2ECKA

Structure of phosphotransferase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ADENYLATE KINASE
publication title Crystal structure of ADP/AMP complex of Escherichia coli adenylate kinase.
pubmed doi rcsb
source organism Escherichia coli
total genus 71
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1996-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2eckA00
4D4JA 1E1RA 4IOKA 4JLMA 4HDOB 2IT1A 2KBFA 2ZUDA 3W34A 2WJYA 1XP8A 5EUQB 5J4YA 1TF7A 3PIRA 1L7VC 1U90A 4A0GA 3RLFA 2WIBA 2ZSDA 3LVQE 5HE8A 5TY0A 4MRPA 2K5UA 3RC3A 2ODBA 4OI4A 4C0AC 2OBNA 4LUCA 3IHLA 2YOFA 2PLRA 4Z1MD 1II0A 1YZTA 2AFHE 2WOJA 5J4HA 1Z2CA 2PMDA 1G8HA 5KPDA 3DOEA 2KE5A 4B76A 1XX6A 2Z83A 5CM8B 2WM9B 1BMFA 4JSTA 1LV7A 1G3QA 1O3YA 4DDVA 1IN4A 4IOMA 5JECA 1DARA 1KMHA 1R2QA 3K0CC 1IXSB 3KKOA 3QXSA 5IF9A 1MO6A 3A4MA 1W1WA 3SJCA 1QG4A 3EXAA 3O47A 1ODFA 2FZLA 1OFTA 2IXFA 3V4RA 2VHUA 3FE2A 2QENA 4K46A 4TL7A 2GA8A 3G5UA 5EP2A 3Q5DA 3EPJA 3DL0A 3CNLA 5E95A 3B2EA 2ZE7A 4Q1FA 4JLKA 4DLVA 3ND8A 1NN1A 3NVAA 3TR0A 3ASYA 4IDHA 1JEEA 4TMKA 4JBWA 2NO9A 5K8TA 2ZSAA 2G83A 1U8AA 1AA9A 1WE2A 1YJ5A 3P27A 1G4AE 3PG5A 4FMDF 4Z51A 1BIFA 1TQ6A 3K0FA 3PEVA 3ZVNA 1M7HA 3MFYA 5LBIA 4ASUA 5JJIA 3BH6A 2JLVA 4LYAA 4MKIA 5HTKA 1KAOA 4N0DA 3THOA 3O8RA 1P73A 4KYUA 1AGRA 3DM9B 1E9RA 2FSIA 2PL3A 2XB2A 2FSGA 1U94A 2GF9A 3A1SA 2DWPA 2HCBA 3EIQA 1GL9B 3VX4A 3K70C 4HZIA 3QSYA 2ZAOA 4LZZA 2BHRA 5CK4A 4DUGA 2ZI3A 4CEHA 5GJBA 3W5IA 1QF9A 3CX8A 4C0LA 2QL6A 1TX4B 2FJUA 2OV2A 4JSYA 2EFDB 3U3KA 5HKKD 3U7HB 2OBLA 3QEOA 3EZ7A 1R8SA 1F2TA 1L8QA 1Q1QA 2NIPA 1G41A 2QGNA 4D4MA 3B9PA 3SHWA 2ANCA 2BOVA 2OAQ1 2JJ8A 2W6ID 3NC0C 1NN0A 4C0KA 3TIFA 1KO8A 3U3RA 2RHDA 2PEZA 2IA5A 3ZD6A 2GEDA 4PR0A 2ZI9A 4S2EA 1Z0AA 2GBLC 4Q7MB 5FL7D 4CW7A 5EZ5A 3SBEA 1AS3A 1T0HB 3OIVA 3RS4A 4BEBA 1OB5A 2IUTA 2CCJA 2Z0MA 1XTJA 1YKSA 4Q4JB 5JEEA 4BECA 4DJTA 3R20A 3WHKA 1KNXA 5B64A 5SZIA 1G5RA 1JQLB 4LHZA 3GLGE 3WRXC 5G40A 4Q18A 2WPDD 1QRAA 1G19A 4G5SA 1W4BA 3H4MA 1VG9B 4OHXA 4XIGS 2ZXUA 5CB6A 3KDSE 1UEIA 4CDGA 2FEMA 4W9MC 2W00A 3TR5A 5FPYA 4LYJA 5BN5A 5FBLB 1GNRA 2ZM5A 3UPUA 5HPYB 1KY2A 4A2QA 2Y8EA 4HDCA 2QTVB 2XNSA 2KSQA 3ZH9B 1TU3A 5JZVA 3WNCA 4ABYA 3NBXX 4LV6A 4UXJA 1R6BX 2JJ2D 2FOLA 4LJ7A 3V4FA 2VF7A 2QE7A 4TL6A 5CJPA 4US2R 2L0XA 4LCBA 1W48A 1KSFX 3H84A 1E2JA 2R9VA 1H8HD 3IILA 4PPQA 5KPJA 4PO8A 2D2FA 3C8UA 3CH4B 2IK8A 4AYTA 4YDSA 1XPOA 1AQYA 2QRZA 3ADKA 4KFUA 4LJ5A 4QBFA 4U02A 4UJ5A 1YRBA 3DVLA 4U00A 3RC8A 4P4SA 1LW7A 3LQRA 1OFIA 3CW2A 3RANA 3VHXA 4RD2A 1ZVQA 1PVOA 1SULA 3PR1A 5EXTA 3ICQB 1BKDR 4IDNA 1NG1A 5AUNB 1OPXA 1QHNA 4BFZA 4PHTA 4ZPXA 2FFHA 1L2TA 1JXMA 4BZPA 4CEIB 2ZJZA 5DYGA 3ETLA 4FW9A 1UFQA 1LY1A 2RH5A 2H92A 4Q1EA 4MDEA 3K0CA 1LFDB 1NVVR 3AKEA 4LYHA 4DKXA 1KSHA 2VEDA 3EZ6A 1DO0A 2YOHA 2R6FA 2EVWX 3T35A 4UNNA 4YMTA 4MGKR 5AJXA 4BFWA 3GD7A 2VH5R 2A5JA 2YYZA 1F2UA 3OZXA 3Q72A 4LX0A 2G88A 1ZP6A 3NEYA 2D7CA 3MJRA 5C1BA 1XJQA 2GXAA 4HEJA 5AJZA 5EJEA 1Z07A 3A6PC 2C98A 2HF9A 2EFCB 4LJ6A 4F92B 4FMCB 4WXRA 5LD2B 3ZGXA 4PZLA 3AH8A 1V5WA 1E2QA 4JVNA 4LHYA 1G20E 1KK1A 3RRYA 1RRCA 1OXSC 2RGNC 3MLEA 2D74A 2GETA 1XD8A 1E79A 5FBRB 1QHXA 4UKDA 4TTQA 5GADl 3MWYW 4QRHA 2I4IA 2BMDA 4NYIQ 1S1CA 1AKYA 1R5OA 1JJVA 2ZRKA 1Z63A 1NN5A 4V0MA 1W49A 2Q21A 1R0YA 4JL5A 3C16C 5G41A 3TMKA 4M1WA 1SKYE 3IEUA 4OK5A 4IJMA 1Q1EA 1S3SA 1CLUA 4ZDWA 2JLUA 1JXOA 5AJVB 3QKRB 4M4SA 4B75A 3AVXA 2J0UB 4FD2A 1ZIPA 5JEDA 2CLCX 5KO2A 1FOEB 1NLZA 3LBNA 2GKSA 3PV0A 4WOPA 3B1YA 1U99A 1W0JD 4LJYA 2QTFA 4U5XA 4YDHB 3EW9A 3U2QA 3CUEF 1GZSA 2HXYA 1NVWQ 3HJNA 3B8HA 2BIFA 1G8YA 3BWDD 4A2WA 1KK2A 4LJ9A 2PT5A 2HJVA 1WB9A 1WXQA 5EP4A 2GBLA 4HB0A 2Z6VA 2IS6A 2NO7A 4WZAE 5EXXA 3MRSA 4Q9KA 3IEVA 1XMVA 1VHTA 5CLLA 2JJ1D 1K6MA 3HR7A 4OQLA 1Q44A 1KJZA 3K9GA 2ORIA 4ZV4A 4A92A 4PC1A 2IUUA 4HAYA 1XD2A 2CK3D 4JIMA 1COWA 4GI7A 5GVRA 3TAHA 2RMKA 2V6JA 2V1XA 4MA4A 1P61B 2XEXA 3B1XA 2J87A 4M1YA 2QEQA 4FMBB 2DY1A 1OH6A 4DLWA 1G1MA 4D6PA 3VKHA 1N6KA 4CZ2A 1LS6A 2IYVA 4M9ZA 1NSFA 3SOPA 3ZS9A 4AWXA 3T1TA 1ZRHA 1G7SA 3CF6R 5E7IA 1Z22A 4DLTA 2ZS7A 4EAQA 3SJBA 4UNQA 4JJZA 4JYBA 3DZ8A 4PX9A 4B48A 3H0KA 4GP6A 1M6NA 2A5YB 3DDCA 1Z3IX 2FPKA 4RFVA 2VP6A 3DMDA 4DEXA 4PSKA 3IIKA 3WYFA 4ERNA 4YMVA 3ZVLA 2OO7A 1Q21A 1HQCA 4E03A 5DN6D 2AXPA 5JMTA 2RHMA 4EPYA 5AUPB 2FSHA 3REGA 2QORA 3THXB 3F3YA 5EXPA 1G8PA 4B3FX 4DLXA 3P4YA 1TU4A 3PFIA 4R2IA 3ZIAD 2BCJQ 1IN6A 1UKZA 2V7QA 2GJAA 2XB4A 2ZUCA 2QQEA 3FKSA 5L3QB 2WJIA 3F8TA 4BLPA 3I72A 1AS2A 3HYTA 3ZZTA 3IHWA 4BFTA 3AVYA 2ZE8A 2P65A 5KHOC 5K8LA 4RZUA 4TSFA 4NHOA 2ZRDA 4DC9A 2DR3A 5FR2A 2ZREA 2ERYA 3GFOA 2IYUA 2CJWB 4MGIR 3UIEA 2ZJ2A 3CM0A 3NBYC 2YV5A 5TVKA 4URUR 4AK9A 4B2IA 4HI0E 4D81A 2P5SA 1OE0A 1XMIA 2ZIAA 5KU1A 2IYSA 2IC5A 3LX8A 2YWEA 4KO8A 2X8AA 1CR0A 2GXQA 3ONWA 5M04A 3AKDA 2XNDA 2RGNA 3CRQA 2KJQA 1GVNB 4C0SA 1EWRA 2OM2A 2QRNA 1DG1G 3H86A 2BBWA 4KHZA 1OFHA 1G3MA 2QROA 4G0NA 4ARZB 1ANKA 2PCJA 1IJEA 1YR7A 2YWGA 4NL4H 4H1VA 1N6PA 5DO9A 3NIBA 2D62A 3OIYA 1JR3D 3TSWA 3UANA 4PPFA 1Z6TA 5JS7A 1ZU4A 2GRJA 2IHYA 3TW4A 5L3SB 3TGPA 4KAXA 