2ECKA

Structure of phosphotransferase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ADP/AMP complex of Escherichia coli adenylate kinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords ADENYLATE KINASE
total genus 71
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1996-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2eckA00
1OW3B 1N6PA 1S1MA 3AF0A 3FTQA 5CJPA 1OJLA 1W0JD 3GLIB 3K1JA 2B7CA 3AKCA 3S1AA 3JVVA 2JCSA 2HXYA 2KSQA 1RFLA 2G88A 1I4DD 2AL7A 2P2LA 3A1WA 3BXZA 1D6JA 2W2TA 3BE4A 4TYWA 3GFTA 4ZDWA 2IYWA 3QXHA 1KSFX 1N0WA 5SZKB 4YDHB 4Z54A 3RVBA 1KKLA 1XEXB 1ZU5A 2CL0X 2NO6A 3GJ3A 4BFYA 2FMXA 3KQKA 1ZM2A 2WV9A 4Q00A 4XH9B 1ELOA 3WYFA 4M0LA 1EG7A 3HYTA 721PA 2P65A 3SJAA 2BCGY 4KHZA 5KSZA 3FFAA 3I8XA 1Z07A 3CUEF 4LHYA 3CO5A 4YMTA 3MMPA 4CGZA 4Z8XA 3ZVLA 4PQYA 3B5JA 2RH5A 4WZBE 1OXTA 2J46A 2W6IA 1G8FA 2BEJA 2VA8A 2EVWX 4BFVA 5A5GA 1PLJA 1FQJA 1NN1A 2XNSA 4LV5B 1IY0A 1FX0A 2HF8A 3DHWC 3ZYCA 2J7PD 2XSZA 4V0NA 4B2PA 3SU8A 5BXQC 2G3YA 3CR7A 2JGNA 1LY1A 4U00A 1KK3A 3B1VA 1S96A 2YC4C 3EA0A 2IYXA 4D0NA 3L0IB 3UMFA 3MAAC 3BB4A 1Z47A 1GP2A 4GI7A 3W34A 4GL2A 5AJWA 4DHEA 2AD5A 5AJYA 1G7RA 1ZIOA 5LBIA 4MYUA 1HA3A 2GA8A 2V6JA 4HAZA 2OO7A 4URUR 1ZUIA 5DGXA 1AKYA 4BLRA 4LJ7A 3KXKA 1E2QA 4LYFA 2GKSA 3LBHA 4LHXA 3THXB 4QGFA 3I72A 2ZUDA 2F7SA 5FUVA 1VKJA 4HB4A 4R98A 4M2LA 4JIMA 3I61A 1IHUA 2GETA 5C4MA 1Q1QA 4HYYA 2VHTA 2G83A 3EWAA 4FMCF 1OIXA 3UWKA 3WHKA 3KKNA 3TUJC 5EE9A 2ZSFA 4ASUA 3GLGA 4TMKA 3B2EA 4M1TA 1G16A 4Q7JB 1ZCAA 2VHQA 3EX7C 4DDTA 1GKUB 5DN6A 2WOOA 4L9WA 1R0ZA 3RYTC 4D6PA 2C5LA 1XEWY 3UMSA 5CB6A 1P2VA 3VKWA 2XITA 1TUEA 1NG1A 5C1BA 3U61B 1IQPA 1QZXA 2R2AA 4ARZB 1MT0A 1NRJB 4ZV4A 3CX6A 3AVUA 1VHLA 3EPLA 1FP6A 3H1TA 2EYQA 3HP1A 3T34A 2ATVA 4CEIA 4UNRA 2XSZD 2J7PA 1N0UA 3AV0B 2OM2A 2ZS8A 4MDFA 2CJWB 1JR3A 4J0QA 4K46A 1IJEA 2RGCA 1J7KA 1GNRA 1XD2A 2WKQA 4DIDA 2ZEJA 4JLPA 2GZHA 1E2MA 4B33A 4G5SA 1WB9A 3L8YA 3WRYC 4NMMA 2XOKA 2FFAA 2GXAA 4Q4LA 4ZDKA 1HY3A 3N5CA 2CLDX 1AQYA 2UVQA 2DY1A 4FXPA 3NH9A 8OHMA 4DB2A 3RSOA 2WSMA 1NBMA 3PEWA 3ZH9B 1GRRA 5JWOA 1S3SA 1IN4A 4AIIA 1S2MA 3I32A 4CEJA 1Z0DA 3X2SA 3LBNA 2IS4A 3AVYA 3AVQA 1KJZA 4HEJA 4FN5A 2REXB 2EFHB 1NJFA 5EP4A 1P2SA 3BB3A 1XX6A 4KCGA 3ZVMA 4RD3A 5FR2A 3C4JA 4IJMA 1BKDR 2V8OA 4DXAA 4PC6A 2PX0A 2XGJA 1XTKA 521PA 1KI6A 1QBKC 4BFXA 1KDTA 1QRAA 4DC9A 1Q1EA 5G3YA 1JECA 3GJ5A 1HV8A 3CH4B 1GTVA 2CHGA 5EXPA 2LKCA 1IN7A 2ORWA 4KSBA 2OCPA 1TF7A 3OESA 4M1MA 1R6BX 3SS8A 1JPJA 1JR3E 4OHZA 1EFCA 2H7VA 2IXEA 4TQ9A 2YC2C 2OCAA 4IDOA 3A8TA 5GJCA 5B58C 3KJEA 4GPTA 4DLWA 5DI3B 3QUSA 1DELA 2NGRA 2CE7A 3OE7A 2OLJA 3SOPA 1FNNA 2H5EA 1E6CA 2ODNA 4JLJA 4TLEA 5B64A 4RD2A 3C7KA 4A8JB 3FMOB 2FG5A 4D26A 2QG6A 3A1VA 2QSYA 1NN0A 4Q5IA 3IIJA 3RS3A 2QT1A 1OIVA 2CCGA 2F3TA 3AGPA 3MWJA 4JSTA 3ZS9A 3GP8A 1Z63A 3B9QA 4FD2A 1KI2A 4C30A 2O8DA 3PUYA 2HEIA 3NC0C 4ZDIA 4EQ6B 1DAKA 2HCJB 2QRZA 1E2KA 1SXJD 2ZS9A 4GSYA 4IW3B 1COWD 3EG5A 1U2RA 3HYRA 4V0ME 3Q85A 3BERA 1E32A 2HJGA 1TQ4A 2CBZA 3I73A 2GCPA 3V4FA 4BWYA 5JHGB 3WBKA 1S1CA 4Q4JB 4C0QC 4DT1A 1OH6A 1SVIA 1G8HA 1N6LA 1U0HC 2OHFA 4E5UA 2ODWA 4XTRA 4PO1A 2H17A 3EZ7A 2J7KA 3REGA 2WKPA 1AS2A 1NF3A 2RGGA 2BM0A 2YJTD 4HZUA 1TU3A 2OBMA 3NWJA 4NONA 3SEAA 5G41A 3W6OA 1XTSA 4WZAE 2G1KA 4OQLA 3EAQA 1KDRA 3FOZA 3ADKA 4CRWB 5CITA 4LZZA 1YE8A 2DFLA 3THYB 3SQXA 3QF4A 1NVUQ 1M74A 3QE0A 4HUQB 4LCBA 4NCJA 2A30A 4WXRA 4QNMA 4TTQA 4A2PA 1TQ6A 1WMSA 3DKPA 1FOEB 3ZZUA 3K0EA 1KIMA 3THWB 3TE6A 2R62A 4EPRA 1IXZA 1M1YE 5DHFA 3VR1A 4B6FA 4MRSA 1IN5A 1ZCBA 3CBQA 4M53A 1KK1A 1TF2A 3PVSA 5FI1B 2VP2A 2C9YA 3DL0A 1N6HA 2WKRA 1UKZA 2XOKD 4WVFA 2WMNB 1R7RA 5HKKA 4JBYA 4QL3A 3LXXA 1N6NA 1PUIA 1S8FA 3A1UA 1CJTC 4C0AC 2V7QD 3U7EB 4IEEA 4MGZR 4BLPA 1RE0A 3C8UA 2GRJA 4M1OA 2GCOB 1LS1A 5FPHA 3E2IA 4A92A 2WJJA 4QM7A 1VG8A 1W0KA 3VNVA 4FI3C 2QTVB 3SFVA 3U4QB 4YONB 2GZAA 4TTPA 3RLFA 4DB4A 1ZRHA 2MSDB 4R2IA 2VYFA 4KBGA 3L43A 5JS8A 3NG1A 4W5JA 4US2R 3P4XA 4A36A 4DCUA 4PC1A 1ZW6A 4AKIA 4Q9LA 3SJCA 1DAMA 1U8AA 1YR8A 1ZIPA 3KTAB 3RHFA 3A58B 4QFMA 4X8OA 1E9AA 4PC7A 1A2KC 3VR6A 4DJTA 2JLWA 1J70A 4IHQA 4ASUD 3L8ZA 4XTCS 1OSNA 1YR7A 2O8BB 1VYTA 2GJKA 4JL8A 1WBBA 1OKKD 2GJ9A 1QVAA 2KWIA 2YWGA 3CONA 4MQBA 1S9DA 1R4AA 1TPZA 4Z8YA 5FTNA 4DKXA 3CH5A 3U2QA 5BN3A 1YZTA 2ANBA 1N6KA 2VQSA 1YKSA 3OIVA 1S9HA 2SHKA 4BUJA 1KJYA 3SYLA 4E09A 1Z0IA 4GP6A 1KHTA 2A3RA 3SYNA 3W5JA 1SVMA 3T5GA 2YWFA 4LJ8A 4EIWA 4RKEA 4M1WA 4QBFA 4KO8A 4A82A 4Q4HA 4UNSA 2GHIA 3E5HA 1I4LD 2C8VA 3OEHD 4QXAA 1JEDA 4RFSA 3GFPA 2ZSDA 4JSYA 2J3EA 4PC3A 4C7OB 4H9GA 4BPBA 3I4LA 3TAUA 3EZ2A 1NP6A 1X86B 1PUJA 2FGJA 4TLCA 1QDEA 1ZM9A 4GNKA 4QBGB 1A1VA 3V4RA 3N70A 1G8YA 2WOJA 4Q19A 3K09A 1E2PA 2PCLA 3FMIA 3GEHA 1NN3A 4ZKEA 1T4GA 1NLZA 2W6ID 2ZRNA 2B6HA 1OB2A 2HLDA 5AR1A 2A78A 3ASYA 2WAXA 3H0KA 3HWSA 4LC0A 4XD7A 4ZIRB 4DUGD 2J0QA 2QTHA 4JZKA 1FZQA 2ONKA 5JI2E 3CRVA 2IXGA 4NPHA 3QJYA 5AK0A 1L2TA 4C0LA 1NMXA 2RMKA 1A2BA 3CPJB 5J40A 4ACAA 2LKDA 3N2IA 4DZZA 3GLFA 4ARZA 2R65A 4RFVA 4OQFA 2V1XA 2DWOA 1ZU4A 1KK0A 4BFWA 5SZHB 1R5NA 3QY0A 