2ECKA

Structure of phosphotransferase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
214
structure length
214
Chain Sequence
b'MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLATE KINASE
publication title Crystal structure of ADP/AMP complex of Escherichia coli adenylate kinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 71
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1996-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2eckA00
2P2LA 4B3GA 2VF7A 2X1VA 5JSZA 3BFVA 4TT3D 3GEEA 2QP9X 1COWA 3A1VA 4JVSB 2ZAMA 5FTLA 5JI2E 2HLDD 5E7JA 2NZJA 4GFDA 3IGFA 2ZYVX 3C14C 1DELA 4HLCA 1G3QA 4PC7A 3NBFA 4L8GA 3OFNA 1DAGA 5C46F 3IO3A 2YINC 1KNQA 1TF2A 4ILEA 2G6BA 1BOFA 2J0VA 2EYQA 4Q4LA 5AK0A 3W6NA 1XD2A 1VYTA 3GLIA 2FSFA 4UNNA 2NQ2C 4KSCA 3HR7A 4G0NA 3WYAA 3ZQ6A 2WWGA 3LDAA 3ECCA 1G1MA 4RD3A 2CNWD 3GLGE 1T9HA 3EIHA 4UJ3A 1J8YF 4RD4A 4LJ9A 1QHXA 4LK2A 3HJNA 1LNZA 4AKGA 2ERXA 1S96A 5E4FA 2R6GA 4NTZA 3A37A 4MYCA 4Q21A 2R9VA 3I62A 4Q9IA 3RC3A 2V9PA 4DCSA 2Q3HA 1SULA 4KBFA 2O0KA 3LY5A 3WHKA 4DEYA 3GLFA 1ZUIA 2RB4A 2JIZD 2R44A 4HB4A 3CBQA 4O2RA 1OH5A 2RMKA 4JJZA 721PA 2C9YA 4KVAA 5TDHA 3EWAA 2WJJA 2PMKA 1Z2CA 5CM8B 2GK7A 2XX3A 3IEUA 2FWRA 4NDZA 5CDFA 3QE0A 3AF0A 1G3RA 1U2RA 1D2MA 1ZNXA 1KGDA 4TWZA 2MSDB 2V7QD 2QBYA 1XWIA 4LV6A 2FPLA 2UZ3A 4CVNA 4TTPA 2P6UA 4IOMA 4EJSC 1GRQA 4W7SA 2ZUBA 2RGBA 1W0JA 3QI2A 3F8TA 3CR8A 5BWMA 4M22A 1EX7A 4RFVA 4EPTA 3TRFA 3EX7C 4KODA 3LRPA 4M21A 5DO9A 4KO8A 4W5JA 2DBYA 1CRPA 4N0EA 1L2TA 4LI0A 1G3UA 3DKVA 3W5JA 2A7QA 3ZVRA 1J7KA 1ZBDA 3K0FA 1SXJE 2ZRMA 1SXJD 1KI7A 1RIFA 1W36D 1NVVQ 3O8DA 2PBRA 3IBYA 1Y63A 4A15A 4DB4A 5DISB 4QNMA 2O8CB 5AJWA 4JS0A 1AK2A 3GD7A 4LUCA 4L9WA 4OI0A 4XWOA 4LPSA 1LS1A 3T5GA 3CRW1 3CKLA 1AS3A 1KK2A 1Z0KA 5TV2A 4LYHA 4LJYA 3R9IA 4DLSA 4EPXA 5AUQA 4A4DA 2KJQA 1N6NA 2QSYA 3ASZA 1AA9A 4M2LA 4M1SA 1KIMA 1JEEA 2P6NA 5G41A 1BKDR 3DZDA 1Q20A 3R8FA 1E2MA 3E2IA 2WVJA 1R8QA 2QSZA 3IQXA 1AKEA 1HH4A 3S1AA 3GLHB 1XTKA 1H8ED 4HUTA 4DLYA 2E9SA 3LVQE 4AC9A 1JPNA 1UKVY 1XXHA 2YC2C 1MABB 2V6JA 2NMVA 1CIPA 3THXB 2JJ2A 1OFTA 3OE7D 4JVNA 1ZM4A 2OAQ1 3PEVA 4W9MC 2Z4SA 1BH2A 1ANKA 5FTNA 4KCGA 3X1WA 4FWTA 2EYUA 2QU8A 2VHTA 2QY9A 1E79A 3KXLA 1K8RA 2P5SA 3ASYA 4G5GA 4AI6A 1UM8A 1EK0A 2O5VA 4TL8A 2CLDX 3T1VA 2B6HA 1XD9A 4ZDIA 4X8HA 3RRMA 3AVUA 4TZ6A 4TN1A 2F9MA 3AP3A 1ESMA 2ZVPX 3B9QA 3SDZA 3JVUA 2YOGA 4IOKA 3KQNA 4LV5B 3WP0A 2GJKA 1W48A 3TBKA 4RD2A 1Z6XA 2V54A 3VAAA 3E5HA 4BEJA 1IXRC 1XP8A 4IKEA 1A2KC 3RABA 1SHKA 4US0R 1IJEA 4CEIA 1GRNA 2H1LA 2XZPA 3KKNA 1B0UA 5GJVC 2PX0A 4OQLA 2DYKA 2VSOA 2ZSEA 4DZZA 4EPYA 3CF2A 2OCBA 1CULC 3TAUA 5H68A 4ZKDA 2RHMA 1KI9A 1VG1A 4C2TA 1N5IA 2KI5A 2ZR7A 5FUVA 4YXWD 4US1R 4BLTA 1N6RA 5TMPA 1FW6A 1RKBA 1U0JA 2WM9B 1ETUA 1XBTA 1CLUA 3PV0A 2ZI6A 3RDPA 4DDWA 4R71A 3RAPR 2PZEA 4JVLA 5GJWC 5A4JA 4UXHA 1ZJ6A 5AR1A 5JRZA 1VDZA 1ZNYA 5K8TA 3KXIA 3CF0A 1OLOA 4GMDA 4YLGA 3TR0A 4BLSA 4ZDWA 1GITA 2XOKD 5FOVA 4A82A 4Q4JB 4B3DA 1XPOA 3EXAA 3SYKA 4Y0AA 4A1FA 4XJXA 5JHHB 2GF0A 4P4SA 4DHEA 3ND8A 4Q7JB 2YOHA 1P6XA 4JLKA 5JWRA 3J81k 1JAIA 4TMXA 3QKUA 2ZE8A 2A5FA 1KJZA 4PHFA 4X8MA 2WKRA 3Q5DA 1G21E 5BYJA 1KDPA 1SVMA 1L4YA 3CZPA 5JBQA 3BBPA 3EASA 2FJUA 4TSFD 4D80A 1CTQA 2GCOA 5JS8A 5AUNB 3NDPA 1NMXA 4BQSA 2GRJA 4ZI2A 1TPZA 2P0EA 4DSNA 5JZVA 1F2UA 2RGNC 3WY9A 2H18A 3TQCA 3TLXA 5JHGB 3FYHA 5L3RA 2QORA 5GADl 5CLQA 4EJSA 2G0NA 4XOIA 4PFSA 3H2YA 4MYTA 4O2LA 1ZNZA 2JGNA 4MGZR 2L0XA 3QF4A 1E9CA 3W3ZB 1KNXA 4LX0A 3EIQA 4HB0A 5C1BA 2R6CA 3EZFA 1P7CA 2WBLC 2UVQA 5JSZB 2JLRA 2H16A 1XEWY 3MRSA 4LDJA 3RSOA 4I1VA 5KU1A 2W2VA 3PQCA 5TVKA 1P75A 1GTVA 3AVPA 3B6EA 4B3XA 4DSTA 2BVNA 4B2LA 4Q48A 4YONB 1OH6A 1P72A 4PQFA 5HKKD 4AG6A 1ZP6A 2FFAA 4TQUS 3AF4A 4PSKA 4A36A 1KMHA 1W4RA 3AH8A 5EXSA 4GOJA 4O3MA 3GLIB 4RD0A 2XNDA 1XD2B 2AWNA 2DPXA 4G5OA 5KDDA 3EZ2A 4BECA 2A78A 1JALA 1EFUA 4DVGA 1XEXB 1E2FA 2GXSA 1VCIA 3TR5A 3RC8A 1UBCA 4BFVA 4KFRA 1EWRA 4N0DA 1V43A 4NL4H 3MWLA 3EZ9A 3THWA 3K9HA 1E1RD 2VL7A 2ZXUA 4Q19A 2ZRIA 3OIUA 1ZM7A 4URXR 4LBZA 3P4XA 2WZQA 4ITRC 4GPTA 2OO7A 4ZPXA 3GLFB 1PUIA 1DO0A 5JS7A 1Z0FA 1XTRA 5IT5A 1J99A 2ZJ2A 3G5UA 1P3JA 4EPRA 1E1QA 1G9XA 3KJIA 2RGCA 4HYYA 4YMSA 4RZ2A 4FCTA 1RRPA 1OKKA 1S4QA 3OF5A 1RRGA 3SHWA 2AWOA 3CB4A 4V03A 4KV9A 1N5KA 3GFOA 2VPPA 4NCIA 3VNUA 1VYUA 3U3KA 4Q7MB 2QBYB 1AIPA 3A58B 4F92B 5TARA 2MSCB 2JLZA 3ZIAA 3VR5A 2ZANA 3IBGA 4LHWA 4OHVA 1XU4A 2JEOA 1XXHE 1VHTA 3L8ZA 2BMDA 1GNRA 1YKSA 1XCMA 2PL3A 2F1IA 1W36C 5BN4A 5CYOA 1CRQA 1ESNA 3K0FB 3QKRA 1CR4A 3GP8A 5FL7A 4MRVA 2XTMA 1LF0A 1AS0A 1ZIPA 4B3CA 3T5DA 2D62A 2R6AA 2RGDA 3DOFA 4DKXA 1R4AA 5F9HA 2XITA 2LKCA 2ZRNA 3ZD7A 1DVRA 1NP6A 4RZXA 3SOPA 4P0TA 4D81A 5FOXA 1ZRHA 5JCZA 3MLEA 1EFTA 4LC1A 3HWSA 1IXSB 4QKQA 4B74A 3FE2A 3NXSA 3RWOA 4M4SA 2IEZA 2J87A 4PC2A 5AWFC 5F3WB 2J7PD 4DIEA 1UBEA 2FSGA 3AF1A 4Q1DA 1PLLA 2RHDA 1T91A 2AK2A 4BZXA 3U61B 1KO8A 2H7VA 4G3XA 1XD8A 4R2HA 3QEJA 4HB2A 2IA5A 4N3NA 3QEOA 4LZZA 3S1AB 1VHLA 2XGJA 3OAAA 4KFTA 5M04A 4D4JA 5AJZA 4NCJA 1GKYA 5HCNA 3ADKA 1TADA 2IS6A 3QF7A 2JDIA 1IY1A 2QG6A 