2ECKA

Structure of phosphotransferase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ADP/AMP complex of Escherichia coli adenylate kinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords ADENYLATE KINASE
total genus 71
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1996-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2eckA00
5CM8B 3DKPA 1HYQA 1VHLA 2AKYA 5FOTA 1PLLA 1KMHA 3AB3A 4RD4A 2EWVA 4URUR 1DTSA 2O52A 2H8KA 3NVAA 1KSGA 5BWMA 4I1UA 3RC8A 4B2PA 5IRCD 3QUSA 1G8FA 2O0HA 4JLPA 3BH7A 2PEZA 5L3SA 3WYAA 2GA8A 4BZPA 3W5JA 3FPAA 3TH5A 4W7SA 3AV0B 4I99A 3BB3A 1XNJA 3ZVMA 2GZHA 1KMQA 2WWIA 4KLNA 3HPRA 3C7KA 3L8ZA 4DC9A 2QL6A 4Q1AA 3CLVA 3KB1A 1R8QA 3PEVA 1QHGA 5EE3A 4LJ7A 1I4DD 3SS8A 3R8FA 3KKPA 1E9CA 4OHWA 4Q1DA 4BQSA 1Z8FA 2GETA 3F0TA 4D4MA 4BE7B 4HUQB 5TMPA 3AVQA 3LAWA 4C0BA 2BIFA 4M1WA 2QENA 4Q21A 5SZJA 2ZE7A 2FSIA 4HDOB 4PC6A 2W6JD 3AUXA 1E79D 4UXHA 3QI2A 1QHSA 1JR3D 1AS3A 1FNNA 1NVVR 3M1IA 2W6ID 4MQBA 1DG1G 2VSXA 4HLDA 4V0NA 4MYCA 5B58C 4TLBA 521PA 5KTYA 2P0EA 2A5FA 2ZU0C 1GAJA 4YMWA 1DS6A 2GCOB 5TXGA 3UG6A 2J0UA 4JLJA 2BKEA 1D9ZA 3C5CA 3CPJB 4M0LA 2KI5A 4WW0A 5CLLA 5E7MA 1FZQA 5FTLA 1UPTA 2G77B 4M1TA 3WMFA 1IM2A 4D6PA 5BYJA 4Q4HA 4OHYA 3O47A 5AJVB 5EUQB 5D3MA 1VG8A 4B3FX 3D6TB 4NYJQ 1PLKA 2OLKA 2HLDD 1QHNA 1M34E 1DADA 2EFEB 2VTKA 1P2VA 2XNDD 4JBXA 4LWZA 4K8OA 4Z8XA 1MR3F 1XBTA 3CH5A 3LDAA 4LDJA 3BERA 4PHGA 2WM9B 1T5LA 1N2CE 3DMNA 1KK3A 2ZRAA 5KNCA 4NONA 4CGZA 4Q7LA 2Q0HA 4FXPA 3CM0A 2AXPA 1US8A 2GJ8A 3DL0A 5CDFA 4DT1B 4M9SA 4L9SA 3TR0A 1KJZA 2DFLA 3RANA 4NYMR 1FL9A 2ZYUX 2R6DA 3QNUA 4KSBA 1V5WA 4AC9A 1WMSA 3UATA 5TB5A 3A1VA 2OCAA 3FE2A 3P32A 1ODFA 3A58B 4C9BA 4D4LA 1N6OA 2VEDA 3TBKA 2Q9CA 4TLAA 1R5OA 4AG6A 3TLXA 1YR9A 3GLGB 4KLZA 4IJMA 5JWRA 3LV8A 3K0AB 3SI7A 2DYKA 2ZROA 1XX6A 3HPQA 4L15A 3IEUA 1T3HA 4ZCLA 2EQBA 2FOLA 3QKSB 1QG4A 3Q72A 4OQNA 4JLAA 1VYVA 3WP1B 3CX8A 2P2LA 1NVXQ 1FUKA 4D4JA 1Y63A 1KMHB 1YR7A 2QAGB 3E2IA 2QAGC 2IYUA 4IFEA 3THXA 2JJ2A 3AF2A 4PO1A 1VKJA 3U6BA 1G17A 2IXFA 3BFVA 3X1YA 3SHWA 4FMCB 3OIYA 4GOKA 4P4TA 1N3BA 1Z0IA 1HQCA 1FOEB 4OI0A 2GCNA 4XVRA 2ZRGA 1R0WA 4CT5A 2VO1A 2NGRA 3X1WA 2ODBA 3BXZA 3DZ8A 5J47A 1G21E 5EE9A 3RWMB 1Q57A 4GT1A 4WOPA 3V4FA 2YC2C 2XXAB 1QHYA 1P75A 4HUQA 1I4LD 4Q9KA 2LKDA 4X8HA 2JA1A 4BGDA 4U7DA 1E3MA 3PUXA 1KIMA 1JAHA 2IYWA 3GCGA 4V02A 3BFXA 1E2GA 2QTVB 3SNHA 1Q12A 1XJ0A 1RKBA 2JLWA 5TARA 4N0EA 2VL7A 2WVJA 3CH4B 4MYUA 2AXNA 4LC1A 3RS5A 1O3YA 1Q1BA 2V3CC 2OBMA 2XTNA 5AK0A 5HE8A 4IDNA 2W83A 3KQLA 4XSHA 2CVHA 2QQ0A 1T3SA 5C46F 2ZE5A 4N3NA 4HLQB 4NCHA 4C0QC 2H57A 2IYTA 3KKQA 3NTUA 5KDLA 2IYXA 1ZBDA 1XEFA 3P4YA 2NPFA 3UXMA 2J7PD 2RGNC 3LO5A 3M0EA 4NCIA 1E0JA 3BIFA 1UJ2A 4UNRA 4B3CA 5E4FA 1RIFA 1SXJD 1KK2A 4JBWA 2C98A 1WQ1R 2QP9X 1HT1E 5TV2A 2QPTA 3OZXA 4OQMA 1XZQA 3EIEA 1P5ZB 1X3SA 1E9RA 4EPVA 2VHTA 3V4RA 4WVFA 2R6CA 3H1TA 4OHVA 1XD2A 5AJXA 2ZJOA 1EWRA 2FH5B 4C2UA 1R7RA 2BMDA 4WBSA 2CL0X 1PVOA 1S1CA 3H86A 5FBRB 5JSZB 3GJ4A 2G88A 4A6PA 4Q4JA 4UJ3A 1XMJA 2KSQA 3OIVA 4I81A 1KZGB 2GZDA 2BMEA 3LBNA 2FDCA 1SGWA 3M6AA 1EX6A 1V43A 2AX4A 3JZMA 4POAA 2ZS9A 1II0A 2EYQA 2G3YA 2QROA 3Q7QA 4L4UA 2Z4SA 3VKHA 1OXTA 2VYFA 1TF7A 4OL0A 4JIMA 1JJ7A 3TUZC 4Q66C 5ELXA 1XF9A 3EC2A 4QBFA 3KJHA 1E2JA 2QM7A 4ON9A 4KFRA 4GI7A 3FMOB 5JJLA 1W0JD 4FCVA 4TT3A 3GLHE 3MWLA 2V1UA 1X1SA 2ZRIA 2CDNA 3FFBA 3B9QA 4PPGA 2ZANA 2O8DA 4H1UA 1II8B 5DN6A 1JAIA 4K81B 1N5IA 1YRBA 5CDFE 2JLYA 2BOVA 1VPLA 5BYKA 3G82C 4M1KA 1R4AA 1SHZA 1UEJA 2VF7A 2H5EA 1E79A 1F2UA 1ZM4A 4B73A 2XNSA 2CCGA 3GJ5A 4GZLA 1MO3A 1G64A 1OXUA 1OW3B 2BMJA 2EYUA 2GF0A 1KY3A 3C8UA 2QQEA 2JJ2D 3B1ZA 1S4QA 5IHPA 4AWXA 1MABB 4JMPA 1TEVA 2J0SA 2WKQA 3W6NA 1OHHA 3TUJC 3GLHB 4XOIA 4NE2A 2CL6X 1XTRA 3ZD6A 5JHGB 5FUVA 3W3ZB 4NP6A 4PQFA 1R10A 1OYWA 5E7JA 1KDPA 2X1VA 2PX3A 3IUYA 1KDRA 4PHHA 3HYRA 1TF2A 3OAAA 4TLDA 3VAAA 5FPTA 2ZI7A 2ZSBA 5GVSA 1NVWQ 1OE0A 3KJGA 1I2DA 3PCRB 721PA 2PZFA 4PAQA 1D5CA 3QF7A 1U8YA 2V55B 1KDOA 2XAUA 2HCBA 3JVUA 2PMKA 3P26A 4RD3A 2FFHA 2KJQA 4RFVA 4EIWA 4OJQA 1AGRA 1KDTA 4S2EA 4QJ4A 1OFUX 1R0ZA 3QXSA 3SBEA 2IUUA 4NMMA 4BLTA 3OEHA 3SQWA 4BZXA 5KUTA 2CBZA 4KAXA 4A0FA 4ERNA 1JPNA 5K8TA 1J2JA 4RCZA 4S35A 3B1VA 2YOFA 4F92B 4PC2A 3QF4A 5LDDC 4OQFA 5G3ZA 3TQCA 2QPOA 3U7FB 4A36A 3Q7PA 2BEKA 1GNQA 1A2KC 3RS4A 4C30A 2O8BB 2A5GA 5CJPA 1G3MA 2VHUA 1W7AA 2ORIA 3AVOA 1FMLA 1GUAA 3ICEA 2XGJA 4LYFA 4M1SA 4P33A 3AF4A 4O25A 621PA 2XB2A 3WHLA 1VYTA 2O8DB 1Z63A 2IYLD 4PPNA 1XD2B 3IILA 4YXWA 3D31A 2QTHA 3LVQE 2HJVA 2QM8A 4CF7A 2NQ2C 1E1RA 3LW8A 5JCZA 2N42A 1TL7C 3F3YA 2X2FA 3U3MA 1ZAKA 3GJ3A 5D3MB 3BRWD 2F3RA 3W3AA 1AM4D 4DVGA 4LBYA 2ZEJA 1Q20A 3QPUA 1XU4A 3DDCA 2W6IA 2BM1A 4LC0A 1OIWA 1NI3A 1NMYA 2YOGA 1OXXK 4B71A 4MRSA 1TTTA 1T3LA 3QXCA 4AYTA 3U7HB 1UDWA 4ZPXA 4KSCA 4TLEA 2QTFA 3OFNA 2V8OA 4ZKEA 1R5BA 3IBGA 4JLDA 4PAOA 5EXTA 3OAAD 3QKRB 1HV8A 3CB4A 1W2GA 3SQXA 1E99A 1DPFA 4MDEA 1TQDA 3IO5A 3UWOA 1DBSA 2FEOA 2RCNA 1SVOA 2BKUA 3LXRA 2F55A 4G5QA 3RSOA 5JLJA 2F43B 2WJIA 4DUGA 1N6IA 2XTZA 2OCBA 3DM5A 2W0SA 3AKCA 5FR2A 1G3UA 