2ZPTX 4LX0A 1Q20A 1AK2A 4A4DA 1SKYE 2PCJA 4HZUB 1DAHA 3IPXA 4PHGA 4JVNA 1R0WA 2OXCA 1E9EA 2VRWA 4KITB 2IUSA 1BOFA 1LS6A 2XZOA 4D80A 2GJ8A 4W7SA 4ZCMA 4UXIA 3RRNA 1XFAA 2N1BA 3A1TA 5J4YA 3CRMA 4ZIRA 3SDZA 3ICEA 2IS6A 5K8UA 2VSOA 5FBVB 4MGIR 3AH8A 2PEYA 4JT2A 5UKDA 2ZAMA 1MO6A 2A9KA 4FMDB 1L7VC 2FEMA 3FWYA 2H57A 4B75A 4U7DA 1AM4D 2QRNA 2E87A 1KK2A 3NBZC 3KQHA 2QORA 4F92B 2X8AA 2AK2A 5HE9A 5JFGA 5L3SA 4URWR 4WA7A 4QJ3A 2HXSA 3KKPA 3K0FB 4CDGA 3OIYA 5CDFA 4LUCA 3W6PA 1CRQA 3TW4A 1DO2A 3HPRA 1G7SA 1G3UA 2FDCA 2BCJQ 2ODBA 5E7JA 4GT1A 2CMKA 2ZRHA 4NE2A 2VIIA 5K8IA 2FJUA 1R0XA 4OK6A 4WW0A 4TLDA 5FH9A 1TTTA 5EP1A 1UEIA 4HB2A 1E1QD 4JLOA 1DAFA 1P7CA 5J5CA 1MRSA 3Q7PA 3WP1B 4NDZA 3DZ8A 2IX3A 5CB8A 1EFRD 2WZQA 3T1VA 1OXVA 1D2EA 2D4HA 3BFXA 2AN9A 5BW8A 2WVJA 4B3CA 2ZJ2A 3QQ5A 1KAOA 2IS2A 4HI0E 1TX4B 1KI4A 1XNJA 3RC3A 4BE7B 1ZD8A 1O87A 1TMKA 4Q21A 2C99A 2B21A 4MRPA 3A36A 1WXQA 4BQSA 4IFBA 4KV9A 4RCZA 2V55B 3MUFA 4EDHA 4A8JA 4RY2A 1FMLA 1R2QA 2FF7A 1LV7A 3OIWA 3NHBA 5BYKA 3GLFB 5JSZB 1UKYA 4A0GA 4B71A 4A0FA 4I4LA 3K0CA 1KMHA 2IYUA 2PMKA 4R71A 2IC5A 3LX5A 1CTQA 1FNMA 2WJYA 4UQOA 4GMDA 4B34A 5CDFE 3D7MA 1N5KA 3VX4A 5AUQA 1A5TA 2ZAOA 4P4SB 3QPVA 3W8RA 3K70B 2W2XA 2RCNA 4X8LA 3BBPA 2ZUCA 4E07A 4YDSA 2QA5A 2QGZA 3GPLA 3QXXA 4URYR 4AYXA 2P5SA 1P4SA 1QHHA 4G5QA 3QG5A 2F1RA 2FU5C 2ZI6A 3ZJYA 4OJKA 1JB1A 3C16C 2FWRA 4AURA 5K8LA 1SVKA 1U9IC 1JJ7A 2P0EA 1KNQA 3D31A 4HDCA 3FYHA 1JJVA 2QPOA 1SVLA 1W44A 2CXXA 2IF0A 3DMNA 1W4BA 3K70D 2C03A 2H1LA 4IFEA 4TL7A 3FHCB 2VO1A 4M4SA 1CJMA 5KNCA 2XTNA 4I1OA 2CNWA 3OAAD 4Q4AB 4Q9JA 1ZC4A 1IXSB 4NYMR 1R5BA 3TR0A 4V0MA 2J0UA 3R9XA 1E79D 1XD9A 3BORA 4F38A 1HH4A 1JI0A 2H16A 2WPDD 3S1AB 3F5FA 4G01B 2OFWA 3BAFA 1XJCA 3EC1A 4OK5A 2GAOA 2A7QA 2GBLC 3HU1A 4YXWA 4QHSA 3RS4A 5HPYB 5DH9A 2BDTA 2FFHA 1KY2A 2XX3A 3GJ4A 1YU9A 3I8SA 4S35A 5C4GB 1KAGA 1X6VA 4P4SA 3ZZ0A 4QJ4A 4LHWA 4XD7D 4P0TA 2HLDD 4OI2A 2WTUA 2BC9A 3TNFA 1CJVC 1W36B 2NG1A 2YV5A 3LBIA 2H18A 1KJWA 3IBYA 3Q9LA 2JLSA 4N0EA 2PEZA 2PH1A 1U8ZA 3NH6A 1MR3F 3TBKA 2JIZD 1P62B 3CZPA 5CYOA 4ZCIA 5TDHA 2N42A 5DYGA 1E2HA 4DBLC 2R8RA 5JBQA 3GLFE 2BKUA 2ZRKA 5H1YA 4B47A 1LF5A 5IT5A 4DWJA 4IDQA 2ZREA 3IO3A 3ZS8A 1FTNA 2ZYWX 4QM6A 1NY6A 2NO9A 2ZETA 1IJFA 1ZM7A 1Z29A 3PEUA 1R5OA 4NL4H 2D2EA 1H8ED 1QG4A 2RHMA 1E2EA 3AUYA 2MMCA 4HLUA 2P6RA 4B35A 4D4LA 4KSCA 2W0SA 1E2GA 3OEED 4W9MC 4OQNA 4TMWA 3I3SR 2BHRA 1E2NA 1GIAA 2N46A 3U6BA 1OF1A 2XZPA 4DDUA 3VR3A 1M6NA 5FTJA 3IHLA 1T6NA 2OFXA 4QG7A 2QBYA 4DLUA 4JVLA 621PA 4B76A 1W5TA 1MO5A 4Q7LA 3AB3A 4DCSA 4MYTA 4NU0A 1VCIA 2YWEA 3U3KA 3QF7A 5DYIA 5C18A 3EARA 4TMXA 5F3WB 2QPAA 1EWQA 3KFVA 1OIWA 3RAPR 1T5LA 4UKDA 2A5YB 1AS3A 5KSPA 3DDCA 4BZXA 1RJ9B 3GMTA 1X8KA 2JJ1D 3W3ZB 2WAYA 2J5XA 1GITA 3QXSA 1E94E 5EXTA 4TQUS 4MRRA 4Q4JA 3SN6A 3NDPA 4DT1B 4M1KA 1KY3A 3D3QA 1OH5A 5P21A 3LQRA 3GJ6A 1II8B 2QAGC 1QHXA 1JAIA 4EPVA 4D4JA 3B1XA 4PHTA 4B44A 4URZR 2BM1A 3B1WA 1EFTA 4JYCA 3UXMA 2ZE7A 3RSLA 3J81k 3O8BA 2A5FA 4DIEA 1ZD1A 2ZR0A 4MGKR 2GWHA 5EZ5A 2ZRGA 1W0KD 1E1RA 3HDTA 1P3JA 4U02A 4XIGS 4F7WA 2E9SA 2G0NA 3L0SA 3FFBA 2GBLA 3G82C 3K9LA 4QBIA 4DCNA 4KXFB 4XWAA 4LBYA 4Q7KA 1GRNA 2C95A 2WWHA 1KKMA 4BFUA 1WCV1 3SR0A 1EK0A 2G0TA 1RKBA 4EJSA 1YZNA 2VSXA 1OHHA 4MRVA 4OYHA 3UMRA 4GP7A 3WNBA 1UDWA 3RABA 2QAGB 1VYVA 2CHVA 2FEOA 5KOYA 2CJWA 2PL3A 3RRYA 1S3GA 3QOFA 4EAQA 1SZPA 4IVQA 3LH5A 2XTMA 4AY2A 4EPWA 1G3RA 4PTLA 2QQEA 3B85A 3UATA 2JLUA 1SXJB 2BBOA 3UANA 1CJKC 3CW2A 3ZZTA 2ZJZA 2QNRA 4LPKA 2JLVA 3KX2A 2F1IA 3TAHA 1VIYA 3OZXA 4KYUA 3L82B 3NTUA 4XVUA 5BN4A 1FPMA 4DLTA 3H86A 5EUQB 2EWWA 1VCNA 2AWOA 4OK3A 3NEYA 3K9NA 1MABA 1GOTA 2C04A 2O8FA 4PSKA 3U3OA 4TYNA 1G1MA 2H92A 5KO2A 1JQLB 2PJRA 1CR2A 1TEXA 2QAGA 4V0KA 5JMTA 2QZ4A 2FSHA 2ZYTX 2QMUA 5JJKA 1DBSA 3KTAA 4OQMA 2OT3B 4QNRA 4KLZA 4KVAA 2WWIA 4DSNA 3UWOA 2O8DB 4UNNA 3JVUA 1M8PA 1Q22A 2FE4A 4A8JC 5C46F 2PJZA 5FOUA 3LLMA 4BLQA 1XB2A 4LJAA 1ZC3A 3EPKA 4XWKA 1E0SA 4B3GA 2MMGA 1US8B 1EX7A 1TQ2A 1IN6A 2PZEA 5SZIA 5KDOA 1SHZA 3QVVA 1IONA 1WA5A 1C9KA 3U5ZB 1XBTA 1UKEA 2D74A 3U6KA 4M9XA 5IHPA 4Q03A 1WRBA 1NMYA 4UNPA 2REOA 1T3LA 5EQTA 3W5IA 3T1TA 2B8WA 2PT5A 2C9OA 2VF8A 3LA6A 1Z06A 3DZDA 4DLZA 5IK2A 4DVGA 5KTYA 4C0BA 1H65A 5EUMA 5CYPA 4JL6A 1G5RA 1OB5A 3UIEA 4MRNA 1OT3A 3KUCA 4WBSA 4EPYA 4P31A 2IWHA 4LGMA 4XWOA 4FMCB 5G40A 1DG1G 1BYIA 1DE0A 4MGYR 4C2UA 5DIFA 3IDQA 3I5XA 5J4VA 4V03A 4AWXA 4RJLA 3TLXA 3CLVA 3TKLA 1F6BA 3CB4A 2IA5A 3P27A 5DHAA 3THWA 1KOFA 2BJWA 4CF7A 3CF0A 2JLXA 3EIQA 4XJXA 5EXSA 2YVUA 2FOLA 3ZQ6A 3CWZA 1K5DA 2QAJA 2WWXA 4K81B 4HAYA 3P32A 3ND8A 3QPUA 5F2EA 3IEVA 4JS0A 5AUNB 2CVHA 3TSOA 4JVSB 1GWNA 1GFIA 3LXRA 4LYJA 1Z83A 3TGPA 4JBWA 1DPFA 1U99A 2WIBA 4MYHA 3LFUA 1P9RA 3A1SA 3IBGA 3EWSA 4TQAA 4C4PA 1XTJA 2JJ2A 4RD6A 4RD0A 3IKJA 1U0JA 4E03A 3AVWA 5ELXA 1ESNA 1U94A 1VTKA 1XTQA 3DM9B 3WXMA 3NDBB 1O3YA 1S0UA 2ERYA 4KJZA 4DCVA 3ZIAD 3PFIA 4C3ZA 1QG2A 3CPEA 4XSGA 2D2FA 4Q9HA 2OXRA 3EW9A 2OZEA 2BEKA 2BOVA 5BQ5A 3BS4A 5F98A 5IF9A 1WE2A 3RS2A 4LBWA 1B0UA 1G4UR 2DR3A 3BH0A 4TMVA 1UPTA 2AWNA 1E2DA 1NKSA 