4JBYA 1N6KA 4FCWA 1W44A 1XXHB 2G1KA 3E1SA 1EX6A 4Q5IA 2ECKA 3M6AA 1Z29A 3I3SR 1CJKC 3KFXA 1T0JB 2W2XA 2ZRFA 1DAKA 3X1ZA 3B78A 3LX5A 1CU1A 4JKIA 4PC6A 4RZ3A 3ZLJA 3FHOA 5L3VA 1CJTC 3DPUA 4POAA 3VR6A 3ZVNA 1E3MA 2AN9A 1E2GA 3VHXA 1NI3A 2GDJA 1T5IA 1AJEA 2RGGA 4OHWA 1ZD1A 5KDOA 5LD2B 1NG1A 3AV0B 4Q1FA 1CR0A 3TGPA 1N0UA 5CIWA 4DSUA 1RYFA 4DUGA 4A0FA 4A0RA 4TL7A 1E2KA 1VKJA 4EFNA 3R9XA 2RGNA 1JR3E 3SZRA 1HURA 3W90A 4C0KA 3C4JA 2RGAA 1YVDA 2W6ID 3GJXC 1IAQA 5DHAA 3W8RA 3UG7A 4OJKA 1F3OA 4KLNA 4TT3A 4CEIB 3JZAA 4BFSA 1Q3HA 2CLSA 3A36A 3KJEA 3MD0A 4JLMA 1CBUA 4P32A 2GCNA 2HLDA 1E9BA 1QF9A 3CM0A 4XSGA 5EE0A 4DLTA 1VCOA 4TTQA 3W6OA 2ZIAA 4DB2A 3LO5A 4L16A 4HI0E 3CNOA 4M1KA 1NSFA 2D2FA 3MJHA 4IOLA 4G1UC 1G5TA 3M0EA 3I73A 5BW8A 3RRYA 1G19A 4AD8A 1ZM2A 3B2EA 2FGJA 5J4HA 2CNWA 4M1WA 3GLGA 4DBLC 4BGDA 3ADDA 3LVRE 2XXAA 2BCGY 2N1BA 1YJ5A 2WIAA 1X8LA 1KMQA 5C4GB 2Z83A 2VLIA 3BGWA 1P2TA 2FU5C 1FNMA 4I99A 1N6LA 1YRBA 2JJ1D 4OQFA 1G16A 1SKYB 5AJVB 4RVCA 2N46A 4YMVA 4MDFA 1QRAA 3TMKA 2ATXA 3AVQA 1Q44A 2NOAA 1W0KD 5DI3A 5EXTA 4ZIRA 2IYTA 1ZCBA 1QHSA 1XTIA 2QP4A 1WBBA 2J46A 1NN1A 1E9AA 3ADCA 4R7ZA 2F43A 3L0OA 1NIJA 2X8AA 1X1RA 5EP2A 3ZZUA 4NYIR 2ZYWX 1DG1G 2GCOB 2A5DA 2GNOA 5FH9A 4TMZA 5EP3A 2ODNA 3PITA 3ZZ0A 2XTNA 1NKTA 2QGNA 2FPKA 2ZRGA 1EESA 4W5WA 1M74A 5IK2D 2OBMA 2OBLA 1CF4A 4MKHA 1PVOA 3AVWA 3L43A 4EDHA 3RHFA 3MFYA 1KSFX 3I4LA 4JLDA 5TY0A 3UXMA 3VU9A 4A0GA 2QAGA 1SXJA 3QF4B 2WSSD 1UPTA 1T8TA 3BOSA 3ZS9A 2REOA 4FD2A 1DAFA 1E2JA 1R2QA 3BB1A 2B92A 4QHYA 4RJLA 2DFTA 2ASEA 1FTNA 3QENA 2PZFA 1DOAA 2A30A 3LBIA 2OHFA 3P32A 4QJ5A 2RGEA 5DNYB 4QJ4A 5J4LA 1J70A 1JJ7A 2JLVA 4RCZA 1KMHB 1G8PA 2AHOA 2G9NA 3X1DA 1RRCA 3BE4A 1E4YA 1KKMA 3FHCB 4Q47A 3BH6A 3WNBA 1FZQA 3NHAA 2DWPA 2VP9A 1IM2A 4Q7KA 4CT5A 1N6PA 1QHNA 3EA0A 1Z3IX 1HY3A 2IC5A 4HLDA 2Z43A 4R9UC 3ZZTA 3OEED 1S3SA 2XB2A 3THWB 3U7FB 3D8BA 3HYRA 1OF1A 1VCNA 2ZS7A 5H8WA 4KSBA 1W4BA 1H8EA 3FMPB 3O8CA 4M9ZA 1DE0A 3K0SA 2ANBA 1U81A 2KBEA 1GZSA 4AKHA 4TLBA 4CGZA 2RGXA 1F60A 1XMSA 2FFQA 4XTCS 5JLJA 2HF8A 5K8IA 1WRBA 4TL9A 3OE7A 3QKTA 3QXCA 5HR5A 1CJVC 1Z28A 4BFTA 1GNPA 3KXKA 2JCSA 4NYJR 1GP2A 4Q7LA 3HDTA 2ZE6A 1M7HA 4KYUA 2EFDB 2F1HA 4WVFA 1E9SA 4BLQA 4HAVA 4AYWA 3AVVA 4QGHA 2OM2A 3CPEA 3H84A 4TMKA 1OH7A 4MDEA 5DI9A 3LD9A 1KJWA 2QTHA 2NGRA 1LV7A 1UAAA 4D0LB 1W5SA 2Q3MA 1ZC3A 2PZGA 2XSZD 2OSBA 3KKMA 4EIWA 1TAGA 3WNCA 4E5UA 3KQKA 3A4LA 1D9XA 3HPQA 2A3RA 1SVIA 3QKRB 5LD2C 4LYFA 4NP6A 2UZIR 2AR7A 3F5FA 4QGGA 3CW2A 2QMUA 2A5GA 2QQEA 3OIYA 2R2AA 3GJ5A 2V55B 1F2TA 1Z0DA 5FTJA 3UIEA 5KPDA 4FWIB 3WMGA 2BM1A 1T6NA 2CHGA 2C99A 2W58A 3GEHA 4YXWA 3PEUA 1U0HC 2V6IA 1JQLB 2LKDA 1K5DA 2VSXA 2BCJQ 1D2EA 2C95A 3OEHD 1P61B 1PLJA 2O52A 4QHSA 5HE9A 1GOTA 1WE2A 2PMDA 3CX7A 3V4RA 3RWMB 3Q85A 3IKJA 3FDIA 2WJGA 5KSYA 3NH9A 1HQCA 3THYA 5FBVB 1GNQA 1U8ZA 2EFCB 1EGAA 3TW4A 2GXUA 1NSTA 2ZSFA 2AXNA 2BEKA 2EWVA 2WHXA 4QXAA 2XOKA 4AYTA 1E9DA 3LNCA 1IN6A 3SC3A 4Q66C 4IEIA 3DM9B 3H86A 3KQUA 3IQWA 1NN5A 4MRRA 3SN6A 2B7CA 4PX9A 1GFIA 1XEXA 1OSNA 4L4UA 3B5JA 1E2NA 1X86B 2OFWA 1S1MA 3NBXX 4Q9JA 1ONBA 5L8VA 2VO1A 4U02A 3VMFA 2OXRA 1VG0B 3KJGA 1EFRD 1JJVA 2GJ9A 2IW3A 3CX6A 3HU3A 4LBVA 4TSFA 4F7WA 2OT3B 1ZUHA 2QAJA 4AK9A 5JMTA 1LB1B 1G17A 2V4ZA 4F91B 3RYTC 1OPXA 1SZPA 3B9PA 2ZI4A 1N5LA 2V1UA 4DC9A 3BB3A 4HEJA 3BERA 4ACAA 4QM7A 2WPDA 3QXXA 1OIXA 1WQ1R 4TYNA 1KAOA 1M2OB 4M9QA 5LPNA 4TYYA 4PR0A 3KJHA 2IK8A 3NKVA 3CNNA 1YR7A 4ASUD 1XEWX 2VQSA 4A92A 1SVOA 2H5EA 2R6DA 3KFVA 3SEAA 1RE0A 2A2ZA 2EFHB 3QBTA 4FXPA 2VHUA 3Q3JB 1Q1QA 4Z8XA 3AUYA 1G6OA 1CXZA 1I4LD 2QE7D 1G4AE 2ZSAA 3BFXA 4HAXA 1PJRA 4O0MA 5C4MA 1TL7C 4AKEA 3P27A 3MSXA 2VP4A 1IN7A 3L0PA 1A7JA 1D6JA 3FKSD 2ZJBA 1FL9A 2P67A 1TTTA 2FDCA 2YJTD 2W2TA 2IUTA 1NIPA 4MUAA 3KKOA 2DY1A 4KHZA 4C2UA 1E2QA 5EQTA 1WP9A 4OI1A 3GLGB 2IUUA 2MSEB 2XXAB 1G8YA 1HV8A 2HT6A 1KTVA 2JATA 2QMHA 3EARA 5KNBA 3MWKA 1E1RA 2F3RA 1DPFA 3ZVMA 3U3RA 4LGMA 4DIDA 1EG7A 1Z22A 3FTQA 4NCKA 1NNEA 1W7AA 2NO6A 3BJIC 4FCVA 4FMBB 1JNYA 1RJ9A 3KKQA 4JL8A 2ORVA 2WMOB 2Q0HA 1NF3A 5A0FA 4BUJA 3ZD6A 3EC2A 4BZPA 4DDTA 3CRQA 5DI3B 4GOXA 1XTJA 4ZIRB 4QG7A 5KSPA 5SZJA 4BEBA 3AKDA 1OIVA 3T1OA 2O8EB 1SVWA 2F43B 4R2IA 1YZNA 5FTMA 1FMLA 1NVUQ 3QIAA 4B6EA 4ERNA 3OIVA 1Z63A 4ARZA 1JI0A 3W34A 3NHBA 1KO7A 4NHOA 3W5IA 3AVXA 4MYHA 4A0HA 4PZZA 3WP1B 1HQYE 3SBEA 3E70C 1IJFA 5D3MA 4PO9A 2C03A 4ZDKA 5C18A 1U90A 4GNKA 3DM5A 3KTAA 2FFBA 3WBKA 1E0AA 3VU9B 3LXRA 2QAGB 1SXJB 3PFIA 2VHCA 3A4MA 3X2SA 1P60A 2QT1A 4G5SA 1W36B 2FZLA 5CM9C 3NEJA 5CYPA 2D7CA 5A5GA 5H1YA 3AKCA 4WA7A 1TU4A 4V0NA 1AZSC 4EQ6A 4B47A 4E03A 3AGPA 2FG5A 2C77A 2P5TB 1EFCA 3IIJA 3RNLA 4BFWA 5CITA 1E0KA 4O25A 5KNDA 1RVDA 4QNRA 1CJUC 4P3YA 3O8RA 2ZE7A 2CLCX 1R5BA 3B82A 4JKYA 2WICA 4WW0A 4A6XA 121PA 1T3HA 4QBHA 4JT4A 1ZU5A 4UNSA 3T06B 4AIIA 1GSIA 2XTZA 3UWKA 3IHLA 4A6PA 1XTQA 4PZYA 1P9NA 3PUZA 4JT2A 5JCPA 1XJCA 2J0UA 5K8LA 4QC2A 3U6KA 4URUR 5DSZA 1G8GA 1ZU4A 2REBA 1YR6A 2QPTA 3EWSA 4WIAA 5SZKB 4E22A 4P4UA 1E4VA 2QRZA 1RFLA 1DS6A 4Q1EA 1S9HA 4PPFA 3QBVA 2ZU6A 3JVVA 4NZYA 4PZLA 3W6PA 4JLAA 3I61A 