2QBYB 1G8GA 1MABA 1TMKA 2W0MA 4IKEA 5FTMA 3RSLA 4NHOA 2OBLA 2IS6A 2OSBA 3EZFA 4EPRA 1F48A 1IN8A 4R2HA 3KQKA 1Z2CA 3CF6R 2IA5A 1M74A 1FTNA 5KSOA 3T5DA 3T15A 1RRCA 3NEYA 4A4DA 1NP6A 2OESA 3RYTC 1Z07A 3HR8A 2XITA 3FKSA 3QF4B 4DSTA 3TGPA 3ZD7A 2FFAA 1G8YA 3AP1A 3NG1A 3VFDA 2JCSA 3QOFA 4B74A 4EJSB 2JLRA 4DSOA 5L8VA 3T34A 1OH6A 3N2EA 4D0LB 4AIIA 4GOJA 4LYJA 1KI7A 2HEIA 1DG3A 1KO7A 1E2HA 2REBA 1IAQA 3ZYCA 1KSJA 5FOUA 1FW6A 3GP8A 3AKEA 4A92A 1N6RA 3H84A 1HY3A 5A5GA 4C0JA 1T8TA 4PC1A 1Q1QA 2JJ1A 5CJ2A 1VG1A 1ZD1A 1F2TA 1COWA 1YVDA 2OG2A 3I8XA 5ANRB 1NIJA 2QE7D 2OILA 5G40A 1IY0A 4LHWA 2IYRA 1LS1A 1KI3A 4IOKA 4LK2A 4C0LA 4F91B 3U44B 2B6HA 2WSSA 4ABYA 3D8BA 1HH4A 1X86B 3KQUA 2VF8A 3TIFA 3GJ0A 1U0JA 2YYZA 2OEPA 3OEED 4C0KA 4PQYA 2QUZA 1CR2A 3HR7A 3RNLA 4A6XA 1VCIA 1VG9B 3MJRA 4D4KA 4M9XA 2O8FA 4YMUA 5CK4A 2P6UA 1HE1C 2UVQA 1OPXA 2WAYA 5FFMA 3S1AA 1E9BA 2ATVA 2B8WA 2IUSA 3EW9A 3EZ9A 5DI9A 1KO1A 1OB5A 5DI3B 1BO6A 3TW8B 1E2LA 1Q3TA 2ODWA 3BC1A 4MH0R 3SE0A 1E2QA 2NO0A 2NOAA 4Q4AB 4URWR 3EPLA 1E0KA 2DPXA 4LYHA 1HQYE 1X8LA 2ZJ8A 3AF1A 4QL3A 2FFBA 1AS0A 4RD2A 3GLFA 2NO9A 3RRYA 2HXSA 3I3SR 3CKLA 3K0SA 2JJ1D 5TDHA 4XTRA 3QBTA 3QXJA 4R7ZA 1FPMA 2QMEA 3DPUA 2QBYA 1UKYA 2GILA 2X8AA 3FVQA 3NC0C 4V0MA 2WTUA 3L82B 4G5SA 1HTWA 1TAGA 3NHBA 1G1MA 2OFXA 1L4UA 2JJ8A 3NIBA 3EPKA 1KI2A 2F7SA 4PC3A 2ZRKA 3DOEA 4P32A 2IEYA 1W36B 2YWEA 4RZ2A 1J8MF 2XZOA 3KB2A 2YWHA 1T4GA 2IX3A 1ZM9A 4Z51A 1QHIA 3VR4A 1E4VA 5L3SB 3ZZTA 1GOTA 5CB8A 4YXWD 4BECA 2BBOA 2D3WA 1CBUA 1JR6A 4OQLA 5SZHB 2C5LA 3CW2A 4B76A 3K9NA 1N5KA 4X8MA 2ZE8A 1U0HC 1W5SA 3G5UA 2QAJA 1GKYA 2WV9A 4YLGA 1ESNA 3B60A 3N2IA 4NCJA 4Q1CA 3AVXA 5BQ5A 1YZUA 3NBYC 4PX9A 1LF5A 4XVQA 5C1BA 2REOA 4U02A 1F2TB 4FWTA 2DCUA 1W4AA 1ZMXA 1B0UA 4MUBA 3DEFA 5G53C 4BASA 3U44A 1OLOA 3R9IA 2NMVA 3AVPA 1NY5A 4UXIA 3K9HA 1YZNA 4PZZA 2OT3B 1RRGA 1Z0KA 2AFHE 2VH5R 2I1QA 4EKDA 5TVKA 4DT1A 2O8CB 3SC3A 3LW7A 3NC1C 3ZJYA 2C04A 2F1RA 3KDSE 4DXAA 4TZ6A 4HZUA 2IWHA 4PC7A 1T5IA 2R62A 5FUYA 4KO8A 4WA7A 1FQJA 2QMOA 2WOOA 4W9MC 1SVLA 5EXPA 1W4BA 1JJVA 3K09A 1XEWX 3QG1A 5FTJA 2JLUA 4I4LA 4KU4A 2A5YB 3ETLA 4Q7JB 2HF8A 3CRMA 3B13B 2QT1A 1EFHA 3WNCA 4DZZA 4F4JA 1ESMA 4KITB 3Q3JB 2BJVA 4A8JB 1XMVA 1Q1ZA 3ND9A 2W2XA 2Z4RA 1ZRHA 2PT7A 2ZSFA 4FIDA 3ADCA 3U5ZB 3QEOA 2BHRA 3TRFA 3EPHA 2VHQA 2W2TA 1W4RA 1D8TA 1EK0A 4M8NE 1Z6XA 2NZ8A 4LI0A 3V9PA 5HZHA 2IF0A 2IXGA 2GXAA 3BS4A 2DWOA 3MWKA 2A5DA 5JHHB 3ADDA 1P72A 3PXGA 2WWFA 3KKMA 1DELA 1E96A 1L8QA 4QKQA 2FPMA 2J41A 4TSFD 3C14C 4PXAA 2ZJYA 2DWQA 1ZYUA 3DM9B 3EZ7A 4C4PA 1JBKA 3VX3A 4QGFA 5JI3E 4IOMA 1GSIA 4B6FA 4D81A 2V7QA 1EGAA 4C7OA 3VR6A 2GK7A 3RRMA 5HR5A 2XXAA 4CEHA 1BKDR 3Q85A 1CRPA 2OHFA 4Z1MA 4KXFB 3CPEA 1W5TA 1LY1A 5J4YA 2AWNA 4CRWB 2C2HA 4MRNA 1S0UA 4TYYA 4GDFA 4M1MA 2JLVA 3MLEA 2VIIA 5AWFC 1N6LA 5FI1B 4A8JC 3U4QA 3TAUA 1W47A 3IIMA 2ERXA 3T1TA 3AQ4A 3C15C 3AVVA 3H4MA 1KI6B 1S1MA 5J40A 1NKSA 3DKVA 4FN5A 3Q5DA 2WIAA 5JS7A 4D25A 2OFWA 3K09C 3K1JA 221PA 2QN6A 2WSMA 3IQXA 2VA8A 4LHZA 2FGJA 4FWIB 5C2JB 1SZPA 4PR0A 3TAHA 3CIOA 1G8PA 3OIWA 5GVRA 5EJEA 4P4SB 1G41A 2CHGA 5FPYA 2AFIE 4AG5A 2ZETA 1T91A 2O5VA 2IS2A 4AKIA 3SDZA 3D7MA 4P4UA 4RD0A 1KO4A 2QEQA 2XSZA 4JLMA 1H8HA 3C4JA 421PA 2FGKA 3BOSA 2BCJQ 4AI6A 2WKRA 2GESA 3MJHA 3U7GA 3RC3A 4YMVA 4JJKA 4A0RA 4MA4A 3DO6A 1H8ED 3LNCA 1G7CA 2GDJA 3UK6A 1DAHA 4DDVA 1TQ6A 1SKYE 2BBSA 3EZ2A 1D6JA 3RLFA 5GJVC 2ONJA 4LBWA 4BFXA 1OHHD 3QKUA 2AWOA 2ZS8A 2ZIAA 2J0QA 4Q19A 1T0HB 4EQ6B 1VCMA 2GTPA 3NHAA 2PJRA 4DSUA 3BH0A 1S3GA 3QY0A 1RZ3A 1XFAA 5H1YA 1HEIA 1CJMA 3RABA 4Q7MB 4TMVA 4LCBA 1Y3AA 3GLIE 1NN3A 1UF9A 3ZIAA 4XWKA 4Q00A 1OKKA 3NDBB 2ZM5A 4IXMA 4RJLA 4GP6A 4BEJA 4UNNA 4PZLA 4G1UC 3PFIA 2HYIC 3IQWA 5DN6D 4QC2A 1SKYB 2OAQ1 3CR8A 3UIEA 3CX6A 3BAFA 4B43A 1NN5A 3SHFA 3KFVA 2GBLA 4PO8A 2RGEA 2O8EA 5KSZA 1RYFA 2OCPA 3BGWA 1TQ4A 3GEEA 2F1JA 1DVRA 1NN1A 4G3XA 4U00A 4LZZA 4HUTA 4G01B 1U8ZA 4TMXA 1JALA 2ZQ5A 4Z54A 2QPAA 4PAMA 3SYLA 1FUUA 4GL2A 1NLYA 2CK3D 3WRYC 5FTKA 2OO7A 1XD9A 2ZRLA 3LY5A 2Q9BA 1OB2A 1DAFA 4IVQA 5JWHA 1M8PA 3IDQA 1P2SA 1VHTA 2CHQA 2EFDB 1ZU5A 3W8NA 1NBMA 2P5SA 1NG1A 5DO9A 3AUYA 4KFSA 1AA9A 4ACAA 4DEXA 4JSYA 1ZVQA 5KDDA 1P73A 1G291 3IPYA 5IDVA 2GEVA 3THWB 4CEIB 2HV8A 1CP2A 1VDZA 1E9FA 5DSZA 2VP0A 3IIJA 4EAQA 1P61B 4QFMA 4BLOA 4XD7D 3U4QB 4WZAE 1E4YA 1GRRA 2BVNA 3ZS8A 4ZDIA 3VU9A 4YQFA 3EXAA 1P60A 4BLQA 1IONA 1Z6TA 1CJKC 4YMSA 4A82A 4L16A 4V0KA 2C9OA 4B47A 1IXRC 1UKEA 4XWAA 1VCOA 3IKJA 3TUIC 3EA5A 3X2SA 5BN4A 3CNOA 1FP6A 1GILA 1MOZA 2PH1A 2Q3FA 2SHKA 2VLIA 3O8BA 4IDHA 1T0JB 1JXMA 1OV4A 1UDXA 2JIZD 4BPBA 2PZEA 1CR1A 4HEJA 4URXR 1S9HA 821PA 2ZAMA 4PSKA 4TQAA 3CONA 5DHFA 4YC7A 1JEDA 4MGIR 3J81k 1Z83A 4NCKA 2QSYA 3GLGA 1FTSA 4QG7A 3BORA 1DOAA 3TMKA 2W00A 3LXXA 4QM6A 4QJ3A 4O3MA 2PEYA 1WXQA 2MMCA 3PG5A 1ETUA 2ANBA 1NSFA 4EFNA 3SJZA 2WPDD 5BN3A 2P5TB 3FMIA 5HCNA 5H8WA 1R0XA 4NYIQ 4M4SA 2F9MA 5HKKD 1U9IA 2E1RA 3AGPA 3BB4A 4BFUA 2DFKB 1X6VA 4XTCS 4DDTA 3LQRA 2P65A 1AKEA 5F3WB 5DE3A 2CEAA 3K8YA 2BEJA 4W5WA 4TQ9A 4URYR 2AKAB 4P3YA 1GRNA 2G83A 1C4OA 2KBEA 