4I9NA

Crystal structure of rabbit ldha in complex with ap28161 and ap28122
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
331
structure length
324
Chain Sequence
b'AALKDQLIHNLLKEEHVPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTANSKLVIITAGARLNLVQRNVNIFKFIIPNVVKYSPHCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWILGEHGDSSVPVWSGMNVAGVSLKTLHPELGTDADKEQWKQVHKQVVDSAYEVIKLKGYTTWAIGLSVADLAESIMKNLRRVHPISTMLKGLYGIKEDVFLSVPCVLGQNGISDVVKVTLTSEEEAHLKKSADTLWGIQKELQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase A chain
publication title Fragment growing and linking lead to novel nanomolar lactate dehydrogenase inhibitors.
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 107
structure length 324
sequence length 331
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4i9nA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4i9nA02
5JLAA 4YDRA 3TL2A 4R41A 4FGSA 1G1AA 3SC6A 5FWNA 2QZ9A 1WDKA 2PY6A 3PFWO 3QE3A 3Q9NA 5BT9A 3AY7A 1GAEO 2BFMA 1PJ3A 3H8VA 2WJPA 4FGWA 4E2YA 4F3YA 2V65A 4KQWA 2HMVA 4BQRA 4B4VA 2J3IA 1P1HA 4D42A 1JN0A 3NTQA 4J0FA 5DN9A 4FDAA 2E48A 3G17A 4IJKA 3SLKA 4N5LA 5L95A 3WJAA 5L45A 4IQGA 1EMDA 3AUSA 3DR3A 4Z3DA 1DAPA 2J5RA 4DPMA 4FFMA 3LQFA 3ZV3A 1V35A 2Y93A 1P74A 3JQBC 2R00C 4HFJA 3GVXA 1R0LA 4ZJUA 4CUKA 3RI3A 3JQEA 5A05A 3L9XA 1DLJA 4KMSA 2I3AA 5IDQA 4U0JA 1WZIA 1Z45A 4YAJA 2GDZA 3CUKA 2D0IA 3NJ4A 2O3JA 4W82A 2IZ0A 3MOIA 1K0UA 1PX0A 1ISFA 1O0SA 3PGXA 5F1OA 5LC1A 4YRBA 2DTDA 3ZNQA 2HRZA 3OQBA 1XEAA 4YCAA 4E5KA 1D3AA 3D4NA 3PK0A 1R4NB 3DDNA 2W90A 4EJ6A 4RO0A 3Q3CA 2Q1UA 2ZYAA 1VJ0A 2HKIA 3WWZA 1A9ZA 1T4DA 1RYDA 2Q46A 1DJNA 2VOEA 4OH1A 2VHXA 1PJ2A 1KOLA 3FR8A 5HS4A 1UAYA 2JFFA 1E1NA 2H6EA 5THQA 3S2IA 4GX2A 1GY8A 1CETA 1DC5A 2Z1NA 2ILTA 3HN2A 1H9AA 2ZB4A 4IJVA 4IIVA 3VPXA 3KYDA 4DA9A 4XQCA 3JQDA 3GPIA 3JYLA 3TZHA 3OA0A 1WDLA 3EVTA 1YH3A 2WE7A 4HV4A 1LSUA 1T2CA 1OFGA 2NVUB 5HS6A 1HWYA 4U8GA 3DAFA 4B4WA 1PL6A 4L4SA 2OL4A 4CMBA 5G0UA 2VRBA 2GGSA 1UJMA 4CUZA 1HEUA 3ULKA 1I2ZA 3U4DA 4ZQHA 2DPGA 3H7AA 2WYUA 3Q11A 1DEHA 3I83A 4OL9A 2V7PA 2AA3A 2W2KB 2HLPA 1H2BA 5L4NA 4W6ZA 4ALIA 4H3VA 3ABIA 1A7AA 4E30A 4RDIA 1TT7A 4TRJA 4RPJA 3KETA 1PJ4A 3WDSA 4W9NC 1O89A 1LLUA 2EKPA 4IY1A 4J49A 3RBXA 2ZIZA 5JCXA 4F6LA 5IXSA 1BDBA 3ETDA 3PFFA 2A9FA 1P1RA 2Y68A 1OBFO 3JQ8A 1AN9A 1ZMTA 1ZSNA 4MVJM 5AYVA 2X23A 4NBWA 2EGHA 3L4BC 5EQFA 4CQMB 5A9RA 1Q7GA 4YJFB 3HE3A 5C7LO 3HADA 4BNNA 4PLCA 5A1TA 1BGVA 3TJRA 2FSVA 1EFLA 4GKVA 3GR6A 1L7DA 3GEDA 1LI4A 1A4UA 2JFGA 5KVCA 2B83A 2CY0A 2HUNA 3S55A 1DXYA 4A03A 2Y67A 1Y7TA 3QJ5A 2FPPA 3FSRA 4Y8VA 3WOHA 1LDGA 4L9RA 5DF1A 3INGA 4WLFA 2FR8A 4WPGA 4NMHA 1EK6A 3BIOA 1LQUA 2O3RA 1XIVA 3ZWOA 1X1TA 2PGDA 3IJPA 4Q3CA 3QVXA 4RLSA 3K6JA 1GEEA 2XXBA 5IG2A 3DZIA 4NBRA 4QFCA 3K5PA 2D3TA 3LZ6A 1HDYA 4MOWA 3UKOA 3AU8A 1HDZA 4KTVE 4J4TA 4Z0PA 4YA6A 3PQFA 3QVTA 2O2SA 5CDTA 1VL6A 1YJQA 2Y0EA 4E5NA 4IQ0A 4JQCA 2JCYA 1VI2A 1YL7A 1LLQA 2VYVA 5FEUA 3GLQA 4M8SA 2Q3EA 2F00A 3KV3O 3LDHA 1V9LA 1DAOA 3PLNA 4K6CA 1ZCJA 4OXKA 1VSVA 1NASA 1HLPA 1HETA 2C7VA 1DIGA 3JQ6A 2D2IA 4OIMA 2P9EA 1SO8A 3BMQB 1XHLA 3JD3A 5ER9A 1RM3A 1W6UA 1TT5B 1WWKA 3U0BA 4Q3EA 3OSUA 4DUPA 4WECA 1F12A 3VAZA 2XF8A 3ZWNA 2NU9A 2PD3A 5TIIA 1MFZA 1QV6A 3NT5A 5G0VA 4B7CA 4CM8B 1I3KA 3RD5A 4URFA 4BMSA 4FJ1A 4PLZA 3V1TC 4M54A 3FTPA 2CVZA 4LRSB 1MG0A 3ZDFA 1QRRA 3TZQA 4KOAA 2GSDA 4BO5A 1R4NA 3GFGA 2IEBA 3ANLA 5A3VA 2O23A 2RHCA 2BGKA 3QLJA 1QP8A 1NQOA 1U4OA 3L0DA 4UVEA 1NQTA 3F46A 2CF6A 3I4CA 1RM0A 2O4CA 5JW6A 1NAIA 5F3RA 4CM5A 2GERA 4JK3A 4UVHA 3IP1A 5DOZA 1TB4A 3KO8A 4GSLA 4GQAA 2AQHA 1UZNA 2JKVA 3P19A 4MP8A 2OZPA 3CIFA 5I8WA 5JXWA 3QVWA 4CM1A 1B8UA 3E8XA 1JQBA 3JCZA 1R66A 4RL6A 4CLRB 4NNJA 2E4AA 4GVXA 1FDUA 1LEHA 3GFBA 2VRCD 1QV7A 3GG9A 5DZSA 3GZNB 5TRTA 3PWSA 3E5RA 1KEUA 1LDNA 5DBIA 3ZV5A 3PZBA 5A4DA 1UZMA 2R2GA 1TXGA 4XGNA 4LGVA 2G82A 3OQ6A 2HK8A 3AM3A 3P2OA 4TZKA 4DPLA 2Y0CA 1PR9A 3JD1A 3RC1A 1R37A 4B8ZA 2EP7A 4EUHA 4GMFA 3H65A 2I76A 2BH9A 3QRWA 4J7CA 4ROSA 2PR2A 4NI5A 1F8GA 1GQQA 1MUUA 4U5QA 3WFIA 2HMSA 2E82A 3MZ0A 4CMJA 3FF4A 1P31A 5KJ6A 4JNKA 3C1TA 1XU7A 5JE8A 1QORA 3SBOA 1O8CA 4HP8A 1JKFA 2HMTA 1RM4A 3DZBA 4BGUA 4CR6A 2BD0A 1XLTA 4ZQGA 1SB8A 4NIMA 1T2DA 1VPDA 1E5QA 1ZSVA 3VTZA 2YQ4A 3QV1A 5F1KA 5KIAA 5G4LA 5TT0A 1I3LA 4D46A 1YOVB 3E1KA 3H3FA 4Q3NA 2D1YA 5TGDA 1E3WB 4DLBA 1OI7A 4PG8A 3C7DB 5C3MA 1ONPA 3GDFA 3PRJA 8ADHA 5I7VA 4PG4A 1WXDA 5EQDA 4O5OA 3JD4A 3BAZA 4MPDA 1GZ6A 1AE1A 2AQ8A 2C0CA 2GN4A 1U2GA 2ZYDA 5U9CA 5JYEA 1T2EA 1ZSYA 1PTJA 1GYPA 3DL2A 3QHAA 5DT9A 1J0XO 1MXFA 4FFRA 3B1KA 4ALMA 1PSDA 4BO0A 1ZUD1 2W2LD 3EZLA 4J9UE 1N7HA 4QXMA 2VOJA 1BXZA 1DRWA 4RVGA 4BMVA 3GDGA 2X0JA 1M2WA 5JAQA 4AJ2A 1ZJYA 3UVEA 3AFMA 4Y98A 2DVMA 4CL8A 1ZK0A 3H4VA 4IS2A 2YV3A 4TRMA 3TFQA 4Z9YA 2HJRA 2QYSA 2EJWA 2PKQP 3F1KA 4MVJA 5I7FA 1LSOA 5JDCC 5B12A 1DRUA 4ND4A 4QECA 5C5IA 1E3EA 1IPEA 3JV7A 3O8QB 5I9MA 1N7GA 3CSDA 4R9SA 3BMQA 4A5OA 3AJRA 3V5NA 1IY8A 2JJYA 2EW8A 3K30A 3CZMA 2BFAA 3GG2A 1NPDA 3NT4A 2RAFA 1NTOA 4E5MA 2EW2A 4OSPA 2X0RA 2FPIA 3VH3A 4FJ2A 2IXAA 5G2OA 4LVUA 1B7GO 5AXDA 2DFVA 2HK7A 