1QJ4A

Hydroxynitrile-lyase from hevea brasiliensis at atomic resolution
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
256
structure length
256
Chain Sequence
b'AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYDROXYNITRILE LYASE
publication title Atomic Resolution Crystal Structure of Hydroxynitrile Lyase from Hevea Brasiliensis
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Lyase
total genus 102
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qj4A00
2VSQA 5LZ9A 5HF8A 5DNUA 1DWPA 5ALOA 4FTWA 3WYNA 5CMLA 5C7YA 4HVTA 2C0QA 2G5PA 1QO9A 1JI3A 4ITVA 4RPCA 5DNVA 4U2GA 4S0XA 3JW8A 2XUAA 1QZ3A 4LYDA 3N2ZB 4J0DA 3RKSA 1ZI9A 1XKLA 1XZKA 1UOOA 3I28A 4KAJA 3AZQA 5DTIA 4WFIA 1R9MA 4BBZA 3WK9A 3QBJA 2BUCA 2X5XA 5AM4A 5C81A 2AJLI 2VTVA 4Q82A 5ALXA 3BE8A 3C6ZA 1YR2A 1E89A 1UK9A 2I03A 1E5TA 5A62A 1XRRA 5LIPA 2WSLA 3I6ZA 1GGVA 3Q8WA 4FHZA 4CIAA 4LXIA 1JFRA 2NW6A 3G0DA 2J4FA 1XLWA 2DHCA 2HA3A 1TIBA 2C4HA 3WYDA 1P0QA 1SCKA 3CCBA 3STTA 1TQHA 2XMBA 4Q1VA 2WJ3A 4UHBA 1UK8A 4DGQA 5LZ2A 4UHFA 3FOBA 2JBWA 3I1YA 3K9BA 3R0VA 1K5PA 4AO7A 3GUUA 3WWPA 1CR6A 4GBGA 3QPCA 2HADA 2PVSA 1E3QA 4OB6A 5LZ7A 4P93A 1QIKA 3HYSA 5FRDA 3FCXA 4QA9A 3WK8A 1QIEA 2R8BA 2OCKA 1OCEA 1N1MA 1G4HA 2ACEA 4JYMA 3GROA 3STYA 2R11A 4E15A 1CUAA 3KXPA 3I6MA 2XLCA 2ZVDA 4EY8A 5AOBA 3ZPXA 5HF5A 1FJ2A 3WKAA 5EHQA 2QUAA 4MEAA 1BS9A 4BRZA 3BL8A 3V1NA 1EDDA 1XRPA 4G5XA 2X8BA 2WTMA 3AIOA 3ESCA 4BE4A 3ESAA 1Z68A 3O4JA 4BVKA 1KU6A 4UBMA 4KEAA 4DIUA 4OU5A 1B41A 1Q0ZA 5AK3A 3QPDA 4BDTA 2J3DA 1WCYA 2BGRA 4PNZA 1SC9A 3SX4A 4OD0A 1S8OA 3LP5A 3BIXA 2HU5A 2HU7A 4XJVA 2RIPA 5EGNA 4MJ3A 4FLMA 1FFEA 1XZDA 5IVHA 2YASA 3H2KA 4X91A 3M81A 1E8MA 2Z3ZA 4G9GA 2XQGA 5T4EA 4RE6A 4Q05A 1WHTA 1BCRA 4KAAA 3PDCA 3WK7A 1A8QA 1A8UA 5DNWA 4GEGA 1XQXA 4GW3A 5CBKA 2O7VA 1O6GA 1HQDA 1U65A 5ALPA 4Y2XA 3FSGD 2WU4A 4J0CA 5ALEA 3MUNA 3WWDA 2HA5A 5LLSA 4IQ4A 1Q83A 1OXMA 4L3WA 3EF3A 3FWHA 2WTNA 1CUWA 3WK4A 2BGNA 2PU5A 3WL5A 1XQVA 2XUJA 1O6FA 5LP1A 5CXUA 4FNGA 3QZUA 2QXUA 3G9UA 2DFPA 4KRXA 5LZ8A 3V9AA 3NGMA 4Y2PA 4W1SA 3AZOA 4F60A 4B84A 1LBTA 1LPAB 4BVLA 4QDXA 3FYTA 1MAHA 4DYHA 1CQWA 1L7QA 2HFKA 5A2GA 3IB3A 2WG1A 4JNCA 3H0CA 1SCQA 2OLEA 3W04A 3DEAA 3DYVA 2Z3WA 1QIGA 5JADA 4KAFA 2BAGA 4DSAA 1MO2A 4IH9A 4FFVA 1R1DA 5ALJA 4L9AA 3KD2A 1C7IA 1W1IA 1A7UA 2D5LA 3C5VA 4H18A 1W75A 1EB8A 2XUKA 1BRTA 4DMCA 4OB7A 2I3DA 1JMKC 1BE0A 1XLVA 3EBLA 4M0EA 1BCSA 1AC5A 2AJ8A 1ZI8A 2JIDA 2P8SA 3M82A 2HA4A 1BEZA 1UKAA 4KE6A 4DNOA 3G9XA 4QLOA 5KWIA 1J1IA 2XMSA 4H7HA 1P0MA 2XMDA 1EINA 2PX6A 4B82A 1XZFA 1CQZA 3K2IA 3OM8A 1VXOA 1GPNA 4EHBA 1H2ZA 1QONA 4Y2VA 3QVMA 1LPPA 2C58A 1KEZA 3K6KA 2XMRA 4BCBA 1T2NA 1VXRA 5AKJA 2DHDA 3FAKA 4H7IA 2JGMA 3W2TA 3R41A 1OILA 4QNNA 2WG2A 3F97A 5ALIA 1CUHA 1EK1A 1LPBB 3ICWA 3DKRA 3UUFA 2WIJA 3A2MA 4AO8A 1XRLA 5DWDA 2PKYX 3C6BA 4HRYA 3IA2A 5JALA 2XLBA 3KSRA 2H1IA 5T4FA 2Q0XA 2V96A 2XDWA 2AJCA 1GQRA 3N0TA 3R40A 4IH1A 4KR0A 3O9VA 1MAAA 1GT6A 1XZBA 3FYUA 5AK5A 1Y7IA 4BC1A 4WDRA 3P2MA 1MX5A 2QS9A 1JU4A 2OPHA 2DR0A 1MNAA 2OCLA 3FYUB 1W6RA 1FFCA 1MU0A 2AXEA 5CT8A 3WJ2A 3W05A 2BKLA 1ACLA 1EK2A 1WM1A 1JU3A 1LPMA 1ACJA 2WFLA 3UMJA 3D2AA 4QE3A 5FDFA 5A7HA 2HA6A 1EDBA 4A23A 4Y2SA 2WFLB 1ODTC 3CXUA 3Q0TA 4BVJA 5IKXA 3BWXA 2PSHA 3BIWA 3WIBA 4F0JA 2QM0A 4FWBA 3WKCA 1UK7A 2XE4A 5AJHA 5K3FA 4DSZA 1VZ2A 2HHAA 2V98A 4PSUA 3M3DA 1GPLA 5D7BA 4Q3KA 3OPMA 1F8UA 2YXPX 5K3FB 3X3HA 4BZZA 3OTQA 2Y6VA 1JMYA 2JF0A 4Y2TA 1HPLA 3LS2A 3HEAA 3IUJA 1VKHA 1F0PA 2XQKA 4AB1A 1X70A 3TGLA 2G5TA 3WLAA 3TJMA 4K6GA 4BYMA 1SCIA 1YASA 2OGSA 4BCDA 5EHNA 3B12A 1DX4A 4ZXFA 1W52X 2IX9A 1ZJ5A 1XZAA 3ZV7A 2RAUA 3R3UA 3CN9A 4HZGA 4QEKA 3W9UA 5AKGA 2PPLA 1DQZA 4MWSA 4YX9A 5FKJA 2PSDA 4A5SA 1DX6A 1ZI6A 2H9YA 5ALMA 1FSSA 4E46A 5K3BA 4K6HA 3IUQA 4C4ZA 3T52A 5JZBA 1U8EA 5E2IA 3W9BA 1U4NA 1CUFA 4Y9SA 3ZLUA 1X2BA 4HXFB 3CCCA 4H35A 5K5EA 5FLKA 4AO6A 2GYWA 4NZZA 4OU4A 5AM5A 3G0BA 5FV4A 4Y2UA 3DKKA 5AM0A 1JT2A 3R3VA 2QJWA 4UUQA 4C01A 3BF8A 3HLKA 5ALLA 2ACKA 1MJ5A 1AMNA 2ROQA 5ALVA 1EVQA 1KU0A 1R50A 2GBCA 2WILA 4PQEA 1IVYA 3B5EA 2GBFA 4OCZA 3F98A 2O2HA 4U2BA 2GYVA 1VA4A 4DMKA 2OQVA 2WLSA 3H1AA 2OXEA 3G0IA 5ALTA 1AKNA 1N8SA 2JGLA 4UBLA 5FOQA 1F0NA 4ZGBA 4E11A 1CUGA 3ESBA 5AKHA 3PFCA 3BJMA 4W63A 1QJ4A 3UUEA 2HDWA 4MXDA 1UFOA 4CFSA 3GA7A 2WUEA 1CVLA 1X2EA 2ECFA 5IVDA 4CI9A 2HRQA 5AI0A 1E8NA 2H7YA 1LLFA 3WI7A 4UHEA 4Y2RA 3H04A 3I6YA 3H17A 5AIAA 5EIHA 5D3KA 3ANTA 5DLPA 1J07A 4DNPA 2DQZA 3G9TA 5AH0A 1GQSA 2WM2A 3DL7A 1R9NA 3STWA 5DTJA 3ZI7A 4K2AA 1ZD2P 2O2GA 4H77A 2XMQA 3U0VA 3NWOA 2H7XA 4W1PA 3VJMA 2OQIA 1YS2X 2JEZA 3HRHA 2Y2VA 4TPKA 3WKDA 4X6XA 2AJBA 3I2FA 4IHAA 3D0KA 4GWLA 5AKKA 3O9MA 1QFSA 1F6WA 1LBSA 3AZPA 5IVIA 4UBNA 4XWGA 1XZMA 3A70A 5LZ5A 4HXGA 5T4BA 3GBSA 4AX4A 4KE8A 3I2GA 5CH8A 4X71A 4G1FA 1P0PA 2XI4A 4PW0A 1ZJ4A 2JGKA 1K4YA 3DYIA 4E14A 1XRQA 3V1KA 1CV2A 3S8YA 1YS1X 3FLAA 2XMGA 3OURA 4JYPA 3QM1A 4YPVA 4O08A 1PJAA 1L7AA 1U2EA 1USWA 1QO7A 1XLUA 5AOAA 3DOIA 2ORYA 1QIIA 3QPAA 1WB4A 2C5GA 5ALDA 2V97A 4W1RA 1RP1A 4WFKA 4XX1A 4KJXA 4ZWNA 2DCMA 4UHHA 3H2HA 3IULA 