4P0TA 3K53A 2DB3A 4AKEA 2Q6TA 1SQ5A 3ZZUA 1CU1A 5BN5A 2W2VA 4URZR 1XPOA 1C9KA 1BMFA 3LFUA 4TYQA 3I62A 1E9EA 1RVDA 3TKLA 2CMKA 1P3JA 3QKRA 4LJAA 2O8EB 1P9WA 3GJ7A 1S2MA 3MWYW 3QE0A 1E2IA 4JT4A 5DIFA 1RJ9B 3MFYA 1AN0A 3AVTA 4DIEA 5K8IA 3HP1A 1BYUA 2FWRA 1MO6A 3K0CA 4PQRA 1W0JA 5KSPA 4LJ8A 1F5NA 3MRSA 3HDTA 4ZIRA 1LW7A 4U5XA 5HKKA 3I8SA 3I4LA 4P31A 1TF5A 2R6AA 4J0QA 2HF9A 4ZV4A 1XP8A 3GPLA 4RCYA 2C9CA 1R6BX 2REXB 4BLPA 2OUKA 2TMKA 4DCTA 2JATA 4EPYA 1IN6A 2JGNA 3GJ8A 3B1WA 1KK1A 3ND8A 4M1OA 5TY0A 4NPHA 4LV6A 5FOXA 3L0PA 1VIAA 2UKDA 2J87A 1G7RA 1TADA 1F6BA 2BMFA 5C18A 3U7EB 4BEBA 1XZPA 4NZYA 2Q3HA 2VP6A 2ZUBA 2FFQA 4DLSA 5EP1A 2CLCX 2GJKA 2WJVA 3U3KA 4URVR 1GL9B 3VU9B 3MSXA 4FD2A 1SXJC 4Q9IA 3FTQA 1NG9A 4Q4HB 2ZRFA 1XCPA 4TL9A 5DISB 2IS4A 2C9YA 1VG0B 2ZVQX 3KTAB 4MUAA 4IHQA 2QI9C 4ASUA 1GZSA 3SZRA 4LX0A 3LWNA 1XWIA 4LHXA 2FU5C 4E09A 2PJZA 4JSTA 1RE0A 1A4RA 3ASZA 3ECCA 1SVWA 1G20E 1UBEA 4OHXA 3R8CA 4QHTA 1VTKA 1Z06A 2PZGA 3U3RA 3BBPA 3ADBA 2GK6A 4LBZA 4ARZB 4IRUB 2R6FA 4QJ5A 3VHLB 4RD6A 3K70B 3B1XA 4UXJA 3I92A 4KYIB 2A5JA 3SR0A 4MRRA 1NMXA 1FX0A 1T9HA 1X8JA 1QDEA 4L5BA 1UBFA 4HB2A 1XXHE 2QRNA 4Q9LA 2HT6A 3EZ6A 5EUMA 4MKHA 1DARA 4A9AA 5FOWA 2L0XA 4AK9A 3GLFE 3VKWA 1OFTA 2VHCA 4PPFA 4EPWA 1ZINA 2ZJ2A 5F9HA 2G0NA 4Y0VA 4F93B 3LBIA 3GLGE 2YKGA 5GJWC 1OFIA 5H68A 3AF3A 1YHNA 1Q0UA 2GRJA 1VCNA 1ZW6A 1DE0A 5EE0A 2G1KA 3WBJA 1J7KA 1CS4C 2GXQA 5F2EA 3REGA 2PCLA 1N25A 1PUIA 2R2AA 3QXHA 1N6PA 2J9RA 5AR1A 4TL7A 1TU3A 3P4XA 3RDPA 1S8FA 1E9DA 3K70D 3V00A 1X8KA 4D2IA 2ODNA 3GLFB 5FPHA 4JVLA 2GJAA 1WDTA 5JEDA 1LV7A 1OH7A 3WHKA 4JVMA 1QRAA 3I32A 3W9YA 4MYTA 3CRQA 2QA5A 3FGNA 5M04A 4KHZA 1Z0DA 1UEIA 2D74A 1ZNZA 1OXSC 1JB1A 2DBYA 2FJUA 3PQCA 4B34A 1AJEA 4NU0A 2RHMA 4C3ZA 1ZIOA 2CXXA 4Q7KA 3PUVA 4KVAA 4QBIA 3W6PA 4E07A 5L3QA 1OFHA 1M7BA 1E2EA 4GFDA 4RVCA 3T06B 1E2KA 2D2FA 2HCJB 6Q21A 2XZLA 1S9DA 1ZC3A 2A7QA 3RRNA 1G5PA 1L7VC 4A1FA 4DDWA 2IHYA 2AL7A 1HA3A 1NLZA 2PLRA 2GXSA 1BYIA 1Z28A 4DLXA 2D7CA 3L0OA 4M21A 4UNPA 1Q3HA 2QT0A 4I1OA 1FQKA 2XEXA 2ZRNA 4B2IA 1XDBA 3NBXX 4UQOA 2RGNA 4IOLA 4G5GA 4JLBA 1ZJ6A 4ARZA 4IW3B 1PLJA 4GOXA 3TVTA 5AUOB 1CKEA 1N6NA 3O8CA 2KBFA 3F5FA 3QPWA 4PFSA 3SFZA 2Y8EA 3P20A 4C2TA 4BFYA 4FINA 4LJ9A 2GHIA 5EP2A 4QGHA 3THWA 3NKVA 1Z2AA 4Q1EA 2RKOA 4A2QA 4ZDWA 4DDUA 2I4IA 3LRPA 3LVRE 4GZMA 3W5IA 4HAXA 3N70A 3X1XA 2ZJ5A 2MMGA 3CZQA 4D26A 1NBME 2C77A 2JAQA 5FL3A 4IFBA 1G18A 2WAXA 4RZ3A 2FSGA 1U94A 1CTQA 5KU1A 1SVIA 4TLCA 4WIAA 2Z0MA 1K8RA 4PTLA 1GRQA 4Q4JB 3R7WA 3TJZA 4JVNA 4DLYA 5JRJA 1PJRA 2ZRJA 3KJIA 2FMXA 4PZYA 4WZBE 1AZTA 3HU1A 4B3BA 1SHKA 3CBQA 2JLQA 2IUTA 2XJ9A 4CIDA 4TZ0A 4NBSA 3AH8A 2W6JA 1XPRA 4JKIA 4XIGS 5E95A 4B33A 4EJSC 1P6XA 4A8JA 1YZLA 1EG7A 1QHXA 2BV3A 2H17A 1XTJA 2WZQA 5DHAA 3U6KA 1GWNA 1U8AA 1OH5A 1SVMA 4OI1A 3BK7A 3UG7A 3VNUA 3OE7A 2A9KA 2RH5A 4JLKA 1BIFA 3QXXA 2ZYVX 5KDOA 5H70A 1S96A 5CK5A 3QEJA 2IF2A 3I1FA 2AK2A 1YZKA 1ZIPA 2RB4A 4CEJA 2MSCB 2WJYA 3O8RA 3NWJA 3P27A 2YC4C 4B75A 2KE5A 2FN4A 2CJWA 2IXEA 2VQSA 3PUYA 3KXLA 3AP2A 2PCJA 4LOAA 4KBFA 3FWYA 5AUQA 3W6OA 1MRNA 2FZLA 1LNZA 1ZCAA 3RS2A 4CW7A 2FZ4A 2OAP1 4JL6A 1TPZA 1CIPA 1JXOA 1IHUA 4OQXA 3VR2A 2OV2A 1MO5A 2YNMA 4FMDF 4PHTA 2ZRPA 4MITA 5L3RA 2BC9A 2C96A 4B6EA 3QSYA 2IWRA 5E7IA 4LRWA 2ODEA 1E1RD 2WJHA 4W5HA 1R0YA 2HT1A 2YHSA 3CO5A 4MKGA 4QGAA 1GDDA 1NL3A 2JLSA 1MRSA 2OCYC 4XVUA 2ZVPX 4AY2A 4ACBA 1P9NA 2GEUA 2WIBA 4AYWA 4R9UC 1GKIA 5FBQB 2GF9A 1EXMA 4Q03A 3SFVA 1WE2A 2RGCA 3Q9LA 3WP0A 5FOSA 5JJIA 3A1SA 4F38A 3G0HA 2BDTA 4HB3A 2ZYWX 1F3OA 2DWPA 1GFIA 4PHFA 3ZGXA 2GNOA 2NG1A 3DMDA 3OF5A 4OI2A 1XPUA 1XCGB 2CLDX 3MGCA 4GRAA 4HSEA 3SJAA 2OZEA 4NL4H 4LV5B 1KKMA 1GL7A 1LB1B 1H65A 1VIYA 1VYUA 1RRPA 2XX3A 4TSFA 4DEYA 1JEEA 2O0JA 1KOFA 4HDQB 2A30A 5KNBA 1DAKA 2YV5A 3EWSA 5EE1A 1Z6AA 2QE7A 3I72A 2RMKA 1AGPA 2R8RA 3MCAA 4DRZA 4MRPA 5DNYB 3ZVRA 5KYKA 2DFNA 2HUPA 3NBFA 4NDZA 4HAWA 2HYDA 2EFGA 3GEHA 5IK2A 3EASA 2F6RA 2GKSA 4OK3A 3ZQJA 4DLWA 5JRZA 1KO5A 4L8GA 3A4NA 5JS8A 1L2TA 5AJWA 3CZPA 4Q01A 2VHJA 2WWWA 5FL7D 2EU8A 2GWHA 3EARA 3T1QA 4EFLA 4MYHA 4UJ5A 3SN6A 3T12A 2ATXA 1OJLA 4OI4A 3VTKA 3EPJA 4QNRA 1G7SA 2CJWB 3HU3A 4LBVA 5JEEA 1W2HA 4PSVA 5SZIA 3I5XA 2ZR7A 4GPTA 2J46A 2BJWA 4G5OA 3FKSD 2IK8A 5CIWA 1JNYA 1AZSC 1ZM7A 3I61A 1LFDB 4GSYA 3ONWA 2GEDA 1CF4A 1YR8A 4TWZA 1P4SA 4JBYA 1Z47A 3FMFA 3IEVA 4DB2A 1J70A 1Z08A 3IHLA 3L8YA 3R9WA 4C0HA 4FMBB 1YZGA 1NY6A 2IYQA 1PUJA 4KJZA 4WXPA 3RS7A 1N5LA 3THXB 2WMOB 1J99A 3NBZC 1Z29A 2J45A 4BFSA 3A4MA 2GVDC 4N1AA 1CJUC 1CLUA 1WP9A 2W58A 2WPDA 4FW9A 4HAZA 2NTYC 1U0LA 3GFOA 5FUXA 5F98A 1QHHA 1N5JA 1OIVA 4TMKA 5JMTA 3K70C 4QBHA 4DLRA 2CK3A 2O8CA 1PZNA 2B7CA 1XTIA 2X77A 1NVUQ 2G6BA 4V03A 5FH9A 1CRQA 5LB4A 3EAQA 4EPTA 2LKCA 1ZUIA 1IQPA 1KJYA 2KB0A 5C4GB 4BLSA 2WOJA 4XD7A 2RAPA 2XB4A 3VKGA 2AD1A 1J8YF 4LJYA 4YDSA 4DCUA 4HB4A 4JLOA 5HCIA 2N46A 3TSWA 5JCPA 1LTQA 2B92A 1JQLB 2C99A 2NO7A 3KKOA 3EWAA 3BD9A 3PVSA 4KBGA 2J5XA 4PSAA 2H92A 3IO3A 1JQJC 3T5GA 3UPUA 4H1VA 3T1OA 4HYYA 5DH9A 2WWGA 2RGXA 5KSYA 3HYTA 2ZI6A 1UM8A 5EP4A 4JJZA 