2GJKA 1GSIA 2QUZA 2FSFA 1Z6AA 2SHKA 2I1VB 2CBZA 2HV8A 4GOJA 4NU0A 2ASEA 2Q0HA 1VYVA 1X8LA 2HT6A 2PX0A 1JBKA 1NBMA 1W4AA 2IHBA 1IAQA 1Z06A 3CB4A 2QNRA 1DAEA 4POAA 5JRJA 1GKUB 5FUVA 3REFA 3RWOA 2HT1A 3VR4A 2JLWA 1YZGA 4XTCS 4NMMA 3LWNA 3KKMA 3EZ2A 1T0JB 4EQ6B 1HEIA 3CPHA 3FKQA 2WBLC 1LVGA 3GJ4A 2D4HA 1J2JA 5FPHA 4FN5A 1R5NA 2BJWA 2AHOA 3BORA 4D0NA 5CB8A 1ZM2A 3KQUA 1E9FA 4Q02A 4BE7B 1ZU5A 3ZYCA 3AEZA 3I3SR 4CT5A 4IOLA 3I73A 5FOUA 4MYHA 3OE7D 2VBCA 4RKFA 4DXAA 1F6BA 3PEYA 3VQTA 1RYFA 4E22A 5BN3A 1MH1A 2H18A 4OI2A 3QG1A 4Q5IA 4Z1MA 3TLXA 1M34E 2OBMA 5CLQA 1MOZA 3VKWA 3K70D 1UPTA 1Q12A 3WBJA 1SKYB 2ZS8A 3D3QA 4HSEA 1GITA 3DOFA 4QNMA 1ZUNB 3S1AB 1GRNA 1TQ2A 4QHTA 2VA8A 5B30A 2QSZA 1W36D 121PA 3AB3A 2VLIA 2C04A 4PC7A 2ZU0C 3E1SA 3TBKA 1F48A 2RGGA 2C77A 2E87A 3GLIA 5BW8A 3SI7A 4GL2A 4KVGA 3TVDA 2H57A 2OCBA 4RD3A 1JAIA 1X6VA 5JI2E 2CCKA 1TUIA 3C5HA 4IDOA 1JQJC 2FEOA 3M1IA 1MRSA 1DG3A 5FUWA 5EE3A 3GEIA 3EA0A 4KODA 2CCGA 1EX7A 4QHSA 3SYLA 4ZO4A 1OYWA 2OFWA 3U4QB 3FB4A 4OJKA 5KNDA 1Q20A 5LPNA 5TV2A 3R7WA 2C9OA 3HU1A 1Z0KA 4QJ4A 2IF0A 2QI9C 4N1AA 4OJQA 3SU8A 4B71A 1YZQA 2GCOB 5DHFA 4OHZA 2GILA 3P1JA 1DPFA 4O3MA 5AUQA 3RS3A 3TSOA 4V02A 3KTAB 1RKBA 3P26A 1XTIA 4TYQA 3TK1A 3T1QA 2X2EA 4TL9A 4DLRA 2BBSA 2O8FB 4GOXA 2ZTSA 1S0UA 2WWXA 4M21A 4A6PA 4B3XA 3FMOB 1CTQA 2R8RA 4TLBA 1DELA 3A58B 2OG2A 2FGKA 4GT1A 2OESA 4HUQA 5CITA 2JLZA 4JBXA 3K09C 4IRUB 3CRVA 1LF5A 3IKJA 5HKKA 1G7CA 1Z2AA 3EZFA 4L8GA 2PMKA 1HUQA 2F1IA 3QIAA 4FMCF 1GNQA 1CJUC 2YJTD 4B2LA 2PH1A 4GZMA 3LBIA 4B34A 4AURA 3AVTA 1KDTA 3JZMA 5B2ZA 2IXGA 1DAFA 2W6IA 5F9FA 3W8NA 5AK0A 4P32A 2WWGA 3PUYA 3NHAA 5DI3A 2XZLA 2KI5A 3A1WA 1E2PA 1R10A 4YMSA 2FMXA 2PJZA 3BK7A 5A5GA 5FL7A 1U8YA 2C2HA 2O0KA 1E9AA 3IPYA 4MUBA 4L15A 1IN5A 4HB2A 4ZDKA 1W46A 3SYNA 1IY0A 5KSOA 4FWIB 4BFSA 2NG1A 1ONBA 2J3EA 1J90A 2OFXA 3B1VA 4KYIB 4DWJA 5JFGA 3B13B 1OW3B 1F5NA 2RGAA 2W0MA 5AWFC 1VG1A 3IIJA 2MMCA 1KDRA 1W2HA 2WVJA 1WBDA 4GNKA 2BEKA 1EFRD 1PLJA 3PEWA 2JIZD 5HCNA 2VQSA 3GLFB 1G4UR 3F5FA 4I81A 1U0JA 4AI6A 4LC1A 4QBIA 4TMWA 2BKUA 3QF4B 4FCWA 2H7VA 3W5JA 2F3TA 3LA6A 1ZBDA 4I1VA 3SJAA 1T6NA 3HWSA 2JJ2A 5FBWB 3ADCA 4XSHA 4XVQA 1JNYA 1KO1A 4KBGA 1H8HA 2FF7A 1VPLA 3KKNA 3WYGA 1UJ2A 3RDPA 5JS8A 1E32A 5J5CA 4IVRA 2J5XA 2I1QA 3CIOA 3QKSB 3ICEA 2J7PD 5KDOA 3R9WA 4MYCA 1U0HC 2HYIC 4ITRC 4Q4AA 1E2MA 1N6LA 5JBQA 3EX7C 4A9AA 4KITB 1G6OA 4QG7A 5J47A 1N5LA 2AL7A 2Q3MA 3L2OB 4HZUB 4WW0A 2C96A 3KJHA 3TUZC 3LXRA 3GLHE 1OHHD 3JVUA 2XX3A 3QXCA 3OHMA 1DAHA 1R8QA 2HEIA 4ZKEA 1KZGB 1PJRA 3FWYA 3QPUA 3GJ7A 3CNOA 4L5BA 2PLFA 3RS5A 1D2EA 3ND9A 1XTSA 3W6PA 4PSAA 1FZQA 2QGZA 3CR7A 2O8DB 1NL3A 1XXHA 3VU9A 1QHHA 2VP0A 1RW4A 4LBVA 4BGDA 4D26A 2DPXA 4RFSA 1E2FA 1GNPA 3GLGA 5L3QA 3VR3A 1VYUA 1JAHA 3P20A 2EYUA 3THWA 1UBFA 2O5VA 3L8ZA 2ZRNA 1YU9A 4A0HA 1G9XA 1Z83A 2C99A 1L4UA 2B21A 2RKOA 2ZI4A 1CS4C 5FOSA 2W2XA 2XSZD 3RWMB 1JR6A 1VCOA 1G64A 2XAUA 2D06A 3MMPA 3GJ3A 4YONB 4DIEA 4TMTA 2W2VA 4D4LA 2FG5A 3I32A 4QGHA 3EC1A 3QKUA 2G6BA 1W7AA 1TNDA 2R6GA 1KYIA 1G8FA 2R44A 1P9WA 3NDPA 3D31A 1CR2A 1ETUA 1RYHA 2CL7X 2OXRA 2ZRLA 4YC7A 4BFVA 1FNMA 3X1WA 1YZNA 3BFKA 3QUSA 3GP8A 2YNMA 1T3HA 4DB4A 2IS1A 1NY6A 1XU4A 3K09A 1E94E 2QAGB 2DWQA 5IT5A 2IYLD 1Z0FA 2JGNA 1W0JA 4PC2A 1XPUA 1QBKC 3T12A 3M6AA 4DSUA 5CDFE 2E9SA 1Z0JA 3D7MA 4MKFA 3CBQA 1KO5A 4DCTA 1UAAA 3LVRE 4PPGA 1ZM9A 3C15C 1EFHA 3I92A 2G9NA 5L3SA 1Y63A 3QE0A 3VMFA 2W58A 1W5SA 2QP9X 4D4KA 2OE2A 4X8MA 1M1YE 2JJ1A 1NN3A 3T1VA 4XD7D 4BRWA 3L82B 1K5DA 4NH0A 5UKDA 2F43A 2CK3A 3KQHA 4BQSA 2R6CA 3B7GA 4M22A 4QHYA 2MSDB 3UWOA 2O52A 4ZDIA 5IHPA 2AD1A 3IQXA 1OXUA 1J8YF 3LDAA 2FZ4A 4EQ6A 2A5GA 3UATA 1KTVA 2IS2A 2WTUA 4A0FA 4NCIA 2QG6A 1E2IA 5FR1A 3OEED 4WAUA 1P2UA 4L9WA 3TUIC 4NYJQ 4BLSA 3Q7QA 1DBSA 4BUJA 2QMEA 2P2LA 2P67A 3UWKA 4NYIR 3WRYC 2ECKA 4EJSB 1S3GA 4B32A 1TMKA 1XEFA 1W36C 2F9LA 4Q1CA 3FFAA 3LV8A 4Q7KA 3ZQ6A 2JAQA 2ZI7A 3KXLA 4WZBE 1D9XA 1II9A 3PCRB 5E7JA 5BYKA 2BBTA 1AIPA 3BB1A 3QENA 1VDZA 2ZU6A 2A5DA 3A1TA 4XVRA 2HCJB 4F38A 2H16A 5DNYB 2O8BA 1X1SA 2A78A 3M0EA 5DN6A 5CYOA 2ZYUX 4ACAA 1T91A 3S1AA 1GFIA 2ZRGA 3AKCA 1EG7A 3L0OA 4Q9HA 1OIVA 2ATXA 3JZAA 1IJFA 3IO3A 4C30A 5IK2D 4C3ZA 1ZW6A 3PQCA 3ZIAA 2YOGA 4IEIA 3SS8A 1OB2A 2HDNB 2NZJA 3Q3JB 4GSYA 221PA 4AKGA 2IEYA 2WHXA 4KI0A 1UM8A 2FPLA 4TYNA 2O8CA 2AK2A 2GCNA 1J70A 3SDZA 4M1SA 2FFQA 1N6RA 4WXPA 2IW3A 2P5TB 4KCGA 1OYYA 2XXAB 4ZIRB 5E4FA 5C46F 1X86B 3U4QA 3RRZA 1Z8FA 4R9UC 4XVUA 2BMEA 4OQNA 1E99A 5D3MA 5DGXA 5SZJA 4O25A 2XGJA 2N1BA 3EA5A 2GCOA 1HT2E 3K0AB 1SVOA 4XH9B 3SN6A 3ZD7A 4QL3A 2VSOA 4I1OA 2VRWA 5C4MA 1E4VA 3BJIC 4ON9A 4KFTA 3KX2A 3NWJA 4WZ6A 3BXZA 4MGZR 1KAGA 1C1YA 4US1R 2O8FA 1PV4A 2ONKA 4URVR 1OV4A 4TLCA 2JLSA 3EG5A 3N2EA 4PHFA 1TEXA 4TMVA 1E9BA 3CX7A 2ZROA 5KYKA 1KDOA 2VHQA 2TMKA 3CZQA 1J8MF 2F3RA 4DHEA 3EC2A 1FP7A 1ZNYA 2QAGC 1JR3A 2WJJA 4QM7A 4KU4A 2NQ2C 4TYYA 1D8TA 3GLHB 2HLDD 4D0GA 1N5JA 421PA 3RS2A 1AJEA 3OF5A 4LBZA 4Q19A 4FCTA 1UEJA 5C4GB 3BB3A 1KI6A 4LK2A 2QN6A 1MRNA 3WYAA 4B44A 1AQUA 4QKQA 2ANBA 3B1ZA 5FTMA 1GL6A 4UQOA 5C2JB 