4N1AA 2IUTA 2JAQA 3TR5A 3GEIA 5FUXA 2X1VA 4M9ZA 1ZNWA 2FSIA 4GZMA 1G8GA 4TLBA 3R8CA 4MKIA 1Z2AA 4MA4A 1YZGA 5D3MB 2IYRA 3C15C 1Z5ZA 1UBCA 4UNQA 2WICA 4PX9A 2O5VA 1NVVR 4BZPA 2OV2A 4FWTA 5DN6D 4IXMA 5H70A 1GSIA 3U3RA 1IM2A 4MITA 2X2EA 1HT1E 2GEVA 1Z8FA 2ZVQX 4NHOA 4QHTA 4RKFA 4Q1BA 4BZQA 5EE5B 2DCUA 2XTZA 3N2EA 1EGAA 1D5CA 4NYIQ 4O0MA 3IO5A 3OFNA 2FV8A 2BBSA 2DFKB 3THXA 5FTKA 3CWQA 2RGEA 3RANA 4OHYA 4IDHA 3LQQA 3GCGA 3BFKA 5J4LA 1ONBA 2DPXA 5JZVA 1IOZA 2IYTA 4PHHA 3GLIA 3K0SA 3Q72A 4L16A 4NTZA 4PO8A 2QROA 2ZUBA 2OLKA 1VG0B 4TLAA 4ZKDA 1IN8A 3FE2A 1QHGA 2R6CA 2ZQ5A 3MG9A 4PAQA 3EIEA 4LRWA 1F3OA 2YZ2A 3MJRA 3EIHA 2XEXA 4YC7A 1CEEA 1G18A 1MOZA 4CT5A 5JCZA 1G5TA 1Q44A 2OG2A 3GLGB 2JDIA 1JQJC 3LW8A 3SI7A 2WWGA 1AZSC 3E70C 3JZAA 3OEEA 1SULA 4OI4A 2OCYC 2PZFA 4MKFA 1U98A 5HZKA 3SBEA 1GKYA 2Z4RA 5LD2C 1H8EA 2ZITA 1VCOA 4IKEA 4C0KA 1IAQA 3R9WA 4L4UA 4F93B 5A4JA 3DEFA 1OFUX 3BJIC 1CR4A 4KODA 3B1YA 3P20A 1KI6B 1SHKA 1G3QA 5AWFC 1KI1A 3HJNA 1XRJA 1F2UA 2ZJOA 3CM0A 2JIZA 5TY0A 1HQCA 3R9IA 3THYA 2OFOA 2XXAA 1T9HA 1LVGA 1Q0UA 3NVAA 3AP1A 3LRPA 1US8A 2Y8EA 4YMWA 4LJ4A 4TT3D 2V1UA 4KVGA 1NG9A 1XWIA 1Z6YA 2CK3D 5F9HA 1OYWA 2QL6A 2YNMA 1J99A 4KFSA 4WZ6A 2V54A 3T61A 4L9SA 1OH8A 2O8CB 4DSTA 2GK7A 3AUXA 4BASA 4BECA 1BH2A 2RKOA 4YXWD 1YZLA 1VDZA 3B82A 3LV8A 1HQYE 4RVCA 2OESA 1TQDA 1NN5A 2WJVA 2WPDA 3DMDA 1KNXA 1P75A 2QE7A 1CULC 3RC8A 2ECKA 1XZPA 4BRUA 2CNWD 1KI7A 4Q1DA 5JCPA 2XJ9A 4EQ6A 5KPJA 5JRJA 4B48A 4F4CA 2FH5B 5AJZA 4G0NA 3K0FA 1E0AA 2Z6VA 3TMKA 5GJVC 2VHCA 1ZNXA 2Q3FA 3BFVA 2VP5A 2FNAA 4Z1MA 4TSFA 3TSWA 1KI3A 3RS7A 1U8YA 3EZ9A 3LVRE 1GRQA 3L0OA 2OAQ1 2Q9BA 1HURA 3TH5A 2GTPA 5HR5A 3U44B 2HJVA 3LNCA 2R6GA 4BLSA 1XCGB 5FR1A 1XMIA 4DEXA 3LDAA 1P61B 2IYQA 3CNLA 2B7BA 2WMOB 4NCIA 2BMEA 2NQ2C 4C0JA 2L0XA 1H8HD 2QT0A 1KI9A 2GF0A 4JLAA 4JYBA 2ZRPA 2C77A 4I1SA 3CR8A 3M6AA 4YMSA 1XMVA 1BYUA 3Q5EA 3QXJA 4JLDA 3KJGA 4WXPA 4F91B 1DADA 1B23P 1RW4A 3IIKA 1R10A 3R8FA 2JA1A 1DOAA 1QVRA 2HYDA 3UKDA 5FL7A 2O8FB 4LHVA 3K9GA 4LHZA 1E9DA 1EESA 2CL7X 2EWVA 3BC1A 1X1SA 1FW6A 4TTRA 4P4UA 3B6EA 1KDPA 5JSZA 3MGCA 2IK8A 1RRPA 2YOFA 4TZ6A 4LBZA 2GVZC 4LJ5A 2AKAB 2C9CA 1KSHA 2QMEA 4GMXA 3MJHA 1PZNA 4CT4B 3TQFA 4NZYA 4Q4HB 2FGKA 2HV8A 4KI0A 1XPOA 1P9NA 5D3MA 4TL8A 2AK3A 5BYJA 1IY2A 1K5GA 1N25A 4RCYA 5CK4A 1E1QA 4A1FA 3BH7A 2QTFA 4OKSA 3CPHA 4FW9A 5FL7D 121PA 1ZAKA 3EASA 5KHOC 4MUAA 3LLUA 5LB2A 3PEYA 5FOTA 4B3FX 2W83A 1FUKA 4F4IA 1Q21A 1G5PA 1RYHA 4R2HA 2J45A 5FBWB 1Q57A 1E2FA 4Y0VA 4MKHA 3W9YA 5J47A 1H8HA 5JS7A 2D7DA 3NBXX 1CR0A 4HZIA 2WSSA 221PA 2AXNA 5JECA 3CKLA 2ZJAA 4ABYA 4CW7A 3KQUA 4OQXA 3ADCA 4AD8A 1NSTA 4AKGA 1ZVQA 3JZMA 3PV0A 4Q47A 1ZJ6A 4D2IA 2WM9B 4DDWA 5DISB 4A15A 1E9SA 2G77B 3I62A 2WWYA 2ZYUX 2GVDC 2EFDB 2IF2A 2X19A 4KYIB 3V00A 4N3NA 5TVKA 2ZRAA 3CRW1 2JASA 4Z1MD 1ESMA 5BWMA 5FI0B 3T1QA 2ZSEA 1DAEA 2GAAA 3IQWA 2VF7A 5JRZA 1JAHA 3UK6A 2R44A 2ZI7A 5FTLA 2IYYA 3PUXA 5L3VA 2F43A 3CNOA 1E2LA 1OFIA 1XJQA 4EFLA 4IDNA 2ZE5A 1YJ5A 4AYWA 1GL7A 3A4NA 1NKTA 1UADA 2QN6A 821PA 2OE2A 4OI0A 4W5HA 1F2UB 3MD0A 4Q02A 3VR2A 1D9ZA 1Q1ZA 1GKIA 2EFEB 5HCNA 2RGXA 3QKTA 4QGAA 2FFBA 4OBEA 3CX7A 4WAUA 4DUGA 2FPLA 3KXIA 3AM1A 3M4YA 1Z22A 4EJSC 4AK9A 2NTYC 5CIWA 1ZM3A 2CK3A 1OH7A 3QEJA 3HPQA 2R6AA 4Q48A 1Z0KA 1GM5A 1K6MA 2DWPA 3NHAA 2DFTA 2CCKA 3QENA 1KSGA 2BBWA 3GJ8A 1FX0B 3B9PA 3K9HA 1BS1A 4FCVA 3AVTA 3AVOA 2GDJA 1N3BA 2D06A 2GXQA 4DDVA 2O8BA 3A4MA 1N5JA 1XD2B 5FUYA 2Q9AA 4EUNA 1ZMXA 2ZR7A 1OXSC 1G17A 4P32A 2PBRA 1HE8B 3KJHA 1FL9A 1GUAA 4PPQA 1BO6A 1G291 1Q12A 3EA5A 1U0LA 3V9PA 1JBKA 2XJ4A 1BMFA 1ZYUA 2JLQA 3OEHA 2QP4A 2VP6A 1VMAA 3PITA 4TZ0A 2IW3A 1ZD9A 3B13B 1N2CE 4FINA 4PAOA 1W4AA 3FKSD 3Q5DA 4TMZA 1XU4A 3FHOA 2HCBA 4ESHA 2IXFA 2JDID 4QJ5A 4O2RA 5EP3A 4ZCLA 3FKSA 1G7TA 1RRGA 3CF2A 4Q18A 4D0GA 2B8TA 3WNDA 3EZ6A 2QUZA 4TWZA 2RGAA 1UM8A 2BBTA 3KZ1E 3IILA 1W1WA 5KPDA 1NJGA 3D6TB 1FFHA 5FPYA 3BD9A 1IY1A 2DYKA 3PIRA 4ZO4A 2IUUA 1UBFA 3GLHB 4B43A 1Z3IX 1OKKA 4RD1A 3OIUA 1GG2A 2J1LA 1NNEA 1BIFA 2BKEA 5AUPB 3SBDA 1V5WA 3P1JA 1M7HA 2IHBA 3PCRB 2ZE6A 4HAUA 4UXHA 4A2QA 5FOWA 3TUZC 3SHFA 4KBFA 1AQUA 1S4QA 5G3ZA 3AVPA 3QKRA 1XPUA 4LWZA 3W3AA 5L3QB 3I1FA 3A37A 2HT1A 1M7GA 1NVWQ 1WQ1R 2IT1A 3SZRA 2J87A 1XJ0A 1XMJA 2P6UA 2ZS7A 3ZD7A 2IS1A 1QHHB 2Q0HA 3VX3A 4B2LA 1Q3TA 2J59A 3LWNA 1P72A 3KXLA 3KB2A 1X8JA 2ZRLA 1GILA 1RIFA 2FA9A 4IOMA 4RZ3A 3QNUA 1Z2CA 3F0TA 5DLQC 4ZI2A 2AHOA 1T8UA 3RS5A 4I1UA 2KE5A 4M1SA 3FHTA 4PPFA 2PLFA 2X77A 3AVVA 1J2JA 2IWRA 4KFUA 4Y0AA 5CM9C 4A9AA 1GNPA 1ETUA 2ZSAA 4JLVA 1KZGB 4NCNA 3PJRA 5AJVB 4I99A 1XDBA 3ZIAA 1SVOA 2K5UA 3O8CA 1Y3AA 4IVRA 2V6IA 1RYFA 5FOSA 1A82A 3T5DA 4US1R 1AKEA 3IHWA 3PQCA 4AC9A 2EW1A 2FSGA 2O8EB 2Z83A 3GJ0A 1R8SA 1D2MA 1XP8A 4DRZA 2VP4A 2P3SA 1XMSA 3HU2A 4M8NE 4EFMA 1VECA 2JJ2D 3WMGA 3AVXA 3LX8A 3FKQA 5CJ2A 5KYKA 2O52A 1OFHA 2GESA 2VHUA 3NC1C 3QKUA 2GEDA 2GF9A 4GOJA 4TL9A 2GJAA 4UJ3A 1P6XA 3F3YA 1P9WA 1KDOA 2ZJYA 4EJSB 1XXHB 3O8DA 4URXR 2EQBA 1EFUA 3QKSB 1DAIA 1UBGA 2O0HA 5DE3A 2XNDA 1G7CA 3KDSE 3KL4A 1RJ9A 5L3SB 2MSCB 3VU9A 3Q3JB 