3DBHA 3WQSB 1PWZA 3U3XA 4AVYA 2ZCVA 3GUCA 2ZJ0A 1Q1NA 1VL8A 3KYCB 3IKVA 4CR7A 1LDYA 3DMYA 4MIYA 3U4CA 4KP7A 1BSVA 3ADPA 3N7UA 2Z95A 2EP5A 4FJ0A 1I01A 1YBVA 3TNLA 3ZHBA 4BKUA 4AJEA 1N9GA 4OOFA 4C7JA 1E6EA 1Y81A 1CIVA 3JQ7A 5BSHA 3MJTA 3RUEA 1PU2A 1ISGA 5BSFA 4R1NA 4CMCA 2NUAA 4XX0A 4TMFA 1KC3A 1NHWA 2Y05A 4PGFA 1DPGA 1JAXA 1XDWA 2NWQA 2WWRA 3E82A 4CLRA 4B8WA 1A5ZA 1BRMA 5BNTA 2GR9A 3WBBA 1HZZA 3GZNA 3DZKA 4RGBA 1U5CA 1YXMA 3H9QA 2C59A 3KOUA 3I6QA 4J43A 2VHWA 3SVTA 4YJGB 2UV8A 4AJJA 3AI2A 1HDXA 5JCJD 1V0JA 1Y6JA 1ZNQO 5GY7A 1ZW1A 1X13A 4BGIA 3QQPA 1MP0A 1P0CA 5L40A 5L51A 2RHRA 1P9LA 2B36A 2Q49A 3LVFO 4BO6A 4ZICA 2NTVA 2PLAA 5C7IO 1I3NA 2UYYA 5CG1A 4FSHA 4H7PA 4UUOA 1XR3A 2JD1A 2QX7A 1P1IA 3V1UA 2BFPA 3LK7A 3KSZO 4HXYA 1PQWA 2AQKA 4P22A 1XGKA 3QVSA 2H9IA 4JXKA 4Z9FA 4WOKA 5F5NA 4CV3A 1M67A 3JQCA 4J1SA 3E03A 5DCWA 1GCOA 5KJFA 2X22A 1NAHA 5ENVA 4XRRA 1YB5A 1I8TA 2Y99A 3H2SA 4D43A 4E12A 1H0KA 3PHJA 1C1DB 2VTDA 1BXKA 4J3FA 1E3WA 3GVHA 3HSKA 4J7UA 3MJSA 1SEPA 4GWKA 4MKZA 5DCYA 1P33A 3TSCA 1IL0A 3VZPA 2D5AA 3E9QA 3VVBA 1E7RA 1FDVA 3GF4A 2O2YA 3WGZA 3UW3A 4RCVA 3ANMA 4E2ZA 5EERA 1VKOA 4AJ1A 4BNFA 1S7CA 1NFRA 3HJAA 3BMOA 4TRRA 3UGKA 1H6BA 1ZIDA 1YS4A 5T8KA 3L6OO 4ZHSA 1LQTA 1TLTA 4FW8A 4PLTA 4UAGA 1KC1A 1GCUA 1HSZA 3ONDA 1E6UA 4B4UA 3A1NA 2X8LA 5IAAA 2AXQA 3RROA 1A7KA 1DHTA 5FF9A 3ZWAA 1LBEA 4JJFA 1LDEA 2CVOA 1PJQA 1Z75A 5KVVA 1SMKA 1R4MA 2JCXA 2C5AA 1EBFA 5K6AA 1YBMA 4PRKA 2JL1A 5AVOA 4YQZA 4DBZA 2GRAA 4P4GA 2GNAA 4WK6A 1HDOA 3K92A 3VPHA 3TWOA 2OBNA 5F21A 3KZVA 5IN5A 3O8QA 3WFJA 2J5KA 4AICA 4QSMA 3ZI0A 5ES3A 3WIDA 4Q3AA 1JKIA 4II2A 4NBVA 1G6KA 4IJUA 3ROKA 4OAQA 5KJEA 1B3RA 2FPGA 4TWRA 3CZRA 3VPFA 1B0AA 5CEEA 1YL5A 3U49A 3ZWYA 4PG5A 4G2NA 2A35A 1BVUA 1ENYA 2VNSA 4WCFC 3RBVA 4BNLA 4F6CA 1Y8RA 1DIAA 3G1UA 3MWDB 4XRGA 4DIBA 3BHJA 4N7RA 4IZHA 3KB6A 4RZIA 4E4YA 1HZJA 1M66A 2W4QA 5F5LA 2EV9A 4II3A 3RC2A 4YB8A 3LLSA 1BXGB 4DL9A 2OORA 3IUSA 4NHEA 1GPDG 3BMCA 2WSBA 4BKPA 3GOHA 3H9UA 3I23A 1ZK2A 1JA9A 3L77A 5AXAA 4CM7A 1Y8QB 1R0KA 4H15A 3ZWCA 4ND5A 3DAPA 2Y1FA 2VYVD 2B4TO 4HUJA 4P4NA 4U0KA 2B5WA 2F1KA 3D1LA 4YT5A 1MC5A 2X58A 1T1RA 3DXFA 4UUPA 5AOVA 3H9GA 2UDPA 2W98A 1NWCA 1SB9A 4PLHA 4LSMA 4Y67A 2AEJA 1M6HA 1KVRA 5TX7A 2CDCA 3BMNB 3CMMA 3QA9A 2VHZA 2NACA 3GY0A 2VHYA 3WYBA 1FK8A 3CKYA 4N18A 1YONA 2NU6A 4DQVA 1X7HA 3GC6A 1X0VA 3JD0A 3IDSA 2VHVA 4P4LA 4CQLA 4YPOA 1FMCA 2YHIA 4IZIA 4JCOA 4BKOA 3EW7A 1V6AA 1AHIA 1AXEA 1LDBA 2IODA 3F6YA 4I8XA 1C1XA 3WICA 1E7SA 3EMKA 3LC2O 4CODB 4KDEA 1MXHA 5B37A 4QQRA 1IOLA 3AOGA 3IOYA 3INTA 5DP2A 4D3DA 1O94A 5H82A 3FRJA 2EIHA 1HSOA 3A28A 6LDHA 3GMDA 3IAHA 4EITA 1EE2A 2P5YA 1TEHA 4KUGA 1W4ZA 1HYHA 1PGPA 1CRWG 1ENZA 3RUFA 5DDIP 3WGOA 1PZGA 2I66A 1B8VA 1DJQA 4LISA 2XOXA 4HADA 2PD4A 3G49A 2DPHA 4PIVA 3DMTC 4IPTA 4D44A 4B3IA 3K2BA 3PGJA 2DFDA 4ZQFA 2DQ4A 1QYWA 1SBYA 2Q2VA 3LYLA 4F45A 4Q39A 4R01A 2DU8A 3P5SA 3WBFA 1PIWA 2ZJ1A 3Q9UA 4KTTE 4E5PA 2PNFA 4YT8A 3FHLA 3Q1LA 3LT0A 2WD7B 3DC2A 1PR3A 3VHRA 4PLWA 3MJEA 4R1SA 1GV1A 3AI1A 1T1SA 5CPFA 3K9QO 4N5MA 2QRKA 5HRUA 1PQUA 3OFSA 3VH1A 3WGGA 4B7UA 1KYQA 1YL6A 2P2SA 2PTGA 2CVQA 2ZCUA 1E3IA 3UHAA 4PG7A 4W99A 4QX6A 3I9MA 1EFKA 4NG5A 5CDGA 3WTBA 4EEXA 1H6AA 2Q50A 2Y66A 3P7MA 2WYVA 4OM8A 4OQZA 4XB2A 4Y6RA 2PZLA 1H2HA 2AG8A 3ZN2A 3KLPX 4L73A 4OGWA 4TSKA 2R6JA 3MOGA 3GAFA 3QWIA 2BI8A 1IYZA 3GMSA 3C85A 3ON5A 2JD0A 2ET6A 4WLEA 4XCVA 1I0ZA 4KWIA 4WUVA 3FD8A 1LRJA 4YACA 3QWHA 4MKXA 5IFLA 3PIIA 2ZKLA 3G3EA 2OP1A 1KVQA 2CNBA 2ZTLA 5ICSA 2AQIA 4BNYA 4IJWA 1F0YA 4L75A 4RDHA 4JLWA 2Q1TA 2Z5LA 1LRKA 3K73O 1OC2A 5CEJA 3FI9A 4N5NA 4PG6A 2DM6A 3F4LA 3VZRA 3WGYA 2Y1OA 3ASUA 2YW9A 1EVYA 2VNAA 1NPYA 2VT3A 1JW9B 3UCXA 2HQ1A 4FOSA 4XB1A 3JTMA 3RIHA 1RYEA 3UFXA 3TL3A 2IZZA 4YWJA 2VYND 3EDMA 4WGGA 1NQAO 1PJBA 4HFRA 2H5LA 4E31A 1BXGA 1ISMA 4RPGA 5L7YA 5DNAA 5I7SA 1X1EA 2VZ9A 3F9IA 2C07A 3T4EA 2DUUA 3IP3A 1FDTA 4NJOA 3L6DA 5A03A 1RJWA 1BW9B 5A9SB 3JQFA 3OETA 1GYRA 4R4JA 3FN4A 1GADO 3B70A 3GGGA 3UXYA 2XPCA 3H6KA 3QWAA 2EWMA 2CD9A 1IPFA 3JYNA 4H16A 5G0SA 5A5EA 1GTMA 4JJGA 2HU2A 1Z74A 1SZJG 2CMDA 3WGHA 5DCUA 2I9PA 1D7OA 5H81A 7ADHA 3I9LA 4I5GA 4MP3A 1U5AA 3DOOA 3MJVA 1KBZA 1R12A 2OMEA 4J7XA 4D3SA 2ZYGA 3LC1O 1NVTA 2IEDA 2V6BA 1LTHR 1MV8A 2ZTVA 1A4IA 2CDBA 4XGIA 1T25A 2VWPA 3S2EA 1HTBA 1H94A 3E18A 5EESA 3GEMA 3LT4A 1NR1A 1DIRA 1KEPA 4LMRA 1ZFNA 2I99A 4KUEA 2GD1O 5EPOA 2C7GA 5KNLA 4RQUA 2O48X 3DOCA 3JQGA 5IDXA 4WNIA 2CF5A 4IGEA 5H83A 3PHGA 4R9RA 1IHYA 5EMHA 3TZCA 1I2BA 1QXSA 1SC6A 3CTMA 2PD6A 4NFSA 1PS9A 4FR5A 2EF1A 4E3ZA 2YQ5A 3C7AA 3VZQA 4QT0A 4Y9DA 1F06A 4CMEA 1C0KA 1CF2O 2C82A 2BKAA 5A3JA 3R1IA 5IF3A 3FWZA 3ONEA 4LCEA 1K3TA 1JWAB 3CXRA 1H5QA 2V6MA 3HUDA 2NVWA 4E32A 2QZZA 3WG9A 3ZV6A 2UAGA 3WGTA 1V8BA 4BKQA 1HYGA 3T7CA 1YQGA 4ZRNA 4BNVA 1VJTA 5L7WA 1HE5A 1CEQA 5ILGA 4EJMA 3I9JA 2I5PO 2HAEA 5FI3A 4A27A 1XELA 4CL3A 2RH8A 2WD7A 1D1SA 4OHUA 4CJXA 5HTOA 4PVDA 4KDFA 4GLLA 1YE3A 3I9OA 3ZW9A 3VC7A 3H2ZA 3WX0A 5IDYA 2B69A 4JROA 1WW8A 1UP7A 3EVNA 3JSAA 4OMUA 3NGLA 4RVDA 5T6BA 4Z3KA 4AL4A 3DHEA 3RCBA 1WLYA 3COSA 1Z82A 3FR7A 3BTUA 3VH4A 3WXBA 1U3WA 5EL0A 4BNWA 