2IW3A 4D0NA 4A0GA 2OE2A 2ZYTX 4Q18A 3FFAA 4OJKA 5DGXA 1Z6GA 1HURA 2YJTD 3GLIA 1EFRA 2XOKD 2CL7X 1Q44A 4QXAA 5IF9A 1KSHA 2VPPA 1E32A 5L3QB 4LHYA 2CLSA 1XMSA 1YE8A 4C0AC 4CVNA 1G5RA 1QG2A 2VBCA 4UNSA 3L0SA 2J59A 4QNMA 2ZJBA 5CM9C 1H8EA 1L4YA 2IL1A 4LHVA 4PPQA 2QORA 4DCSA 4Q02A 4HLUC 5E3HA 1WF3A 5EP3A 4QOSA 1NJFA 1ZP6A 2V54A 5EZ6B 1A5TA 1RC8A 3TR5A 1XMIA 3RVBA 1UBGA 2NZJA 5KPJA 2XSZD 121PA 3IHWA 4KODA 1YKSA 4B32A 1ZNWA 4C7OB 4ZI3A 3OFND 3MAAC 3VR1A 1A1VA 3BWDD 1E0SA 2V9PA 2Q21A 4A0HA 3AVWA 5HZKA 2ERYA 3NEJA 4ZO4A 1TUEA 2CNWD 1DAEA 3ZVNA 1J90A 2PX0A 4H9GA 1KNXA 4TTPA 5J4LA 2O0KA 4M9QA 3KL4A 4JYCA 1Q21A 4KI0A 1QHHB 3CRVA 1K6MA 2F3TA 1QVAA 1P9RA 1GTVA 4NYJR 1E98A 3AKDA 1KI6A 4MKIA 2Z6VA 1IJFA 4LJ4A 4X8OA 4KV9A 5J5CA 2F1IA 3B1YA 2OLJA 2CHVA 3KZ1E 3FDIA 2BCGY 1EESA 5SZKB 1TEXA 2YVUA 3LH5A 4D0GA 1Z0AA 2E87A 2NO1A 3OEHD 3TSZA 1O87A 1OIXA 2XNDA 1KY2A 4O2LA 2ZJZA 3RWOA 3BFKA 4RZUA 3TNFA 1N0VC 3QPVA 5B57C 3DHWC 3OIUA 1RYHA 2G0TA 2JDIA 4TYNA 2ZRCA 1RJ9A 3U61B 4GNKA 4DCVA 1W49A 5AJZA 4KFTA 4EDHA 1IY1A 2VP5A 4MDFA 3FHTA 5HTKA 4JT2A 3GQBA 4US0R 1IXSB 4ZIRB 5FPSA 4F7WA 3QVVA 2ZE6A 2Q3MA 2LWIA 4BFWA 3C41J 1EFUA 2H7VA 4PANA 4XJXA 1KNQA 2B21A 2QP4A 4LV8B 1YZTA 5CYPA 4NTZA 1ZM3A 2P3SA 3EA0A 1G5TA 1YU9A 3FHCB 3KXIA 3QQ5A 3A1WA 1G4AE 3WNDA 4HAYA 4DLVA 5JJKA 2C95A 1JR3E 1FNMA 3TK1A 3W8RA 3QVUA 1P7CA 1NJGA 1TU4A 3AVUA 1KO8A 1KKLA 1TUIA 1S3SA 1U90A 4L9WA 5EXXA 3L2OB 4YDHB 4BUJA 2ANCA 3IIKA 4HLUA 3EIQA 2IYYA 2E9SA 3U60B 2PL3A 4Y0AA 3KFXA 4CYMA 4RFSA 2RHDA 1AQYA 5LB2A 5DYIA 2BBTA 3B82A 2YWGA 4GP7A 1IBRA 3KJEA 1G4UR 4DKXA 3W34A 3QIAA 1Q1EA 2V7QD 4ZI2A 4BZQA 4MKFA 4ASUD 1JECA 1AQUA 3ASYA 1W46A 4HAUA 1WBDA 2D62A 5FBLB 2I1VB 3AF0A 5LBIA 3EIHA 2EW1A 4IEIA 1ZUNB 5UKDA 4TYPA 4E03A 1XCMA 1G3IA 4GMXA 3FYHA 3K0EA 4RKEA 1ZC4A 3H0KA 5FTNA 4HZUB 3QBVA 2OM2A 2GCPA 4NCNA 1G19A 1GITA 2VRWA 1F60A 3CRW1 2GZAA 4GMDA 4TMWA 4LY6A 3L0IB 4TL8A 3OE7D 5B2ZA 2D4HA 1FX0B 4JL5A 1KHTA 1N6HA 3DVLA 1VECA 4G0NA 4K46A 4ZKDA 5KOYA 5HPYB 1UBCA 4IDOA 1AIPA 3CF2A 4MGYR 5CITA 3BB1A 3A1TA 3VHXA 5L3VA 3RHFA 5K8LA 1OH8A 1QF9A 2KWIA 4Q9HA 3SJCA 2FEMA 1E94E 5K8UA 2QMHA 2V6JA 3N5CA 1II9A 4XH9B 4BFZA 3AGQA 2ZREA 5AJYA 3THYB 1XJCA 5B30A 4QM7A 2WSSD 4HLCA 3VR3A 1TQ2A 1D9XA 2EVWX 1YRAA 5FUWA 3PR1A 4LUCA 4AURA 3KKNA 4Q1BA 3KXKA 4B35A 2CNWA 3ICQB 3CWZA 1NKTA 3WXMA 3K9GA 4HDCA 1NF3A 4I1SA 1IN5A 1RW4A 2WWXA 4ZDJA 3MG9A 2F43A 2GCOA 2UZ3A 2CE7A 3A37A 1RFLA 5LD2C 1UKVY 3LLMA 1G3RA 1ZU4A 1QZXA 2GAAA 3Q5EA 4AD8A 4XSGA 3QKTA 1BS1A 2R65A 3EC1A 1G7TA 2FF7A 2FSFA 3H2YA 2ZPTX 1W36D 1UAAA 1Z6YA 2D2EA 1IN4A 1MKYA 1WA5A 2H18A 2YZ2A 3P1JA 2G1JA 1G6OA 4JKYA 1VMAA 4M9ZA 3SOPA 3T61A 4JYBA 4LGMA 3MWJA 4ITRC 1XXHA 4MGZR 4HZIA 2P6RA 1M2OB 2HDNB 4AKHA 2NO6A 1KI8A 3B85A 2HXYA 2ZR9A 2Z5FA 1R8SA 5J4HA 2ZUDA 1IN7A 1WB9A 3RS3A 3MMPA 4TN1A 3S1AB 4R98A 3KUCA 1E2MA 1E2FA 3REFA 3SYNA 2WJJA 2RGAA 5DI3A 1KJWA 2AR7A 4IOJA 4DHEA 5AUNB 2WMNB 5JWOA 3B9PA 1OKKD 2BBWA 4M53A 3PEUA 2GVZC 2RGDA 3QG5A 4YMTA 4V0LA 4O0MA 5FL7A 4II7A 1OT3A 4C0SA 1BH2A 3E70C 2AK3A 2JDID 3B6EA 3JZAA 1N6KA 1ZD8A 2BWJA 1MT0A 2HLDA 4IDPA 3W90A 2PT5A 4A15A 1U98A 1E9SA 1NIPA 5FPKA 4F4CA 1G3QA 1UADA 3U3OA 1ZUHA 5JECA 3THYA 2IS1A 4V0ME 3UKDA 1CXZA 2O8FB 3CNLA 1DAMA 3CWQA 1Z0FA 2WHXA 4UKDA 4DSNA 1I2MA 3T35A 3SU8A 1G6HA 1NNEA 4B3GA 2QY9A 2ECKA 1G16A 2H1LA 4M22A 3LLUA 2ZI5A 2O8BA 2QMUA 2R9VA 3NH6A 4DBLC 3LBHA 2QGNA 3LD9A 3ZLJA 5GADl 2D06A 3K0AA 1UFQA 4FCWA 1LF0A 4BRUA 1QVRA 4LSGA 4E22A 3LA6A 2OBNA 3X1DA 4FCTA 4BFTA 1TNDA 4TTQA 4CT4B 2ZRDA 4IVRA 2D7DA 3PJRA 1TX4B 2ZSDA 1K5DA 4Q5IA 2PMDA 4JZKA 2FSHA 3SBDA 2ZI9A 2FG5A 1OF1A 2VP9A 3TSOA 2QSZA 2FX3A 4QGGA 1NVVQ 1DAGA 1NSTA 1N0WA 2GBLC 4EPXA 3BE4A 3FHOA 4MGKR 1FP7A 1I4TD 2ZS7A 2GJSA 2IBMA 2OXCA 3FKQA 1GM5A 4ESHA 3O8DA 3VNVA 1P2UA 2I3BA 1EWQA 4FMDB 2XOKA 4R71A 4DLUA 3LX5A 1SXJE 2ZITA 2VP2A 2IYZA 2NPIA 3NXSA 1RPZA 5HE9A 2ZI3A 1W48A 1W0KD 2DFTA 3GJXC 2VSOA 3RS0A 3TW4A 1YR6A 4TQUS 4RSGA 3X1ZA 1NLFA 2OXRA 3NDPA 3WYFA 5D3QA 5B64A 3HWSA 1E2NA 1KSFX 3GD7A 3IGFA 5EE5B 3R9XA 1OSNA 3GFPA 5J4VA 4WZ6A 4DLTA 2V4ZA 1CR0A 4QBGB 4RD1A 1D2EA 3K0FA 4R2IA 4CZ2A 1SXJB 1T8UA 1IXZA 1U9IC 3WRXC 4OHZA 3PUZA 2X19A 4DIDA 2DY1A 4NYIR 3KQHA 4DUGD 5F9FA 1DEKA 3TVDA 1X1RA 3PEYA 4PO9A 4W5JA 3D3QA 4TTRA 4FMCF 5CLQA 2CE2X 2H16A 5JBQA 2YINC 1JPJA 2C8VA 1T6NA 5DYGA 3GMTA 3IPXA 2Z83A 4UNQA 1W44A 2QNRA 3WMEA 3LQQA 2PLFA 2WBLC 4Q1FA 3DZDA 4IXNA 1W4CA 4X8LA 4B3XA 1MV5A 1E6CA 3CNNA 4LJ5A 4HAVA 4OK5A 4TT3D 5LD2B 4AYXA 2R6GA 2P6NA 2RGBA 1OYYA 2N1BA 4TYWA 2VP4A 1GP2A 1ONBA 1WRBA 2ZRMA 2WICA 3BJIC 2Z43A 1XD8A 3VMFA 4JLNA 3NH9A 1II8A 1EX7A 4Q4LA 2AD5A 4NH0A 4CEHB 2K5UA 5J4KA 1E1QD 2JIZA 3ZQ6A 3A8TA 4OBEA 5JSZA 1UKZA 5GJBA 1F2UB 4US1R 1BMFD 5G3YA 1KZ7B 3CPHA 3PITA 1E69A 3B8HA 1B23P 4LJ6A 1Z3IX 4KVGA 3ZZ0A 4XWOA 1IY2A 3AP3A 3CF0A 3IBYA 3UMRA 1GG2A 2FV8A 4QRHA 2WWYA 1AK2A 1YQTA 1HT2E 2J0UB 3A1UA 1IOZA 1XRJA 3WYGA 3DOFA 4B48A 4DLZA 2V6IA 4AKGA 1A82A 4ILEA 3PIRA 1ELOA 3GEIA 8OHMA 4OK6A 3THOA 4KCGA 2EFCB 4NYMQ 1KAOA 1Q22A 2J7PA 1PV4A 3TE6A 3CRRA 4EUNA 3ZH9B 