80A 2Z8ZA 4RK1A 5HJ2A 2PMKA 4GUAA 1OC4A 3SIXA 1GCAA 4JQOA 4NEQA 1Z4QA 1NN5A 3GHHA 1FOEB 3A9VA 3V4PB 2JLCA 4M7RA 3RT9A 4BGDA 2XF8A 3I1IA 2WD7A 3AG5A 3BZBA 4UCWA 3W5VA 1M8PA 4URXR 3HXOA 1XL1A 3MGCA 1PLJA 1ZZEA 2DF8A 5F1OA 2AWNA 4G5SA 3ISTA 2FFRA 5CVTA 5JRZA 3OY2A 2PGNA 1NOKA 4PGHA 1OIVA 4JODA 4RFVA 1UDCA 1A2BA 4EKNB 3BRCA 3NHKA 5EMHA 2FLKA 3LA8A 2BM8A 4HI0E 3GG2A 3CO5A 4LDPA 4B8ZA 1G42A 5JJ5A 1MOSA 2HCRA 4R1OA 3TCNA 2Z9BA 4BNIA 3KL4A 3R9XB 4PQGA 1UXIA 1CUZA 1CB7A 1LSJA 3T3MB 2BM1A 3EVGA 3TCKA 4V0SA 2XUGA 3NEYA 4JP5A 4LVNA 4CL2A 4LWZA 2NTNA 1OBVA 2R4UA 3I6IA 3RK1A 4FUTA 5LA6F 2OL4A 1YJCA 4CG1A 1PJTA 3OG9A 3LX8A 4K6FA 4BKRA 1X7ZB 4PVDA 1RAIA 2XODA 4EWLA 1SQSA 3EISA 4EO7A 1NVAA 3HEBA 2IUEA 3E0QA 1L5LA 3CH5A 4HXGA 3RREA 1U9CA 2Q50A 3IAXA 3R5FA 1P9LA 1Z8DA 5BQ5A 1NLZA 3P9KA 1AS0A 2PLNA 4IFTA 4I0WB 3X1ZA 4DTCA 1UWCA 4U7DA 2W8ZA 1WVGA 3QIVA 1S6YA 2C2GA 4JR0A 3EYWA 1T24A 3H2HA 4CT4B 5H8WA 2OECA 3H2ZA 1R0ZA 3A06A 2CJPA 1QZXA 3KOOA 2K4MA 4HLQB 4OXRA 3PGLA 2ATCA 3ZHOA 4C3OB 2XNJA 1ZICA 3GFOA 4BRWA 1CUHA 1U94A 2VNKA 3BFXA 1FFSA 5HE8A 4R4JA 1W36B 3DHNA 1QZ3A 4JLDA 5IAEA 4JJEA 2NU7A 4B3CA 1YNOA 4I55A 5JROA 1WHTB 2CSUA 4EZBA 3PYXA 3V4LA 4II7A 5AW8A 3V2HA 4UZFA 1AS3A 2DR0A 2W5UA 5FTMA 4YUAA 2BFDB 4EEZA 4ZEOA 4DKJA 1FSSA 1E2DA 2ZIWB 3GNSA 2K2WA 4V0QA 1FSPA 3WLPA 3DUFB 2L2QA 5LQNA 5HZHA 1ISPA 2DFKB 5LYYA 2B8JA 1T8SA 3IC5A 4IUYA 4TKUB 2JIDA 2VQEB 2IH5A 1A9OA 1XN1A 4BKMA 2J0SA 1FMJA 4R8VA 4EZIA 2C94A 3FBGA 5IJ0A 2FSSA 3KSDO 1T5HX 3JRXA 4UEOA 2O19A 5CLIA 1S96A 1YE5A 1W8IA 2J9FA 2WUGA 1RIIA 3KELA 1YS4A 1E7YA 2GK3A 3F2IA 5A3QA 1J8FA 2H52A 2X3FA 3G82C 3HCOA 3DCJA 2J85A 4HGNA 4KR7A 3OFKA 5IAGA 2AFIB 1BMTA 5ADWA 1J20A 1DJPA 2XX3A 3FVWA 3NC0C 4WZAB 1K68A 2GPYA 2CD7A 3KOYA 1N1GA 5HEKA 1F51E 4UDXX 1JIVA 2EGGA 1Y1QA 1RKXA 4MI3A 4XEUA 1P6UA 3IVCA 3EIHA 3H42B 3Q3IA 3QU2A 4TV8A 5BQOA 3AV3A 4ACAA 5D2CA 2MJLA 4B43A 1BDHA 2FEKA 3ZWMA 5F7ZA 2IDJA 4NZPA 4CEJB 1YR3A 2VDVE 3NVKI 1T2DA 1JDJA 1KJZA 2C7PA 1V4NA 3U6KA 1FDRA 1N2GA 4P5DA 4XRGA 2O4CA 1QHEA 3LUPA 4TQGA 2B2CA 3JARB 3QIAA 4WXMA 5CIQA 1E2HA 3UQYS 4OEHA 4X93A 3CO0S 4HN4B 5DCYA 3PXXA 4I4TA 5E2AA 4BQEA 5IDYA 2TMKA 3GJZA 4C7VA 1QSGA 4EUEA 5KYNA 3I5UA 3LBFA 2BLLA 3L7LA 2CVHA 2FGKA 2FVXA 1TF5A 5E2IA 3WGUA 3ESZA 1B2RA 1JAIA 4GF5A 1HRDA 2GSDA 5CMLA 3ZR4B 5HK9A 1XZFA 1W5AA 2AMYA 2H31A 2PDAA 2MYPA 4RLHA 4UUQA 3ETNA 3HEAA 5ELMA 3VNRA 1JQJC 4YT2A 3BH7A 2Z1DA 4TXMA 1RXSA 3VJMA 5KEIA 2R5NA 3MWEB 5TDHA 1Q7EA 4D0SA 1O54A 2NV2B 1GPKA 5FWYA 5CFLA 2BIFA 3FBTA 1VJDA 4JJ8A 2V7TA 4LC0A 3NDBB 4H31A 2IYNA 3L7YA 1X39A 3IQHX 3T9EA 4C4OA 3G2PA 2F62A 2GN6A 3KXKA 3MT0A 1XQXA 2V7GA 4G63A 3GZNB 4KRFA 2WAOA 3A4YA 4I5DA 5AW9A 2VBIA 1KEWA 2REBA 5FH9A 5F73A 5AUQA 2QROA 4AS1A 1Y6RA 5ER6A 5M5BA 1PR5A 2HU7A 2ZAGA 1DKRA 1XLTC 2P5UA 2V5VA 1NW6A 2PX6A 2XBLA 1A4RA 3A1NA 3I05A 3N5CA 4II2A 5FBVB 4CIWA 2EWVA 4ER0A 1GFSA 1V4VA 1GDTA 4RF3A 3X1MA 5CK5A 3H3XA 5JFGA 1IZ8A 1FBNA 1X77A 1YMVA 2WHQA 5ALMA 2H5JA 1DKQA 3EGOA 3OMXA 1Q74A 1L7PA 1G9TA 3C8UA 3EDCA 3NIFB 1XEXB 2G83A 2OCAA 2WRZA 3LECA 5IJZA 4LXIA 4O63O 2O2HA 4V03A 1AG9A 2IHZA 1XKQA 3LWBA 2PBZA 1CJCA 2FKAA 2KE5A 3LY9A 1QH8B 2G5PA 4W4TA 2I22A 1MVOA 2PRZA 4BUZA 1M5UA 3BIWA 4U9UA 3VPSA 1PL8A 2ATIA 2W22A 2HUPA 1CJVC 5E7QA 3VKWA 1Y1SA 5BXQC 1PQWA 3JCZA 3T7TA 3EBPA 1VG1A 4NNOA 3UCEA 5CB4B 3WADA 1SVUA 5DX8A 1E3WB 4H2DA 3ANNA 2IH2A 4UDYX 16PKA 1MEEA 2HJHA 1T9GR 3AEUB 5D7NA 2R79A 3VX3A 1RVV1 2BOVA 4Y2YA 3GJ5A 4WN3A 1E9RA 2QJOA 2A4MA 2Q6IA 3NHJA 2F90A 3DVLA 4M0PA 5JRJA 1G21B 1SK8A 3T3DA 2ZYRA 4HS9A 1K3TA 1U98A 4NMLA 2JFPA 1GNQA 1O95D 3UFXA 1Y9AA 1IQRA 2FMIA 2PUJA 1B6GA 2W2MA 4GX1A 4PFSA 2JK1A 5EN4A 4QGSA 1K7FB 4JJKA 2EG5A 4LG1A 1EA5A 4I14A 4HB3A 3I61A 4YECA 1C30A 1TYEB 2GB4A 1QDEA 2Q1TA 2QQ5A 2LZ0A 3PNYA 4KUGA 4URHA 2Y1KA 2OQ2A 4ZQGA 4HLCA 4N0MA 2PKXA 2C95A 3FG9A 3A6EA 4YCDA 1I9CA 3LIPA 1O97C 4JP1A 4C29A 3ND7A 3E84A 4N3NA 1TMOA 1Z6TA 2W2PA 2OWEA 1V5IA 1EWRA 4HDKB 5BPFA 3A6LA 1T43A 2CHQA 3T9BA 3O8DA 2O8DA 1XMOB 1KI8A 3O93A 3RIYA 3S6JA 3ZWYA 3UAZA 4N7MA 4BVJA 