2ZRPA 3B6EA 4NDZA 1BOFA 3LX5A 3KB2A 1XCGB 5J40A 3HPQA 3MGCA 2PX3A 3P4XA 1N2CE 3AVPA 3BBPA 2IF2A 1AKEA 4M9QA 3CPEA 1A5TA 2PZEA 2W2TA 1G17A 1SZPA 3IPXA 3VR6A 2NO0A 1DAMA 1XNJA 1G18A 2WV9A 2OFOA 3OE7A 3QXJA 1XB2A 1SVKA 1R0ZA 3QBVA 3L0SA 1XEXB 1XCMA 4QOSA 1BYIA 3NH6A 1Z47A 4V0LA 2HF8A 2ZITA 4OYHA 1Q3HA 2MSEB 4EJSC 3TQCA 4NYMR 4LJAA 1ZM4A 3FDIA 2B7BA 2Z4SA 1Q22A 2R65A 3QXHA 1ZIOA 2IYTA 1N5KA 3KJGA 4GFDA 1GTVA 1OJLA 1RJ9A 2V54A 4Q9IA 4II7A 1FPMA 1OH7A 3UMFA 4EFNA 4X8HA 5FTKA 3K0SA 4A8JB 4TLEA 5BN4A 1MABB 4HATA 3QKSA 4CEJB 1OF1A 3MCAA 4LHVA 1E3MA 3NKVA 4BZQA 4C0QC 5KDDA 4QC2A 2ZRMA 3OEHD 5J4VA 3AF2A 1DADA 2QBYB 1YE8A 2Q9BA 4HZUA 5KDLA 1HT1E 2D3WA 4A0RA 1DE0A 5FBVB 3TRFA 5FL3A 4JLBA 1E69A 4YXWD 2WJHA 2ZVQX 1QHIA 5JWHA 1ZNXA 1KNQA 2ZJOA 4Q4HA 3WMFA 5B57C 2BM0A 1TUEA 2EU8A 3L0PA 1C9KA 2PT7A 3Q5EA 2P0EA 3Q7PA 4KFRA 2ZYTX 3KFVA 3QI2A 4X8OA 1G16A 2O8DA 4NE2A 4TT3D 1T8TA 2FV8A 1ESMA 2NTYC 4C0JA 1E2KA 2EYQA 3GQBA 1ZD8A 1AS0A 5G3ZA 3G0HA 4QGFA 1D2NA 4GP7A 3ZZUA 4NKRA 4JVLA 2CHGA 5DSZA 1J99A 4HDQB 4FWTA 3AP1A 5JI3E 2W6JD 1UKEA 3LH5A 4JZKA 4X8LA 3RNLA 4W5WA 3B78A 1KI4A 3HU2A 4JLDA 3MWLA 1E2DA 1YZKA 3ZLJA 2BM1A 4QFMA 4NCNA 4QBHA 5AJYA 2ODWA 5AJWA 4IOJA 4A82A 5A4JA 1DVRA 2BKEA 4PXAA 4DEYA 1I4LD 3O8DA 4I4LA 2B7CA 2F1JA 1GKYA 2JATA 1K5GA 3CKLA 1OH5A 1C4OA 3U7GA 5DIFA 5GJVC 4EKDA 3R9IA 4C7OB 3D6TB 2CNWA 1KMQA 2DBYA 2B6HA 2GESA 5EUMA 1M2OB 4O2LA 1FX0B 3QVUA 3ZVRA 2WMNB 4S35A 1PLLA 2WJGA 1E1QD 1EWQA 2F1HA 3RSOA 2QAGA 4A1FA 1HYQA 1F3OA 1JEDA 4MQBA 3VX3A 2I3BA 1W47A 4JYCA 2AWNA 1DTSA 4HAZA 3W3AA 3AVVA 3BFXA 2NGRA 4LBYA 3TAUA 2IYYA 2GWHA 5LD2C 3K9LA 4N0EA 1XZPA 4PPNA 2XOKA 5GVSA 3AVUA 3GLFE 3I8XA 1EFRA 4B74A 2JIZA 1XTQA 5EXSA 4LI0A 5K8UA 2GF0A 2Q9CA 4DZZA 3AM1A 2CDNA 2GVZC 2X19A 1E6CA 4AKHA 1NI3A 2WIAA 1NKTA 3EPLA 1KHTA 2WAYA 2W83A 2VHTA 4NYMQ 4AKEA 4HUTA 4LPSA 4KJZA 1RC8A 1NMZA 4GMDA 3EWAA 2A3RA 4DLSA 2WICA 4EPXA 1EESA 2GK6A 3Q9LA 3QPVA 5JSZB 2QP4A 1DOAA 1NRJB 1CULC 3ZVMA 3IBYA 1G5TA 4NCKA 2J7PA 1TQDA 4V0ME 5JCZA 4F93B 4MUAA 4FXPA 1Z08A 1KJYA 4E07A 2YZ2A 4EJSA 1X8KA 2GK7A 2ONJA 3PXGA 4PQRA 2LKCA 5HR5A 1H8ED 3L0IB 4MRSA 4F4IA 1FFHA 1KMHB 2H8KA 1NIPA 3E5HA 4Q7JB 3U44B 1VHLA 3VR1A 1NF3A 4G3XA 3KJIA 5EE0A 1ZNWA 1OHHA 2XITA 4DT1B 1IQPA 4LOAA 4Q21A 4RKEA 1CR4A 4OHYA 5JLJA 2C03A 1NMYA 4DCVA 3LXXA 3QJYA 3U3MA 1M7GA 1BS1A 1FUUA 1TPZA 1Z5ZA 2GAAA 1YZUA 1QZXA 1CJKC 2J59A 1IM2A 5H68A 2ZPTX 2IEZA 4MRNA 4B33A 4Q4JA 3B60A 2GCPA 1XJCA 4ZDJA 2WWHA 2JLXA 2AXNA 3BC1A 2ZYWX 3IQWA 4W7SA 3DPUA 4UXIA 1I4TD 1NLYA 1VECA 1ZD9A 4CRWB 4V0NA 4GRAA 3K0FB 1NJGA 5B58C 3KXIA 3THYB 2ZI6A 2WSSD 2XSZA 4JVMA 3MJHA 1XCPA 3PEUA 4PANA 4CF7A 1E4YA 3WY9A 4XWAA 2XXAA 3SFZA 3X2SA 2E1RA 1YR6A 5FTLA 4KV9A 3FMFA 3K9HA 1NVUQ 2GZAA 2WKQA 3FHCB 1FTSA 1ZM7A 3UKDA 2JA1A 2GXSA 3TKLA 2WWYA 3K0AA 4W5HA 2WSMA 5DH9A 1GILA 2H17A 3LO5A 1QDEA 2REBA 3GCGA 3N70A 1A2KC 1E2EA 5FFMA 5BWMA 4M9XA 1SXJE 3SBDA 1U9IC 1GP2A 2R2AA 3KXKA 3OAAD 2A2ZA 2VYFA 3A8TA 3U6BA 1W0KD 2FFAA 1Z29A 1ZJ6A 4YMWA 4CEIA 2BBOA 1KO4A 1XPRA 2C5LA 1CU1A 3F0TA 4LPKA 2ERXA 3V9PA 2XTMA 1AZTA 2HXSA 1RZ3A 4FCVA 4HB4A 4OQXA 1PZNA 3R9XA 1KI8A 1MR3F 1IXZA 2G1JA 4XD7A 4URZR 3DM5A 4DCUA 3VR5A 1NNEA 3UG7A 4M53A 4R98A 4C4PA 3E70C 2C95A 2YWHA 3DHWC 3VKGA 3CR8A 1DO2A 1U81A 1FTNA 3B9QA 5GJWC 4V03A 1WBBA 1S96A 2BMJA 3SC3A 3UK6A 2H5EA 4PZZA 3UXMA 2Q9AA 4ZKDA 1E2GA 3T5GA 4QGAA 5E7MA 1TEVA 3OEEA 1WA5A 2A5FA 3IO5A 4OI1A 4XJXA 2B8WA 4Q4LA 2GJ9A 2RGBA 1NVXQ 4ZI2A 3C14C 2CXXA 2MMGA 1K8RA 1XEXA 3P32A 4C0BA 2V4ZA 2QMHA 1N0UA 4PO9A 2IX3A 5GJCA 3EARA 4TMZA 3CRRA 1UBEA 2Q3HA 1OXXK 4LHXA 1QHSA 1XEWY 2ZSEA 3A4NA 4NBSA 4ACBA 2DCUA 1D9ZA 3ZQJA 4D25A 2CNWD 2ZS9A 2NPIA 2PJRA 1T3SA 1T5IA 3PUWA 2OXCA 2ZRFA 3AQ4A 4NCHA 3QKRA 4AC9A 3WMEA 2J0UA 4URYR 2Q6TA 1Q1BA 2ZRAA 4BFXA 1SXJD 2J7KA 3V00A 4JVSB 3AVWA 3EPKA 2CVHA 5TXGA 5IK2A 1Q0UA 2IXEA 4RD1A 5EP1A 4D80A 2FH5B 5CDFA 5FOVA 5LB4A 3ZZ0A 5JCPA 2FFBA 4P31A 4CT4B 1NBME 2XOKD 2OLJA 3OESA 2ZEJA 4BLRA 1SVWA 4PZYA 4M0LA 4HAWA 2WWIA 3SYKA 1KI3A 2X1VA 4DLYA 2REOA 3H2YA 2BEJA 3HR8A 1BO6A 4BLQA 5ELXA 2W0SA 2ZE5A 1E2LA 2IYZA 4F91B 4E09A 1I2MA 2NMVA 5KNBA 4PFSA 1JI0A 4RY2A 3OIUA 1D2MA 1ESNA 4GZLA 2QSYA 1HE1C 2IBMA 3GJ6A 1WRBA 4P4UA 1IHUA 3X1DA 4Q7LA 2G0NA 5BXQC 2HYDA 5LB2A 3X1YA 5AUOB 4AYXA 4AG5A 4NYJR 3NC1C 1KKLA 5FOXA 2WAXA 4XWOA 4IVQA 2BC9A 1NP6A 3GEHA 2NO6A 1CJMA 3TJZA 1RRGA 3UMRA 4BLOA 2GEVA 2ORVA 1CIPA 3GJ5A 1QVAA 2VIIA 4JL8A 2WKRA 3BAFA 3CRW1 1LB1B 5SZKB 1P60A 4KXFB 4EDHA 1XTKA 4QXAA 4QNRA 3WP0A 6Q21A 2BMFA 1DS6A 2DFLA 3LBHA 3VNVA 1YQTA 2J9RA 2QY9A 3BS4A 3OFND 3WHLA 1GM5A 4IDPA 1UBGA 4QJ5A 2IUSA 3PITA 2HLDA 2GNOA 5JRZA 5EZ6B 2GZHA 1CRQA 1OIWA 2ZR9A 2G0TA 3GLIE 2P6RA 4R71A 3FOZA 1U9IA 4B2PA 4Q47A 4DRZA 1KKMA 3THXA 3W9YA 3J81k 4M1OA 3DKPA 3TUJC 2FGJA 1FX0A 4CGZA 1ZYUA 1ZMXA 1N0VC 3TQFA 4IFBA 3AKYA 4KVAA 1E9EA 3VHLB 5EE9A 1P2TA 3RRMA 4AD8A 1ZNZA 2RGCA 2O0JA 2YC4C 4U7DA 1W4RA 1XD2B 2JLRA 3LQQA 1XWIA 2V55B 2F6RA 2GJ8A 1A2BA 4EPRA 3NH9A 3W6NA 8OHMA 4P0TA 821PA 3CONA 5DHAA 2BCGY 4A15A 1OFUX 2AK3A 1SVSA 2CJWA 4LJ4A 3AP2A 4JMPA 