1LNSA 3HACA 1YSCA 4JEIA 1LZLA 1UK6A 1WPRA 5JZ9A 2WIFA 1J2EA 3ZLVA 3ILSA 2QR5A 3F67A 4HRXA 4B9EA 4X6YA 4J3JA 2JGEA 1JJFA 1MTZA 2B4KA 2CB9A 4FLEA 4QWWA 4G8DA 3BF7A 2I3ZA 4B9AA 3TEJA 5ALKA 5CW2A 3C87A 4L72A 1XZIA 4X7BA 3FSGA 4W9RA 1CUXA 1EB9A 2UZ0A 2VF2A 1C4XA 2RONA 1BN7A 4X94A 2RHWA 2OGTA 3HI4A 5ISMA 2O7RA 4G4JA 5DYWA 2HM7A 2ZJ7A 5JANA 4B81A 1MN6A 4GECA 4B83A 1MX1A 4WY5A 5JAHA 1QIJA 3HC7A 4Y2JA 4H0CA 5SYMA 4JUIA 1E66A 5AKXA 2EDAA 4I4CA 2O2IA 2QUBA 3BDIA 3VJLA 3T4UA 2HA7A 5BWCA 3WA6A 1MT3A 1D07A 4H7KA 1IZ7A 1K63A 1Y7HA 2WJ4A 3R3XA 5AKEA 1ZGCA 5SYNA 3E3AA 3R3YA 4UBKA 2EDCA 1EVEA 5JIBA 2ES4A 1SOMA 1GKKA 1FFDA 3AJAA 4X93A 1FFBA 5AIBA 2G63A 2BJHA 4EY6A 4PSDA 3H1BA 4WJLA 2DHEA 5AM2A 1HKHA 4IH4A 3OG9A 4UBOA 1ETHA 4N8DA 4GHWA 1LGYA 3WWCA 3STUA 4N5IX 4TVKA 4ARAA 4BC0A 4C88A 5AKYA 4BP8A 3F96A 2JGIA 4F21A 5CXXA 3C6XA 4OPMA 1WB6A 4CG3A 1QGED 5LKAA 2HFJA 4MEBA 4CIBA 4Y2QA 4B7ZA 4EY4A 4P08A 1TKRA 4L0CA 5I8PA 4LXGA 4X90A 2QJRA 1DT5A 4MYDA 4NS4A 3NOXA 1QTRA 3C45A 4I19A 4ZI5A 3D5EA 3O4HA 5FUMA 5AHXA 1CUEA 4B0OA 4ARBA 3DJYA 3D4LA 5AO9A 4NVRA 3WQHA 4GI1A 4U2CA 3VISA 2VAXA 1VA5A 2RI6A 2JGFA 4FNMA 3H2JA 2CUTA 4C89A 3QMMA 5HK9A 2WU3A 3FCYA 4HXEB 1XZJA 5AI5A 3LIIA 4J03A 3V48A 2B20A 1CUJA 4MQMA 4QWMA 3F9CA 5CT4A 1H2YA 3IIIA 3KWFA 4ETWA 1C7JA 2CMFA 3FVTA 3ZWQA 4Y7DA 1R88A 5HZGA 1WB5A 5AM1A 4LYEA 2IITA 4KE9A 4B85A 1W4LA 3DS8A 4C87A 4QDUA 1IUPA 5EIAA 5DYTA 1XZGA 4FBLA 1XZHA 4AMZA 1CLEA 3G0CA 5CURA 1NU8A 3DL4A 5K3CA 1CUSA 1XRNA 2QRUA 4HTAA 2B9VA 2VJAA 3H18A 3VKFA 4XVCA 1W76A 2VJDA 4ZV9A 3G8YA 3R3WA 3WZMA 1YCDA 4JH0A 4Y2YA 4QDZA 5C8ZA 1DQYA 1ZOIA 1RWQA 5EHZA 1HL7A 4C4XA 3V1LA 3YASA 3C8HA 5T4HA 5EIEA 2BFNA 5ALGA 3ANSA 1AGYA 2BUAA 3EIOA 4BRSA 4PSCA 3L1HA 2XQIA 4N8EA 4H7EA 2XUQA 1AZWA 1ZGBA 4Q3OA 4BP9A 3F8SA 2JGJA 4MQLA 4EY5A 4BDSA 4YK7A 3NUZA 4P92A 2QOEA 2PBLA 1ZD5A 4X85A 2D0DA 1UT6A 2W6CX 1CUUA 1NU6A 3RLIA 1ODCA 3WL8A 3LLCA 5K3DA 5BWBA 1XRMA 4FFWA 4MYSA 4CCWA 4N8SA 1UZAA 3A2NA 3DNMA 3IDAA 5JD5A 2DQYA 3FLBA 1ZICA 3D2BA 5ALHA 5ALNA 2GZRA 5AI6A 1THGA 3U1TA 4C6HA 5LZ4A 4BZWA 3PUHA 2HA2A 3DOHA 3WJ1A 1AUOA 1EHYA 3VDXA 2RGUA 3LIPA 1UXOA 3BDVA 4PO3X 2VJBA 4BAGA 5ALSA 4V2IA 4DMHA 4UHDA 2HA0A 2PU7A 2PL5A 2Y1KA 5F4ZA 1QIHA 4H7JA 1CUCA 4ROTA 3VVLA 1NX9A 5C8XA 7YASA 3ESDA 2WIKA 3H2IA 4C4YA 3FNBA 4J0KA 4QLAA 5HQ3A 1EH5A 1CUDA 4DM7A 3EQ8A 4AN0A 4BATA 5CT6A 3WWEA 5HQ3B 3QITA 3EQ9A 3O4IA 2Y2UA 1UOPA 1CUBA 1MNQA 4F5ZA 3E1GA 5ALWA 4DTCA 2HU8A 3A6ZA 5EFZA 4J7AA 1ZD3A 3I2JA 5ALRA 4G9EA 3WWOA 2BCEA 4NMWA 4DNFA 2XUOA 4WFJA 2FJPA 4XIIA 4MWTA 2XUPA 3MGAA 5E4TA 3OOSA 2ZJFA 4OSEA 5AI8A 1CPYA 5DJ5A 4FLFA 1SFRA 2WUGA 5ESRA 3WL7A 1EA5A 3M83A 1ZIYA 2GBIA 3BJRA 1VJ5A 3FLEA 1BN6A 3WMRA 4QZVA 1DU4A 1LZKA 3G7NA 1WOMA 5AKLA 4CG1A 1QIFA 5CT5A 2V9ZA 5ALFA 4G4IA 4OB8A 2PM8A 5FXMA 1G42A 3I1IA 5CT9A 5A7FA 4G4GA 1K6EA 4B0PA 5A6VA 2VJCA 4UBIA 1GZ7A 5JAOA 5JAPA 4J0JA 1A88A 4G8BA 2WHRA 2Z8ZA 5AI4A 3AFIA 2JEYA 3FBWA 1THTA 2ZSIA 3IURA 4UFPA 4X95A 2YH2A 4BE9A 3L1IA 3GZJA 3WK6A 1YA8A 1Y37A 1B6GA 2WG0A 2QXTA 3PF8A 1K8QA 3RARA 2WHPA 4UBJA 2ZSHA 4GXNA 5KBYA 5AP9A 1H23A 2VT7A 3DLTA 3STVA 2WHPB 1QIDA 1LPSA 5BV7A 2XQFA 1XQYA 1N5MA 4P9NA 2OAGA 3O95A 3WK5A 2PUHA 2XQJA 2EEPA 4LKOA 3AINA 4KACA 3B3QA 4X97A 5HCUA 3GFFA 2BUBA 2C0PA 2QZPA 3PE6A 3TRDA 2OCGA 2VA9A 2I78A 2GBGA 4LIPD 4PV7A 2J4CA 2K2QB 1UWCA 3HZOA 3W06A 3PI6A 1HDEA 2OGZA 3BXPA 3D59A 2VAVA 3HJUA 2RHTA 1JKMA 3IVMA 4FMPA 4J0IA 4FDMA 2GYUA 1MX9A 1XZEA 3O4GA 5K3EA 3IBTA 2WHQA 1VLQA 3G02A 3R3ZA 2XMZA 5I7UA 1QLWA 1YAJA 3FYUC 1CEXA 2WQZA 3WL6A 2WKWA 2XUIA 1VOTA 5ALQA 5KWJA 5JYCA 2E3JA 2Z5GA 4KYVA 1DWOA 1UKBA 4FOLA 5AOCA 1XROA 3QYJA 2VATA 1H2XA 1IZ8A 3DD5A 2VT6A 4D9JA 4AZ3A 4DLNA 3DQZA 4X00A 3MVEA 5BOVA 3VVMA 4ZRDA 3C8DA 2XT0A 1LPNA 3QMWA 1ZIXA 2PSEA 1G66A 1VE6A 1CUVA 4BAZA 2OG1A 2B61A 1QIMA 5HK8A 3IUNA 4LHEA 4QDOA 3LCRA 2FJ0A 4W1QA 5JASA 3C5WP 2G4LA 4EB0A 1EI9A 1DWQA 2X76A 1G5FA 1ZD4A 3V1MA 4UFOA 3KDAA 5AI9A 1DINA 1TCAA 2LIPA 4BTLA 4UFNA 5D6OA 3KOOA 1GPKA 5YASA 4ZREA 1DTEA 3QMVA 5IH7A 2VQ6A 4AQDA 4J0GA 2VEOA 4U2EA 5CRIA 3AILA 2XB6A 2XUHA 1MPXA 4LXHA 2AJDA 1AQLA 4OYYA 1IUOA 1YA4A 1BU8A 5HKBA 3DCNA 4RGYA 4CG2A 3WA7A 3L1JA 5J3JA 1R4ZA 4PF1A 5CH5A 4K6KA 2PSFA 5H3HA 2CBGA 3OC0A 2Z8XA 3HXKA 1H2WA 2PUJA 2J3QA 5D3ZA 5AKZA 5AM3A 2XUFA 3I2IA 5JD4A 3PUIA 3AUKA 5I9IA 1CIJA 5ALYA 4H7DA 1XZCA 4INZA 4X3CA 4I3FA 5DYYA 1H22A 3PF9A 2H7CA 5AICA 2ZYIA 2WJ6A 1HBJA 2QTBA 4GLBA 2WUDA 3MUOA 5HFNA 3C43A 4AN1A 2OCIA 4CCYA 4X6UA 4B80A 3JYHA 4J0HA 2CEKA 2YYSA 4M0MA 2ZYSA 4OYLA 3EQ7A 4CCYB 4H7FA 1P0IA 3RK4A 3S2ZA 1TK3A 3G0GA 4U2FA 2ONCA 4FBMA 3DDUA 4HS9A 5JZSA 2FUKA 1TCBA 2C5FA 1EDEA 3FVRA 1CRLA 4U2DA 3CN7A 2WFZA 4AZ0A 4QDTA 1IUNA 1BEEA 5C8VA 2ZYHA 5JAUA 2WUFA 1XKTA 1GKLA 3ZLTA 1I6WA 1J06A 4B6GA 5FPPA 3HSSA 2PSJA 3QH4A 3WKEA 5LKRA 4N5HX 3H2GA 4BAUA 1QE3A 2CKMA 4UHCA 2QVBA 4EY7A 5A71A 2XMCA 2ZYRA 4ZV7A 4OUKX 1EX9A 1CUIA 1WHSA 4TGLA 2ZJ6A 4YASA 3A2LA 4IO0A 4DNQA 3WKBA 1PV1A 1QFMA 4BTVA 4FKBA 4M0FA 1ISPA 1A8SA 4X92A 4RE5A 1XZLA 2QMQA 4RNCA 2W22A 3I2KA 3PICA 5K3AA 3E0XA 4K5QA 5JD6A 4G8CA 2GZSA 