3H4MA 2BIFA 3GLHE 3MWYW 5JHHB 5LPNA 4HDOB 2IYZA 2FPKA 4RD4A 5KUTA 3KQNA 4DLXA 2F9LA 1L8QA 1FUUA 2JATA 3AF2A 2EFCB 3WP0A 2YYZA 1W7AA 2VLIA 4LV6A 1YVDA 1II8A 4ILEA 3RRMA 3K0AA 2FN4A 2WHXA 3R7WA 4PQRA 5K8TA 2ODEA 4UJ5A 2F43B 4JLBA 2V4ZA 2RGBA 2ZJ5A 3B1ZA 1YR9A 4Q1FA 5LD2B 1LTQA 3TVTA 1E4VA 2HF9A 4PZZA 1SKYB 5TV2A 5B30A 5G53C 3DOEA 3ZGXA 2OAP1 2R9VA 2KJQA 2QP3A 4A0HA 3QKSA 4MKGA 4G5RA 2RB4A 1PV4A 3UG7A 5F9FA 2ZRIA 1LW7A 3X1ZA 1LF0A 3CX8A 3FGNA 1N5IA 3VR5A 1KO5A 2O0JA 4BFTA 1GL9B 1G6OA 5IDVA 5HE8A 2DFNA 3TW8B 2BMJA 1EFHA 2KB0A 5EE3A 3SQWA 4P3YA 3RRZA 6Q21A 1KTVA 2ZIAA 1KO4A 4GDFA 3RWOA 4DLYA 2RHDA 2JLZA 4JKYA 2C78A 2CEAA 4A6XA 3U7GA 3AF3A 1ZNYA 4FCWA 4LJ9A 2NO0A 1YRAA 3NXSA 2KBFA 2D62A 1NBME 4LYHA 5FBLB 421PA 3C14C 1OXXK 4AYTA 1NSFA 3WRXC 4G3XA 1NIJA 2X2FA 1VG9B 1P5ZB 1UFQA 1JNYA 2JEOA 2KBEA 2OBLA 4TSFD 1AJEA 2ZI5A 3QG1A 4Q01A 2WWFA 2E1RA 4JBXA 3GEEA 2RGDA 2TMKA 4QBHA 2PMDA 2CLSA 3UG6A 3IEUA 4CZ2A 1ZNZA 3QF4B 3EZFA 4HUQA 1XXHE 1GNQA 2UZIR 1W47A 3VQTA 1CU1A 3NBYC 4MH0R 1T3SA 1X8LA 4H1VA 3FMFA 4YLGA 5H8WA 4MUBA 1E69A 1ZINA 4U5XA 5JWRA 3BWDD 3WMFA 2QE7D 2YINC 2ZSBA 4OHWA 4N0DA 4A2WA 4CVNA 3VNUA 1NBMD 5D3QA 1OYYA 1E0JA 2Z4SA 3FPAA 2AFHE 2AXPA 4X8HA 1PJRA 3U7HB 1VG1A 3LO5A 1W5SA 2GXSA 3KUDA 2W2VA 2G6BA 4BGDA 3B8HA 1KGDA 1CLUA 1J8YF 3I92A 2GJSA 2JJ8A 4GOXA 4O25A 4HUTA 5KDDA 4C7OA 3L2OB 1Z0FA 2OILA 4O2LA 1ANKA 2UZ3A 4TT3A 1JR3D 2OSBA 1M7BA 2FZ4A 2VP9A 2YKGA 1XEXA 5AJXA 1FQKA 3FDIA 5A0FA 1CJUC 4EPXA 3I5YA 2W00A 3ASZA 1KZ7B 5HCIA 1MO3A 5CLQA 1II9A 4LSGA 4OHXA 3B7GA 1YRBA 1A7JA 3WY9A 1CR1A 2IEZA 1AN0A 5E4FA 4JL5A 2OBNA 1AGPA 1DARA 1G41A 2J9RA 2QM7A 2BMFA 4L5BA 3SE0A 3WNCA 3GLIE 2LCFA 4M1YA 4Q9IA 1XEWX 2DBYA 3U7FB 4W5WA 2QSZA 2P6NA 5FPKA 1TUIA 1XEFA 4JLMA 2BWJA 5KNBA 3A4LA 2NO7A 2Z43A 2PX3A 4LOAA 2VL7A 3NEJA 4AKEA 2QQ0A 1NLYA 3ZLJA 1U9IA 1Q3HA 3Q7QA 2VHJA 1SVSA 3ZVNA 1WBDA 2EYUA 3GLGE 3OHMA 2F1JA 4LPSA 3SHWA 3SJBA 3LY5A 3NKVA 1HUQA 2O8EA 2W58A 2DHRA 1G21E 1E2IA 1IXRC 1I4TD 3KKOA 3IQXA 2V3CC 1CXZA 1AA9A 1MKYA 4AG5A 2ZRJA 3WYAA 1NY5A 4PQFA 3KB1A 3FVQA 2RGNC 5FOXA 3EC2A 4KLNA 3B60A 2F9MA 1N0VC 2ANCA 2NO1A 3OFND 3ONWA 4PFSA 2XB2A 5C2JB 2ZRBA 3GD7A 1P60A 2QMHA 1UAAA 5GJWC 1P2UA 4YMVA 4JT4A 4ERNA 4Q66C 1TAGA 5J4HA 3K8YA 4JVMA 4DSOA 3PR1A 1Y63A 1UF9A 2NPIA 3VKHA 3QIAA 4MDEA 3E1SA 4WIAA 3MWLA 1KSJA 2CLCX 5FTMA 4DLVA 3VHXA 3KQLA 1K8RA 2P67A 4RFSB 4JJKA 2XB4A 4MYCA 2A5DA 3RWMB 1E2JA 1NVVQ 3FMPB 3MCAA 4GOKA 4PANA 1LFDB 2ORIA 4XVRA 2QPTA 2O8CA 4OI1A 4DEYA 1CBUA 3QEOA 4FIDA 4PAMA 1E0KA 3VKGA 1P2TA 1JXMA 1E99A 2NOAA 5EE1A 3IUYA 3BB1A 4IDPA 3VFDA 5CIQA 2AFIE 4IRUB 4TL6A 5HTKA 2HUPA 2ZVPX 5LB4A 5FPTA 5L3QA 3WYGA 2ZI3A 1TADA 2ZM5A 3EPJA 3ETLA 3QPWA 2CHQA 3G0HA 2Q9CA 5FPSA 1T8TA 4TMTA 3ZQJA 4E22A 1W4RA 1Z6XA 4HLUC 1LNZA 2ORVA 5CM8B 4HAVA 1TNDA 4CIDA 4F4JA 1AS0A 4C9BA 4POAA 1W2HA 2AKYA 2YWHA 3VHLB 3O8RA 4DLRA 3U44A 5BN5A 1C4OA 4QC2A 1JXOA 2WWWA 1DVRA 3TVDA 2ZANA 3FB4A 1HE1C 5SZJA 1AIPA 2EFGA 4RZUA 1PVOA 1EXMA 4G5OA 2R6DA 5FUWA 2VH5R 4Q1CA 5E95A 4B74A 3OAAA 1JALA 1IBRA 3QI2A 2ZTSA 3VMFA 1CIPA 4K8OA 1TF5A 2CVFA 1PLLA 2BMDA 4QHYA 4JLNA 5KDLA 4R7ZA 2VSFA 2VEDA 4HDQB 1E3MA 2G9NA 3PXGA 4PHFA 3DO6A 3HR7A 1DAGA 2HYIC 1W0JA 2IL1A 2BJVA 2GCNA 2IYSA 2ZRCA 3ICQB 1ZP6A 5HZHA 2BV3A 1RZ3A 3U3MA 1N6RA 1YZKA 5KU1A 4PPNA 3PUVA 1F48A 3DM5A 3H84A 4FWIB 1A4RA 3GQBA 2KI5A 1W36D 4NYJQ 1X3SA 1T0HB 2I1QA 3C41J 2Z0MA 2LWIA 1M34E 1F60A 2ZE8A 2ZRDA 3CNNA 3P4YA 4ESVA 5B2ZA 3TJZA 4NH0A 1GAJA 2RAPA 1RVDA 3D8BA 4DLSA 1KI8A 1QF9A 5IK2D 3W6NA 2YHSA 4Q1AA 1L4UA 4O3MA 5TMPA 4M22A 3K53A 3O47A 1NL3A 3NIBA 1U81A 2D7CA 2CE2X 4PPGA 3W8NA 1YZUA 3CIOA 3OF5A 1E98A 2AD1A 1R8QA 5JWHA 1JPNA 4FMBB 3X1WA 2ZROA 5EP2A 4HB3A 4B2IA 2ZJBA 4IOKA 4NBSA 3K0AB 4ON9A 1SXJE 3R7WB 1DO0A 4IVPA 4CEHB 4LDJA 4Q9KA 2GILA 1ZM4A 3W90A 5EZ6B 2I4IA 4OJQA 5H68A 1JR6A 4B32A 3DVLA 1N6IA 2BVNA 1KYIA 1E4YA 3KKMA 1EFRA 2IBMA 3R20A 1G3IA 2GK6A 4D4KA 3PG5A 3CF6R 5KNDA 4LBVA 3AF1A 2ZR9A 3QVUA 4DCTA 4BFZA 4HLQB 1KMQA 2FX3A 3K0CC 2J41A 4PC2A 2A2ZA 4B3XA 2Q3HA 1DS6A 1CF4A 1T3HA 3MRSA 3BK7A 4II7A 3GLHA 3SYKA 4A0RA 2W6JD 2REBA 2A5GA 3RDPA 4D82A 2ZXUA 3ZD6A 4M21A 2WJHA 4HSEA 3IIMA 4JLKA 3X1YA 1I2MA 4Z51A 4R9UC 2XNDD 3PUWA 5B57C 4ZPXA 4M9SA 1F5NA 1W36C 3BH6A 4ZDJA 5GVSA 5GADl 4HAXA 1W49A 3C5CA 3DOFA 1W46A 3GFOA 4KFTA 4B6EA 1G19A 5JEEA 3P26A 4LI0A 3TSZA 2UKDA 4D0LB 1DEKA 1G6HA 1L4YA 1D9XA 1D2NA 4X8MA 4D4MA 1UDXA 2B92A 2QENA 3QSYA 5FFMA 4NYIR 2MSEB 2I1VB 3K09C 2QGNA 3CRRA 4PZLA 4Q1EA 3LD9A 1OHHD 4ZI3A 4V02A 1HTWA 1QHNA 4LC1A 3L0PA 3BIFA 3U3JA 2GEUA 4NKRA 4LJYA 2QY9A 4CEJB 1KO1A 4IOLA 1EWRA 3HU3A 2OUKA 2GZDA 1KMHB 5JLJA 2EU8A 4D81A 1XTRA 4PO9A 1J90A 2IEYA 1XZQA 2ZI4A 3LW7A 2ZRMA 3HR8A 1UJ2A 4JJZA 4KAXA 4EFNA 1YQTA 1R0YA 3RS0A 2O0KA 1Q1BA 1E1RD 1M2OB 1T0JB 3KKQA 1HYQA 1F2TB 3MSXA 4WOPA 4XVQA 4BFSA 3AF4A 4BRWA 4BLTA 2QM8A 2WJGA 3QXCA 4QRHA 2ZRFA 4C0HA 1OPXA 1MRNA 2Z5FA 2W0MA 4YQFA 5JJIA 1TL7C 4LYAA 4B3DA 4JKIA 1OXUA 3KJIA 2J0VA 2VTKA 1XTIA 2FZLA 3AKEA 1N5LA 3U4QA 2GNOA 4HLCA 4NP6A 1Z6GA 1OV4A 4I1VA 5DI3A 4EPTA 1HT2E 2JJ1A 