1UM9B 4GI5A 1T4GA 1BTOA 1E5QA 4RZXA 5KQRA 3NASA 1ZNQO 1TVMA 4XGQA 4Q1CA 1ZGJA 1RC8A 4R3WA 2LDXA 3PGMA 3D3EA 3ZCSA 2P41A 4ERNA 1DT3A 1ORTA 2FPIB 4G0UA 3HXPA 4ER7A 1XXHE 2AZDA 5EHIA 2QJTA 4HQNA 1GNVA 2C1ZA 2X9GA 3R74A 4BV2A 2WU1A 4URYR 3DDSA 1HORA 1TYCA 5J9FA 4PZ0A 4CMEA 4E5KA 3BS4A 5KNBH 3HZZA 2HA5A 5BUQA 1R9GA 3QHQA 3C7AA 1QFZA 3PUJA 1EFUA 2O1SA 4J1SA 1FRVA 1K5DA 3NHYA 4ZAGA 5SZJA 4M49A 4N0PA 1FJHA 1M8JA 4CW7A 5FUQA 1W7AA 3QBTA 1A8SA 1MQAA 2GRJA 1BDJA 3GRUA 5I4CA 3T54A 4D80A 2V7BA 1O6BA 5L3SA 2RHTA 3D7RA 3RV4A 4BGVA 4I1PA 5FL7A 1HDCA 3W7AA 3LQ2A 3N74A 3B89A 1Q15A 2QY6A 3WTCA 2O3RA 1EFTA 1JPNA 4JLNA 2CJFA 5DF1A 5EWMB 3KE9A 1ZM3A 2XLBA 3CEMA 5ABPA 2AXEA 1YRHA 3KEGA 5SY4A 3UGQA 3IO5A 3CF2A 4OY3A 5I9NA 1YZNA 2CMFA 1DX4A 1UJ4A 5AMXA 3IVXA 2W2QA 5HOQA 3E22A 3SHTA 4OXKA 3SP1A 3AW9A 1OXSC 3ZU6A 2RGCA 1A98A 2D1RA 4IHJB 1V9CA 1Z22A 4M0DA 4PQFA 4YI5A 5BT9A 3UJ7A 4JI0B 4B1FA 1O57A 1C3OB 3GN1A 4PCVA 4YJKA 3LUDA 1WHSA 1BQ4A 4OHKA 4BJ1A 3ZE1B 3TVYA 2W6OA 1E1YA 2WWRA 2I8AA 2X2PA 3VR5H 4EG0A 1XPRA 1RQRA 2C4MA 8ADHA 3T3NA 1JFFB 2OCLA 4GT1A 4N6NA 4MUHA 3UKJA 3WP1B 2QTVB 1GYRA 2XGJA 1CTQA 3EQ8A 1G4AE 2O3SA 5FA5A 4D5GA 4ADSG 2FHPA 4R8MA 1VKNA 4U2BA 2JGFA 4MVJD 5B2FA 3HHEA 4II3A 4D92A 1N7GA 4INZA 1NASA 5CNIA 4E6PA 4YRIA 1KWKA 3VXKA 3QVVA 1GKLA 1PYOA 2ZYHA 3QWBA 4FNMA 1Q2UA 2G07A 2MINB 2JCXA 1XQYA 1LNSA 2ONZA 2V6FA 1M2HA 3DC2A 5BSFA 1KZ6A 4ZI2A 3FY4A 2C61A 4GX5A 4KFTA 3QFCA 4MAFA 4TMWA 1M5TA 2IEBA 5BW8A 3BBLA 3S3TA 4FHFA 2IUSA 3QYJA 3OA2A 5HG0A 1ODTC 3F1LA 1S1CA 3R9XA 2BEJA 2J9YB 3E7WA 1PJ2A 5E3HA 5IARA 1ZNXA 1JPUA 2VEOA 1NW5A 3BIFA 3DZKA 3ORHA 4O0MA 1P2DA 3GBVA 3OQIB 2OQIA 3KHUA 2PV7A 3RBXA 1X7ZA 3OTOB 4GKJB 1QGOA 1A77A 2ZJ5A 3PQEA 4A8JA 1M6EX 3GLSA 4Z7NB 1Y6FA 1ADYA 1ZCBA 4QLOA 4FHDA 1ADFA 1EJBA 4LSZA 4Q4JA 2XZPA 2JATA 2XXJA 3ROZA 3CW2A 5A5VA 1SCBA 3OURA 3RVMA 1GDHA 1ZN9A 3BGSA 1JXOA 2WJAA 1CXZA 2EJUA 1QTNA 2X3UA 1SVKA 2HJVA 4PYRA 4L6AA 3TINA 2Y3IA 1I7QB 2Q5JA 4TLAA 5FUXA 1W87A 4IS3A 4LNUA 3OC6A 2VK8A 3GJ3A 1RPTA 2AXNA 4BQQA 2XE4A 4JK3A 4YONB 4F21A 4IGFA 5KVAA 3U60B 5D8DA 3LPAA 1XNRB 2K5UA 4MGEA 1UUFA 1V1MB 4YDHB 4P2GA 4JCCA 1VI6A 1WHTA 1XD8A 2J1LA 1UZAA 4DC1A 1W34A 3DTVB 5F98A 1TZKA 2RKOA 4PV7A 4GWLA 1W88B 5EIOA 2BFDA 2GOYA 1N4DA 1AGNA 1XEAA 2AC4A 3QVSA 5HS4A 3DUFA 5ADVA 4GOXA 3AVTA 1JWBB 4JVNA 1VKZA 2A7XA 2OHIA 4TKUA 1SUPA 4L0QA 1FBTA 5K9ZA 1ZGCA 1U8UA 2DTDA 3W3ZB 2IGTA 2VUTA 4F12A 3D6HA 3CVJA 3AVYA 4JOBA 2OG2A 3ZIAA 4CLHA 4KE6A 3ICQB 5T3UA 4P84A 2ZLBA 1Y5LA 3BRWA 3PCRB 3M34A 1ND6A 3FUXA 2Y6UA 1B8NA 4NZYA 2NX2A 2QTMA 3WZLA 4N54A 2AFIA 3L8FA 4L95C 4CVNA 1YBMA 4YIKA 2OZVA 5AJVB 3ZJTA 4WZAA 5GQSA 4HNGA 1XWWA 4XYBA 2DULA 5FKJA 3WHPA 4DWOA 4MQ4A 3PP8A 3A0RB 4C7OA 4AS3A 1AKMA 2EHJA 3ELWA 3LO8A 3E9EA 3ECSA 3UHJA 1QP7A 1LK0A 4JQSA 1IHUA 4RY0A 4K7JA 3VPAA 3ZD7A 5A6SB 4J76A 1GAXA 4QRHA 4MP3A 4XSHA 2Y6VA 3HB7A 3GP8A 4PGGA 4LOAA 3GMSA 5FOQA 2JLUA 4JCOA 3I01M 4ZAYA 1DG1G 5JNLA 2HA4A 4G65A 1P1RA 1PLKA 2G88A 3VDXA 1DQYA 3JWPA 1TO6A 4IGKA 1HYQA 1NMQA 5GJCA 4CEJA 1WCV1 2YZGA 4WKNA 4FYHA 1PVDA 4B6PA 3Q8KA 4KKXB 4UHKA 4NNPA 4ZVQA 1BKDR 3SU8A 2OCXA 1BVRA 1PAUA 2GTIA 2QTCA 2XUPA 3EFHA 3IPRA 3JARA 4KXXA 6REQA 3SE0A 4HH1A 3V97A 5MN5A 5D3ZA 5AK3A 5FJIA 5K99A 4IXMA 1YR8A 1OGYA 4KSBA 3UK1A 3GLIB 1IBMB 1L1RA 1NVDA 3QVKA 3NWPA 3S8YA 4WY8A 4LHZA 3VKHA 3CEPB 3ZE7A 3AJAA 1AMNA 5HMLA 1Y1TA 5AJUA 4O3FA 2J5RA 3CT4A 3MXOA 3RFXA 2FN9A 1OFUX 2XE8A 2ODBA 2ZAIA 4ABYA 1PR2A 4BTVA 4DIKA 4ER5A 2Y0CA 3HCNA 4KXYA 4XDZA 5COBA 1VL6A 1TGYA 5IDWA 3PDCA 1MAWA 2XZTA 4BNGA 3MWEA 4F2HA 2F2TA 2UZ1B 4FYKA 5JZSA 3VR2A 5KYWB 1L8QA 4HKTA 4TZKA 3OQOA 2H4WA 3EA4A 1YRLA 1LUAA 2RONA 4JA0A 3QXCA 2AR7A 3I0NA 1A76A 2RGUA 3FTDA 2SNIE 3HPQA 3R6TA 3BKXA 5DKFA 3I72A 3VHXB 5KZMB 4UATA 2GCNA 3GZNA 4J03A 5K4AA 4CLRB 3MGAA 2AR9A 3EH1A 1U3TA 4N4AA 4X00A 3VTKA 1PW5A 1Q95A 3A9UA 2NIPA 1Q0SA 1JEOA 3DAOA 4TL8A 3KUKA 3DBHB 4O08A 5J2UF 1Y3IA 4R9RA 3DMHA 1CUWA 4G0YA 3T7JA 2O7RA 2FZKA 3DP7A 4MA0A 4EMUA 3RIMA 2O8VA 4TM8A 1RHKA 3P9PA 3KJQA 4B4KA 2PUTA 3H8VA 4NYIQ 5C31A 