1XJQA 4N0DA 1SKQA 3WY9A 1HUQA 1DO2A 2B8TA 3AKYA 4TMZA 2MSDB 5JFGA 2NIPA 5IT5A 1M7HA 5KHOC 1SVKA 1XB2A 2J0VA 3JVVA 3AVYA 1N0UA 1W0KA 4Q48A 3K0FB 1CJTC 2IT1A 1KK0A 4OKSA 1KI1A 3I5YA 1JR3A 1KYIA 1AS2A 4GBMA 1IJEA 1NRJB 3I73A 2JEOA 3TQFA 1FMJA 2IEZA 5BW8A 3GLHA 2WWHA 1U2RA 1Z0JA 4HATA 5JI2E 3UMSA 5G41A 1DAIA 2J3EA 3R7WB 3PV0A 4A2WA 3KTAA 4HB0A 3ZDQA 4DCNA 5KO2A 3FOZA 4P4SA 1GNPA 4HI0E 2OFOA 3AEZA 1NMZA 1E2DA 2MSEB 4LPKA 4BWYA 3B5JA 1SVSA 2ZR0A 3CX7A 5FR1A 4JLVA 1BOFA 3PUWA 4ZCIA 2A2ZA 4Z8YA 3U2QA 1LS6A 1SXJA 1KAGA 4JL8A 2J1LA 3VR5A 4DJTA 3AM1A 5KPDA 2FPKA 1W1WA 1E2PA 4A2PA 3ZIAD 1ZCBA 2ZI4A 2F1HA 3R20A 5GJCA 1CEEA 4QHSA 3K0CC 3L43A 1DO0A 2CCJA 2QAGA 4WXRA 3A36A 1C1YA 4D82A 4G5RA 1M1YE 3ZS9A 3GLIB 4EQ6A 4O2RA 1JI0A 1ZNYA 1Z22A 3FMPB 4JS0A 3CUEF 3KQNA 1RRFA 2JLZA 2LCFA 1NN0A 5KNDA 4CEJB 4FI3C 1KGDA 1XXHB 1WCV1 2ZAOA 4RKFA 3A6PC 2ZUCA 1NBMD 2ZSEA 2IC5A 3C5HA 2JLXA 4B44A 1R2QA 5FI0B 4TL6A 2RGGA 4BRWA 1CJVC 2FNAA 2GJ9A 4B3DA 1GKUB 2IYVA 3Q8XB 1ANKA 1GNRA 2XZPA 5EXSA 1G9XA 2EFHB 3KUDA 4DB4A 2QZ4A 1XEWY 3KX2A 4ESVA 1AKYA 3HU2A 1EFRD 2V1XA 3GJ6A 1K5GA 4ZDKA 2QU8A 2ZXUA 1ZD9A 2ONKA 4E5UA 3QENA 1XEXA 2AN9A 1GIAA 3E1SA 1LVGA 2DR3A 2GAOA 2ZTSA 4US2R 5CIQA 4V0OA 1CR4A 1E0AA 1A7JA 1H8HD 4KFUA 4F4IA 3UWKA 1XTSA 1MO4A 3MUFA 5AUPB 1W36C 1GVNB 5FBVB 2YOHA 2C03A 2ZU6A 3C16C 1WBBA 4IEEA 5P21A 3QJYA 4TMTA 4BFVA 2DHRA 3LX8A 2X2EA 5DLQC 3PEWA 4EJSA 2QP3A 2ZRBA 5EQTA 4BLRA 5CYOA 2EWWA 5BXQC 4CEIA 5LPNA 1KI9A 2BM0A 2AHOA 1EFCA 4I1VA 1MH1A 2WJGA 3E5HA 4MRVA 4RY2A 2F9LA 4LYAA 2ZJAA 4ZCMA 2P67A 2HJGA 2Q9AA 5A0FA 1XTQA 1E1QA 4YONB 2R44A 1D2MA 4LPSA 3BH6A 2CVFA 3B7GA 3M4YA 3A4LA 3F8TA 3SEAA 3GFTA 4RFSB 3WNBA 5JZVA 1OXVA 1P2TA 2XJ4A 1SULA 2CCKA 5C4MA 2PBRA 3HJNA 3PENA 5CB6A 4IDQA 2QRZA 4RZXA 3OESA 3T1VA 4EFMA 3U3JA 3ADKA 3B2EA 1D2NA 3OEEA 4KYUA 4DWJA 1YJ5A 2YWFA 3FB4A 3WMGA 5A4JA 4Q9JA 3OHMA 1EFTA 4M1YA 3UANA 3UMFA 4QHYA 1XTKA 2FE4A 3B78A 1Z5ZA 1E9AA 4B2LA 2ORVA 2ZRHA 2IYSA 1COWD 1G8HA 1R5NA 2QGZA 2WKPA 1P62B 4Q47A 2JASA 3VQTA 1KI4A 1GL6A 3K9LA 3WBKA 3EG5A 5EZ5A 1A2BA 2C78A 4Z1MD 2A3RA 3ZVLA 2ASEA 3RAPR 1U99A 1YZQA 1U81A 1ZNXA 4M2LA 2ZSAA 4Q4AA 4WAUA 3CR7A 4JVSB 2UZIR 1QBKC 1M6NA 1XEXB 2G9NA 3SJBA 5IK2D 2GXUA 2QG6A 4IVPA 2ORWA 2J7KA 5FOVA 1FFHA 3RRZA 3EX7C 5FBWB 3SYKA 4CDGA 2XTMA 1CULC 4D80A 1ZM2A 1M7GA 4OYHA 4NKRA 2B7BA 3QKSA 3MD0A 2VSFA 2A78A 1US8B 2FPLA 3VX4A 2FA9A 1HE8B 2IHBA 1KTVA
chains in the Genus database with same CATH superfamily
3DKPA 4Y98A 1VHLA 2FFJA 1UOEA 4C21A 1KMHA 1LH0A 5KMGB 3CGGA 4BNZA 1DTSA 1OQAA 3PHCA 4YQZA 3ZXUB 4NCBA 2JGEA 4B2PA 4CF5A 3DEAA 1A9YA 1TT5A 2VYNA 1WNFA 2NUPA 3H7AA 4INJA 2AMYA 4KQCA 2B61A 5T3YA 3L0BA 3VPHA 1Z5WA 4BQEA 3AV0B 3TIIA 3BB3A 4LFBB 1DQZA 4I50B 3VC2A 1YDWA 3SICE 2WSLA 4KLNA 1TCUA 1RU3A 5CCEA 1CQWA 4GPIB 3C7KA 3L8ZA 4AF6A 2I3ZA 2FZEA 2PWBA 2ZWIA 5IWAB 1TCAA 2ABWA 2G04A 1QHGA 5EE3A 1EFLA 1Q1GA 1S8OA 4ILKA 1DWQA 3GEMA 2IZ6A 1LSSA 4JQOA 2P4SA 4N39A 4Q1DA 2GETA 3H0EA 3M5DA 3BGOS 4QUJA 4ZFNA 2XCRB 4WPGA 3QX7A 2BIFA 4QPJC 2I66A 3SFTA 1Y80A 1SQFA 4L78A 4PC6A 1M8FA 1E79D 4GP9A 3QI2A 4GQIA 3INRA 4MP3A 4CV2A 1QHSA 1I4EB 1TGVA 1JR3D 4EY6A 4JI4B 3BMOA 1DG1G 4MQBA 4HLDA 1QQ5A 3R8XA 5JYEA 1AXRA 2VNHA 2DWCA 1DS6A 3QLVC 4JXJA 3W9BA 2CFSA 2P68A 3UXHA 4M0LA 3C5CA 2VDWB 1U0RA 3CPJB 4RWEA 5CXQA 5IT4A 2WQ6A 1UBKS 1BXRB 2H1RA 4IJVA 5E7MA 2ZW9A 3DR3A 3HG7A 1NHWA 1UPTA 2G77B 1LLUA 3WYBA 3WMFA 5I9TA 5F3DA 3G5TA 5EUQB 3TCKA 3O91A 2FZ5A 1PJSA 3DOHA 1A96A 1PLKA 3WK7A 4JBXA 4KSCA 4AO8A 1F20A 4X84A 1BE6A 1RKXA 3BERA 5D5PA 1WMFA 3SOZA 3ONFA 1N2CE 5LP6C 1J07A 2VPYA 3PXAA 3KV1A 2CD9A 1PT5A 4NONA 1X7WB 2JRLA 4D96A 3L7NA 4CGZA 5F73A 2H65A 4FPXA 1DCFA 3DL0A 2XUDA 5CDFA 3GHHA 1BRMA 1R0SA 4L9SA 4ERXA 5JSHA 1M83A 1EAMA 4AQDA 1FL9A 4BL5A 2R6DA 4KSBA 5KVQA 1YE3A 4M7PA 3C74A 5LYYA 1H23A 3E9RA 2YHIA 3ITEA 5TB5A 4GKAA 1C8KA 1DKPA 4J16C 5T5QA 3FUVA 1MQAA 2IV7A 1HETA 1NXPA 4TLAA 1EP2B 2OCXA 2BSAA 3AR3A 3QEMB 4TMFA 3GLKA 1YR9A 4D99A 4DXHA 5BUQA 3FOFC 2X8LA 1R6DA 4JD5A 3U09A 4L6AA 2IY8A 4UTRA 1YQGA 3WGVA 2C0QA 3IEUA 2ACEA 3HV2A 4OHCA 1UM9B 1M73E 1R1DA 1DCMA 1WO8A 2ONZA 2A84A 4KWCA 4BQIA 1Y3DE 2CBGA 2AA3A 4ONEA 2P2LA 1NVXQ 1JV2B 1RE1A 1FUKA 3CE9A 3FF1A 4ZT4A 2VK1A 4D4JA 2FWNA 3HO6A 1KMHB 4CMIA 1FMCA 1CF2O 1TYDE 1ICIA 2JJ2A 4GYJA 5EERA 1FB5A 3AF2A 4O8CA 4OKIA 2NU7B 3L5KA 2O1XA 4FI3F 4RVGA 3U6BA 4PF1A 1I51A 2HRDA 5EMKA 4ZYVA 2BGLA 4X3PA 2J3LA 2DWUA 3P9QA 3ETCA 5E1BA 2XKKA 2ZCVA 2ZJ4A 1M1NA 4P4TA 2PV7A 3KR0A 1UIMA 3AY6A 4XVRA 3MXTA 1J1IA 4BV3A 3PNBA 4X63A 2NGRA 3F2VA 3X1WA 4FLEA 3BXZA 3KT6A 1B8OA 1X9IA 2P2CA 1U0OC 4YCJA 1E2UA 3BILA 2VZLA 4OHMA 3FYSA 3RWMB 2YJ3A 1YB1A 5IYZF 3SEZA 4GT1A 1ZY2A 3HDVA 4ZTBA 4E15A 3EODA 4WLOA 4AUMA 3QPDA 1P75A 3UGQA 2RGUA 5ABPA 2PQ0A 1NNI1 1OAAA 1JQ5A 4X8HA 2JA1A 3A9SA 1WXIA 2Z2KA 2ZYDA 3GJTA 4F2HA 4KE6A 2FUNB 3KALA 4I9FA 1LI7A 3IVXA 1TRHA 1E2GA 1L5WA 1OZ0A 1NVGA 3ZWVA 1Q12A 2ID8A 3WI7A 2BM9A 2XQVA 1BEZA 4ND4A 5TARA 2VXBA 4JUFA 4N0EA 2NU8A 3WRXA 4AJPA 2JLWA 1TVEA 4RORA 3LF2A 1F0NA 3ZHBA 3MNFA 3NAGA 2NZVG 2OBMA 1NJ5A 4HFJA 