4HATA 2OCAA 4JL6A 2QZ4A 4FN5A 4UNQA 4TMVA 4V02A 3PEYA 3Q8XB 4FMDF 4ABYA 1ZVQA 3PCRB 1UEIA 2GK6A 2G1JA 1OIWA 2QMEA 4C7OA 1E2LA 2JLWA 2IXFA 1UBGA 3BWDD 3UWOA 3WXMA 3A1TA 1DAHA 2X2EA 5FOSA 1IQPA 2HEIA 4A2WA 2FX3A 3G82C 4LJ5A 2CJWA 1Z47A 4MGYR 2OESA 4DXAA 1FTSA 4TYQA 4A8JA 2BJVA 5CLLA 3TH5A 2I1QA 2YHSA 1FMJA 1G8HA 2W6JA 3QVUA 3UMFA 1JR3A 1O87A 2WWFA 1L4UA 1ZM9A 4H1UA 2W6IA 4KFUA 5FOUA 2OZEA 5DYIA 3VFDA 1R10A 2BJWA 2KB0A 2WKPA 1DARA 4KITB 8OHMA 2GETA 3SJCA 3CPJB 1F2TB 5CK5A 4LPKA 4UNRA 3GJ7A 4XWKA 1WF3A 2ODEA 4NE2A 5GVRA 2JLUA 2QM7A 2W0SA 3WHLA 5HZKA 1O3YA 2ZJOA 2J0QA 3VX4A 1XRJA 5FI1B 1RYHA 4LYAA 4Q18A 2VP2A 4Q4AA 1EWQA 2H17A 2OLKA 4CEHA 4OI2A 2BKEA 2QI9C 3GQBA 4IFEA 1X6VA 2R8RA 3MG9A 3NVAA 3LX8A 4YQFA 2AD1A 3PJRA 3KB1A 4ZKEA 4HZIA 3THYB 3EG5A 3TSZA 1MKYA 1P4SA 4XVRA 1E0JA 4HLQB 1VTKA 1GKUB 4B71A 2XZLA 3LW7A 2GWHA 4C0SA 3C5HA 1E9EA 5E7MA 1KI3A 3T12A 2W00A 1MRSA 3K0AA 1P2VA 2KE5A 1P5ZB 5G3YA 2JJ1A 1A4RA 1MO4A 3EA5A 1KK1A 1QHHA 1TEVA 1ZAKA 3KL4A 4IVQA 1V5WA 2J7KA 2XEXA 1VECA 4EFMA 5FUXA 1W0KA 3FFAA 2YV5A 2O8BA 3EAQA 1MT0A 2WSMA 4GL2A 2ZS9A 3WMEA 5FBQB 1XNJA 3RANA 1NY5A 2REXB 4GOKA 4NONA 3ICEA 1Q21A 2YVUA 5HPYB 4KBGA 5K8UA 3PIRA 1GAJA 4TLDA 2CMKA 2VP0A 3AGQA 2NO0A 3FGNA 5JJIA 2HUPA 4NYMQ 1X3SA 4Q00A 4K46A 3RS2A 3TAHA 1CR1A 4OL0A 3H4MA 2AXPA 1RW4A 5J4VA 3K70D 4PANA 4WXRA 4K8OA 4OHXA 1N3BA 3AVTA 1UFQA 2FEMA 2WSSA 3BD9A 1T5LA 1CJMA 4B43A 3TVTA 1YZGA 2VP6A 3MAAC 4IXNA 4Z51A 4GP6A 2BMJA 4IHQA 2GEUA 3DL0A 2GAOA 1A1VA 3VTKA 4E07A 4ESVA 2WJVA 1YZLA 1H8HD 2EW1A 2QAGC 1SXJC 1QVAA 3AP1A 5LDDC 2EVWX 2F3TA 4PHTA 2IYZA 3CR7A 4QRHA 3MWYW 4TMWA 5C2JB 1U9IC 1DADA 5CJPA 1K6MA 1WDTA 2OLJA 3NIBA 2D2EA 4PSAA 4NPHA 5EZ5A 4HAYA 3MWJA 1BYUA 4EAQA 1OFHA 3SHFA 2XZOA 3LW8A 5GVSA 4GSYA 3OEEA 3CLVA 4YMWA 5EE1A 2C5LA 1RZ3A 4X8OA 3SFVA 2VRWA 3Q72A 5J5CA 3GPLA 3I1FA 2IYXA 3ZGXA 1QHGA 4D4LA 2ZJ5A 2OCPA 2YYZA 1Q12A 1FPMA 3N70A 4DCNA 4TTRA 1RJ9B 1QDEA 3IILA 2CE7A 1XX6A 4P31A 1CEEA 5J4YA 1BMFD 3B8HA 3CX8A 4XH9B 1W5TA 2QMOA 3LWNA 4IFBA 3ZJYA 4PAQA 4JMPA 3KUCA 1MOZA 1YZTA 1I2DA 3K0CA 3IDQA 4PAMA 5UKDA 2CVFA 2ZRAA 1R5OA 1OFIA 4ARZB 3SBDA 521PA 3PVSA 2CEAA 2J45A 4ZCMA 2IYVA 2VSFA 3MMPA 4OI4A 4PXAA 1G291 3RRNA 1LVGA 5D3MB 3AF3A 2WWXA 4UQOA 1ZNWA 1R5NA 1QHIA 1U99A 4MITA 2YKGA 2CL6X 3KTAB 2KBFA 3L2OB 4Q03A 4C0QC 2H8KA 2QNRA 1KHTA 3QPVA 3V00A 5H70A 4M9SA 3ADBA 1XCPA 1KY2A 3FB4A 1NLZA 2FPMA 2OG2A 3NBYC 4JLJA 4DLXA 5KPJA 1KSGA 1NBME 4JSTA 1NBMD 4HUQB 4EQ6B 5BN3A 4LY6A 4URVR 1OT3A 2CE2X 3JZMA 2ZUDA 4BFXA 4CRWB 2VHJA 4GT1A 1SGWA 4Q01A 1E2IA 3QY0A 1Z6AA 4TYPA 4DRZA 3OEHA 4FIDA 2IS2A 3SR0A 1ZYUA 1GWNA 1S0UA 2CDNA 2OAP1 2BIFA 3WBJA 1P2SA 1N2CE 3SI7A 1RPZA 1VG8A 2J0UB 1KI4A 3GJ6A 3B60A 2FA9A 2VEDA 5FUWA 3TUJC 3CUEF 1NG9A 2IBMA 1G5PA 3BAFA 3HPRA 4RKEA 1F48A 5BN5A 4JLNA 4M8NE 2BBSA 2J9RA 2ATVA 3QPUA 1XTSA 1XZPA 4UXJA 1KDTA 4FMDB 4IEEA 5CK4A 4JYBA 2PCJA 4LOAA 4NYJQ 1E2PA 4QFMA 3DMNA 1QG2A 5CJ2A 2QUZA 1FQJA 4RY2A 4DDVA 3B1WA 3C7KA 2Z5FA 3EPKA 3QXSA 1C9KA 4OQXA 5FBWB 5JECA 4CEJB 4C7OB 1RRFA 2JAQA 4C0BA 4ON9A 1OYWA 1TU3A 2GVZC 2JIZA 4PPGA 4B35A 3H1TA 2CJWB 2WOJA 4PPNA 5KUTA 5KO2A 2IYSA 3I8XA 3SFZA 1G7RA 3H0KA 4A8JB 4D6PA 2IYLD 1KY3A 2ZSDA 3EZ7A 2WJIA 5FPHA 4UJ5A 3N5CA 2GJ8A 2O8EA 1ZD9A 2GBLA 4Y0VA 1OXTA 2MMGA 1YZKA 4ASUA 5TB5A 2UKDA 4B6FA 1WBDA 2V7QA 2B21A 3DHWC 1GG2A 3FWYA 1W2GA 2GKSA 2GZDA 3AB3A 3U4QA 4XVUA 3GCGA 4ZCIA 1TF7A 2QE7A 2YWFA 4TZ0A 1WA5A 2CHQA 3MCAA 4OKSA 2CL0X 2HXSA 4Q4AB 1FQKA 3U44A 1T4GA 1OJLA 2A5YB 1UKEA 1AGPA 4CEHB 1U0LA 1G18A 4QBFA 3HR8A 1US8A 4GBMA 4Q9LA 4C4PA 3TNFA 2LCFA 3CNLA 3TK1A 1U9IA 4JL5A 3IIKA 1R0XA 5HE8A 4F93B 1FUUA 3A8TA 3KUDA 4GMXA 4TQ9A 3QOFA 4DT1A 4MQBA 3UG6A 5DN6D 3ZVLA 1NVWQ 3VQTA 1UEJA 1E1QD 1Q1ZA 3Q7PA 2B8TA 2IT1A 1UDXA 1IBRA 1OKKD 4I1SA 4MGKR 1E98A 4D4MA 2BBWA 3K0AB 1W2HA 3IIMA 1QHHB 4ACBA 4B2IA 4H9GA 3WYFA 2J3EA 5LBIA 1XB2A 3QKSB 3Q7QA 1OHHD 2O8BB 1S9DA 2OV2A 4MUBA 5B30A 4KFSA 4AKIA 1TF5A 1JQJC 1N0WA 3BH0A 3DMDA 4BLOA 4M1YA 4QGAA 5SZIA 5KSOA 3M4YA 1GVNB 4OJQA 5KYKA 1M8PA 3K70C 2ODWA 2OEPA 3B1ZA 1AM4D 2DB3A 1FP6A 4TLCA 3M1IA 2ZR9A 4EUNA 2B7BA 2K5UA 2XB4A 1GDDA 1KK3A 3CONA 1I4DD 5FPSA 2X2FA 1XZQA 2FH5B 2Q3FA 4WOPA 2RCNA 3FKQA 5L3QB 2GCPA 4GI7A 2NPIA 2ZQ5A 2QTVB 2GXQA 2PX3A 4DLUA 2P3SA 1R0YA 5HTKA 4Z54A 3UMRA 4BZQA 2EWWA 3IEVA 1TQ6A 1H65A 1IOZA 2IYQA 2DFNA 1KO1A 2IWRA 2ZJZA 3B13B 5B64A 3SS8A 1KJYA 2QPOA 2HF9A 5D3QA 5TXGA 4KJZA 3W9YA 3I5YA 4KLZA 1NVXQ 4PQRA 3NDBB 1JEDA 3IHWA 4OHZA 3OAAD 4IDHA 3A1SA 2AK3A 3PR1A 4TMTA 5JI3E 3P4YA 4Q02A 4DSOA 1MO3A 3B1VA 3CH5A 3I8SA 4D25A 1OXSC 1GL6A 1J8MF 1FOEB 1DTSA 2DHRA 1TMKA 1AQUA 2I3BA 1KO4A 3NTUA 4NMMA 2WTUA 4HSEA 1IN5A 4IDOA 1TQ2A 2OCYC 2GVDC 4LBYA 4TYWA 5BQ5A 2WJYA 2YOFA 1XF9A 2DR3A 2F9LA 1LY1A 1TQ4A 2J5XA 1AZTA 5EE3A 1Z07A 3EPLA 2DWQA 1S1CA 4OK5A 2EQBA 1KK0A 1MO5A 1XCGB 3U2QA 3EIEA 4LWZA 4A9AA 2ZI5A 3U6BA 1FX0B 3T34A 1IONA 5AUOB 3GMTA 4NCNA 1Z06A 1P9RA 1T3LA 3GEIA 5B58C 5B2ZA 2ZRBA 4C9BA 4DCUA 3I5XA 5FOWA 1MO6A 5FPKA 4G5QA 3PG5A 4KI0A 4C30A 3RS4A 3MUFA 1G4UR 2WWIA 2ZS8A 4C0HA 3BK7A 4PHHA 5KSZA 3PEWA 1OH8A 