1WF3A 4Q1DA 4OK3A 4P33A 4UNRA 4TYPA 4YLGA 3NBFA 2NZ8A 4BPBA 4DIDA 2BJVA 3WXMA 3WBKA 3EIEA 3WNDA 1EXMA 3GMTA 1FL9A 3AVQA 3K9NA 5P21A 1KSGA 4ZCIA 1IOZA 2IYXA 4HAVA 1FUKA 5TDHA 1R5BA 2OCAA 3T5DA 2V9PA 4B43A 4HLUC 4WVFA 5JSZA 1JB1A 2ZRCA 1SXJB 2XJ4A 4ARZA 4MITA 1N6HA 5HE9A 3VR2A 1RIFA 1NIJA 3C7KA 4HB3A 1XRJA 1SVMA 1E0KA 2JDID 3OEHA 4LHWA 4DSTA 2DFKB 4N3NA 1PLKA 3BE4A 1RRFA 1WDTA 4B6FA 4BEJA 3LLMA 4JLNA 1VG0B 1VIAA 4CYMA 3U44A 5TARA 3UMSA 4UNSA 2AR7A 4IW3B 2DYKA 4RD6A 2QMUA 3W6OA 4JL6A 4G5RA 4TMXA 4DT1A 4YXWA 5KOYA 3NHBA 2ODNA 3B85A 2WWWA 4RJLA 1KOFA 3I1FA 3K0EA 4LJ8A 3WNBA 1GWNA 1M8PA 2A7QA 2NOAA 2PCLA 2UKDA 2Z43A 3D8BA 4ZCMA 5FH9A 4G01B 5FPSA 1OKKD 2IYWA 1BYUA 3OIWA 1OH8A 5F2EA 5JHGB 4TT3A 4DLZA 1ELOA 3QNUA 4RZXA 2QPTA 1A4RA 1XZQA 1J7KA 1TQ4A 4E5UA 1R7RA 2YHSA 3RS0A 4LGMA 5L8VA 1H65A 2GHIA 2P6UA 4LY6A 1KI7A 3CLVA 3FPAA 3RAPR 3KUDA 4JBYA 1MO5A 4R7ZA 4P3YA 3THYA 2W6JA 4UXHA 1LF0A 3QY0A 1XJ0A 1ZINA 3H1TA 4MKHA 1TF2A 5JWRA 4C9BA 2ZAMA 3DO6A 1PUIA 5FUYA 1UDWA 2VPPA 2VL7A 4GPTA 2QP3A 4HYYA 4OKSA 1KDPA 1NJFA 1NMXA 2BV3A 2G3YA 4TN1A 1GDDA 1KJWA 1NG9A 2IL1A 2ZYVX 1TADA 4JT2A 2N42A 2J0SA 3AF3A 2J45A 3BRWD 3SJZA 1N0WA 1CXZA 4PTLA 5G53C 2G77B 1P9RA 1E2NA 4B3GA 4TQUS 4LWZA 1P9NA 4FI3C 2IYRA 1G7RA 1GL7A 4YMUA 4D2IA 3A1UA 3FHTA 1VTKA 1E1QA 3QOFA 2FU5C 4ILEA 4EPWA 1US8B 2ZETA 1KSJA 1B23P 4OHWA 3HDTA 3KZ1E 2ZRIA 5KSYA 1ZCBA 1II8B 2R6AA 3PENA 1P5ZB 3AVOA 3KQNA 1KIMA 3BH7A 1XXHE 2FE4A 3CF2A 3IDQA 1DAGA 3DMNA 1NSTA 5HZHA 4RD4A 2Q3FA 5AR1A 3FVQA 3U61B 1Z0DA 5G3YA 1AM4D 2RCNA 2UVQA 5A0FA 1Q3TA 1XD9A 1GAJA 4RZ2A 2OZEA 5ANRB 4DCNA 1GG2A 4CIDA 4BASA 5HZKA 4UNPA 2VP4A 4LC0A 1X8JA 4Y0AA 1SQ5A 2C9CA 1KK3A 1RVDA 4OQFA 1EGAA 4G5QA 3SQWA 5JJLA 4IHQA 3K1JA 1IXRC 4DB2A 3KTAA 1F60A 1HH4A 3HU3A 2AKYA 5H8WA 3GJ8A 3Q8XB 2R62A 3TVTA 2EWWA 1GRRA 2RGEA 3CH5A 5FI0B 4EFMA 5KTYA 721PA 4HLQB 1XF9A 4PAOA 4RZ3A 5KSPA 2VTKA 1EFTA 3B5JA 4K81B 2OCPA 5DI9A 4TYWA 3IGFA 4HLDA 4F4JA 4KSBA 3MSXA 1SXJC 1VCMA 1HY3A 1H8EA 1G6HA 1VG8A 2ODEA 2ZVPX 5HCIA 4PAQA 5H1YA 3LD9A 4PC6A 3L43A 2CE2X 4HLUA 4A36A 3R8CA 2F1RA 3N5CA 3EWSA 3GLIB 3MUFA 3QF7A 2QT0A 1G7TA 3BD9A 1U0LA 1T5LA 1Z6GA 1FW6A 1UF9A 4Z54A 4DBLC 2V3CC 3B1WA 2X77A 1IN7A 3FHOA 4B3BA 5JHHB 3O8BA 3GFPA 1WQ1R 3SR0A 2GZDA 1TAGA 3ADBA 2VP5A 2A9KA 3HYRA 4MDFA 1OLOA 4WIAA 1HV8A 2VSFA 2ZSFA 2BVNA 2RGDA 3R7WB 4JLAA 2V6IA 1DEKA 4Q9JA 4TZ0A 2VP9A 2YC2C 3HP1A 4NZYA 4ZCLA 4OBEA 1SVLA 4J0QA 1G5PA 3CRMA 2J1LA 3GLFA 2ZANA 3QBTA 2WSSA 1JPJA 4JKIA 3T06B 4BFYA 4MGYR 4EUNA 3QF4A 5DE3A 1KI2A 4OL0A 1E1RD 2RAPA 4AIIA 3BOSA 4EIWA 621PA 3RRNA 2PEYA 3C41J 4Q48A 3KB1A 2CL0X 1RE0A 4DDWA 2ZI5A 2QT1A 2V1UA 4URWR 2PZFA 2AD5A 4JKYA 4XWKA 1P62B 1Z6YA 4KBFA 4HUQB 2WJVA 4L4UA 4MYTA 4TZ6A 2FX3A 5CJ2A 3AUYA 1GOTA 5DISB 4JT4A 4URXR 3GJXC 4TTRA 1KI1A 3AGQA 1N6NA 3T1OA 1VIYA 1GIAA 4RSGA 1BMFD 3GJ0A 2DHRA 4AG6A 1MKYA 2ZRJA 3OAAA 3LFUA 5DI3B 1V43A 3G82C 4JJKA 1TTTA 1W0KA 2CLSA 4C2TA 2AWOA 1ZD1A 4R2HA 1G8GA 2VF8A 4PO1A 4IEEA 1EFCA 2PBRA 4LV5B 3SEAA 3AF0A 4P4TA 1DAIA 2XJ9A 4GMXA 3U7EB 2EFHB 3I5YA 2CHVA 5FI1B 2EWVA 5TB5A 5BYJA 1HQYE 2GDJA 2A30A 1E9CA 4M1TA 2GXUA 4I99A 3NG1A 3DZDA 1KZ7B 1R0WA 2G1KA 1O87A 1P2SA 3LRPA 4QGGA 1HE8B 2RGXA 2VO1A 4JLJA 4EPTA 4LDJA 2P6NA 3SNHA 1ZAKA 1G3RA 3RABA 3NEJA 2D7DA 2OCYC 5CM9C 1YZLA 1S9HA 2ZJ8A 2D2EA 4PQYA 1W2GA 3EZ9A 3SHFA 3M4YA 2B8TA 3AF4A 3K53A 4IFEA 2LCFA 5CIWA 4IDQA 3IBGA 3VFDA 4MRRA 2CE7A 4ASUD 3LLUA 4PQFA 1CEEA 2CL6X 3TSZA 2GAOA 3RSLA 1YHNA 4Q9LA 2JEOA 3QVVA 2O8EB 3K8YA 2EQBA 3AUXA 1G21E 3U3OA 2X2FA 3RS7A 2Z5FA 4TL8A 4UJ3A 3W8RA 2OUKA 2JASA 2HJGA 4M8NE 4XTRA 1P7CA 1TL7C 4DUGD 4Q4AB 3KKPA 2EW1A 3U3JA 4LV8B 3L8YA 2QAJA 3X1ZA 1HTWA 3DEFA 4PC3A 5H70A 1T8UA 2EFEB 1E9SA 1FP6A 1WP9A 2AFIE 1RRPA 2AX4A 2QPAA 1VCNA 1JR3E 2NO1A 3KJEA 2QQ0A 1SXJA 3CWQA 1JECA 4I1SA 4PHGA 3X1XA 4WBSA 2YINC 5TMPA 1U98A 2QMOA 2AN9A 2IS4A 1HA3A 1QG2A 2IYQA 4US0R 3QG5A 4W5JA 2KB0A 4TQAA 1YVDA 3CO5A 3I4LA 2IWRA 1NVVQ 3TE6A 4L16A 4D0LB 3AP3A 3C5CA 1Z6XA 2KWIA 3FFBA 4KLNA 2ZJYA 1N6OA 1XXHB 5J4KA 4H1UA 4O2RA 3VU9B 1QHHB 5C18A 1QHGA 2OHFA 1XEWX 1SVIA 4RFSB 5EE5B 3AF1A 3BB4A 3BH0A 1ZCAA 2OILA 5SZHB 3GLGB 1NLFA 2P3SA 3THWB 3IIMA 4Q66C 4NPHA 4OI0A 5EQTA 1TF5A 3I61A 3U7FB 4BRUA 3CF0A 3NTUA 1MO4A 3NBZC 3FYHA 4AKIA 3SFVA 2F9MA 3BGWA 4KLZA 2GJSA 2ZJAA 5CIQA 2KBEA 3T15A 4MYUA 2RB4A 3ECCA 1P72A 3KQKA 1EK0A 4ZI3A 1AK2A 2QE7D 1G3IA 3W90A 4A8JC 3MG9A 4Q1AA 3ADDA 1QHYA 1CRPA 2ZQ5A 2ZJBA 1AGPA 1ZM3A 3PUXA 4C2UA 4Z8YA 3B82A 2OSBA 2WMOB 2CVFA 3OFNA 4KFSA 1W4CA 1M74A 1NY5A 3MD0A 2YVUA 2OLKA 4Q01A 1IBRA 1SHZA 1ZUHA 4FMDB 4H9GA 2ZRHA 5CYPA 3EASA 3ZJYA 5FTJA 2ZUBA 1G3UA 4Q00A 1IY1A 2GEUA 1T4GA 1VYTA 3VNUA 4AYWA 2JLQA 2XZOA 2MSCB 1MV5A 3VAAA 2F55A 1T3LA 2J46A 3NDBB 2XTNA 1US8A 4RCZA 2B92A 4JLPA 5EE1A 1UADA 3WMGA 2CEAA 3QQ5A 3RYTC 4A4DA 1VMAA 1SGWA 1CP2A 1T9HA 1CJVC 2VHCA 3RVBA 1II8A 3CWZA 4M1MA 4EFLA 3SZRA 2F43B 2WKPA 4HAXA 4Q1BA 4D82A 1JALA 2WZQA 4DDTA 3T34A 1P3JA 3U60B 2LWIA 2VSXA 4DCSA 2FDCA 5L3RA 1XFAA 3E2IA 4ZIRA 1E98A 1FMLA 2FN4A 2BWJA 2O0HA 4NTZA 2FNAA 1A1VA 2FA9A 2NPFA 1W44A 