3RASA 3WLFA 4CV0A 4K1LA 4PN3A 1YVEI 1HL3A 2O3TA 3DBLB 3QIVA 3ZWBA 5C37A 3RAJA 3X2FA 1KVTA 1ML3A 2OOSA 3GNQA 3H9JA 1JVSA 3B6ZA 4FD3A 4NJMB 3W4JA 5IDWA 3AU9A 2XAAA 1GL3A 1XKQA 4XYMA 3AW9A 5LDHA 2H63A 1ULSA 3QWBA 4K6FA 3OH8A 4EI2A 4R54A 1U8XX 4DYVA 2WDZA 3AOEA 1HYEA 1H6CA 1W73A 3NTOA 1U7HA 3DAGA 4N54A 1D8AA 5GZ3A 3RSHA 1JWBB 2YHUA 3LSYA 3C7CB 3C8MA 3UCFA 1F17A 2NVUA 2HCTA 3IKTA 1GV0A 1DC3A 1YGYA 4CM9A 1K2WA 4EUEA 4W7IA 3S1LA 5T8KC 3AI3A 3NUGA 5DULA 5KVQA 4PLFA 2Z1MA 4G5HA 4PZDA 2VZ8A 1BW9A 4YAEA 2GYYA 4ZVVA 4YRAA 4QO8A 4RZHA 4BV9A 1ZK3A 2C2XA 1VL0A 1GFSA 2W2KA 1Y9AA 4IGFA 5CG2A 4TROA 3FNHA 4M86A 1VLLA 3Q0EA 4R1UA 1EVZA 1PGJA 4J90A 5CPBA 4J91A 1D1TA 4LN1A 5KVSA 3EYWA 1UAGA 4GWGA 3LLVA 3GHYA 2BGLA 2NV6A 3VKUA 5K6AC 4CMIB 3OA2A 4DC1A 3HB5X 4D0SA 2JFHA 2DAPA 1B26A 5B4UA 2Q4EA 4YJDA 5LCXA 3FTNA 2VWQA 1KVUA 1N92A 2QIOA 3BTSA 3GH3A 1XA0A 4XYLA 4GVLA 3JQBA 1M6WA 2X5KO 1NBOA 2HK9A 3ICPA 1JVBA 3GGPA 1FF9A 4CQMA 4PLPA 3U62A 4YJFA 2TMDA 4IBOA 2HJSA 3DFUA 3ASVA 3NT2A 4D7AA 1DSSG 2FHSA 4I9NA 3DBRB 3OJOA 4B3HA 3KSDO 4DVJA 3GRKA 4PFJA 4UVIA 3GNSA 5C7OO 4R16A 1DO8A 4ALJA 3MWEB 4G81A 2CZCA 2RIRA 1HE3A 2GO1A 4CM4B 5TJ9A 3UCEA 4YYZA 1YQDA 3MTGA 3OHSX 4RVUA 4NPCA 5JDIC 3FNEA 1Y5RA 6ADHA 3B1JA 2GPTA 1K6XA 1Y9EA 1Z7BA 1ADBA 1PS8A 2Y1GA 2NLOA 4IMPA 2YFHA 2IDZA 2YDYA 2O3QA 4I5EA 3B20A 4BOYA 5BSGA 3AUAA 3RFVA 3KUXA 1BVRA 4A73A 4BNKA 4GX5A 4YJHB 2FSSA 4OJNA 3HQ4O 1RPNA 4ONEA 4BNUA 5T67A 3ZWPA 4JJIA 4XYGA 3ZNNA 1UXIA 3HFGA 3S2FA 2J3JA 2D8AA 4BMNA 5F1PA 3OQ1A 2EHDA 3GK3A 4BNMA 4NU5A 4DGSA 3PZRA 3JQAD 4ND2A 3FBGA 3WNQA 3D4PA 2Y1CA 4AJPA 2DBVO 4RVFA 5MDHA 3RU7A 1TT5A 4BNJA 1QR6A 4RPKA 4YRDA 5TS3A 3DHNA 3DBLA 5JAZA 4OYRA 4CM8A 1P1FA 1RWBA 4HKTA 5B1YA 2ZB7A 3I9NA 4W9NA 5GZ1A 3OICA 1SOWA 2B4QA 3NAQA 1Z7EA 1GDHA 2Y1EA 4NJMA 4RVSA 1KEVA 4GH5A 4B7XA 1U28A 3BXXA 4NH4A 3T4XA 5DP1A 1A9YA 1LUAA 4XQGA 1E3SA 4E13A 1BTOA 3IUPA 4KQXA 3WLEA 9LDTA 4BKRA 3R0IA 3AWDA 7MDHA 2LDXA 1D4FA 2AE2A 4J9VA 3ENNA 3O9ZA 4JGBA 4Q3BA 3KVOA 4J1QA 5DBGA 1IE3A 2FOIA 3VOSA 1F14A 2FZWA 3D3WB 3DOJA 5HM8A 3WNVA 3KTDA 3ZHXA 5KOIA 3WJ7A 4AG3A 2EEZA 2VUUA 3QSGA 4BL5A 4R68A 1PEDA 4DLAA 3DONA 5THKA 2AG5A 5JY1A 4MVJE 2IYOA 1HKUA 2DKNA 4FBGA 3FBTA 2PZMA 4AJNA 4XEHA 4JP2A 1VJ1A 1W0CA 3EZYA 3GT0A 4S3MA 1ARZA 1YO6A 3F5SA 3HFSA 4R3WA 3EHEA 2B0JA 3WSWA 3O4RA 3E9NA 4IXWA 4E33A 2A92A 3ROQA 2P4QA 2FR0A 4K9DA 4R5HA 1T2FA 4C7KA 4O6VA 1BDMA 5IJZA 4CMIA 3ZHZA 3ZWWA 2OBYA 4P38A 4FB5A 1YB4A 4CLOB 1EUZA 2FR1A 3G0OA 2X5JO 1ZK4A 4NR0A 2DBRA 4RQTA 3QW2A 4MVJH 1LC3A 3NGXA 4FPXA 2C29D 5DOVA 3W4IA 4RLHA 3WQQA 1T2AA 3CH6A 4UEKA 4A10A 5JAMA 3DBRA 1Q0QA 3Q6IA 1KY5A 1E3JA 4YEDA 1YOVA 4CM3A 3JQAB 4EEZA 4OKIA 4QO7A 5JC1A 3ZHYA 1P1JA 1BWSA 1MA0A 1EDZA 4GGPA 4BHTA 4DPKA 3D0OA 3SEFA 3A14A 2BLLA 1GD1O 5EINA 2W8ZA 2JHFA 5KJ1A 4XWYA 4Y6SA 3TFOA 1U8FO 5TC4A 1P3DA 4BGEA 4D0RA 1I10A 1ZEMA 2PA3A 3WYCA 3ZWXA 4W7HA 4IINA 4EBFA 2RBEA 5I9NA 4NK4A 1E3LA 4CR8A 4YVFA 5KKAA 3HG7A 3JQ9A 4FIZA 3ZU2A 1FXSA 3JQFC 3DBVO 1LSJA 1PZEA 1M75A 3ZZNA 4Z9XA 4HNGA 1ADGA 4L74A 2G17A 2OHXA 4LMPA 1NXQA 1QMGA 1U3VA 4DBVO 4J0EA 2YDXA 1PGQA 3T7EA 4ALLA 2YJZA 4B79A 1V3UA 1XWFA 3ENKA 4DMLA 1J49A 3ZU4A 3SLGA 5IN4A 3EGOA 4YAGA 4HBGA 4Q3DA 4L8VA 3KEQA 2QQ5A 2UUPA 3S2GA 2BELA 1DDOA 2NSDA 3RVDA 2AE1A 3U4HA 4D45A 2DC1A 4DQUA 5ITVA 2I6TA 4GBJA 5AQ1A 2Q4BA 1I5RA 5COAA 2VRCA 3DWFA 1YDWA 4XYEA 5ICMA 1I2CA 5JY6A 1UXHA 4UREA 2NU8A 4JIGA 5A02A 2YV2A 5CFZA 5I8ZA 5B4TA 4HFNA 1PJSA 5G0TA 1J5PA 2WD8A 3WWYA 5FFFA 3H5AA 1G0OA 4L76A 4MIOA 4Z0TA 3O26A 4Y6PA 1ZMOA 1SCUA 4HWKA 3KYCA 2X0IA 4ZD6A 4UUNA 2OO5A 1MC4A 2VZ0A 3HZZA 5COQA 2GLXA 5LDGA 1HF3A 4OXNA 4CMEC 1KIFA 4XIJA 3SX2A 3OJLA 1C3VA 1DIBA 3DEYX 1QYCA 3EK2A 1EUCA 4CV1A 5ITWA 1NVMB 2JHGA 4ALKA 2J8ZA 2ZB3A 2J3KA 3UAGA 4IDCA 4L4XA 5JS6A 3M1LA 1PQPA 2GCGA 3I5MA 3Q2KA 2P4HX 3ZWVA 2TMGA 4PZCA 3DFZA 4OO3A 3O03A 2WE8A 1Y1PA 1DBVO 1XU9A 1FDWA 5JSFA 1KVSA 1B14A 5TF4A 4BNHA 1MG5A 3ST7A 4OOEA 2P5UA 3F1LA 3C1AA 1N2SA 4QFDA 1QYDA 1KEWA 3TPCA 4OXYA 1DFIA 2NADA 5G0WA 1DB3A 4YJGA 1XCBA 4JBGA 4EZBA 4XR9A 3MEQA 1PJLA 2GN9A 4BO7A 3RFXA 4CLEA 4MIEA 1Y5MA 2HMUA 4ZN6A 3KXDA 1IHXA 3RC7A 3TQHA 1WVGA 2NU7A 2DBZA 1HDGO 1RM5A 1ADFA 1UXKA 3M2TA 1EEHA 4JX8A 4M87A 1PGOA 3L9WA 4DQXA 1U3TA 3K96A 3RWBA 4ZGWA 5JDCA 2W2LA 3WGIA 3ORFA 2WYWA 4RF4A 5AXCA 5JAIA 1PJTA 1EE9A 3OECA 3RQSA 2UUOA 3U9LA 5EN4A 3JQ8B 3DTYA 1UP6A 3GZ4A 3PDUA 2AMFA 4WJZA 3ADOA 1EBUA 4RVHA 3RKUA 1C1DA 2PKRA 3UICA 5L3ZA 3HDYA 1PS0A 1H6DA 2JAPA 3GAZA 4IXTA 1VM6A 1GYQA 4E5YA 4WCFB 2PH3A 1VSUA 1EUDA 2DTXA 3JYQA 4HY3A 2WEKA 4S1VA 2QG4A 1OOEA 3VVCA 2DUWA 4DC0A 2BI7A 3U09A 3K2EA 1N8KA 1GZ4A 4RF3A 5T64A 2NTNA 4I1IA 3ZU5A 5BQFA 1I24A 4PVCA 3RBZA 4BO9A 1P77A 4CLHA 1X15A 3AFNA 4WE3A 4A7PA 3NDJA 2EERA 4M49A 4R69A 3VPGA 4DYDA 5GZ6A 3ETGA 3BTVA 1P45A 1ZO8A 3F3SA 4W4TA 2D4AA 3FWNA 3S8MA 3RUCA 5FYDA 4ZU3A 2Q1SA 4R5MA 2EKLA 5A06A 2BFOA 2QRJA 3OIGA 4DRYA 2SCUA 1YJ8A 2HRBA 1GEGA 3D5TA 1X7DA 2ZTMA 1NR7A 3GHHA 2VN8A 4CQMD 1T24A 3IL2A 3W6ZA 5IXYA 5T5QA 2FZEA 4YR9A 4X54A 4A26A 3K31A 2QYTA 2PK3A 2RCYA 2EKQA 3VZSA 4IUYA 4NDNE 1JKJA 1R6DA 1E7WA 2X9VA 1JU9A 4BGVA 3U5TA 