1N5JA 5DIFA 1M34E 1PLKA 2ORIA 4MKIA 1JECA 1KDOA 1DBSA 3GJ0A 1G3IA 1TUEA 2BHRA 2CK3D 4LHZA 2IS1A 4WXPA 4M1OA 1E0SA 1XEFA 5FBRB 4R98A 3L82B 4RSGA 3VR2A 3EW9A 5E3HA 4A8JC 2ZRHA 2IHBA 2A5JA 2JLSA 3T15A 4B3BA 4JVMA 4JIMA 5JEDA 4DJTA 1Z83A 1KYIA 1OE0A 1YQTA 5E7IA 1HT1E 2G88A 2J1LA 2VF8A 4Q9HA 1C4OA 4DLZA 1CP2A 2IYUA 3BFKA 2O8FA 2NPFA 1BIFA 3OIWA 5L3SB 2O0HA 2FMXA 4NCHA 2ZRKA 3AVOA 4OK3A 3D3QA 4QL3A 3REFA 2XJ4A 3QG5A 2CCJA 3C16C 1E2DA 1UDWA 4HLUA 4AURA 4PAOA 4UKDA 3SNHA 2H92A 1KI6A 1ODFA 1A2BA 5HKKA 4BLRA 4HAUA 3SU8A 3FMFA 3CH4B 4D0GA 4DDUA 2FGKA 2ODBA 3K53A 1XJ0A 3AUXA 1N25A 2JLXA 4P33A 5DYGA 1E96A 3GLHE 3I32A 4LV8B 3PUWA 4LJ7A 1FP7A 2ZEJA 5B57C 3IUYA 3U60B 5CIQA 3ZYCA 4I4LA 2OUKA 1Z6GA 2FOLA 3FMIA 3VKHA 3VR1A 3BB4A 4QHTA 3HU2A 4MRSA 1M7BA 4DEXA 3TW8B 4OQNA 4B3FX 2OILA 2C8VA 3HYTA 4S2EA 3SYNA 3U7GA 3AP2A 3RVBA 1D2NA 1P73A 1R0WA 3U3JA 3K0EA 4ZI3A 3TKLA 3BIFA 1CS4C 2VP5A 2BC9A 4B73A 3U5ZB 4YC7A 1EFHA 1KZGB 1XMIA 2ZITA 1AGRA 3D6TB 2I1VB 1IY0A 5EUMA 4V0OA 2YC4C 4JJKA 3TSWA 4EPVA 2JJ8A 2YWEA 3NG1A 5AJYA 4MRNA 1IXZA 4F4JA 4OBEA 4YMTA 2ZAOA 4WAUA 3A1WA 3U4QB 2QQ0A 5F2EA 2IX3A 1TX4B 4B32A 1DAIA 1YR9A 2G3YA 2OFOA 1Z08A 1H8HA 1JXMA 2Q21A 1E69A 4NU0A 1Q1BA 4TLEA 1U94A 2IYYA 3TUIC 2PLFA 1YZQA 3VX3A 3BC1A 2ZE5A 4IOJA 5EXPA 5CB8A 2HDNB 3SQXA 1ZCAA 1JB1A 3U44B 4C3ZA 1ZM3A 1HE1C 4EKDA 1US8B 3BRWD 5JWHA 1KO5A 2CHVA 3TUZC 3N2IA 4HAWA 1KKLA 3LLMA 4JLOA 4JYCA 2D06A 1K5GA 2BOVA 2PJZA 2XNSA 3B1YA 1KI1A 3K09C 2C04A 4HUQA 3RS7A 1QVRA 4DT1B 4OHYA 1BO6A 5IDVA 1S3GA 4URWR 3KB2A 5EXXA 3KKPA 2QGZA 2V3CC 2XAUA 3NEYA 2HV8A 4BFZA 4YDSA 1NJFA 1QG4A 3UMSA 2ZJ8A 1G20E 1U98A 4HDQB 4BRUA 3R20A 3VR3A 1R0ZA 2J7PA 1E99A 5BXQC 1BMFA 2F1RA 1WCV1 4XD7D 3RS3A 2BEJA 3CWQA 2H57A 4PHGA 5FL3A 1AQYA 1YU9A 2OE2A 421PA 4CZ2A 4UXIA 2BKUA 4Q1CA 1GRRA 1SVKA 4HAZA 1UKYA 3VHLB 5DH9A 4XIGS 4FI3C 3PENA 3TVDA 2QRNA 2GTPA 4KU4A 3C5CA 3BH7A 4BWYA 621PA 3QJYA 3K9NA 3I72A 3L8YA 4B75A 2A9KA 1VIYA 2ZSBA 4II7A 1NN3A 4OYHA 1G7TA 2PLRA 3AM1A 3C41J 4WZBE 4BASA 1LTQA 3K0CC 3THOA 1UJ2A 3CZQA 4RKFA 4LBWA 4TLAA 2F7SA 1DEKA 1PUJA 3T35A 4WZ6A 3SJBA 2C9OA 3U7HB 2GJSA 5HZHA 1W46A 3WYGA 4PC1A 2ZROA 1Q22A 2EU8A 3OESA 4JLBA 4KAXA 4CEJA 1NBMA 4G5RA 4NKRA 4Z1MD 4URYR 2O8DA 4XWAA 2VA8A 1WMSA 2WWWA 3QXHA 2QTFA 1HYQA 2W83A 2VYFA 4QGFA 1NVVR 4CIDA 2J59A 4RCYA 4Q4HA 2AX4A 4XSHA 1COWD 2ERYA 2F1JA 3QG1A 1HE8B 1KI2A 1I2MA 2HJVA 2NZ8A 4FMCF 4GP7A 5IRCD 4S35A 4JLPA 4OQMA 2OXCA 1D8TA 2NTYC 5FBLB 1OB5A 3OFND 1EXMA 4M1MA 2IF2A 2W0MA 2ZI7A 1AS2A 1YHNA 2GEDA 1G8FA 2HJGA 2X77A 2ZU0C 3AEZA 3I92A 2GHIA 3TIFA 2Z4RA 3GLIE 3L0IB 1MRNA 2IS4A 3DKPA 2QL6A 2B8WA 5J47A 2DCUA 3P26A 3LBNA 2D74A 2WKQA 2FV8A 2HCJB 2NG1A 2PEYA 4YDHB 1HUQA 4HZUA 4P4TA 2C78A 1UKZA 2KSQA 4DLWA 2QEQA 2CCGA 3KZ1E 1W4CA 2GA8A 4AWXA 4D0NA 5BYKA 2WJHA 1JBKA 2ZRLA 2FEOA 3UPUA 1S2MA 4K81B 3ZDQA 4Q9KA 3GLFE 2IL1A 1LW7A 2WIBA 3LAWA 1AKYA 4I81A 3AVYA 3T1QA 3P20A 5FOTA 4BRWA 4Z8YA 2DWOA 3AQ4A 4LHVA 2QM8A 3CO5A 2AD5A 2GZAA 1ZINA 1R8SA 1JPJA 3AKEA 5LB4A 4U7DA 2WPDD 5AUPB 1DG3A 1G64A 4I1UA 5CDFE 1L8QA 1W1WA 1Z5ZA 2ZJYA 2IYWA 3K1JA 2R62A 2SHKA 4WBSA 2AKAB 1LS6A 3QKSA 2J41A 4F4CA 2C96A 4Q1BA 5G40A 4MH0R 3F3YA 1TUIA 1G41A 1W0JD 2ORWA 2VTKA 2WMNB 1R7RA 1G7CA 2WV9A 3KDSE 4ZCLA 3EPHA 4L5BA 1OYYA 2BWJA 1W4AA 1VPLA 4V0LA 1CKEA 2YNMA 5FPYA 2FE4A 2PJRA 1MR3F 3CRRA 2C2HA 3KX2A 1NRJB 2IWHA 4RFSA 4JZKA 2YZ2A 1E2HA 4MKGA 4E09A 3GJ3A 3F0TA 5JWOA 1B23P 1VG9B 5JJLA 1Z8FA 2FZ4A 2GBLC 5IK2A 4B33A 3LXXA 6Q21A 5EJEA 4U5XA 5J4KA 4EPWA 1M6NA 4LJ8A 1HA3A 2O8FB 1FNNA 1NLFA 4F38A 3WNDA 1F5NA 3WRYC 1ELOA 5L3QA 3QSYA 4QBIA 1SHZA 1NJGA 4LSGA 5KHOC 3A6PC 4MGIR 5EE5B 4LC0A 3REGA 3SYLA 1II8A 2ZREA 1W49A 2E87A 4KVGA 2JLQA 1UBFA 2QPAA 3SQWA 2FSHA 5DN6A 2ZM5A 3TE6A 1E9FA 1PZNA 4GZLA 2ZJAA 1KI6B 1TEXA 3FVQA 2HT1A 2DFKB 3SJAA 1E2EA 3K09A 4J0QA 3RLFA 4AG5A 4D26A 1R6BX 5JRJA 2ZI3A 1DAMA 3QQ5A 2QP3A 4U00A 5FR1A 4A2QA 4IRUB 3IO5A 3K8YA 1AN0A 1OW3B 1M7GA 4B48A 4DCVA 1NL3A 3FHTA 5EP1A 1OHHA 2IHYA 2BBTA 3B85A 3D31A 1A82A 1XPRA 1VCMA 3Q9LA 4LJ4A 3CF6R 4XTRA 1C1YA 4BPBA 2JJ2D 3FMOB 4PC3A 5DGXA 4M0LA 1BYIA 3X1XA 1IN4A 1VYVA 4IW3B 3SE0A 4DLRA 1YE8A 1SVSA 3Q5EA 5FFMA 3W8NA 2Z0MA 4MA4A 4LRWA 1Q3TA 1G7SA 2BDTA 2Z6VA 5IHPA 2EFEB 1E79D 1JXOA 2E1RA 2FN4A 3BS4A 4LCBA 3GFPA 5ANRB 4I1OA 3AF2A 2WOOA 3HP1A 4W5HA 4B2PA 3ND9A 3K70B 2G0TA 3AKYA 1VIAA 2BMEA 2N42A 2IXEA 2EFGA 2PT7A 3QNUA 4BFUA 3N2EA 1FX0A 4CDGA 2OFXA 5FUYA 5P21A 3A1UA 4NYIQ 3C8UA 2Q6TA 4WZAE 4NH0A 2D4HA 3P1JA 3CRVA 2CXXA 5CB6A 1T8UA 1HT2E 3R7WA 4C0LA 2ZTSA 4L9SA 4MKFA 5GJBA 3UK6A 4LJ6A 1SQ5A 4PTLA 3V9PA 1JAHA 1U8AA 1ZC4A 3VKWA 2LWIA 2ZRDA 1RC8A 1OFUX 4CF7A 2XSZA 3LH5A 4JBWA 1OV4A 1XFAA 2VIIA 1E94E 4EFLA 2P6RA 1ZW6A 1HEIA 1GUAA 5J40A 1SKQA 3LFUA 3LBHA 3ZH9B 2ZRJA 1PV4A 1Y3AA 4V0KA 2D3WA 2AFHE 2C98A 2BM0A 1HTWA 1E6CA 2NO1A 3GFTA 5KTYA 1WB9A 3LQQA 4ZO4A 2WWYA 1G6HA 1Q0UA 4FINA 4IVPA 2Q9CA 4GDFA 3GJ8A 2ONJA 3QVVA 1I4TD 2Q9BA 2HYDA 3T61A 2GJAA 5JJKA 4PO1A 5EUQB 4PPQA 3QXJA 1D5CA 2IYRA 5F9FA 1NN0A 4V0MA 5L3SA 2V8OA 1LF5A 2BV3A 2DFLA 4LHXA 1X8KA 1Z0JA 4DCTA 4QM6A 2AFIE 