4EO4A 1GAXA 1T5DX 2OCGA 5D3KA 2IZ5A 1H4VB 3JQFC 4B3JA 1E1DA 4TV8F 3IQDB 4CIXA 4CQMA 5JR3A 3PT5A 5EXEA 1Z6QA 1ADBA 4XSHA 3VC3A 1PZEA 4R69A 3R7SA 2JW5A 3JR3A 5C46F 2YWDA 3AXTA 4HLQB 1Z56C 1IBLB 2IOQA 2H57A 2IYTA 4O6VA 1HDYA 3CLKA 2PRIA 3CVJA 3NTUA 4QTUB 2PUVA 1TW3A 3TRHA 5C7YA 4BFSA 3ELBA 1E0JA 3VPBA 5CXUA 5EKDA 4XYGA 1BC5A 4JDPA 1DWOA 1RIFA 3ANMA 1Q91A 1KK2A 2QVGA 1N57A 4HYTA 4TT8A 2UXBB 1HT1E 3HDHA 4OQMA 1EUDA 2XGGA 3F98A 1U3GA 1E9RA 1B1CA 1FSGA 3E84A 1YS1X 4CKBB 4CMEA 1GZ5A 2R6CA 4OHVA 1YCHA 1P7WA 1XD2A 4U8HA 2BZGA 1B8PA 4HXEB 5A4IS 2H9YA 4YCDA 4D8VA 1Z8DA 2ZPUA 3AEKA 2CL0X 3DE6X 4YO7A 1S1CA 3I2JA 3JYHA 4YV1A 5HZGA 3JQFA 5BXYA 1S2GA 2R1VA 2I7XA 5ERXA 3WDMA 2XV1A 3LBNA 4Y7CA 2FDCA 3GRVA 3THRA 2R8YA 3RVNA 3JZMA 3KUXA 1GQRA 3R41A 1II0A 2AXEA 2EFYA 5CNKA 1T0UA 3OLQA 3H2SA 4A26A 4HQ0A 1VBFA 1N1EA 1K1EA 4JEMA 4JIMA 5GONA 4YN3A 3R3JA 4UTXA 4WDQA 3O90A 5EQJB 5LXTF 3O5AA 2ZWVA 1OWNA 4KFRA 5TPWB 1FLVA 3MM4A 4HY3A 4H15A 3GLHE 2JAHA 4RF5A 1U3UA 4PPGA 2CDNA 4DTCA 1O5OA 2G1UA 1Z4IA 2P6PA 3L7DA 1II8B 2QXYA 1N5IA 2WRZA 3LTEA 3NTOA 2JLYA 2BOVA 3FLEA 2DEUA 1VPLA 3I09A 1N3LA 3COZA 1UEJA 1L6RA 1JVSA 1ABFA 1SHJA 1SCUB 1Y7PA 3DMRA 1N9ZA 3JAWB 2GEKA 1HZZA 1OW3B 1JPVA 2GF0A 2II6A 2W6NA 4MVJD 1EB9A 4OLHA 5JVDA 3KAJA 5ALNA 3TG8A 3C8UA 1KJNA 2QE6A 4FYWA 2SCUA 4P3OA 4FT2A 3FZGA 2HWKA 2BR3A 3X43A 2CLMB 4JMPA 4KWIA 3KQOA 5JE8A 5B4UA 3WB0A 5DM4A 1Y1TA 1A7AA 3QVOA 4C4RA 3TUJC 1FYDA 3RSGA 1G59A 3A4YA 4HNRA 1P0CA 4O1HA 2F1OA 3V1YA 4NE2A 2O5CA 2WD8A 3F6EX 5JHGB 1N3IA 5I8ZA 4H3HB 2Y1OA 3L07A 4PQFA 5E7JA 4BNNA 1OYWA 4NNJA 2VF4X 2X1VA 4EG0A 1SC1A 3NBQA 3IUYA 5LQAA 1P1FA 1RZUA 2A1UB 1EX9A 1LSUA 1Y34E 1T9DA 3HYRA 1UODA 3OAAA 4B9EA 4FEAA 3PYMA 4AJ2A 4OXRA 3BF7A 2VG8A 2ZI7A 1NVWQ 1QK4A 2AJDA 1Y7LA 1I2DA 2W6ZA 2VTVA 1R6TA 4UD6A 1C8BA 3TD6A 2PMKA 1WSAA 3K8QA 3KJFA 3AWDA 4W5RA 2QJTA 5K1ZA 3F7MA 3N2GA 4INAA 4OJQA 4UU8A 1YQXA 3JY6A 4LXGA 5IKXA 4FOTA 4EWLA 4L6IA 1Q7BA 3TJRA 5KTPA 4MV7A 2GTHA 2YIMA 3QBDA 3COSA 4QSHA 5D85A 1DWUA 4R3WA 4AJ1A 3HMQA 2EAUA 5ALDA 5KUTA 4D9FA 2NYAA 1DO8A 3IUEA 3U7JA 1PFKA 4ERNA 3EOAI 5K8TA 2ZCUA 1J2JA 1JFFB 1YONA 5AK6A 5JV5A 3KQTA 4KXYA 2X22A 3P2IA 4BNGA 4J90A 5LDDC 2PQ6A 3FX2A 4OQFA 4D6YA 1A76A 1GPAA 1S2LA 4A36A 4C7MA 5L45A 4FFLA 1YDFA 1DPGA 1U1IA 2C5GA 3QI7A 4L57A 2HDHA 4DN6A 4KDFA 4F4DA 3PJGA 2Q7XA 3JVIA 5CJPA 1JUDA 3AVOA 1A04A 4DARA 2NVBA 4DS3A 1GUAA 3DNFA 4EITA 2XGJA 1U3TA 2HO4A 2C7BA 3AJ9A 1MJNA 3CZCA 3E0QA 4LYFA 4LE1A 2P0YA 1M6WA 4EB0A 4GBED 2OFPA 3AF4A 4JQZA 4F8JA 2GH1A 1EWKA 3DYVA 3HZHA 4XZ3A 4HPXB 3SPXA 4YT4A 2IHNA 1YHYA 2VJQA 4KE9A 1ZK0A 2G25A 2IYLD 3A9RA 4JX8A 1XRSB 1HX7A 1XD2B 5HA5A 4EENA 3D31A 2QTHA 3FUXA 3G9XA 1B76A 2QM8A 4OO3A 4S1VA 5SY9A 3LW8A 3PQEA 4IILA 3ZJUA 4YAKA 2KM1A 4IXWA 4LMRA 3JCZA 4NPCA 1GTJ1 2I78A 2F3RA 1I0LA 3DOIA 3ZE9A 1E5TA 2PSSA 2ZEJA 4L72A 1YI0A 1G38A 1XU4A 2XLCA 5BPFA 1THTA 2IE8A 4DRXA 2JCVA 3BE6A 5HUHA 1PQ4A 2B2XA 5CG1A 2ZVDA 1T8PA 1YZFA 2PA0A 1TTTA 2XUZA 1I2AA 3QXCA 3WOHA 4TV9A 4ZPXA 3FNIA 2EZ4A 3BK1A 1MHPA 1PGOA 2QTFA 2ZR8A 1N2SA 2V8OA 1NE7A 3ESXA 4P53A 5CAEB 3GMSA 3DTTA 1R5BA 1KYQA 3HCEA 1L3CA 2FZGA 1C9EA 3H87A 4AF8A 1BDIA 4DM7A 5JPDA 3V8PA 1W2GA 2DHQA 5C7LO 3LXUX 4BZWA 2VCYA 1FYVA 1DBSA 3WL8A 2RCNA 1QCCA 3LXRA 2ZVJA 2D4AA 2AOVA 4OYLA 2WJIA 4IHJB 5JNLA 1XVIA 3W2HA 1DQRA 4MKRA 4KDRA 4MDYA 4QREA 5FO1A 5I5EA 5FR2A 2CJXA 5JXGA 2W0MA 4B31A 3EPPA 4NHOA 3DE2X 1R6UA 3L4BA 1J8FA 4X54A 1YVPA 3WAKA 2TS1A 4R2HA 3CE6A 2XNJA 3L5OA 2XIJA 4OHUA 4P7JA 1BVUA 4EB6A 2D2IA 2XBLA 5KSOA 5L3VA 2HI0A 3Q6NA 5C8YF 5DGTA 2P4HX 2C5BA 2YW2A 1MO2A 4A4DA 1RRCA 1UP7A 4RVDA 3ESZA 2XITA 5KYWA 3QF4B 2JFVA 2N9UA 2FFAA 1GPBA 3S99A 4EJSB 5HXAA 1WXWA 2YJ6A 2GCIA 1DKRA 4FZRA 4B17A 4CG1A 2WZBA 3ZE2B 4GWLA 2GZSA 5L8VA 1OH6A 3L7OA 1JH9A 2ZYHA 3B5IA 2X86A 1YR3A 1GZ7A 1NPTO 3R5FA 3TOSA 2HEIA 4Z7QB 2XMBA 1K7YA 2JH8A 3LT1A 4N4AA 4PQGA 2REBA 1IAQA 2ID4A 4RLFA 1SKMA 4D9BA 3A04A 4H4CA 3GP8A 3V5NA 2A0WA 1P3Y1 3AKEA 4BMYA 3PKZA 4A92A 1OUMA 4K9KA 1N6RA 2H1IA 4I36A 4C0JA 2B1GA 1U31A 1GAQA 5CJ2A 6NULA 3E27A 3FNGA 2YYYA 2G6TA 1L7XA 4ND8B 1AGYA 5EJ4A 1ZD1A 2QTZA 1F2TA 3BF8A 3I9OA 3Q9NA 3SNKA 3UT5B 2DG2A 2WG2A 3W7VA 5G40A 1JHQA 2OILA 1QWSA 4EARA 4IOKA 3EK2A 5AW6A 3U44B 2PMCA 3G8CA 1O95C 2D5AA 1H0HA 2FQWA 2FKNA 5U4QA 4ABYA 1TAQA 2YYZA 2B99A 1FSFA 2OEPA 3OEED 3OHPA 4WHMA 4Q7QA 4OMFG 4WT7A 4A6XA 1PJ2A 3MZ0A 4X71A 3RNLA 5FADA 1VG9B 3M6WA 2VDNB 3IAM1 2WWRA 3HEMA 3NASA 2H2GA 4LZLA 4M9XA 3L93A 2C2OA 2MYTA 1HE1C 2P6UA 4QLAA 5J5AA 1JTFA 1TUBA 1E9BA 3WS7A 4C6TB 2IUSA 2PHZA 3AWIA 2ZIUB 3JQ6A 5DI3B 4G67A 1E2LA 1V95A 1XQ9A 2CB0A 5A5VA 3T8YA 2NO0A 5ADVA 4D02A 2OORC 3F6RA 1RM5A 1D4FA 2DPXA 2JGLA 1M0EA 4LYHA 3WLHA 4LKOA 3TJMA 5LL6P 2MSWA 1YJ8A 4DRXB 1BNCA 5EWJB 2XMQA 3ONNA 4TSRA 5IM4F 3MT0A 2O2HA 3K0SA 1QH0A 4R7ZA 2VUHB 3VNRA 4AXBA 2O7VA 3SQNA 5M7EA 3FVQA 2GPAA 2UU9B 1X1EA 3NC0C 4MVJP 4GC9A 5BSMA 4E4TA 2WTUA 1HTWA 1HFEL 1UZAA 2JJ8A 3Q1LA 4N8SA 4RK5A 2F7SA 2IEAA 3GCWA 3T7SA 4Z99A 3ADOA 4FLMA 3WFJA 4UM7A 2BF7A 4G23A 3AIIA 2RHGB 3C6YA 2ORYA 1J2TA 5DK6A 2Q1TA 