4I9HA 4E2WA 5K9ZA 1EK5A 2C20A 4BO3A 4R51A 4BNIA 2X9GA 2P68A 4DTIA 3F5QA 4TVOA 2PWZA 3GVIA 1LRLA 2BF7A 1SNYA 4FS3A 5TNXA 4BNTA 2E6UX 2J3HA 1WNTA 2CDAA 4BIIA 1NHGA 4RF2A 1NYTA 5JNLA 5JCJA 1JAYA 4Q9NA 3ZW8A 2J5QA 2AEMA 1GUZA 4BO4A 3BHIA 4ALNA 1GUFA 2A4KA 3KSUA 1JLLA 3NTRA 4U7WA 1JTVA 4TQGA 1B16A 2O7SA 3D64A 1U9JA 1DIHA 3E5MA 1NWHA 5I9LA 2X7HA 2VQ3A 1Y8QA 3I52A 4CMKA 5CHEA 3GUYA 3RKRA 1P1KA 2O3SA 3TN7A 2FWMX 4LRTB 1HDCA 4MVJD 3OP4A 3KYBA 4WASA 2P9GA 2EG9A 4BB5A 4PRLA 5A5FA 3KEOA 4GI2A 4MVJI 5KWEA 2C2YA 4WEOA 1NNUA 3FCOA 4CM6A 3BMNA 3DZGA 1E6WA 3AY6A 4Z6KA 5IZCA 2LDBA 4OSOA 1ENPA 3GA0A 2PGJA 1Q2XA 3I1JA 1BHSA 1GQ2A 3K8ZA 2A94A 1WP4A 3C1OA 3TZKA 4A0SA 4WNCA 1WMAA 4EUFA 1O5IA 3PQDA 4YBZA 4YTEA 1LU9A 5BNFA 4RPLA 1DC6A 3DHYA 1A72A 1EVIA 3W6UA 3OEYA 4MJLA 2E37A 4BQPA 2PZJA 3KBOA 3AM5A 3X2EA 1KETA 5CDYA 3OJ0A 2DLDA 1LX6A 1UXJA 2X0NA 1O9BA 2PZKA 1YKFA 4G65A 4GGOA 3CE6A 4GKBA 5JFOA 3PWKA 2OUIA 1CWUA 4OKNA 4XDYA 3QWFA 1UDAA 1UR5A 1O6ZA 3W8FA 4B4OA 3DQPA 3PJDA 1ZBQA 1EZ4A 1HRDA 1S6YA 1C14A 1EVJA 2X4GA 5I7EA 4WCFA 1LXCA 1WMBA 4ZQBA 3RFTA 4XQ9A 1PWXA 1C0LA 3NKLA 2FY8A 4BO8A 4B3JA 4IIUA 3ZNOA 1J6UA 1E0DA 1NFFA 5BR7A 4D41A 2Q99A 1NPTO 4WEQA 3UH1A 4YAIA 2P91A 1V3VA 1T26A 3L4SO 4FC6A 3PHLA 3N74A 3O38A 1B8PA 3VTFA 4NQZA 4BNZA 4IDBA 4ZA2A 3EUWA 2G0TA 1GR0A 2NVBA 4EYEA 1UP4A 3PWZA 4YXFA 1GUYA 2YYYA 3OM9A 1QLHA 4J2HA 5CDUA 4BS9A 3FPLA 3TF5A 1DOHA 2B37A 1QYVA 3G1TA 4FFNA 4M1QA 4UVGA 4OQYA 5FI5A 1CJCA 4KUHA 4RORA 3ANNA 3VPSA 3ETEA 1R0SA 1LSSA 1SEVA 2FP4A 3RUIA 3HNPA 5TSDA 4J2OA 3W1VA 5MGBA 1NX6A 3M6IA 4I08A 3OJEA 4RPHA 3VDQA 1HE4A 4CMHA 4JP3A 1ULUA 1VKNA 2ZTUA 1OC4A 4CMAA 2PFGA 3CINA 3OMLA 3PIDA 1ZKMA 2PGLA 1N1EA 5KJCA 2O3UA 3AUTA 3PXXA 5L7TA 2BRUA 1WDMA 2V6FA 2BMAA 1KERA 2WTBA 1C0IA 2AW5A 1DFHA 4IQ8A 3ZNPA 3DBHB 3W4KA 1UDBA 1X0XA 4CLXA 5BNIA 4FQ8A 1SPXA 2NM0A 4FN4A 1KY4A 4BVAA 1N9GB 2Q2WA 4NBUA 1ISHA 3PVZA 3JQ9C 2GF2A 5A9SA 3A06A 1W8DA 1X7GA 3C3XA 3DMTA 1UXGA 4O63O 3JQ7B 1L7EA 4EW6A 1TI7A 1E7QA 3PJGA 1UZLA 3MJCA 1LNQA 3RUAA 1VRWA 3W8EA 3GVCA 3NDIA 4AFNA 1ZXBA 1DC4A 2PH5A 3ZCXA 3OJFA 3GVPA 4GSKA 1SAYA 3WGQA 3PQEA 4UULA 5DBFA 3JYPA 1QSGA 3D7LA 1FJHA 3N58A 2CFCA 1M76A 4XKJA 3HN7A 3RC9A 3EC7A 1LA2A 3F47A 4E21A 5TT1A 5CDSA 3WSVA 1U2DA 3PTZA 1G0NA 3LU1A 4DIFA 3PJFA 1Q0HA 1SOVA 2R00A 4KZPA 2X9NA 2HSDA 3C24A 2RH4A 3DZHA 2DTEA 3QP9A 4J4HA 2B4RO 4I5FA 1AHHA 1B2LA 1XQ1A 4JBIA 2VUSA 2EGGA 2CUKA 2J6IA 3QY9A 3NYWA 4GX1A 4O59O 3KRTA 2G5CA 1FDSA 3GNTA 3GN1A 2QHXA 3VKVA 3WYEA 4HX5A 4NZ9A 3V2GA 3KHUA 3B1FA 1IULA 1IZ9A 4ZQEA 4KWHA 4HNHA 4PLGA 3WR5A 3D4OA 3PLRA 4I5DA 5JO0A 3GPDG 3Q2IA 3DO5A 2CSUA 2Q45A 1CQIA 4IDEA 1Q7CA 4YQYA 4DXHA 3KM0A 1Z73A 4XYBA 4CUJA 1ID1A 3BTOA 4GLOA 4TKLA 1J4AA 1UH5A 3GEGA 4FFPA 4Z0HO 3LF2A 5ENDA 4XDZA 3NJ8A 1B3BA 3LT2A 1ENOA 3H5NA 4O1MA 3RJ9A 1L1FA 4AJOA 4R3NA 1E1LA 2NTJA 2X6TA 2IYPA 2VCYA 4WLVA 3SC4A 4XGKA 5A9TA 3OF2A 3I9KA 2JD2A 4J16A 3PJEA 1AGNA 2EXXA 3BMOB 2O50A 5TJHA 4TKMA 1OMOA 4AJKA 3FNGA 3A9WA 3GQVA 3UOGA 4TZTA 3CMCO 2Q2QA 5TLSA 2VYNA 3JD2A 5JMPA 1XYGA 2IXBA 2VWHA 2Y1DA 2IE0A 3SJ7A 3L6EA 3I6IA 4FC7A 4J6FA 4J4BA 3BZUA 5COBA 2G76A 1I32A 3P2YA 2NQTA 3RUDA 1ZJZA 1R4MB 3FPCA 4UUMA 2GZ3A 1MFPA 4IDGA 2ZK7A 3GN2A 4J1TA 4WKGA 2XXJA 3PYMA 2VWGA 2PV7A 4PCVA 2HDHA 5IZ4A 2C5EA 4GAEA 4NFHA 2JAHA 1LDMA 3HDHA 2WMDA 3UF0A 1C0PA 1GPJA 4MVJP 3WIEA 3CPSA 3BA1A 4BUCA 1NVGA 4EDFA 3H9EO 5CEFA 4IM7A 3ROMA 2GZ1A 4D79A 1IZ0A 4YAKA 3ZGYA 3DZJA 3L4BA 3PYLA 4BV8A 1YDEA 1N5DA 4L4RA 3ICCA 1QLJA 2YUTA 3DB2A 4O0LA 4INAA 4DMMA 2OP0A 3AY3A 4C4OA 4LK3A 2FMUA 4PLYA 4RJTA 1WAMA 1LLDA 4NBTA 4BO1A 4FFOA 2DT5A 1RKXA 4GMGA 1Y8RB 1Q0LA 1T4BA 2BGMA 4WOJA 2YY7A 4ITUA 4FCCA 1F8FA 2IZ1A 2YZ7A 1XG5A 2OGUA 5A04A 4WLNA 1QYXA 2Y0DA 1U7TA 1K5HA 1BMDA 3V8BA 1E92A 1ZZEA 3R3SA 4MDHA 4ZRMA 1LC0A 1PJCA 2DBQA 3DTTA 3ONFA 5JO9A 2VUTA 3BMCB 4CV2A 2GASA 3GGOA 4P8RA 1A27A 3OIDA 4NK5A 5L9AA 1I33A 4JN6B 4MKRA 3GRPA 1VC2A 4XR4A 4JBHA 1I30A 1ZEJA 3FNFA 3ZU3A 3IIEA 3NX4A 1PL8A 5L53A 1PGNA 1EQ2A 4CPDA 4DREA 3WQRA 2WM3A 3U4IA 1E7MA 5U4QA 3PI7A 4MVJG 2HO5A 5ER6A 1WPQA 3ITDA 5CP8A 1MX3A 2OFPA 3BHMA 3ITKA 4MP6A 4E6PA 3IS3A 1JDJA 2HMWA 1ZVMA 2Q1WA 3AK4A 4ND1A 4ILKA 4XZ3A 3PYXA 4XQEA 1QG6A 4U6SA 4CQLB 1ORRA 2YHIB 3I4FA 1ADCA 4M89A 3PHHA 4HFMA 4ND3A 3H3JA 4DLLA 1AXGA 3JYOA 3DZFA 1C1XB 4TVBA 3IMFA 2JCVA 5G4KB 4RV9A 4UEJA 1PZFA 5ADHA 3LC7O 3WTCA 2X86A 1ZK1A 3PPIA 4A2CA 1B15A 1KS9A 2I3GA 2I65A 1YB1A 2NNLD 3TOXA 1I3MA 4CM4A 1YQXA 4QEDA 3EAGA 2P9CA 2PKQO 1QKIA 1CERA 4IDDA 4BNGA 2G1UA 1E7YA 1K89A 2ZB8A 1ONNA 4XJSA 3PP8A 3PHIA 4GL4A 4CLDA 2GUGA 1ZH8A 4XIYA 3WS7A 1DHRA 4ESOA 5GMOA 3ZV4A 3TOZA 3OBBA 4I9UA 3HDQA 1U3UA 2BHLA 1NQ5A 4K26A 3TDKA 1CQJA 2EJVA 1V3TA 3WMWA 2V6GA 1GQYA 1CDOA 2FN7A 2O7QA 4AJ4A 1Q7BA 3NDRA 1MLDA 4XA8A 5JMWA 1NM5A 2D59A 1NFQA 4YJHA 1H93A 5K0ZA 1MB4A 1GU7A 2UVDA 4IDFA 5KTKA 3NRCA 3WB9A 1ONOA 4XJTA 4WLUA 4IS3A 4IMRA 4BB6A 1VE9A 1I36A 1DRVA 1GZ3A 4XD2A 3RJ5A 5JBIA 5L4SA 5JYDA 5TQVA 4FFLA 5IZCC 3A4VA 4NFYA 5T57A 5B4VA 4GPD1 4D3FA 3UUWA 3HHPA 2B5VA 4L0QA 1CYDA 4CMGA 3NV9A 3R3JA 1YWGO 3I3OA 3M2PA 1HLDA 5HWSA 1H9BA 4YT4A 1E1MA 4GX0A 1AUPA 3F4BA 