3E4DA 5AKIA 2WFMA 5A7GA 4BB0A 5JATA 2XUDA 1TCCA 2C7BA 3STXA 1AX9A 3C70A 3O0DA 4WCVA 5HKAA 5HFAA 2HRRA 4EBBA 5FPQA 4KE7A 1XFDA 1CFJA 1YB6A 1JJBA 3PFBA 5KREA 4EUSA 1WPXA 1UOQA 1N5RA 4KRYA 2HIHA 1EXWA 4Q34A 1T4MA 1QOZA 2WIDA 4EZIA 4A16A 4WY8A 1JJIA 4AMYA 4GDMA 3D3NA 5AK4A 3ICVA 4AXBA 1YAHA 3SK0A 5EI5A 5E4YA 1UKCA 1E8DA 5LYYA 1TRHA 1LPOA 4HAIA 1TAHA 1VE7A 3D7RA 2FX5A 5E4JA 1CUZA 4Q3LA 5AK6A 1HLGA 4UPDA 4BCCA 1Q0RA 5ALZA 5HF6A 2WIGA 6YASA 3ED1A 3WIOA 2QKYA 5CTAA 5JARA 4DMFA 1M33A 3AIKA 4WDQA 1CUYA 2XUGA 3H19A 3SWWA 2IIVA 1ORVA 1RYYA 5IVKA 3IUMA 1FFAA 2CZQA 1GXSA 1ODSA 2OAEA 3JWEA 1R3DA 3AIMA 4EA6A 1DT3A 5EHXA 3G9ZA 5CH3A 3SC2A 3D2CA 5HF9A 2HL6A 2DSNA 5FP0A 3VXKA 1PFQA 3I2HA 3RM3A 4Z49A 2Y6UA 2QT9A 1BROA 3VJKA 3HABA 3C6YA 1IMJA 1QTIA 1L7RA 1XQWA 1VZ3A 3KWJA 1ORWA 3WZLA 1AURA 5ALUA 1Q84A 3GELA 1YB7A 2CJPA
chains in the Genus database with same CATH superfamily
1ZLXA 2VSQA 1LC3A 3BSWA 3SOZA 3R9WA 2DPMA 1J21A 5LZ9A 5KOYA 3G2IA 1S02A 1PG2A 1T4BA 2Y8EA 5DNUA 1H85A 3S29A 1IBRA 4UEJA 1KJQA 1DWPA 4YQYA 3TDMA 4LF4B 5DE3A 2Z83A 4OXQA 3FSEA 2JAOA 4IUCS 1Y3IA 3A4VA 4F3KA 3EF1A 5JU6A 4ZTZB 1FTSA 2OHFA 2FSHA 1DB3A 3NM4A 3DZCA 4YCJA 1WP4A 3AHCA 4URUR 1FP4A 1JHAA 3G1UA 1O89A 3QVVA 4X24A 5D5QA 3WFJA 1FX0A 3WGHA 4CLOA 4UAJA 4C2UA 5BNTA 3HYCA 1AU9A 1OREA 1P1CA 2Q6TA 3MB5A 3JW8A 4HL6A 4PX5A 4E1AA 1JI0A 4BO4A 2Z57A 1Z25A 1VKJA 2I7CA 3H1TA 4KXWA 3NHJA 1U1EA 3AOEC 1VBFA 4QGSA 4CKYA 2QRPA 3DTVA 1NDQA 1UOOA 4GOMD 3TQHA 5K0CA 2AXPA 1J49A 3ND5A 2EGUA 4ACBA 2GZMA 3PIDA 1WPQA 3IKVA 4EHKA 3BA6A 2YIVX 3DH0A 1PYDA 3AZQA 3DTNA 3K0AB 3VOBA 5JQGB 3LWZA 1O96B 3H1GA 4MJXA 2H85A 5LA6A 1JMVA 3MWGA 1AY0A 4ER5A 3COJA 4P5DA 1EFLA 4OMUA 1JXOA 5EXEA 4UE6A 3QBJA 2YCBA 4KR7A 2YUIA 3L0CA 2BFWA 4XD7D 2VTVA 3HCWA 2HR1A 4Q82A 4INOA 4Y98A 1IPEA 2XT6A 4UXHA 1AV7A 2GJSA 3PHJA 3C6ZA 2ISQA 5GOZA 2C1EA 3VNSA 4TZ6A 5DXFA 4TLCA 4MB2A 1BQEA 3BAZA 1NJ2A 2VAMA 4C03A 1JPJA 3W5IA 1OROA 1MC1A 2PZBA 4KTTE 3LYUA 1CJTC 2OORA 1PNTA 5LIPA 4FWIB 3AERA 1W0KD 2Z98A 1YONA 4LSGA 4B34A 4DJFC 2WSLA 3A1EA 1YK1A 4FHZA 4XYMA 3OCYA 4MYCA 1DPGA 4Q4DA 2M9MA 4UUAA 4XLLA 1MB4A 1W36B 1MXHA 3OZEA 3HJGA 4HQ6A 3CLRC 5B12A 3GJYA 3OQIA 3SE0A 1WX1A 4FQ5A 2JK0A 2NOAA 2HMAA 3KV3O 3PDJA 4OHZA 3FI0A 4CTNA 2J4FA 1XLWA 1UBLS 2HLPA 3N70A 1QF9A 2ZIZA 4I1PA 5K4GA 4IJWA 4LPKA 2C31A 2D5IA 2B78A 4QRHA 1X86B 3DFIA 3PEEA 1L5LA 1T5BA 1GNVA 2FRXA 4S2EA 1R8QA 4DAEA 3RK1A 3V2GA 2BDTA 2C4HA 3ZK7A 1P0QA 2XT9A 2IX3A 1PFYA 4FX5A 1U0BB 1JTFA 3K4QA 3C7CB 4BJ6A 3C14C 1XJ5A 2Q28A 3HKCA 1USVA 3PGJA 4LSZA 3REQB 3LBHA 1ZMTA 1D2HA 3H4MA 4COOA 4PXSA 2WJ3A 3PQ4A 4QGAA 2F8SA 3IPRA 1FFXA 4GMHA 1T3ZA 3K73O 2QY9A 4TRNA 1KEPA 1E4VA 3ROFA 1K5PA 2DR2A 1JNYA 1RXCA 1LI4A 1ELOA 4FOOA 1QM5A 2SICE 4IOLA 3NM6B 3C1UA 4TN5A 5EFOA 4CL8A 4HDNB 3WLRA 5AJVB 4L8FA 3QPCA 2HADA 3MQ4A 4B4OA 4BX0A 4C7MA 2W2KB 4M55A 3CSDA 5DLDA 1E3QA 3BIFA 1JEEA 3FSJX 4OB6A 4ZT5A 2MR6A 2PX4A 4CM3A 5FRDA 5BQPA 2X86A 3KYDB 2QTMA 3HJTA 4LQCA 4ND1A 1B14A 1CTQA 2GK3A 1GNPA 2VXBA 4A0HA 3NBZC 4ZIRA 5I7WA 2PQ0A 3EXHB 3GLGE 4BS9A 1I24A 2R8BA 2LRHA 4JSTA 3LXMA 5EE3A 4MWDA 3IOYA 3C1TA 3FHCB 1S2OA 4LY0A 1DG3A 3IXQA 1YBHA 4FZ5A 4Y9TA 4PO9A 2WJWA 1Z4IA 1T5OA 2NADA 4L8YA 4Q9IA 1DPFA 5E6RA 5LBUA 1G4HA 2OFFA 4BN0A 2ACEA 2OWEA 2C9CA 4F46A 3GROA 2VK8A 3EPLA 3OZGA 1CUAA 4CIDA 1IDN1 3KXPA 5DASA 2ODNA 1KYWA 1NIPA 2II6A 1FMTA 3CLKA 3VAAA 4GDFA 2XLCA 4ZQGA 1BMQA 4QOSA 2C57A 4BX3A 5HJ5A 3O8QB 1NAIA 3DDNA 4YDSA 2D7CA 3E18A 2EGHA 3LKBA 3GFSA 3JALB 3MINB 4KNVA 4NG4A 4MEAA 3ZWKA 2XYGA 1YRBA 4FGJA 5BXQC 2AVDA 4LN1A 4YAIA 4HDSA 3W5SA 4ZJUA 1B3BA 3TW6A 5SZKB 3C0KA 4BRZA 4YCAA 1QV6A 3VTFA 1NI3A 3BL8A 4HQRA 1MIOB 3B1KA 1KMNA 1P73A 3GEGA 4YLYA 4HWOA 2F43B 3JX9A 2B98A 1XTQA 2FYTA 2UYGA 2PMBA 3ESAA 4HNSA 4L0DA 3TPCA 2QU8A 5KTTA 1HA3A 5BT9A 5LPNA 3P2KA 4UBMA 4E21A 4TVBA 3JARA 3I0ZA 2GHRA 3QXCA 1JG2A 4KEAA 3ROPA 2VP9A 4IGKA 3RRJA 1Q1EA 3HR4A 2SCUB 4PCUA 4RQUA 2OBYA 3C6KA 3DSRA 2X1VA 1D0VA 4O4JB 2NO1A 3B36A 3F5MA 5TMEA 2BGRA 2LVBA 5GJCA 5IZCC 3PC2A 1Q5PA 3CONA 1VMEA 4AJLA 4HH3C 5DT9A 4OD0A 3DEZA 5H80A 4FSHA 1M74A 2VQDA 3LDUA 4MS1A 3RAGA 3WFIA 5KMGB 3HO1A 1SCUA 2IHYA 1PR2A 1XMVA 1EAMA 2VYVD 4R6WA 4YRRA 4KVZA 2G8NA 2J3MA 4C21A 1EVYA 2EFJA 5EGNA 4R1TA 5HSGA 4HDMA 3CE6A 5EIWA 3DBLA 1FFEA 4ZVOA 5FORA 3PUYA 4N3NA 4IS2A 2I22A 3C6MA 2HTEA 2GPNA 1RXEA 1K6MA 1TGYA 4OSPA 4MI3A 4ZO7A 3AV3A 3BXOA 4JMLA 1YHYA 1H3NA 1N9KA 3SEAA 4YQEA 2KBEA 4XGIA 3WMGA 4BFCA 5BWNA 2BBOA 2IYRA 1KQGA 2XODA 3Q3VA 2HT1A 3NV7A 2YBEA 5KVVA 4FMCF 4KAAA 4PTLA 1O6CA 2GCEA 3TB4A 2BSQA 2VPWA 5K01A 1A8UA 3MRXA 4JT4A 3CLTD 2QVXX 2YZMA 1RCTE 2RHLA 4N3BA 2C07A 3NKLA 4HDKA 2RH4A 3R9XB 4Q6WA 2X1MA 1YZYA 4AY5A 4MW6A 2V9PA 1X1DA 4HEJA 1HL3A 1JDUA 1SOUA 5H81A 2O7VA 5IAKA 2BFPA 2YR0A 4LKRA 2GN2A 1ANKA 1ULHA 2W0MA 1A5ZA 4RZIA 2XWPA 2AFRA 2FZLA 2VJQA 4RFSA 4KBYA 1ZN9A 2WU4A 5CVJA 4RSHA 4R7GA 1W35A 2V6GA 2R6DA 1S5PA 4M46A 2O3RA 1K86A 4UAVA 4R51A 1YJCA 4JC4A 4IQ4A 4I9HA 5LLSA 4DDWA 3W7AA 2VP4A 1S8AA 5C51B 4I8DA 3TKLA 3AESA 3T3EA 2YZ2A 3EVTA 5H4HA 1OLSB 3VR5A 1X9HA 4EATA 1CETA 2FPPA 