2ZI9A 5FBRB 2GCOA 1Z28A 2NIPA 4GZLA 2NPFA 1YHNA 3EXAA 1XCMA 2J0SA 1GZSA 3QBVA 4AG6A 5LDDC 1KO7A 5AUOB 1NI3A 3AP3A 3EPHA 4CYMA 1ZUHA 3M0EA 3AP2A 4ITRC 4L15A 4PR0A 1RPZA 2C98A 1C1YA 3AGQA 4HLDA 5ANRB 1X1RA 1DG3A 5GJBA 1VCMA 3THOA 2C2HA 3MWKA 5EXXA 1WP9A 3X1DA 4RZ2A 1CKEA 4QGGA 5KSYA 2QU8A 2IHYA 2CDNA 2OEPA 1LB1B 3LVQE 2CL6X 3NBFA 1TU4A 1E9CA 1Z0AA 2YOGA 1XPRA 1SVWA 1W48A 4BLOA 4FMDF 2AX4A 3DPUA 3CZQA 1KO8A 4LV8B 1BMFD 4LY6A 2FPMA 1E9BA 2NZ8A 4BEJA 1UBEA 1W4CA 4RZXA 3SFZA 5CK5A 3AKDA 1MABB 5E7IA 2F6RA 1DTSA 1GL6A 5EE0A 2ONJA 2JLYA 2NMVA 2ZJ8A 4H1UA 1T5IA 5JEDA 4TYQA 2XXAB 4ACBA 1NMZA 2DWQA 2RGNA 2DB3A 2QMOA 3ZDQA 4NYJR 4UXJA 3G5UA 1I2DA 4LJ6A 4B3BA 4PSAA 3WMEA 1Z6TA 2YOHA 3M1IA 4AI6A 1AGRA 1P73A 2Q21A 4P4TA 4GFDA 1F2TA 3PENA 5KSOA 2OCBA 2QP9X 4GRAA 4URVR 4AKHA 4HB0A 1MH1A 1MO4A 1FP7A 1MV5A 3PEVA 3MLEA 1G9XA 3Q8XB 5L8VA 2NZJA 2QBYB 2FFQA 1XD8A 1II0A 1T91A 4OHVA 2PZGA 4QOSA 4RSGA 4V0LA 2C96A 5TXGA 4CEHA 4NCKA 1RRFA 1FTSA 2AR7A 3CRQA 3UPUA 1E79A 3QKRB 3VR4A 3B78A 4M9QA 2Q6TA 2Q3MA 2ATXA 3T35A 1SXJC 1YR6A 4IXNA 4TYYA 1VIAA 2GXUA 2F1HA 1FMJA 2I3BA 2ZU0C 4KU4A 1VYUA 4IOJA 2H8KA 2IYVA 2HDNB 2V7QA 2VP0A 2J0UB 1CP2A 1WDTA 3GJXC 3RNLA 5HKKD 1E96A 1G3MA 2QI9C 1QHIA 2ERXA 5FOVA 3SNHA 1E9RA 1Z08A 1G4AE 1SGWA 2V9PA 4JMPA 3TK1A 1QHYA 2WBLC 1UKVY 5DSZA 4OL0A 5CLLA 4US0R 1RRCA 2WIAA 5DO9A 1PLKA 3BGWA 3TQCA 1EX6A 2WSSD 1NVXQ 4PSVA 3BRWD 1VHTA 2PLRA 5L3RA 4NCHA 4DSUA 5IRCD 5GVRA 1J8MF 4L8GA 4FCTA 5JI3E 3AEZA 4PZYA 1CS4C 2W6JA 4QGHA 4QKQA 1ZUNB 1NLFA 1Z0JA 4GBMA 1ODFA 3U60B 4C2TA 3T15A 2XZLA 3SC3A 4YMUA 3IGFA 2CCJA 2QEQA 2ASEA 3MFYA 1SKQA 1GVNB 3REFA 4XSHA 3DKVA 2FSFA 2ZU6A 4G1UC 1G64A 3PUZA 3VTKA 4I81A 2PT7A 3SJZA 3VU9B 5TB5A 3IPYA 1TEVA 1AZTA 1WF3A 4XOIA 1OFTA 4CEIB 3TRFA 1Z6AA 4TYPA 5FL3A 2G1JA 3X1XA 3BOSA 2F55A 3QBTA 2D3WA 1COWA 4P33A 1SXJA 3LAWA 1XCPA 4Q7MB 1GDDA 2F3RA 2R6FA 4LK2A 4HATA 1OE0A 4IEIA 1W2GA 4TN1A 5FBQB 3WHLA 1RC8A 1N6OA 3ECCA 1JEEA 2ZYVX 4HAWA 4NYMQ 1G8PA 3H2YA 1QHSA 2IYLD 4B73A 5EJEA 4A6PA 3KFXA 3TIFA 4D25A 4PXAA 3K70C 1VPLA 5E3HA 3C5HA 2WJIA 5TARA 3ND9A 2A5JA 2HT6A 3ZVRA 5J4KA 3ADDA 3AKYA 5M04A 1SQ5A 3A6PC 3VAAA 4V0OA 1D8TA 3T1OA 1UEJA 3TUIC 4BEBA 1G20E 2VPPA 3OE7D 4KFRA 3WBJA 1ZBDA 3ADBA 3T06B 2VBCA 5DNYB 3F8TA 1E9FA 1V43A 2P5TB 3T12A 4EKDA 1XXHA 1NIPA 1OLOA 4S2EA 1XF9A 1U90A 3AQ4A 4G5GA 2JLRA 4C0SA 1CRPA 3GJ7A 1HEIA 5DI9A 2XAUA 4Q4AA 5E7MA 5JJLA 1YZQA
chains in the Genus database with same CATH superfamily
2FMHA 1OZAA 1RKVA 3UGTA 1ZMBA 2I4LA 2VJMB 5DT9A 3HCPA 1HWYA 4YIHA 3MT9A 3O2NA 5CNKA 1R4NB 2B7CA 5HIKA 3PLAE 1PR9A 4PRZA 2HXYA 2VJYA 2PQ2A 3VUEA 5LU9A 3ANYB 5F9MA 4E3WA 4YRGA 2AL7A 1W87A 3N0VA 5BWBA 2FPGB 4UVIA 3T99A 4DIMA 3H65A 4K6MA 5ESRA 5DHTA 2GERA 3DE7X 1Y4AE 4G37A 3FCAA 1QYWA 5F2KA 3HB5X 3W2HA 1FQWA 1O95C 1Z0ZA 3FNIA 4WL0A 1N0WA 4OHUA 4PZPA 3GT7A 4Z54A 1KKLA 2XTJA 2CL0X 3GJ3A 1N9KA 5IKPA 3A70A 2WV9A 4HGZA 1PW7A 2MJLA 1WB6A 4GOND 4WUVA 5KBYA 3K9WA 3A32A 4BVGA 3HYTA 3KLPX 3B6KA 3PJEA 3HR4A 1NHGA 1SXHA 2BR5A 3RFXA 1ORHA 3I8XA 1PNTA 5DYYA 1FNCA 1MTOA 4LHYA 4YMTA 3MMPA 4LWPA 4HDNA 3WQSB 4I9HA 4ZAVA 1T5TA 4BE9A 4AZ0B 1BTOA 2XCUA 1G8FA 2BEJA 1RYEA 5A5GA 2IEDA 2YQ4A 4EY3A 3ZHOA 2WZDA 3L07A 3NHLA 1NN1A 3GZJA 2XNSA 3ZJTA 4REQB 3B6MA 1XPJA 4F2GA 2HF8A 3X43A 3ZYCA 4G9GA 5F51A 3O3NB 4V0NA 1U2SA 1RAIA 3WYCA 3CNEA 3D7RA 2BLNA 5H9WA 3V8VA 3ZJ5A 1BFUA 2AQ8A 4LNUA 2Z04A 1C9NA 4QLBA 4AQDA 2DHDA 3PCTA 2IYXA 4D0NA 1EUCA 3D3WB 2JIQA 1OX6A 1C8LA 1AUXA 3IEKA 5AKEA 4RE6A 3MAAC 1SFRA 3UMFA 1GP2A 4NJMA 1PSZA 1UM9A 4M9RA 3GCWA 2FRVA 3BCHA 3Q3VA 4K87A 1ID8A 4GL2A 3N87A 3V34A 2AD5A 4NZZA 1EWTA 1XZKA 3NDIA 1KEUA 4C78A 3ZV5A 4MYUA 5EHQA 4BQEA 1EU1A 1PWYE 1QDLB 2OSVA 2VHZA 3ACCA 3JRWA 3KWJA 3LUBA 4C7JA 4DDKA 2JA2A 4BLRA 2BUBA 1T8YA 4LJ7A 3SICE 3T95A 3KXKA 1E2QA 5ERGB 2VDWA 3UPDA 4UPEA 4X5OA 3D5TA 3DT6A 3CS3A 3KQVA 4MDYA 4Z0TA 4RORA 3R7NA 4QGFA 2ZUEA 3GVPA 2QSJA 3I72A 2VAXA 1O95D 4CFYA 1U8EA 4MKRA 4CUKA 1VKJA 3KZNA 4R98A 3TTSA 3O4IA 4P54A 1R74A 1RC0A 3LRXA 4KKXB 4EKEA 5A2GA 2WSIA 1O08A 1OIXA 5GONB 3GC6A 5JNTA 1OWPA 3AUFA 4GXQA 1SCUB 2YBDA 3TUJC 4OPMA 2X22A 8AT1A 2H6EA 4BPRA 1YOVB 3HJBA 2Q1TA 3B2EA 4ONEA 1AQIA 1T8WA 3GJRA 2X0JA 3N2YA 2A1TS 3O4VA 1ZCAA 3ELWA 1ZPDA 1RLMA 4M6WB 5CDSA 1E1YA 1Y82A 3Q87B 1FFDA 3BMOB 3P9KA 3DKKA 2IXAA 1O8CA 3NPMA 2C5LA 1CNMA 4S1WA 5J1SB 4RK0A 5CB6A 1AXEA 1Z37A 2QD2A 5I4KA 5FCDA 3U61B 3AFMA 2R2AA 3E4DA 4DL9A 2K7FA 2WF9A 3KZCA 5DU2A 4C2BA 4QOEA 4ZEMA 1BCSA 3EPLA 1FP6A 3H1TA 4YRPA 5CNMA 2JHPA 4UNRA 4BAUA 3NT4A 1I1QB 1YBMA 2I34A 4EA8A 1N9GB 5G2OA 4BP9A 3AV0B 3EBPA 1SCUA 4CM3A 2Q7XA 1CUCA 2ZS8A 4P3NA 2IHKA 1O57A 1AB5A 2WD8A 1JR3A 2H51A 5LZ9A 4XGQA 1E18A 3E9EA 1LNSA 2ZQYA 1IEWA 2W2OA 1NWCA 4GC9A 1X80A 1JKJA 2IOQA 4QWWA 3ODGA 4UDNA 4AJKA 1HY3A 3OF3A 2C1ZA 3N5CA 5EMLA 2Q1XA 1AQYA 3QOYA 1W5BA 3M8KA 3ON5A 5BUCA 1JIUA 4DB2A 3PEWA 1HETA 3IIIA 2GZ3A 1GRRA 2C29D 5E4JA 4YR9A 5JWOA 4IUDS 2ILTA 4DMKA 1Y6ZA 5KX5F 1ZR4A 4IGKA 3LBNA 1RQRA 1FFGA 3W5HA 4P8RA 3EG9A 3HKDB 3A9SA 4GEKA 1KOGA 2GB4A 1W94A 2REXB 3WLTA 2EFHB 4QYSA 4WN3A 