3OIFA 3BYZA 3TRIA 1UDCA 1PZHA 1R15A 5ILOA 2AEFA 1O95A 4TRNA 1LJ8A 5JPIA 5CAEA 4U6QA 4BO2A 4QTZA 3R6DA 4FOOA 4YT2A 1P0FA 3HDJA 2I67A 3E6AA 3AUUA 3GDOA 2FRDA 1R16A 3MJ4A 2GZ2A 1K6JA 2AHRA 2NQ8A 3D5QA 3NEPX 1BG6A 1E5LA 2QW8A 2B35A 3MCVA 3LT1A 2OXIA 3WMXA 4E2XA 3PEFA 1E1KA 3IQDB 2YFQA 4MINA 3AM4A 3ROPA 4ID9A 3MTJA 5HBRA 1UUFA 3LF1A 3TZ6A 3D3WA 1P44A 9LDBA 1MGOA 4LW8A 3HWRA 1NP3A 1TA4A 2X5OA 4PLVA 5U1PA 5KCZA 2GN8A 3H5RA 4AJLA 2ZQYA 3KYDB 1EDOA 1HT0A 4AJIA 2VTEA 1DLIA 1OAAA 3PDJA 3L07A 3IC5A 3CEAA 1TVEA 1ISIA 5JDIA 4J1NA 3V2HA 3G79A 3EY4A 1E77A 1X14A 1EQUA 4NU6A 3VH2A 4WLOA 5JC8A 1PL7A 5BSEA 3VDRA 1K6IA 8LDHA 1U4SA 5HA5A 4DWVA 3M1AA 2E49A 5EJ2A 4E0BA 4F46A 2POQX 4RF5A 4WCDA 2QRLA 3V1YA 4EJ0A 4MVJF 4PZEA 5J23A 3ZH2A 4M55A 3D3EA 3KLMX 1ZXLA 2H1SA 4K28A 4QUKA 2D5CA 5KKCA 1U1IA 4CLOA 3ZWMA 1XQ6A 3RU9A 3W8DA 1XSEA 1ISJA 1HXHA 2X1HA 1LLCA 3QVOA 4UEOA 1IUKA 3IJRA 1A71A 1HE2A 5AXBA 5EIOA 3RUHA 5G4KA 3V2UA 2YV1A 3SXPA 3JQAA 2ZATA 1OZAA 3AOEC 4CM9D 1DFGA 4MO2A 1YRLA 4LSWA 5L4LA 2ZQZA 4LCJA 3JQGB 3STHA 3INRA 4R1TA 1IB6A 3E48A 3UN1A 4EGFA 4DIOA 4BNXA 2GN6A 3E9MA 1YBAA 3OEWA 1WZEA 2C54A 2O4UX 4AJHA 3SJUA 1HDRA 1N1GA 2IRWA 4UVDA 3HB4X 4LVCA 1Z6ZA 2VT2A 4IDAA
chains in the Genus database with same CATH superfamily
5JMOA 1ZD3A 4LYEA 3BDVA 2FI1A 4PCLA 3UT5B 5C5CA 3QK7A 1N5RA 3KELA 1G1AA 5FWNA 4UXIA 3VYTB 3B48A 2V54A 1JR3D 5DGCA 3CJTA 5CK5A 3HPQA 4F3YA 1H2RS 4E2YA 2MJLA 1BVYF 1JFFB 1FNCA 2VK2A 2YWFA 1DCKA 1V7ZA 4NVRA 4BVEA 1JN0A 3NTQA 1P29A 1N2IA 1SIUA 2VJLA 2E48A 4I4LA 2XLBA 3GJTA 4ZDIA 5L95A 4RXMA 2VP9A 2QE6A 4W8GA 4A15A 4IQGA 1T0HB 3ORHA 1PZXA 2ORIA 3K6SB 2O2EA 1NJ8A 3WWPA 2J5RA 2A9VA 2QZJA 5IXJA 2Q5HA 4LK2A 4IH1A 4RFVA 1K98A 3FYUC 4JD5A 3D8NA 4RIIA 3ZV3A 5BR4A 4W5QA 3HCAA 5AESA 3HM2A 3GFVA 3GVXA 3ZGVA 4E4RA 1UBGA 2H18A 1R0LA 4LV5B 3VMFA 4B6RA 5J9FA 4C2BA 2D0PB 3U3MA 3AVYA 5B6PA 1XZMA 2B1QA 4QQ8A 4CUKA 3K1AA 4C6HA 5F78A 5A05A 1SVUA 2HA6A 3G7UA 1DEAA 2GLUA 4MW0A 1GAJA 4OLFA 1ZUIA 4LWPA 5DO9A 4HDQB 5G1PA 1VPEA 1XRSB 4BATA 4BUZA 1J22A 1WZIA 5ALSA 3IVAA 3OFVA 1JBQA 2JF0A 1XZGA 1AKVA 2KWIA 1G16A 2PYZA 4GOKA 3JSXA 4R2IA 2ROQA 1STOA 1H2YA 2IZ0A 1K0UA 2O1SA 2MU1A 3CLKA 3PGXA 1O6FA 3LUDA 5MGNA 5LC1A 3NNNA 2HRZA 1FFYA 4U2GA 3D4NA 4E6EA 1VMAA 2IUYA 1ACLA 5A0VA 1YHZA 4DMKA 4EY3A 4EJ6A 4AWAA 3Q3CA 4PYNA 2ZYAA 3O8OB 4ZOLF 1VJ0A 2AFIE 7REQB 1GGKA 1VCOA 1DJNA 2VOEA 4LQ4A 1PG5A 4PW0A 5SICE 5AW0A 4FMCF 3KKLA 5K03A 1B74A 1P4JA 3F97A 3CRQA 1E1QD 3N2GB 1A1VA 1OBCA 1GY8A 2OM6A 1DC5A 1CF9A 1IRIA 1NBME 2CMHA 2CNDA 3HN2A 5FA5A 3VPXA 3KYDA 3AFGA 3NVDA 2AI2A 4DA9A 3JQDA 4EKEA 1FNDA 3G7NA 4NYMQ 3TZHA 2P40A 2ORWA 5IABA 5D2CA 1HNXB 4JUDX 1Y4DE 3BK1A 1XX6A 4IJQA 5TS2A 4KI7A 5HIKA 4JVLA 3J80A 2JIDA 4YONB 1Z0DA 1HWYA 4BJ3A 1PL6A 3S1AA 5A5GA 1TJ4A 5LYYA 3MRSA 4CMBA 3I64A 2IHBA 2CLOB 4NE9A 4B75A 4DR5B 4CUZA 5CVCA 5JT1A 3U4DA 1QVVA 2QTNA 3H7AA 5BOSA 1TUGA 1XRQA 5FUVA 3QFCA 2OV2A 3GUUA 1E60A 2V7PA 3HCWA 3I83A 3NH9A 2ZJBA 4HWOA 4OL9A 3STWA 5ITZB 1XO1A 4ARBA 3EGXA 3UJNA 5L4NA 1XJ5A 1S3FA 1EFRD 1FTGA 4P5PA 3K2IA 3ABIA 1M2HA 3DKKA 2XMZA 4RDIA 1KU6A 1PO7A 1QTIA 3JVVA 1DZIA 3CW2A 2Z2XA 4TRJA 5C8YA 2C77A 4RPJA 4O25A 1AB5A 2VJCA 1ADJA 1CZKA 4O2RA 1O89A 1Q22A 4GRAA 2IC5A 2ZIZA 2EJBA 1AQYA 3NIBA 4IJ6A 4JHXA 4R40A 4B35A 4V3CA 5BQ3A 3ETDA 4Y2VA 3O3OB 2A9FA 2GPAA 2VDJA 2YUIA 4GECA 4W1SA 3T3GA 5AYVA 1I4EB 1ZMTA 3ZJ4A 2X23A 1IZ8A 1GJRA 1P9WA 2EGHA 2REQA 3PUWA 1WMFA 4NBWA 4RHFA 5HQ3B 5JTUA 2O06A 1DS6A 3E9CA 3VC1A 1CJTC 1JH9A 2BFBB 4YJFB 1W75A 3SQLA 5HE9A 4N7MA 1BGVA 2FSVA 3EDYA 4M9QA 1EFLA 1G7CA 2QNIA 2VDPB 3D6TB 3UMJA 1LI4A 4RTKA 2D2FA 1E2GA 2PX4A 1NNEA 1U7DA 1N8NA 1W1WA 2B83A 2CY0A 2HUNA 4B6EA 1QKJA 3H16A 5T3YA 4N41A 4LHVA 1Y7PA 4TS4A 1XZPA 2Y67A 4TL7A 2LW7A 4YCDA 1C4KA 3FFXA 3MUNA 3QF4B 3SZGA 5HHTA 1Y9ZA 2FPPA 2L42A 3INNA 3WOHA 5E3HA 2WZCA 3R8FA 4L9RA 1XEXB 3I8OA 2KLBA 3NHWA 3NLLA 3HNOA 1C3OB 1L5RA 2B4KA 4PX2A 4RJJA 2LZ0A 5FRDA 1M33A 2FR8A 2SKEA 2ZJFA 4QTTB 4RM3A 1V7PC 1CY8A 3BIOA 1FU7A 1O54A 2GJ9A 1XIVA 2O3RA 3EIEA 4KEAA 3VO1A 4YXWD 1CHNA 3MFQA 4PF1A 4RYLA 4TTJA 5IG2A 3DZIA 5JROA 1HE8B 4NBRA 1S8NA 2BFWA 2D3TA 3E9RA 1JYEA 4ITRC 1IWOA 1P4HA 1ULBA 5J2TB 5KYXA 1DMRA 1CUDA 3IV6A 4JJAA 2R60A 5HF9A 2YJNA 1OROA 5ALQA 3PQFA 1CJMA 5J40A 2NZVG 3QVTA 2EIXA 5J5AA 2O2SA 5CIWA 1RYMA 1VRCA 5CDTA 1VL6A 1T9BA 1YCDA 4JQCA 3L7NA 2QD2A 4RENA 2GKGA 3SHWA 1TE2A 3DEAA 1M8GA 3ESZA 4KCGA 3WGUA 4EG3A 4Z53A 2Q3EA 3TBHA 4K6CA 1L4YA 3K35A 5A4AA 2IBSA 2PQ0A 4Q1EA 2FZLA 5ALUA 4OXKA 2ARKA 2VTVA 1NASA 1H2AS 2CUNA 3ZH9B 4BV2A 1VA4A 1OAKA 2BGIA 3JQ6A 3LO8A 3BIFA 4MRMA 3OOWA 3UQZA 4CDRA 1VTKA 5FV7A 4UM5A 4LF6B 1TM5E 4G5RA 2GTHA 3BMQB 3JD3A 5KWSA 1RM3A 1W6UA 1SCIA 4M9XA 5GV7A 1R64A 3R9XA 3U0BA 1C41A 2P9TA 4DDTA 2HRQA 1YZTA 4MUBA 4DUPA 2IL1A 4KSBA 1N8TA 1SCJA 3ZWNA 1WEKA 2NU9A 2Z5VA 3LXXA 1MFZA 4G37A 4B7CA 3AVXA 2JPDA 1T0PA 3DSRA 4WK4B 3RD5A 4ACAA 3DL7A 1C7RA 2XAUA 1KIMA 1DV2A 4HTFB 4FKMA 5LOVA 2HSGA 1UZAA 3B1WA 3H5WA 4JBXA 3K0SA 1G98A 3V1TC 3FTPA 3L7DA 4MWCA 3WGNA 2HM7A 2R7LA 3ZDFA 3T1OA 3L7BA 2JGRA 2JIOA 2VRWA 4LI0A 4BO5A 2IEBA 1QRDA 5A3VA 2O23A 4KR2A 1NJ5A 4OSEA 