1ZUD1 1AUPA 2DLDA 3OF5A 4RH3A 2VP3A 1NLYA 5BV0A 2ZJ8A 3U0VA 3GLQA 3ISVA 4HXFB 4G1VA 4ZOCA 1ENZA 2C78A 2OBNA 2FE1A 2KYRA 1RBMA 4KVGA 1XEXA 3B3AA 3E5RA 1CZRA 1OH7A 1VKHA 3SS9X 5IDQA 2C8JA 4ZKDA 1RPAA 2FPPB 1QH8A 2KMLA 5ANRB 4G6ZA 1BVUA 2QN7A 4MS1B 4U2FA 3W04A 4MLPA 2ZWMA 3K1JA 1OLOA 4X92A 1U3CA 4MRMB 4DDUA 2QRVA 1ESCA 1PKXA 3HJAA 4G5HA 5CJ2A 4U02A 5CB4A 3RSLA 1XZAA 4O4IB 1E3WA 2ONYA 3N8HA 4PXSA 1P0FA 3RHSA 3AEUA 1EFAA 1Y3FE 1JDBC 3Q6MA 4L4UA 4YT8A 4FYVA 1EIZA 4JOQA 1U0JA 2R60A 4MWSA 3ZBTA 3KO8A 2NPOA 2AI1A 5EMLA 5HJ7A 2IDMA 3NVAA 1W4RA 1MX9A 2HRRA 4HH0A 4HDSB 3PFNA 1EE2A 1G21A 1YCFA 4UE2A 2JGKA 4MDEA 3K3PA 2BRUC 3OZRA 3C6QA 4I1OA 4ZU1X 3WIBA 4UBJA 3CUEF 3DAHA 3V2UA 5FI3A 2PSDA 3PA8A 2Y1WA 2VHVA 4OBBA 5KNDH 1AS2A 2QUBA 2ZBEA 3NRBA 3QBEA 5JO9A 4Y2PA 2X8BA 3U7QB 4TGLA 4YAFA 3FYHA 3LLCA 3DVRX 1RVDA 1DAGA 2WJGA 3KD2A 4L22A 3BXHA 4FDMA 4XPIB 3DUWA 4E21A 4OQFA 5LQUA 4XD7A 3JS5A 2E4UA 5JASA 4PIVA 4MULA 2NNLD 1DFIA 4DLNA 1NLUA 4ZIRB 1IY2A 3QPAA 3CLUC 2IEAA 1XOIA 3M1YA 1U3WA 4HDKA 1RLMA 3RRNA 5BYKA 2VQFB 1JB1A 3QGMA 4BO7A 5DI9A 2X0EA 4HBGA 4FSHA 1JNXX 1X38A 2JH3A 3GCGA 3KQWA 5CITA 1NU8A 2YJ5A 3C4QA 3KYCB 1UM9A 4B7UA 4X24A 3R7LA 3EVTA 4C7XA 3O73A 4QJ5A 1PHRA 2ZB3A 4UEKA 4QQNA 1ONBA 2W6NA 1N2IA 3V4RA 2CHUA 2XVZA 1H8EA 3EARA 3T4UA 2GKGA 4HEHA 4XCQA 2PSSA 4ZYXA 3IJEB 2OO5A 1AA6A 2FPIA 3KCNA 5FPTA 2Z6QA 1P7WA 1KYZA 2QVGA 3MJDA 3Q85A 1SWVA 3EVBA 5K0NA 4BQSA 3AF6A 2IPMA 2WB4A 4YFYA 3EPLA 3T95A 3HYTA 4I9HA 1E99A 1JIXA 3MMSA 1H5NA 1XZQA 2LNDA 4MUNA 4TMKA 5L4LA 1XPUA 4CGYA 2R85A 1MKYA 3P9RA 4QPCA 5EAIA 4X85A 2YZ2A 1KJ9A 2QMOA 1O94C 1YBFA 3ZWKA 4MKGA 3NVDA 2BGNA 4LVCA 1UKZA 4FD3A 3KYDB 1L7NA 1Q6YA 3CT6A 4E5SA 5T5QA 1ZMXA 3KUXA 4AN0A 1X7WB 2IQ5A 3PXUA 4QHYA 1KWGA 2FG5A 4CDMA 4K8RB 2FZGA 3BTSA 2DUJA 3HCAA 3Q8XB 4BJ5A 1QYCA 2TMGA 3B5IA 1F0PA 3ZZUA 4BV3A 3HKEB 1COWA 4YP0A 3L05A 3NBXX 5THKA 2EV9A 3NYQA 2C00A 3OE5A 4BZQA 1J24A 4RKRA 5CAEB 2YIJA 4GYJA 2FFHA 3C1AA 1RJEA 2NAFA 5KWJA 2ZIFA 5LPNA 2GO7A 1X13A 3L40A 1QC5B 4F3RA 4M0UA 3W06A 3WJ1A 1G5TA 2EP7A 1Z0UA 4QIHA 1GV1A 4IHJA 2E6UX 4AYWA 3AFGA 1WSWA 1RRKA 2YWRA 3HVIA 4IDHA 4FWTA 1KI9A 8ABPA 2CD9A 3MCZA 5GZ1A 3FJ1A 4G5OA 5LZ4A 4RQTA 2Z98A 4B3JA 2JKZA 4BFTA 1IHXA 1WDLA 4B34A 1SZPA 4JC8A 4UXIA 5IVIA 2RMKA 3FDZB 4XVCA 5JNTA 2VA9A 3CU5A 1GILA 5K8UA 2I62A 3QKIA 2VYNA 4HWRA 4JKIA 4YAIA 2AOWA 3OM1A 1IIBA 1PEKE 4IH9A 1PZNA 1GGJA 4XLZA 3NHSA 1X92A 3GLVA 5AKYA 5JSKA 2DB3A 1C8KA 4CNQA 3GEIA 2CNKA 2MINA 2V96A 2GPBA 1B15A 4FYMA 4H6PA 1LK5A 1NSYA 4KN6A 5CUQA 5IM4A 1C9EA 2PZ8A 2YCBA 3INRA 3P9YA 3QFHA 3REQB 3U19A 2GPAA 1B26A 3IHTA 1IIRA 1ILWA 1GNPA 2Z2JA 4HUTA 3CRRA 2X6TA 1L5OA 3ADDA 4A0RA 1XRRA 1G1MA 1QZUA 2FR8A 5CG1A 5DSXA 4FZVA 2DBVO 2GLXA 1CR0A 2HTFA 2YIDA 4MTLA 2CXNA 3R7AA 4XWTA 4C0KA 2CVFA 1ZG3A 3QVMA 2NSLA 2OV2A 2QLTA 5F33A 4ZOQI 3R0QA 4FINA 4Q34A 5BSVA 5BNIA 1BAPA 2EKPA 2G63A 2O0KA 4AB1A 1T0PA 4P3OA 1H2XA 2P2NA 3KKOA 4ZI7F 1ZHHA 1W4AA 3R4VA 1E4OA 1R0XA 2C7GA 3IAUA 1F1JA 3A10A 2BMVA 2OKCA 1OV4A 2C58A 5JJCA 2YVAA 3JQAB 3KSUA 3KDAA 3CVYA 3WE7A 3IDOA 4E5VA 3PRKE 4ESVA 1TPZA 2A0KA 3LHKA 4OYRA 3C1UA 5ALRA 3V3TA 4DYHA 4QELA 1ONSA 3WLOA 3KOUA 3D8RA 5GV8A 4S12A 1O5IA 3F6BX 3QX9A 4J7UA 2ADMA 3DF9A 4NS4A 3KLNA 4P7FA 5CA0B 4MCJA 4XIFA 4E32A 3QVWA 4HATA 2F48A 5TQJA 2OA0A 5IWCA 5UKDA 1RM5A 3VYUB 3ZU2A 2YHIB 7MDHA 4RYDA 4R9NA 2RGNA 3NVMB 1KY2A 3G6WA 4GGOA 1WKVA 2EL9A 2OXRA 2PL9A 2ERXA 3DTVA 5D86A 1W0JA 3U4DA 3ORYA 1W88A 3DMNA 3UMFA 4G1FA 2W6QA 1KOLA 1PEAA 1BXGB 3OQBA 4IMPA 4B84A 1TCUA 1MB3A 1I2MA 5AJXA 5LLSA 3E0XA 5DP2A 3BFPA 3ND9A 3EK2A 4Z9AA 3Q5DA 4ZTZB 5KMGB 2A1UB 4PQEA 1Q7RA 3AETB 2X1MA 1T36B 2AYXA 2VPYA 3FMVA 3G7NA 1L4GA 4GOMD 3E7DA 1GL7A 3H1EA 3L84A 3RHFA 2YJGA 2NTYC 3GJSA 5E1MA 4WERA 1FW6A 3BREA 1SUBA 2J31A 1GQSA 1HDEA 5K0BA 4R2KA 5F76A 1NBMA 1R9JA 4BEVA 4QPPA 5JI3E 3PXEA 1KY5A 2PXCA 2ZETA 4S1WA 3SSOA 1TI7A 1DV1A 1NM5C 2R6GA 4G0NA 2AA3A 5CT8A 3KQLA 3TSAA 5IG2A 4DCCA 4J4HA 4J1TA 3OJ0A 1POXA 1HYBA 2QRGA 3FN4A 2FK8A 1SBNE 2GJ8A 3LQQA 2IIBA 2X0FA 5A6SA 1TF2A 5JATA 2ZB7A 