3TW8A 4M0KA 4D02A 3HK2A 4KCGA 3RTGA 4RD3A 1YIDA 3G9UA 2EX1A 3HCAA 4Q15A 5CW1A 2V9CA 2HB6A 3E7FA 1BXRB 4KODA 2C2OA 4JUCA 4PC6A 4EY6A 2PX0A 3L0YA 3H4VA 4NECA 5JDCC 3VSDA 2F62A 1H2FA 3RSGA 1KI6A 5FHQA 1QBKC 2YZKA 3IAM1 4KYVA 3RVKA 4M1ZA 3K9BA 4ZZ3A 4DC9A 5CX1B 4M98A 1JECA 3DNPA 3ISTA 3OX1A 4MX8A 2EX4A 2LKCA 3TLJA 1KVRA 3ENNA 4KSBA 4XQGA 4ZYLA 1ECPA 3B51X 1M8GA 3D6VA 4B4WA 3VA7A 3G49A 4YCBA 3KKLA 1JR3E 2IH2A 5CA0A 4OHZA 2H7VA 4E31A 4EW6A 4JN6B 2AF3C 3KJFA 4TQ9A 2XE6A 3OUZA 3QMWA 5GJCA 3QUSA 4N5LA 1U7PA 2CE7A 5KINB 4B6OA 1GTG1 2OLJA 4FFSA 4LZWA 3LMKA 2C00A 1FEZA 1VL8A 3S44A 3VHQA 2BEVB 3OHPA 1WD5A 3DJYA 1FFSA 3C45A 3L1HA 3C7KA 4A8JB 3SVZA 4D26A 3H9QA 2QG6A 3A1VA 2QVLA 1FYFA 3AGPA 3KB6A 3MWJA 4LJKA 5A06A 5FA8A 1EE1A 3GP8A 3B9QA 2JC3A 4X6LA 2XWQA 1PQ4A 1Z2PX 1PFWA 3PUYA 2AZMA 4M0CA 3NC0C 3FTDA 4PYOA 2XRYA 4D99A 4EQ6B 1D5WA 3A9TA 4ZYTA 1SXJD 4GSYA 4NULA 1VKHA 1U2RA 2EKLA 2YHAA 3WLIA 1CZOA 1I80A 2X5OA 3Q85A 2QLNA 3ET5A 3R44A 4G4JA 3K6SA 2OV3A 4M46A 1OWMA 3OPNA 3S2ZA 2YCLA 4S05A 2JKZA 4DT1A 5K0LA 1UOPA 4YRIA 5DWVA 2E37A 1QRSA 2BF7A 3V4VB 3REGA 2WKPA 3AETA 1REQA 2W8BA 3HVIA 1AS2A 3O94A 2VQDA 3MWEA 3PNPA 5LXTB 1PWZA 4NAVA 4NONA 5BQFA 4IKPA 3SEAA 3ZE7A 3W6OA 1EVKA 1XTSA 1L4FA 2G1KA 4G0VA 5HIMA 2GAJA 3EAQA 4JI0B 2C3OA 5BUQA 3WKAA 1GNTA 3ADKA 4Q3DA 5ISMA 4S1NA 4CRWB 5CITA 5EZYB 9ABPA 2ZT5A 3OE5A 1MA0A 1TD1A 3TFQA 1UINA 1V9CA 3QF4A 2P30A 3QE0A 1NR5A 2D2XA 4R3UC 1N0HA 2Y6UA 2GD0A 4WXRA 1AKVA 4UBLA 4ZA2A 3BIJA 5DZSA 1Y7IA 1LD3A 3CVJA 3KYBA 3DKPA 4XVCA 4UUMA 1FP2A 3FSGD 3PD1A 4UFOA 4G4SO 1QIGA 2Q6VA 4X1YB 4GKJB 1IXZA 1ZHFA 3MBOA 1LI4A 4PY2A 4K3VA 2B83A 2XHZA 2OAGA 5IT0A 4IS3A 1IN5A 5ULLA 4ND8A 4R1SA 1Z4NA 1QG0A 2YN4A 1AY0A 1HZJA 2HO5A 2IUEA 2HQBA 3FD8A 4Y1RA 3CTPA 2XOKD 4RVGA 2WMNB 4UMEA 5ALDA 5HKKA 2ATCA 4IJVA 2EOAA 5FO0A 3A1UA 1S8FA 2XV1A 4IIEA 4C0AC 1FBTA 4F8YA 2BZ0A 4EB3A 5I7VA 1YS2X 1B8NA 4J3FA 2PS9A 2GCOB 4M1OA 1DP4A 4ZAXA 5LKAA 5GINE 5BVGA 1NX6A 1UOQA 3G3EA 4H4CA 4UM9D 4QM7A 1YIAA 5IPFA 1VG8A 4IIGA 5CIWA 2WZBA 4RHFA 5MDHA 2HIAA 3VNVA 2N3ZA 4YONB 4C04A 3IP1A 2AX3A 4DB4A 5K1ZA 3H42B 4PG4A 2VYFA 2BFOA 4MV4A 2DQYA 1LJ8A 4NCXA 4UHBA 5JS8A 2WEKA 4BY9E 3NG1A 3HM2A 1KR2A 2HWXA 4P4GA 4US2R 3R0QA 4BO0A 3HKBB 4A36A 5A7GA 2Q5HA 2VBGA 3IVCA 1ZW6A 3EVTA 4NOLA 1USKA 4Q9LA 1BNCA 3G89A 1HORA 4MIEA 4LG1A 3VZPA 1WVMA 5TC4A 1YR8A 2X9VA 1ZI8A 3F7NA 2G9RA 1QVWA 1Z2DA 4FJ1A 3GFFA 3N28A 4R5HA 4X8OA 3PQ7A 2D8MA 2B4RO 3UXYA 5E2AA 2IDMA 3NI2A 2JLWA 1J70A 1U6KA 2C7QA 1QK5A 2O2CA 4CIYA 3MGGA 6ADHA 1JJFA 1E5QA 2XKJE 1YR7A 2FPIB 3E81A 3L1VA 4MPPA 5F7XA 1VYTA 5DNCA 1NUTA 1D0VA 1WBBA 1BXZA 16PKA 2OQVA 3H5LA 2GJ9A 3PK0A 4LX8A 4Y6SA 1FFBA 5J9FA 2XCIA 3SM3A 4CR8A 2KWIA 3AZQA 3CONA 1K1EA 3MMZA 5ER6A 1YTUA 3EZXA 1TPZA 3R5JA 4JK3A 3CH5A 1CX9B 1YZTA 1YZFA 3QFHA 4M38A 4N7JA 4W9NC 2J4FA 4X85A 1GZ7A 3TNLA 5I8WA 2X6TA 4IDGA 4QYXA 4WZZA 4ZMBA 1S3FA 1H42A 3OJWA 5GOZA 1ONNA 3ICWA 3OIVA 3USES 2Z58A 4E2FA 3QBJA 5BSVA 5I4BA 2SHKA 3LU1A 2EHJA 4E09A 5AW3A 4WV3A 1TUBB 1PJAA 1Z0IA 3MRXA 4YY3B 4ZOEA 1LX7A 2X4LA 3EIFA 4HQNA 4JOQA 3V1NA 4QGSA 5EZSA 4EIWA 2BY4A 2HMYB 1UZMA 1U2EA 4M1WA 2XECA 2XUDA 5EFOA 1AE1A 4E0BA 7GPBA 5K4GA 1QORA 4QXMA 4Z7NB 2GHIA 3E5HA 3GZTB 4DABA 5HFJA 2RGYA 3K72B 1JEDA 1U0NA 1RPNA 4LXIA 1O0BA 4PGHA 1JIIA 2QMYA 4D57A 3H97A 2P9TA 3TAUA 2PGOA 5EWJB 1OTXA 3GRPA 2FZGA 3SF0A 5IUNC 4QATA 1ZM9A 2YN0A 2I62A 2WUDA 3WADA 3ORQA 4ZVSA 4DNQA 3LT4A 3L7DA 3KIPA 2VUTA 3IV9A 4HJXA 1IQ0A 4LS3A 5A4MS 3K09A 1ZMOA 1E2PA 3GEHA 3QFCA 1DBQA 1HDXA 3HDGA 3EMDA 3EDCA 4TV9A 5FEMA 3DVAA 1VL0A 4F60A 4RTQA 4IIXA 5ITZA 3SHQA 3K05A 3CUTA 2B6HA 3DV0A 1SQ6A 3AKZA 1R4MB 1J33A 5IH7A 2R4TA 5LWQA 3ASYA 4LC0A 1JJAA 4HDRA 4WY8A 3R74A 1FZQA 1VJ5A 3PFCA 5KYWB 2VK8A 5D3ZA 4XR4A 2FHPA 4MV5A 5TX7A 5J40A 4ACAA 2PX4A 5B57C 2HW8A 1E5XA 2VCHA 3DQPA 1JDPA 1NI5A 1ZH8A 4JC0A 4KQWA 4FR0A 4MS3B 1UBRS 3GLFA 1TVCA 2HA0A 3SAJA 1OX4B 4WTOA 3M3DA 5SZHB 3HZHA 3BZWA 1XA4A 3X1MA 3HEBA 5KNCD 3F74A 1Q20A 2ZFUA 2PWZA 3DUWA 1I7QB 4EA9A 4AJ9A 1A7AA 1JEOA 4HZUB 4YQYA 2BTOA 1DAHA 3IPXA 3N0TA 2JGIA 2R751 3QYJA 1IPHA 4IHKA 4ZK6A 3G6KA 2ZBVA 4KITB 1CE8A 1LS6A 1BQEA 4D80A 4W7SA 5KS2A 1KP9A 2NYUA 3A14A 1XFAA 2N1BA 3IDSA 1P7VA 3CRMA 3P9SA 4P4NA 5HIIA 3ZGYA 4ZIRA 3ILYA 5F77A 4I1YA 1GLVA 1JDBB 1DAOA 1Q5PA 1WLYA 2BFCB 2ASVA 2NU7A 5K3FA 3UXEA 2YFKA 3VYUB 5JMOA 2IGTA 2Y9MB 2A9KA 3JVIA 4GR5A 2DMRA 3M6WA 2FEMA 4GLFA 3C48A 4PFJA 4BNZA 4RNCA 2H57A 3OVMA 2WU4A 3T3NA 3NBZC 1QIEA 2EZ8A 4KZKA 4CTKA 3DB2A 4R3NA 1MNQA 1NVBA 4K1XA 3WK7A 3DHVA 2CHFA 4WNAB 1PT8A 5JFGA 1JL3A 4GAEA 4URWR 1PZHA 3LE8A 4S1VA 5IMBA 4QJ3A 3OT4A 2EERA 2PWAA 1OGIA 2RK6A 2WB4A 1CHNA 2IV7A 3TW4A 4ESOA 1DO2A 1UWVA 1G7SA 2GEFA 4KOEC 3EPPA 4W5NA 3PC8A 4I6JA 1QGUB 3F6SA 5AKZA 4BNXA 3JATB 2FJUA 4JWKA 5IKEA 4B4OA 3PNYA 2NTVA 9LDTA 2CMHA 1O9GA 1TTTA 1L5WA 4ZQHA 5L9AA 4EK9A 4UAUA 1Z13A 2XE7A 5IT4A 3U3DA 3WP1B 3W5AA 3I2YX 2GR9A 5TGTA 2IX3A 4CHGA 3QV2A 3DBHA 2QUIA 3WK8A 3KCNA 2QRHA 2R97A 4DLPA 3NOXA 4G67A 5H80A 2EL7A 5BW8A 1IY9A 3RVPA 1RXYA 1YL6A 4NCBA 2PUEA 2ZJ2A 3QQ5A 1P7WA 