1U4OA 3L0DA 1MABA 3QIAA 4BN0A 3I4CA 2O4CA 2O1XA 2YH2A 3BGDA 1L5VA 1YUMA 1IEXA 4R7GA 4JK3A 4UVHA 5F9MA 4DDVA 3L4KA 2B8NA 2GM4A 1WY5A 4DHEA 5EIXA 4JQSA 2VUHB 5HXAA 4Q7KA 2JKVA 1HQYE 3K4PA 2OZPA 5I8WA 1CIJA 1RXUA 2BKLA 1W2GA 2K6GA 2PRSA 2WM8A 2FN8A 3GD7A 4CM1A 2C57A 2ZT8A 4TV8A 3TJZA 1JQBA 1EFVA 1R66A 2AJTA 2PMCA 4MW2A 4RL6A 3WZ2A 3DOUA 4CLRB 4IOLA 1XL1A 2E4AA 3NHPA 4GVXA 4XI9A 3WA6A 1LEHA 1T43A 2XUHA 3GFBA 5GJCA 5BW4A 2VRCD 1RSZA 1IDN1 2F90A 3DULA 4IEIA 2HB6A 3KJNA 1GRQA 2RAUA 3ZIDA 3EYAA 3KB1A 2F1HA 3Q15C 1KEUA 5DBIA 2XRZA 3PZBA 5LBIA 1J7KA 5A4DA 1HFKA 2R65A 3CG4A 2IOFK 4LXYA 3UXEA 4CEJA 4EI2A 1X9HA 5JEEA 1YZQA 4Z7QB 1JT2A 1H3FA 3MLBA 3AM3A 5SZKB 4AUNA 1PRYA 3OO0A 2YFYA 3DXYA 2COKA 5JQGF 3IHTA 1I4DD 1AOXA 1KI3A 4EUHA 3H65A 1P7VA 1AM4D 4Q4JA 4HQFA 2XKBA 1A4XA 2B5OA 1CUCA 1HYQA 1UDRA 2PR2A 4J7CA 1GQQA 2HMSA 2UZAA 3MZ0A 2ACEA 821PA 2HBRA 2C31A 3FF4A 4X1YB 3MJHA 4COKA 1XRNA 5JE8A 1NATA 4NPAA 3SBOA 1ZR4A 3FLAA 4IKOA 2HMTA 1Y3IA 4L07A 3F78A 1IQUA 1XA4A 3HM9A 2P27A 3EG5A 3CR3C 2GNOA 5AVUA 1SB8A 1UEJA 1NBEA 2QX9A 3MRXA 4GOJA 4YV0A 4EL0A 1I3LA 3P71T 1YOVB 3H3FA 4LI3X 4L3WA 1BQEA 2I7DA 4QYIB 6PFKA 1DO0A 2V74B 1S0UA 1P39A 3DE7X 1A1SA 1F6DA 2JHPA 3KLBA 4Q6WA 5TGDA 3UB3A 4F4FA 3HP7A 2GEJA 3AHGA 4YLGA 2OWDA 3EASA 1M2VB 5JPDA 5J43A 1KSGA 1TU0A 3TTYA 4QGFA 4BWFB 4DMFA 5C3MA 8ADHA 3L8DA 1VPTA 1EX1A 2F1RA 1ORHA 1WXDA 2IGBA 2P2NA 2QE7D 2YRXA 4GM4A 4MKHA 4R2KA 4DDHA 1JIJA 1NVVR 5MN6A 1DG1G 4RMJA 5A71A 1GZ6A 1AE1A 1PFYA 1W19A 2GN4A 2O8NA 3G2IA 3MIZA 4W5RA 2F3RA 3LXRA 1QFMA 1L5SA 4OHRA 5CVJA 4Z7NB 1ZSYA 2VJOA 1E6KA 5ERXA 3FAKA 1KFEB 2OG1A 3LP5A 1GYPA 1ZWLA 5C8XA 2P3SA 1N2JA 4AT1A 1OTHA 2QN7A 5K3FA 5B2FA 4DM7A 1WSAA 4Z8XA 1JMYA 3KAPA 1YAJA 4X8HA 4BFSA 4QXMA 4OH7A 3AEYA 4Y2YA 2X0JA 4Z51A 4XD7A 3IE2A 1VLQA 2PDAA 3CZCA 1ZJYA 1H5UA 1M1YA 4M0LA 4LZJA 4ROTA 4V0MA 2DVMA 4Y98A 3TKLA 4A0RA 1I1OA 4KACA 4PIPA 3H4VA 2YV3A 2QVYX 4U7DA 3BWVA 3UJ6A 1SXHA 3KD3A 4BVGA 4B4KA 2EJWA 2A67A 2W00A 1MAHA 1PT8A 3JVUA 4MVJA 4AMGA 5B12A 1DRUA 2PXCA 4X85A 3BQMB 3D4BA 4TWIA 1L5KA 2C4UA 3G9QA 4XWGA 5ARDA 5C5IA 1E3EA 1GFWA 1IPEA 2W6MA 3AI7A 3O8QB 3OEHD 4MCIA 4ZVQA 2BFFA 3EBLA 3NXSA 4UNPA 3V5NA 3K30A 2XNDD 3BGOS 5K6RA 5CFNA 1ADYA 2PAAA 2HIHA 5K0BA 2BFAA 5F64A 4AS1A 2GFQA 2HXGA 1XRJA 3CRZA 3L6BA 1NPDA 1N5JA 1N2CB 1KDVA 1VYHA 1XTBA 3CA8A 2AC2A 3O8BA 4B87A 3FLMA 3PEYA 2OBFA 4RWEA 1ILWA 3ZY4A 3VH3A 4GC9A 3W9UA 5AJTA 1KI9A 1DOZA 3BRQA 1U8AA 1J0BA 3GUCA 4OJTA 2ZJ0A 4NMMA 1VL8A 3KYCB 4HS4A 1LDYA 3CRNA 2RJNA 3DMYA 5E0KB 3TLGB 3ZE6A 4BKUA 2Z95A 1UKBA 2P6UA 1SK9A 4U7HA 3SDZA 5F9FA 1ZD4A 4KAJA 1GARA 3SJZA 1LFAA 1SXJB 4NY1A 3V8EA 4C7JA 1IWPB 1E6EA 1XU4A 3PDIB 4TTAA 3SYNA 3TGWA 1W44A 1TTHA 1FLVA 1ISGA 5E6SB 4C0XA 4BY9E 2NUAA 3E3MA 2IIPA 4Y7DA 3ZDRA 4TMFA 2FJ0A 2YCLA 1BXRB 2A1UA 2G1KA 3RO7A 3VZBA 2JH8A 3N3BC 3V4RA 4B8WA 1C4XA 2Q0QA 1Z4PX 1A5ZA 1BRMA 1NX9A 4TMYA 3ZE7A 4EKDA 5BNTA 1HFJA 3JATB 3LFUA 4E70A 5IMSA 3WLHA 4X91A 4RY9A 4RCYA 3GZNA 4QPDA 5AW5A 5ED4A 3T6KA 4BYMA 1U5CA 2QDXA 1DNPA 1HEYA 2C98A 2C59A 2DOKA 3W5UA 1KJYA 2RD2A 4KNWA 1KAHA 4J43A 3SVTA 2KLHA 4V0LA 4B31A 2HF8A 1XNRB 4ZI5A 1M8PA 2IPLA 1XZBA 2UV8A 4AJJA 2ZR8A 4JZYA 4PX5A 2PLFA 5JCJD 4UHEA 2H92A 1VE6A 2G7ZA 2GQ0A 2Y0BA 4F0JA 2XIJA 4MEAA 3V1KA 3PGKA 4MW5A 3REQB 3SE0A 5KC8A 2WV9A 5SY6A 3DMNA 1TJYA 1Z22A 2NU7B 4GDFA 1OWMA 3QQPA 5H5JA 4BZPA 2RB5A 1RABA 3DQQA 2LKDA 4OA8A 3AZQA 2RHRA 2Q49A 2VF2A 1C8KA 2NTVA 3QSYA 1FW6A 5KHLB 2ZWOA 5FL7D 4LRXA 4X93A 4B2LA 1I3NA 2UZ1A 4BBZA 2V7EA 4OV6B 2AV6A 3PNYA 4EFNA 3DOFA 4EGCB 4K0KB 2AF4C 3OT1A 2JD1A 1FLAA 2P4EA 4JC0A 5J2UA 4KGXA 2BFPA 3OE4A 5JHGB 2FE4A 2ZP1A 4P7JA 4BX3A 5JJBA 2QGNA 2E18A 3KTAA 4LZLA 4Z9FA 1AJEA 3KP1A 1HT1E 2H08A 5EEGA 1M67A 1VGRA 4J1SA 3E03A 1NA5A 1QC5A 4TTTS 5H80A 4PSCA 2DR0A 2ID9A 4JT9A 1SGWA 1K66A 2J9XB 3TVYA 1N0VC 3CUUA 3GRVA 3A9RA 4ZOBA 3ZCPA 1WBBA 3LKVA 1I8TA 4D43A 1Z0IA 3HCFA 4PYIA 1QB8A 3NO4A 1C1DB 2VTDA 1BXKA 3OTQA 4LXXA 2I4LA 3IAUA 5KNBD 3HXMA 5LXTB 1E3WA 4I2VA 4H1UA 2QVXX 4MRRA 4R2WA 4J0JA 3LPCA 3V97A 1P33A 4PS0A 4OAOA 3E9QA 3RSZA 3O4JA 3DLCA 3GF4A 1JU3A 2O2YA 3MTIA 1CRZA 2DULA 4OQQA 3MQ2A 2I3ZA 3KJEA 3QFSA 3Q87B 3VBCA 4BNFA 3V4PB 4ZI7B 4ZFNA 4OQFA 4NARA 2PBLA 1GZUA 3HJAA 2XEXA 3BMOA 3UGKA 1IN6A 2CXQA 1ZIDA 2W6IA 3GO4A 4ZHSA 4XQ0A 4U2KA 3Q3VA 1TLTA 4MH0R 3F73A 1FS5A 1G2OA 3M8KA 4ZT6A 4UAGA 2R6GA 2Y6UA 4C7XA 1KC1A 3LSTA 1RYBA 5CVVA 2OQVA 1T36B 2DFLA 3A1NA 1WUKS 1ECCA 1WCIA 2AXQA 3WWOA 2VPXA 1DHTA 1ZJ5A 4F2HA 5BWBA 1PT7A 2VA9A 3FRIA 4AG6A 2AYXA 1VCMA 1KP2A 1LDEA 1ATIA 1JLMA 2JJQA 2QAGB 3EF0A 3OJWA 4HDRA 1M10A 1JECA 1HG0A 3BGIA 1K0FA 5DLEA 1H0RA 3UJ9A 1EBFA 1EXMA 1WBDA 4O3MA 2AXPA 3OESA 5JJKA 2NXNA 4HGPA 4Q1VA 2X0DA 2O8BB 4DBZA 2O8EB 4HK4A 4EPXA 1C9DB 3T94A 3D81A 2GNAA 1NLYA 5TGZA 1HDOA 5LP6C 3UENA 4B2PA 5IVHA 4AXBA 3TWOA 3NH6A 1JHMA 5GOZA 3R5JA 4UU1A 2IHUA 5IN5A 3SN6A 3ZDEA 1T5DX 2BI4A 2D0DA 4QHYA 4WXMA 3ZI0A 4MWGA 4B3XA 4RY0A 4RHYA 5FNZA 2P2YA 3EXHC 1TO6A 2PCLA 2FPGA 2EFJA 3E7WA 4TWRA 3K0AA 1B0AA 4M9CA 4U4AA 5AOCA 3VPFA 5BSVA 1F5SA 4PG5A 4IRMA 4NCKA 3R0ZA 1EP9A 1RPJA 2A35A 1BVUA 1C7FA 4FCWA 4WCFC 1ANKA 2PBRA 3HBLA 