5AUNB 2DHCA 4DDWA 5IJWA 2C4KA 2QG4A 5EE1A 2AR0A 1UT6A 1SKYE 1M66A 4R31A 3AEKB 4HPJB 1USKA 1H0RA 4IDDA 1CETA 3I1JA 4ID3A 4KAFA 5C7OO 3LY8A 4FNGA 4F06A 1GEGA 1XYYA 4G85A 5G0WA 4YAKA 1JKJB 3X44A 4KGZA 4CT5A 4QOHA 1QYDA 1L5SA 1G1AA 4L6CA 2Z43A 3BTUA 2PT7A 2B6HA 3TO5A 4UHFA 3UV6A 4RK0A 1XEWY 4UTZA 3LDAA 4Y0NA 3B78A 3OBIA 3QXXA 1E1KA 4GL4A 3C6YA 1NU6A 3GLIA 1V1JA 2VJNA 2OXIA 3D5EA 2Y2VA 5SZIA 4QQRA 1YCGA 4E33A 1QLHA 4NESA 2BGLA 4L76A 3GFRA 1EZ4A 1VE6A 1IXSB 3L1VA 3D6UA 2I4NA 2IHJA 4R2IA 1IATA 1O7JA 3CUUA 4KQ1A 3ZY4A 1WETA 2XUAA 2F3RA 3R0XA 4I5FA 4MUYA 5KYWA 3FSEA 1DKPA 2VHQA 1U0NA 4I1VA 4DEYA 1VYTA 1OBOA 1PFWA 1YS1X 3O6VA 4MW2A 4XUEA 2K7FA 3OZEA 5C3UA 4OHYA 1TE2A 4XEHA 2D5AA 2WA1A 1CJKC 3PT5A 1N9KA 5C53B 3U6BA 4N3BA 2WTEA 4COOA 3ZHRA 1HM5A 2EXXA 2GBLC 2GQ0A 1R18A 5BSEA 3G79A 3LXRA 1DEAA 4MDYA 4QQ8A 4H16A 3HYCA 2G1PA 1OD6A 3DBHA 1H23A 3QM1A 3AR6A 4FN4A 4XYEA 4YQFA 1PNRA 3T7IA 2GDJA 4MYDA 3ZVNA 4HN9A 1DV2A 2A58A 2ZTSA 2A1TR 3IPCA 3NBQA 3QXSA 2V7EA 4BLPA 2ZRAA 1ZRNA 4K9MA 3ZU4A 5IRCD 4DNOA 3U61B 4RVFA 4C20A 3L18A 3VC7A 1Y3AA 1PK8A 4ZA2A 1P7ZA 5JSHA 3PDIB 4GI7A 4IUDS 4KNVA 3HKBB 4QXMA 4B82A 2P9GA 4FE4A 1RRGA 4L3VA 4MR7B 2LKDA 1J2EA 4WJLA 4JI7B 3WGNA 5HZMA 2J5QA 5EE9A 2G5TA 4CLOA 2FPPA 3FETA 3FRJA 3NGLA 1GGEA 1AM4D 1V2HE 1U8FO 1VRVA 3DPSA 4ILKA 2QQFA 3PHJA 3HLTA 4MS1A 1GCOA 4WLUA 4ZAFA 2M1ZA 3AVWA 3T1QA 3AF4A 4MRMA 4WNAB 1F2TB 3P32A 3S2FA 3STWA 4NC9A 4N0DA 1UZUA 1Z16A 1RI2A 1WMBA 2ZVJA 4O4IA 1NG9A 3BJEA 3CCBA 3P9IA 2DUNA 3QLUC 5LZ8A 3OQNA 1N8TA 5GGYA 1W25A 3PUKA 4MUAA 4Q18A 5EHQA 3U4HA 3CGWA 5DYYA 3VUEA 1E2IA 3IQZA 2I6GA 5TMEA 4AY5A 3FTNA 1SHLA 1FJ2A 3C5CA 3AVOA 3O1JC 1TIPA 2BFAA 4NV3A 4HDSA 2P6NA 1E5TA 4TUYB 1MH9A 3FLBA 3WLLA 4WDQA 1C7QA 1V1RB 3OX4A 4X9XA 3I32A 1AC5A 4PQRA 2KBEA 4L3WA 4YGXB 5TJHA 4RJKA 2PT9A 3MOGA 1B8VA 3N07A 4KYUA 1RYBA 4DBLE 5ESWA 4YJ3A 1T3SA 3Q4GA 3FYUC 1E79A 3TLEA 3U7QA 4HLNA 4BBZA 3OC0A 4C0JA 5AM5A 2ZR7A 3ICCA 2H4JA 4Q47A 1U28A 3M49A 4XPIA 4CGZA 5EE5B 3SZGA 3ZXYA 1LTHR 1EP3B 3Q12A 3L07A 1CDZA 1ZO8A 4ZPXA 4F4IA 4OREX 1NTOA 3O94A 4MV6A 4Q9IA 1VGVA 2OV8A 4ZIRA 5DEIA 2RIPA 5FOSA 4ARSA 2C4HA 4YXWA 1WZCA 3DMTC 1NP6A 2BR5A 4C9BA 3MB5A 1WY7A 1EGAA 5T64A 2QRPA 3BDVA 2C2XA 1XP8A 3HDVA 3SHVA 5DPMA 3EF0A 2FPRA 4FONA 1T9KA 4TXJA 1AGXA 3KYCA 4W8OA 3FLMA 3LW8A 4WEQA 1L4HA 2QSUA 2VO1A 5FYDA 1Z12A 2G7MC 2ZUWA 3PDWA 3KJZA 3E9NA 4MQBA 4QTYA 4IOMA 2GLUA 2YNMA 1KYWA 4CDRA 1I3CA 3QE4A 1MH1A 4BP1A 3MLBA 4LOIA 4MLZA 4OJKA 3VNAA 1NVBA 3AI7A 4MW5A 1XMQB 1IHYA 3HB5X 4FFVA 1VA4A 4HVAA 1KMMA 3OU6A 3IX7A 3DDZX 1JU3A 4PU0A 3N6XA 4D4IA 1C2TA 3I6QA 3O95A 3WMXA 1X8XA 5FOWA 1DZ3A 5J23A 3MQ4A 5DW3A 3QKWA 2GJ9A 3PPIA 5H9VA 3O74A 3PITA 5A9TA 4YB8A 5C8DA 4D98A 2C4TA 4IJWA 2O2CA 3L7BA 1L9XA 1PTKA 3LIIA 4CTMA 1VGQA 1CZOA 1QVWA 4HCJA 1D07A 1M83A 2AX3A 2PKWA 3DMYA 3KYDA 4GPEA 4LOHA 5ITZB 1UBEA 2E49A 4GR9A 2F8SA 1Q6ZA 1IVSA 3CR8A 1IM8A 1AO3A 2ZBVA 3MWYW 1CUYA 2GYYA 3AB7A 5CVDA 4GC9A 3B6EA 1EVLA 1OFVA 2BZ1A 4NCJA 1GZVA 3DZCA 1EDEA 3H5WA 4D0LB 1RJ9A 3SVTA 1DEHA 1TK3A 4S1NA 2QV7A 4NDNE 1GL9B 3HKEA 1RXEA 3G3EA 3TKYA 3NDPA 2GEDA 3KHTA 4PYMA 4ZMSA 3DPUA 4XD2A 5CAEA 1RRVA 3AXSA 1H65A 1Z2EA 2QEQA 2A1IA 2QTNA 4Y6RA 3VPCA 5M34A 1HI9A 1W5EA 2UXDB 1QC5A 2QTLA 2F4NA 3WLIA 3LHSA 4PX9A 4YTEA 3U4QB 1ZWKA 3NDRA 1JH8A 1OOEA 2OOKA 2V03A 2O0JA 4QGBA 5ALKA 3U49A 2ZT8A 1A69A 3STYA 3RUFA 1NATA 1FYWA 1GLNA 2GMWA 3AUJB 2OYSA 3BF7A 4FMCB 1JHRA 1G55A 3A3OA 2PUEA 2V3VA 4NATA 2GNOA 5CJJA 4QATA 4DCMA 4W5TA 2CCJA 3DEZA 4FS8A 2RH8A 3T5AA 3A9SA 2GUGA 3IQGX 2ZE5A 2EW2A 3BEOA 3JR7A 3I2JA 5KWSA 3FDZA 1OH6A 4HTAA 2GK7A 4DV5B 1OX4B 1QRAA 2Y67A 2YFKA 1VG8A 4XFJA 4LSGA 3RVQA 2HXGA 1T8UA 1CUEA 3JVDA 1DGQA 3BX1A 4FR0A 1SQ5A 3DSRA 3AUAA 1JYSA 3WL3A 2A67A 3WIUA 5DNUA 4UCQA 4DVGA 3IQWA 3QTLA 5KVSA 1YH3A 4BLTA 2IYEA 1CDDA 4OK5A 1SBYA 5BSWA 5ED4A 4OPMA 4QICA 3RQSA 4JH0A 4OUDB 1C8BA 1E18A 4DQKA 1YAHA 3CKYA 1AKEA 2P40A 3KPVA 1FLNA 1EWKA 3PLRA 4BN4A 3WMWA 5LVAA 3EMBA 1I1OA 4S1PA 1UK8A 5FFFA 5EKDA 3PC8C 2IY8A 5FQNA 1A2OA 2FUCA 4FW9A 2A59A 4JWTA 1SUAA 