4G1UC 1ZUIA 2QM8A 3A4LA 3O8CA 3KKQA 5F9HA 4XOIA 1IY2A 1XTRA 1CJTC 5K8IA 4NONA 1GUAA 4CEHB 5F98A 4OQMA 1E79D 1SHKA 5BQ5A 3LY5A 2CMKA 1UKYA 4DSNA 4PSVA 4TQ9A 4QM6A 2QU8A 2ATVA 5FPTA 2J41A 3TH5A 1P6XA 1G291 1XMSA 3FMIA 1F2TB 2DFTA 5FPKA 5KNCA 2YWFA 3UG6A 1R4AA 3AGPA 1U8ZA 1ZC3A 1AN0A 2OT3B 2N46A 1RFLA 4ESVA 3TW8B 1OIXA 2ZJ5A 4M1KA 3QKTA 2O8BB 2ZRBA 3A37A 2DB3A 1B0UA 521PA 4B3CA 3GPLA 4B35A 1KGDA 1PUJA 2WOOA 2DWOA 2JDIA 5JWOA 3R8FA 4CVNA 3QEJA 3GLHA 4TLAA 2OEPA 1EX6A 3C4JA 2PZGA 4F7WA 3T61A 1CBUA 1I2DA 1JPNA 1X1RA 3A36A 1UKVY 1IN8A 5J4LA 5FOWA 1JJ7A 1P2VA 4LRWA 1XBTA 5EP3A 2FPMA 1S8FA 3SQXA 3FTQA 1Z28A 4RVCA 1LS1A 5FUXA 3EPHA 2QM7A 3QXXA 3W3ZB 2UZ3A 1MT0A 2O8CB 2CLDX 4DSOA 2EFGA 1N6IA 3NXSA 3LAWA 1KO7A 4JLOA 1OKKA 3Q85A 4GOKA 4IKEA 5D3QA 4XSGA 2ORWA 1N3BA 4BWYA 4A6XA 1HURA 2ZSBA 1NKSA 1W5TA 2REXB 4Y0VA 1E9DA 3CNNA 1COWD 5D3MB 1UBCA 2UZIR 4TLDA 3PUVA 2J0VA 5FBQB 1EFUA 1D6JA 1VKJA 1P4SA 1A7JA 4B3DA 1CF4A 5KUTA 3U5ZB 4BZXA 4IXMA 1E0SA 4TTPA 4RD0A 4B47A 2GTPA 1Q1ZA 1XMJA 4L9SA 5JJKA 5LDDC 2XTZA 4DVGA 3PUZA 4P4SB 3LW8A 4PAMA 1E96A 3JVVA 2LKDA 1S2MA 3GEEA 1N25A 1OXTA 5IDVA 1GRQA 1YR9A 2C78A 2ZE6A 3TNFA 1E0JA 3BERA 4G5GA 1XDBA 4GBMA 4I1UA 1N5IA 4K8OA 2VP2A 3KFXA 1QVRA 2BDTA 2WWFA 3CZPA 2HUPA 3N2IA 4A2PA 4WA7A 4A8JA 4BLTA 4F4CA 1MABA 3KQLA 4CEJA 2OAP1 1S4QA 1OT3A 3MWKA 4JLVA 3ZDQA 5E3HA 4DDUA 1KI6B 3RHFA 2QBYA 3ASZA 1WCV1 3I62A 1D5CA 1F2UB 4FIDA 1Z0IA 3SE0A 1OXVA 4HLCA 1E0AA 4GDFA 3LW7A 4AY2A 3DKVA 3EIHA 3A1VA 1FQKA 1I4DD 2ZR7A 4PHHA 1ZC4A 1BH2A 2FWRA 2V7QD 3IUYA 4YQFA 3FKSD 4NCJA 3PVSA 1AZSC 5CK5A 4G5OA 1Q57A 5FOTA 4KSCA 4B6EA 3KL4A 2WPDA 2GVDC 4QBGB 1U2RA 2C9YA 4LBWA 4O0MA 5FTNA 4Q03A 1X3SA 4TSFD 4TWZA 4QJ3A 5DLQC 2DFNA 4IVPA 5KSZA 3FGNA 3PJRA 3VTKA 2QTHA 3I5XA 1KI9A 2J0QA 3KUCA 1FNNA 2AKAB 1L4YA 5L3VA 3AV0B 3QPWA 4DLUA 3WP1B 2ZR0A 4IXNA 3K70B 3CPJB 5DYIA 2XNDD 4NP6A 1IONA 4C0HA 2O8EA 3I8SA 1RJ9B 3MAAC 4RCYA 1KY3A 3CX6A 3HPRA 1S1MA 2VHJA 4BFUA 2JLYA 1W36B 1S9DA 1P75A 4LYFA 4HAUA 4Z8XA 4OK6A 1M7BA 1LNZA 4C7OA 2JCSA 1YR8A 3U6KA 4ESHA 3BIFA 2QA5A 1FQJA 1E2HA 1YRAA 1GKIA 1RPZA 2Z4RA 4JS0A 3FMPB 4OHVA 4V0KA 1MO3A 4MH0R 4MRVA 1LTQA 2C8VA 4V0OA 4FINA 4M2LA 2IWHA 1CKEA 4EPVA 1A82A 1VCIA 3GFTA 3MWJA 2V8OA 2H1LA 2R6DA 1KK0A 2QZ4A 1NBMD 3LNCA 4M9SA 4Q4HB 1FMJA 2YKGA 3ZS8A 1WMSA 1UDXA 2CHQA 1Y3AA 2QPOA 5IRCD 1CR1A 5F3WB 3BFVA 1R0XA 4B73A 4MKGA 4LSGA 1SKQA 2F7SA 2XZPA 1OSNA 1DAKA 3EAQA
chains in the Genus database with same CATH superfamily
4UZEA 2B35A 1MIHA 4BVAA 4CKEA 1ZSYA 2WYOA 4JCOA 4WLUA 3GRVA 3KPJA 2UVDA 3AM4A 4FOSA 3SWWA 1SKMA 4WD3A 1TF7A 3PIRA 4F0JA 4YJHB 1VJ5A 2WM3A 4FKBA 1SU4A 4GKVA 3RLFA 1E6WA 2WIBA 5I7VA 4P3KA 2IBSA 1OTXA 2VDLB 4QE3A 2EJTA 5JAUA 4LUCA 3H6HA 3SBOA 2PLRA 3A6FA 2XCLA 3WAKA 4C07A 1YZTA 3ICCA 5A6VA 2I4OA 2WOJA 5I9NA 5J4HA 1Z2CA 1G8HA 3UVEA 2PXAA 1U3VA 1U11A 3I0ZA 2PNJA 3KEQA 4JOQA 2KE5A 4LZAA 4ENQA 2A3NA 2HMYB 4WNAA 1KIFA 3GRPA 1XX6A 4OB8A 1MJNA 3GFBA 5BQOA 3VVLA 4MMZB 3OICA 1N5RA 3A9RA 4MVJM 3IT0A 1LV7A 4YDQA 5E6RA 3I09A 4NENA 3MBKA 3RU3A 2Z5VA 2FVYA 4IAOA 2GD6A 1GGFA 3K05A 3WLHA 4AJEA 3EXAA 1QCCA 1NMSA 3TRJA 1B16A 3V4RA 1AO3A 2VJKA 5BR4A 1T0PA 2XEDA 3FWHA 5ICGA 3I5MA 1SQ6A 2WFLA 3PYMA 5EP2A 3EDCA 4TVOA 3PPVA 3T3HA 3DL0A 3KBOA 5E95A 3TQRA 1LBSA 3U37A 2ZE7A 2HA3A 4H17A 4JLKA 4Q1FA 1TCAA 2BFCB 1ZEJA 3HXPA 5I7AA 4AUEA 5ER9A 3EXG1 4WQMA 4BMCA 3QJ5A 2NO9A 1HE3A 2EXXA 5L53A 1OROA 4YCDA 2G83A 1U8AA 5KQLA 4HDKA 1YJ5A 3ZVNA 1XMPA 1Z5NA 3QU2A 2XE4A 2JAWA 3R09A 4HN9A 3WKAA 2P3QA 3MFYA 3PKIA 4L7VA 4LTNA 5ALNA 5HFNA 3B89A 1GQ2A 5LBIA 5LFAA 4MKIA 5THKA 1ZVJA 2XDQB 3IMCA 3QZUA 4IJ5A 5FQNA 4KYUA 4PFKA 5ALJA 1AGRA 2WYVA 4NU5A 3DM9B 3ESXA 2CY0A 4RLSA 1UQRA 5TRTA 2FSGA 3A1SA 1NATA 1PWXA 3F2IA 2DWPA 3C6QA 1EVIA 4JFAA 1QH8A 1IXKA 2Z98A 2ZAIA 4DUGA 2ZI3A 4L4ZA 5GJBA 4OMUA 1ND5A 3CX8A 2QL6A 4D3ZA 2EFDB 5HKKD 3WNQA 5K4AA 1JFLA 1U3TA 2GOYA 1R9JA 3SSNA 3COJA 2OCDA 1XRQA 3EZ7A 1LK7A 1L8QA 4XR4A 5YASA 4TVBA 1QZ3A 2JNWA 2C5SA 5E9QA 2AMFA 5C1OA 2G08A 2ANCA 3SM9A 1FRVA 2OAQ1 2QVLA 3TIXB 3IMEA 4DHWA 2Y76A 2W6ID 3DXXA 3ZD6A 5GZ3A 1BWSA 2FSSA 5L51A 1T3ZA 1Z0AA 3LYHA 4G5XA 5FL7D 3S7TA 3DAYA 4CW7A 1MB0A 5EZ5A 2GN2A 4G1BA 2FPGB 5FF9A 3SBEA 1MG0A 1LU9A 3ZGOA 1AS3A 2I22A 3FYUC 4MCIA 4NLLA 3RS4A 4ZT5A 4NJEB 4LFCB 4BEBA 5IUNC 4MO2A 2Z0MA 5KNDH 2WZCA 2JD1A 1IOVA 3KVYA 4MX8A 1U28C 4UM9D 5E0KB 1ILWA 4BECA 3R20A 1FRFS 1KNXA 2AC7A 3O0DA 3DTVD 3NU1A 3TDMA 1A8UA 5GGYA 4KOEC 1FMCA 4DE5A 1U9JA 3BKWA 4IHKA 3DLIA 5BWNA 1QRAA 1YO6A 3SEZA 1DO8A 1ECGA 4M1QA 3L8HA 1O08A 1RJEA 3KDSE 1UEIA 3C0KA 4N3GA 1MTZA 3AERA 4IG9A 4BJ3A 2PVCA 4JDPA 3AHHA 2PMEA 1UKBA 3WGNA 4P92A 5K6TA 1VHQA 4R84A 1H23A 5HPYB 5LNK6 2Y8EA 2QTVB 3JAWB 2Y9MB 4CM8A 3DDWA 2XXBA 3ZH9B 1KZ1A 1C7RA 3I2HA 3VHRA 3H9UA 3NTQA 3TLAA 1UPFA 4ABYA 4LAFA 2X0EA 3NBXX 4LV6A 4U2FA 5A3SA 3VPBA 2QE7A 1C0KA 3HB0A 1SG0A 1HNXB 1HLFA 1KSFX 1CQXA 1S7GA 2DC1A 1Z82A 2O3TA 4J2OA 3QQPA 5KJEA 4KOAA 2II6A 4PO8A 4B81A 3PFGA 1TOAA 3CH4B 5K6AC 3CO0S 4QBFA 1G21A 2E1PA 2UVPB 2BFMA 3ELYA 4FHGA 3U56A 1ZLXA 3GJRA 4FONA 4YT5A 