4D2IA 1SKYE 5G53C 1IN8A 3B7GA 3UKDA 3LQRA 5EP4A 2ZRCA 2NIPA 4NYMR 2R6FA 2GXAA 3ICQB 1II9A 3FOZA 1MV5A 1U8YA 2CVHA 5GJCA 3OZXA 2W6JD 3CWZA 3DEFA 1JR3D 5LB2A 5JFGA 1W47A 3O47A 4N1AA 2PH1A 2F55A 4C0JA 3NC1C 3PUVA 2D7DA 2J0SA 2ZYTX 1Z2AA 4GZMA 1JR6A 3A4NA 1X8JA 2HYIC 3G0HA 1J2JA 3NBZC 1LFDB 4IDQA 1XPUA 3ZS8A 1GILA 1DAEA 3KQLA 2BMFA 1EFRA 1YR8A 2CK3A 2R65A 1FUKA 5JEEA 4BE7B 2GILA 4M1TA 2OBNA 4DWJA 2NO7A 1D9ZA 2ZYUX 5AJXA 2I4IA 4BLPA 1ZMXA 5DE3A 2O8DB 4FMCB 2ZI9A 3D7MA 1KAGA 5SZHB 2GF9A 5FR2A 2V1XA 2C9CA 2IXGA 3PUXA 4NBSA 1Z6YA 4KXFB 4TQAA 1NMYA 3MGCA 4Q4HB 1Q57A 2ANCA 2TMKA 4B34A 4AY2A 4JLVA 1QBKC 1UF9A 2PEZA 2O8CA 3WMFA 2X19A 3IPYA 3QUSA 4IVRA 1OXXK 1XMVA 1KI8A 3SJZA 1KOFA 221PA 1P62B 3DZ8A 3LV8A 1UADA 4C0AC 3EPJA 1ZIOA 3OHMA 2XJ9A 2CL7X 1GL7A 4M9XA 5HCIA 5EE9A 2XNDD 4P4SB 4G01B 1SVLA 2CBZA 2GAAA 1IY2A 1J90A 3ETLA 2PCLA 4LJAA 2MMCA 3IPXA 4RD6A 5FI0B 4URZR 4IDNA 2VHQA 2CCKA 3FKSA 1NKSA 4HZUB 1IHUA 4YMUA 1YRAA 1P9WA 1Z0IA 3GLHA 4JBXA 2JASA 1ZD8A 2Y8EA 4HDOB 4HLUC 3MJRA 2NO9A 4ZDJA 3KQHA 3CRMA 1GKIA 2ONKA 1GIAA 2P65A 4HB3A 3O8BA 2RAPA 1F2UB 1Z6TA 1MABA 4D82A 3THXA 2RH5A 3EZ6A 3V4FA 3X1YA 2GEVA 4QBGB 4EJSB 5EZ6B 3U3MA 3CPHA 4F4IA 3T1TA 2F6RA 4PO8A 3QPWA 3WRXC 4CT4B 4RD1A 2YWGA 1G5RA 3FPAA 3PXGA 1N6OA 1VMAA 2VH5R 4H1VA 2QA5A 1E9RA 2HCBA 3DO6A 5G3ZA 3R8CA 3W3AA 5DLQC 4M53A 2JLYA 4TL6A 3ZIAD 1XJQA 3DDCA 3NC0C 2FNAA 1KZ7B 2RKOA 3HU1A 1NLYA 3K9LA 4LYJA 3R9WA 2QN6A 3VNVA 3DVLA 3ONWA 3K9GA 4RFSB 3RS0A 1GL9B 4US2R 1Q1EA 3UANA 4QOSA 2VBCA 3LLUA 4XVQA 4RZUA 5FL7D 3VR4A 1CR2A 4D4KA 2HXYA 3VKGA 1A5TA 1S8FA 4X8LA 3BORA 3CIOA 1FFHA 5DHFA 2AL7A 2G77B 5IF9A 4ESHA 4HDCA 3EC1A 1OB2A 1QHYA 3RRZA 2BBOA 4IDPA 2JA1A 2WAXA 4Q1AA 4L15A 1L7VC 2G83A 1F6BA 1BS1A 1II8B 2IEYA 2ZETA 3C15C 4DLVA 1DO2A 3L0SA 2O0JA 1MH1A 2ZRPA 3FFBA 5KOYA 1P2UA 2IF0A 1YZUA 4CW7A 5F98A 2FFHA 2QENA 1M1YE 2WAYA 1II0A 1N6HA 1TQDA 1WXQA 3GJ4A 4GRAA 1ZUNB 4JSYA 3RSLA 4OK6A 2ZR0A 4PQYA 4B44A 4AYXA 5KNCA 1KSHA 2IUSA 4BFYA 1E32A 2PT5A 4LHYA 4PSVA 821PA 4Q4JA 1OXUA 4XD7A 3RS5A 2JDID 4QJ3A 5FPTA 5FTKA 3TQFA 1OXVA 2QT0A 3LA6A 1TNDA 2ZUCA 2ZVQX 1XDBA 2WWHA 2QROA 3ZQJA 3B1XA 1KSJA 2KWIA 2Q9AA 3TJZA 1Z0AA 1NMZA 4UNPA 4A2PA 2ZPTX 2FSIA 4KYIB 2AKYA 3BXZA 1T3SA 4V0ME 3UATA 1N6IA 3NWJA 2YWHA 5ELXA 3TSOA 4MRPA 3NH6A 4MYUA 2GZHA 1G3MA 4ZV4A 3U3OA 1X1SA 4CYMA 4DUGD 3DOEA 5E95A 4FW9A 1N0VC 3U7EB 2FF7A 4Z1MA 3PUYA 4IJMA 3R7WB 1QZXA 4B76A 1XMJA 1KDRA 1NY6A 2GESA 4IXMA 5KDLA 1T0HB 1GM5A
chains in the Genus database with same CATH superfamily
1G42A 3CW8X 4JBIA 1L3BA 4RMIA 1ATIA 1RQRA 3BFVA 4RORA 4XR4A 3WMXA 4F4FA 3GRZA 1COWA 3S2SA 3TMAA 1B00A 4HVTA 4IR7A 3R5JA 5JXGA 1XAHA 1GYPA 2OTCA 3KPJA 4RHTA 3VJKA 5JI2E 3P9CA 1YCDA 4G4GA 3Q3GE 4GFDA 4KQHA 3IGFA 1UBUS 1WTCA 3C14C 1DELA 4GPAA 1G3QA 3DOOA 4HGQA 4PC7A 2CGEA 2PX8A 5I7SA 1KBOA 3PYMA 4MVJA 4LOHA 1VE3A 5K8JB 3C3JA 5HM8A 5BQFA 5LP1A 1TF2A 5REQB 4XIJA 1UFOA 2AOUA 3EFBA 3Q0TA 4OHOA 2NQ2C 3P5SA 1YT5A 3HR7A 4D44A 4HX5A 3VC1A 3A32A 4JYZA 5AK6A 5HUQA 1T9HA 4XAQA 3Q1KA 1CZNA 4WJLA 4RD4A 3WI7A 1F3LA 1I1OA 1QHXA 1UJ6A 4MLZA 4D4HA 3VYRB 3HJNA 2GO1A 3DKIA 5BR7A 2ERXA 1XMXA 2O3TA 1S96A 5C5CA 1B3RA 4R1TA 5JCXA 3A37A 3OZAA 1UP7A 4Q21A 4E11A 4PQEA 3ISTA 1QQAA 4Q9IA 3GFFA 1XTZA 3GD5A 3RFFA 2YFYA 1SULA 4KBFA 4YNBA 3LY5A 4DEYA 2XXJA 3TINA 3GLFA 3EEFA 3OFVA 4N9WA 1P31A 2R44A 5HGJA 3KUKA 3U7RA 3V6MA 4E32A 3F6YA 3TZLA 1QP8A 2FEWB 1Z2CA 5CM8B 3OO1A 2PUGA 2G70A 1FU7A 1Z5GA 3ZWAA 1P33A 1ST2A 2KX7A 4M60A 1KMMA 4YT4A 5IF3A 5C53B 3UOWA 4LNUB 3E4DA 1NUUA 3RWBA 5IAGA 3N2ZB 3N8IA 3EAFA 1YQGA 1KGDA 3FSRA 1N2EA 3N28A 1T9KA 3O92A 4TWZA 5FI5A 4C21A 1K06A 1J21A 1GU0A 2VUSA 4LV6A 4TS4A 4ZA2A 5JV5A 1WOMA 4CVNA 1DBRA 2RHGB 1Y98A 1GRQA 1A71A 3FM9A 3QI2A 5KOHA 4B3MB 1JKMA 4JSRA 1SCNE 4YGXB 5BWMA 1FXSA 1GAQA 4R7TA 1LPBB 1KPIA 3AIIA 4NMHA 3EX7C 2DUJA 4JASB 4Z3OA 3GV0A 3LRPA 4M21A 5G1NA 1W93A 4HTFA 4BMPB 2OPBA 4PZ0A 4A6DA 2OKGA 3X2FA 4LQDA 4N0EA 2EJBA 2HWYA 3DW3X 3W5JA 1G3UA 1FYDA 4BU0A 1MORA 1UMDB 2HM7A 2VWPA 1O94D 4W5OA 3WKDA 3NHPA 4ZVLA 1J22A 3PEEA 4G85A 1NVVQ 1W29A 3AEXA 4KR6A 1YFZA 3EIXA 3QPCA 4J1SA 3HJFA 1M66A 4JT8A 2YNMC 4QNMA 1ZH2A 1VJ0A 3R7DA 1AKNA 2EBFX 1I6MA 3C7AA 3DVRX 5F1YA 1K0FA 1PR0A 4R8VA 2PANA 4ZOBA 2GCGA 3UA3A 2OV3A 1PS8A 1M9NA 4EJ6A 5EHXA 1LS1A 3T5GA 2HPHA 1M2EA 3GP3A 3A1NA 3JRNA 4A8PA 1AS3A 3P2OA 4BX0A 1Z0KA 3H5IA 3OOWA 5TV2A 4ND7A 3LOPA 1SXHA 1UFKA 3JYOA 3E9RA 1KEZA 3QJGA 1PV2A 4JNCA 5CH3A 5JU6A 4NPCA 1K86A 4JX9A 4C05A 1N9GA 4ZGBA 2G1AA 2KJQA 3OM9A 4CF6A 3K1AB 5FHRA 3IVXA 1E59A 3B6KA 3FLMA 1KIMA 3JRXA 4G0OA 4ZTUB 3M4NA 4IYRA 5I7FA 1Q20A 3R8FA 1HMPA 1YACA 4XWYA 1AY0A 3L4BA 5GINE 1AB6A 3GLHB 5K3CA 2HBZA 4B87A 1U2DA 1ONNA 4PCLA 2OYRA 1U7DA 1HE2A 2P1DA 1EM8A 4KVAA 2H2DA 4MLCA 3A26A 4WA8A 5B6IA 4RA6A 2G1PA 1IB0A 3LYHA 1Y7IA 2C2ZA 1Z0ZA 1W6RA 3ZX5A 3P97A 4KQXA 3S29A 3PT9A 1R6XA 4ROTA 3THXB 2GWRA 3GZTB 1U0NA 2H9AA 3CWCA 3RC1A 4IJ6A 1BH2A 1BN7A 1ND6A 1QIEA 2EXXA 2P2DA 3GAMA 2CWDA 4LRUA 1L5ZA 2VDOB 3LWZA 2A8YA 4CKEB 4AS2A 3UK0A 4UDYX 4Q3OA 1Z36A 2AG8A 4AECA 2V7GA 3O9ZA 2P5SA 3ASYA 