2CEKA 4M7WA 5TT0A 2B8EA 1SCUB 2X19A 3AB3A 3EQ6A 5BSMA 3F73A 2WUFA 1C41A 4WCFC 1PWZA 2WUVA 4BZZA 1F7UA 2ZATA 1AKUA 3IAAA 1KETA 2FSVC 1LQTA 2OAEA 4RS3A 1Y34E 3E9DA 3MJFA 4Y2SA 1ADGA 4M9SA 4Q24A 4E7OA 1XFAA 5EGSA 2QI9C 4DV4B 4KQMA 1ZRSA 2OBXA 4KH0A 3CH4B 1TUBB 1DFHA 4WFKA 4E3WA 3PXGA 3JQAA 4JBNA 2IYRA 4TTAA 3TSCA 3V1KA 4TL7A 1A9PA 2AUTA 4I3FA 2EU8A 3LYAA 4WQMA 1KQNA 4Q39A 1NMZA 1UC5B 4MDFA 2OBMA 4F96A 4WNCA 3JYQA 3U9LA 3C3KA 5HGXA 4Y7CA 4IIJF 1MFPA 4P98A 2H2GA 2BMEA 4J7XA 1J0BA 3GUYA 2EX1A 4RUKA 1V25A 4BMXA 1OF1A 1U8EA 5CA0A 2AG8A 8ATCA 3ZVKA 1W36D 3ZGZA 3EZFA 4UTNA 1OLXA 4CFSA 2YHIA 4EHIA 1CS0B 2NU8A 2P2YA 2II6A 3CA8A 1RWMA 4GMGA 4DLLA 3G9ZA 5DHRA 5HIMA 5J5VA 2HXYA 2PKQP 3ZCVA 3D2CA 3GDFA 4R05A 1BXGA 4AMGA 1QJCA 3IO3A 3ICWA 2I4LA 2I8LA 4Z2AA 4G5QA 3PF9A 2FUG6 3MM4A 3U31A 3I58A 3MWJA 3LF1A 2GCOB 3TW8B 4TTTS 1MT3A 4EI7A 3PFCA 5KMGA 2A1UA 4KQKA 2A5FA 4ZC8A 3MF4A 4KQEA 4R71A 1YACA 1T36A 3TL3A 3NV7A 2V5AA 1VJRA 3W1WA 3TDKA 4KQWA 4UTRA 3HA5A 1VJ5A 2YX1A 2ZBDA 1L8OA 3ZIAD 1L0BA 2ZPAA 5IK2A 2VHUA 2PPLA 4M0KA 3RM3A 4Z3KA 2QENA 2FLVA 1RADA 1POWA 2FPXA 2R97A 3BRWD 3HI4A 3IP3A 3LYHA 3MVEA 4M86A 1NUUA 4WRRA 5F35A 3L93A 1JHYA 2X41A 4WZBB 1J70A 2VAVA 1MF7A 4IH1A 4X44A 3NJRA 4BMVA 1NIPA 3AR5A 4OOEA 1RNLA 4BNJA 4H35A 2CLLB 1HG1A 2O8EB 4ONEA 2ZTUA 4PHCA 2YC2C 1P29A 5JAUA 1CPYA 4Y1RB 4WMLA 2PQMA 3SCZA 2WT8A 3TKAA 1B6RA 1QORA 2FWRA 4JI2B 2LRHA 2AUNA 1LI4A 3BJRA 5EJ8A 4IIBA 1N25A 3RVSA 4DJDC 4GMFA 3JY6A 5FBKA 3ESXA 1V6SA 3GVHA 4G1BA 3IAM6 1JKJA 3C7KA 1IMJA 4HGRA 2B98A 1KF0A 2PGLA 4QUDA 3QK7A 4YRKA 2PWPA 3K6RA 4CHGA 3DP9A 3NIGB 1C9NA 3CBQA 3IBFA 3VR6H 4KPFC 4DF3A 1PIWA 1SC6A 2VPPA 1JSCA 1GARA 2ZSJA 3DDHA 3QVUA 4LCEA 3TSWA 4NHOA 4UU0A 3TDMA 2HJGA 2GS9A 3G2JA 3V1TC 1KMQA 5GM1A 1ZJZA 5CM2Z 5ES3A 3UKDA 1S2OA 1Z47A 3GJYA 3UK2A 4E5YA 1SHJA 1XMXA 1BQEA 1QOPB 1Y8AA 3FCOA 2YZKA 3GG9A 5E1BA 5ADHA 2VDPB 2P2CA 3BMXA 2FWMX 1X7YB 3NKFA 4YT5A 3KJFA 1N1EA 1USUA 2YJZA 1EX7A 2CXRA 2IZ1A 2R47A 4FLEA 4OBEA 1B3BA 3SHQA 2GBFA 3LWNA 2QOEA 2RAPA 3EDMA 1DAEA 4RJJA 5EEHA 3S99A 4YCCA 5FUVA 1JDBB 3VR2D 3RROA 3H97A 4RMIA 5CGQB 1WW8A 1SQFA 5F2OA 5COQA 3DWIA 1H1LB 2YYZA 1NV9A 1SURA 2OFOA 3ELDA 3UWSA 4BUCA 5H3HA 1E9CA 2AVNA 1Z3IX 2ZIUB 3G5MA 3F9IA 3QQ5A 3W8EA 2DBZA 4P4SB 1IM5A 4CKBB 2HRZA 2XYQA 1O03A 3A05A 4OF4A 2AGVA 3GBSA 4ND2A 4UHEA 3SN6A 1SVNA 3OH8A 1F2DA 5I7OA 4N41A 3HABA 3GGDA 4YJ2F 1FJGB 1RKUA 1XTZA 4LN1A 4UNIA 1K6JA 3OOYA 2DFPA 1KSHA 3GU3A 2DPHA 2INGX 4ZGWA 1DELA 1U2SA 4LY3A 1NPYA 1USIA 1E69A 3PDIA 5DWDA 1S3FA 2J5BA 4NG4A 1OWMA 1AXGA 3B6KA 4JJGA 4ALLA 2R00C 3D8BA 3TH5A 2VSOA 3VR4H 3RQIA 4OSEA 4XZ3A 1OMOA 5IHXA 1ORRA 4Q9DA 1VECA 1CC1S 5CRIA 1K5PA 3WSTA 1JJFA 2A0UA 2W6JD 1GN9A 1FK8A 1XDBA 2BBTA 2LTAA 3IALA 1E9SA 4FYJA 1F2TA 4HAZA 4WNAA 3OHMA 1RHQA 3IODA 2ZPTX 1U2EA 1ONOA 1P77A 3VM6A 3LFUA 3K5HA 3EAFA 1RPZA 1SD2A 1ESNA 1RE1A 3DOIA 2XOEA 3LCRA 3ZDEA 1E6CA 5BR7A 4CU2A 2CZCA 2PYDA 4KG7A 1D3AA 2ADFA 3F9RA 5EXEA 3OPYB 3HQ4O 2JIQA 2O1EA 4HNHA 3QUSA 4M1WA 1XCBA 5JZMA 1N2BA 2ZCUA 4J75A 3BXGA 3BZUA 2HPAA 4TUYA 4OHWA 1AHIA 3RC7A 1I7DA 4PHGA 2XD9A 3IXMA 5L95A 1V1RA 1LSUA 1RKBA 3H2BA 2Q7XA 3SF0A 3UICA 1HY3A 3MQFA 4PQYA 4AZVA 2FG7C 3DCNA 1TKCA 3R40A 5IBPA 3OIFA 5BWLA 1QYIA 1VLMA 3ZNQA 2KJQA 1NT4A 1ZLXA 5F4ZA 5I01A 1WY5A 4O59O 1VHTA 4JR1A 4NMMA 2ORIA 1T8PA 1ZI8A 1C0PA 3SC2B 1TW2A 4YDSA 1G0NA 3ZW8A 3LW7A 4M7OA 1N2CE 3QYPA 2OCDA 5C1IA 3HACA 1W93A 5BOSB 3G9UA 3VYRB 1DX9A 2HRDA 2C98A 4CQMD 1OWNA 1UH5A 3CKKA 4YREA 1NONA 1XZGA 3AP1A 4RF4A 5PNTA 2AC2A 5E7JA 3T1NA 3B12A 1WBDA 5F1KA 4A1FA 4C06A 4HR7A 1UIRA 3DR3A 3K5IA 1Y6GA 4NG5A 1H2RS 4J49A 4ND8B 1UP7A 2ODAA 2QQGA 4P80A 2CYCA 1WW2A 4X41A 5DBHX 2X13A 3CRVA 4OQEA 3KDSE 4PFJA 1H8ED 3L8HA 5FX2A 2CLIB 1VHWA 1VE5A 4FILA 3AP3A 5KVCA 3KJEA 3ZU5A 2GEBA 3SC4A 4AJEA 2G80A 5GINE 3PJFA 2C3UA 4AY4A 4ZVRA 1K8XB 1FFEA 1V8FA 1RZUA 1EPUA 3H2IA 1JTVA 4K46A 4P3KA 4Q37A 4KYIB 4YAUA 1GU0A 3ZE8A 3CYFA 2CBZA 1T8WA 3M1IA 4NU0A 5DWQA 1C3XA 4OLAA 3K2BA 3TNYA 2Y71A 3PEFA 3RUHA 3ROKA 2AT1A 3BGDA 4YASA 5ITZA 3HK2A 