2I1VB 3P9RA 3RBVA 1JHDA 1JG6A 2OHGA 4F1KA 3E8SA 2P41A 3KG2A 3DUWA 2DPXA 4YCBA 1HM5A 3MWDB 3N5KA 2NMVA 2O8FA 2VUIB 1CCWA 3S5JA 1OX4A 1XVIA 4GD3Q 4DIBA 3QBEA 4QYTA 2KYRA 4DCGA 1H8HA 4EY8A 1ELOA 1HZJA 1OPRA 1W4LA 2DJ5A 2W4QA 2Z9BA 3EGDB 5EWLB 4Y9TA 5CT9A 5FULA 2C5GA 1EFAA 2G36A 4IDPA 5LQDA 4OX9Y 1BOFA 1P4AA 1M1UA 1Y89A 3IUSA 2V8OA 2QV0A 3K1JA 4NHEA 2JAQA 3H9UA 4BKPA 3I23A 1ZK2A 1E64A 5AXAA 1WW3A 2ZROA 3TLBA 4C43A 3ZWCA 1QKKA 1ZHFA 2IY9A 2IYZA 2QSZA 3A7EA 1UJ2A 3B3QA 3B51X 3DAPA 1RBMA 4I2NA 3C4QA 5BYBA 3O8DA 2F3QA 1WLSA 1WUHS 2H1CA 1ZUHA 2P0EA 1TCVA 1GPNA 4FK8A 4HUJA 4P4NA 4U0KA 4RCZA 1JQLB 1USGA 2B5WA 4MYHA 3MG9A 3MMSA 3D1LA 2AOWA 3AV3A 2X58A 2JZOA 2DBYA 3HXTA 4L8LA 1VYVA 1SB9A 3OF3A 3CEMA 5B7QA 1U8UA 4LSMA 5KX5A 1QWOA 4WBNA 3BMNB 2W6NA 3FYCA 4FINA 3VGPA 4BVKA 4YX9A 2SNIE 1RLMA 4QVKA 3AR3A 4DJ5X 2WHQA 2VHYA 5BMVF 5K05A 4F8YA 2NU6A 3AFIA 4P5DA 1MC8A 1X7HA 2PH7A 4LIPD 1A8IA 5GIOE 4UDXX 3IDSA 2DHRA 4P4LA 4IZIA 4JCOA 2ISQA 4OP3A 4BKOA 1WV0A 1AHIA 1B1CA 4I8XA 3DBIA 3AVTA 1C1XA 1WO8A 1E7SA 1Y80A 2QW1A 3A3KA 5AM3A 1Z38A 3EMKA 1GTL1 4TLBA 4MW4A 4B3BA 1K27A 3BF8A 3NTXA 3GJXC 1OILA 4PSAA 3PUVA 2ID4A 1NU6A 3IOYA 3NPAA 4O29A 5E9JA 5AR1A 4A8JB 5JZOA 5H82A 2ZUUA 5IK2A 2BRUC 3W7VA 2NNWB 4G1VA 4E07A 1UJ4A 2ZM6B 3A28A 2O1WA 3P9CA 3RS0A 6LDHA 4JGIA 4M76B 3D8SA 2IZ7A 3IAHA 2WU4A 1EE2A 4GZLA 4EITA 1NJGA 1BE6A 3N8IA 5JVDA 1QFXA 2O2XA 3GZJA 1IXRC 4LY9A 1NBWB 1UFVA 1DJQA 4DR6B 2JI4A 3PNKA 5TE9A 1ECGA 4LISA 4C4XA 3BHNA 4EHAA 4NCAA 4XJVA 5H0IA 2FUG1 3M4YA 3P5BA 3G49A 2QQFA 3HYSA 5J59A 2DPHA 1R9GA 3DMTC 3SM9A 4LQLA 5WRFA 2WU8A 1RXCA 1V4VA 1WG8A 1RBYA 5KOJB 3PGJA 1U0EA 4RGYA 3KQLA 2G3YA 1SVIA 4F45A 3KE9A 3LHFA 3LYLA 3B52X 1RZRA 2O5RA 2XXAB 4ERNA 3JASB 3RLIA 5DTRA 1FMTA 2ON6A 1PIWA 3COWA 3ZWQA 4E5PA 4YT8A 2WA1A 4PHFA 3FHLA 3PENA 3ADKA 1M34B 2WD7B 3LT0A 4W63A 3M6AA 4IIXA 4P32A 5K0CA 2E21A 2EP8A 4WZZA 2F17A 3RAGA 3AI1A 1WXHA 5KO2A 3KR1A 1GP2A 3N0WA 3U3RA 4MW9A 1P72A 1U2DC 3L1JA 5HRUA 2GFIA 3GBVA 1Q20A 4PWZA 2LIPA 4AS3A 3VH1A 1O0CA 3VBEA 2WF7A 5B36A 2FKAA 4YP5A 4HDNB 1YL6A 3A2KA 5DVZA 1U2RA 3S7TA 1E3IA 2AFHE 2FCRA 4RVOA 4W99A 2RE8A 2NPOA 3PC2A 3RV4A 4CKWB 1EFKA 1USKA 1QIKA 4CZ2A 2BKUA 2H06A 3ZOKA 3I3SR 1RI1A 4RA6B 1DMSA 4J29A 2Y66A 1EVEA 2WYVA 4D4IA 5K09A 4OGWA 3NKVA 1I13A 1QOPB 1MBZA 1OZHA 1KDZA 1ZRNA 3DJYA 1SD1A 3OE7A 5DM1A 5ALDA 1OH7A 2AKEA 4I4NA 2JD0A 3BWYA 3IESA 1YCHA 1JJAA 2H52A 3FD8A 2NUTB 4WUVA 4DRXB 1LRJA 2WIAA 2GAFA 4CL2A 5KKNB 1BFKA 5IFLA 3LX4A 4PPQA 2ZKLA 3LDUA 4QNNA 3J81A 3AGQA 4ZPXA 1FLDA 2BR5A 4BNYA 2G5PA 4JLWA 2Q1TA 2Z5LA 3K09A 1OGYA 2CEKA 3K73O 3LK6A 3QX9A 3T5BA 4PBRA 1KWKA 3FI9A 3SG0A 4Q9LA 2H1RA 3SC2A 2Z6AA 4PG6A 1VYUA 5KYWA 3WGYA 1YR6A 2Y1OA 1W85B 4MK4A 5KTRA 4JXXA 2GCEA 3HVUA 2CN1A 1PVDA 4QBTA 1JW9B 1NN0A 3FZGA 4TLLB 2JA1A 3N8DA 4FOSA 3UCXA 3NM4A 4B9EA 5CDHA 1RYEA 3UFXA 1M7BA 2P7IA 3WE7A 1JDPA 2WF8A 3WBJA 1UT8A 2B99A 2H5LA 3A2NA 4N3NA 2EAUA 3V7NA 3ME5A 4K6KA 4RPGA 4HX2A 4UEWA 3LBNA 1H1DA 5L7YA 4IX1A 2ZYIA 5I5GA 1TA0A 2Q5JA 3IP3A 1EWVA 1QOZA 2FF7A 3K1YA 3P9KA 1RJWA 5D85A 3JQFA 3M5WA 4KOEC 4YI3A 1GADO 1D5WA 1P61B 1XJQA 3B70A 2XB8A 2NSYA 4RK5A 3UXYA 3QWAA 1Z06A 1D2EA 1U0OC 1W36D 3NAZA 4TVSA 3BDAA 1Z74A 1F48A 2FMIA 2W8BA 4U2BA 3EBPA 3ZE2B 2LUOA 1DAHA 2H51A 1Y6FA 5H81A 2KBFA 4PPYA 1UAAA 3GPCA 1L5YA 4MP3A 1WXIA 1QB7A 4B4DA 1U5AA 3DOOA 1K9VF 4DYHA 3WP1B 3L2OB 5HDQA 3ZK9A 1G1MA 1P7PA 4CU2A 1UKEA 1JEDA 1EWKA 2V6BA 4N82A 2CDBA 1GLGA 3VVMA 4UTVA 3IDZA 1YR7A 3QTTA 3LPDA 2VPZA 1KJWA 2WQZA 3EMDA 4LHZA 1EGAA 3NTUA 2OA0A 4QOFA 1E5XA 3OZTA 1IXYA 1KO4A 3OM0A 5BUSA 2C03A 1QZ3A 1KU0A 3U09A 3AEUB 3WRYA 1NJ2A 1CY4A 1ONBA 2PVSA 3DOCA 2XKJE 3MGGA 3R76A 3WKAA 3W9SA 1P2DA 2BTEA 1G9TA 3ZLUA 2IHNA 4P08A 1RAHA 2YX1A 3G0GA 4BASA 2VZEA 4W5OA 4LYJA 3A10A 1N2ZA 4NHOA 1F1BA 1OBHA 2DWOA 2YHBA 2YV4A 4X20B 3CTMA 4YCMA 4MCAA 1XVAA 3NCTA 4PGGA 3SAJA 4H7HA 1PS9A 1U1FA 3UM9A 3MINB 3TZEA 3C7AA 3VZQA 1NOIA 3MBKA 4M0PA 3DLBA 4CMEA 1C0KA 5IF3A 5A3JA 2BKAA 3PUXA 3R1IA 1K7SN 2PPVA 3GRYA 3WRWA 5BNWA 1XD2A 3VDNB 3MB5A 1RCUA 1WXFA 1H5QA 2FYTA 3HUDA 2QZZA 4NEGA 3WG9A 2I4NA 5CFPA 3HUTA 1Y3FE 1SBCA 2WIBA 1VJTA 4HRVA 3NIGB 1EFUA 4RPIA 5ILGA 4LHSA 5KYYA 1JZTA 4DCSA 4EJMA 2I5PO 4PO8A 1RJFA 2G0AA 4FNAA 5FI3A 4ETWA 2CJFA 3W9YA 2ONKA 4I99A 4DB4A 1OJLA 4R8LA 3ZTWA 5H3LA 1HZZC 4LOKA 3KU1A 1MH9A 1WBJB 1XXLA 2NV2B 4INZA 3EQ7A 4U8HA 1BH6A 2ZGVA 1GRNA 3R7SA 1F2TB 1PLJA 2AN1A 2AR9A 2FEKA 3G68A 2B69A 4PSVA 3LKDA 3RVKA 3LRTA 3WX0A 5JQWA 5KTTA 3BB3A 4RNCA 5JBQA 1T5IA 4OMUA 3JSAA 4KFTA 1K2VN 1TZ2A 2XGMA 3IALA 1OXUA 5GJWC 2ZUWA 1KAMA 4ME6A 2M2IA 3PL1A 5IVKA 2NUPA 4BFWA 4PX3A 2ECFA 3TAUA 3G2MA 4IWYA 1XA3A 2A84A 1W88B 1G21E 2VDUE 2BFDB 4GBED 1FP6A 2QUAA 2ZRKA 1U3WA 5EL0A 2A0WA 4BNWA 1CG6A 3LZCA 5LUAA 1FYFA 1CVIA 2ZJ8A 4BJHB 1NLZA 2Z2JA 2NX2A 2H11A 4R2LA 2D1QA 4FE4A 4PN3A 3SWWA 5IWAB 1JSLA 1DBRA 4RD1A 2XDAA 4UJ3A 2WICA 2BN4A 2X1MA 1RADA 2BE7A 3DLIA 1PG2A 3QIVA 4ANFA 3TGPA 4EF6A 2YR0A 1FYDA 1N0IA 4I6GA 4OK5A 3RAJA 4B40A 4DCVA 1KVTA 1ML3A 1P4RA 2NXCA 3GNQA 7YASA 5D84A 3OIYA 1N6IA 1S2IA 1N75A 3DEJA 5A1JA 4Z54A 1PFWA 1YULA 2JHCA 2Q3LA 2YV5A 3W4JA 3ZK8A 