4I9NA

Crystal structure of rabbit ldha in complex with ap28161 and ap28122
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
331
structure length
324
Chain Sequence
AALKDQLIHNLLKEEHVPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTANSKLVIITAGARLNLVQRNVNIFKFIIPNVVKYSPHCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWILGEHGDSSVPVWSGMNVAGVSLKTLHPELGTDADKEQWKQVHKQVVDSAYEVIKLKGYTTWAIGLSVADLAESIMKNLRRVHPISTMLKGLYGIKEDVFLSVPCVLGQNGISDVVKVTLTSEEEAHLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords L-lactate dehydrogenase A chain
publication title Fragment growing and linking lead to novel nanomolar lactate dehydrogenase inhibitors.
pubmed doi rcsb
total genus 107
structure length 324
sequence length 331
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4i9nA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4i9nA02
3GAFA 2ZYGA 2PD3A 4B8WA 4D0RA 4B3JA 2NQTA 4GSLA 5AQ1A 3LQFA 3VDQA 2NU6A 3VPHA 4YTEA 1CJCA 4IGFA 4RV9A 3ANMA 1AHHA 2NLOA 3WLEA 3U49A 2CNBA 1HE5A 2HU2A 2OUIA 3I9LA 5CAEA 4ITUA 2O3TA 5BT9A 3GVCA 2PZJA 5BR7A 1DBVO 3GNQA 4B4UA 2CVZA 4W99A 3VDRA 1VJTA 3MJTA 1LNQA 3PWKA 2YDXA 1XA0A 2CDBA 4F45A 4E5YA 1A4UA 2Y67A 2FZWA 3DL2A 3HFSA 4LMPA 3QRWA 2PY6A 4JBHA 2FHSA 1QV6A 4LRTB 5F1KA 2PZMA 4ZHSA 4CJXA 2ZJ1A 1P1HA 1BG6A 4CLRB 3WTBA 3U62A 4UVGA 4HX5A 4NBRA 4OM8A 3CXRA 1LLCA 1NX6A 4WECA 1J49A 2JJYA 4TROA 2OORA 4IXTA 4O1MA 4GWGA 3ZGYA 2FMUA 2OHXA 1Z7BA 3WGZA 3CE6A 1JAYA 5KNLA 4WE3A 4FFRA 2VOJA 4WNIA 4P4GA 2BI8A 2X0RA 4NBVA 2BH9A 5BNIA 4I9UA 3BTOA 1IHYA 4RDIA 3H4VA 4P4LA 4YR9A 4L76A 2YYYA 4IDDA 4BO7A 4Z9FA 2OFPA 4QECA 4RPJA 1P44A 3EHEA 4TWRA 5L4NA 1GFSA 4BNKA 3WWZA 3ZI0A 2AQ8A 2HRZA 3D64A 1O6ZA 3WIDA 2GR9A 3AM5A 2PGJA 1U4SA 2FZEA 3ICPA 4EEZA 3AW9A 2VZ9A 4CR6A 2R00C 4R16A 4XYMA 4BNIA 4R1UA 1ENPA 4KQXA 3VH4A 5BQFA 1KETA 2E6UX 2DTEA 3GNTA 1TI7A 2ZK7A 4UEKA 5ENDA 3WBFA 3UH1A 3IMFA 4YQZA 3Q11A 1WW8A 2QW8A 3PQDA 2BLLA 1LXCA 4NJMA 3NYWA 3W8FA 4FC6A 5KVCA 1P31A 3H9EO 1E1NA 2OXIA 1GCUA 3LK7A 1E3EA 1ZXLA 2XXJA 4I8XA 5F5LA 3ZHYA 4M8SA 2O3UA 1ZK1A 3UN1A 2EKLA 3V2UA 4MDHA 4BS9A 4BKOA 1DFIA 4RORA 4IDEA 4EUFA 3KV3O 2BFMA 3NRCA 3RQSA 1WDKA 3GFBA 3TL3A 1DOHA 2JHFA 3QVXA 5TQVA 1EQUA 4PFJA 3F46A 4YJFA 4F46A 2CZCA 4J7XA 4RVHA 5A5EA 2HJRA 4W7IA 4TKMA 4PLCA 4MPDA 1M67A 1U1IA 2BFOA 3GK3A 4DXHA 4ILKA 3RFVA 3ENNA 4YT4A 1EVIA 4DVJA 4E0BA 4BGVA 1EK6A 1ZKMA 4BNGA 4CLEA 1AUPA 1O8CA 4CMCA 1VSVA 1XELA 4G2NA 4XR9A 4TRJA 1PQWA 3PQEA 4OKNA 5KOIA 1UXGA 3IP1A 3OP4A 5L40A 4II3A 3RFXA 4CM4A 2J6IA 1PGQA 4ALKA 5ENVA 1IOLA 5KVQA 3I9MA 1A9YA 2HQ1A 5BSFA 3I9JA 1W73A 1Y1PA 4P22A 2IXAA 3P7MA 2RHRA 1HXHA 1CERA 1HLPA 3FR7A 3U4CA 1U3WA 1YQDA 3ROKA 1DLJA 4IS2A 4JJFA 2X0JA 3ICCA 5JNLA 3OQ6A 1E1LA 1H9AA 3OFSA 2J3IA 5KWEA 1XQ1A 1NNUA 4M87A 4FSHA 2Z95A 2BI7A 3RJ9A 3RD5A 2O3RA 1YQGA 4EGFA 4BIIA 3QWFA 1CRWG 1BMDA 4RZIA 1MA0A 3AM4A 2P68A 3AI1A 2NSDA 3DFUA 5G4LA 3O03A 4AJLA 5JAQA 3RC7A 1E3IA 4S3MA 5AXAA 1LDEA 4CM9D 3TZ6A 3PHHA 3HQ4O 2BGKA 1QLHA 1JDJA 4J9UE 5HBRA 1Q0HA 3A14A 3EMKA 4E32A 2P5YA 1NQ5A 1LA2A 4YB8A 2VTDA 4GMFA 2NTNA 3JQAD 5COAA 1ZK4A 2CMDA 2HAEA 3NT2A 4J3FA 4MVJD 2BFAA 4H15A 5L3ZA 5ITVA 2WM3A 4EBFA 1YOVA 4BGIA 1EUCA 3RUFA 1N92A 5JC1A 3ZU3A 4I5GA 1OAAA 1UDBA 3S2EA 3WG9A 1MG5A 1RYEA 4LMRA 2QRJA 4L75A 4AJIA 3VKUA 1GPJA 1R4MA 1EZ4A 3UW3A 3E5RA 1LLDA 4BNHA 4F6LA 5JDIA 4WOKA 1K5HA 5KIAA 2Y1DA 4Q9NA 5HM8A 1Y8QB 4KZPA 2LDBA 5CDTA 3QE3A 4WLEA 2Q4BA 1UP6A 1ZH8A 1C1DB 1QKIA 4YVFA 1ZVMA 4CMEA 4DQXA 2JHGA 2XF8A 3EDMA 4FFOA 2FR8A 4Y9DA 1M2WA 2TMGA 3ZHXA 4Q3NA 2DLDA 3ADPA 1D3AA 3BZUA 1LDNA 4R51A 4MIEA 3JTMA 2H5LA 3ENKA 3GDFA 1YO6A 3H9QA 3VH2A 1PJCA 3NGXA 1RM4A 1IULA 3KB6A 3H3FA 4IM7A 3U5TA 1ZO8A 1XG5A 4MINA 4R1SA 1UZNA 2EKQA 2VWHA 3TZKA 5T64A 1PJTA 1U5CA 3DOOA 2PZLA 4XDYA 1CEQA 1MXFA 3FNFA 2QRLA 5I9MA 1L1FA 4DPKA 1GADO 1A71A 2WE7A 1X1TA 4I08A 2WSBA 3O26A 4WLVA 4DMMA 2NVUA 5L45A 1HTBA 1B7GO 1ZMTA 2VYVA 2VHXA 4GLOA 3W4JA 3F3SA 3U4HA 1PL6A 3CTMA 5DBFA 3RUIA 5JAMA 2B5VA 4XD2A 3OQ1A 4DQVA 3W6UA 1BDMA 4FB5A 3WWYA 2AEMA 2VWQA 3PIDA 4XYBA 1HYGA 2O4CA 1HYEA 7MDHA 2C07A 2DU8A 1XGKA 3V2GA 2EJVA 3OQBA 3C7AA 2J8ZA 4G65A 2UV8A 4QO7A 4E5PA 4K6FA 3GY0A 5CDGA 3DQPA 1U7TA 1NTOA 3PP8A 4CM3A 3CPSA 3LT0A 1CWUA 3LT1A 1HE2A 2B37A 3OM9A 4ESOA 5IFLA 5KTKA 5JCXA 3NTOA 4PLFA 1P1KA 2UDPA 3O9ZA 2P9EA 5TNXA 3EGOA 1KERA 4IMRA 4E2ZA 2GO1A 3QSGA 3FBGA 3PHGA 4HADA 1PS9A 1ZXBA 2GASA 3IOYA 5IN4A 3UXYA 1JKJA 3U3XA 3NDIA 3QVSA 1IL0A 2PD4A 4I9NA 2YDYA 3CMCO 1AE1A 4U5QA 4R9SA 1IYZA 5DZSA 2Y05A 3ZU5A 1F8GA 4DUPA 4CM5A 1JWAB 4HUJA 2PD6A 4E5KA 1E6EA 2BKAA 2GN6A 1V6AA 4NU5A 3BMQB 4EJ0A 3TOZA 2QHXA 5A4DA 5JLAA 1RM0A 2I9PA 1BSVA 1HE4A 5G0SA 3P2OA 1ENYA 2UUOA 1MGOA 1QP8A 1NR7A 2CSUA 4JCOA 3JCZA 4DMLA 1YQXA 3CH6A 2QX7A 1F12A 2IZ0A 2ZB7A 2NACA 2ZTUA 4HP8A 1PSDA 4WLFA 1LSOA 5ICSA 3I3OA 3ORFA 4NJOA 2HMUA 1QMGA 3U4IA 4DC0A 1Y5RA 1KVSA 4JQCA 4PLPA 4YWJA 4GKVA 3WJ7A 1R0SA 2CY0A 5BSEA 4J1QA 3PHLA 4M49A 1DFHA 4XGKA 3T7CA 3R3JA 1X1EA 1ARZA 4CMBA 1C1XB 1T24A 4Q3EA 4B7UA 1U8XX 2UUPA 5KVSA 2RH8A 1KIFA 3JQGA 3V1YA 1C0IA 2VNSA 1T1SA 2AEFA 3WMXA 2YV2A 4PG4A 1IB6A 4KUHA 