3KKLA 4WWHA 1I13A 5C5EA 2YJ6A 3L8EA 4LJ7A 1YJAA 2I2FA 3GFSA 5A3RA 4CEIA 2ID8A 3G2KA 3OP4A 5D6NA 3JD2A 2WU4A 1EU1A 5A9SB 1W2GA 3OA0A 3VAYA 4DYVA 2BZ0A 3BL8A 1I7SB 2IYFA 3NIBA 3KR2A 1I4OA 3OZBA 4EA6A 1NY6A 1YZYA 4HGYA 2UYOA 1AQUA 4LZJA 3WNVA 1ZCJA 5FQOA 1COWD 3A6HA 4GOND 2VT2A 2CMHA 2GN4A 3H19A 4J1QA 4NONA 4R8SA 1UAAA 5BR1A 4PYNA 2IKSA 3T5DA 4H08A 3ZDAA 3GEGA 5L3RA 4JI1B 3I3SR 1I7PA 5TQ0B 3R7WA 5KSYA 3U4QA 4PZDA 3K9HA 1LI7A 4M8NE 4EG7A 2F8TA 4JS0A 4MEJA 5A3VA 4CWAA 4R2WA 3UJAA 3L0DA 1K3FA 1XQ1A 1SM4A 1FTNA 4EY5A 1AKQA 2ZS7A 2ODEA 3LNCA 1P2BA 3GARA 3Q3GE 2B1RA 3NIDB 2PYZA 3HFSA 1JE0A 4TWAA 3AONB 1PP4A 4UKDA 1T9BA 3GEDA 1B0AA 4AF8A 4XRRA 5ICCA 2BUAA 1QVZA 2VYND 5JCJA 1JXAA 4MW1A 4BCDA 1PTJA 3DR5A 1C2YA 3P2IA 3U56A 5LBTA 3AKZA 2CKDA 2C5HA 2X2FA 1FMCA 4P81A 1EGMB 1H9BA 3A1WA 3LRTA 5C51B 4NXMB 2XCQA 3WAKA 2AEJA 2C2BA 1M54A 3QKUA 4G2NA 3QV2A 3EASA 4HLUC 3X1DA 4YACA 2XA1A 5EJ4A 1E3IA 4OUDA 1WM1A 2IOYA 3IA2A 4K1XA 3SSAA 4BS9A 1SCAA 1TAUA 3K72B 3BWMA 4RSMA 5TNXA 4UDNA 3U80A 4MVJM 1N6PA 2MTBA 1AZLA 2JAWA 1N6HA 2C2HA 1RQNA 3T5BA 4M0EA 1L5WA 4ZYVA 4KSYA 1HEYA 1NWHA 3Q88A 1U99A 5EP4A 4HNVA 1S7GA 5BRJA 1WX1A 3DULA 3WGMA 1SCUA 2H7CA 1WZNA 1YGPA 5DHQA 5FNZA 2AUMA 4DV3B 1ONPA 1QFMA 1ULUA 4OXXA 5AVYA 4N48A 4BAUA 3FPKA 1TYBE 2CC2A 2P2ZA 2ZJZA 2Y77A 3GQBB 4WK2B 3T1VA 5ICMA 1RU3A 1TAQA 2YS7A 4WD3A 2XUJA 1UC8A 2ENWA 3HMKA 3IXQA 1ZM4A 2D59A 3KPUA 1NXTA 3DFMA 4OBWA 3HY4A 1TUBA 1DQPA 1NRJB 1QTRA 1QWOA 4WCVA 4QYTA 2ZI6A 3ZXXA 1CF4A 2YMQA 4O4JF 2A9OA 2CL6X 4L9SA 4OU5A 3UMYA 3W4IA 2Z6AA 3I83A 1F9EA 3BQNB 5G3ZA 4CEHB 4ZN6A 1NBIA 1T2UA 3ZXUB 3X1KA 5KNCH 1ZMTA 1M72A 1T8YA 2C7RA 3WX0A 1CVIA 4E46A 2FG6C 2Q0QA 1BXRB 2CLKB 2W6PA 3IELA 3LKVA 2TRSB 2CJWB 1ZIYA 3L77A 3VSCA 1GG2A 2NXNA 1JN0A 3EWIA 3P7MA 1ABBA 4YBZA 2ZSUA 3KXIA 1JPVA 4NOJA 3IBSA 4KC0A 4U0KA 1I5EA 1HLPA 1DZIA 5TF4A 3I04A 2O8BB 1QHIA 1V2GA 4FSXA 4RC9A 3V1LA 2QUIA 1YJ8A 3ZDDA 1NC1A 1V48A 2H07A 2JCVA 1E3LA 3DTVD 4L7QA 5CCXA 1IH8A 1QB8A 3DT8A 4LJLA 1CUJA 1FZTA 3VDRA 2I7XA 2HMYB 2PJRA 3RK0A 1L4YA 3G5AA 3JD3A 4N18A 4LISA 4CF4A 3QQPA 3JQ6A 4MV5A 2XF2A 3VC2A 3TW8A 3GBPA 3N0RA 3GO4A 3ZWXA 2E4ZA 2IUFA 2VEDA 1M74A 4C07A 4ETNA 4IGAA 4K5QA 1IN7A 4J91A 3VO8A 1XA3A 3WK7A 4BKQA 5ICSA 2RFLA 1KFEB 5KNBA 1M8GA 3PCTA 1J2JA 2FDXA 3TLMA 3OIUA 4ALKA 4LFBB 1WCYA 2H4HA 2IGBA 3AF0A 1BGWA 2EFJA 3IIIA 2NO1A 3STTA 2GAIA 2Q29A 2QGZA 4LJRA 1P74A 2ALJA 1RRPA 2E9SA 4RIHA 5M29A 1O6FA 5KYKA 4WACA 4WZBA 1NBMD 1Q19A 1HEIA 2AG1A 2B99A 4JVOA 4BATA 3W5DA 1CVLA 5EIBC 2UUBB 1DKUA 4A91A 3INGA 3K0FA 4FXPA 3B60A 1X8LA 2H08A 1J9ZA 3EVNA 3KTFA 4Z53A 1A4XA 2FSFA 4Y1RA 4OHMA 1PHPA 2OGTA 4TWBA 3WLEA 2IRWA 2ZBRA 2FZWA 4WOJA 5FNVB 5CX4A 5DFAA 1XVLA 1WB6A 1T3GA 5F1YA 4RVOA 2YYAA 4MPDA 5ESRA 5BSRA 4C21A 3OCJA 1F3LA 4I66A 2EARA 3R3WA 1NXOA 1IQUA 3RJTA 2P1DA 5ITVA 5EYPA 1Z17A 1RJDA 2C2MA 4DR6B 4E0BA 1X9HA 4A6PA 2JJ2A 1DBVO 1IZYA 2H1CA 2WEKA 5AKGA 4EPXA 4F6LA 2O8NA 3IHKA 3K70C 1MMFB 5C32A 3M2TA 1AA9A 2ZT7A 3DKKA 3VU8A 4D6XA 1D0VA 4ZJYA 1GEEA 2A84A 3SYMA 1SVMA 1YXMA 3TIVA 5C7LO 2ILTA 3VR5A 2UXCB 3HP1A 1VJ0A 1ZZGA 2GDZA 3KJNA 5I5GA 1JQLB 3D4NA 4FGUA 1L5HB 3KSMA 1RAFA 4Q05A 4EHLA 2PLFA 3FAKA 4N40A 1LJ8A 1Z26A 3BH0A 1FNNA 1X7YA 3GEHA 2L19A 3JQ7B 3QOFA 4WESB 3REFA 1YL7A 4ZT6A 1RI4A 4F97A 2WIGA 1GN8A 4XM2A 1XP5A 1AV7A 2AZTA 1M7HA 1P0CA 1X19A 1N7IA 2I29A 1UBKS 2OB1A 2PQ6A 3RC1A 4E3ZA 1ZRHA 2IY9A 1LJLA 1JDUA 3A1CA 2VHEA 1IXKA 1N2OA 1I6MA 1UFKA 3TJMA 5C7IO 3BFJA 3BQ9A 2VJMA 1UBMS 1BDBA 1H1LA 1N6OA 4PLYA 5L4SA 2P5TB 1D9XA 3NCTA 3ESQA 2BRUA 5CW1A 1C0KA 4EB3A 1SXQA 5FADA 3GLUA 2QZZA 1A0OA 3WOVA 1SCKA 3MUOA 2XNDA 4P4SA 2HK7A 2Z09A 3QMVA 4N49A 5CPBA 3SKVA 2HSZA 3IHWA 4XIJA 4XTCS 1PU2A 2QTFA 2FU5C 4GL2A 4YP9A 3JQ9A 3LXUX 3KS9A 4BLQA 4HDAA 4IS2A 3SDZA 2QG6A 4GZ5A 2F64A 3F7TA 4M46A 5E4JA 5TC4A 1CKEA 4D81A 1U63A 5DMHA 1BS1A 1Z0ZA 4QD3A 3NANA 5AK4A 5GONF 3LKDA 4D8YA 1G7CA 4B7XA 4RPHA 4QXOA 1Z2PX 2QRHA 1N3LA 1FQKA 2WDPA 5EJGA 3RRYA 1XQ9A 1E9FA 4Q4HB 4X1OA 4AIRA 1J39A 5BQ3A 2HSJA 3L4BC 3VH3A 4Z99A 3ZYZA 3F0TA 1GTZA 3N5KA 