1KMIY 3B1JA 5JRDS 1UJ6A 4H1TA 4L85A 5AVXA 1EXNA 4K9QA 1UXJA 2XDQA 5JAQA 2O4CA 1Z5GA 1ZN7A 3K5PA 3R5KA 3L49A 4MGHA 4MVXA 4RXMA 1YS4A 3MQFA 1N8TA 3ZNOA 3WGZA 5AVYA 5TB5A 5CXUA 1TVCA 1IATA 1ZRNA 1NR5A 1KVTA 4IDPA 1ZCJA 3NWBA 3MOSA 4P7GA 4B17A 3ZY4A 2ILTA 1R18A 3EOBI 4OMFG 2I6FA 3QKUA 3G9UA 4IDEA 3WNDA 5JECA 1X8JA 3FMOB 1VI5A 1TXGA 2MSLA 3P1JA 5DZSA 4HJRA 3Q11A 3THYB 1NVEA 3V9AA 1U0EA 3SHQA 4X1IB 3NGMA 3U7QA 5A02A 1T9GR 1OYVA 2CWWA 1ORDA 2Y93A 3AM5A 3AZOA 4MVJP 4O0LA 3UMCA 3MF4A 5H59A 1XPRA 3CEPB 1LPAB 1GLVA 4MS4A 4F91B 3BMNB 2PVCA 3FYTA 3WFZA 1MAHA 2YVQA 4ND6A 1U1CA 4F84A 3PTAA 3AUFA 2MOKA 1I2MA 5DP2A 1CY1A 1C30B 3O9ZA 3PLRA 3RUEA 3HK2A 3LGSA 3Q0IA 3TEMA 3PHHA 4JNCA 4TM8A 4P7BA 3FD8A 1BS2A 2IZ5A 1LWOA 1I01A 3OCWA 1VGVA 4PPGA 3KQVA 3UK2A 3VR1A 3WQQA 3N5CA 1DRWA 1XTJA 2G0NA 3DEAA 3QQPA 2ZUDA 1M6YA 1S2GA 5A0FA 1FXUA 1P3Y1 3L43A 1EUZA 4M0KA 4E5SA 1G3RA 3F4LA 1ZPDA 1R10A 2WRZA 4DSAA 2P6PA 2ODTX 1I8TA 4IH9A 3UHFA 3LX6A 1KP2A 2I2XB 1JE0A 2O05A 1R1DA 1MIHA 4WXEA 4RTJA 2BJVA 3CLSC 4HZUA 4L9AA 1EP2B 1C7IA 1UBSB 1T3SA 4M1QA 1TMOA 3R76A 3ADKA 4FYHA 1A7UA 1C81A 4I0WB 3UXEA 4R71A 4G26A 7GPBA 2MJLA 2BSXA 4H27A 4Z4GA 3NJRA 4E5UA 5J2UB 1FZQA 3CGGA 2JA2A 3HDGA 3TZCA 3U3KA 3MS7A 3TW4A 3WBFA 2C5LA 2BDEA 4CMEC 1H94A 5KNDH 4HYYA 4S0ZA 1BE0A 3MJ4A 1JSXA 1PX2A 2PFSA 1E2IA 1ECLA 1M0SA 3UAZA 4MP8A 2C8LA 3VPDA 3AL0C 3KQMA 3BM5A 3UPDA 4CM8A 3CZQA 3Q2OA 3FRHA 4I5EA 1G21E 1ZI8A 2C5SA 4L95C 5TQ0B 3BZBA 5GIOE 1FQJA 4Y0VA 3K31A 1FEZA 1BC5A 5DCYA 3F78A 3LT0A 3DFMA 2BFCA 4JBHA 3OPNA 4FT4A 2BMJA 1K3UB 4G37A 3W6UA 3WB1A 2WICA 2FFHA 3G9XA 2FMIA 3M9WA 1OZHA 3H4TA 4HQ0A 1WTAA 2PZJA 1YU6A 4URVR 1ZA1A 4R0VA 5IWCA 1J1IA 2AOWA 4Z4FA 1KKUA 2QZZA 5FJIA 1WV1A 3U4CA 1AZTA 2VLBA 1NNLA 2EVWX 4YMLA 1P0MA 1ZUWA 2XMDA 4ENTA 4B82A 2LP4Y 1AIPA 4N12A 4WK6A 5HIMA 4CPDA 1F2DA 1CQZA 3UQYS 2DQ4A 2BLLA 3K2IA 3KKNA 1PI3A 3PQDA 3PWZA 3BFVA 4DLLA 3KCQA 2ZEJA 1LDEA 3HY4A 4JBIA 4YHBA 4YRPA 3VR4H 1JFSA 2PH5A 1S2LA 4Y2VA 3HVKA 4GPBA 3RYHA 4DV6B 4PFJA 2F3QA 4OA8A 1LPPA 3OCVA 4G0MA 4KDRA 4YMIA 5LQSA 4NE2A 1JBKA 1OHHD 1YRWA 3AY7A 4I7EA 4Q6BA 2GB4A 2CLHB 2UYQA 4KXQA 2XY4A 2OXIA 2HD4A 2CL6X 2R84A 4L8VA 2A1IA 4G6ZA 1T2NA 4MZDA 5DXAA 3ZUPA 5A4DA 2YXDA 4J6FA 3QVKA 2ZCUA 4F1WA 1BW9A 5C18A 3FPEA 3FAKA 5IPFA 2X2OA 3PGMA 2CNDA 2I4MA 4H7IA 4AQ7A 2JGMA 4M49A 3IVAA 4DG9A 1J0EA 3CISA 2ZE5A 1WNFA 2ZYWX 3ML1A 3CRW1 1LVHA 3PITA 4QNNA 4LCEA 2FN4A 1L7EA 2CNBA 3AM3A 2ZT6A 3LGAA 5ALIA 5DIFA 3MIZA 1CUHA 1YUMA 3EYAA 3NHFA 3F5QA 4FS3A 3EDQA 4W5NA 3NBUA 5JDIC 1KP9A 2C7PA 3EZGA 2IUUA 5B7PA 4BHTA 3TG8A 1QHIA 2CV2A 2V6JA 5CB4F 1M2WA 2GSWA 2VFAA 3WGGA 3CXRA 2W6JD 1JVSA 4HNVA 4NCKA 1CQIA 4YDRA 2B69A 1UKZA 5AXCA 5B58T 2PXXA 2A5JA 2PJUA 1HLPA 1BXGA 3EVEA 3GGDA 1T5DX 5DWDA 1Y5MA 2PKYX 4WT7A 3IA2A 4GPIB 4L6AA 4ZT4A 3L46A 4LFBB 1CKEA 4JLAA 3KSRA 5HE9A 3WYCA 4WKBA 3E0QA 2AJCA 1ZL2A 1NSFA 1CQPA 1DCFA 1CXZA 3DUWA 4JA0A 2BKAA 4LI3X 4JASB 2QN9A 5I7HA 3OY7A 4FDUA 1U9ZA 4GZLA 3R40A 1RAIA 1U2RA 3DP9A 4MAAA 2QTVB 1T0UA 1W5EA 5G4KB 1VE3A 2I6SA 4OBXA 5EIXA 2Q1UA 3A9UA 1EFKA 4ES6A 4EWLA 3INNA 2C96A 4PZDA 3GQVA 4FR2A 4IW3B 5E38A 5JY6A 3OWOA 2W37A 1E2GA 5AK5A 1KJJA 5K0ZA 5KHOC 3DF7A 1FTYA 1NI5A 3BGWA 2IS6A 2PGLA 3ABIA 1R8YA 3AP1A 3P2MA 4HDRA 4X0EA 4YBRA 1QCCA 1E3SA 4Q9NA 1YCHA 1T1EA 1YRYE 4RJKA 4BKUA 1NXWA 1SGWA 1R8XA 2PA0A 3MG9A 1MNAA 4R69A 4ZJPA 4ZYZA 2VTBA 3FYUB 4R41A 1B8VA 5GJWC 4HB2A 4IIHA 2X8WA 4JWKA 4HGQA 3CUWA 3KQWA 2JLQA 4N6NA 4RHYA 2JLZA 3U5TA 2O8CA 2AC7A 3O2NA 1WSWA 3N8KA 3P9KA 1BKYA 5HP4A 3U7JA 2AXEA 4KLAA 1PJRA 1ND6A 3H2ZA 2ZB7A 3IO5A 3ZZTA 4DUZB 1TUBA 1IULA 3N53A 4G1EB 4DLTA 5EJEA 2BKLA 1ACLA 2Q3DA 1WM1A 5J5VA 5K3FB 1IN1A 5CFZA 3RIMA 1RI3A 1W19A 3IKTA 3AEKB 1TYCA 1Z2EA 1D03A 3NXKA 2HSJA 1LW7A 2DWOA 1OD6A 1ACJA 3FJOA 3NHKA 4O5OA 4GSYA 4XIFA 4EB6B 4KFSA 3B7GA 3D2AA 2GRAA 5LOVA 4RA6B 4QE3A 2CK3A 1G41A 2FMHA 4IMIB 1B8NA 5D00A 5AVJA 1OJ7A 5A7HA 3QE4A 2WNHA 4IHJF 4DL9A 1IZ9A 5K0TA 5C1DA 5A0TA 1XALA 1ODTC 1OU0A 2VDUE 1ZBQA 2Y4OA 3PGVA 3Q0TA 4BTEA 2IP1A 2ZIVB 5IKXA 3OQJA 2DPGA 3BWXA 2PSHA 3KXIA 2X6RA 1DOZA 3SMQA 1A50B 1U2DC 3RRZA 3PEUA 4L57A 2YQZA 1H1LB 3A1FA 3C4QA 4G81A 2C00A 2XE4A 5FWNA 5ERXA 3NDPA 3U4AA 1L5FA 3H5TA 3MRTA 1QVWA 1KDPA 3HMKA 4K03A 2WVGA 2XTNA 5JZMA 5CCDA 2WD9A 2WU0A 3M3DA 3BGVA 3URKA 2BCJQ 1W59A 3OPMA 2AMJA 4QPNA 3TCKA 1ZGGA 3SQDA 3K8QA 2G4CA 2E7ZA 2GPJA 2GS9A 3DR5A 1UMCB 4MV5A 2VYFA 2Y6VA 4PVDA 3SN6A 1HEYA 5KU7A 3VDMA 1XA3A 2JBHA 2VJLA 4G0OA 3D3WA 5FTWA 2JHGA 4Y6SA 3L05A 3LWDA 3TCXB 4BNVA 2CB0A 5IAEA 1Z36A 1W46A 3OPXA 1HPLA 2BELA 3CRRA 4FD2A 1RWBA 1NVTA 2FSVA 2FPUA 2D1QA 3IUJA 1YJQA 1F0PA 3O2SB 4L7QA 3OQNA 4EP1A 1GZHB 2P3LA 4I2NA 2H16A 4EJSA 3HM9A 2FWNA 3LO5A 1E61A 2EJCA 1FTGA 2RB4A 3CW8X 1QFZA 3VUFA 5IT0A 1N5DA 1RHMA 3K0KA 2XB9A 4QPDA 4BBJA 4DC9A 1U98A 2IELA 3WLAA 4PX2A 3ZE0B 3MWFA 4AURA 1VTKA 4YAGA 2W90A 5DVZA 3DC2A 4E1VA 4AIIA 5AVQA 3AWIA 1FDUA 1IB6A 2FU5C 3TVYA 1XA4A 2WJZB 4D7AA 1NUAA 4JOSA 1XJCA 4QPJC 2WAAA 1H4QA 1T9BA 4V0OA 4IDBA 3RO7A 2VPQA 5LQAA 4ND8A 2ZBFA 5TARA 4ENRA 4K81B 5KPJA 2XZLA 2BW0A 4LYJA 9LDBA 4RX1A 