4IS3A 3H9UA 3AI3A 1DAOA 1E3WB 2AHRA 1O95A 3DDNA 3VPXA 1DJNA 5DCWA 1NFQA 2E49A 3H7AA 4CV3A 3FRJA 5JY6A 1TEHA 1C0LA 3HB5X 3G79A 4KUGA 1T2FA 4EEXA 1P0CA 2QQ5A 5I9LA 4MVJE 3EVTA 1Z82A 2OBYA 4KTVE 4OSOA 4PZCA 3ZWYA 1KVTA 1VPDA 4BMVA 4GQAA 1E6UA 2YFHA 3PEFA 1BHSA 3ASUA 1EK5A 3EW7A 3JD4A 2GCGA 4AJOA 3GPDG 3H9GA 3SEFA 3OJOA 4K9DA 1AGNA 4ZRNA 5I9NA 1D4FA 3ITKA 4YRAA 1PR3A 1ZSVA 4GPD1 4OYRA 5JBIA 2I99A 2FR1A 4PZDA 2WWRA 4TMFA 5TGDA 4ALJA 1NHGA 4CV1A 1E7WA 2D4AA 5L4SA 3OECA 3M2TA 1XWFA 3DOCA 3A06A 1SO8A 3DZBA 1F8FA 1UXKA 2JCVA 1XQ6A 3GMDA 1P1IA 1T1RA 2GZ3A 1ZJYA 3NT5A 4DYVA 5JDCC 1DDOA 2BF7A 1KC3A 1QORA 3KZVA 3L9WA 2W2LD 1Y9AA 3FBTA 3N58A 3PZBA 5TT0A 1J5PA 2PK3A 4CQLA 1WNTA 5JYEA 2AG5A 4ALMA 3Q1LA 4R69A 3DAFA 4RLHA 4IQ0A 1Y81A 2P2SA 4GLLA 3OICA 4WASA 5EN4A 3ROMA 4BKRA 4CLOA 1WDLA 3QQPA 4Q3CA 4FGWA 4XRGA 2OO5A 1GV1A 4GI2A 4B8ZA 3DTTA 3KSZO 3VZPA 2GN9A 1IZ9A 3TZCA 1KVQA 2O3SA 3CKYA 2OP0A 1Q0QA 2VNAA 1VJ1A 3OEYA 3GGOA 3F1LA 3WGHA 5TC4A 1YB5A 2C7VA 3C7CB 3BTUA 1TVEA 4BQPA 1JTVA 4OL9A 3DC2A 1HSOA 3GFGA 3JQDA 3HDHA 1U28A 4FFNA 5A9SB 4GKBA 4YJGB 1PEDA 2GD1O 4L0QA 5ER6A 1U3TA 5KCZA 3AY7A 1ORRA 3WX0A 2WTBA 5T57A 5EMHA 4HFNA 4RL6A 4B3HA 3NTQA 3UUWA 3GHHA 3S2FA 4CUZA 1U5AA 3QP9A 4PLTA 1YGYA 3ZWBA 4WOJA 3V2HA 2I5PO 3FCOA 1GYQA 5FYDA 4RPGA 4J0EA 4E13A 2Y66A 3PTZA 1PIWA 3SJUA 4BNXA 3L07A 2VWPA 2EWMA 5TT1A 4KMSA 3C3XA 3ABIA 3FNHA 2Q46A 3K5PA 3FNGA 3L77A 1P3DA 3ZZNA 2IEDA 5F1PA 3PJGA 1KEVA 1H6CA 4BO9A 3S55A 5CEEA 2I67A 1ZK3A 3GRPA 4NIMA 4CQMD 5HTOA 1TT7A 3W4KA 3RKRA 4D46A 2FY8A 4J2HA 5ADHA 4ONEA 4JX8A 3NDRA 1MUUA 3ETDA 4K1LA 3ZWWA 4BB6A 2RHCA 3GH3A 4UEOA 1HDOA 4D43A 3ETGA 4NR0A 4FJ2A 4XGIA 2C5AA 5TRTA 1I3LA 1V0JA 4RVFA 3JYPA 1QV7A 1YONA 1E3SA 2QZ9A 1PGOA 2IODA 2GPTA 3ZWCA 3U09A 2NTVA 3WR5A 5L7TA 3GG9A 3DZKA 1EE2A 2CF6A 3UKOA 1K6IA 1TA4A 3KBOA 1GCOA 5C7OO 1PTJA 1P9LA 2NU9A 4YAJA 1KY5A 2D3TA 2VRCA 1BVRA 2Y1GA 3X2EA 3LF1A 4FPXA 3DMTC 1IHXA 2E37A 2NU7A 1I3NA 4HBGA 2QG4A 4ZQGA 1PR9A 4CUJA 3KTDA 1SPXA 2Q50A 4FDAA 3KYBA 3K8ZA 1Q2XA 3E9QA 4PIVA 2EV9A 3FHLA 4XA8A 2B36A 3UGKA 4IJWA 2P4HX 1ZUD1 1JKIA 1ZK2A 3UF0A 1YS4A 2EXXA 4EZBA 4BKQA 1LDGA 3LYLA 5T67A 3JQFC 1B2LA 1XDWA 4RCVA 3DXFA 4UUOA 3IKTA 1VE9A 3PIIA 3DZIA 4TKLA 4XJSA 2HMWA 1H93A 3DHYA 2JD0A 4J90A 3AK4A 4JP2A 1OOEA 5BNTA 2O4UX 3L4SO 1FJHA 3W1VA 3DBVO 4LVCA 4H16A 3TPCA 2VT2A 4UAGA 3RUCA 3L4BC 5I7VA 4Y6SA 4O0LA 3COSA 4DBZA 4UUNA 2VCYA 4OXNA 1DIAA 1GEGA 1H2BA 2WYUA 1PX0A 3AY6A 4KWIA 2FPPA 3TN7A 4N54A 2Q45A 2Q49A 3RIHA 4BV8A 2C2XA 2XXBA 2YHIA 3UCEA 4CMGA 1GUYA 2AQKA 3QHAA 2FPIA 4AJJA 1YB1A 2ZIZA 4XYGA 4IZIA 3PJFA 3U0BA 2CUKA 3OJFA 3W8EA 2WMDA 5I7EA 3E5MA 1DXYA 5ICMA 2PV7A 3GEDA 1YJQA 3ASVA 5TJHA 2VZ0A 4CM1A 2A94A 4QFDA 3ZU2A 2QRKA 5G4KA 4YXFA 3D0OA 3GEGA 3HUDA 5IXYA 4JBIA 4XR4A 5F3RA 3TZHA 3JD0A 3F5SA 3ZW8A 2I6TA 1I2BA 2H9IA 4L8VA 3BYZA 3B6ZA 1LC3A 3N74A 4M55A 3KUXA 3TNLA 3C8MA 3MJ4A 2IZZA 2CD9A 3WOHA 5A04A 3VPSA 3K31A 1J6UA 2PKQP 2ZCVA 3EY4A 1X0XA 4A0SA 4PLZA 4XB2A 3RAJA 1PL8A 1YJ8A 2Q1TA 2Y1OA 4CUKA 4NHEA 3TJRA 3WMWA 3OA0A 4BNTA 3PGXA 1VSUA 1A7KA 2W98A 1YH3A 2EHDA 3F47A 4R01A 1ZCJA 3T7EA 4Z3KA 2WJPA 4PG7A 5EESA 3CIFA 1J0XO 4GBJA 4GX2A 3ROQA 1R6DA 4LN1A 1FDTA 3PYXA 5GZ1A 2WD8A 1OC2A 1PGJA 3H8VA 3GF4A 2I65A 3ZH2A 1D8AA 2DBVO 4QFCA 1HWYA 1T4DA 1W8DA 4IPTA 3KYCB 1JKFA 3D3WA 1NPYA 3WS7A 3E03A 1TT5B 4BNMA 4OKIA 2FR0A 5F21A 3LVFO 3NT4A 4EI2A 4BNNA 4RDHA 4IMPA 3WFJA 4HV4A 5F1OA 3L6OO 5K6AC 4BGUA 2A92A 3AOGA 2W8ZA 5THQA 3TDKA 1NWCA 3KXDA 2IRWA 4J1SA 4E33A 3GZNA 1N9GB 4O59O 4YAGA 3JD3A 1TXGA 4IDCA 3GG2A 4CR8A 2G17A 1HDRA 4KDFA 4TRMA 2DBZA 1PQUA 5KJCA 1I10A 4KUEA 1B8PA 4QX6A 2Y1FA 5DOZA 4FFLA 4NBWA 1E7QA 3AOEC 4NU6A 5H81A 2YQ4A 3PJEA 1E7YA 4HNHA 2WD7B 5HA5A 5B4TA 4GGPA 2IDZA 3HB4X 4RPHA 1KOLA 2DBRA 2DVMA 2VWGA 4J4HA 4U6SA 4MVJI 3JSAA 4G5HA 3NGLA 4FCCA 4XZ3A 4HKTA 3I4CA 1PJQA 3H5RA 5JC8A 2O2YA 3MWEB 5JDCA 1PJ2A 4J1TA 4NZ9A 1VI2A 3WSWA 3ONFA 2HK7A 1GAEO 2RBEA 4MVJH 1Q7GA 2YQ5A 4R1NA 3KHUA 3GN1A 4CM7A 3DAGA 4RJTA 1W6UA 4AJEA 2GDZA 4Z3DA 2FOIA 4JJGA 1BW9A 1AXGA 3L6DA 5L51A 1MLDA 5JO0A 3M1LA 4IJVA 2ZQZA 1MG0A 3PDUA 1MFPA 1QYWA 3JQAB 3IC5A 4I5DA 3JQBC 2ZCUA 5L7WA 3C85A 2ZTLA 3IUPA 2AE1A 5CPFA 3V8BA 2BHLA 1GU7A 4YJHA 5IAAA 2YHUA 2HO5A 3HDYA 4R4JA 4J1NA 4D0SA 3R3SA 1SCUA 1LLQA 1ZFNA 3PWSA 3ADOA 2Q1SA 4JXKA 5JCJD 3D4OA 5U9CA 3ZV4A 1DC4A 1LLUA 3CZMA 1JAXA 5FI3A 1DIGA 1EVYA 2Q2VA 2D8AA 1NVGA 1PGPA 3H2SA 4JN6B 4BNLA 1MX3A 3DZFA 1QR6A 1EUZA 1OZAA 3LT4A 4R5HA 4EUEA 4GL4A 4YDRA 4DREA 3MTJA 3DBRB 3DBLB 3PLRA 3PRJA 1F0YA 1PQPA 2JD1A 1JVSA 1MB4A 2ZYDA 3Q2IA 4CLXA 2Z1MA 1YRLA 1PZGA 2VUSA 2YUTA 3JQ7B 2VYNA 5A06A 7ADHA 5KJEA 1MXHA 3FD8A 1YKFA 4RF5A 2YV3A 1GDHA 3IQDB 4CLRA 3ITDA 4AJ1A 2GRAA 4DIFA 4BV9A 1LUAA 4IINA 5CDSA 5KKAA 3N7UA 3OH8A 3DBHB 1G6KA 4W82A 1PJSA 2D0IA 1Y5MA 2VYVD 3OJEA 4XJTA 3PYLA 3MCVA 3NAQA 4RO0A 1B0AA 4YT2A 4ID9A 4DGSA 2JFHA 3R1IA 4PVDA 4FIZA 2J3HA 3WGQA 4J0FA 1E7MA 2Y1EA 3PVZA 2QYTA 1LEHA 1DC5A 1RYDA 3BAZA 3I6IA 1HEUA 1PJ3A 4W9NC 1ZEMA 5COBA 1F06A 3HJAA 3SJ7A 4ND4A 1X13A 3GQVA 4M86A 1XU9A 4N5NA 2IYPA 1K3TA 4OOEA 4JGBA 1O89A 1M6WA 5JCJA 4FOSA 3JQEA 1E0DA 