1KAOA 3OG9A 2IS2A 3B9BA 2IP4A 3KVYA 3M83A 1ZD8A 2H48A 3PKJA 1O87A 1WXEA 1JG2A 1WXQA 4IFBA 1CUDA 3IOBA 1KYWA 2C31A 2H0RA 2AJCA 3DOIA 3QI7A 2H8GA 2C97A 4JB3A 1Y5RA 1A9RA 1R2QA 4D43A 1LV7A 3OIWA 3O9VA 2QRLA 5JSZB 2GJ4A 1A9PA 1NC1A 3TD6A 1NV9A 4KWTA 3MAJA 1TIBA 3NHRA 4A0FA 3K0CA 4REOA 2OB2A 2IYUA 1NW7A 2PMKA 2YHIB 2IC5A 1GQQA 2A9JA 2V03A 2XAAA 4MPJA 4CF4A 1GAXA 3QX3A 2J3JA 1LWOA 4B34A 2Z4TA 3GNLA 1ULUA 5E38A 4DBZA 4NX2A 5AUQA 1A5TA 2DG2A 4KNWA 4P4SB 3K2EA 4PU0A 3SC2A 4D9NA 2V7UA 5JJCA 5ERYA 3COJA 4IMPA 2ZUCA 3UEOA 2N47A 4JNCA 4YDSA 4E07A 4B3IA 1M10A 1SBZA 2QGZA 2YY7A 2R00A 2XHEA 4C4XA 2AJ8A 4FGZA 2UUCB 3IP5A 2PZJA 1DWQA 3FIJA 1TCAA 4FOPA 5D7BA 4IQGA 4YCDA 5LMZA 4FT4A 2FWRA 1QFJA 5A0TA 5BMVA 4H3VA 4PVDA 4WZAA 5K8LA 3OWXA 4OUDB 2IITA 4OUKX 3AEUB 4DDMA 1NASA 2WG2A 4HDCA 3WDLA 1JHZA 3G0OA 1K7SN 3AF6A 1U5AA 1VJTA 3MTJA 2ID4A 1CUIA 1YXMA 5NULA 1PF7E 1W4BA 2P9GA 3PLNA 1TA0A 4JFRA 1IWBB 4M88A 4R1NA 3SMVA 1ZW1A 3AXTA 3LPCA 3UQYS 4E5PA 5C7OO 1XVLA 4XWWA 2Y6VA 3RS8A 1CJMA 1V16B 3BMNA 3GEDA 4ZT6A 3ZWYA 3OAAD 3HN2A 5KNCA 1ZC4A 2G9UA 2JH9A 1EGMB 5H0IA 3RAGA 3UK7A 1WABA 1DJNA 2MU1A 1VZ3A 1JI0A 3CE9A 5BV7A 1DEXA 3SIRA 5CXQA 3PXAA 3NEPX 2OFWA 4GWLA 2I91A 3TOSA 1CUYA 3EC1A 3L4SO 4OK5A 4XDGA 1J2YA 4B35A 4EG8A 4YXWA 2VT6A 5DH9A 5CB8A 4OGKA 1KY2A 2XX3A 3WBBA 4AJEA 4PX5A 4S35A 1Y33E 2WIKA 2WG1A 3ZZ0A 4QJ4A 4LHWA 4XD7D 2GARA 4C4ZA 1KEEA 4HADA 3PC8C 5ALYA 3DZGA 1GYRA 2WTUA 2B0JA 3ICCA 3TNFA 1CJVC 2HA3A 1W36B 2Z6QA 1YCDA 1YBFA 1TM7E 3IBYA 2NSYA 1MX1A 2JLSA 4KAFA 4BGIA 3WLMA 5IKXA 1VBFA 4RHXA 2PH1A 1W5FA 2LXNA 2Q1UA 3ZKWB 5C81A 2OC9A 2QUHA 3K9FC 1K8XB 3DDSA 5JMPA 4F4FA 4WZAB 3SQMA 4OFBA 2R8ZA 4EO7A 4JXKA 2R8RA 4DBLC 1Z9BA 1QFSA 2ZRKA 1G2IA 5H1YA 4W5QA 1Z33A 1LF5A 4L28A 5FBKA 3I0ZA 2C3PA 4QM6A 1NY6A 5ES4B 2ZETA 3GAAA 4F71A 4MGEA 8ATCA 1EP1B 2BSAA 5EWLB 3F8WA 3B89A 3P0IA 5EUBA 2ZWAA 4FYXA 3TW0A 2GEBA 2B94A 3DKRA 3FUVA 3M5DA 4RVNA 3EGCA 3NATA 1HTTA 1ZGHA 3F5MA 3HRKA 4D9JA 1EGVB 3RSCA 2W0SA 5LA6F 3WXBA 5LP6F 2HJ9A 2Y1WA 3A4VA 4NK4A 3EBLA 4W9MC 3G88A 4N12A 3NTLA 4OQNA 4X63A 4GXRA 3NTQA 2BHRA 2CHEA 2CKDA 2DC1A 4J03A 4Z6KA 2N46A 4BTVA 3U1BA 3U6BA 5KYYB 1A71A 1RFGE 1XO1A 2HHLA 4QAQA 1IRXA 2XYHA 4UVDA 3IHLA 1T6NA 2OFXA 3PQFA 3QWHA 2Q5QA 3MF4A 1W5TA 1P39A 4S24A 1AJEA 2J9FA 4EF6A 3RUFA 4GNRA 2PX5A 3A4TA 2Y1XA 4DCSA 3C6BA 1VCIA 2WYOA 2YWEA 4EG4A 5DTEA 4JITA 4X91A 1C30A 4KHPB 1S2GA 1Y8QA 4X61A 4DAOA 2QPAA 3ZBPA 3TRJA 3A10A 2P9EA 1OIWA 1AH2A 1DC8A 4CM1A 2XGMA 4UKDA 1PHPA 3QVWA 4FUTA 1AS3A 1EDEA 2YH2A 4CV2A 1CK4A 2WFLB 4MUIA 2IHUA 3DDCA 4RZQA 1X8KA 2JJ1D 2V7TA 3CGGA 2WAYA 3H5TA 5HMMA 3UWMA 7YASA 3K31A 1GITA 3HHEA 3MMSA 2GLTA 3JPWA 3W3AH 4LZAA 4Q4JA 1IMJA 2FEKA 3ZW8A 4DT1B 3QMVA 4IS2A 2CGEA 4WLEA 5JQGA 1KY3A 3D3QA 4IKOA 4PCUA 3WB9A 3I45A 5FDFA 4Q3EA 4UUAA 3GJ6A 3RBXA 2QAGC 3P0RA 2EEZA 1O0SA 5IG2A 4EPVA 5EHXA 2IOFK 3B1XA 4MQFB 4C87A 1YA4A 2VEOA 3L01A 1BQ3A 1CDOA 1YE3A 3BULA 4JYCA 4ND4A 1SB8A 2ZE7A 4F2WA 1GUZA 4DIEA 5T3UA 2PH3A 2CXTA 2Z1DA 2ZR0A 1ZEMA 1J0AA 4ND7A 3SZLA 2AXQA 4NZ9A 3AJ8A 4F12A 1ZD4A 3HDTA 4YP9A 2VCYA 3CT6A 3DLCA 3PTZA 2G0NA 4NZMA 3L0SA 1DQPA 3E3AA 3K9LA 2GBLA 2IZ1A 4BQNA 5INTA 3EGXB 3HKCA 5JS6A 3F46A 3DP9A 4GQBA 4BMPB 3I1YA 1S8NA 5IKMA 4J43A 2NSJA 2MINA 4R0NA 5K3SA 1DC4A 2WC1A 3CLRC 3ZHRA 4BL5A 2X6QA 1LDBA 2JI8A 2Z1NA 2G0TA 3MA0A 3NBKA 1QS0B 4G4GA 1OHHA 4OYHA 4OKIA 3CE6A 1ZOPA 3GN2A 4PE5B 5AVTA 5JV5A 1SWVA 5DNAA 1VYVA 2YWRA 2CHVA 4ZMRA 1MJGA 2JZOA 1JBQA 3OQPA 1I3MA 5T6BA 4MJLA 5ELMA 4JI7B 1XU9A 3OETA 4EFDA 1RAEA 1B00A 4DSAA 5MGNA 5F23A 1C8KA 2B34A 2CLIB 5JAHA 5A1JA 4W5TA 1DEHA 3EW7A 1RJDA 1X19A 1G3RA 1NLUA 4Z86A 2QQEA 3B85A 1EVJA 5B1YA 3VDMA 1SKUA 3PSAA 2X76A 2VT2A 3DYIA 3NAGA 4LPKA 1Y6FA 5BN4A 2AZDA 2BFDB 5JG7A 3PZRA 3U62A 5I5GA 1TKRA 4DLTA 5EUQB 1C3VA 3CQ9A 4G1CA 1IM5A 1L7DA 4OK3A 3F3MA 3SCZA 3PGKA 4MW6A 1G60A 1HFKA 1NONA 2C04A 2YY6A 3AOEC 3HCCA 4MARA 4YFYA 5FPQA 4PSKA 3OZWA 4AO7A 2O8FA 1PVVA 1ISMA 1OYVA 1NZJA 4MA0A 3FI9A 4YP1A 2PTHA 3F9IA 2G25A 1D03A 2ZYTX 3A4YA 2PGDA 3PS9A 2VJKA 3F6EX 2WQ6A 5KNLA 3COYA 3QVXA 1ENZA 4OQMA 2OT3B 1DINA 1U5BA 2BFPA 4RHUA 4RIFA 1G5FA 1Q22A 4CMEC 4A8JC 5C46F 4ZCRA 1UMBA 3RHSA 3AHEA 3HUDA 2WJAA 3OFJA 3WL4A 3RRFA 4H31A 1C0PA 1QOPB 2JH8A 3K32A 4NFLA 5IDWA 1HYHA 3QHPA 5KDOA 3ZE0B 4DIOA 2OA0A 4DAEA 1E77A 4IV0A 5MHTA 1UXHA 2FWPA 1XBTA 1TCCA 4M9XA 4QLAA 3GL9A 4UNPA 2WP8J 3D7SA 5KTNA 3O75A 1RI2A 1T3LA 2REOA 3B3AA 1E2UA 3H4TA 1RS0A 1XROA 2B8WA 2XIJA 3DAGA 3JYPA 4FDMA 1K4MA 1NVFA 5CDGA 1Z06A 1XJ5A 5HBGA 4IZ6A 5IK2A 1IHOA 3HB7A 3LT5A 2JEYA 5KTYA 1BEEA 1PT5A 4RXTA 1H65A 2R25B 5CYPA 1X2BA 3F6YA 3NYRA 4MI6A 4JL6A 1G5RA 2HGZA 1OT3A 4IGFA 1PR4A 3FTCA 4RO0A 1TYAE 2IWHA 5K4AA 3MS2A 1IZ7A 4FMCB 5G40A 1C2YA 1X7WB 1BYIA 1LDNA 1YZVA 2IPNA 3EWNA 3NIGB 3RT7A 5B4VA 3FOEC 4N18A 2ZPUA 4V03A 5E8RA 4RJLA 3IT3A 3CLVA 5TPWB 4AWXA 3EVEA 4DPMA 1AKQA 3CB4A 2IA5A 3THWA 1Q6ZA 2BJWA 2F3QA 3HB9A 4CF7A 4TS4A 1HDIA 2HMUA 4LY9A 2FSUA 2JLXA 4TPKA 2GNAA 4XJXA 3RFVA 2OENG 4G8BA 3H13A 4L22A 2WWXA 5BOSA 3WR5A 3EGWA 4LF6B 2NZVG 2Q46A 3P32A 3I37X 