3L6BA

X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
327
structure length
322
Chain Sequence
AQYDISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVRKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Serine racemase
publication title The structure of mammalian serine racemase: evidence for conformational changes upon inhibitor binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 118
structure length 322
sequence length 327
ec nomenclature ec 4.3.1.17: L-serine ammonia-lyase.
pdb deposition date 2009-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l6bA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l6bA02
1FCJA 1CW2B 2JC3A 1KFBB 3FCAA 4D9FA 4ZU6X 4D8TA 5B1HA 2Q3CA 3R0XA 3X43A 1TZKA 3SS7X 4D9NA 2CLMB 2RHGB 3X44A 3FGPA 1J0CA 1TZ2A 2ZPUA 1V7CA 5J43A 4L27A 4HT3B 3ZEIA 3PC4A 3L6BA 1TZMA 4LMAA 1RQXA 2CLEB 4HPJB 1K7EB 1WDWB 4H27A 2CLKB 4D97A 5KINB 2ZSJA 2J9XB 5I7WA 1TTQB 5B36A 1UIMA 3AEXA 4L3VA 1QOQB 1A5SB 1K7FB 3DWIA 4I1YA 1QOPB 2TYSB 2ECQA 5I7OA 1V8ZA 4OFXA 3L6CA 1A5AB 4ZQCB 1Z7WA 4KKXB 5CVCA 1UBSB 4LMBA 5D84A 1UINA 1VE1A 2C2BA 5DW3A 4D92A 4NEGA 1JBQA 1WBJB 4NU8X 5T6MA 3DKIA 1C29B 5HBGA 3L6RA 4D9KA 3PC3A 1K8XB 1KFKB 3BM5A 4PCUA 2RKBA 2DH6A 1D6SA 2TRSB 1VB3A 5CGQB 5DBHX 5J5VA 3VC3A 1WTCA 2CLLB 3R0ZA 4D8WA 4D9IA 2CLFB 3IQIX 2Q3BA 5I7AA 4HPXB 2PQMA 1X1QA 1PWHA 3VSCA 4D9BA 5B55A 5IXJA 1K3UB 1TTPB 3IQHX 4JBLA 4D9MA 1Y7LA 5I7RA 1KFJB 4L28A 3SPXA 3VSAA 1Z7YA 4COOA 2CLHB 2DH5A 2ISQA 3TBHA 2ECOA 3PC2A 4D8UA 3V7NA 2V03A 2RH9B 3CEPB 1OASA 5IWCA 1C9DB 2Q3DA 4LI3X 1BEUB 1J0EA 1PWEA 4D9GA 2BHSA 2C2GA 3IQGX 4AIRA 2TSYB 3IAUA 5B3AA 1FUYB 5JJCA 1TZJA 3RR2A 1VE5A 4HN4B 1V71A 2WSYB 5D85A 4D9EA 1J0BA 1TYZA 3HMKA 5DVZA 5BW6B 3SS9X 4IL5A 4D96A 3DWGA 2CLIB 1TDJA 1K8ZB 3AEYA 4QYSA 4XUGB 2EGUA 2J9ZB 4HO1X 5I6DA 5C3UA 5I7HA 1O58A 1J0AA 5DBEX 1A5BB 1P5JA 2O2JA 3VSDA 1KFCB 2GN1A 2EFYA 2BHTA 5EY5B 2ZR8A 5D87A 1M54A 5JISA 1CX9B 1BKSB 4Y6GB 3VBEA 3PR2B 5DW0A 5B1IA 5D86A 5B53A 1C8VB 4AECA 4F4FA 1TJPB 2D1FA 4JBNA 4ZU1X 4OREX 2CLOB 2GN0A 2O2EA 1WKVA 4L0DA 4WX2B 1E5XA 1K7XB 4D99A 2J9YB 1A50B 1J0DA 5IW8A 1KFEB 1KL7A 1F2DA 3T4PA 5KZMB 4D9CA 1K8YB 5E0KB 2GN2A