3RC8A 2W6PA 3BA6A 1P1FA 3DMTC 5BQ3A 3CW2A 3H0EA 3TDNA 3Q40A 4FYHA 1J56A 5EXTA 1BKDR 3HVRA 3BEOA 5KIAA 1B3RA 1HMPA 1NG1A 1LGYA 2Y0BA 1OPXA 4HDMB 1I7NA 1L2TA 2X6TA 4CEIB 2D4AA 1K88A 3GDOA 2Q7XA 3NNSA 3RD5A 5DYGA 2XE8A 2O2DA 2V6BA 1HBJA 2H4ZA 5K8JB 2RH5A 4MDEA 4LYHA 1L1FA 2AOTB 3S5JA 1KSHA 2QN1A 4DKXA 1OZHA 2ZGVA 4AECA 3ZNPA 1JTFA 3EZ6A 3NO4A 1ZKMA 2AMYA 3QVSA 3E4DA 5COQA 4CCYB 1I3CA 2NZ2A 3QPDA 4PNHA 1IBMB 5AJXA 3D2AA 5EKUA 1RXSA 4LX0A 2VH5R 2A5JA 2YYZA 3BCRA 3HVKA 3Q72A 4GE0A 4C6TB 3HE3A 2M6RA 4KLRA 2EF1A 3MJRA 4OY3A 1L5NA 1EMDA 2PGLA 3LUAA 5AJZA 5A05A 3F6RA 1ZVKA 3IXLA 1UWKA 1A9SA 4MQLA 1SUWA 3ICVA 3JQ9C 4F92B 5J43A 1U9ZA 1Q0PA 3EXIB 1YGYA 4KDEA 1YNOA 3G2KA 4WXRA 2WE7A 3AH8A 5H3LA 1V5WA 4YALA 3ZGXA 1GNSA 1XWWA 3V32A 2E49A 4MCAA 1IMOA 4LHYA 4UMFA 3QMPA 1G20E 2CZGA 5KVSA 4F5EA 1OXSC 3EGIA 4MUGA 3BXFA 3D5QA 2Y67A 3GNLA 4GUDA 3U4CA 1CJSA 1E79A 2WF9A 5CVDA 4A23A 1ACMA 2HEGA 2I54A 3OQ6A 4AS3A 5GADl 2O4CA 2YCBA 5AMXA 2P1RA 3OQIA 1AQ6A 4NYIQ 1JJVA 2SKEA 3IERA 2ZRKA 1SIBE 4P5PA 3O90A 3C3AA 3E5NA 2A57A 1R0YA 2XVAA 3MYYA 3OF2A 4JL5A 4TRJA 5EFOA 5GONB 3ZHBA 1SIUA 4M1WA 3CWCA 4LGCA 4C5AA 3PTZA 4OK5A 3C1UA 3F4LA 4Z9AA 5KOJB 4DJEC 4YO8A 1Z7BA 1S3SA 1CLUA 4ZDWA 4LOJA 3RHTA 2JLUA 1HSZA 4MV9A 1ADCA 4JP8A 2WVAA 2XRMA 2ZBUA 4B75A 3AVXA 1FXSA 1NV9A 2BGKA 3OJ0A 3ZZMA 3KWMA 3HMQA 3RE1A 1FFSA 1FOEB 2E55A 3BBLA 1LZLA 2P2ZA 2GKSA 3GPDG 3PGLA 4RVFA 5JO9A 3B1YA 3VPXA 1Q77A 5LBUA 1JS1X 2O2IA 2H1IA 1U7HA 2FRDC 2C42A 3L84A 2DSTA 4UATA 4JI3B 1GZSA 2IZ5A 3K8OE 1KP3A 3TOXA 1N2BA 1GPNA 4XX1A 3BWDD 1AN9A 2VPIA 4LZJA 1KK2A 4Q15A 2PT5A 1WB9A 1SUEA 1SXGA 1XLTC 3HYLA 4HL6A 5EP4A 4B3JA 3V8MA 3R3XA 2Z6VA 2IS6A 2OPBA 3KG2A 2YL2A 1VHTA 4DREA 5EMKA 3KKEA 4FLMA 3FYUA 1P4AA 4HDSA 2H2GA 4IDAA 4TWIA 3HSSA 4ZGBA 4R05A 1K7SN 4KWEA 4EI9A 4O4IF 2ALJA 1UC4B 3D3WB 4PC1A 4HAYA 1XD2A 1COWA 3T5BA 1OU0A 5CW2A 1MN6A 3TAHA 4XVCA 2V6JA 1NBIA 3N8DA 3IXMA 1X8XA 4MA4A 3B1XA 1EFVB 1GY8A 2OV3A 2XEXA 3DSRA 5A5FA 3AR5A 2YIMA 4M1YA 1C7IA 1CEXA 1NRWA 2QEQA 3TF5A 1G1MA 3OOEA 2BFAA 2JFFA 1KSGA 3DXYA 1F0PA 3UAOA 4D6PA 5AVVA 3I9FA 3PF9A 3VKHA 2LCIA 2Y05A 3LL7A 1O4WA 4CZ2A 5LQRA 2A1IA 3GCZA 3SQNA 1NSFA 4JXJA 1Z2OX 4YJHA 5E1BA 4XAQA 2O3UA 5KEIA 2QR3A 1ZRHA 2Q0XA 2VPQA 4YO7A 1MAWA 1SUBA 4ZI7A 3CIFA 2QIPA 4OPMA 1XFDA 5TQ2B 4JJZA 4JYBA 4CJXA 1OX4B 2E82A 1CQJB 5EY5B 3SAJA 4UMDA 3DHNA 1PHRA 3MJFA 3DMDA 1ZJ5A 2VRBA 1KY4A 1PQWA 3OZRA 4NPCA 3IIKA 4U0JA 3RVSA 3WDMA 4DJFC 2PH7A 5K6AA 2H52A 2CWWA 3V2UA 1OLSB 3CR3C 4CM1A 2XVYA 4E03A 4EKEA 3NYWA 2RHMA 4EPYA 1NNI1 2FSHA 3DMTA 3WK9A 5AUPB 4JQSA 3THXB 2YYAA 1JF8A 1TKCA 2FMTA 4DLXA 4K8RB 5I47A 5EMNA 4URHA 3PFIA 2VJMB 4R2IA 5AVZA 3KKLA 1WW8A 3OPYA 3OJEA 4B6QA 1UKZA 4E12A 4FR0A 3TNDA 3H42B 3GXBA 3IOEA 3O4FA 4HCJA 3WDKA 5JTTA 2BF4A 4JCCA 2WJIA 4FK8A 1AS2A 3DL2A 3HYTA 3TFOA 1Q0HA 3BK2A 3IHWA 1WZNA 5EIWA 3ZZTA 1A1SA 1L8LA 4P81A 2HFJA 3P2OA 2P65A 3HS3A 2BFCA 2BKVA 1P4JA 2I3GA 3ZKAA 3QFTA 1TK9A 2G06A 1QTQA 2Y71A 3MMXA 3PEFA 1T5TA 2AZ4A 4EENA 3OBIA 2Q7DA 1RAHA 3OCCA 1GZ5A 2YV5A 3JQ9A 3BKXA 2H3EA 2I7XA 3OC0A 5AHXA 2P5SA 3ONEA 5ECWA 1JG4A 3TQHA 3EWIA 1EJ6A 1RR6A 4MROA 3HM9A 3K3PA 5KU1A 2IYSA 1M8JA 3D6AA 2NTNA 3P0RA 4G9EA 3IPRA 4KXWA 3A10A 4O3FA 4QA9A 1ZOOA 2CXTA 2QW0X 3ONWA 1L5WA 2E0IA 1NWCA 2IDMA 3FBWA 2QD5A 1XYGA 1EWRA 1GEEA 1KVRA 4RPKA 4C0SA 2R8PA 1KY5A 4DNOA 3H86A 3KTOA 3EA4A 2UUCB 1OFHA 2CYBA 3CKKA 4FX5A 4M3NA 4V2IA 4EUFA 3PXCX 5JXGA 1SWWA 2HK6A 1IJEA 2OCIA 4LF5B 3ONFA 3TNLA 1PIWA 5B1IA 1H0KA 4H1VA 4MV5A 2HU7A 4RZSA 2D62A 1EVEA 5AVJA 3SC4A 3OIYA 3TB4A 1A9OA 1JR3D 3V9AA 4IRMA 2BY4A 1ABFA 3EH1A 4HXFB 1XZFA 3W2HA 5D01A 2P2CA 3QH4A 3TW4A 1UXKA 1JDBC 4HX5A 4H1HA 1W19A 3HJHA 1GSIA 4KRYA 1NE7A 1YXMA 2FSFA 2HD4A 1I7QB 2DETA 2EIHA 2D59A 2I1VB 4TLMB 1DT5A 2ASEA 1J5PA 1JBEA 1X8LA 1B41A 2HT6A 2PX0A 4FW8A 4GYYA 2NZUG 1W4AA 4ZEOA 3VH1A 3ZGLA 1P7PA 2IHBA 3R0XA 2FRDA 4HDNB 5ULLA 3NOVA 1Z06A 2BFOA 4AMVA 3CB4A 1DAEA 3FPHA 4POAA 3MN1A 4EG0A 3UMBA 1ABEA 2WD8A 1Z2PX 4YJFB 3RWOA 1JTVA 3U7HB 3I0NA 2AKEA 1YZGA 3OCUA 3DEYX 4BCDA 2EZ4A 1XLTA 2QM3A 3LWNA 4KWCA 1T0JB 4EFKA 1WB6A 4AULA 2VCHA 3GGSA 1GYRA 2L19A 3HUDA 5FPQA 4AJLA 1Y7LA 1YDFA 2IOQA 1N3LA 2H1VA 3W5HA 3P0JA 3UT6A 5CB8A 3KQUA 3L4BC 4Q02A 3GVHA 3RS8A 3INRA 3BILA 4WOKA 3ZYCA 4BE7B 3EZYA 5FOUA 3RUCA 3KD3A 4TV8B 3MNFA 3VU1A 5K0SA 4GRIA 1DC4A 1DIBA 4MMXB 4MWEA 3I6BA 4H35A 2BGTA 3JAWA 4K5QA 4X00A 2VTBB 4U5QA 4QUIA 5AHWA 1QK4A 5FLYA 2I2FA 2CXUA 3QG1A 3LTEA 4OI2A 2WYWA 3TLXA 5KQMA 2LVBA 4LDRA 5TE9A 4BVGA 5DM4A 3EEIA 2LR0A 2H51A 2OCLA 4PYKA 4UHHA 2ZS8A 4MIYA 3Q6NA 3FPGA 2EZ9A 2J4DA 1J07A 2PS9A 3NT4A 4HSEA 4G56A 1Q3KA 5J58A 4QNMA 1ZUNB 1T8WA 2NP6A 3P9QA 3LA8A 1NVKA 2RBKA 3IFSA 5J3JA 4PCLA 5B30A 4I1PA 4YUXA 4CIVA 3V4VB 3CB2A 2JGMA 2UVPA 3AB3A 3F71A 3V8VA 2VLIA 2C04A 4YUYA 5ALHA 4LECA 4R8KA 1MQ8B 2AG5A 3E1SA 3TBKA 1XAJA 1SHLA 2C77A 2E87A 4CE6A 4X65B 4GL2A 2ZJ7A 4CKXA 3IPAA 2H57A 4DV2B 4E32A 1HL7A 4NZMA 2GBFA 2CCKA 3IAS6 2XCQA 1Y80A 4RVGA 1G66A 4MPJA 3WIUA 1MRZA 5EMMA 1RAGA 5FBKA 4E7OA 4ZRDA 3AK4A 3ZXXA 1DG3A 4Z5XA 3JQ8A 1T2NA 4U8GA 5EQJB 