3PEVA 1HZJA 1PJ8A 2WHEA 1XP5A 1OKKD 3GLKA 5EHNA 5C4GB 2ALJA 3JQQA 3LPAA 1RFGE 1R0ZA 1EFPB 5K03A 2ZUEA 1L1RA 1SUWA 3JQ8A 2JIZA 4IILA 3RS9A 3TSWA 1E3IA 1XZAA 2RAUA 2RHCA 3HYLA 3C74A 4AS1A 4HGYA 1UBHS 4P98A 2BTOA 3VA7A 1C3OB 3CN9A 3QIAA 3BIJA 3GLIB 3SJUA 1QORA 3HCEA 1IEXA 3WGMA 4BRWA 3BGSA 2G0AA 4GSLA 4ARUA 2W2XA 2PPLA 1G3IA 1DQZA 4HYTA 3CZCA 4DA0A 3GLFB 1IG3A 3NTQA 3H3XA 3RPEA 3NJ8A 5FKJA 4ESEA 1QC5A 1ZI6A 2HXSA 5G0SA 4MZXA 3OU6A 1KE2A 3GR6A 1UM8A 1B6TA 2X7HA 1LBIA 1R9GA 2OYRA 2IDZA 3AWDA 3T7TA 3ULKA 3W9BA 4RTSA 1G38A 3D8UA 3DXYA 4B5LA 1S1MA 2NZVG 2ODWA 1DAIA 1OC4A 4Y9SA 4MGZR 4ZZ0A 2VRBA 3QXJA 1PEKE 3VOAA 2W6ZA 5KWSA 3GA0A 3JVVA 3CCCA 2HSWA 5K5EA 1GTSA 4RH1A 4BNMA 1PWHA 3KSBC 1BJKA 2Q9AA 3H5LA 4M1KA 5IC6A 4ZEWA 1ST2A 3ADCA 5K4AA 3ZZMA 1RWNA 4L51A 1H6BA 3U4GA 3TI7A 3PJRA 1RRGA 3V9PA 5KQGA 4AJIA 1TFUA 2NV6A 5K8VA 2VRWA 4TLLB 4BKOA 3G0BA 4MHOA 4MQ4A 1TZBA 1RAAA 3JRXA 1AGPA 4MUXA 3W5VA 4AKTA 3OTIA 4PLVA 3GLIE 5FV4A 2AC4A 1FQKA 1PSZA 2Z4SA 3IR6A 2BN4A 3DONA 4QTUB 5CNKA 4BNUA 5FWXB 3OA2A 4UU7A 1ISFA 1J5PA 3TUJC 5FBVB 5LD2B 2QL6A 4KZPA 1JT2A 3GLFE 3WRYC 4EA7A 1WQ1R 2QJWA 3CEJA 4IO1A 1Y5LA 4RLSA 4UUQA 4D4HA 5M2QA 3USES 1HMYA 5IJ0B 2G67A 1UT5A 5HRAA 3NORA 3BF8A 4W5JA 5CK4A 3SFTA 4LBWA 4LBVA 4LOIA 5FBHA 3RC9A 2ACKA 1GUBA 4RFVA 4F4JA 4Z1MD 2VP2A 1TT5A 4UNSA 2EF1A 2JASA 4RDCA 3VPSA 5ALVA 2VDKB 1PDOA 2GEBA 2VZ8A 2JKZA 1ZR4A 3SS7X 1NATA 4OK5A 2VDRB 1OA1A 5ENZA 1E9FA 3GEMA 5A1JA 1E3TA 3AEQB 1S7CA 1LF5A 3L77A 4NYMR 3ZOKA 3Q4GA 3JWJA 1H9CA 2ZU0C 3RWOA 4FEYA 3PK0A 1C7ZA 2GBCA 2JFQA 1HYBA 1KRXA 3BPSA 3PNBA 1J2JA 1ZM7A 1W25A 4DPMA 3FKQA 4M9UA 1G20B 1C0LA 3O4VA 3QUCA 1PJCA 3F98A 3K8YA 3MCUA 2O2HA 1H69A 1P9NA 2J67A 4JXJA 3L06A 3MLBA 1PO7A 1ZCFA 3DZIA 5B7GA 3H1AA 1GADO 1C9MA 2ZJ3A 4P3OA 4UQLA 5CD1A 4LAFA 2P9ZA 4HH1A 2JGLA 2YC4C 2GEUA 3E23A 3S2FA 4HQOA 3WVNA 3RIHA 3TJZA 5FOQA 3RBZA 2AG6A 4E11A 3ADDA 1OVMA 4TRRA 3W7VA 5AKHA 1PR0A 3VHQA 4FFRA 4EA9A 3ORHA 5IUKC 5JE8A 1J22A 3THXA 4FB4A 4U3JB 1V11B 1WR8A 1F20A 2QW0X 1U5BA 1KZ7B 4Z2AA 5IANA 2ANBA 3GCZA 1OTXA 3O4FA 3NDIA 4KHZA 5C8YA 4XD7A 3VMMA 3ZUGA 4LDQA 1U02A 1X1CA 1IZZA 1ZXLA 2HDWA 2P79A 3KZVA 4G0NA 4M98A 3FUCA 3U0BA 4PLGA 2Q3JA 4O0MA 4BO5A 4MXDA 4F9EA 3WLNA 4BP3A 3KVVA 2X22A 1QFXA 2JJYA 4CFSA 4XX0B 5JNSA 2YIMA 4DR6B 4ER7A 2TRSB 4LZLA 4R6XA 2FPIA 3JQ6A 3ZG6A 4H3VA 5L9AA 4BFYA 1OLUB 3KPWA 3E2MA 5IVDA 3GNTA 3WL4A 1OBCA 3JWHA 3K5HA 4QICA 4CI9A 1GU7A 1QRUA 2FEWB 2JBAA 4ESOA 1E64A 3B13B 4P4UA 3U9TA 1VLLA 2UYCA 2BFDA 4EQ6A 4E08A 4IEEA 4F5WA 5JTUA 2ZVJA 3O4RA 3R6WA 1GPAA 3FNEA 1A8HA 3N0WA 2H7YA 3N2YA 1DAFA 3MWYW 4MW7A 5J2TA 2IYYA 1LLFA 2WB2A 3OLZA 1LQTA 4UHEA 4ZRMA 4WLUA 3HH8A 3PRKE 3EGWA 4EM6A 3I6YA 3H0KA 1FMCA 3FF4A 5AIAA 3T7CA 2V7UA 5EIHA 2J85A 2ZUCA 2EXXA 2QLJA 4QVIA 3OF2A 5I3ZA 1X7XA 2J08A 3EIFA 4O59O 3VZQA 4FE4A 2HJ9A 2ZB4A 1AKQA 2NYRA 3ANTA 3DGFC 1I0ZA 3FF1A 2DQZA 3G9TA 5AH0A 1FYFA 4I14A 4US1R 4A82A 1A4XA 2I7TA 3HKDB 4EARA 1LDBA 3AVTA 1B8UA 4IWXA 4R83A 3PE3A 4LVOA 4RHUA 3EIUA 4HPXB 2LW7A 2XEDA 4XIGS 1E2NA 1NM5A 3OZCA 5TDHA 1L5YA 1JB9A 2R8YA 1ZD2P 1KXZA 4TXHA 5G53C 3R7NA 2O2GA 1VKRA 3F0TA 3E3OA 4PZ0A 3WXBA 3PXDA 3E22A 1HXHA 1JSCA 2CJFA 5BNWA 1M2OB 1KO5A 2L82A 2KBFA 3C3KA 3KXKA 4JC0A 1HYEA 1TEZA 3CM0A 3GVCA 1Q44A 4EGFA 2X4IA 5EJ5A 1FF9A 1MG0A 3NWOA 3W6ZA 1SKMA 4QOIA 2B83A 3B8HA 1E9CA 2Q3EA 4OREX 2P67A 4KXMA 2C54A 3D5QA 5ILQA 5HXAA 3KQUA 3ND6A 5MHTA 2CLEB 3FCAA 3QW2A 2PT7A 4RL6A 3W6NA 5LWHA 3ZNQA 1FNMA 4YWJA 1XTZA 4NE9A 5JNTA 5DTEA 4X6XA 5E7JA 1DAGA 3DVSX 1PV2A 1Z5WA 3LMKA 4KFRA 5F9FA 1PTJA 1SKBA 2EYQA 4AY3A 2ZQ5A 5PNTA 2J48A 1F6WA 4BNJA 1FYVA 3OSUA 2H59A 5IJAA 4W5QA 1O0BA 1KL7A 3E9NA 4UBNA 3RTEA 3O91A 1FY2A 3HU2A 4XWKA 1RJWA 4KOAA 1D4OA 4FMBB 3A70A 1DKQA 2QZ9A 1N1EA 2O3UA 2QNRA 2G1KA 3BX1A 1VFNA 2NV2B 2RGXA 1E2LA 3GBSA 3AI1A 4TKUA 1CR0A 4AX4A 4HAZA 4JIGA 5D2CA 4OBBA 4AX8A 2OHHA 4C29A 3TMAA 3H5VA 3EH2A 1N2XA 2CCKA 4S1TA 2I8AA 3FWPA 3WP1B 5CH8A 1NW7A 1EVJA 1X1SA 4GL2A 1KQOA 2BWJA 4E0BA 2QROA 3FZQA 4DTIA 1Q0PA 1H65A 3ABSB 1I0LA 3U62A 2PRIA 1E9BA 3DBOB 1G8MA 3LI2A 2IV7A 3CNOA 3E58A 5FFFA 4B44A 1GHTA 4W5TA 5BVHB 1QX4A 2FJUA 4PW0A 1ZJ4A 2JGKA 3CH4B 1KYYA 3MM4A 3HY3A 3QPWA 4GFDA 4MUKA 1BX3A 2C4TA 4GGPA 4JCCA 1XWWA 3K35A 4MVWA 3V1KA 3UK0A 5B3LA 1G7CA 3R20A 4GWGA 4O2BB 3VX4A 3RUFA 5BR7A 3WLOA 1YS1X 4C1NA 3F1LA 3FLAA 4KJZA 4QUIA 3UJ9A 1O9GA 3GDGA 1CY7A 1FVFA 4JYPA 4MPDA 3RSSA 4WXPA 4ZDIA 1I7SB 1BE1A 3IP8A 4LE2A 5EE1A 3L0SA 2GAIA 4P4NA 5CDTA 1FS5A 4D9GA 4YRZA 5BQ5A 4EW1A 4KMOA 1W0CA 3ZU6A 1ULAA 3INRA 1Q20A 3PQ8A 1DC4A 1PJAA 1Z6PA 3CU5A 4JXKA 3GJ6A 3MIIA 3A32A 1L7AA 1U2EA 2CN1A 1KOLA 4D0SA 1P6XA 4RO0A 5CA0F 5CW1A 5DM4A 5F3DA 4PYQA 2EZUA 2ORYA 4ZPJA 2CXQA 4B3CA 1Z2DA 3LRXA 1WB4A 5ALDA 3FGOA 4QPCA 2F1KA 1YQDA 3TQIA 1DC6A 4LHSA 2V97A 4W1RA 4Q3BA 3VZBA 5FQNA 1U0SY 4WFKA 4EKIA 4KJXA 3IELA 2I5PO 1R4NA 3DBRB 5KHLB 3NIWA 1GGFA 2IKSA 5KYXA 2GJ8A 3C3MA 4HGRA 2CL5A 2Q2NA 1QGOA 2PMCA 5LQCA 4JYAB 3IOBA 3LOQA 4IV0A 4YV0A 2JCGA 3L5OA 4CR8A 2B4TO 2A8YA 4Q00A 1Y48E 2BYTA 1J2EA 2OEPA 3IQHX 2IHTA 2FH5B 3REOA 3ZLVA 5LYJA 3F67A 3K4PA 