chains in the Genus database with same CATH superfamily
2CNWD 1Y5IA 3DEFA 1IMOA 2AOUB 1QQ5A 1T34A 4IICA 1Z2OX 5C7OO 4NOLA 2FW9A 2Q6LA 5HQ3A 3D3NA 2PTGA 4MKXA 3BWCA 1E64A 1Z4QA 1IC6A 4JNCA 3QXGA 1VCIA 1DINA 4BZQA 4OAPA 3DLPX 3IOYA 3NJ8A 5CIYA 3K1AA 1WHTA 4BN5A 1A77A 3H5TA 1MTOA 3MGCA 3OCVA 1E0JA 4M0UA 3UO8B 4GLJA 1E2KA 2QL5A 4CMHA 4NOKA 1F7VA 1WCWA 2J9RA 2R1TB 1XZGA 2FRDC 1TCVA 1GQOA 3BTSA 4RYLA 3F6BX 5H80A 4F4DA 4KR7A 5EJFA 1ZAYA 3AY3A 4KQXA 4BB9A 3E9CA 2LTAA 4RTQA 4RSMA 3KJEA 1Y8RB 5AXAA 2HHAA 4KK4A 5JH7B 1UC4B 3MCAA 3K20A 4I1YA 4NBRA 2DT5A 5AMXA 2TYSB 3K2IA 5AKIA 4AKSA 4Y9SA 3U3JA 2FFQA 2A1IA 1BU5A 1KAMA 2FWNA 1O6GA 3AEQA 4AJ1A 1J70A 3ZGLA 1RTKA 1GPLA 2HA4A 5EWJB 1XT6A 3TNJA 2F8MA 4BUCA 1RPZA 2JFVA 2X2PA 3EUAA 3QGMA 3WQBA 4HZIA 3CZCA 4LK2A 2UZ3A 4CM1A 3PUJA 1JQEA 4EGAA 5I9BA 3OEED 1GTZA 2GZHA 3JZFA 4Q3NA 3THXA 1QKJA 2VHEA 4RK0A 2AX4A 2VBGA 1DKOA 1D2NA 1A82A 1NC1A 4K46A 4CMAA 2OCYC 2XT0A 4J07A 1GLGA 2BM9A 4ZVKA 4BLPA 4OYHA 5JNLA 4OGKA 1RC1A 2N9UA 3G2MA 2HA7A 3GHHA 2W2NA 2X6TA 1UWVA 4X94A 3WYFA 2PMKA 1CUCA 1NMEA 3B51X 3EH2A 3KEOA 4OTZA 4Q18A 1JG2A 5TNXA 4LMPA 3V4ZA 3ZWAA 3ZUPA 2C77A 4C0LA 2B1IA 1FLAA 3I0NA 4WNIA 1RZUA 3H3FA 2BRUA 4J3FA 2P9QA 1LDGA 4M49A 3HXKA 5DB4A 1CNFA 4DMFA 4GC9A 3FPJA 1SU4A 4H3KB 2BHSA 1DELA 1U0GA 2X2FA 5AOCA 3IKTA 3EC1A 3WXBA 3K4PA 1WS6A 3I3OA 4UPVA 4C3OB 4O0MA 3EZNA 4X1IB 2F43A 2XZTA 1VHWA 3CUYA 4JL6A 5F1OA 4EFKA 1G8MA 1ZNQO 3EZ9A 3KOUA 4BFYA 5L7TA 1JGTA 1G6Q1 1P4RA 4P0QB 3LC2O 4KO8A 2XQKA 4XR4A 5TPZD 4RK4A 4E2XA 3IIKA 2WD7A 3KOYA 3PQ2A 1JDPA 3ZHOA 2GEBA 1UOEA 3IEIA 3A26A 2HIGA 4V3CA 3K31A 3G5LA 4XYBA 2RHBA 3GFTA 1UFKA 1CQJA 1PKXA 5K8VA 3B3FA 2GDJA 1K3TA 3V7UA 4WBNA 5JXJA 3V7FA 1XUOA 3MJ4A 2Z56A 5JD6A 2JEZA 3QXXA 4Q4HA 4XZ3A 3ILYA 5KJ1A 3IT2A 3LWDA 1PJQA 1TTHA 5JPCA 4MO9A 4TMTA 1CC1S 3DGEC 4PZUA 4U6NA 3TIGA 4A4DA 4JQYA 2VH1A 4FVTA 4X8OA 3LRTA 3ZV5A 1DARA 1OXMA 5KNCD 3P94A 3PEEA 3AF1A 5DSXA 5BWBA 1UWLA 1M74A 1JJBA 2Q62A 3O8LA 4P2BA 1RJFA 1GTG1 3G1UA 4GZLA 3SYNA 3CLTD 1Z4LA 4NE7A 2CD7A 1SURA 4URWR 5I9LA 2Z6AA 1TIKA 2C04A 521PA 3VA7A 4MCJA 2DUMA 1F48A 1KMHA 3K9QO 