2KS6A 1TD9A 3CJQA 5JCOC 1IAVA 2ODWA 4BO6A 3LMKA 1BHJA 4AJPA 3P26A 3DGFC 4CR8A 4ZI5A 4IBOA 3ESDA 2A5LA 1AUOA 1WOMA 2FAXA 3NM4A 5AI8A 3VYTB 1BN7A 3BERA 2QTAA 2VQDA 1NXQA 4FCWA 1QRSA 3R3UA 4RY2A 3MUEA 2C82A 3DM5A 4G67A 2Y0EA 3AF1A 2ZS9A 5KKNB 1KRHA 4LSMA 2JH8A 2WUEA 2IYZA 1N77A 2C97A 1W9MA 2P4EA 3OPYA 4YMVA 2DGDA 3IAHA 3PDJA 2P77A 1V5GA 4RL4A 5ILGA 1QPGA 5ES4B 1H1DA 1FDIA 5F77A 1E1CB 1XNHA 2MSWA 4RHYA 3ZE2B 2HCJB 1PZEA 4QRDA 3KQQA 1T5IA 2H0AA 2P78A 3ESRA 4K9QA 5C35A 2QP4A 1H6BA 2R6FA 5EJ9A 2NWQA 1TMYA 2FN3A 3KT6A 5EZYF 3B1JA 5LC1A 4EUFA 4FYPA 4Q00A 4UFOA 5BWMA 2Z9DA 3E70C 4K9KA 1OXTA 4EGAA 3V48A 3V7UA 1E79D 2ZIGA 1KMIY 1XQVA 3QPVA 4UBKA 3SC2A 1TL7C 5B30A 1PJLA 3RARA 1M0EA 4GKKB 1MTOA 2B8NA 2BUCA 2WF8A 2WP8J 5BOSA 2X6RA 3RU2A 1SXHA 1NJ5A 1HOTA 1GG9A 1X42A 2AH5A 5U4QA 3UWKA 4BC0A 1GZSA 5AXCA 4BO1A 1KVTA 2ZWVA 1AT1A 2JEZA 5KU7A 2D62A 3O8CA 1EHCA 1MNQA 1L4FA 4MOWA 3SNHA 2YFYA 2E4YA 3A31A 4JQYA 4DMGA 3D8UA 1Y7LA 4E2WA 5AVTA 4ND8A 1P1JA 3QU4A 1N6LA 4UCXA 1L4UA 4ZI3A 4ROTA 2XNHA 3LVQE 5T3YA 4F4CA 3TL2A 4Z0NA 2ZJ6A 4A0SA 1IZZA 5DISB 4XDYA 3NM5A 1VJTA 2YNMD 3W9YA 2XV1A 3O3NB 5LXTB 3F5DA 3G0DA 1Q50A 1Y42X 1WQ4A 1RHUA 3I2GA 1ZISA 3MPUA 1BEUB 3K9LA 3K9BA 4BJ3A 4MYUA 4D0GA 3P9NA 1GCGA 1KP9A 3D0OA 5FOVA 1RE0A 3SAJA 2PNFA 4IDBA 4UMFA 2QUZA 3C43A 4FKMA 4PWYA 721PA 5E7IA 3UMBA 1O58A 4M9XA 3M4ZA 1KBQA 3DA8A 3AM3A 4OQYA 2B7CA 4B0PA 3OZSA 1O3YA 2PGAA 2W2NA 3IDSA 1Q1NA 4HWTA 3OIWA 1W75A 1CLUA 4IPTA 3R24A 1CR4A 2QD4A 3GA5A 3TTTA 2GLTA 2VZ8A 1H66A 4MKIA 5A9SA 4PE5B 3ID6C 3LHIA 3TLYA 2RHMA 1KVSA 2OXFA 3K9CA 2WAXA 4N5MA 4LDAA 1MT0A 2IIPA 1BA3A 1QO7A 2FWBA 3G2IA 3F8TA 3NTQA 2FXIA 5FFMA 3TXYA 4LJSA 2PCLA 4AMVA 4CF5A 1NN3A 2FW7A 1XVAA 1S89A 4ZRMA 3HO6A 1E2QA 1K27A 2QE7A 4LGYA 3WRWA 1JT2A 4NZZA 4WCFB 3L7CA 4D9GA 1ZM9A 3M2PA 4FCCA 1PSDA 5TQ0A 3S7TA 4Z7OB 4XI9A 2FPKA 4OQZA 1V3TA 5KHAA 1HDXA 4YPVA 5M2QA 1BE0A 4Q3AA 4FFRA 3LLVA 5DNAA 2TECE 2PS0A 5TR9A 3WRYC 4H7HA 4UXHA 3ZHXA 5J47A 1SN7A 1RM3A 3HL0A 3TAHA 1WMSA 4V2IA 5DBIA 4X95A 3WOHA 2VFAA 4AM8A 3G2LA 3CWZA 2VZEA 2Q3CA 3F67A 1KO1A 1Z6XA 1Z18A 1GUBA 2IW1A 2IBMA 3DFIA 4MPPA 5FAKA 2ZJ7A 3TQRA 1JR3E 1JT9A 1Y5MA 4JD5A 1W46A 1KVQA 3ZHCA 5IBCA 3DLHA 3O5AA 4GPD1 2MR5A 4N3GA 2L69A 2ZJ0A 1YGYA 1BJRE 5D5QA 4C4SA 2R6ZA 1PD0A 1NBOA 1R7RA 3K8ZA 4GMHA 4HJRA 4BECA 5LA6B 8LDHA 1K08A 2ZPUA 3EUWA 4EKEA 2X9NA 1RJFA 3PD1A 1O1YA 4HGZA 4B3RB 4IDAA 4RF2A 2AKYA 3NUQA 2R8EA 4TPKA 2IS4A 4H59A 1OSNA 3OM8A 4DMFA 3PXBA 1N5KA 4B6RA 3RFUA 4TMZA 1UZNA 2FR1A 3Q40A 4AIIA 3QY9A 2CV2A 1JQEA 4K87A 1Y6QA 1T1EA 3DNMA 4W5QA 2I2AA 2YXEA 3E9QA 1P0MA 3MUNA 3NTRA 1ZXXA 4MJLA 3ACDA 5IAJA 4LYJA 1AGPA 4KO2S 4MW4A 2C3MA 3UW1A 2JLSA 2Q2QA 3C74A 4NKRA 1HPLA 1VLLA 4OL0A 4Q0MA 5IBQA 5H5JA 1JE1A 1CUFA 1LY1A 1P2FA 3GQBA 3E1SA 3R0JA 3LWDA 3ER6A 1N34B 1XCMA 1P7PA 1UZLA 3FHOA 5EZQA 1KXZA 5EP1A 5G4KB 5ALVA 4TLBA 5I8PA 3DMGA 3E58A 1OGIA 4MB2A 4DA8A 3K0KA 4B0OA 3Q9LA 1OUMA 3HEMA 4GVXA 2NZVG 3VTAA 2VN8A 1T9CA 5HTOA 2TMYA 3JQAD 4HRVA 2DR2A 5IW8A 1I4LD 5FEMA 1XT6A 1O6CA 5JCZA 4CEHA 5B6JA 4XASA 2XRZA 2ST1A 1YVUA 4NJEB 5DTMA 2ZVPX 2G8NA 1U0HC 1U2DA 1ZN8A 4WI1A 2BF7A 2ZTHA 1HDRA 3C39A 1J2UA 2Q5LA 3GGPA 2DYKA 4OQ4A 4BU0A 4LS3A 2DUMA 1AE1A 1U2TA 1OI3A 1Z8HA 4LI0A 4NBUA 5EJMA 2O8BA 3R3VA 4MW7A 2O0LA 1BZYA 2QJRA 1KYYA 2PXAA 4H0FA 3PGJA 3ZBUA 4EELA 4PLWA 1XI2A 3D5QA 4ZEWA 1GVHA 1KK1A 2Q3DA 3JQ8A 1LI5A 3QPUA 2JARA 4P31A 4PZ9A 4HX9A 5ALUA 1BOFA 4MWEA 3CH7A 4ROSA 3N8IA 4PC3A 4D3XA 4AUKA 2WNSA 4FUQA 1PL7A 4HH4A 3DE7X 3OJWA 3ROGA 4JSRA 4L75A 1DKLA 4P4GA 3WRXC 4ARIA 4OI2A 3ZTYA 5JTUA 5IHPA 1EEXB 2E6KA 1CRZA 5TMPA 3RNLA 1TZJA 1QGUB 1JMYA 1W4CA 4NPHA 4MIOA 4REOA 1XNQB 3RYFA 5A04A 4H6XA 4XYMA 4F91B 5IK2D 1Y98A 4DWJA 2D0DA 1Y8ZA 2J6IA 3CJRA 5EJ5A 1P7VA 5AXAA 3IMCA 2Q2WA 4D44A 3P9XA 4XKJA 1K6XA 1A1VA 3DXXA 3ADBA 2JIOA 3PUYA 3CUWA 3FTCA 4OXIA 4A26A 3D6FA 4MS3B 821PA 1H4SA 1YI0A 2V0NA 3L1KA 3RKRA 3MTAA 2W2KB 3QITA 4XQ0A 3VPBA 4RKWA 2ZXFA 1ECGA 1FVXA 3E82A 2CLEB 5FNVA 4EDHA 1VIDA 3M33A 2AMLA 4HRYA 1AUVA 5AHOA 2ZSFA 5IDVA 4BJHB 2Q41A 2WWHA 