1HTWA 1NY6A 5HIJA 4DCVA 4POOA 4MB0A 1ND5A 4QBTA 3AHDA 3OUUA 3RS2A 3OT5A 4DABA 2WF7A 3NBFA 1B43A 1RPJA 4YRMA 1D3AA 1UDCA 3VDRA 3OE1A 1MW8X 3U80A 1MTZA 3TM5A 1VKNA 1Z0KA 3Q5EA 2PKQO 1HORA 3ZQKA 1D6NA 1EBBA 4A03A 3FTFA 1PLKA 4PE5B 3CJQA 5H83A 4I55F 1GDDA 4G8DA 4RHXA 5D1HA 3SYKA 3BF7A 1O94D 2OKCA 3QKSB 4JL5A 4YJ3A 5COBA 3TEJA 1HDOA 1BE8A 2SKEA 1RRVA 1UBMS 3BWYA 3T0GA 1K88A 4FX2A 4DRXB 2R6R1 4HNTA 4X7BA 2QT1A 1WBDA 3E1SA 1P5HA 3EUAA 9LDTA 1MKYA 3C3JA 1V8PA 3W2FA 5CX1A 1KPIA 1PN3A 2CUKA 1UQUA 2WZBA 1I9GA 3HDQA 1FUYB 3K94A 2YJTD 1N7GA 1MVNA 3CVUA 1HSZA 2A0FA 5DI9A 4ZCQA 3BZUA 3OC6A 1GRRA 2ZK7A 2QIPA 1JG4A 1CZHA 1KHTA 4WLOA 2RONA 5M29A 1K5GA 4CEJB 4HQKA 4L8LA 3GMSA 1I4TD 3PVSA 3O1HB 2ZAYA 5B3JA 4FDAA 1CX9B 5AVTA 4X1OA 2FRDA 3HWSA 1J0DA 3EPRA 4QXQA 3AXTA 1QCDA 2O7RA 2O5CA 5DWQA 1ZRMA 1L5KA 2QSZA 3VTAA 3TZHA 3H2BA 4M22A 4LFCB 3V2HA 4ALNA 3JQFA 3M4ZA 1Q6ZA 4CQMD 1MN6A 4B83A 2HSDA 5KVSA 4WY5A 1O97D 3A36A 4C4SA 1K5HA 4AVYA 1C1HA 4Y2JA 4CLEA 1DFGA 1OYYA 1TI7A 1YZ3A 1VCHA 2F3PA 2QAGC 1W5SA 3HA5A 3K1YA 1BWRA 1TA4A 3PZRA 4MMYB 3JATA 2QLBA 3G82C 2ZXEA 4RYLA 3SC3A 4B76A 3UAXA 1E66A 4EENA 1WLSA 2EDAA 2HLNA 2PVPA 1PE0A 2QRHA 1GQYA 1KK2A 3NC4A 4TV8F 3SGLA 2G1PA 2H2HA 2AG0A 3HB9A 3KEFA 3K7EA 4LHWA 1GY8A 2C5HA 4RMNA 4OLJA 4LTDA 1A95A 3CTMA 3UWKA 2EGGA 3C48A 4URWR 3WA6A 2DPLA 4G0XA 2JK1A 2IZ7A 1D07A 4QYIB 2HF7A 4YXWD 5BUZA 2ECQA 3TLAA 1BDHA 2PYDA 1IZ7A 4A0RA 2G9VA 3OUZA 4TZKA 5JI3E 2A0XA 2P0EA 5C7IO 2H7VA 3FGNA 3KSUA 1TYZA 5SYNA 1CERA 4G3XA 3IUSA 3CYFA 4KWIA 2PMKA 4B3TB 2ES4A 1SOMA 4X20A 3HJBA 2CD9A 4P0TA 4RIFA 5AUOB 1B4DA 2CSXA 2I29A 2Q3CA 1FFHA 1FFBA 3VTZA 2PLFA 1GN9A 2IL1A 1Z29A 3D6JA 1NMSA 2BJHA 3GP5A 1EGHA 1Q77A 3V4VB 4LC0A 2H0QA 1Q95A 2NU8B 3WS7A 4FHFA 1XMJA 2YJ4A 1B74A 2ZI3A 4D3XA 2PRSA 3GN1A 2COEA 4UJ3A 1KI1A 1M2VA 4H3SA 4BV2A 4IH4A 3A7EA 2FR0A 1F48A 4IWYA 1E63A 3SX0A 3W5BA 4UBOA 4XB1A 4D4LA 3GRCA 3DYBA 1ETHA 4R2XA 2H54A 4UMDA 2FW1A 4NDAA 1MB9A 3L7AA 1N57A 2B6HA 4TVKA 4IDOA 5DLEA 4ARAA 5K8CA 2ZI5A 4H6PA 1G16A 4C88A 4IQFA 3N05A 2C98A 4EX6A 3H9EO 1ZR2A 1M9NA 1XAGA 2QX9A 4F21A 1I2DA 1WMBA 1OZGA 4OPMA 4CTJA 5FNVB 3RRMA 10MHA 2BOVA 3D4PA 3I58A 4CG3A 4CM4B 2IU3A 1WOYA 4ER3A 1XNRB 4AWXA 2GZ1A 4KTVE 4MYTA 5TT1A 1W48A 5G02A 2PQ6A 3G5UA 1TKRA 4IDQA 4NOLA 5JDCC 4LK3A 5GTDA 1N92A 1HR0B 5I8PA 4LXGA 1PHRA 4X90A 3ET4A 1DBSA 1OPRA 3EZ2A 3GFGA 5B36A 5CDYA 4OI0A 4RTQA 1JQDA 2TMYA 4R98A 4WZBB 1GTZA 4ICIA 3EDYA 5ED4A 4ZZIA 1BHO1 4MUEA 5CDFA 3C45A 2PK3A 3CX8A 4ZI5A 3VBEA 3ZYCA 1XRJA 4OP2A 3L6OO 3N8HA 2IS1A 1K7FB 5K51A 1JQLB 1L5QA 1G2OA 3OQBA 5IM4F 4GYJA 3AVWA 2ACVA 2X4GA 4EHLA 1BG6A 1WIWA 1ZMRA 2IW3A 3AKCA 3TK1A 1GGHA 5LU9A 3K6RA 1V26A 3WISA 4OHMA 1WZIA 3T4XA 1XCMA 4EPWA 3PGLA 5EJ4A 4JP2A 2Z2XA 3KBOA 1B23P 2R96A 1YQQA 3HWRA 2Q2OA 4GI1A 2J1LA 3PNYA 4U2CA 4MWZA 1GTG1 1C3EA 3EOZA 1U1GA 2JGFA 1ZIPA 2AKAB 2JIPA 1GGMA 2PIAA 4FNMA 2YXEA 5LN1A 2DX7A 5G0TA 2YNMC 2CUTA 4OFBA 4OIFA 1NMEA 1W36C 2DT5A 1VYHA 4C89A 5HK9A 3FCYA 4U5QA 3W4KA 5CYGA 1PGPA 2A1TS 2P6OA 4HXEB 3ZWXA 2GEKA 4EH1A 3WHPA 4ZOLA 1KJYA 2AC2A 2EERA 3DLAA 3EFEA 4IGFA 1CUJA 3M6IA 1ZKMA 4NESA 4F9GA 5DI3A 4MQMA 4QWMA 4WZBE 6ADHA 2FEOA 4K9RA 5GM2A 5PGMA 4FB5A 2OD9A 4C6SA 1YU9A 1O95A 2DULA 2JAHA 3FDIA 1CF2O 2WYUA 3M6VA 4L5BA 4LNAA 2VHJA 5HZGA 4IICA 2QUIA 4EF4A 4P33A 1QS0A 5LJLA 1PG5A 1YE5A 4CKCB 1CU1A 2IITA 2P2SA 1GA4A 4GSKA 1PAUA 4LYEA 5EAIA 5IKOA 4C14A 1E0SA 3BRCA 1MZVA 3ZWYA 1YNOA 2L2QA 3CIOA 1UUFA 4NY1A 1WVIA 4REMA 3V42A 2Q4RA 4QDUA 3K0FA 2X8JA 3P52A 1M6HA 1IUPA 3GFRA 5IVPA 2CV1A 4NQZA 1K89A 1K8RA 2TECE 4J6EA 4P7JA 4DDKA 3JAKB 3P32A 3MBOA 4K9SA 4NBRA 5KJCA 3UNXA 4CLHA 2HCJB 2XIQA 4Q1CA 1NFQA 3G0CA 1SU4A 4Y18A 2PS1A 2I2WA 1NU8A 1YRQA 5IJXA 3BWVA 4BLTA 1JV2B 2BZGA 4KGDA 2GXAA 3FCOA 3ZE1B 4HRVA 1VYVA 2ZAOA 3B2NA 4OL9A 5K3CA 2JANA 1J97A 4OQEA 4O3FA 4P34A 4EO7A 4DLBA 2YZ7A 1E7RA 1Y3CE 2ZSJA 2R7KA 4S1OA 5JW6A 1X1QA 4K9LA 3KJQA 4FDTA 4XVCA 1AK1A 1CWUA 3OM1A 3UHPA 2D1SA 3EXHC 4FP9A 4MRSA 6Q21A 2AG5A 3HVHA 2PQ2A 5HKKA 1GG8A 5CM8B 2Z1NA 1FMLA 3CNBA 1QH1A 2MT9A 3HJCA 4D26A 1P1BA 4UQOA 4Z7QB 5FR1A 4QXRA 3WZMA 4EKGA 5B1EA 3WDMA 1M2EA 4QDZA 4NZNA 3P9ZA 3DTYA 3TTVA 4U6SA 4KQ1A 3AFNA 1H6AA 2YWBA 4WH0A 3CINA 3E9ZA 2JLAA 1GV0A 1SCAA 2ODQA 4L27A 3FBGA 2CVPA 3DUFA 5FI3A 2FG7C 1ZWLA 1FB5A 1NJFA 3TQSA 1A72A 1K9VF 1TAUA 1W1UA 2JVJA 2PO5A 3HU5A 3PFWO 3WBKA 3BMOA 1G3MA 1G8PA 2C8JA 5ICEA 3KB2A 5K6AC 4D57A 4RK1A 3BXZA 3R2JA 4IOKA 4ZHQB 2D54A 1DBRA 1TF5A 4P31A 1X8LA 4B3SB 4Q47A 2X7JA 3AM1A 5CB0A 1AQUA 1SZCA 2OUKA 4M9SA 2F2TA 4KQ2A 4H7EA 4XSVA 5FYDA 2ECKA 4PM4A 4WADA 2LD4A 3RG8A 4GE3A 3EPPA 4FYWA 3N87A 1T36A 5EIBC 4Q3OA 4DUGD 3D3KA 4BP9A 1M5TA 2D7JA 3RWMB 2VF7A 3KJXA 2B4AA 4MQLA 1XVUA 4UMFA 2JHAA 3GLHA 3GRFA 1L7VC 4KSBA 3SG0A 1MC5A 4Q7EA 4DV0B 4BDSA 1VECA 3LYAA 3COWA 1RDFA 1FNSA 2ZWVA 3NUZA 4E4RA 2A0WA 2Q9CA 4H3HB 4Z4EA 2D6FA 4JR1A 3TUIC 5CAEA 1B2RA 4I9FA 2W6CX 4JB2A 4F3RA 5LQDA 3NWEA 3R7BA 3M3HA 3A3KA 4YFVA 1GQQA 1WLYA 3SIWA 2ATIA 4KW7A 1UANA 3SKYA 5DW3A 1N1GA 2H08A 3MPUA 5BWBA 3H3FA 3LKVA 2UVQA 4NJEA 4NU0A 3M6FA 2ISSD 3F5SA 3CG0A 