2H2FA 3AHEA 3EA0A 2IUEA 4KODA 4G9BA 2RJNA 4JC0A 1UIMA 3PB3A 4QHSA 3AI3A 4DCJA 2C00A 2AOTA 1CFZA 1I2AA 1D4AA 1RYBA 1V35A 1YNSA 1L7RA 2X14A 3E0QA 2RC5A 4Y30A 5TV2A 3HU1A 5LPNA 3MT8A 5T6MA 4C6TA 5D2CA 2BFBB 2RHBA 3I34X 3LHDA 4BKPA 1N8TA 4B71A 5DHFA 4X6YA 1GCIA 2CF5A 4OHZA 4MYSA 3V2HA 3KQPA 3RT9A 1VKOA 4BVEA 1O96B 4QVIA 1YT5A 4JROA 1QFYA 4EOGA 4B6PA 4J43A 3GXOA 3KTAB 4MWGA 5L6MB 1XJ5A 1XTIA 3PLRA 4TYQA 3TKAA 2BMWA 2OAEA 4OYLA 5K3EA 1Q0TA 5EXEA 2SKDA 3MGKA 4OP3A 4B3XA 3FMOB 1TMYA 4JT9A 2R8RA 1DELA 3U7IA 2FGKA 3NHRA 1WB5A 1BJKA 2PGDA 1BXZA 2YNMC 1S2OA 4HUQA 2JLZA 4JBXA 2Q46A 4HNUA 5HDBB 2E18A 1LF5A 3CRVA 4D97A 5BW4A 1Y1SA 2P9EA 1J23A 1T8YA 4MJLA 4PYMA 5G2OA 3WICA 4DANA 1EE9A 4L8GA 2PMKA 3H97A 2F1IA 4FP9A 3QIAA 4YAWA 4FMCF 2OP1A 2YJTD 4XFDA 1I1NA 3IKLA 3M81A 4LVUA 5EIFA 5JPIA 4B2LA 4B34A 2FF5A 3AVTA 3JZMA 1J06A 3M70A 3PR3A 5F9FA 1SK9A 4QAQA 5AK0A 2OYCA 2GFIA 1QC5A 3MTGA 3NHAA 4KQCA 1AUXA 4HNTA 1OFUA 3BK7A 3NJ4A 1FJXA 5A5GA 1YA6A 5C1PA 1E9AA 1H2EA 3F7MA 2NADA 4UASA 1V39A 1YS7A 3UNXA 4BO0A 3W5AA 3WYCA 4CKCB 3VOSA 3ONDA 3F7TA 1X13A 1FQOA 2GPJA 4PR3A 5ALKA 2WNHA 4FWIB 1XA3A 4N6NA 4X7BA 1SD2A 5K4GA 1G8MA 4NZOA 4DWJA 4EVIA 2QVBA 3OOJA 3BIOA 1F5NA 2INGX 2LRHA 2G4CA 4K40A 2ZJ1A 1NRXA 2CXHA 4JX9A 1YH3A 3JQDA 2DT5A 3R5JA 4ER0A 1ZHOA 2ZZNA 2FMFA 1M67A 4N8SA 2VTDA 2BEKA 3F6YA 2G25A 2ID9A 3FB1A 4J7CA 1V95A 2VQSA 4NBLA 4YCBA 3F5FA 4AI6A 3DD1A 1R6AA 2WAAA 5ICFA 3P9ZA 1ZZGA 2COKA 3QF4B 2QKYA 4MVWA 4YS6A 3W5JA 3VO8A 2B61A 3GU3A 5KMGB 5ED0A 3CZCA 1Y3FE 4WGFA 1D8AA 1UXHA 1L4HA 3SJAA 1H1DA 1T6NA 1ZITA 2AZXA 3HWSA 4GOMD 4EG8A 2JJ2A 5FBWB 1YBMA 3ADCA 1FVOA 3VOTA 1G0NA 1WXIA 3GNQA 1E4OA 3KVOA 1EFVA 4JJIA 1FDTA 4D9BA 3L4BA 4KBGA 1KAMA 2C4HA 1ZA1A 3ISVA 4IH4A 1T4DA 1VPLA 4LVNA 3KKNA 4KO4S 4YECA 4ZT4A 3ETCA 3U26A 3BXXA 5ERYA 1KYYA 1UJ2A 1WL8A 3RDPA 5JS8A 2VC2B 4BAZA 3GA7A 2MCFA 3HH8A 3UWMA 1W87A 4L2IB 3DLAA 1WXDA 1PG0A 2GK3A 1N6LA 5D5PA 3EX7C 4LZNA 4KITB 4MV3A 4P7GA 5AXCA 3RVLA 4A16A 1N5LA 2AL7A 5TQ2A 3HBMA 1OX4A 2QN2A 4WW0A 2C96A 3OJLA 1M0WA 3VJKA 3LXRA 2EBHX 3W3AH 1Y1QA 1OHHD 3JVUA 3QXCA 1T6ZA 1JE1A 1YWGO 3IODA 3OHMA 3OZDA 5HEKA 4BVHA 3MWFA 3FWYA 1PT8A 1OLSA 3H17A 5H9WA 3NHWA 5JFOA 2Z9BA 3DNFA 3ND9A 1XTSA 5T4FA 4BVLA 4C4XA 3ER8A 1Z36A 1Z26A 2ZYAA 5H0IA 3CR7A 5BNZA 2O8DB 1XXHA 4JI6B 4HNSA 1ENZA 2PS1A 3SR4A 3VU9A 2DBVO 2VJMA 4LBVA 4X6UA 5AP9A 5A71A 2VUHB 1WV0A 5AT1A 5C1DA 5ES4B 1J5EB 3GQBB 3DLBA 4OX9Y 3C8DA 2ONYA 1E2FA 4IZOA 3D8HA 2QJRA 3WB1A 3HABA 3L6BA 3VR3A 1JIXA 1YDMA 3PP8A 5L4SA 4RHYA 1XC7A 2O5VA 2IV7A 3MJCA 1WZUA 3L8ZA 4PYQA 3VSEA 3M1AA 3V4LA 1NW9B 3G2MA 2OZVA 3I64A 4A0HA 2P9TA 2C99A 2I7CA 1L4UA 3RWMB 2RKOA 2ZI4A 5FOSA 3S7ZA 1JT2A 2XSZD 3DYVA 1LQTA 4ZCPA 1G64A 4RE5A 1YRQA 1Y4AE 2CSUA 2D06A 1U4NA 3EQZA 4B2YA 1ENYA 4I4NA 3V1NA 4MGEA 3V7WA 2HK7A 2X7JA 3EC1A 3QKUA 1I6WA 1RPJA 4YAOA 3NW9A 3O8QA 3Q3VA 4GDMA 1MHTA 2PUEA 3PK0A 3ZH2A 1KZYC 3CUWA 4QASA 4OB7A 4OXNA 3CPSA 5ITZA 5KAMA 1P74A 4JKOA 1CFJA 1QGOA 2CL7X 4BFVA 1UZNA 3EY9A 1FNMA 3PLNA 4M46A 1SCIA 4ZREA 4ZRNA 5ADVA 4QGBA 1YZNA 3BFKA 4ZQCB 1G60A 5JNTA 4M89A 3SF8B 5LUAA 2IXDA 2EJUA 1K97A 2YNMA 5I51A 1GU0A 1NY6A 1Z4QA 3BHMA 3PA8A 5LYJA 5C8YA 4XJSA 2QAGB 2DWQA 1THTA 1PZGA 2WU8A 3AXSA 5IT5A 2JGNA 3RAFC 4MVJD 1NOIA 1QBKC 4ZVSA 5F4BA 4DSUA 2VPWA 1RIIA 4JELA 2PKQP 2VJCA 1JLSA 3CBQA 1VRWA 1Z4NA 2GN6A 2J08A 3GUUA 1R0BA 4KKVA 5AO9A 4YT4A 4DCTA 1GT91 4B3TB 3M6MD 3WSWA 2C82A 3C15C 2JPDA 2WKSA 2Q6VA 3DTNA 1HDZA 5JD5A 1KF0A 1UBRS 5BQXA 3SXUB 5KVQA 2W58A 4JT8A 3CEMA 3ACCA 1IPHA 2OE2A 2X86A 1JBQA 1M1YE 5EESA 3UN1A 1UOEA 2YXNA 2LGJA 2JJ1A 5DCLA 1YAJA 4MUEA 1VE9A 3ER9A 1J2UA 5H4GA 1X3LA 2XUGA 4E4TA 3SS9X 3TX2A 1CVIA 1TFUA 5EOVA 4DNXA 3KQHA 2I3ZA 5C51B 1S8OA 4AT1A 4ZVVA 3B7GA 1CLEA 4M22A 4JC8A 2ENUA 2MSDB 4YJFA 3ZG6A 4ZDIA 1U3CA 5EJ7A 3ROZA 4YUAA 1JYFA 3IALA 1NVBA 2E89A 2P8SA 4KR9A 4CMEC 2B5VA 1JTEA 2RDMA 2CKDA 4K88A 4BX2A 4RVSA 4WBNB 1KE1A 1T2FA 2G1PA 2QG6A 4Q7QA 4FC7A 1P2UA 3E9RA 5H81A 2IBTA 4X63A 4BLSA 2GS9A 5BSEA 1IM5A 1RJDA 5CDYA 4PHCA 3MZ0A 3E7XA 1SH7A 4XUEA 5FT9A 2XODA 5IAKA 2P2LA 3UYKA 5F78A 7MHTA 2OO3A 4NYIR 2ECKA 1SUSA 2ZVDA 1TMKA 3DBHB 3BWMA 3PE3A 2QYHA 4O1MA 4OXYA 4QO8A 3H9EO 1RXWA 3HV2A 4Q1CA 4R1QA 3UA4A 6LDHA 3ZQ6A 1VJDA 4Q7KA 4N5NA 2POCA 3SVZA 3KXLA 1E5QA 3T06B 3HO1A 2YYSA 1VM6A 3ZXUB 1NOJA 5E7JA 4ZAVA 3TW8A 1AIPA 3I9JA 5BYKA 3TRHA 2A5DA 3A1TA 3TEJA 2HCJB 4F38A 5DNYB 2PX2A 1LBIA 1WEHA 1ZRMA 1S02A 4ZMSA 1WDMA 4QX6A 5ALSA 3VC7A 2JLYA 1JLRA 1MV8A 2BW0A 4QULA 1AOXA 1ZUNA 1P1CA 1GFIA 3P2IA 3HQ4O 1SOWA 4XIFA 1KQFA 3ANSA 4MB2A 4MYRA 5DBIA 3E7FA 1NU8A 1DXOA 4DQKA 1BD4A 2X58A 1Q50A 3PX2A 3CRNA 5EPEA 3W9UA 4LZWA 3ZIAA 3FZYA 3L6OO 3RODA 3SS8A 1MXFA 1NW4A 2E4YA 3DKIA 3EUEA 1Q84A 1USKA 1XVTA 4BO9A 4AKGA 2AJTA 1HDCA 1UM8A 3WC4A 2VYND 2ZSIA 3I37X 3JQQA 3FYDA 4IS3A 5EKDA 4HQOA 3ZDXB 4BEWA 2VNIA 3GZNB 4ZCTA 4TYNA 1BKYA 3EZLA 1T0UA 4AMGA 1THGA 1VFPA 4LMAA 2QMYA 4M1SA 3BTVA 4WXPA 4WEOA 2IW3A 3INTA 3UJ8A 4UQLA 2P5TB 4JSYA 3FYSA 4ZQHA 3FNEA 5AXDA 2VUTA 2ADOA 2JH9A 5TF0A 4K3VA 2VUIB 3RRZA 5KNBD 5K0ZA 4DV7B 3WQSB 