2EF1A 2J3JA 3PGJA 5BSHA 3ZWMA 2H1SA 2FSVA 3I1JA 4NMHA 4RQTA 4AL4A 1Z7EA 1W0CA 4WKGA 3ZNQA 5FEUA 4CLDA 3ANLA 4A03A 4INAA 3WGGA 1SOWA 4Y98A 3ZWNA 4WJZA 1KBZA 1P1JA 1VL0A 2OP1A 4LCEA 4NBTA 4BOYA 3DMTA 3KETA 3E9NA 4DLAA 1SAYA 2O7SA 4JP3A 3ST7A 1UDCA 2HMTA 1I33A 2R6JA 4XDZA 3DFZA 1CDOA 4NG5A 3SX2A 2DUUA 3IAHA 3UVEA 1D1TA 1HETA 4AJNA 4FQ8A 1M66A 3IP3A 4I1IA 4MP3A 4PCVA 1KY4A 3G1UA 2GSDA 1WZEA 4D3FA 3BMOB 1VJ0A 4R3WA 3QWAA 2DBQA 3B20A 2VUTA 4IDAA 4ND2A 4LRSB 5LDHA 5A5FA 1Q0LA 1PS0A 2PNFA 2GERA 4IY1A 4PRLA 5DT9A 4EJ6A 3CSDA 2J5RA 4G81A 4RF3A 1B3BA 3GA0A 1VM6A 3K2BA 5EERA 1LQUA 3FNEA 1PJ4A 3A9WA 4FW8A 1SC6A 1NPDA 2VHVA 1P33A 5B37A 3JYNA 2X9NA 1EBFA 3EAGA 4W6ZA 2I3GA 2RH4A 4XIYA 3L4BA 4PG6A 2NVWA 1DB3A 2AW5A 3ZWOA 1SBYA 4JBGA 4MP8A 1NBOA 2C7GA 4QQRA 4TZKA 4B79A 4YYZA 1YE3A 2G76A 1G1AA 4WPGA 3WGTA 1M76A 2HRBA 4MP6A 2VHZA 3W4IA 4CV2A 2OGUA 3GVHA 5A05A 3SLKA 2IZ1A 2HMVA 3CINA 2X58A 4RVSA 5C7IO 1NP3A 5TIIA 2PTGA 3FPCA 2EGHA 1P74A 3F4LA 3T4EA 3IKVA 1EVZA 5IDQA 3M6IA 2Y68A 4TVOA 1T4BA 1GZ6A 2XPCA 1NR1A 1DRVA 1IE3A 4Z6KA 5L53A 4OQZA 3EYWA 3MWDB 1ZNQO 3GR6A 4ND3A 4CLHA 2F1KA 5HRUA 1VL6A 1E1MA 2JAPA 3PZRA 1V9LA 3EZYA 3K92A 3AM3A 3AUSA 4E5NA 1Y6JA 1MP0A 2NADA 5GMOA 4E31A 3WGOA 3F1KA 4GX0A 1NYTA 3FWNA 3AY3A 3PLNA 3D7LA 3RCBA 1VKOA 2YZ7A 3AU8A 4DBVO 5JAZA 4R41A 3K6JA 2C2YA 3VPFA 1RWBA 4M1QA 1OFGA 5B4UA 1TB4A 5EQDA 1DPGA 3A28A 4WEQA 2FSSA 3MJEA 3H65A 1EFLA 3BA1A 2X22A 4LSMA 3VC7A 3GC6A 4B4OA 1GQ2A 3JD1A 2DC1A 4KDEA 1G0OA 1JWBB 4BMSA 4NH4A 4UVHA 4XQCA 3IDSA 4CM8B 4GX5A 2IEBA 3QVTA 5TJ9A 2Z1NA 4FS3A 5A3JA 1GD1O 2ZJ0A 1YBMA 4OXYA 2O48X 3SLGA 1MFZA 4N18A 4Q3BA 1S6YA 2DTDA 2O3QA 3UCFA 1PZHA 1WPQA 5TLSA 1DJQA 4MKZA 2QZZA 4DPMA 1T2CA 2B69A 1LDYA 1WP4A 3WQSB 3IJRA 4DQUA 5K6AA 1FMCA 1Y8QA 4BO3A 3G1TA 1ZEJA 1C1DA 3ZV5A 1E3LA 4E21A 1HKUA 2R00A 3DHEA 1KYQA 4XEHA 4U8GA 3WLFA 3MJSA 3ZWAA 2NM0A 1R4NB 3LC2O 4D79A 2HLPA 5JPIA 1LJ8A 1U8FO 5GY7A 5CDUA 4IQ8A 5A9TA 3OIFA 1X14A 3AOEA 1KEUA 2DFDA 5EQFA 1A4IA 4C4OA 2AE2A 2J3KA 3QLJA 1F17A 3HWRA 4FFPA 4NQZA 1ADCA 1ZBQA 2X86A 2VN8A 1P1FA 1I2ZA 2WYVA 2DAPA 3X2FA 1G0NA 1D7OA 1U9JA 2D59A 3VVCA 4D44A 3F5QA 2VOEA 1CIVA 5ES3A 3VHRA 1QYVA 2DPHA 1UZMA 2P4QA 1Y8RB 1ZW1A 3ZNPA 3ZW9A 3PQFA 2GN8A 4Y6RA 2B4RO 4IDGA 1X7DA 3GT0A 3WQRA 3Q2KA 3S8MA 1RPNA 5HS6A 5MDHA 4BO1A 5DDIP 3RUHA 3MJCA 1ISGA 5IN5A 4J7CA 3RROA 4L4SA 1AXEA 1SOVA 1VKNA 5GZ6A 4ALNA 4HFJA 4L73A 1L7DA 3K30A 4OAQA 4NFYA 4CQMB 2DT5A 5IG2A 3JQBA 4J91A 5BNFA 2W90A 3NX4A 3OSUA 3BMCB 4X54A 5A02A 4OIMA 4PVCA 2EW8A 3PWZA 4TSKA 4CR7A 4ALIA 3B1FA 5FI5A 4L4XA 1NAHA 4XQEA 3OHSX 3V5NA 5A9RA 2PA3A 4A7PA 5A1TA 3C7DB 1I2CA 2X0NA 4JIGA 1DIHA 3RASA 2POQX 1YDWA 1JW9B 4UVDA 2JAHA 2PLAA 1LX6A 1CETA 4XKJA 4ZA2A 1PJBA 3A1NA 3WFIA 4FC7A 3I5MA 1E77A 1WWKA 1WLYA 4IUYA 3ZNNA 6ADHA 2VRCD 1P1RA 2D5CA 1HE3A 2NVBA 4BKUA 1HDYA 4H7PA 4EITA 5DBGA 1NFFA 1FXSA 2X8LA 5DULA 5IDWA 3E1KA 5JS6A 1H94A 1XYGA 1KVRA 1QXSA 2VRBA 1LSSA 3GGPA 3PI7A 2EW2A 2LDXA 3G3EA 3HSKA 3RFTA 4KQWA 3DMYA 1HL3A 4Y6PA 3GUCA 4LISA 1YXMA 1XSEA 4AG3A 3ETEA 2BRUA 4M54A 3UFXA 3BMQA 4UULA 1JA9A 2J5QA 1UDAA 1ISHA 2AA3A 1A7AA 2V65A 2BMAA 5KJ1A 1GUFA 1NQTA 5B1YA 2ZQYA 3R6DA 3FN4A 3GGGA 1XEAA 4W7HA 5CHEA 4AJKA 4OXKA 1Q7CA 3ZV3A 2R2GA 4I5FA 1JN0A 1YVEI 4GGOA 1N1EA 4OSPA 2Z5LA 4J16A 2ILTA 4IIUA 1O9BA 2ZB3A 4CM8A 1UJMA 3P19A 1DLIA 1I3MA 4W9NA 1LI4A 1MC5A 3E6AA 3WBBA 1ENZA 1C1XA 5U1PA 4WUVA 5C37A 3NUGA 5TX7A 3D4NA 3PFFA 5BSGA 4P4NA 4RF2A 1PZEA 1CF2O 4A2CA 2VHWA 1B16A 5H82A 4GMGA 3QVOA 2X9VA 2E4AA 4WK6A 3FF4A 4F3YA 4ND1A 3CMMA 4UEJA 3RBZA 2GZ1A 4HFRA 3NJ4A 1W4ZA 3OJ0A 4PRKA 4TRNA 3GHYA 3L9XA 3EZLA 1B26A 2ET6A 1N7HA 1E3WA 3Q0EA 2G0TA 4FD3A 1RKXA 2DM6A 5IZCC 3GVIA 3PPIA 3Q9UA 4CM6A 4B4WA 4CODB 1IPEA 4YRDA 2CDAA 3DONA 1U4OA 1O94A 3E82A 2Q1UA 4N7RA 1SEPA 3JQCA 2C59A 4YRBA 3C1AA 3HZZA 4QEDA 3I23A 3AUUA 3PHJA 1K6JA 3GEMA 1VL8A 3ANNA 4J4BA 4DLLA 4GX1A 4JNKA 4RLSA 4ZQBA 1LRJA 2HMSA 2NNLD 5EINA 1NASA 1UXHA 1YWGO 3FTPA 5FFFA 1EBUA 5C5IA 5LCXA 3DB2A 4BO4A 3GNSA 2NQ8A 5KJFA 1MV8A 1PWZA 3RBVA 1I36A 4L9RA 3DHNA 4NJMB 5DP2A 4E12A 1VLLA 3VKVA 4WEOA 2VT3A 4M89A 4FGSA 3HNPA 4B3IA 3C1OA 2C54A 3NEPX 3F6YA 3WTCA 3LC1O 2JCYA 1XU7A 3ZNOA 2G82A 1EDZA 1FDWA 1KC1A 4MO2A 4GVLA 4AICA 3H2ZA 1X7GA 2QYSA 5L4LA 5EJ2A 1H9BA 2WYWA 3I52A 4DL9A 2X0IA 1UXIA 4YJFB 3RUEA 4A5OA 1O5IA 4Y8VA 5DN9A 4EDFA 4YAIA 3GVPA 2GYYA 3OEWA 4U0KA 1J4AA 4DYDA 4JJIA 4UVIA 3L6EA 4MVJM 5JXWA 1PZFA 4ZICA 3WYBA 1E3JA 1A9ZA 2PWZA 2AQHA 5CP8A 4Z9XA 3AWDA 2EG9A 3OBBA 4HXYA 1KEWA 4IQGA 4XB1A 4R5MA 4NK5A 3VZQA 4XRRA 2BGLA 4IGEA 1L7EA 1FK8A 1O0SA 2AG8A 1E1KA 3PJDA 2PGLA 1M6HA 1BXZA 5A9SA 3E18A 2FN7A 2DFVA 4YJGA 2D1YA 3LLSA 3G49A 1DSSG 1DFGA 3UHAA 4CM4B 3SBOA 3D4PA 4RZHA 4Z0PA 4GAEA 2G1UA 3ZCXA 1SMKA 4EYEA 1EUDA 2E82A 5HWSA 2E48A 2YJZA 1GR0A 4CMAA 3D1LA 4CMHA 5MGBA 3ZWPA 4OO3A 4AVYA 3ON5A 1YDEA 2I66A 1V35A 1WDMA 4R68A 3PFWO 4WCFC 3CZRA 3VH3A 4DIBA 2CVQA 5L95A 2V7PA 4WNCA 4KTTE 1LDBA 8ADHA 2WEKA 4NI5A 1SB9A 3RVDA 3DZJA 3VTFA 2EEZA 4IIVA 4ND5A 1RM5A 4HNGA 1XKQA 2ZKLA 3A4VA 2RCYA 2XAAA 4MKRA 2ZB8A 5ER9A 3WXBA 1ZK0A 1I5RA 1YL6A 3MEQA 3G0OA 3LT2A 4E2YA 4BNFA 4RPKA 