2V4UA 4KLAA 4FNMA 4LW8A 4ZYTA 5H81A 1Y1RA 4UCXA 1T4GA 1KZ4A 3A6GA 5ICCA 4Z51A 4LXIA 1LQ2A 3TWOA 3ZZTA 1GOTA 2QUAA 3PFFA 3VI4B 6AT1A 5E7QA 1BROA 1O8BA 4LVOA 2D3WA 1U65A 3BXXA 1KEVA 4ZAVA 4L22A 4BECA 4ECAA 4ZZ1A 4OQLA 4UDYX 4B82A 2XYRA 1OBHA 1YZYA 2C5LA 2VDUE 4OBBA 2W6QA 4B76A 4X8MA 4E2YA 3L7CA 3LCCA 1W5SA 2FOIA 1HXHA 3G5UA 3E53A 4RPGA 4E1AA 1GKYA 2VPXA 4YJ2A 1U2ZA 3ANSA 3G2PA 4NCJA 1EP1B 1SXHA 4Q1CA 1P7PA 4BNLA 4BUZA 2RHHA 4P38A 4EB6B 1NMSA 1U8CB 2I34A 2REOA 3AETB 3GARA 1FRQA 4C05A 5FD8A 3BHIA 1W4AA 1ZMXA 1B0UA 1AHNA 1BEEA 2WHYA 4N5IX 5K45A 4A6DA 4Y6RA 4G0QA 3HCBA 3TLYA 1N3YA 2Y0EA 1Y5IA 1DIAA 1DKQA 1GQQA 3HSYA 3OQIA 3Q10A 4UXIA 3PPXA 4LF5B 2DT8A 1Y6ZA 4PZZA 2PKRA 4XARA 4TVSA 4BQFA 4BN5A 4B5KA 4G4GA 3KWLA 4H27A 2QYTA 1XZBA 5LA6F 1EZZA 3IJ5A 5C1DA 3B8EA 3HB9A 1C8VB 4BNUA 3TNJA 5H4HA 1E6WA 5ALWA 5TVKA 2PUDA 3SC3A 3O93A 1D0VA 2YYSA 3KZOA 2VI5A 2IWHA 3WK5A 4RA6A 3ZDEA 5DVZA 2R62A 3L4BC 3MMXA 3OFVA 1CQXA 2IDJA 2HSJA 2Q2WA 4FOOA 4XDZA 5DT2A 5FUYA 5BRNA 3OQNA 4EZEA 4FHEA 1SVLA 4BVBA 1KMIY 3ZTTA 4UAGA 4ND8A 1USWA 5EXPA 1ISSA 1L9XA 1FFWA 3DCIA 1L5KA 3W9SA 4EL0A 2IPAB 4E5MA 1R9NA 2XVZA 3G5MA 2MHCA 3HABA 3PDHA 4RCVA 4I4LA 3ZWNA 3ILXA 5KI6A 2QT1A 2Q5QA 4QOIA 4F4JA 3GNSA 1JIVA 1NYQA 2C7RA 3Q3JB 4DYDA 4A8JB 1NXVA 4TM8A 3ND9A 1G9TA 4FCCA 3IMGA 3H05A 2PT7A 4D5EA 4M0FA 2CVQA 4MUNA 1U11A 4Y1RA 4MS4A 1V8OA 2ZUTA 3TRFA 2A9JA 2QN9A 3ABRB 1JXAA 1Z6XA 2PXXA 4LI0A 3M1YA 4N49A 2NZXA 2IF0A 4WWHA 3C8HA 2IXGA 3O9ZA 5L6LB 1YJCA 2WM3A 2VDPB 3HJBA 2XKBA 2J6BA 3MWKA 4HBGA 1GCOA 2PRJA 3OT1A 3R6DA 3SR4A 3PXGA 3A4TA 3PQ6A 1DBWA 4AN4A 2AG6A 3PYLA 1R74A 1WX1A 2CNKA 3PFHA 1ODLA 4J0FA 3D5EA 2PLWA 2FR8C 1HE5A 1UC9A 4G41A 4QBTA 3JR7A 1CRZA 1JBKA 2QJFA 4QGFA 4Y0NA 4QG3A 1A97A 1ENZA 3Q0TA 5JIBA 4I5DA 1Z5GA 4RADA 3E4DA 1RHQA 4IDAA 1M0TA 4C7OA 4PX2A 3D9QX 2ZYSA 3L18A 4J7XA 3DVQX 3Q85A 3H75A 2O06A 3GGGA 3DV9A 4Z1MA 4KXFB 5JSKA 2AFIB 2GBCA 4RJ2A 4AROA 2CDBA 3WDSA 1NFRA 4CRWB 4TYYA 1S0UA 5KCMA 3AHGA 4GDFA 3ECAA 4UFNA 1WU8A 2JIMA 1ULAA 1MEOA 3KSAC 4XR4A 1PX2A 5EMHA 4A8JC 5D6NA 1WHSA 3IIMA 2ERXA 3DMYA 3GEBA 3M4XA 5CT5A 3Q3GE 4YYEA 3L7IA 3C15C 3QUQA 4DWWA 4N8EA 2IPMA 4EDFA 4XJSA 3K5WA 5J40A 4TVKA 4BUCA 3O38A 2ZDHA 3Q5DA 5K0SA 5JS7A 5EWLA 4D3XA 4NBNA 221PA 4MQ5A 4RGYA 2VA8A 3JATA 4FWIB 3ITNA 5FJIA 5C2JB 3TAHA 4L8YA 2G76A 3OIWA 4LDQA 1U7HA 4IIYA 1L8LA 4NEQA 3O3MB 4P22A 4DQVA 2ZETA 1T91A 5B7NA 1EE9A 3SDZA 4DUZB 2DECA 2XSZA 3SM9A 3KKZA 2JI8A 2Y9PB 4HEQA 1KH2A 2WKRA 3SE7A 2GESA 4GZ6A 2HA3A 2JFQA 2Z30A 3RC3A 1MQSA 2A58A 2FRXA 4JJKA 3CEAA 5HCUA 3H2HA 3KYCA 2C84A 2KPOA 4YTEA 2GDJA 1GUYA 1F0PA 1PR4A 5K03A 4MJ3A 2W2KB 1D6JA 3RNOA 4EHBA 1Z2EA 1A9OA 1DV2A 5THXA 3GRPA 4BFXA 1OHHD 4R8KA 5EC8A 5G0SA 4AT1A 2J0QA 4M7WA 3ROXA 4Q19A 1T0HB 1T13A 1DEAA 1VCMA 2FE1A 4EQ6B 3GELA 1F7UA 4DSUA 3QU4A 1TKBA 1HEIA 1CJMA 5C35A 1L4FA 1EFKA 3OA2A 4LCBA 5SV2A 1P18A 2R3SA 1NN3A 4FFBB 3UAYA 2CLKB 2Q3DA 1DRKA 4UM9D 5FF9A 4JT8A 5HFNA 3Q1KA 3WWZA 3NGMA 2HK6A 1DBIA 1FDRA 4YEDA 5JC8A 2B36A 3I05A 4BEJA 5IANA 5CFZA 3HWX1 5DM70 2HYIC 4ZZ3A 3A26A 2YBEA 3W05A 1SKYB 2OAQ1 3UIEA 3FFXA 4EA7A 1IUOA 2G08A 3B9RA 3LBFA 3OX4A 1NN5A 4BMVA 1JBQA 4C04A 1QGAA 3KFVA 4G0PA 3T54A 2RGEA 2QD3A 3DE0X 5B36A 2IHTA 4J94A 5M2QA 2O8EA 2IKSA 2RGYA 4KRGA 3ZE0B 1AV6A 1CY6A 4G3XA 4RAOA 2GBPA 2LCIA 4G01B 1PJAA 2BI8A 1JALA 1UJBA 2RBGA 1WMDA 3FB1A 4YRSA 3SYLA 5HF5A 3A3KA 4Z9AA 2FLVA 3GWGA 4KQ6A 1QCYA 2PSEA 1U1DA 3QE3A 3EBLA 4FFRA 5GP1A 2A9OA 1YDEA 2PDAA 4HYQA 1M33A 3IDQA 2PX5A 4RSMA 4EYKA 3Q7TA 1UR5A 4ES6A 2P5SA 3J7TA 4HDMB 5DO9A 3ZWQA 2Q50A 3RFVA 1TYAE 2WTMA 1A71A 1C81A 3FGOA 4BVHA 1OI4A 2QRKA 5C0OE 4QTYA 2Q6OA 3ZWCA 4DEXA 4JSYA 4C4ZA 4CTMA 3ZX5A 1ZVQA 5B2FA 3OZIA 4FX2A 1G291 1K2WA 3AC0A 5IDVA 3WSWA 1I01A 2GEVA 2VATA 1CJCA 1PK9A 2GHTA 2W93A 3MS2A 1HZZC 2F00A 4UU0A 3IIJA 5DSZA 5AVJA 1P61B 2JNWA 2V5VA 3ABIA 3EIXA 2K2WA 2QVZX 1Z37A 3NBAA 4C4YA 2I4LA 3W5BA 5J2UB 2GN0A 4ZVQA 1O94C 2EIXA 4WZAE 2BVNA 3N53A 1KQGA 1O2DA 1ISGA 1U02A 1G66A 1MC5A 2I5PO 3DB2A 3QA9A 1JLLB 1CJKC 1HKUA 1QNFA 4YMSA 2D1TA 4V0KA 2C9OA 4L2IB 1UKEA 1FDOA 5EWLB 3VV3A 4O4IB 1UPAA 2PH1A 2WG1A 1XFDA 3STXA 4TVOA 1KPIA 4G0WA 1W85B 4FHFA 2JIZD 1VE6A 3FI9A 1K7EB 2FUG6 4G0XA 4LRYA 4HEJA 1E1YA 4TWJA 4ARUA 4DA9A 4NXNB 821PA 4QYXA 3F97A 2CBXA 3TZKA 4O4LF 3CONA 4EG7A 5JQGA 4YC7A 1IK4A 1TA9A 4MGIR 4AMZA 3J81k 3A2MA 2QSYA 3IE0A 1YAHA 2DFPA 4HEHA 4BKMA 2HM7A 1HNWB 4JOCA 1K7CA 2W00A 4QM6A 3PLAE 2BFCA 4MZDA 4O3MA 2MMCA 3K2IA 1Y6RA 4FHZA 3AFIA 3WWDA 2IZOA 4W9NC 4Z4GA 3ZW8A 5BWOA 1YB4A 1OA0A 2VDQB 1IXKA 4GU5A 4IIGA 3AFGA 3GFBA 2JGKA 2WPDD 1B73A 4KQ9A 5HCNA 5H8WA 2O3SA 4M7OA 4EA8A 3I5UA 1UT5A 4Q3AA 3AGPA 2WKWA 3UB3A 3BB4A 1NDUA 1NWCA 2JK1A 3F9CA 3UAOA 1RBZA 4P34A 1R4ZA 3EH2A 4NS4A 1N7HA 1Y1SA 4RESA 5JRDS 1NZDA 2BEJA 3PC2A 4W5WA 4URYR 1U0SY 1GDHA 1DX4A 2QLTA 4KMSA 1C4OA 2KBEA 1I1OA 3EVNA 3K53A 1RXUA 4HNTA 1VFNA 4I0WB 1SQ5A 4DMRA 4X1YA 3DJFA 5BQOA 5JC1A 1ZGGA 1C9KA 1E1LA 1XTBA 2XUPA 3W4JA 1E9EA 1JHXA 3JYPA 2Y1GA 1WSDA 1WABA 3BL6A 3TKLA 4FR0A 4B0PA 1NW4A 1MHTA 1P3JA 3QKRA 3A1EA 2QX9A 