2CFTA 4G5GA 1VHWA 3AFOA 2O5VA 4TL8A 1XHEA 2CLDX 2YHIB 5I5GA 3ZI4A 3FETA 1YR3A 1YUBA 1RFGE 4Q4DA 1CPYA 2HMTA 4X8HA 5B1SA 3ZDEA 4TZ6A 4D6YA 1ZDMA 4P0PB 2IXDA 1T8PA 3IULA 3SDZA 1S2DA 3ZXUB 2CNKA 5JAOA 2WD7A 2XNHA 2I2XB 5IAKA 2X8WA 3TL2A 1JHPA 4RD2A 4X5OA 2Q5QA 2V54A 3VC3A 3IQEA 4D41A 3HEMA 5BSVA 3HKDB 4BN5A 3FIUA 4BAGA 1B8VA 1NULA 1FYFA 3IE0A 4NAHA 3BXFA 1B16A 4R3NA 2H1LA 2XZPA 2Z4TA 1E3QA 5EWJB 4LOLA 1B0UA 3DEZA 4FJ2A 2VSOA 3EISA 3ZHTA 4HYEA 3OE5A 1D2RA 4ZKDA 4CXMA 1C9JA 1E6UA 3KTOA 5CB0A 3RVKA 4G56A 4OATA 1N5IA 2ZR7A 4YDQA 2OC9A 5TMPA 3F5QA 2JFGA 1RKBA 3ZDBA 1DSSG 3WKCA 3V9AA 3FOEC 2GEKA 3CT6A 2WM9B 1EK5A 3RU2A 2R25B 3DV0A 1CQJB 4DDWA 1W8IA 2ZI6A 3FX2A 1JHYA 2PZEA 1UOPA 1V45E 1C3XA 1ZJ6A 2JGLA 1NXXA 4F8JA 1BS2A 1VDZA 3FTFA 4GWGA 3FZGA 1ZNYA 1JB9A 1P1HA 1YIOA 2VYVD 1XVUA 3TI9A 2NACA 3CF0A 2JVJA 4A2CA 2H2AA 1S3FA 4J07A 4F2HA 3KD2A 3RVQA 4BBJA 2REQB 5SICE 4BLWA 4A82A 4WCFA 1N8NA 3GHYA 1G6Q1 3EJ6A 4JI8B 4A1FA 3PFGA 3R6TA 4Y0AA 1UOEA 4XJXA 4P4SA 3M33A 1VMEA 3ND8A 4HDKB 1TT5A 3U0BA 4Q7JB 3JSAA 1K7XB 3DDZX 3D4BA 3BD7A 3I9NA 3GXBA 3L8EA 3J81k 2A94A 4NK4A 3QTBA 3WYBA 4XJSA 1ENZA 3IAEA 5K0NA 4BJ6A 1L5FA 4JN6B 1S01A 2NYAA 3LC1O 4PHFA 4QTXA 4WLNA 2ZUWA 3B12A 4G84A 4RLQA 4KPUA 4X93A 1G21E 5BYJA 3V2GA 1MZPA 1E3SA 5JBQA 1JU4A 1MIHA 2IV7A 3X1KA 1ADGA 3DC2A 5F7OA 1ABEA 1R3DA 3LPAA 3UFXB 5LWQA 3A6KA 4IVNA 4II2A 3HZZA 3M6IA 4KUHA 5JS8A 4G0YA 1NMXA 3JQBC 4BQSA 1ORTA 4KLRA 5JZVA 2BHNA 2RGNC 2XRMA 3WY9A 1IN1A 3MEQA 4ENTA 1V96A 4HNTA 1C7ZA 3D5EA 3FYHA 4P7JA 4ZI7F 4KRFA 3U80A 1KU6A 3O2NA 4TZTA 2CHUA 3H2YA 3NT4A 3HYLA 4H15A 1SBQA 4O2LA 1ZNZA 5CHYA 3K9QO 4O4LB 3O0DA 5L40A 2MWMA 3ON5A 1E9CA 1M5UA 3C48A 3E3MA 4LX0A 1IH8A 1NBAA 4HB0A 1P7CA 1O6FA 2JLRA 3K1TA 4EZEA 4S3MA 4P7KA 1G2PA 2WPNA 2XDQA 3F97A 3PQCA 4O33A 1P75A 5KU1A 4PPYA 4DSTA 3GF4A 4B3XA 4CQMA 2OWEA 3P9NA 3ZD9A 2RH4A 4AN1A 1J49A 4PQFA 2QXUA 5HKKD 4RKQA 6ADHA 1WUYA 3GT3A 3P0EA 1CZUA 1W4RA 3ZQ4A 3LT5A 1X38A 3S8YA 2WM3A 2AOUB 3H1PA 2WWRA 2W2LD 1MB9A 2HN9A 1JALA 3EULA 5F76A 4L7QA 2XQVA 3DF7A 3KCQA 2GXSA 1VCIA 3G8BA 2W48A 3HL4A 2RHWA 5JXIA 5AQ1A 4UDNA 4EEXA 1VJ1A 1L5SA 3EZ9A 4LE0A 2WABA 3OKCA 2VL7A 1V4BA 5FD8A 4Q19A 1IWPB 2ZRIA 4DF3A 2AZXA 5KC9A 2XWSA 3P4XA 3V8QA 3N7UA 1DC7A 1O57A 1I2CA 4ZPXA 4B6PA 3S70A 2O1SA 4PYMA 2ZYHA 3GLFB 1DLJA 4N18A 5JS7A 1XTRA 3RU3A 3BG5A 2O7QA 1GCOA 1P3JA 2Q6IA 1JHQA 2ZJ2A 2Y1DA 3MBKA 3O94A 4RDXA 4HYYA 4YMSA 4FCTA 1JDNA 1XZFA 1L4LA 1OKKA 1GQFA 3NHYA 3OE4A 2RHBA 5THXA 1DXHA 2AWOA 4YRLA 3AEKA 6REQA 1R8YA 4NCIA 3RFUA 3SSMA 1HYHA 4HCJA 3FNQA 4LYYA 5EMHA 1UT8A 1SHTX 2JLZA 5TARA 2Q8PA 4O08A 1RBZA 2GN4A 3L04A 2CXQA 2ZANA 3M34A 1POXA 3IBGA 1U04A 4OMUA 3V1UA 4BUZA 2C3PA 3TFOA 4OHVA 1NPDA 1XU4A 2JEOA 1KETA 4FYWA 4MS3A 3ZI0A 3F96A 2I3GA 5EGNA 4HTFB 4YR9A 1RM4A 2F1IA 3JQGA 3ZWBA 3QVSA 2JAOA 2X86A 2I34A 1Q15A 1JAZA 3D2LA 1CLEA 3OY2A 4Z4HA 5CYOA 4D9FA 4YPOA 1PJ8A 1WNTA 2GASA 4M0UA 5DNEA 3UAVA 1XL0A 4I5GA 3U19A 4KWEA 1CR4A 4GBJA 4J3JA 4MRVA 1BQ3A 1E3WB 2F48A 3FUWA 2DX7A 3ELYA 2R8XA 2VJPA 4YRMA 4B3CA 1RRKA 2JEYA 5I8WA 3OCVA 3PUJA 3DOFA 2QUHA 1KQNA 1EFKA 1K9SA 3V1TC 2FPRA 4WGFA 1M2JA 2XITA 3KAQA 1LWNA 2ZRNA 1JTFA 3U7IA 3ZD7A 1XK7A 2P9BA 4P0TA 1NX9A 1WHSA 4HBGA 4D81A 1AMUA 4KE8A 2I6XA 1TM2A 1Z74A 5AMXA 2HZBA 2PZLA 2V4MA 3W77A 1DKRA 2Q3EA 1EFTA 3CO0S 3PZBA 4XB6B 1IXSB 3EVFA 4JBLA 1PUXA 3D6MA 3NXSA 3O3MB 3RWOA 5JSHA 1GFWA 4FB4A 5ALIA 3TTVA 3V46A 5DM4A 3HCWA 1N9GB 1T6ZA 1UR5A 1V8PA 3L0YA 4PC2A 4JBHA 4UOQA 3U39A 1EHYA 2Q4RA 2WU4A 4CM6A 2FSGA 5IAOA 3IUBA 2A86A 4BZXA 4XCVA 4UVEA 5GWXA 1HRDA 2NXJA 4DUZB 4XQGA 4ITVA 3A1EA 1HXHA 2XGJA 3LY7A 3QMVA 5DP2A 1KQGA 3OAAA 5M04A 3JRWA 1EM8B 4CMAA 1GKYA 5THQA 1QHEA 1TADA 2HNKA 3ILHA 3QF7A 2JIOA 4RA6B 2OMEA 3WGIA 1VL1A 1WUHS 4KWIA 4YRNA 3FWNA 3E1SA 4Q5IA 3C6KA 2AC7A 4MA0A 1ONOA 3NPAA 2ECKA 4QO7A 2PH7A 3EK2A 5IM5A 2F90A 1Z29A 1PBTA 4WFJA 2OGUA 3I3SR 1CJKC 1DRKA 3ZOZA 1T0JB 2BFWA 2POQX 4QU0A 1XZCA 2W2XA 3EGCA 4RNDB 1DAKA 1P74A 5EOVA 3TKYA 3X1ZA 4JKIA 3BA6A 3SKXA 1XV5A 1UODA 5AOVA 3F2IA 4M38A 4P9NA 3FHOA 3QNWA 4KNVA 1U7TA 1ODIA 2X1HA 5CW1A 2RG7A 2G17A 3V3TA 3VHXA 1T5IA 4X1OA 1GLNA 2NT3A 2RGGA 4R9NA 3RYIA 5T64A 1I7DA 3H87A 4MK4A 1OZ0A 2ZUTA 2VNAA 3I2JA 1EUQA 4LCEA 4FGLA 2Q2OA 4G37A 2W70A 1ECPA 1SXIA 4ZVRA 1N0UA 3I42A 4DUGA 3KS9A 5F3RA 1J5PA 4A0RA 1C30B 1XDSA 5F33A 1VKJA 3NHMA 4EFNA 2WD7B 1RPAA 4C0KA 2IY8A 2FW8A 1A9PA 1Q3KA 3GJXC 3KNZA 4MI6A 4IXWA 1AOXA 4DC1A 4B46A 4PYKA 4LRXA 3ITKA 1Q3HA 2CLSA 3KJEA 3MD0A 3PCXA 5LDHA 3BSFA 3EB9A 3CPSA 2GCNA 3O83A 2J9YB 1YA6A 1E9BA 2ZWIA 4GKKB 4DLTA 4CMHA 2PRZA 3A9VA 1WMEA 4KQWA 1ZEJA 2ZIAA 4DB2A 3LO5A 2HA6A 3D7KA 2MIIA 1XN1A 3JQ9C 1VFNA 5AYVA 3CNOA 4M1KA 1RAFA 2QTCA 1F7VA 2HTFA 3DV0B 4PG4A 4R1LA 3I73A 4X7RA 5BW8A 3RRYA 3GAAA 1G19A 5KTOA 4LXUA 2FGJA 1PS9A 4M1WA 1I0ZA 1XMPA 2BISA 3ORHA 3SIXA 3HTXA 1OXKB 2V5AA 1QIHA 2BCGY 2FW0A 4KIUA 4ALIA 2SBTA 3ND5A 4EABA 3IKMB 2WIAA 1X8LA 4Z0PA 1DDGA 1I10A 1OXBB 1Q19A 1Q83A 1T29A 4KE6A 4QELA 4D9NA 3RSZA 4W5NA 4AT1A 3AW9A 4ESOA 4KKVA 3WX0A 4XPZA 1Z7EA 1FNMA 4WCFB 1RWQA 2ALJA 3SWWA 4I99A 1VGVA 