1IRXA 2XNSA 3L7KA 2C4TA 2QTVA 3QOXA 4LMAA 1V2GA 1Z56C 1ND6A 5AKIA 5EKUA 5FYQA 1XKQA 5DH9A 5KWJA 4OBEA 4BE4A 5LDHA 3QOYA 1Z4MA 3C97A 1MW8X 1V11B 3DBOB 1J0CA 2FPXA 3N39C 3UNXA 1U8XX 1P19A 3I09A 2BM0A 4XVQA 1AKRA 1TM4E 4RZ2A 5BW6B 1LPMA 4O2LA 4WRRA 5LMNB 3I5UA 3AQIA 2DPMA 2W0SA 2J0EA 3NTOA 1U7HA 1SUBA 3PQCA 1XRLA 4QGAA 1X86B 1T8UA 2XF2A 5HK9A 2IYTA 1MEJA 1D8AA 1PDVA 3FUVA 1YZGA 1XFDA 1HH4A 3C0KA 1JWBB 3GEBA 2JFNA 4M8NE 1EDBA 2R7KA 3LSYA 3C8MA 3V46A 1TAGA 1ZX1A 1G7RA 3QUAA 1CEXA 2EDAA 2C88A 2HO4A 3KR9A 1DC3A 4CM9A 5FOQA 4BP8A 1WDWB 1K2WA 2XUGA 1XJ0A 3S1LA 1Y3CE 4DZTA 5DULA 5IDVA 1YVUA 4PLFA 1V39A 2Z1MA 4PZDA 2VZ8A 1BW9A 2ONZA 5AKXA 1XRPA 4IICA 1X2EA 4QUIA 1BEZA 2GYYA 2FW9A 2WUGA 3EXEB 4ZVVA 3QEAZ 5HEKA 4LXGA 4RZHA 3MWLA 1ZK3A 2C2XA 2RGYA 2J3EA 5JASA 5F77A 4AG5A 1FYWA 2TMKA 1F8YA 4O4IA 4TVKA 1Y9AA 1XHFA 3NVMB 1FL9A 4IGFA 5FPPA 3RRJA 5CG2A 3F96A 2MT9A 1PGJA 4G5OA 3ZJVA 3CX4A 2MCFA 4NJEB 1R9JA 4TL9A 2DLCX 4LN1A 4XPIA 4GWGA 4EPWA 3U7QB 3VKUA 5K6AC 4FLEA 3SBXA 1WOYA 3OA2A 4PEVA 1Z7GA 4QHTA 4RTSA 2FWNA 4LRYA 2DAPA 5F33A 4TQAA 1B26A 5IULC 1E79A 2C7QA 4OGKA 5HDBB 3VDXA 4OI1A 2Q4EA 4YJDA 2ZTSA 4DQDA 2VWQA 4WXHA 1KVUA 3WXMA 2QIOA 3BTSA 2MSKA 1NVFA 3R0VA 1KZ9A 3JQBA 1JXAA 2ZDQA 5LP1A 1U65A 5C9ZA 5MFZA 2PUWA 3PDHA 2W37A 3JAWB 1AZLA 3KLNA 1F7UA 3AF0A 5HFJA 2EZ8A 1RNLA 2YY6A 3QPDA 4PLPA 4CF4A 3U17A 2A9PA 2HJSA 4W1QA 1B76A 3ASVA 3NT2A 4DVJA 3O74A 3DBRB 2WSMA 1GAQA 1SCAA 1ZNXA 2GJSA 3CW8X 4D9CA 1DO8A 3IAAA 4P33A 2GTPA 3W3AD 2YJ5A 3MWEB 1MNQA 3U1TA 4QXOA 3L43A 2EOAA 1HE3A 2M1ZA 2OFOA 4CM4B 4ZK2A 3NVAA 3A6EA 1YB7A 2W22A 3LL7A 3OFND 4DLKA 4QDXA 4CN8A 5H9VA 5A7HA 3MTGA 3T95A 5D7BA 1G5HA 4CTKA 1PEYA 1OFTA 1SHJA 4A2PA 2GPTA 4N01A 1EA7A 4X66B 1K6XA 1Y9EA 4XFKA 3EVBA 2H7VA 2O8DB 1PS8A 5CM2Z 2NLOA 2GRJA 5ALXA 3CO0S 3HK2A 3IULA 4COOA 3VKHA 1B23P 4LNUB 1ZGHA 1ZOOA 3B60A 4MYCA 3AF2A 2G80A 1FOEB 3AUAA 1BFDA 1VKRA 4TTSA 3RFVA 1ZVVA 3OBIA 1G5IA 3URKA 1XUOA 4MQ4A 3T5GA 4UPEA 5E6RA 2Q9UA 3HQ4O 3KD2A 1KDTA 2XD4A 3BH7A 4BNUA 1FMFA 2Q9BA 1S2OA 2ODEA 4JJIA 1FEZA 4XYGA 1E1CA 3SDBA 3T34A 5FV4A 1OZ0A 1UXIA 2WVGA 5GVRA 3ILXA 3S2FA 3QVGB 6NULA 4BMNA 3FOWA 1J90A 3GK3A 4J0CA 1X1RA 3PZRA 1FX1A 2Z57A 3JQAD 1XVLA 1ZBDA 2PXHA 1FJ2A 3UUEA 1RP1A 3V80A 4CIXA 1SHTX 4EYGA 4CIWA 2B6HA 2WK1A 2XT9A 4PSDA 4AJPA 4RVFA 4B3RB 5MDHA 2WKWA 4YMWA 4LFBB 2B1IA 1KY2A 4MDEA 1JE0A 2RK6A 5IBRA 4GOMD 4I1PA 1J2EA 5I01A 1F2UA 1MGPA 3TQQA 2C9DA 4P3YA 2QVGA 1D2GA 4OB6A 3NYRA 4CM8A 4LJ9A 4H17A 3L5KA 4QFMA 4HKTA 3SYRA 2ZB7A 5B1YA 5GZ1A 1QP0A 3OICA 1DAFA 3NAQA 4YRQA 1Z7EA 5LJLA 1FTSA 4KPEC 4OHFA 3IEMA 2DXIA 1GTRA 5FJJA 5AM0A 1KEVA 3HUFA 4GH5A 4DW8A 1U28A 5KNDD 2FG7C 3BXXA 1N6RA 1UEXC 1ABBA 4Q4CA 4N3GA 5TPWB 2VR1A 1E3SA 3FPAA 3VV3A 1ESCA 1LGYA 2DUJA 1U99A 3CR7A 1Z8DA 3CFYA 3IUPA 2AZTA 1ECFA 2H48A 3ECCA 9LDTA 1EX6A 3RANA 1G3MA 1AKEA 2FG5A 2OXRA 2Z0MA 3M49A 5CVDA 2K87A 4J9VA 1D4FA 1L2TA 3WC4A 1HA3A 3VOSA 2IKSA 4MI3A 2VNKA 1GSIA 2OO7A 2FOIA 3KVOA 5DBGA 5SY9A 3D3WB 5HM8A 1UQUA 2IPNA 3USZA 5JEDA 4CM7A 1GA4A 4MWDA 3WJ7A 1K5GA 3VHXB 4FKZA 3ZZ1A 1JNXX 1I3OA 1UJ5A 2CLFB 1NUAA 2A59A 3FVQA 2ZSJA 4XCQA 3UGTA 5ERGB 1FFXA 2ECPA 4FWIB 4MRPA 5EI5A 5DLQC 3EF3A 4D9NA 4UMVA 4ZCPA 1CDEA 3ZX4A 2X6RA 1WD5A 2R79A 2NAPA 3FBTA 2VLBA 3MHPA 1QHXA 3JAMA 3LY5A 3RYHB 1RHQA 2OFWA 3A04A 3EZYA 4DADA 1RAGA 4XGQA 1ARZA 1DKNA 1FSSA 4DWJA 4ZMRA 1YO6A 4R3WA 4MUEA 1LK5A 3EHEA 1YFZA 3BJZA 3C7TA 3Q0IA 3H9CA 2PKXA 2VDKB 3L1KA 1THZA 2D13A 2ZSBA 4MTCA 1M54A 4E33A 3ICOA 2P4QA 4FFSA 2MSWA 2WWIA 4NPHA 4XH9B 4CG1A 4R5HA 4O6VA 3O5AA 5B2ZA 1V5IA 2J0UB 5EIBC 3ZHZA 4M1ZA 4I6EA 1ODJA 5E95A 5A7FA 3PUHA 4LF9B 1U90A 3PRKE 4FB5A 3RRNA 1UBFA 3N9IA 4G84A 4QTUB 1G20E 3G0OA 2PLRA 4ZI2A 1YE8A 3B1XA 3W79A 4A8PA 1QIHA 3OX1A 1SKMA 4Q19A 1LC3A 1L4GA 1ID8A 2F7SA 1UMDB 4FPXA 4F6RB 4UBJA 2BJVA 3OPQA 5FKJA 2E5FA 1QX4A 4KXFB 4OBBA 5JAMA 3CH6A 3RLFA 1YDFA 3CUVA 2FEPA 4HNRA 2TECE 4CTMA 4YEDA 3F49S 2KM1A 3ZXXA 3QXGA 1EVQA 3GLIB 3SSAA 3JQAB 4PNPA 1QGAA 5I7AA 4LUCA 4O5AA 2G08A 4QO7A 1F60A 4MXDA 3AVPA 3VISA 5JC1A 1MB0A 1WEHA 5CCDA 4B34A 4GGPA 1PSZA 3TK1A 4DPKA 1ZAYA 2EX0A 2X76A 3SEFA 1UMBA 2V97A 1GD1O 3KX2A 5EINA 2ZAGA 3PC4A 2WSLA 4N12A 2IZ5A 2W8ZA 5KJ1A 2JI6A 4Y6SA 4DIEA 3AESB 1NKSA 2OCPA 2PMKA 4H1HA 5TC4A 5IH7A 2WWFA 4JKOA 1VOTA 1P3DA 3IKJA 1ZEMA 1G8AA 3P2MA 4G5GA 4P2GA 3MJFA 3WGJA 4EBFA 1GNPA 5E1BA 3BJEA 5EXPA 4YAOA 2FQWA 1Z15A 4CR8A 4YO8A 5H1YA 4MGHA 4U3JB 1KAOA 3JQ9A 4RKFA 2X4LA 4FIZA 3TQSA 2BEVB 1V9CA 3TOCA 1T9AA 1Z4NA 1CUWA 5C5EA 4QOEA 1RI3A 3TG2A 1LSJA 3NHAA 4GEGA 4HDCA 3T5MA 1ADGA 3D2CA 4L74A 4HVTA 5DTEA 1CUHA 4RSGA 1KWGA 1NXQA 1OD6A 2QM0A 2COUA 4EI7A 1XZNA 4P9NA 2MYTA 2YDXA 1ZQ1A 3AR9A 3T7EA 2X5NA 4QYMA 4ALLA 2SCUB 3E4CA 1J49A 1RRVA 5IN4A 5HJ2A 3VVLA 3EGOA 3KV1A 4PZUA 4HBGA 1DG3A 3T06B 3UG7A 4OXRA 1O0BA 1GTSA 2HHHB 2QUJA 1NI4A 1GPYA 1Y7IA 1L7VC 2BELA 2D2EA 3C8HA 3Q7IA 4MW7A 5AHKA 1RXYA 3RVDA 4ESEA 2ADMA 2ZS8A 1NUUA 1Z2EA 2A88A 2BBOA 2VLIA 4HL6A 4K05A 2QA5A 4PO3X 2WWHA 3T3PB 4DQUA 3SNHA 5CFOA 8ATCA 5KOHB 1RMTA 5IBPA 4EO4A 3EC2A 3LFTA 4XYEA 1YDWA 4MNTA 1E98A 1LI5A 2RKOA 5CVUA 5JY6A 5AVXA 1BA2A 3DC7A 1VSQA 2NU8A