2QIOA 4OQNA 5DGXA 1XT6A 2W71A 3DFKA 4GW3A 2Q4DA 4RUKA 1XDDA 1C0EA 5EZYB 3TOCA 2UZ4A 2BFBA 2YZGA 5EKXA 4DXDA 2XGJA 3M6WA 3H5WA 1VKZA 1MNAA 4XH9B 1SVOA 1Y7IA 4CUJA 4C4TA 1QP8A 3SN6A 3X1MA 4P4NA 3ZD7A 2VSOA 3P9SA 3S3TA 2VRWA 3B6JA 5C4MA 5DBEX 1L5YA 4NEHB 1E4VA 3BJIC 1Z5PA 3MD9A 4ON9A 4EG3A 2C5GA 3GZJA 3WE7A 2D5BA 4GBGA 3UB2A 1EFKA 1TLTA 3NZEA 1RTTA 1IBSA 4F2HA 2FPOA 5JR3A 1PV4A 1E63A 4ZO8A 2JD2A 1RWQA 3NGMA 2JLSA 1G8SA 3DE5X 4OQQA 5FBHA 4WKOA 2A0YA 1E9BA 5EWJB 4E5NA 4GX5A 2UXBB 2VHQA 3OQOA 3RSCA 1J8MF 2Z6UA 1CS0B 1FP7A 3JQPA 4AX8A 2E4UA 4XDHA 2QAGC 1GSHA 1HQKA 2G82A 3D4NA 1PGPA 3HUEA 3UZUA 3ZBQA 4E46A 5A4FS 1XIVA 5IJ9A 4JENA 1YZFA 3GLHB 1A8HA 2HLDD 4P7KA 5BRNA 3RS2A 3WWYA 3E9EA 1JG7A 2QVZX 2PYDA 5CB0A 1QDLB 3KZCA 4PLYA 3VZCA 3O6VA 1QCZA 2WUWE 1Y5IA 2FPUA 3HL4A 4R4JA 1JQBA 1C1HA 2QJOA 1IHXA 2QN6A 4AMYA 4BB0A 1XROA 2R1TB 4PLTA 3WYAA 2MU1A 3CGGA 2OQVA 4E1AA 4YV1A 4G1FA 2X0FA 3VNBA 4RHEA 4Y6QA 3AMVA 4Z86A 1OXKB 3DHEA 1NR7A 2EKDA 5KTNA 2ZRPA 3CVYA 5GIOE 1J39A 3KB2A 1XCGB 4ER7A 5BSMA 4MTLA 2Q6IA 3P4XA 4YAFA 3AVPA 1PR1A 1RQRA 3RARA 4UMVA 2IF2A 3SHQA 3O8LA 3TQTA 5LQMA 2PBLA 1ADBA 2JHGA 5ESXA 3P71T 2NO0A 5A6SB 3VR6A 3N9IA 1BA2A 2W98A 1U0TA 5KQGA 1NDHA 1D6NA 2BTQB 3BWYA 2PUHA 3ZUGA 2Q29A 3QXJA 1XB2A 1SVKA 2VF4X 3LUHA 3A9UA 4LRYA 4ROSA 4P08A 5AVXA 4Z53A 4OJTA 1HMYA 5G4KA 3QSYA 3K4PA 3VUFA 4FGJA 4OYHA 4CMEA 1PRYA 2MSEB 2TSYB 4FGKA 5JJKA 3CUUA 1QMGA 5IC6A 4I8XA 1ZM4A 3T52A 4RK1A 1MZVA 4ME6A 1OBHA 1ZK1A 1Q22A 2R65A 3IUMA 2C1ZA 5HMLA 5SYAA 1FFAA 2PL5A 3MS7A 1ZIOA 4RHUA 3W8EA 1N5KA 1MQ9A 1GTVA 1UR5A 3EVZA 3EZXA 1DLIA 4TN5A 2C54A 2B2CA 4PF1A 2FVXA 4II7A 1L5MA 1YB2A 4RH1A 4C21A 4MHTA 2ZJFA 4X8HA 1J2EA 1WZCA 1ULHA 3PFNA 1RJFA 1TUBB 1YCDA 3G1WA 4LHVA 4LY9A 4TKLA 3VR2D 5JXHA 3C97A 4L2IA 4AS1A 4BLPA 4BZQA 3K4HA 2V7BA 3A28A 2A8YA 5FI3A 4F04A 1T3TA 5HKLA 4V1CA 4LF4B 1WHSB 3JZFA 3Q9SA 1RQNA 1JKXA 1IEXA 2JGDA 4BNIA 1E7YA 2QBYB 2JRLA 3CT4A 1NNSA 3PC6A 3PFBA 5KDLA 4U2EA 5CA1B 1NQAO 1RWKA 3C8MA 3AR7A 4NNOA 5KI6A 3UHPA 5AW7A 4DDKA 1VGRA 5CB4F 4JLBA 4FHDA 2YWXA 3PZRA 3Q15C 4G65A 5D00A 5J2TF 2J3KA 3WMFA 1P0PA 3EDMA 2BR3A 1Z56C 2EU8A 4KQ6A 3L0PA 1ID8A 2KHZA 4AO6A 1EK5A 3L7YA 5JASA 4X7PA 4N3BA 1XF1A 2WUDA 3LT1A 4KFRA 3KFVA 3I3OA 3QI2A 4LXGA 4X8OA 1BU5A 2R96A 3T7IA 5AW4A 2O8DA 1NQ5A 1T8TA 2FV8A 2NTYC 5HQTA 1F4VA 4FQ5A 1HQDA 2E7ZA 1E2KA 2EYQA 3KYCB 3RYIA 3UWSA 2YUIA 4C0JA 3FOFC 3GQBA 1WHTB 1AS0A 2FR8C 4QGFA 4GP7A 2R68A 2B4YA 3N86A 5FUBA 1ORVA 3G8AA 1CZKA 3L77A 1DTWB 4MJ7A 5CA0F 5JI3E 1R6UA 4Q9AA 1UKEA 2A7XA 2RHOA 3QOWA 1EBUA 3OTGA 4FE3A 3MK31 1KI4A 2NYRA 4JLDA 2OK7A 4ZTBA 3QBDA 2EEZA 4BQFA 2HU8A 1K6EA 2GWRA 4GEGA 4I3FA 1NVMB 1Z6ZA 4XRRA 1NXVA 4LE0A 4IQFA 4BWGA 2ODWA 3C5WP 4R16A 1H2RS 5K3SA 2C0CA 3IP5A 3RTCA 4WACA 5T41A 4DEYA 1IDN1 3HGQA 5A9RA 2FG6C 3CKLA 4EKNB 3G5MA 4OHBA 4ZC1A 1KEWA 4MQMA 4NAUA 3U7GA 1RXUA 3ZE8A 5HOEA 4GOND 1V1RB 3NOOA 4BNXA 4Z7NB 2AXEA 1KMQA 1FVXA 3ZOZA 3DULA 2B6HA 5EUMA 1M2OB 4ZQIA 1JHZA 5AM4A 5A03A 5ADWA 2WMNB 1R6XA 4AMZA 3G0DA 1PLLA 2Z6QA 2H07A 2F1HA 3GCWA 3OZSA 4JZYA 4K6CA 2QAGA 1PAUA 1R1DA 2WFZA 3H2ZA 3IAEA 1C81A 2NYUA 3IVMA 1I33A 1WXWA 1HI9A 2OGZA 1D0IA 4HAZA 4ENWA 2QTNA 2EG9A 1UBUS 3BFXA 1JX6A 3Q0TA 4N3AA 3TAUA 4NCXA 1C0IA 1XZCA 1L0BA 1Z17A 1SUCA 1B0PA 1ZH0A 4G86A 3HLTA 1I6KA 1J42A 3H2HA 3P2MA 1P2DA 4N0EA 5GVSA 2ZIWB 3GRKA 3AVUA 3HJBA 4NIMA 4M54A 4BNNA 3ON5A 5AOAA 1JQKA 1PEDA 2UV8A 1EFRA 2JIZA 1Z6PA 5EXSA 2I6SA 3I2FA 5LA6A 2Q9CA 1A88A 1GNVA 2QRHA 3LT4A 4NMHA 3QVLA 3HJAA 3ELWA 1LDGA 3MILA 4RV9A 5CH5A 1MFZA 3OOHA 1Z4JA 1YF3A 2YDYA 5DOZA 1W0CA 1YRYE 1DSSG 1AH2A 4HMQA 4Q6WA 4DMFA 4MV1A 4NYMQ 1X7WB 3KOXA 1XL1A 5EI5A 1H05A 2PZ8A 2A3RA 1XDWA 2NZWA 4Q0MA 1DAPA 5JSZB 2QP4A 4RETA 4GMHA 4G37A 1KP9A 4WBNA 1DOAA 1IWBB 1GLGA 3ZVMA 4Q4DA 3F9CA 2J7PA 4NCKA 3ZNOA 2PGNA 4F93B 3O8OB 3TZHA 3R0ZA 1H42A 1V5EA 2WHQA 3PXGA 3DBHA 1N5DA 2LKCA 4MPTA 2YW9A 1H8ED 4GC5A 2H7YA 5F7JA 4MRSA 4F4IA 5K20A 2QX7A 3Q4GA 4NZZA 1IBLB 4MQEB 4HC4A 4TRRA 2CJYA 5EE0A 1KH3A 1U2QA 2GVNA 3DV0B 3N2KB 3ZPXA 1ADGA 4BY9E 4DT1B 2QG4A 4LOAA 3C98A 1S6YA 5LXTF 2J9FA 1A27A 3OFVA 5IKOA 3LXXA 3DP9A 5ABPA 2VXYA 3K1AA 2I2WA 3AJRA 2GSWA 1TPZA 1YZUA 1J22A 4KXVA 4B6RA 2NNLD 3PWSA 5D5QA 4QYWA 4EVQA 1WUHS 3FM9A 5IN5A 4KAJA 1AXGA 1QYRA 1Q1NA 2WABA 3QPAA 5FBZA 4DQXA 2VNKA 4MGHA 3M9LA 2AXNA 5C8VA 3ZXSA 2R6JA 3FXAA 5AI0A 1PKXA 1K4MA 1UOQA 3AM5A 1DZIA 2Y1DA 3KLMX 4BU1A 1NLYA 2B83A 2G9QA 4GRAA 3K0FB 2IIQA 1QIMA 3KXIA 3GZNA 3L4SO 3FPFA 3NDJA 4GIBA 4JVMA 1XRMA 4U7FA 4G9GA 4EUKA 3A4IA 3K1YA 4PANA 2GEKA 5K3CA 4P7BA 3WY9A 1PNTA 3ENQA 1V5IA 3PXBA 4YPFA 3VH2A 3RYCA 3KR1A 3LHKA 4KV9A 4V0RA 4AJ2A 1WUKS 1M73E 1JILA 2WC1A 4UD6A 2R6R1 5F77A 3UW1A 2FR8A 3FHCB 2K2WA 1X80A 1GU7A 5EZYA 2CSXA 2D5AA 1QV7A 4NXNB 3P9NA 1CZOA 4U7TB 3HFJA 5ECGC 1LNQA 3DBVO 2M6SA 1RRKA 2XOEA 2Y1GA 2REBA 5GV8A 3LCRA 1DINA 4JUBA 2K4MA 4IIBA 1YD7A 3MTDA 3ISJA 2HPHA 3DF9A 4GI5A 4E6PA 1SXJE 2X9GA 1IZ7A 3E8MA 1U9IC 4FXOA 4RQBA 3KXKA 2DCMA 4RFVA 4UHBA 4K86A 2VYFA 4PZUA 4BOYA 1KS2A 2V97A 1J0CA 3U6BA 2HK9A 5IC5A 2FFAA 3O03A 1Z29A 1ZJ6A