1GQYA 3VH1A 5CG1A 1XR3A 1V3UA 2PKQO 4OH1A 3KLPX 1WXDA 3OIGA 3JYOA 1GZ3A 3ZV6A 1V8BA 1I3KA 1B3RA 4I5EA 3BTSA 4OJNA 4CL8A 1GPDG 1R0KA 3BHMA 1P0FA 2GUGA 2V6MA 1HDCA 2X5OA 1YOVB 4DRYA 4LK3A 2GZ2A 3SC4A 3TSCA 1EVJA 9LDBA 3GVXA 4YAEA 1XHLA 5I8ZA 4Z0HO 1KVUA 2FWMX 3ZN2A 1GYRA 4BUCA 3MOGA 3JQ8B 3UCXA 1PS8A 1HSZA 2C5EA 4KWHA 3H6KA 1R4MB 4XX0A 3OIDA 3UOGA 1WMAA 4BO0A 5T5QA 4J4TA 2Q2QA 5L7YA 2HDHA 3TOXA 1YBAA 4IXWA 1H0KA 5AOVA 3LZ6A 4J49A 1FF9A 4BO2A 2G5CA 3JYLA 1EQ2A 3NV9A 4UREA 1DIBA 1NVMB 1ISMA 1UP7A 1C14A 1B15A 3E8XA 1ADBA 3EVNA 1IPFA 4MJLA 4LGVA 2EERA 1QLJA 3BXXA 4ZVVA 1K89A 4CV0A 3LF2A 3BHJA 3LU1A 3OF2A 3OMLA 3B1JA 3RWBA 1GY8A 2VZ8A 2EP7A 2VYND 4QTZA 4XYEA 4IDBA 2PH3A 3O38A 4YQYA 1Z75A 4W4TA 2Q3EA 3GZ4A 2W2KB 3HN7A 4Z0TA 3U9LA 3JYQA 5T6BA 4QXMA 3KSDO 4J9VA 4BNUA 3QWHA 4BNZA 3ZDFA 1GEEA 2SCUA 4BB5A 2JFFA 3K9QO 1E7SA 3WB9A 1GZ4A 3CUKA 1DRWA 2NVUB 3W6ZA 3DO5A 2J5KA 4BGEA 1AN9A 4GSKA 4P38A 3EUWA 4PLYA 3MZ0A 2B35A 3DEYX 4DC1A 1DIRA 1NHWA 4MIYA 2OL4A 1N8KA 1R12A 3ROPA 1BXGB 3AFNA 4A26A 1ZZEA 1BRMA 4II2A 4E30A 5C3MA 2RIRA 4KOAA 4JLWA 1ID1A 2DUWA 1C0PA 1PU2A 3SC6A 4K6CA 1UAGA 2EKPA 4FR5A 3PK0A 4KP7A 3OETA 4PLHA 4AJHA 5I8WA 3TFOA 1ZMOA 1I0ZA 1R66A 1JVBA 3GMSA 1GTMA 3DR3A 3GAZA 3ZHZA 1P77A 3I9KA 2OZPA 2P91A 3QVWA 5DCYA 5AXBA 4CMIB 1K6XA 4F6CA 4ZD6A 1T25A 2Y99A 5G2OA 5DNAA 3KEQA 1HF3A 1LC0A 3GDOA 1UR5A 4JK3A 1LTHR 4WCFB 4NK4A 2HUNA 1QSGA 4YT8A 3D3EA 3MTGA 4OMUA 1HDZA 2B0JA 4R54A 1BGVA 1C0KA 1YB4A 2I76A 1N2SA 5CEFA 1NVTA 4E2XA 1ADFA 1GL3A 1ONNA 3GDGA 1VRWA 4QSMA 2FRDA 2VUUA 3BHIA 1CYDA 3DZGA 1DC6A 3KSUA 4QT0A 1T26A 1JU9A 1A5ZA 2AQIA 2O2SA 5T8KC 5JYDA 2NU8A 1PGNA 4PZEA 2YV1A 3OA2A 4FN4A 3RC9A 1QRRA 1RM3A 4BO5A 4PG8A 3INRA 1HDGO 3JQ9C 3KYCA 1LSJA 1B8UA 1HZJA 4ZN6A 2C29D 9LDTA 1NM5A 2A9FA 1TT5A 2JCXA 4IZHA 2EGGA 1LQTA 3QW2A 1QYXA 4N5MA 5H83A 3GOHA 3AJRA 1H2HA 3H5AA 4EUHA 4Y67A 1MC4A 3M1AA 3KYDB 1E5QA 2Y93A 4PN3A 3R0IA 4FFMA 4LW8A 1T2AA 3HDJA 5IZCA 3MOIA 4PLGA 2X9GA 1N9GA 4ROSA 3JQGB 2UAGA 5K0ZA 3QWIA 3DOJA 1Z74A 3DTYA 2IE0A 5U4QA 4E5MA 3JQ8A 2H6EA 2HKIA 4YAKA 1CQJA 4E2WA 2XOXA 3QA9A 1P45A 4DWVA 4LVUA 5I7FA 3O4RA 3C24A 3K73O 1D1SA 2UVDA 3L0DA 2Y0EA 3H9JA 1BDBA 4Z9YA 2HJSA 1EE9A 1ZJZA 4BVAA 3K2EA 4A73A 3JQ6A 4PG5A 1QYCA 2WD7A 2O7QA 3EC7A 4HY3A 4MVJG 1JLLA 1BVUA 3WDSA 4CMJA 3Q3CA 2EIHA 4N5LA 1Q7BA 3F9IA 4YBZA 3JQFA 4RPLA 3WNQA 5KVVA 1NQAO 3FTNA 4XQGA 4EJMA 1C3VA 4E4YA 4URFA 1SEVA 3VZRA 2NWQA 1DO8A 3LLVA 2JL1A 3WQQA 2W2KA 1DC3A 3S2IA 3TQHA 1CQIA 5G0WA 3F4BA 1GYPA 4GVXA 4CM9A 3OJLA 2VQ3A 4AJPA 2QIOA 5CFZA 2A4KA 2IYOA 4RVUA 1PJLA 3NJ8A 4J43A 4QUKA 1HT0A 3HFGA 4A10A 4AJ2A 1DEHA 3Q6IA 1ENOA 3JQAA 3BMNB 3SXPA 4MVJA 4OHUA 4O63O 4RF4A 1H5QA 4U6QA 1EEHA 2X4GA 3U4DA 4ZGWA 3S2GA 1LU9A 2OBNA 4CQLB 6LDHA 5IDXA 3KO8A 3VOSA 2P9GA 2X23A 3WYCA 2ZYAA 2X1HA 1BXGA 1N1GA 2X6TA 2O3JA 3GN2A 4NPCA 4CLOB 2RAFA 1N7GA 4TQGA 5J23A 1I24A 1OC4A 1UH5A 5JE8A 1DAPA 2CFCA 2EJWA 3LDHA 3VTZA 3WICA 1A27A 2X5JO 4XWYA 2B4QA 2NV6A 4RVGA 3K96A 2HK8A 5HS4A 3VVBA 3ZHBA 2F00A 4ZQHA 4WLOA 2O50A 2H63A 4RVDA 4S1VA 1NXQA 4R3NA 4J2OA 3HHPA 1PWXA 3E48A 3DBRA 3DBLA 4YCAA 4BNVA 4CMIA 2NTJA 1HDXA 3TF5A 2ZB4A 5JO9A 3QIVA 4L4RA 4TVBA 5GZ3A 1T2DA 1QYDA 3V1TC 3JQ7A 2UYYA 4D3DA 4WCFA 3RJ5A 1GQQA 3WYEA 1NQOA 3RU9A 1WZIA 1NWHA 2D5AA 4FBGA 2VTEA 5FF9A 1K0UA 4IDFA 3INTA 4AFNA 3RC2A 4NDNE 4DLBA 3DBHA 3H5NA 4UVEA 5A03A 4ZQFA 2V6BA 3B70A 4J6FA 2YFQA 1YBVA 3I4FA 5LDGA 1ULSA 2BFPA 3ZWVA 4DTIA 3M2PA 3QWBA 3AUTA 3NTRA 4D41A 5B4VA 1I32A 1ZSYA 1LDMA 3PXXA 4BL5A 2Y0DA 3D5TA 3SVTA 3C1TA 1U3VA 3JD2A 5IZ4A 2V6GA 2HCTA 4UUPA 4DIOA 5IXSA 1KEPA 1K2WA 4DPLA 4XYLA 5IJZA 2HK9A 1LRLA 3ONDA 3FSRA 4Q39A 5THKA 3AU9A 4BO8A 3KRTA 3PDJA 4B7CA 2PH5A 1R16A 2DTXA 3EK2A 1A72A 4FJ0A 1UXJA 5C7LO 3KYDA 5CEJA 2AXQA 4PGFA 1HYHA 4D42A 1KS9A 5F5NA 4BKPA 1ZIDA 1H6DA 1SNYA 4OQYA 1LBEA 1E7RA 2DPGA 1LRKA 3TRIA 4MIOA 4OOFA 5CDYA 5B12A 3ONEA 4NFHA 5IF3A 5COQA 4IBOA 4NBUA 5K9ZA 2O23A 4FOOA 3WNVA 1YL7A 2FPGA 3O8QB 1ISFA 4GH5A 4U0JA 4OGWA 3BMOA 3PHIA 4PLWA 3V1UA 2HSDA 1EDOA 5JAIA 5IDYA 1T2EA 2W4QA 1NFRA 1Z6ZA 4C7KA 4A27A 1SB8A 1XCBA 4XIJA 1U2GA 3I9NA 1WAMA 3FPLA 1E6WA 4XQ9A 3RKUA 1BXKA 3I9OA 4ALLA 2P5UA 2V6FA 4C7JA 3H3JA 3Q9NA 3ZWXA 4BMNA 5EL0A 4MOWA 3FI9A 2CF5A 1H6BA 4XCVA 3HE3A 4B4VA 1PL7A 3E9MA 1X15A 4FJ1A 4K26A 5FWNA 4UUMA 1NPTO 5JSFA 3PYMA 3S1LA 1M75A 5CG2A 5AXDA 2JD2A 4YEDA 4CMKA 2Q99A 5EIOA 3RI3A 4WGGA 3I83A 3P5SA 4DA9A 3HN2A 2Q1WA 5L9AA 3BMNA 3WJAA 3NDJA 2X7HA 1DHTA 1OMOA 1F14A 3TZQA 3TFQA 1S7CA 1XLTA 4PLVA 3QJ5A 2DQ4A 5JW6A 4EW6A 2YW9A 5I7SA 3LSYA 4BNYA 3G17A 3TL2A 2C0CA 4BQRA 3GRKA 2YHIB 1NAIA 2PZKA 3DAPA 3IJPA 1Y7TA 3GUYA 5LC1A 5JMWA 1LSUA 3BTVA 1U7HA 5JMPA 3QV1A 5ILOA 2PKRA 3D5QA 3TWOA 5JY1A 5AYVA 5JFOA 2Y0CA 5DCUA 4AJ4A 1I8TA 1WMBA 4CPDA 3AUAA 3RUDA 5G4KB 4Q3AA 4ZU3A 5TF4A 3T4XA 1E92A 4BNJA 1JQBA 3IIEA 3JV7A 4NFSA 3RBXA 4MKXA 1IZ0A 4D3SA 1HRDA 2DKNA 3RU7A 2YY7A 4U7WA 1TLTA 1EMDA 2NUAA 1SZJG 2OOSA 1GV0A 2CVOA 3RC1A 4WLUA 2GF2A 2CDCA 3GPIA 3IL2A 1ISIA 4B7XA 3LC7O 4TZTA 1IUKA 4CL3A 4ZJUA 5DP1A 1U2DA 3VZSA 1IY8A 3HDQA 1AHIA 1FDSA 4D7AA 1N5DA 2C20A 5T8KA 4MVJP 4L74A 1XIVA 4GWKA 