4HAYA 1E1KA 1KRHA 2F90A 1DZ3A 5F2EA 4ETMA 1RZRA 4FYWA 2J48A 4B3TB 4R2XA 2W6CX 2XUKA 3AM5A 1B0ZA 1BVYF 4TLLB 4JBWA 1U99A 4JAVC 1XDGA 2YW2A 1PJQA 5BSMA 3VHRA 2W48A 1M83A 3P52A 3M82A 4TKZA 4Z7QB 5KJ6A 4HRVA 3EWSA 4D4IA 4Y18A 5IP5A 1VQ1A 3SEQA 3WL5A 3BM5A 2I9PA 1BD4A 4E03A 1ZXLA 3R5XA 4RM2A 3LECA 4L95C 2VDKB 5ELXA 1YUBA 1HX7A 1VRVA 3N8NA 1UANA 4JP5A 1E3EA 4XIIA 1TYCA 2XT9A 3NDBB 2QW0X 4GXNA 1SH7A 1S0UA 3L7YA 2ERYA 2V3WA 2ALJA 3DCIA 3ZIAD 3SSAA 1EAMA 2VQEB 2F8SA 3PFIA 4C3ZA 1ZD3A 1Z6QA 3ANSA 3CPEA 2D0IA 2CSUA 3D4BA 1JLRA 1ZQ9A 1VI2A 1EQUA 2QTMA 2WNSA 2B5WA 3A6KA 3THSA 4CFSA 4L3OA 4JI1B 5IF9A 4Y8VA 2X40A 4FM9A 4LBWA 2DR3A 2IY8A 1PFKA 2ZAIA 2AWNA 2Q0XA 4N1AA 2C2MA 4JR0A 3WISA 1RMYA 1LBTA 1BU5A 1X15A 1T3GA 2CLOB 2FSIA 2G0AA 4TLBA 2IBSA 2XWPA 1P6UA 1NFRA 2MYTA 3D4LA 2G67A 1Z2AA 3MBKA 3R5KA 4U2DA 4AKTA 1TC1A 5L7TA 1JPVA 4LTNA 2OQ2A 1CDZA 4GL4A 1TM1E 1Z5ZA 4IMJB 5FWYA 1XF1A 1L6IA 1QAQA 1K8YB 2Q6IA 1M8KA 4UNQA 4G97A 4L2IA 4BO2A 4BZPA 4FMPA 2C07A 3I28A 4ADSG 1WD7A 2P35A 1U7ZA 3UQZA 1GZ5A 2YJ4A 4I5GA 1IM2A 1JIQA 3VV2A 4FOOA 3ZBUA 1V7ZA 2GGSA 1EFKA 1Z8FA 1GT6A 4C3OB 5EE5B 1XNRB 1O58A 1T36B 1UFOA 2XTZA 4HRAA 4ARIA 3N2EA 4QJIA 1R6XA 2C94A 1VRWA 2CKMA 3CSUA 5JTUA 4CIAA 3DE0X 3UC5A 4B8ZA 4PONA 2A88A 2BBSA 3PX2A 1FSZA 2ODTX 2HX1A 4OHYA 1LPPA 5EQJB 4NNJA 4LXQA 2DPXA 4EYQA 4YRFA 3JAKA 1OREA 2QRUA 4NTZA 4LF8B 3DFFA 1J6UA 2QROA 1N9GA 1O5TA 2ZQ5A 1U0FA 4LRWA 1KERA 3MJRA 3TEMA 2VPTA 4CT5A 2QN8A 2PNFA 2OK8A 2Z5GA 1HE2A 1U7TA 2JDIA 1JQJC 4HNVA 2AUTA 1XQYA 2P40A 3OEEA 4BP8A 3KOXA 2FZCA 1TTPB 1ESEA 2CUZA 5KNBD 2OD7A 3IELA 4MKFA 1U98A 2ZCJA 1ZL0A 4L6IA 1GKYA 2XRMA 3FJOA 3OZEA 4GI5A 3D3NA 4FKBA 4URFA 5A3QA 1ORDA 4FWBA 3U5TA 2O3RA 1FDWA 1IAQA 3TIXB 3PT5A 4PSDA 5BUSA 4P80A 2XB8A 5KCZA 1C0LA 1OFUX 1OBHA 1QZUA 1T6XA 2H59A 2N0SA 2YZMA 2ZTHA 3DBLA 3E3OA 3PUIA 5AWFC 2QJOA 5DBOA 1KFJB 3KALA 2I22A 1NQ5A 1KOJA 1MH9A 2OZPA 1C0IA 4CKCB 3CWCA 1PKXA 4N3CA 1KAHA 2XXAA 5TLSA 3EVFA 3LCJA 5M5BA 3MJ4A 3BRCA 1T9HA 1Q0UA 5EMKA 5JXWA 1KWKA 4UHJA 2B1GA 2XY4A 1JZQA 3PR2B 3NVAA 1P1IA 3OSUA 4QUEA 2PUAA 3LRPA 1WETA 4YMWA 3S2SA 4KVGA 5KAMA 4FN4A 5IYZB 3OQMA 4DARA 1OYWA 4WZ6A 2BFEB 3H2KA 1P1RA 3T61A 2O8CB 2RJNA 3EMVA 4LXGA 2WFMA 3VH4A 1X7ZB 4PGFA 4R9NA 4BECA 4HS9A 5C7LO 2HRDA 2J9GA 1J00A 3ACDA 1UZUA 2RKOA 3B82A 4IH4A 1HQYE 2UZ4A 3DZBA 1PL8A 3GFBA 3FN4A 1S7CA 2WPDA 2I5PO 3U16A 1VE9A 3I9KA 4XB2A 2EG9A 3GFQA 4EO4A 3X1JA 4JJAA 2J08A 1MMFB 1ISHA 4GHWA 4C6TB 3U09A 2XCSB 1ISGA 3RR2A 2ECKA 4EUEA 3RC8A 3ROQA 1KI7A 5LQRA 1OLXB 5JCPA 5A0VA 1V96A 2XJ9A 1ZICA 5JRJA 1ZGZA 3GUCA 2HY7A 3LPNA 1GDHA 2FH5B 1EIZA 2DT5A 3K16A 4G0NA 5JXHA 2EIHA 2H4ZA 2I6GA 2A0XA 1H2XA 3PFKA 2DQ4A 7MHTA 2J3LA 1FTQA 4KAAA 1TIPA 2OP1A 2PR7A 1J0DA 1EP3B 4HF7A 3IUSA 4I8XA 3CEJA 1NUUA 3L41A 3FYUB 3GVHA 3UT0A 3WDSA 4Z1MA 4TSFA 4MVJF 3GA0A 4JUBA 4R0MA 1LDGA 4Y9RA 3OECA 4UAVA 1SUBA 4EY8A 3NONA 1AOXA 1GRQA 1VYHA 4UQPA 4FGLA 3ZJUA 3Q3EA 2GTPA 1IG3A 1K6EA 2HJVA 3LNCA 4B2YA 5JY1A 3C3CA 1RM0A 3R0XA 1XMIA 1K88A 1X14A 2PRIA 4L27A 4QQFA 3R77A 3QTLA 1P61B 2EV9A 2FQYA 2PN1A 2WMOB 4FGUA 5HJ5A 4QTTB 2BMEA 2NQ2C 4Z4GA 1IN1A 4XFKA 3DB1A 5CLFA 1E3WA 1VJRA 5EJ4A 3D9QX 3HY4A 1J5PA 2QNIA 2NAFA 1O6CA 4J6FA 4ZT5A 2Y0EA 1P45A 1PKEA 5A5FA 2B1JA 3ZBQA 1CZLA 2D2VA 1BYUA 4YMSA 5GOTA 2QXYA 5KQPA 1DADA 1ZJJA 3NOVA 3OP1A 1B23P 1RW4A 3KEOA 1RHMA 1B93A 4PNPA 1UQTA 4F8EA 2ZTLA 3GUYA 5FL7A 4BO6A 5FAXA 3CXUA 4XQ9A 2PMFA 4LHVA 1EJ2A 2XYGA 3K9GA 5G0WA 1E9DA 3D81A 2EWVA 4GOLD 3VAZA 2IXTA 3LX4A 3CBGA 3LP6A 4JEUA 1Y9JA 3V1TC 1LTHR 2IKQA 4HN2A 4EJ6A 3PFGA 2R8XA 4RW0A 2IK8A 1TVKA 1RRPA 1V3QE 2QLMA 2VP3A 2IZOA 4FKZA 4MHSA 4AS2A 4LBZA 2JCBA 3OEYA 4GLLA 4YBRA 2GM9A 3ZDBA 5C32A 1RI3A 4CT4B 4NZYA 3R0ZA 4KYTA 5BQOA 3QNWA 4PZAA 4MB0A 4BKRA 1XPOA 2VAVA 3FDZA 4LCEA 3WK4A 4E12A 1N25A 4G1MB 2C4NA 1E1QA 4UUPA 4DMHA 5A1TA 1BDHA 2QTFA 1DTWA 4BDSA 5FL7D 5SICE 3WNVA 2C88A 2Z9BA 121PA 1WMBA 3N0WA 1ZJZA 3V7YA 3H4IA 1T8PA 1XZ8A 4Z99A 5JDIC 1KY5A 1NW3A 3LLUA 3FNRA 4P0QB 2NUBA 2CVQA 2XCQA 2AUNA 3NCHA 3OPYB 4D9IA 4IIJA 1JSCA 3QHQA 3RH0A 1P1HA 1Q21A 2P4UA 1G5PA 4DXHA 2C82A 4F4IA 3ZG6A 3MOGA 3T7EA 1HE5A 1EUDB 1U0GA 5DSTA 4PS1A 4PG6A 3BRWA 3CH6A 1XR3A 4WI1A 5J47A 2C83A 5JS7A 3NBXX 3TI9A 4KDCA 4JR2A 4AFNA 3TLAA 4D9HA 3JASA 4GI1A 3PQ4A 3T8YA 3LUPA 2PVCA 1OXBB 1ODKA 4AKGA 3P9ZA 4Q47A 1NPTO 1PR6A 3LGSA 1JSZA 3O4HA 4MVXA 4DDWA 2VDJA 4NDNE 1E9SA 4Z9AA 2FK8A 4KO4S 5KTTA 1BMQA 2ZYUX 2ZB2A 3E7WA 3ITEA 5FOQA 1D0IA 3LHFA 4N3NA 2VJMA 4QDUA 1ESMA 2I4RA 4YAUA 5FI0B 4HGOA 4LOHA 3EQ2A 3K4PA 5JRZA 3S8YA 4KR9A 1NDHA 3P9IA 2XNCA 2R44A 3IS3A 2VZLA 4K2AA 5L3VA 2P69A 3FFXA 4JEMA 4MCHA 2YICA 1SM4A 1FVOA 1CRLA 2H4YA 3PWTA 2ZZMA 1X1DA 2FPIA 2ZB3A 3CNOA 2QXUA 4OA8A 3TLGB 1E2LA 3LUCA 3EWIA 1ZGCA 3EDQA 1AGNA 1JDJA 5B1SA 4E51A 2B37A 2ZE5A 1AURA 2I8AA 3MPOA 5B3KA 4AYWA 1GL7A 3A4NA 5ALJA 3CRZA 3GX1A 4OI0A 5AI9A 3Q1KA 4N9QA 1M3SA 2V6GA 4TWAA 4UZSA 5TPZA 1F2UB 3AG5A 4Q02A 3TNJA 1GKIA 2YIJA 3L4EA 2WMDA 1TTQB 2EFEB 2B2NA 3LF2A 1I1OA 5K3OA 4BFLA 3RKRA 2R11A 4YHBA 4WASA 1PJ2A 5LP6B 3KXIA 3A3YA 3CB2A 3F49S 2VXBA