3PU6A 2JH3A 4AF8A 3Q7RA 4PPFA 2YKGA 5EHGA 1HQCA 3I72A 1TADA 2PZFA 1UZAA 3NYIA 4BLSA 5FPKA 3NBKA 2P2NA 5J1TB 4CIYA 5T3YA 3IDAA 1RTKA 4MVJM 4XCXA 4DT1B 1NVWQ 5A1TA 1XJWA 2I7XA 3A6LA 2AZDA 1E7MA 1PUXA 5CLQA 4AKHA 1DG9A 1ZICA 2IDKA 1P7CA 1NN0A 2X13A 3L0DA 3ZV5A 3GGSA 5KKNB 1FDVA 1N3BA 5CFOA 4BGDA 2VZ9A 1VQ1A 3U1TA 1CD5A 3KLMX 5FEUA 3ZS8A 2A5YB 1C2TA 4JAVC 3N8IA 2QN1A 3T12A 1DC3A 4Q4LA 5DSTA 1M83A 5IKMA 2BZ1A 5LZ4A 1Q1GA 3DOHA 2QQGA 3HCOA 4OP1A 3IJEB 1Q57A 5GGXA 1WDMA 4XGQA 4U9HS 1C3XA 3EGXA 5EKDA 3JQ7A 3UWOA 3UXYA 4M8NE 5C2JB 1RXWA 1COWD 1EWTA 1ZK4A 4OUDA 4YJKA 3V8RA 6ABPA 1OKKA 2I3AA 3MBIA 4K8RB 4KQ9A 5K7SA 4V2IA 3DLBA 3CF0A 4JR2A 4UNPA 4UHDA 5BSWA 2PU7A 2R6FA 3TNJA 1ZD1A 1EFHA 4DOMA 1QIHA 1NVAA 1YB5A 3RB8A 4P4LA 5FULA 4GM4A 1NX9A 3M4YA 3WMWA 2YV2A 3MCWA 3KTAB 5JNUA 3BE5A 1Z08A 3KG2A 5CBPA 4BLUA 3Q7QA 1M0TA 2WIKA 3CEAA 3UG6A 2FCAA 3L8EA 3T7AA 3V80A 3V4RA 4J0KA 2CEAA 1U8YA 4H1HA 1V37A 3PNKA 3PXEA 4Z9YA 3TSYA 3UZUA 4C5BA 1MGPA 1CT9A 3EQ8A 3BXGA 3KR0A 3ZR4B 4DM7A 1TA0A 1WB9A 4CGZA 1Z7EA 4EG6A 1R64A 2YWDA 1WP9A 2FSIA 1H9AA 2FW9A 4Y6OA 1OFTA 4GXQA 3T7RA 2IEAA 1QV9A 2K5UA 3QITA 3KQKA 2Z08A 4TMTA 5DOZA 5TQVA 1VHDA 2O0JA 4HLNA 1I30A 1JLHA 4BXOA 4MUYA 4YYZA 3K70B 1CUBA 3Q6IA 1KPHA 1DARA 5FO0A 2G0TA 5SZHB 1XR3A 3V97A 4RWZA 5ALWA 4DTCA 2NNWB 1V96A 2X5NA 1N0VC 3A6ZA 1YZQA 3GOHA 5EFZA 1TQ8A 2HN9A 1P5FA 4KO3S 3CTPA 4D80A 2HCBA 3FRJA 2A88A 1ESNA 1PJTA 2D06A 3I2JA 3G5TA 3Q88A 4BWGA 3HRKA 3CFYA 5I7VA 5ALRA 1QG0A 2FW8A 3MPOA 2F62A 4G9EA 4NKRA 4IV8A 4O4LB 5JO0A 2J5XA 1FRZA 2R1VB 2WWHA 4BEVA 2BCEA 3EFOB 3MAJA 1MABB 3DV2A 3QMPA 5E1OA 5A4MS 3VPAA 1VMDA 5SY6A 5TIIA 3S81A 4J9VA 4AP9A 2XUOA 2NP7A 2NVOA 5L7YA 2C3YA 1MOZA 2IY7A 4KI0A 4WFJA 3HXQA 3GQBB 4R7TA 1B76A 1SQ0A 5TS3A 2OQ2A 3KVNA 2ZIXA 1XZPA 3ECAA 5FTLA 3NBXX 2Q6KA 3GAMA 4DXHA 1KDZA 2XUPA 3MGAA 3J81A 4ZVQA 3NBMA 1ODFA 2ZJFA 4OSEA 2F1HA 4FYYA 3CH5A 1XU9A 2UZIR 3TTSA 1JFLA 3EUEA 1E6MA 1L5MA 2WUGA 2P3QA 3L7DA 4FXPA 1CRQA 4M38A 1EA5A 4PONA 3WL7A 1NG1A 1ZIYA 1KVQA 3QLUC 4M6WA 4R8LA 1TTTA 1VJ5A 3AETA 3NVAA 3D0QA 3GEDA 3RVMA 3GMTA 3IB6A 4ZVUA 4C20A 1GUFA 1DU4A 4JT2A 4MCIA 1KAHA 4QZVA 2DETA 5CT5A 2H1HA 3WLKX 2QV0A 2Z0MA 3GLGA 4B6FA 2FWRA 3ZDCA 4OB8A 4PYIA 4OMDA 2OXFA 2P40A 1GSIA 5JMTA 3L1VA 4JOBA 4LCBA 3FUWA 4YUXA 1TQDA 1XD2A 5A7FA 1PT9A 4HPWA 4W5WA 3IH5A 3F71A 1JS1X 4EQZA 4EUFA 3D3EA 5IRCD 2CL0X 1VYUA 5H4GA 2EFHB 3HJRA 1XTKA 2NO7A 2QL9A 4ZOBA 4PWYA 2I2FA 3U3DA 3KETA 2CGEA 4TV9B 2VJCA 2P77A 1GZ7A 1I5EA 1Z4MA 1SHKA 1K6IA 1U28A 4IVQA 1V8ZA 4II7A 1A9PA 4S2UA 4PC7A 4J0JA 5JAPA 5B58C 5JAOA 1QFYA 4G8BA 5BW4A 2WHRA 2A5DA 3SE7A 3OCJA 3PT5A 3V32A 4LF8B 1U0JA 4QG7A 3QUQA 1BVRA 1HT1E 4BLPA 5L3QA 5J23A 2A33A 2JEYA 3IURA 3R4CA 4FILA 4ZAZA 3WNVA 3D8SA 3I23A 3PFFA 5JBIA 2C2BA 4WK4B 2XJ4A 5IAJA 2IH5A 5K1ZA 1KJNA 4GXTA 2A7QA 1WG8A 3GFOA 1MQ8B 1FTQA 2IUSA 4FJ0A 2POQX 1CY4A 3UICA 3UAGA 1F8XA 4GL4A 3U49A 2WG0A 1HV8A 2QXTA 4RQTA 1TJPB 1GJRA 4DADA 2Q6OA 2AZXA 3KEMA 1Y4SA 1UMKA 2OHXA 2WHPA 2ZSHA 2CXXA 1XN4A 3E9CA 5JS8A 3HMQA 2PWZA 5FTKA 1G3QA 1DTWB 1E1YA 4L5IA 5CIYA 3K5IA 2FWPA 1ICIA 2DRIA 2I1WA 1T5LA 3OMXA 2CVZA 1KE1A 3KKKA 3A14A 1NP3A 2V03A 2H4WA 2KYRA 2ASVA 1QIDA 1A9OA 1GR1A 2I62A 1OLXB 2TMKA 4KX3A 3TW0A 2FR1A 4EG1A 1XQYA 1VIVA 1SVWA 2OAGA 3D7MA 3CWQA 4F9TA 1IY9A 2NYUA 3SS8A 3WK5A 2PUHA 3KEGA 1QHHB 1PNRA 1AHHA 3FPLA 3QKIA 4PNPA 3OPQA 3OZTA 1TD1A 2QE7D 2GM4A 3BHNA 4IIFA 5F7ZA 4KACA 3QY9A 3UB2A 5BYJA 2IYXA 4U63A 4Q7LA 4BB9A 2C94A 3AO0B 3FIUA 2FPXA 2PKXA 2Q4OA 1NBMA 2OFPA 2P75A 3DWIA 2D4AA 4C76A 3TL6A 4Q4JA 1Z2CA 2IZZA 3PE6A 1YVDA 4KXNA 5BMVF 3TRDA 4HTFB 4YMVA 4IQ8A 3LL4A 1Z6ZA 3GCWA 5HDBB 4BMOB 2YY5A 5DHAA 4X66B 4L5YA 4LIPD 1Z4OA 1CEEA 2K2QB 3ER6A 1U2ZA 4KQ6A 3CVWA 2DEUA 1IH8A 1KAOA 3KQOA 1VRVA 2YX1A 4UW9A 3EXFA 3S3TA 3ADOA 5EXXA 5H02A 1Y4AE 2XDYA 2FOIA 2SECE 4RHCA 4B3MB 2C9OA 3R7WB 3RRNA 5ADHA 4XIJA 4MSUA 1T8RA 1UMDA 1X7YB 4GXRA 8ATCA 2X7XA 3K1AA 1PW5A 2GVZC 3MGGA 5CP8A 1YXMA 3KLBA 3D31A 4RABA 1LSUA 2VTEA 1D2GA 4L50A 1S4MA 3LH5A 2GYUA 5B1HA 3O4GA 4JLVA 1NI4B 3O7MA 4RWEA 4EK9A 5MN6A 2CLKB 4UM7A 1MAWA 1IN8A 4ZEXA 4RZUA 3E1KA 1UAGA 4FBGA 4BWYA 4FNAA 5KYWA 4AWBA 3DPSA 2RHDA 1T9ZA 1KP3A 4L8GA 3RJ5A 5CLHA 4J9UE 1TZJA 3QOXA 5HBGA 2GLXA 1HI9A 3K0EA 4D9EA 3PPWA 1DHRA 1SG0A 2OZEA 3H2YA 3N2NA 4RLFA 3VYSB 3MWJA 3KZKA 4QXPA 4X8MA 3VJRA 4B75A 4DSTA 2CFRA 4GMKA 4IZOA 1N2ZA 1JTEA 1CEXA 1PVDA 1NOIA 2G76A 2PKCA 2WQZA 3E5HA 3FYUC 4IDFA 4IJ5A 4ZT2A 2UZ3A 4G1BA 4HADA 3SVZA 5A4IS 5IYZF 3WIDA 4N5LA 2WJGA 3UB4A 3VYVA 4CIXA 2GT1A 3ZDXB 3OF5A 3RVOA 2RD2A 5JYCA 2BHRA 3EWNA 5B37A 1D4AA 1L4YA 1Q1NA 1TX4B 2J9ZB 3UT6A 4H6XA 4DVGA 1DWOA 1UKBA 1UQRA 1Y8QB 1YUNA 3JVDA 4GP7A 2CNLA 4FR5A 5ANRB 4XASA 5EC8A 5H68A 2Z6AA 2B5OA 1XROA 3HBJA 4Y0NA 1UDWA 4R54A 5TVGA 1H2XA 1UBRS 4WINA 2VT6A 4OXKA 5JRJA 1QHFA 1ZMBA 3RYTC 5LMZA 3ELUA 2PXHA 1B26A 3DKPA 4CMJA 4KMMA 4Q1EA 4N0PA 4DQDA 3VO8A 3WMEA 3PEYA 2BP7A 3QFFA 3WDLA 4Y2HA 2EBWA 5FIUA 4R5HA 1UT8A 4X00A 4B2IA 3S5JA 3B1YA 4TZ0A 3C8DA 3BH6A 3AEUB 4D9NA 4O4IA 1W4RA 2HK7A 2MYTA 2XT0A 4IDDA 1T2UA 1XPJA 2PZKA 4DMLA 1JLMA 2PSEA 