5ITWA 2W2LA 8LDHA 3JQ9A 2AEJA 1I30A 2GNAA 1OBFO 1ML3A 5G0UA 2D2IA 1B8VA 2PFGA 5DF1A 5CPBA 3WGYA 1Z45A 1VC2A 3UAGA 1R0LA 4XGNA 1UAYA 3IUSA 3NKLA 4MVJF 3QY9A 4E6PA 3KOUA 1FDVA 5TSDA 1QG6A 2VHYA 3IS3A 3D3WB 4YT5A 2IXBA 2A35A 5G0VA 4IJUA 4JROA 1RJWA 2GLXA 5ILGA 3FR8A 4BO6A 1V3TA 4D45A 1E5LA 2PR2A 3DWFA 1Q1NA 1X0VA 1R4NA 2GN4A 3B1KA 3GLQA 4QO8A 5JDIC 1BWSA 1EFKA 1UUFA 3KVOA 4RGBA 4I9HA 1ISJA 1UZLA 3BIOA 3STHA 5KKCA 4HFMA 3WGIA 4H3VA 3GZNB 4CMEC 5AVOA 4BNWA 2OMEA 3KLMX 3O8QA 4ZRMA 1Z73A 3MJVA 5KJ6A 2C82A 1H6AA 3KEOA 1ZSNA 5G0TA 3ULKA 1YL5A 4NNJA 4YA6A 1HLDA 5TS3A 4E3ZA 1Y9EA 2WE8A 2EP5A 4TRRA 4LCJA 4WLNA 3I6QA 4RQUA 2ZTMA 3HADA 1ADGA 1Y8RA 4ZQEA 2P9CA 1X7HA 1FDUA 2B5WA 3CEAA 5A3VA 3WIEA 3ZU4A 1U3UA 3AI2A 4LSWA 2WDZA 3INGA 4P8RA 5DOVA 2BELA 2GGSA 2I3AA 3DZHA 4YJDA 4O5OA 3RSHA 1DRUA 1B14A 4J7UA 4R1TA 3WSVA 1ULUA 2Q2WA 5AXCA 3P2YA 5DBIA 3W8DA 2FP4A 4CQMA 1ONPA 4WCDA 3KM0A 5EPOA 3FWZA 2ZTVA 3BMCA 4K28A 2AMFA 2JFGA 3HG7A 2JKVA 1GUZA 1WVGA 4BHTA 2TMDA 2B83A 4O6VA 4R9RA 3RUAA 1R15A 4YACA 3VAZA 1BW9B 2BD0A 1HZZA 4YPOA 3UICA 2BGMA 1I01A 1OI7A 4Q3DA 2PGDA 2B4TO 1BTOA 4IJKA 2ZATA 1R37A 1V3VA 2X5KO 1ONOA 2Q4EA 2Y1CA 4YJHB 3VPGA 1UP4A 4HWKA 1DHRA 3AFMA
chains in the Genus database with same CATH superfamily
5B55A 4IJQA 3BGIA 4PZLA 1MRZA 2BEUB 4YRLA 1HT2E 5HBGA 2CLHB 2AG1A 4NKRA 1VPTA 1XMIA 3OZTA 1D2RA 3TQFA 3D4LA 1NURA 3KJEA 3VDQA 1FPQA 3JZDA 3E2MA 3RIYA 1BGXT 2WWXA 1R7RA 4YTEA 5CLHA 3ANMA 4PYLA 5ALKA 4D4LA 1OT5A 1AHHA 4YMSA 5EGSA 3K9FC 4HNRA 2NLOA 4NZOA 3L05A 2CNBA 1XZQA 2BFBA 1HE5A 3IODA 3MWJA 3I9LA 3C8DA 4FX5A 5CAEA 3RLIA 4U63A 2KBEA 3SYLA 4OXRA 5DYIA 2QAJA 1S4QA 2FCRA 4Z9BA 3SDSA 4O1HA 3VHLB 2HA0A 5B3LA 5IBPA 1WKBA 3FWKA 2ZLBA 4KBFA 1BE6A 3PWKA 3Q8MA 2NXWA 4BCCA 4F45A 5KOHA 2BZSA 5K6RA 1FL9A 1TVCA 5K7SA 4Q7EA 5DX8A 4A3SA 2QRQA 1PWHA 2BBSA 3KUUA 3QRWA 4LYHA 2NO1A 4CJXA 4QUAA 1BG6A 2COUA 2JDID 1Q1ZA 1Q0UA 2YRXA 4GNRA 3OF3A 4HX5A 1RC1A 3AUJB 4NBRA 4JLSA 3T4UA 4HS4A 3K9HA 5HZHA 1BOOA 3CXRA 4BLWA 4DR7B 1RYYA 3VSAA 2O2JA 1IZYA 4EVSA 4IXTA 4QRDA 1A9XB 3KWMA 4QTYA 1E1RA 4MYRA 1PO7A 1UJNA 3ZGYA 3QVKA 4LJAA 1M5RA 1C3XA 1WW3A 1KYTA 5LA6B 1JAYA 4YJ3B 4WE3A 3VPAA 1YR3A 4G0WA 3MUOA 2VOJA 3PCTA 3U80A 3ZJTA 1A82A 2BI8A 4YFVA 4E7OA 2JJ2A 1M2EA 2BH9A 5JATA 5F51A 4UBJA 5CT6A 4O2RA 3KZ1E 1SC4A 4NMXB 4FZ5A 2VPXA 1ZR2A 1GGEA 3QXJA 1MIOA 4YR9A 2HXGA 4KLCA 2GEKA 4BO7A 4HQFA 5DNUA 4RPJA 2QT0A 3IBYA 3OU2A 4TWRA 2VF7A 1GFSA 4JBLA 3G2QA 5L4NA 3UMYA 3JALA 3RWMB 3E81A 2QVGA 4HDMB 5ITVA 1D0IA 3ZJUA 2GR9A 5G02A 4HNAB 5AW5A 4YP9A 3ZE6A 3AM5A 1O95C 2PGJA 1U4SA 3H1EA 2G0NA 2R00C 1LB1B 1R50A 4MI1A 2ZP1A 3KKQA 1P9NA 4R1UA 4BNIA 4KQXA 4MR8B 3CLVA 2ZVPX 4US2R 2VTVA 1G2OA 2DTEA 3M8KA 1K5GA 3KUKA 3QF4A 4X66B 3I72A 2BM1A 2XHEA 1Z88A 3L1UA 3ZK8A 3OE7A 4D4JA 3Q11A 4RAQA 3UIEA 5F3DA 4B48A 1WW8A 2CEAA 2BLLA 4B6EA 1UMCA 1IJFA 5D3ZA 3H9EO 1E1NA 4C1NA 1GCUA 2HREA 3LK7A 1ZXLA 4KWTA 3BWEA 2OHHA 2XXJA 3DB1A 3D9QX 1WXXA 2O3UA 1L8QA 3UN1A 2EKLA 3V2UA 5A3QA 1TDJA 4BS9A 5DHUA 2P9JA 2ZZNA 1YMQA 4U7DA 1IC6A 3FWHA 4EUFA 1JXOA 3F6PA 1WDKA 3GFBA 1EFHA 1DOHA 2RGUA 3LPNA 2J0EA 3QVXA 4A91A 5CVDA 3PNBA 4MQFB 1ZM4A 4DEXA 4F46A 2CZCA 3AINA 3U17A 2V45A 4EGCB 1E1DA 4J7XA 3Q8XB 2XDYA 1K8XB 3WRXA 2OZLA 5A5EA 2ZUSA 1HLGA 2L17A 3CX7A 4KQ6A 4OLJA 1M67A 4N8DA 1T5LA 3T95A 4EECA 3MIIA 2WJGA 1OA0A 4CZ2A 4ILKA 2ZITA 3X1KA 5EJGA 2YN0A 1UBCA 1OV4A 5EJ8A 2RGNA 2DHEA 3PIRA 4B2YA 4K88A 1PBNA 2UZ0A 3LUDA 4IW3B 5DNDA 3V4LA 2OO5C 1KZYC 4R1LA 3V3TA 3RS9A 4OJTA 1UQRA 2DRIA 4BP9A 3BFJA 1YBHA 1VSVA 1T9ZA 1XELA 4G2NA 4LJKA 4PZ9A 4F5ZA 1PQWA 2EX0A 3I34X 4KJXA 4OKNA 3AG6A 2QY6A 2WNHA 3IP1A 3OP4A 4ZVNA 2CFTA 4V1CA 1JMKC 1MQ9A 4Q12A 2O7NA 3LUPA 4QLOA 3E22A 1M1NA 3A7EA 4ZTUB 1Q0TA 3EWSA 3UB3A 2Q3JA 3P32A 3OU7A 5AKLA 4ZCRA 2CLMB 4AKEA 4KN9S 3PTLA 3I9JA 3QHPA 4P22A 4AI6A 4RVNA 4DB4A 4EQ6A 1G20B 3TE7A 1JDNA 3M6MD 1IEVA 1HLPA 3O1IC 3OCVA 2I7XA 4WXRA 4XM0A 1Q1EA 2X0JA 5DI9A 5I6DA 1E63A 1E1LA 4MUHA 1MC1A 3D3JA 2J3IA 4TL6A 5CBPB 1NNUA 2Q0HA 4G01B 3KJHA 4BMZA 1LPPA 2BI7A 2Z95A 3RJ9A 4WTOA 4MQUA 4LHXA 3HCPA 4EGFA 4QGBA 2WP8J 4JAVC 2PMKA 4MGHA 5HRCA 4QC2A 1BMDA 4NDZA 4PZUA 3OM1A 4N7JA 3KDAA 2P68A 3W7BA 4JLMA 2NSDA 1K7YA 5G4LA 4AJLA 3QBJA 5TR9A 2HLDD 3HR8A 4P7KA 5JAQA 3ZLUA 5AXAA 3EARA 4B09A 1IBKB 2HRCA 4H7JA 3BL6A 3TNYA 1RLIA 3WA6A 1NQXA 2Y2UA 2J4CA 2XSZA 1S96A 3KQYA 3O7MA 4KXMA 4B6FA 1PT5A 1JR6A 3CQ9A 1V48A 4MCJA 3ZDZB 1JG7A 2L69A 3A14A 3EMKA 3NETA 5AHKA 1NQ5A 3T9CA 3W0LB 4N9QA 4ANFA 1RWPA 3IQXA 1LA2A 4MVXA 2YRFA 4ZVSA 1KKLA 5A4MS 2NTNA 3JQAD 4J0QA 2WTAA 5COAA 4MVJD 4QPNA 3KQHA 4H15A 5JU6A 2HT1A 2WOJA 5L3SA 1KU0A 1X7YB 4ME6A 2FMTA 4A0HA 3L0BA 4KYVA 1EUCA 1Z0FA 3M5WA 5JC1A 2K4MA 3MXOA 4GZ5A 4L7VA 3N6RA 2FOLA 2ZSFA 4I5GA 2WP0A 1FRVA 1UDBA 4QU0A 2XBUA 2ZYWX 3ZDXB 3LVQE 2CXSA 4AJ9A 4ARVA 2XVMA 2NZXA 1US8A 3CH4B 3ELBA 3U7QA 1EZ4A 3NALA 1DMSA 1K5HA 1ODJA 4MGKR 3JASA 2Q3HA 2HX1A 2BR3A 1UBUS 2NZWA 1UEIA 221PA 2LDBA 3SG0A 2QN6A 2ZUEA 3R09A 2Q4BA 4R8MA 3ZZTA 4CKWB 5HJ5A 4PINA 1XFDA 4FXOA 4KPGA 5JSKA 4B0PA 4LXUA 4CMEA 1D03A 2JHGA 2F3SA 4DLXA 1CQXA 2C0PA 4WMLA 4Y9DA 3DM9B 3ZHXA 5DEIA 2TYSB 