5JTTA 3H5WA 1Z4OA 3BZWA 3RM3A 2XZDA 1R50A 1SKYB 1GPMA 3MOIA 3MJEA 5I4KA 2N46A 4KX5A 5JCJD 3QELA 4UM5A 1TT5B 2FFRA 1HETA 3AI1A 4RXMA 1B76A 1Q44A 1BKYA 3HCEA 4FJ1A 3W4JA 2QP4A 3TXXA 1WBBA 2J46A 3OCWA 3HVRA 3SSOA 1YDMA 4R7ZA 3L0OA 4KPUB 4DJAA 1P0MA 1H2EA 3WWPA 3ZZNA 2ZYWX 1AV7A 2A5DA 3NGMA 3SZLA 1CYEA 4ZVQA 1Y4SA 2O8NA 2ODNA 2R5NA 3NGXA 3PITA 2XTNA 4GH5A 4IV0A 3B9RA 5LQKA 3K9WA 2CLOB 4IXDA 4W5WA 4ES6A 3DEYX 5IK2D 2ZDQA 1DWPA 2OVBA 3AVWA 3PUIA 3L43A 1PVOA 1DWUA 1P0FA 2PD6A 3RHFA 5KTSA 1D04A 1ORRA 1RTKA 3ERCA 2AOTA 1E6MA 2UUBB 4LE1A 4M7WA 3HV2A 3GFQA 3M4JA 1W19A 2QAGA 3BXHA 5EPUA 3BGVA 3HCBA 4NOLA 3AQIA 4Z4IA 1UPTA 4YACA 4PYJA 1HGXA 2DR0A 1PWZA 1E2JA 3ENQA 3FUCA 3G59A 1LBHA 2O3JA 4QHYA 3ZHYA 2DFTA 1J4AA 1GL3A 4AP6A 2C7VA 4Y6LA 1JVSA 3DF9A 1WNFA 2XDQB 4E33A 3U81A 2PZFA 5EAIA 3NM5A 1OT5A 3AY7A 2YH2A 2A30A 3LUBA 4CQMB 5B2EA 4AY6A 5DNYB 1Z4QA 1PCXA 1USGA 4K9SA 1JJ7A 5F2KA 2JLVA 2UYQA 1E77A 1M3SA 4H77A 1G8PA 1MC8A 2IHJA 3ORFA 3OZFA 3GRKA 1RRCA 1E4YA 1KKMA 1FZQA 2Y05A 3NHAA 2VP9A 2O6LA 1QCZA 5FPQA 2B9EA 2P2CA 3A9TA 3TTUA 1QHNA 1Z3IX 2IC5A 16PKA 4HLDA 4TQGA 3EOZA 2COUA 3QOWA 4N40A 1ADCA 3U7FB 5EJ2A 1MJNA 3HYRA 5KVAA 2FY8A 1TE2A 2A67A 2ZS7A 1YE3A 5AJHA 5JZBA 2R8EA 2VDNB 4I66A 5IRCD 2HA3A 4S1PA 4IIGA 5M3BA 2RC5A 3WL5A 5AD1A 4M87A 4O4JA 1L4KA 3CLUC 3ZC3A 3U3DA 1JA1A 1GZSA 5H83A 4TLBA 2DPHA 4CGZA 1XMSA 2FFQA 5JLJA 1FF9A 2HF8A 4YRCA 2PYZA 2GOYA 2VJCA 3OE7A 2WU3A 1CERA 1IIBA 3QXCA 4R2WA 4TL9A 3L4BC 4KXUA 5E1MA 3HR4A 2QUJA 1U2DC 4FFDA 3G9XA 4NYJR 1GP2A 2NW6A 1IBKB 3L7OA 3G2LA 4OOEA 3AEKB 2F1HA 2XMRA 6REQB 4WVFA 4NH4A 3HU5A 4BLQA 4XLTA 2XYVA 2Q5LA 3V4PB 5IFKA 4H6XA 2Q3BA 2V98A 5CDTA 3AVVA 3EGIA 2E48A 3ONDA 2Q5OA 5C35A 2QWXA 2GPTA 2VXCA 1BX1A 4BNLA 4Y2VA 4INZA 5C80A 3B7PA 4I1IA 1LV8A 1SIWA 3DTVA 4MS3B 2W5UA 1UAAA 4DWWA 3F5DA 2GZMA 1W5SA 4DZTA 3JQGB 3CNEA 1CZKA 3FOFC 3MGAA 4TUYF 3PGJA 3A4LA 5ALJA 2A3RA 2PY6A 4GSLA 2DHDA 3RCBA 4M1ZA 3TZKA 4DJJA 2FUG1 2UZIR 5BSEA 1PL6A 2Q2WA 4RS3A 5EESA 5KYXA 1G60A 2F4NA 3LF1A 2HL6A 3OIYA 1XRPA 3FRJA 4ZU1X 2V55B 4Z1OA 3PUHA 4MQ6A 2CF6A 1KBQA 1Y1KE 2QJTA 2BM1A 2IITA 3ZW7A 1W96A 3D8TA 2G36A 2IPMA 1DBWA 1ZD2P 4UNRA 2GZ2A 2ID9A 4NE7A 5BQXA 2OAGA 1WHSB 3KZXA 1XROA 4GBGA 4U9HS 1EXWA 1K7FB 4YXWA 2R5FA 2V6IA 2XUHA 4PSCA 1RLTA 4IDAA 5IUJC 1D2EA 1SUPA 3JTMA 1QFZA 1R0BA 4LN1A 4QHSA 3S2GA 4BZZA 3G2KA 1O0BA 1GOTA 1U4NA 4C6HA 3V4RA 3RWMB 3TQQA 3LQ1A 3WK7A 3OT1A 2GBGA 3KSAC 2DHCA 1RHQA 2ADOA 5KSYA 2QZPA 1KIFA 5D1HA 1N78A 3MXOA 4D3FA 1U8ZA 2EFCB 3BWVA 3BWXA 3UAGA 4LFAB 3VYVA 3UMVA 2ZJ7A 1ZIDA 2C7RA 3N87A 2ILTA 4FFBA 5LA6A 4RDIA 2C7BA 1MQSA 4R40A 4AYTA 1E9DA 2GBCA 5DBGA 1Q0QA 3DM9B 2XGGA 3H86A 3QPDA 3RARA 1I94B 5KWIA 2V65A 4OM8A 3MC1A 2VDMB 5JDCA 3Q2KA 4PX9A 1SCIA 4L9RA 3PS9A 2BUBA 1OSNA 4ZV7A 4RKYA 3HCFA 4NULA 3EZGA 3ANYB 2P2SA 2OFWA 1BVRA 4BMZA 1ONBA 5L8VA 4WCFC 1JDVA 1NW9B 2VO1A 1QQ5A 4YXFA 4I7EA 1D4OA 2GJ9A 1G21A 1R4ZA 2IW3A 4HWSA 4WUVA 2H85A 3DHEA 5FWDA 1UWKA 4TSFA 4AB1A 3T5CA 4GD3Q 5AOCA 3JR7A 1KJ9A 3VHXB 4QUHA 5JMTA 3FI0A 3K0KA 3RYIB 4Z4FA 1P9LA 2V4ZA 4F91B 4QICA 4B09A 1OPXA 1KQFA 1Q14A 1PTJA 3B9PA 4MDYA 2HIHA 3EEIA 4DC9A 2JA2A 2HLHA 4H7HA 2FPSA 1RHKA 4P7FA 1HNWB 5CB4A 3R7SA 3JQ8A 7GPBA 4EHDA 1WQ1R 2JJQA 2WVAA 4TYNA 1KAOA 2ASVA 5AVZA 1H9CA 3I37X 5LPNA 1NVGA 4I4TB 3BL5A 3KJHA 1FYXA 3KB8A 4NEQA 1VP9A 4RL4A 4QYWA 1RQGA 1SB8A 2H5EA 2R6DA 4XCQA 1QV6A 3KTFA 3EWNA 1G98A 1ND5A 3ZHRA 2YBDA 3RJ5A 5AM0A 4WQMA 1IPEA 1D2AA 4MAAA 4ZOCA 2XYGA 1WV0A 3OOSA 1G4AE 1U0GA 3BFXA 4HWRA 4JITA 1AK9A 3HY3A 3HI6A 3OCXA 4FSDA 4AKEA 1LLFA 1NXPA 3RIXA 4S12A 3IVMA 1R15A 3HCPA 4HNVA 2C4NA 1CY6A 3FKSD 2FDRA 3ABZA 5CH8A 3GCDA 2ZJBA 1FL9A 3D6FA 2PBZA 3I1YA 2IHTA 3VVLA 1H4VB 5J2TA 2CMGA 1E2QA 2RE8A 5JBNA 4WOBA 2Y67A 4C5AA 5B6PA 1G8YA 3WB2A 2QZJA 4IUDS 2CVPA 4BOYA 2OHJA 1CUSA 1CUEA 2JATA 4NZPA 2GAJA 3WGYA 3RSFA 1W25A 5KNBA 2XCUA 2IU3A 2F3RA 1DPFA 4WDQA 4ZHQA 4A73A 1UK7A 2PX4A 5K09A 4LGMA 3QVMA 1Z22A 4LZAA 4O4HA 1E6LA 4NCKA 4Q3KA 1NNEA 1CD5A 4QUDA 2A1IA 2NO6A 2CFSA 2D1YA 1BD4A 1JNYA 3C3KA 3KKQA 3LVBA 5SYNA 2IYOA 2WMOB 3DAFA 3QELB 2C3OA 3UTCA 3ZD6A 1CY2A 3E58A 1DQPA 1O8BA 2OV6A 4UREA 2O4UX 3HXMA 2WUVA 4ZC1A 2QW0X 3T7JA 4UVGA 1T1EA 2J08A 1RXCA 5K3BA 2C61A 2MDTA 2NV0A 3AKDA 4ZRMA 4CG0A 3IVRA 2B82A 3LMKA 3LYAA 4AP9A 3Q8MA 4LRTB 3GJTA 3Q0IA 4B6EA 4IIEA 1HF3A 4MCAA 4EHHA 3DR3A 3ZWCA 2BGTA 1XLUA 2Z08A 3W34A 2JFHA 4HVLA 1H3NA 1HYEA 2YIVX 4A0HA 4HMPA 6GPBA 3HFGA 1HQYE 4HQNA 4RACA 1IJFA 3MJCA 1JIKA 4FX5A 4PO9A 3RUIA 1YGYA 3R75A 5C18A 3UVEA 1TXGA 3L4EA 5LMUB 4CKBA 2DXIA 5JYBA 5AO9A 2WWVD 2AOTB 4X44A 1TJPB 4HPWA 2QAGB 3PFIA 4PYOA 2DQ4A 3AF6A 3P2KA 3PXEA 1P60A 4FEGA 1D2CA 3I0NA 5CM9C 4AJKA 5C5DA 5CYPA 2D7CA 4LGYA 3AKCA 2FKAA 3MPOA 4Q0MA 5AOBA 1NT4A 1QR2A 3AJDA 3MRTA 4CIBA 4RF2A 4OX9Y 1LEHA 1C1XA 2XNJA 2R47A 2XWBF 4G63A 1AHNA 3AL2A 2EARA 4F86A 2C77A 2P5TB 3FYSA 5B5SA 1NP3A 3HLKA 4BFWA 3IIIA 5CM2Z 4J75A 1TI7A 1U1DA 1O03A 1DIBA 2WA2A 3DBLB 3FNGA 3KQQA 121PA 1ZD5A 1T3HA 3CX3A 4G07A 4OCZA 3G8YA 4Y18A 3TW6A 4BP8A 4UNSA 5B7QA 3TECE 2O5RA 1IY9A 3DBRA 2O19A 1XEAA 2RCYA 3D8SA 