1JXMA 4G5GA 5I48A 5HKLA 1GTL1 2QP3A 1SXPA 1RYMA 1UFQA 5KTPA 4EY8A 3MAGA 3T7SA 1ZN2A 2A88A 4EYGA 2JC3A 2HJSA 4RHFA 4Z7JA 1E2MA 5FUMA 1E0DA 5FTNA 1KDYA 2QR3A 4RE6A 2AOXA 2I7CA 4JL8A 1YL5A 3IUYA 1F06A 3INNA 3LHFA 4GI1A 4A9AA 1T1JA 3OOWA 4FN5A 1DJLA 3HCRA 3IT2A 4MVJH 4OHUA 4C30A 2ZI7A 2O5RA 3ZBPA 4CHTA 4Y8VA 3KETA 1EFCA 3B5JA 4CL0A 3GDWA 4ZYUA 1XA4A 3TECE 1PR9A 5AW2A 1QCYA 3SDBA 4KPYA 1JDZA 1M0SA 1E1QA 2ECPA 3JQ7A 4TWRA 4WESA 2W4MA 3R8XA 3SJUA 4ZO6A 3WZ2A 1J23A 3EFOB 3ZJYA 1CP3A 4X91A 4DBVO 4D96A 1K86A 1ZS9A 3JQCA 4B6JA 1XYGA 2PUCA 3K6KA 3N2EA 1YB2A 4C0HA 3GJ8A 4OKIA 3ZJ4A 3OT5A 2QMUA 3RAPR 2Z1MA 4G56A 1ZXLA 3R5XA 4UU7A 4XIYA 4BB0A 4IXDA 4D3ZA 4OV6B 2JK0A 2WAAA 2DCMA 4UTVA 2AQHA 1JG2A 4ZOLF 3KP1A 3FPAA 3PI7A 3F98A 3M6AA 5F51A 3ZQKA 4IIFA 1D1PA 1EYZA 1N2JA 5BVHB 1KXJA 3GWGA 3OIYA 1MW8X 3N6RA 3RKUA 3DMRA 1VI5A 4P53A 4B47A 4DIDA 3TTUA 5A5FA 4LRTB 4JYMA 2RAUA 3LPNA 4I1IA 4KVAA 4DQUA 1DI0A 2YWBA 3TI7A 1XU7A 4POAA 1O0SA 4B7AA 2G67A 2NV6A 3TOSA 4M0MA 2E1PA 4EJSB 1MX3A 2ZBFA 1QV9A 4G5RA 1M73E 4I8DA 3MN1A 2XQGA 2PH1A 4OO3A 2GPNA 3C7TA 3IT0A 4Q4HA 3GNTA 3DMTA 5CYOA 5FTWA 3R7SA 1L6RA 4PYJA 4B3FX 3TEMA 2LIPA 4US2R 1OVGA 2GF9A 1DG3A 4Q9LA 2R0QC 1ZX1A 2BEKA 1QX4A 2RK3A 1XRQA 1YKSA 2Q28A 1L1FA 3F3MA 3OPQA 4H18A 1UJNA 4R9VA 3OX3A 4RVSA 5LP6B 1H5UA 4GLBA 1E3TA 2H85A 3GX1A 3LLUA 3OU7A 4HYYA 4HXEB 4XJTA 1S8OA 3KQKA 2H1LA 3N2YA 3Q9SA 4TMVA 4OX9B 3RIHA 5CVUA 1FYFA 1SMKA 3I9LA 1P61B 3QLJA 3FRIA 3A3NA 1MV5A 4HNTA 1V37A 2IL1A 3MXTA 4QBFA 3IUEA 1PN3A 2WYIA 3MFQA 4CL8A 1NVVQ 5JAZA 5DT9A 4HLDA 4PO3X 1OBHA 1E1CA 3V55A 2I54A 1R5OA 2AN3A 3TRKA 1JEEA 3LU1A 1UDWA 1ZOPA 4QX6A 1E1LA 4KJXA 5AVUA 5EKTA 4MVWA 1NBHA 4GNKA 1ISJA 3DOCA 3BPSA 4YWHA 5DM60 1ZQ9A 3K6SB 9ABPA 4WJZA 3GNLA 2HA0A 4DA7A 4O4LF 1OFHA 3I9KA 1EWYA 3MBKA 3EG5A 4JZYA 4DLVA 2DPYA 1A2QA 1TRHA 3E5MA 2FSIA 2X86A 3BOSA 4NE9A 1HT0A 3LXXA 2RI6A 4PSDA 3TL6A 2VT6A 2A4KA 2XMQA 3KZCA 1PE0A 3N2KB 1GNSA 3MINB 2GXUA 4MWTA 3LT2A 1IJEA 4LZLA 5KO2A 4U7JA 3SJAA 1RZ3A 5D3MA 5K51A 2N9UA 2P9HA 3PL5A 2OB2A 4TSRA 5FUWA 2CLSA 3RC3A 1G8HA 4EKYA 1CYEA 1F8YA 1YC2A 4Q16A 4Q1BA 4CM1A 5LQSA 2C03A 1Z5ZA 3NV9A 4U8GA 1VCOA 1A7JA 1MC5A 3O4HA 3V42A 2HJWA 1PJSA 4L4ZA 3V4OA 2UUPA 4HWSA 4QPDA 4EY6A 4TKZA 1VA5A 3L7OA 1N5RA 2GM9A 2NPIA 5DH9A 4HGOA 4WDRA 4Y9DA 3E9ZA 5LXTA 3G0IA 1F8UA 3CF6R 4Y2GA 2QYHA 2AJTA 1JUDA 2P4SA 3HV0A 3PD0A 2GM4A 5DRYA 3HDHA 4HT3B 5TV2A 1FQJA 4WNYA 4E4YA 3FPBA 5MDHA 3D0KA 4JLOA 3W3AA 4YR7A 2Q5CA 2X7HA 3FPGA 3KUCA 1KMCA 1KNXA 3W6PA 4EL5A 3WBKA 2BW0A 3TCXB 4HP8A 1ORVA 1GDDA 1R9MA 2EW1A 3GJXC 1I24A 3R3ZA 1KI3A 4H27A 4JR2A 1XEFA 2WKSA 1U1DA 4JYAB 1AXRA 1P5HA 2YY5A 3IP6A 3NT5A 1J0AA 2ZYGA 4G3XA 4F56A 1P2GA 4KLAA 4U5XA 4EJ2A 4U7PB 4GM4A 3V8VA 3LAWA 4MMXB 3GT3A 1XMPA 3KU1A 5CDHA 2XT9A 3UUEA 2OEPA 1RCFA 2HBZA 3CX7A 1IEWA 4B4OA 4F93B 2IZ5A 4ZVTA 1HLGA 2H1HA 3K7EA 4M3NA 1YULA 4GAEA 5HQ3B 4R1QA 2XBUA 1ZAYA 3PC8A 3T1TA 3Q15C 2ANCA 1PJ4A 2I66A 1D4ZA 3CNQS 3PQFA 4TTPA 3TPCA 3TVTA 5JUWA 5P21A 2WJHA 1Y4SA 4QBIA 2H4ZA 4EUHA 2QPAA 2GEFA 2CE2X 1E2JA 1MEOA 1QQ6A 4FC7A 4X61A 1EXDA 3KZNA 3W8FA 3B1FA 5IVDA 1FSGA 5DLDA 1QONA 2O2JA 1IONA 1H22A 2PN1A 3FXAA 3U3OA 2XDYA 2FOLA 3K35A 1U04A 3OI7A 2LR0A 4AWAA 4O1HA 2PX2A 3TQOA 2JANA 2QW8A 3O21A 3QU7A 2CNDA 3ZDFA 1I1HA 2WD8A 2ONKA 1U3GA 3OY7A 5FD8A 3VKVA 1E66A 2FMKA 3UHPA 2XD4A 3W5JA 1GGVA 2BMWA 1DXQA 1KEPA 3HGQA 3IRUA 1WVMA 1E6MA 4KV7A 4ZYTA 5AKHA 3UCXA 4ZZ0A 1DC8A 1NF3A 1T35A 3SI7A 1BFDA 1LLDA 3ETEA 3L6RA 5LA6A 2YFHA 3HWSA 4UD2A 3T15A 5LMNB 2X77A 3NS7A 5JCJD 1GITA 2X76A 2NO6A 5KQLA 1KYQA 4HVCA 1TZCA 2VK1A 3QX3A 4U5QA 1I4WA 3T52A 3ZWAA 1F2UB 4AKEA 2Q4EA 3KEMA 2GEVA 2DPMA 4DZTA 1KAMA 3RRMA 1EWQA 4XH9B 1ZJJA 3D2BA 1XDDA 1BA2A 3MWFA 5HM6A 2AQKA 3I9MA 4NCKA 3T7DA 1XE3A 1DS6A 3FF1A 1WQ1R 4YAEA 1JHVA 3ZZ0A 4ODIA 4EW2A 3FHJA 3GRFA 3OU2A 4R8LA 5F78A 3RVKA 3N0XA 5EHZA 4KREA 3JZMA 1MAAA 2OFWA 2XAUA 5DZSA 2NACA 3PV0A 5JXIA 2CFSA 2BR4A 5DHFA 2I33A 1XVTA 4JUCA 4CCWA 2JFFA 1GPAA 4GBMA 3DS8A 1I36A 4D0NA 3KV3O 2QGNA 4QPNA 4W5RA 4IMIB 1AK9A 2POCA 2A14A 2BY4A