3NNDA 3R24A 1TJYA 4MSUA 5BQPA 1KE2A 4MIEA 1AKMA 1NOIA 5C80A 2R4UA 3VH2A 4CI9A 2GZSA 1RM4A 1YZLA 2AYZA 2XRFA 3HB9A 3BRSA 2SICE 4R40A 4F8YA 3KB6A 3EBLA 3E7XA 3RT9A 3ZKWB 3BDVA 3BB3A 4AWXA 2C7QA 1ELOA 5H1YA 3TZKA 4CKCA 1VE1A 5IK2A 2VHCA 2PZLA 4WKBA 3FNFA 2QRLA 3UANA 4JQSA 1A71A 4GC5A 1WXQA 4I08A 4M7WA 4N40A 3HP7A 5AJZA 3BFVA 3MSXA 4OJMX 4CN8A 4DMMA 2NVUA 4PQEA 5L45A 4MVCA 2ZYTX 4F9EA 1RMQA 5B1HA 3PE6A 5KYVA 2AMYA 2BHRA 3EVDA 1EZ1A 4WDQA 3U4HA 5JAMA 5DBFA 5K0TA 6AT1A 4XD2A 4CQJA 1U6KA 2P9ZA 4OATA 5FI1B 3K15A 2BAGA 3TUZC 2VWQA 2O07A 2CXPA 1HYEA 5ADWA 1C9KA 2CB9A 4UZFA 2C07A 3Q3IA 1XYYA 4ZO9A 1XGKA 2JAXA 3TK1A 2XOEA 3FYHA 4QTXA 2J8ZA 1C9EA 4E5PA 1NN5A 1MEJA 4URUR 3VR6A 3NASA 3V46A 1PR6A 1X7ZA 3GY0A 3AT1A 1SIWA 1KYYA 4PPFA 1ZOSA 3FOAA 4AECA 3ER9A 2HW8A 1DX9A 521PA 4E1BA 2C78A 2GVDC 3QJGA 2WJZB 4E5VA 3AEYA 4QEZA 3ZIAD 1NGSA 1T8TA 4F3KA 4KKVA 1CV2A 2FP3A 3LXMA 3E8MA 4K40A 4N8SA 4PGGA 4PLFA 4L78A 4ZOAA 4OHZA 4BPRA 3SC2B 3O9ZA 1PT9A 4B3MB 3OI7A 4ZCIA 4OYLA 1C3JA 2NUTA 2EHJA 1EGMB 4OGLA 3ZXIA 2WYOA 3FBGA 3MRSA 1ZXBA 1HNXB 4YIKA 5EKSA 3I5AA 4X85A 3RTDA 3OZGA 1JKJA 4BMXA 5KX5B 2YDYA 3D81A 3T3PB 3R6TA 1POXA 1YUMA 3WLOA 3CMCO 2WSLA 1EFAA 4BFTA 3IEVA 1CZKA 3AEQB 4DCSA 2H57A 2WUVA 3BAFA 3AJ9A 4JQZA 1WETA 1IYZA 4ZP1A 3MCZA 3Q6NA 1AV7A 1EAYA 3IDOA 3UK6A 4MH0R 4DUPA 1W36C 2ZZMA 4HUJA 4M9UA 3FGNA 3HYRA 4E5KA 5MGNA 1JS1X 2PVCA 4B84A 2GN6A 2WMNB 3ZV7A 3PD1A 4NU5A 4KVGA 2ES4A 1ZOIA 2ZVQX 3FMFA 4EJ0A 1O8BA 3LQRA 3HCCA 1RM0A 4G07A 1Z8NA 4HDAA 3HEBA 1HE4A 2V6JA 5DM70 5JXIA 1U6IA 1HDEA 5JQGF 1U98A 3ZGNA 3BULA 1QP8A 1NR7A 1GIAA 1KI9A 1RPTA 1YZ3A 3JCZA 4JCOA 5EPEA 3U9SA 5LJIA 2PX4A 4A8JC 3JPWA 5EYPA 2FZKA 4DMLA 2VAPA 2QX7A 1F12A 1X2BA 2IZ0A 3EPPA 4N0QA 5DYNA 5FBQB 2Q0XA 3TI9A 2X4LA 3F2IA 4H6WA 3Q9LA 3QELA 1JI3A 4KXLA 5EVCA 3RTBA 3ORFA 1JLHA 2YHSA 3L0ZA 4IOLA 5BOSA 1ZI9A 1FU8A 2G07A 4NOKA 4MI6A 4YWJA 5KTTA 1LS1A 3QOYA 2XTAA 1EK2A 3RREA 1R0SA 4ZGGA 5K4HA 1P8JA 4JJ8A 5ALOA 2VQFB 1V95A 3QM1A 4UPDA 4AYXA 2BFDB 1ARZA 2J7KA 4B7UA 1U8XX 1BWQA 3VTAA 4DJEC 2RH8A 2V7BA 4Y6QA 3V1YA 5EJ7A 3OCZA 2E18A 3IBTA 1HT3A 2P8JA 5KNBA 2OXFA 3FPHA 3DEAA 3HK2A 3LKDA 4R0MA 1F51E 3T1YB 4HN9A 3A3PA 4PG4A 3TSOA 2PSHA 5KB3A 1OXTA 4EJSA 2J59A 3AI3A 5BNWA 5FWYA 3VPXA 1E3WB 2AHRA 4UBKA 2EZUA 3C3PA 1VA5A 1OD6A 4K2AA 3TQSA 2AW3A 1I4EB 1Y42X 1ZJ4A 1TEHA 3FRJA 5GJVC 4YXWA 3SHFA 3L84A 3JVEA 4IJ6A 1T2FA 4L9WA 3KYJB 4LNUA 4MVJE 1HQCA 2BGRA 4PZCA 4UNPA 4C0WA 1YB2A 4XLLA 5SV2A 3ZWYA 2JI4A 2ZPTX 5HKKD 1W76A 3JRWA 1Z6QA 2ZG6A 4GQAA 1E6UA 3OPXA 1W34A 1TNDA 2XUDA 3EW7A 1IATA 3QEAZ 1NMSA 1O4VA 3TLZA 4DUGD 1I4DD 3OJOA 4K0RA 2VZLA 3L2OB 4LF6B 3TTXA 4YRGA 4GPD1 1JIQA 4OYRA 5JBIA 4EG1A 1M34A 1RXUA 2WWRA 3R3ZA 1GFWA 4MMXB 4PZDA 1N77A 3HUTA 2PUAA 1E7WA 3LW7A 1G17A 5TMEA 5L4SA 1UBEA 1WB9A 5ALYA 2QGFA 3R8XA 1WUHS 4OHBA 3A06A 3AZQA 3U1BA 4JR1A 2Q07A 3A3YA 2JCVA 3HABA 3TQRA 1XQ6A 3GCDA 1Z37A 3LUCA 5HIKA 1CY7A 4JFRA 3EXEB 1G3QA 3CLSD 4EG6A 3JVIA 3L8YA 4C4TA 3AL3A 4E88A 5KMGA 4YAUA 1YE8A 1KC3A 1I5OA 3ENZA 3NUQA 5REQB 2HIAA 3RIXA 4BVKA 4RTSA 3FY4A 3IHKA 2ZI3A 1U7OA 3P45A 3WKAA 1J5PA 4BMOB 2XADA 5HUQA 1ORVA 2AG5A 5JYEA 1GG9A 3MB5A 2Z0MA 4Q18A 4PO8A 4XM1A 4ALMA 3C3WA 4TUYB 4EBBA 1I6MA 1HRKA 2IQ5A 2OG1A 1HE8B 2VZEA 3IPAA 4M3NA 3ACBA 5EN4A 1B1CA 4AP9A 4FGWA 1NG9A 2OC4A 3FE2A 1GV1A 4GI2A 2PRIA 1KDRA 1NVWQ 4KYIB 5DHFA 4B8ZA 4E1AA 5BUCA 3L6RA 1ZP6A 2JLAA 3HBAA 1IZ9A 3SXUA 1JDVA 1Q0QA 3KT3A 5ELMA 4LZOA 5LXTF 3DDSA 3PT9A 4UUQA 5HG0A 3PSHA 4WINA 2FMHA 1ZS9A 3CNLA 1YB5A 2JGAA 1KAOA 4Q15A 3S70A 3WJ1A 3IBGA 3VHQA 4BU1A 4CW7A 2XQFA 1E1CB 4NY1A 2XQIA 3BRCA 3IAUA 4G56A 1TM5E 1CUIA 5DLQC 3F97A 3DC2A 1HSOA 1L7MA 3AB7A 2GBLA 4P0TA 3HDHA 1U28A 1V1JA 1ZUNA 2XIJA 4FFNA 4WY2A 4ZU6X 4BIMA 1AV6A 4FW9A 2IVFA 4LQ4A 2Q7OE 4CEIA 1U3TA 3WFZA 3HUFA 4GXNA 3VX4A 4TOIA 1BWPA 1YQ9A 1K27A 3WX0A 1CZUA 3G0CA 4M9ZA 3LTNC 1F7UA 3HM2A 4HFNA 2FZ4A 1WMEA 3P9KA 4Q5IA 3F9RA 2ID4A 3U3RA 4CUZA 5CM9C 4H7HA 2I5PO 4ZCQA 2ZIGA 1GYQA 2IIQA 5HSGA 4C06A 1EUDB 2NO7A 2YMQA 2HUPA 2ANBA 4BNXA 2GZHA 2Z2KA 2G63A 4KMSA 4JU9A 3FTEA 1CUUA 2JI7A 2ZE7A 5BV7A 3VAYA 2Z4TA 5IT4A 4RIGA 2H29A 2ZSAA 2WIAA 4F2GA 2BGWA 2OSVA 3A4MA 3G7NA 2OZVA 5EXSA 2EJCA 2QYOA 3QYPA 5AD1A 2BC9A 1V5EA 1EGAA 3K5PA 1YVUA 2OCPA 2FWRA 3BZBA 3L77A 3A4IA 4MQLA 2HADA 4A8JB 3ZZNA 5JISA 1P7WA 1KEVA 2UYGA 1H6CA 2JFOA 2W6OA 3LCRA 4JI8B 1JZTA 3D8RA 4RK6A 4YRSA 3EXHC 3ENWA 5FKJA 1ZK3A 4QSHA 4TKUB 4N49A 2ORIA 3TXXA 1TT7A 4WNAA 3K09A 2Y0BA 4UU0A 4FDMA 1GUAA 1N0WA 5ADHA 1MUUA 1BEUB 3N75A 4K1LA 2RHCA 4IXDA 1HDOA 3FPBA 2W22A 3DTVD 1U9IA 4KKXB 3S3TA 1W7AA 5J5VA 2ZWAA 2Y77A 1AS3A 2Q5JA 1W5BA 1S2OA 2WUGA 2I4MA 1DXOA 3N7TA 4R83A 2IYAA 4ARZB 5LQSA 2FX3A 4UU1A 3PFHA 3ZWCA 4QOJA 5CIQA 1C30A 2LCFA 4RACA 3WR5A 2CLEB 2JIMA 3DZKA 3TNJA 5L3QB 3UA4A 1E2UA 3S68A 4E03A 2IX3A 3KBOA 3ILYA 1J0CA 1GCOA 1PTJA 3RYFB 1J8QA 1YCHA 2YC2C 1KXJA 1SJ9A 2D7CA 3UMGA 1G42A 4RPCA 4U2CA 5J4LA 3LT5A 1J1IA 2H0AA 3M33A 5I3CA 2PQ2A 2P2LA 3DMTC 3Q8WA 2E37A 1GG5A 1SVSA 2LPMA 4NCNA 5K3SA 3FYTA 1I3NA 2Q6TA 1YRHA 2QG4A 4IH1A 1P39A 3W2EA 4BFZA 3KTDA 1YQTA 3BOSA 4YFYA 2OO7A 3KYBA 2C92A 4DKXA 1FSPA 3ONNA 