2ID4A 1Z5VA 3QZUA 5AW3A 1XVTA 3IHLA 3W04A 4BP3A 2G7ZA 3NV9A 1P9NA 4EKIA 1CUGA 5JCPA 1XJCA 4DCPA 2FEXA 1WS6A 5ER6A 5ED4A 1IVNA 1RM0A 3EUEA 3VO1A 1QP4A 1L3IA 4O4JB 4OIFA 2SNIE 3I12A 5EMNA 2HC9A 4FPXA 2Z6QA 3F47A 1P0PA 2H07A 2SECE 1A1SA 1SD2A 2J6HA 4PPFA 4P98A 1DXOA 2ZU6A 3JVVA 1U0BB 1PDVA 4NEGA 4AIRA 2DR2A 2FVXA 1KEKA 2D5CA 3MYYA 4YAEA 4ZOQI 1DKMA 2OCAA 4HPXB 5T67A 3DFUA 3PICA 4FN5A 4OQQA 2VWGA 4NBVA 4PFQA 1BCSB 2LDXA 3Q8XB 4FMDF 4NECA 3SBXA 4C3OB 4C08A 4RGVA 2W6OA 2X0RA 2G1JA 4ZFNA 3B9BA 4GI3A 3UWOA 3WXMA 2KM1A 3QFHA 2JLWA 3A1TA 3PDJA 1VE5A 1E5TA 2JGIA 4MB6A 4A2WA 4DCGA 2FX3A 1DCTA 3AZPA 3DTVB 4DQUA 3R7FA 1T36A 2OCIA 2OESA 1FS5A 5DYYA 1LVUA 2IHKA 4TYQA 5CCDA 5KTKA 4G5YA 2BJVA 3K15A 4RE5A 4I9GA 1ZJ4A 1FMJA 1G8HA 4QPCA 3QVUA 4B3JA 3ETHA 3KVOA 4GMKA 3VOTA 1VL5A 1KEVA 1L4UA 1Q1NA 3EAGA 2OGWA 2RJNA 4G9EA 2PL1A 3ZWXA 5C7YA 4YP6A 1SQ0A 2PHZA 3DKKA 5IKXA 1EDZA 4BO7A 1S2OA 1ARZA 5FQOA 1DARA 1OVGA 1QQ6A 5KYXB 4Y67A 4KITB 2BI7A 3SJCA 5JIBA 4ZC8A 1H2HA 2XA1A 4GLFA 3L7MA 1PFWA 1Y9DA 5JALA 2WJ3A 5L4LA 1GVHA 5DP1A 4DA0A 4NBTA 1PQWA 2HK7A 3P2JA 2PKYX 1WXHA 5HZKA 1O3YA 2ZJOA 4OHRA 3NFYA 1TUBA 3DD1A 4KG7A 2C92A 5A04A 1PFVA 3LT4A 4Q4AA 2VP2A 4NV1A 1EWQA 3KR2A 1Z38A 4YV0A 3KOYA 3IMKA 1PK8A 2QVYX 5FNZA 2AG6A 3AESA 2HIGA 2W71A 4IFEA 1PSZA 1X6VA 4AZ3A 4EG6A 1TPYA 3T8YA 3MG9A 2O0LA 3OT1B 3LX8A 3SLKA 1OD6A 1C3VA 3HNRA 3CXRA 1HZZA 4ZKEA 1SZDA 5J63A 2BL4A 1MKYA 1P4SA 2PKQO 1GYRA 3OQPA 1AQIA 4JEMA 4LYGA 5KQPA 1VBNA 4L8YA 2Z8YM 4HLQB 3ZW8A 2JJMA 2XZLA 1N0IA 4QLAA 3IPLA 1LSJA 5LA6B 1E3LA 4JP2A 3VH2A 4CMEA 5M2QA 3IJRA 3K0AA 1P2VA 2KE5A 3D8HA 4KRXA 1VKNA 2JJ1A 3HDJA 1A4RA 3QM1A 3PE6A 4LXIA 4YJ2F 2HU7A 4XFKA 4C3VA 4IVQA 1V5WA 2ZIFA 3U1VA 3BICA 3M83A 3RRXA 5BP7A 4V1CA 1IG0A 3V8PA 2P77A 3Q7RA 4EZBA 1PJBA 2BE9A 4MA5A 2ZS9A 3KOMA 4GL2A 4Z2YA 2AQKA 1G21B 2JFVA 4D79A 1U5CA 1XNJA 5F5XA 5DXAA 3EDRA 3RANA 1B4DA 4M1QA 3ICEA 1TKAA 4LDQA 2VP0A 2AEMA 3ZWOA 1UQRA 1OX4A 2H2IA 5LVAA 2XHZA 2Z3ZA 3FGNA 2LCIA 1X80A 2RBGA 5HJEA 2DF8A 4FOTA 3PEFA 3U4GA 4M37A 2FPIA 3K70D 5CB4B 1OXMA 1EWTA 3GUYA 3JQ8B 4R1UA 4JK3A 4N82A 4PANA 2J9XB 2I3ZA 4XD2A 3T7EA 4OHXA 2RHTA 3PIDA 3UJ8A 4OHPA 1AQNA 2ZCJA 2NZWA 1BNCA 3BD9A 2H1VA 3Q1LA 4IO1A 5ALWA 3GNQA 3KYDA 4K7JA 1YZGA 3R0IA 2QTVA 2A1TR 3VO9A 2IYAA 3U4IA 1E5XA 2IYNA 2ZTMA 4GP6A 4IHQA 2PL9A 2Q46A 1UZNA 3CVJA 3DL0A 4R6XA 5DTRA 1A1VA 1Z5WA 4P3XA 3PPYA 1FDUA 5EWMA 3B6JA 1H8HD 2OXEA 3JQAA 5TQ2A 2QAGC 2W22A 5HG0A 3AP1A 4QTUB 5LDDC 1QV7A 2DKFA 1XLTA 2IYZA 3CR7A 1IULA 3HWWA 4PHTA 2EL7A 3NIWA 1DADA 1A98A 4WCDA 5CJPA 3ZWYA 2DUMA 5CNIA 4D8TA 2D2EA 3BE5A 4D98A 3BK1A 4J0HA 1UJMA 5J2TB 1KVUA 2UYGA 2VDLB 3CINA 5IAEA 3SNKA 3T9FA 3TD6A 4JC0A 2XCRB 4XYGA 1PZGA 3SHFA 2MINA 4UTPA 7YASA 1MFZA 1GGEA 1U8FO 1MJ5A 4GSYA 5GVSA 1HR0B 2DTEA 3CLVA 1TO1E 2C5LA 3HACA 3F7OA 3HBJA 2HRRA 2QX6A 4G0MA 2H5LA 4ZHQB 3WYEA 5ALEA 3I1FA 1XQYA 1QHGA 3Q41A 4O4HB 4MNTA 4EF5A 4E14A 3L7KA 4C4OA 3EVZA 3ZCTA 2PGAA 1FPMA 4WKBA 4ZAYA 1SUEA 4AZWA 5EJ8A 1QDEA 2ECPA 5BOSA 1GSAA 3D6UA 3IILA 2CE7A 1RR6A 1T2UA 1OC4A 2Y0PA 3L0DA 4ENSA 5GIOE 1PFQA 1BMFD 1U1EA 4IO0A 5TVGA 5KNLA 2RAFA 3ODGA 2QMOA 4HDAA 1GTRA 2XV1A 4IFBA 1QG6A 4B5LA 1FLVA 2OD2A 1WPGA 4PAQA 5B7NA 5A2QA 1SOWA 1MOZA 1TAQA 1I2DA 1SNYA 1C4XA 1NQOA 3KOOA 2CVFA 2QTRA 3WJ2A 2NZUG 4C78A 1R5OA 2WYHA 2HREA 2RDMA 1OFIA 4RLHA 3SBDA 1Y7TA 4F60A 1FCJA 521PA 2P11A 3HFSA 1NPYA 1JDTA 2J45A 2GERA 2IYVA 3OZWA 3QVKA 4HYQA 4W7IA 4P3OA 4YUVA 3KO8A 2B83A 5A7GA 1NBEA 1SBNE 4UQOA 1HI9A 1R5NA 2C42A 3KL2A 3ZHVA 1TZ2A 1HKUA 1SK8A 1H0SA 2HQBA 2GK3A 4CKBB 2YKGA 4B4DA 4E5DA 2KBFA 5IKOA 3L2OB 4KNWA 4UCWA 4C0QC 3WDMA 1KHTA 3DTTA 3QPVA 4QTTB 2IEDA 5H70A 4DAEA 2D8MA 5B1YA 3NGLA 1QQBA 3DV9A 3TZHA 4NU6A 1OWNA 4DLXA 1K75A 5KPJA 2H11A 3GN1A 3UO8B 4IIYA 2GK4A 4JSTA 4KR7A 4HUQB 1MZVA 3ZGZA 1E9VA 1C1XB 3P9PA 4KMOA 3WWCA 1AH2A 3VOSA 2QUAA 2OKCA 1SU6A 1A7UA 3DL4A 3QLEA 4BS9A 1QQTA 5H7XA 3VZRA 3FHJA 3LBYA 2XTAA 4F6RA 1ODKA 1EHCA 2IS2A 4QUGA 4XWTA 1MQ8B 1RJEA 5CDSA 2V45A 1M2NA 1S4MA 1GWNA 1ZYUA 2CDNA 2G8NA 1SVUA 3DBRB 3L7AA 4HAIA 5EWLA 1F0NA 2VN8A 1Q0TA 2BTQB 1UJ5A 1N2CE 1V41E 2VQ6A 1EIZA 1KI4A 3FDXA 4GI1A 4WOCA 1B6SA 5FUWA 4DG5A 4QTYA 3LUPA 5DBIA 2IBMA 3Q88A 4GEGA 2JRCA 4RKEA 3R5KA 5BN5A 2WNHA 2Q4OA 3AHHA 4P2BA 5HK9A 1FUEA 2PKRA 4LK3A 4C0XA 5JC1A 1DJNA 3ZYZA 5LBTA 4CN9A 1U4OA 1WV1A 2RD2A 4EY6A 3QPUA 1YWGO 1KDTA 3M5WA 4ZK2A 5JT1A 3JYHA 3TS1A 1E2PA 4QFMA 1T3ZA 4RVFA 2J3LA 2DRIA 4TPKA 4XQ0A 2HHJA 3QE4A 5CJ2A 2F3PA 1QIFA 1FQJA 3EYWA 3WICA 4P5EA 3B1WA 3AB7A 3SZOA 3F3KA 3ZNQA 3QXSA 4B7XA 5JDCC 1C9KA 3LZDA 3ICVA 2Y1LA 2ONYA 3BRCA 4KPGA 4CEJB 1ZIXA 1FDVA 3M5DA 2QL7A 4B35A 2YVAA 1MG0A 4E0BA 2NU9A 4UHBA 1T36B 2IYSA 5HRAA 1E8MA 2HSEA 4XZ3A 4CT0A 4D6PA 3ZX4A 5DYTA 1KY3A 2VTBA 3ORRA 2BMAA 2IOQA 3TD9A 4BBZA 3VH3A 2WJIA 3EFOA 4IKPA 2BEVA 2R7AA 1QKJA 2RK4A 4Y0VA 2MMGA 2FMHA 2QPLA 3JWHA 4P80A 1HNZB 3TRHA 4K3VA 1WBDA 1WZCA 2B21A 4NEHB 4M0MA 5EKUA 2YNMD 4F6RB 1IB6A 2GKSA 3UT6A 4L50A 2P4SA 4XVUA 3LNTA 3GCGA 4L0DA 3PHCA 5AVOA 1F9AA 2GT1A 3E35A 1OCEA 5L4NA 4TZ0A 2YTZA 1WA5A 2BZGA 2EOAA 4Y2UA 1TUBB