5AVOA 1G66A 3S6JA 3GBPA 1CUVA 1JW9B 4BAZA 1HT2E 1AHIA 5AK0A 3NAGA 2ZROA 3T99A 5A04A 3KEQA 1J70A 5LMCA 3ICQB 4BVAA 2B61A 2XIJA 3DEYX 2J33A 2ZREA 2BH2A 1CB7A 2GEDA 4HC4A 3I04M 5HK8A 2ETXA 1UBGA 3B6JA 4OGKA 1PFKA 3KUUA 1VI2A 3D6TB 5B3KA 1G60A 4NXNB 1E2KA 3V3KA 3JQGB 4B3FX 3OZIA 1V16A 2OPBA 2I71A 3AEXA 3LBFA 5EWLA 2FJ0A 1CC1S 3T3IA 1PL0A 2OQRA 2MHCA 4I6JA 3NXSA 3OOEA 3ORRA 4Z0NA 1FLAA 2VUSA 3WY9A 2G4LA 3IBSA 4UARA 2FZVA 3OOYA 4BZPA 2QRGA 2O20A 2X76A 2HK6A 4UTVA 1AXGA 1G5FA 4IJVA 2Y1OA 1FFGA 2GVDC 3UKJA 3V1MA 3DE6X 4OV6B 3A25A 821PA 4MUNA 4B6SA 1JAHA 2IJGX 4LXTA 2UZ1B 2H17A 3FHTA 1I3KA 3HSYA 4LF9B 4Y1RB 1PEYA 3LT5A 4R9SA 4UFNA 4D82A 5YASA 4DDHA 1AQJA 1P1JA 1G21A 3HL4A 4HYEA 1A96A 4RZXA 3ZDAA 2J5BA 3TSOA 3ACBA 3G0OA 5IH7A 3ZKAA 2VQ6A 1Y89A 2F90A 5DNYB 2ZSKA 4UD2A 4LJKA 1M6VB 2WKPA 4AQDA 3JD0A 2XGJA 1O94A 3KB1A 2O8FA 3A1SA 3E05A 4BFLA 4LZJA 1LLCA 1OFGA 1PR9A 2FEMA 3O38A 4FGWA 2XUHA 4NEQA 3SJ7A 4BP1A 3TBKA 1APBA 1PWYE 1IN4A 3A3PA 5IFKA 5FUVA 1SVNA 4KFTA 5LQRA 4YI5A 1S2NA 4NMMA 5JROA 1SZDA 2OO5A 5EP1A 1Z37A 5J1SB 3F73A 2K7FA 4IY1A 2W2QA 1JDVA 1BU8A 2JIMA 3PHLA 3OX1A 4C04A 4EEKA 3ZY6A 1F0YA 4Q3DA 3RASA 8AT1A 3MILA 3LT4A 4XB2A 3MT0A 4UUBA 4QOJA 1EEXB 5FO1A 2EP8A 5JBNA 3L1JA 3WA7A 1WW3A 3C1AA 2Z5VA 5J3JA 3OQVA 5H9VA 3EE6A 5IDXA 5CH5A 1T3TA 4K6KA 4KQWA 1U04A 1GAEO 3IAM6 2ZTMA 4KB5A 5LVAA 1PQPA 5H3HA 2QDXA 3QOFA 1K1EA 4AZVA 1GN8A 3JPWA 3HXKA 2YOFA 3QPVA 2V55B 5CVEA 1L7MA 4YV7A 2DAPA 2E4VA 1VYTA 2EC5A 2E9SA 5AKZA 4CQMA 2UZAA 6PFKA 3DAYA 3O8OA 3NH9A 2XUFA 4PBSA 3SSNA 2XVZA 5FBQB 4I08A 2GK6A 4F11A 1P2DA 4WQMA 4GG1A 3IYLW 5ECWA 4YRNA 5KX5B 4H7DA 5J4KA 1GFIA 2FFJA 2FETA 4INZA 4D9BA 2D0OB 4X3CA 2FPOA 2P2DA 3KZMA 1MH9A 2ZRQA 1C4KA 2QUZA 4XQEA 1I4EB 5DN9A 5BN4B 1KYQA 5ITSA 2IDMA 1SUDA 3I83A 1OI4A 3KR9A 4J90A 4K3UA 5AICA 2V4UA 1ONBA 1KI3A 2ZYIA 2FP4A 1HBJA 4L5JA 3QKRA 1KK3A 1UC5B 1YS7A 2R4TA 3D7SA 2FGKA 4FEAA 4YXWA 4HV4A 3K9QO 1OIVA 4GKJB 2HXGA 2OHIA 3QXHA 2C5EA 2NX2A 4MV1A 3RVNA 3X1MA 4CFZA 5G1NA 5GADl 2Q49A 2WPNA 2Z6VA 4HUTA 1M8KA 3K8ZA 3R5FA 3VHXA 1EXMA 2COKA 2FKNA 2PZ8A 1YS6A 3DLCA 4NONA 1HE8B 4X6UA 5REQA 1Q7EA 1KSFX 1Z6GA 2YYSA 5LD2C 1GP2A 2V1XA 4KIUA 4Z9BA 2D8AA 4JGGA 1DADA 1MJNA 1RQNA 4P35A 2H65A 1SZJG 2HZBA 2G6TA 3HVIA 4GQAA 4IXTA 5C7LO 3IDZA 1PDVA 3T5PA 2X3UA 3RK4A 3S2ZA 3UUWA 4E2YA 4U2FA 3SZ3A 2ZVQX 1HY3A 2H5EA 1JR3A 4WEQA 1XVTA 4FBMA 5IBRA 1KYTA 3CGWA 3E2IA 5A5FA 3ZW9A 3OQMA 3LECA 4UTXA 1NRXA 1V5IA 2E49A 4UVEA 5F2NA 1TCBA 1Y6GA 1GTMA 2R7NA 3N0VA 1AK9A 2JAWA 3NJ4A 4CF5A 2V1UA 1FLVA 1OJLA 1R5OA 3UUGA 3MOIA 4HEA6 2OT3B 3HCRA 3O21A 3QJGA 5KCZA 4DB2A 3FVRA 3IQIX 3MMZA 3OQ1A 4RLHA 3V3TA 2VJPA 4OHOA 3OE5A 1E6CA 2RGCA 1RWWA 4U2DA 2AOUB 2WFZA 4H0NA 5B1IA 3RVRA 1V3TA 2Z1DA 3CZMA 2BEWA 3UMRA 4CV1A 1F9EA 4QDTA 4XSGA 4CKWA 3SXUB 3GUYA 2VAWA 4BO3A 2VBCA 2JCBA 5JCOC 4MQUA 5ARDA 3VKGA 1G0NA 4LRTB 1DQSA 1QB8A 4MRVA 3KB8A 3U09A 5DP1A 1I6WA 1J06A 4Q1FA 4B6GA 1UWLA 3LUBA 3M9LA 1XVLA 3MRSA 3PWSA 2BFOA 5JJIA 3HRIA 1XCBA 2J07A 3H16A 2JGDA 1KGSA 2V3WA 2GM3A 3ETHA 3WRXC 1YJBA 1QH9A 3O93A 4N40A 1E0AA 1ZUNA 2BVNA 3H2GA 1TUIA 4IKOA 4N5HX 3UF0A 5H1YA 1LJLA 2CKMA 3JR7A 1UMBA 3JZIA 4W7HA 3CRQA 3VO2A 1O57A 4Q9HA 5JQGF 5ENVA 3FPAA 1C4OA 1ACMA 1J42A 1D2RA 2GF2A 1QZZA 2LKDA 2XMCA 2HWUA 3G8DA 4UDYX 4A3SA 4OUKX 1PYGA 3OCCA 1T9HA 2AJTA 2IYUA 3FVVA 2W6NA 2XH8A 4RCYA 5FL3A 3KKZA 4MQFA 2A35A 3OEED 1NSYA 3W9SA 1NZDA 4D44A 4U7JA 1KBOA 2EJTA 2A9JA 4YASA 4ZPXA 2JAXA 4CMIB 1V71A 4R2HA 3M6LA 4IFTA 5JEEA 1WXGA 3FCEA 5TVKA 4KO1S 4R01A 4KN9S 2QBYA 1CQXA 5A3QA 3F1KA 1ISPA 1VBMA 2CHQA 2REQA 3BXXA 4NAUA 4RE5A 4X63A 4X92A 1Y5IA 2E85A 3FPHA 1VL2A 2IPAB 4Z8YA 1D7AA 2QI9C 2X8AA 3ON5A 4BRUA 4DCUA 5BOSB 3WBJA 3MJSA 4FGLA 4WX2B 3RSZA 2DTEA 4EMTA 5CFLA 1WO8A 3PICA 3IVXA 4K5QA 3KC2A 4EGAA 3HBAA 3T61A 2GZSA 2ZI7A 4Q4AB 1ZJ6A 3RUIA 1VLMA 4OI2A 1VJDA 1CJSA 4H0FA 3S28A 5IFLA 5KOHB 4NU8X 3GT0A 3QX7A 1G6KA 1I3NA 3ER9A 4X1YA 3F46A 3E48A 3SEFA 2DQKA 3SNHA 1RPTA 1A4IA 2QGNA 2DPYA 2PL9A 5HKAA 1X7GA 4I3GA 5HFAA 4CDNA 3DV0A 2OSBA 4EBBA 5JHGB 1G7TA 1E1KA 1Q12A 1SNYA 2HRCA 4MQBA 1AQIA 3RVQA 5BR8B 3LUKA 3O75A 3AF4A 2J9FA 5F5NA 4HY3A 4TV8A 1JJBA 4ARZB 4V0RA 2VBGA 1QK4A 4R1UA 2VNIA 1J23A 3LCVB 4G5SA 2RGEA 3QFTA 4AIRA 2JJ1A 3ZXUB 1UOQA 2MINB 4DCOA 4D96A 5JYEA 4CR6A 2ZIGA 2GK4A 1OR8A 2H63A 4WY8A 5JJBA 1P4GA 1E69A 2W2NA 2P5UA 4AICA 2UUBB 4NFLA 2AOXA 3LUPA 4S24A 1H5UA 4PQGA 2F4NA 4XXHA 3UT5A 1E8DA 1EESA 1R6BX 3OLYA 4D3FA 2BH9A 5EKTA 1TB4A 2FOXA 1VE7A 2XXAB 4UTOA 4KR9A 2FX5A 1IHPA 3RJ9A 3EODA 1WTCA 1TK9A 2YS6A 2PTGA 3HKEA 5EJAA 4EGQA 3WV4A 1MTOA 2NP6A 3FOZA 4AS3A 2WIGA 3RBXA 1JNXX 5CA1A 3ED1A 3N8NA 1BE6A 6YASA 2C03A 1TC1A 5TNXA 2QKYA 4XTCS 5DTQA 1FC0A 3K0HA 2ERCA 3THWB 2EV9A 2Q5FA 1BFDA 3QELA 1S96A 2O3SA 1RQ7A 3GZTB 5F9MA 5JARA 2ZM5A 3GEIA 2CVQA 1Y3HA 5BVGB 2PDAA 2WSMA 3MAAC 1AJEA 2HEIA 4L4SA 1ES9A 1XD9A 4OQXA 2G88A 1CUYA 3FFWA 3Q7SA 4JC5A 3M6MD 1YR7A 2FEPA 2ZTVA 3FHLA 3M5WA 4IIVA 4BJHB 2E55A 2NU7B 1U11A 4OYRA 3SWWA 3PQ3A 4O2AA 2BCGY 3UAYA 3PJGA 2R6JA 3IUMA 4CMCA 1QCYA 2N0SA 4TQ9A 2REOA 3VO1A 5BN5A 4J2OA 1ODSA 4YV2A