4UCWA 3FHLA 2QVYX 4XA8A 3WYFA 4BTVA 4ZK2A 2UZ1A 1QZ3A 4OA5A 3UGKA 3FDFA 2P4HX 2PMWB 4Y9SA 1U94A 2Z3WA 4YCCA 1HKHA 3TG2A 1ITZA 2L82A 5C34B 2EXXA 3UF0A 4DJAA 1AGYA 2UU9B 2VJBA 1LDGA 2COKA 2R6ZA 2C3OA 3PXUA 4IOJA 3AX6A 3JQFC 4MUIA 1C3OB 1D5WA 1N0IA 1YJXA 2CLKB 1B2LA 1F0PA 1ZKDA 2Y6UA 4Q1DA 5AKJA 4WZBE 1XEWX 5F33A 3RBAA 4TYYA 1A3CA 1VE9A 2B6NA 1O5OA 1YB6A 3D3KA 3PIIA 4LX8A 4ER5A 3U1TA 4K2HA 1G5IA 3HP1A 3L0IB 2ZI9A 4TKLA 2H8GA 3S28A 5E4JA 4MNTA 4D98A 3GJ5A 2D1TA 3AK4A 3MWLA 2V9PA 1P2TA 1JPVA 3IQHX 2O4UX 3DXXA 4MI9A 3L4SO 3B8HA 4NYIQ 1GILA 4LVCA 5KWIA 1B0PA 2FWJA 1CF9A 3V48A 1E1RD 4H16A 4ZOBA 1VIDA 3NIBA 3MCWA 1A8QA 2HQBA 4Y6SA 3COSA 4EY4A 3LMKA 3RHFA 4G97A 2VCYA 3MD0A 3FDZB 4P1ZA 4WY5A 4BBPA 3DPUA 2VSNA 2JJ2D 3WMRA 1CLEA 1KI6A 3W3AH 1ZUWA 1L1EA 4N54A 1TTQB 2REQA 3N59A 4GBGA 3BE8A 4NZPA 4PPNA 3UCEA 2AQKA 3UJ8A 3UV6A 1P62B 4AJJA 4DR5B 2DR2A 1VCHA 2QROA 4IZIA 3PJFA 3HUEA 2BMJA 2X7JA 4Q9JA 4F4IA 3OJFA 3W8EA 3ZEIA 1QGUB 1Z7GA 3KJQA 2WAMA 3MYYA 5I7EA 1ZAYA 4K6KA 5BT8A 3PC6A 4ZO8A 4P0PB 5DM4A 3KWFA 2VQ6A 3GEDA 4YRFA 3HLTA 1FCJA 1YJQA 3ASVA 3P0JA 1DZ3A 2A94A 2ZOSA 3C3DA 4QFDA 3ZU2A 2E21A 1IM8A 4YXFA 1W1UA 4OPMA 3HUDA 1G7CA 2HFKA 3MS7A 3HYCA 1ZNWA 3ECAA 2IUFA 3O5AA 3UWMA 3F5SA 4HQRA 2I6TA 4LBZA 3M4ZA 4Q1BA 5EZYB 4ZT5A 3NZEA 3V4FA 1VBNA 1YS7A 5JPDA 2XVXA 3HJCA 1MTOA 2B61A 4KQ2A 1KYWA 1LC3A 2DX7A 1RS0A 1EFVA 3OE7D 2FSPA 5EKDA 1FRZA 2ACWA 3F5MA 2O20A 3B2EA 3HSYA 3WL4A 4DG5A 1Y5LA 4LXQA 5TXGA 4E51A 4U2FA 1IN7A 3AETB 4HL6A 3CKKA 2PT7A 3PNLA 4ICIA 4XPIB 4A0SA 4TT3D 4XB2A 1Y4AE 3RAJA 5FTLA 1JHDA 1K3UB 1XTKA 2Y1OA 4EW2A 3CISA 4XARA 4RY8A 4NHEA 4C4RA 1K6EA 2Y27A 3WHPA 2FX2A 1PFVA 4RM3A 4BNTA 3PGXA 1YHYA 1C9MA 1EZZA 2W98A 3GLHE 3Q3VA 4MQEA 4PO1A 4LGMA 5EHGA 5WRFA 4DIUA 1Q17A 4EG8A 4PG7A 5EESA 4YJ2F 4Y0AA 4TPKA 1J0XO 2G80A 3ROQA 4WBNA 5KC9A 3LP8A 1THGA 4LN1A 1FDTA 1R8JA 2GWHA 2I1VB 3KR1A 5HIMA 4ARCA 1PG5A 4LFCB 1CS0A 4JWKA 1UK6A 1U7ZA 1PGJA 1AMNA 2UZIR 2OXRA 1T3GA 3E2IA 4HLUA 1C2TA 1GDTA 5LUBA 4F96A 4S05A 4NXMB 1AJEA 2ETXA 5LZ2A 4DVGA 5KSWB 4Y2YA 3WB2A 1K9SA 4FUTA 4W1RA 2Y3IA 1K8RA 3D3WA 1I4LD 1NPYA 3WS7A 5LQUA 1MNAA 1TT5B 5JBQA 2BGUA 3M6UA 3WP0A 2IYXA 4Q7JB 5AI0A 4EI2A 1ZCBA 2KWIA 4RDHA 1OZFA 1MMFB 4V0MA 5JCOC 1UZAA 5BYJA 3TEFA 2ADOA 3R4CA 4YMTA 1PVOA 1QANA 4EIWA 1DKMA 1XEXB 5DB4A 4OP1A 3TDKA 2QQEA 2JGNA 4ARSA 4J1SA 3DWEX 5CNKA 3HUUA 3T3IA 1BMTA 3P26A 2O8CB 4ZQIA 1TXGA 3GG2A 4IVRA 1IEQA 1WO8A 4C07A 3UBTA 1CQJB 1Q14A 1FVHA 3JQRA 1CUDA 4NRDA 4TMYA 1Y3DE 4HLNA 4TRMA 2VKQA 1PQUA 3GYGA 3L82B 4ER7A 1JEYB 1GAXA 1L1QA 4JXJA 5IM4F 3Q8KA 1FOEB 2OCBA 4NU6A 4PTYA 4L9SA 2LCQA 2IGTA 2QRMA 3ROXA 2YQ4A 1E7YA 2AUMA 2WD7B 3AM1A 4H60A 4IV5A 4AMGA 2ZEJA 1WOMA 3NHKA 1VPVA 3BXZA 3TDMA 3L1VA 1KOLA 2GETA 5LIRA 2LKCA 3ZVNA 5EVJA 4KWCA 4PHGA 1ZVJA 5EPUA 1ORHA 4Q4HB 1EXNA 4U9UA 3UTCA 4G0YA 1BJRE 5BN5A 5C8YB 2BSQA 4TXMA 1JNXX 4RC9A 3UUFA 1R6BX 1XX6A 2DBYA 1CZHA 4B43A 3I4CA 2PL9A 3NCHA 1XTUA 3AQ4A 2XIQA 3VU3A 2C2KA 3UK0A 2JIZD 3CH5A 4J1TA 4RHYA 5CYFA 4ZVKA 4BB0A 4C22A 5JDCA 3QVLA 3WSWA 3DEFA 4DR4B 2CNNA 3FROA 4X1YB 2WFLA 2XSZD 1D2CA 2CNWA 4MVYA 1VCIA 1AZSC 3BA6A 4P4UA 5ALLA 4BCBA 4C88A 4JYZA 4RJTA 1ZVQA 2JPDA 5FL3A 5AJWA 5FUMA 1KEKA 5LWQA 1RZRA 1KMCA 4MYHA 1MLDA 1SHUX 1XQXA 2X0EA 4EHHA 1MG0A 1KP3A 2BZ0A 3SMQA 1Q21A 2O6LA 1T6NA 3A6FA 3IC5A 1Q3HA 4I5DA 4JITA 2Z2XA 1U9YA 4A0QA 3PITA 1WUKS 2ZTLA 1YVDA 4P98A 4XOUA 2SBTA 3QF7A 3WMGA 1NUPA 1JJ7A 4YJHA 1GU7A 5CPFA 3FPAA 4BDTA 1ZH4A 4DCMA 3Q6MA 1ZQ9A 2WKSA 4BRZA 5IAAA 1WVIA 2I4OA 1EJ0A 2BEUA 3DG9A 5EUMA 3W6OA 4BLPA 4D0SA 2CJXA 3R3SA 5EHQA 3PKZA 4BX2A 3PWSA 1XLTC 2WF7A 1OX6A 3F6EX 3PXEA 2O2EA 4AW9A 4COKA 1CY8A 1SVLA 1K7XB 4JXKA 1I1OA 3UV3A 1SXQA 1JWLA 3D4OA 4KX3A 3UT6A 1RMYA 2AI1A 4Q3OA 3D7SA 3F4KA 4OP3A 1A8IA 1VKHA 1IM5A 1Z5PA 5IM5A 4G63A 1TUIA 4LI3X 4C5BA 1I6KA 5HQJA 1QONA 2JGMA 3Q40A 1IWPB 4W7SA 5J2TF 4BNLA 3D2LA 5EP1A 3ZCSA 2RGWA 3DZFA 1PVVA 3LT4A 3VISA 3A4YA 4AP5A 1EUYA 3ODPA 3T3OA 5CDFE 1JXQA 4R84A 3LCCA 2GJ4A 3H0CA 1KR5A 1YK0A 3KIPA 3L8DA 1J2RA 3HFRA 3NIFB 5GOTA 2J48A 3PLRA 2D13A 3PRJA 5TQ0B 3KU4A 3VOBA 5BMVB 2HR1A 1CVIA 1MB4A 1X6VA 1GLVA 2W58A 4CLXA 4IIFA 1SBTA 3SKXA 4QGFA 2C2GA 4AY4A 2VUSA 3B89A 5C0OE 3C5EA 2QL9A 4JLPA 1PDWA 2VYNA 3T5DA 5H02A 5JBNA 5KJEA 5BR8B 1XU4A 5LOVF 2BCGY 3FD8A 5IK2D 4RF5A 4CFSA 3ZIDA 3IQDB 4X8MA 2CK3A 2QM3A 3DQZA 1BCSB 4MXDA 5M04A 4IINA 4F3RA 1DAKA 2JHPA 1EVKA 3DBHB 1G6KA 3AHIA 5KQPA 3E3NA 3GJSA 4ZARA 3OPNA 1FFDA 3G8AA 1YIOA 5HZMA 4QXQA 3AR2A 1FUEA 1A9XA 3WLPA 3DDWA 5AI8A 2QTLA 2QUKA 2AH5A 4PXYA 1B0AA 1MPTA 4YV7A 1VCNA 1T9GS 2JFHA 4YT2A 3D2BA 4PVDA 4YJ3A 5LA6A 1I4OA 3JWGA 1BC5A 4J03A 4J16C 1E98A 2J3HA 3T54A 5F35A 1Q7EA 5D87A 4MYSA 3BD8A 1E7MA 3PVZA 3FKSA 3LOUA 5DE3A 1LEHA 1RYDA 5E9QA 5COBA 3TTWA 5HZGA 5KU1A 4LA4A 5K99A 1CRQA 1XVTA 4JT4A 1MB3A 3SJ7A 4ND4A 1X13A 3GQVA 3G5UA 1JV2B 4URHA 3VR6D 2A30A 4GQIA 3G5MA 2YXNA 3IBFA 1YZYA 2IYPA 5F9HA 1UAAA 2XD9A 1QRTA 3QX7A 1O89A 2I2XB 2J41A 4UMDA 5JCJA 3JQEA 3HL4A 5BW4A 1Z5WA 2EF1A 2Y2VA 5BSHA 2ZBRA 2H1SA 2FSVA 4ZEVA 3I1JA 1HG1A 2Y1LA 2INGX 4S0ZA 3WMFA 1W0CA 4HNAA 5JFTA 2WA1A 2YJNA 4AMBA 1CR1A 5HF6A 