3H8JA 3Q9SA 1YASA 3WLQA 3GJ7A 2C0PA 1S2MA 4OJYA 3VDNB 2H11A 5JALA 4GHWA 3TR6A 4JT4A 1SPXA 1ZMRA 1Y8QA 1Q17A 2F67A 3VR5H 1WPGA 2FWRA 1ICEA 1X39A 2QOEA 3HP1A 1SHTX 3OJEA 4JK3A 2E37A 3HB7A 2I1WA 2D2VA 2ZDQA 3IBTA 4KEAA 4DV7B 2MTBA 2QG9A 3IVAA 3MRSA 3F9IA 4P86A 4ZIRA 3GCDA 5HKKA 3P45A 3F67A 4MVJG 4JGIA 4RKYA 5K0JA 1N8TA 1ZICA 3ZXIA 2HF9A 1ZA2A 1XP8A 2HQ1A 1K89A 1YBAA 2FVXA 2JB9A 1GUDA 4X9XA 4D41A 3GPLA 3ANTA 5F51A 2DUUA 3O21A 4LOHA 2EJWA 2JIRA 5JZ9A 5T4EA 2H1OA 4IH9A 3UPTA 1GTZA 2JL1A 4NG5A 1ZI9A 4BB6A 4RLQA 4EPYA 2R0QC 2RFLA 2WJAA 2JGNA 1KK1A 2Q4TA 1E8MA 4LV6A 4NPHA 4HEA1 5AW2A 3PJRA 1E2BA 2PO5A 5K20A 4X6XA 2FPSA 1GU0A 3VI3B 4ZQHA 3K5PA 1LRJA 1XELA 2XA9A 3U7EB 2HDOA 3JVDA 3ZCVA 2UZ0A 4QUBA 4HVCA 3W77A 4DLSA 1T9CA 4S0ZA 5KU7A 1GLGA 1KBZA 2WYWA 4K88A 3KPUA 1O1YA 1HL3A 2GJKA 2Q4BA 4I46A 1USVA 4W6ZA 3K6RA 3U3KA 4UC0A 1GL9B 2HGSA 1QGZA 4FD2A 2WM8A 5FT9A 3L1JA 2X8JA 2JAOA 3DYIA 3L1IA 4MMXB 1ZOOA 4R05A 4TL9A 1J00A 2ZUSA 3WYCA 4X66B 4B3TB 2C9YA 3C5EA 1VG0B 2QVYX 1IQ0A 3DFFA 3EB9A 3ODGA 3QWAA 4MUAA 4IHQA 4MUIA 4WLNA 5J58A 1Z26A 1PG5A 4KGZA 4YQEA 2QI9C 2FAXA 4QQ8A 4D9KA 4M7RA 2BMAA 3LUAA 4L07A 4E6PA 4S24A 2A86A 4IJ5A 1J1ZA 4LHXA 4GUDA 3U80A 4CQNA 1WOMA 1H1TA 3HC7A 4PCVA 3V6MA 4UDOA 1AHPA 3DT8A 1HORA 1IG3A 3GMIA 2FTKE 5K0TA 4MLZA 1H2RS 4QHTA 5DXFA 1NU8A 2PZGA 5EINA 4ZOBA 1NUQA 3R7LA 4CIAA 4LBZA 4RKQA 1HFJA 3E7XA 3ADBA 2I99A 1M1YB 5ALPA 2X9LA 3TW8A 3D6AA 2HC9A 4BBPA 4WUTA 2A5JA 1DHTA 1NTOA 2G0AA 3AIOA 3RKUA 2OGUA 3R6GA 2D5CA 1V26A 1SCUA 2IU6A 3IDZA 3WGNA 1EZ4A 4L5BA 4BNWA 4YT8A 3TTUA 3FDXA 2HU8A 5EUMA 4UEJA 1TIKA 1GPYA 3FJYA 5AKZA 2SCUB 5EKTA 1V71A 3SYKA 1NVMB 2L0XA 4AK9A 6PFKA 3VKWA 4EPWA 2FEXA 2ZRQA 1QGUB 2HFKA 3E9NA 1RXIA 5KYVA 3DEJA 2YKGA 3IP8A 1DFGA 2DU8A 4X1YB 1P81A 4MUEA 1DJQA 2GRJA 1TZKA 1H6AA 2VNAA 4EATA 1NX9A 1B0ZA 2G1KA 2EBUA 2CUNA 3BXEA 4OOEA 2AB0A 5F2EA 4JVOA 3REGA 1CZOA 3QNWA 4DIOA 1W88B 1FRZA 1LTKA 2R2AA 3Q0IA 4MVWA 4E5YA 1WW2A 2IXDA 2J9RA 5CDTA 4TL7A 1Y8QB 2C07A 2C2BA 2YMPA 2ZSKA 5BWCA 4CI0B 1YVRA 1E9DA 2GK4A 4LYGA 1PYOA 5DRYA 3V00A 5BNFA 3K70D 1IEXA 1JR6A 1X8KA 3H11A 1TM5E 3JQBC 4ZA2A 4N5NA 4C4AA 2RJ3A 3H5WA 4DM3A 3OTWA 2NXWA 3M6IA 2D7JA 4KHZA 2XOXA 3SHVA 3AX6A 4QLBA 2D74A 3EVTA 4PZUA 4QPZA 3M6LA 3DMGA 1OXSC 4RTNA 1FDUA 4R1UA 3TTSA 5EHZA 3PSHA 3H6HA 1RCFA 1PWYE 2EZ9A 5JFTA 1Y3IA 3IT3A 1M0SA 4QBIA 1H2HA 1NQAO 4C2AA 1OFHA 2I4TA 2PZBA 3FYTA 3O0DA 4M6WB 3ZDXB 3SVLA 5GONF 4RVCA 2WYIA 1E2KA 1A69A 1OC2A 2HCJB 2XDQB 2APJA 4LN1A 3T06B 2XZLA 1DV1A 1K08A 1S9DA 4EMTA 5A2QA 1ZC3A 3IXLA 3GNTA 4YPVA 3QP9A 3IT2A 3ACDA 2PLRA 4RGVA 4ZQCB 5EJ6A 1Y4ZA 4WGGA 1CVIA 3IUPA 2WIJA 3L0OA 3OZWA 1Q3HA 1W75A 4I1OA 4B1FA 2ZRNA 1ZESA 5AVSA 3NBXX 5CHYA 2DKOA 4I2VA 4IOLA 4GPBA 5KOJB 4ARZA 2E2WA 3RPEA 1XE3A 3UMVA 5ENVA 2RKWA 4IW3B 3PFKA 2NUAB 1AB6A 1CKEA 4KB5A 1L6IA 3EXFB 5HQTA 3FRJA 3AY0A 2KBFA 3WWOA 4NH4A 2WFMA 4C2TA 2NSDA 4P6VF 5ALUA 1OTHA 4LJ9A 4YCNA 3VH3A 3DC7A 4QQFA 5EP2A 4E2ZA 2DHCA 4OTZA 1GGHA 3NS7A 5F4BA 2GAIA 1LDGA 1LUAA 1WDKA 4JXKA 5I9NA 2RKOA 2Q5LA 3M6VA 1BN6A 4DDUA 3FCXA 3DE4X 4JNKA 4Q82A 3WRWA 1ZIDA 3KSMA 3LVRE 2M1ZA 1VJ1A 4NEGA 4YUVA 4BY9E 3KOXA 3N70A 5FQNA 3WGIA 1C7QA 4HR7A 2QN8A 4D0RA 1G8KA 2GASA 3SK0A 2FW0A 5FL3A 4IFBA 1G18A 2WAXA 2ZIZA 9LDBA 1RXYA 5KU1A 1CTQA 1GG9A 1SVIA 1Q0HA 4E5NA 4KUGA 2VWQA 4NJEB 4Q4JB 3WGQA 4CF6A 3VYRB 3WJ7A 5KNDD 4U7PB 1WW8A 1NAIA 4DUPA 2H4WA 2QYSA 2ZLBA 4B3BA 1ORWA 3UJCA 4QRIA 1SHKA 2GYWA 1MD9A 1Q74A 2BGIA 1GCGA 1BS9A 2D5BA 3S2YA 3SC2A 1NBEA 3DBOB 5AVRA 2B34A 4TZ0A 3A3NA 3E9EA 2W6JA 4TZTA 4MUMA 5HJEA 2DSTA 5E95A 4B33A 3MMZA 2R87A 3A2NA 1P6XA 2PXCA 2R00A 3X2EA 4A8JA 2EGHA 2H17A 2AMLA 2BV3A 1L5OA 3I28A 4R2WA 3MCVA 1YUNA 5DHAA 3L8CA 4UUNA 3ST7A 3HJRA 3FUCA 4MS4B 4LSMA 2MYPA 2WZDA 3P9YA 5K3EA 1KS9A 4BMZA 1SVMA 3QVMA 2E4ZA 4OXQA 1E8DA 3L8DA 2A9KA 4PZ0A 2YCLA 4QGBA 3DDNA 2IIVA 1BIFA 1RHUA 3KZXA 3UAZA 3ID6C 3I30X 1WCIA 4K2HA 3ZY2A 4CMBA 3R3SA 1PTKA 4BMPB 4B4DA 1TCVA 3DDZX 5DNEA 5HF9A 1RAFA 3P27A 2EZUA 5PNTA 2YC4C 4B75A 2KE5A 3VNSA 4N54A 3DOJA 5BR1A 1XNRB 2HBQA 5DT9A 1QX4A 4LOAA 2JK0A 3B1JA 2JC3A 3W6OA 3ZIUA 10MHA 2FZLA 1BXRA 1PU2A 2WNSA 3ZI0A 5FTWA 3EGIA 3RS2A 3QE9Y 3H4VA 4JL6A 1SRQA 4NR0A 3LZCA 4G9GA 4ETIA 3CH6A 4DCGA 1UKAA 2GBFA 2WQZA 3KNZA 1J49A 1JXOA 2OENG 2DE0X 1LBQA 3A9TA 5F77A 5HEKA 3VR2A 4PHTA 4EEXA 1QH8B 2OQ2A 5L3RA 3ORRA 3PU6A 5JZBA 4YREA 1Q0ZA 2IKQA 1RSZA 2YH2A 3LXMA 2GTIA 3OFSA 1ZH6A 1ZQ9A 4LA4A 4RMHA 2WJHA 4J1QA 2VNIA 3KEOA 1KZ1A 1NL3A 1X9GA 1EE1A 2QN1A 3AB7A 3GGPA 2ZVPX 3I45A 3V80A 1YS4A 4NDNE 2WIBA 4PVCA 1YRLA 3VGPA 3ILSA 1UQTA 4RBNA 1XZJA 4TSKA 4Q03A 4DCPA 4BX3A 5GAJA 2GD6A 1UJ4A 1XT6A 4R41A 3SDSA 2ESRA 1OREA 1AQJA 3G0HA 4ZV9A 2ZYWX 2OBBA 1F3OA 3NYQA 5EPOA 2WTAA 3WK6A 3OZ7A 3DMDA 3S2EA 4OI2A 1PL8A 2BFFB 1KYTA 3VTAA 3EXFA 4U0KA 1PK8A 3VSEA 1NP3A 2YXPX 4WJLA 3CFYA 3ZX4A 3DXZA 4NL4H 3VU1A 1AMUA 3RU3A 2B78A 1LB1B 3F5SA 1H65A 2CYCA 4RELA 3LQ1A 3RYFA 1JEEA 1AZLA 1KOFA 1KFKB 2ZTUA 2VAXA 4ZCQA 4A8HA 5LQUA 2CNLA 4ZU3A 2I71A 3EWSA 2AQ8A 3COPA 2NZ2A 4FFOA 2RMKA 4OLJA 1AGPA 3C7DB 1GTSA 5CDSA 1NJ6A