2CL5A 1NU8A 3WGGA 4Y98A 3CNBA 4WJZA 3TCNA 5EFZA 5MN4A 2A0UA 4CKEB 2X2FA 3E9NA 2IU6A 2O5VA 3H8WA 4MR8A 2O7SA 4P93A 2I6XA 3S4YA 2EDCA 3C5HA 2PO5A 2QLFA 4RKFA 1B2RA 4G0PA 4XDZA 5ERXA 1V5GA 2Q6LA 5IAGA 4FI3C 1TW2A 3ISTA 2PAFA 5KHAA 3RO7A 4MYUA 1M66A 1TM7E 4NENB 4MP3A 4IH9A 4OK5A 4PCVA 3TD6A 1IVSA 4V38A 4JJ6A 1EA5A 3BMOB 2GHRA 3BX1A 4YWHA 1TU3A 1EJBA 1DX6A 3B6KA 4FDVA 4MV7A 1E0SA 2JGKA 4OQ4A 4YO7A 5KYGA 4IDAA 3CCBA 4LRSB 4MJ3A 2V7VA 2UYHA 5DT9A 4C14A 1T2VA 2J08A 2BKLA 3KPYA 3GA0A 3NBZC 4DFDA 2R6AA 2R8OA 4MK4A 4KMMA 2HHAA 3CVJA 3EZFA 4MQFA 5KYWB 3A9WA 3VU0A 4Q4AB 1R3UA 3PLAE 3MA0A 3KJGA 1W2HA 3PXBA 3B60A 2MSKA 1NPDA 1OGJA 5F5XA 1NDQA 1ZCFA 4PPGA 5IULC 5K0EA 3RJTA 5K05A 5LMZA 2W0SA 2I3GA 2GBGA 1OIVA 2XI4A 3L4BA 4PG6A 3ETCA 1HT1E 3A4TA 3W5JA 1K8QA 1GG8A 2A5DA 2AW5A 1Q11A 1KAQA 5FV4A 1SBYA 2EZ9A 4UU7A 2JC3A 1PKEA 1N2BA 1N3LA 2CHFA 1IDOA 3K0AA 3K4QA 3H97A 1F8YA 3HKDB 4LBWA 4YYZA 3PQ7A 4QM7A 2YY5A 1O03A 3G2PA 4LXYA 3WGTA 1A9TA 2O5EA 2VHZA 2BM8A 2CXXA 2SKEA 2B8EA 4G0MA 1QNFA 2P77A 2WF5A 1J42A 3SEQA 1FJ2A 2IZ1A 3CN7A 1NP3A 5C7IO 4PYJA 5TIIA 2XMGA 4FDLA 1H5NA 1TW3A 4M7PA 2IS2A 2WKPA 5KNBD 1LGYA 1P74A 1GVNB 3THRA 1PK8A 3GGCA 4LJ6A 1QIFA 5IDQA 4F93B 3CU5A 4MITA 1BMQA 1R9MA 1U99A 5L53A 3KQQA 2GLTA 1YA8A 3MWDB 1G20A 4OQZA 3CZCA 3HY4A 1MO6A 4Y1RB 2JAPA 4YXWD 4KQGA 3IEMA 1DEKA 1CDEA 3AM3A 4LRWA 1UBTS 4HWRA 1KZGB 4A2QA 4B71A 5CBPA 3ENQA 1MP0A 3O1LA 3LYAA 3N28A 2Y4NA 3OE4A 2JLRA 2NADA 4MGYR 5GMOA 4E31A 3NTXA 4QBHA 4F0JA 3F1KA 4GX0A 5ELXA 3R5JA 1NW5A 3PLNA 2DSTA 3UV7A 4C3UA 4JT8A 5H4GA 2HYDA 1VKOA 2YZ7A 3AU8A 1NZFA 4FHDA 4DBVO 1PV2A 1XCGB 4PICA 3IYLW 1HMPA 4B6GA 1PSZA 3M6WA 5DHPA 3RVQA 3K6JA 1LPNA 1ML4A 2ZJ8A 2Y92A 3NW9A 3VPFA 4CNBA 1OFGA 2LUOA 3IDFA 3QBEA 1K7CA 2NUAB 5AUOB 2EVWX 4UE3S 3U60B 3ANXA 3AR9A 4UDYX 5EQDA 1KZ4A 2WU1A 2D7DA 4Z4FA 4H4CA 2HMAA 3CUSA 1EHIA 2FJUA 1J2YA 2H7CA 3GC6A 4LSMA 1GNRA 4B4OA 5LYJF 1L7PA 3Q85A 4RGYA 3HRKA 3GD7A 2C4UA 4KDEA 4GZ3A 4O08A 1JWBB 4JLKA 2CNLA 1P6XA 4D4MA 1FC0A 3DMDA 3DVRX 3TEJA 4L50A 4YP5A 3LAWA 4CM8B 1X7YA 1Z06A 5H7XA 1AUOA 1GDDA 1KH1A 2AD1A 3DXYA 1P1BA 3E9CA 4WKCA 4DLZA 3Q7EA 1GD1O 3IELA 2YX1A 2ZJ0A 4HNVA 2JW5A 1YFLA 1JIJA 2AJBA 4OXYA 2O48X 3SLGA 4GPIB 3RTEA 1GL7A 2YVKA 4O4JB 2O3QA 3ITNA 3W5DA 5TLSA 1PZHA 1WPQA 4AUKA 1DJQA 3DVQX 1N3BA 2ZBUA 4MKZA 3RVMA 4U4AA 4AMUA 1GA1A 3ZE0B 2P2YA 3I92A 1WP4A 3CLUC 1YDHA 2B21A 1DELA 5T6MA 2I4NA 1L7OA 4C4PA 4KWEA 4IXMA 2JFQA 1N25A 2GJ8A 2E4UA 4CKWA 5C3UA 2PUWA 2CLSA 1HKUA 2R00A 3G2JA 1R0CA 2QI9C 4RHTA 1CE8B 1XDGA 4U8GA 4DE5A 3WLFA 1SQSA 4YYEA 1Z0IA 3DW3X 2HLPA 2JA2A 1DPFA 1LJ8A 1GRVA 1KORA 3LO5A 4B87A 4IQ8A 3O3MB 3NORA 3BJZA 4MGEA 1X14A 3B38A 4D8TA 4G0QA 3IDZA 2OFOA 3DKPA 3QMPA 4WXPA 3VSCA 1A4IA 2RJNA 5KSYA 3ZKWA 3EXG1 2WSSA 3QLJA 2HSJA 3SCZA 4R8LA 4BVGA 4FFPA 2ZVJA 1CG6A 3QUCA 4QPDA 3PC4A 5M7EA 3SZGA 2QLLA 1ZIXA 1I2ZA 4H1TA 4TV9F 5CUQA 1SXGA 5SZKB 1GNPA 1G0NA 2IHVA 3OD1A 2IELA 2Q0QA 4O4HF 1U9JA 2XMZA 3WO1A 3VMFA 2B78A 2FQYA 4EEKA 1QYVA 3IAAA 3ANSA 2BEKA 2P7IA 2GMWA 2P4QA 2W6CX 4YUXA 3BWYA 1ZM3A 5MFPA 3LC0A 1KEEB 3M5PA 2GN8A 1GJRA 2B4RO 1EFPB 2GD6A 3BSSA 4PNZA 4G8CA 2WTNA 2ZU0C 3GT0A 4U2EA 1NTRA 3RYTC 1R8SA 2BFCA 3F8SA 3JWEA 2PRYA 2D5LA 2QTRA 2VNIA 1QHYA 1WNFA 4J0HA 4RKRA 5IN5A 4J7CA 3RROA 1CUEA 4L4SA 1SOVA 2FOXA 2IPNA 2Q3LA 1VKNA 1IJBA 1E5VA 1QCYA 1Z8DA 2FE1A 5AFSA 3S40A 1QP4A 3F6SA 4HFJA 3UENA 3ZQ6A 2IEIA 1QTRA 2VBCA 3G2NA 3GJ6A 4IFEA 5IG2A 3LPMA 2VRWA 3M49A 2W90A 3ZE1B 1QH1B 1FS5A 1T9CA 4PVCA 1ZD1A 2EW8A 4TSKA 4CR7A 3ENVA 3E7PA 3UOWA 4MRRA 4XQEA 4ZOEA 5AM5A 2ORVA 3TTTA 3UMFA 5KQMA 3D8SA 4A7PA 4DUYB 4YBRA 1SUDA 1I2CA 3A9VA 4HLDA 5HJ2A 1T36B 1G8GA 1UFRA 5F2OA 1I6WA 3EVZA 4MWZA 3ADBA 1DIHA 1VHDA 1WCIB 3SC2A 2X8AA 3RASA 3MS2A 2HXYA 2CVPA 2NSJA 2ZJBA 4QFMA 4PWYA 1JW9B 5KYUB 1Q95A 1CETA 3K8OE 3TI7A 4FEGA 1GTZA 5FUQA 5LM3A 4FC7A 3GFTA 4AY5A 2VKTA 3QKIA 3WL5A 3ZY5A 1L7QA 1WLYA 4IUYA 2ZIEA 4KGXA 4ZEMA 4PRYA 1HE3A 3PUVA 1UBLS 5K3BA 3PDWA 3UJ6A 2J3LA 4BKUA 2HA6A 2YMMA 4EITA 3SAJA 2FAXA 4KAFA 1NFFA 5EAIA 1T9GR 1UWVA 3AEQA 5DYYA 3F9CA 5KO2A 1KVRA 4FILA 1D4AA 2QN7A 3OFVA 2GUWA 5E0OA 1XNHA 3AFGA 3SDBA 2EW2A 1R3DA 4HLQB 3RVPA 3HSKA 5IW8A 3L18A 5ITSA 2A5YB 3QU9A 2EBUA 4Y6PA 1LVHA 1XSEA 4AG3A 4DWOA 3KKZA 4LWQA 4ZHQF 2VDRB 1GLNA 2QV0A 2M6KA 3SS7X 2YMLA 1ZN8A 1JA9A 2J5QA 4X20B 1M1XB 3PC7A 4LWPA 1KL7A 3ZZ0A 4YQFA 1F5NA 4FKMA 4RZQA 2I4IA 4K6GA 4MJ7A 4Q00A 3FTQA 3QUBA 4UE2A 1GUFA 5JI2E 2XDWA 2ZQYA 3D6AA 4F2WA 4EABA 3URKA 1XEAA 4MEBA 2JK1A 3N1UA 1XRJA 1RVDA 3DOFA 4LJ8A 1PT8A 5CHEA 4DG8A 3ZV3A 1W4LA 2QRPA 2CL0X 2R2GA 3OZAA 2I3BA 3ZGLA 2JAQA 3DV0B 3KP1A 1EWRA 2WFMA 4ENUA 2GO7A 3FJYA 1PWEA 2EAUA 2YWXA 3MF4A 2P2DA 4ENRA 1TVKB 1MRNA 1W1WA 1GP2A 3CR7A 4UEQA 3BREA 4HH1A 5BN4B 3A6HA 2HU5A 5AK0A 4PQRA 1MC5A 2R6GA 1REQA 3WBBA 4G89A 5LMNB 2QP9X 5U1PA 2XWQA 2H1IA 5DASA 3NU1A 5BSGA 4F4DA 3CO0S 3N39C 1YR1A 4RF2A 1PZEA 3QLVA 2VHWA 3O73A 1B16A 1M34E 1D6MA 3F98A 3VO8A 3OLZA 3QVOA 4UBNA 1JDBC 4O3MA 1RDFA 1YCGA 3BILA 3NJ4A 3JU3A 3TKAA 4EG7A 3N2ZB 1B26A 2PBRA 5GADl 1N7HA 1E3WA 2EYQA 4Q03A 1Z4NA 1DC7A 4NS1A 2DF8A 1LV7A 5L3RA 3WDKA 5IZCC 3RTCA 4CM6A 4EI9A