4MMYB 4TXNA 2IFTA 2ZJAA 4EHBA 1TCCA 4CL2A 1IXRC 2DFLA 5A0VA 1ZMBA 4A26A 2ONKA 3DFUA 1UANA 1UBLS 3MB8A 4QOIA 1ZRHA 5JSKA 3WAGA 1YHZA 1AUOA 2J4CA 2OLKA 4YV0A 2G71A 1W47A 4X3PA 2CHVA 4A9AA 3O3CA 2B1RA 3VR5D 4ED9A 4NQRA 4YUXA 1WV1A 1GHTA 2H31A 2ZAMA 3OPQA 5J2UA 1EWVA 2YWDA 2R48A 5AVSA 1U0EA 2RGBA 1I2ZA 2W2QA 3FMPB 2FEAA 3OLQA 2YIDA 2R2GA 3PRKE 4II2A 4OMUA 2NQ2C 4ZVNA 2NM0A 4RL6A 5H0IA 1F38A 2ZS7A 3GIWA 5JU6A 3K15A 2V3CC 5IZCA 3GZ4A 1UT5A 1JSXA 3KU1A 1UEJA 3H19A 3OC6A 2IEGA 1K6XA 1D9XA 2QPLA 2PRIA 4P82A 1ZG3A 4BO6A 1GZSA 5F2NA 1E2BA 3P0EA 3LI2A 5GADl 2CKMA 1QDLB 1VSQA 1Y4UA 3FPEA 4WINA 5ERGB 1Y1TA 4QFDA 2WYIA 3Q4GA 4FFSA 3Q3CA 4WZ6A 1KEEA 2JHFA 1WXDA 4D7AA 1SKUA 3ZCSA 4QGGA 3E22B 4MA0A 4E5VA 3Q0EA 5BXYA 1L7VC 3RFTA 5FKJA 1P7ZA 2AEEA 3SZMA 3AIIA 4RQAA 5FBWB 1V5FA 3BVPA 5HJ2A 1QVZA 4KQ2A 4CG2A 4F3NA 4MYDA 1W36B 3K5PA 3AV3A 4FS8A 1QO0A 1A9OA 3IP8A 3PEVA 2G4CA 4MI9A 3KKMA 5LB2A 4JBWA 3O8QA 1NPYA 3PFCA 4FD2A 5BYAA 1KRWA 1JI3A 1N5RA 4P7BA 4L15A 1I7QB 4ZAVA 5BT9A 3SI7A 1DFIA 3QJYA 2P6PA 5ITWA 4Z4GA 3MTGA 2J8ZA 3QFFA 1DS6A 3F9CA 3VRHA 4ENSA 4CQMB 2IU6A 3BGIA 4GWGA 1JAIA 5CLLA 4JT9A 4HN9A 4HYQA 1ZLYA 4LNUB 1UT6A 1QVRA 1Y8AA 4QPJC 5HX7A 1MR3F 4DC0A 1QZ3A 2GF9A 4XUGB 1K98A 3PSAA 2WHYA 4QQFA 5J4LA 3FAKA 1CJMA 1TVEA 5FNVB 3PL5A 3TOSA 4RJJA 2IWHA 4HWTA 1ZRSA 4UMDA 5BN5B 3WK6A 5CD9A 4QUAA 4CMBA 1QE5A 2GEVA 1OTHA 1O6CA 2NQ8A 4M83A 5D87A 1S01A 1MUUA 2KJQA 1CX9B 1CUUA 1GVHA 3T41A 3ETEA 2C8LA 2JH3A 2XRFA 4PQRA 1M67A 2PX3A 4RWEA 2FW6A 4HDSA 1AB5A 2EZ8A 2E3JA 4YMGA 3TNDA 4PO1A 4GOND 3IP3A 2XVYA 2REXB 2Z2IA 5EHZA 3PGLA 1A2BA 1ULSA 3WISA 3K2QA 3UJ9A 2XWSA 4GMFA 5A3JA 1WF6A 5DTEA 4JIGA 1P0PA 4UU1A 1QIHA 1XKQA 2MDTA 2OZKA 1GXSB 4FFWA 4WZBA 4F7WA 2WABA 5I5EA 4FZ3A 3DAFA 1FSSA 4JB3A 3Q7RA 4AUNA 3A0RB 1IAVA 3B60A 1YAJA 1BW9A 1FRFS 1Z2CA 3MAGA 1SXHA 2I2FA 1DBSA 4GS5A 4UEQA 1AZTA 2F3TA 2J1LA 2V8BA 1RMQA 2DY0A 3OETA 3PKZA 1WXHA 1ZM2A 2FVXA 1AHNA 1F0YA 2A1TR 3EA4A 3EXAA 3FYTA 4K2AA 4CF3A 4MHTA 2PKRA 4HEA6 3GMSA 2IF2A 1EBUA 3OM0A 4JLOA 5TARA 3B6KA 3V48A 4R40A 3M9LA 1OC4A 4D5GA 3LGXA 4KFUA 1U90A 5BNWA 4Y8VA 2QVXX 3CF0A 2PT5A 3NORA 1CR4A 1USUA 4K86A 5ALPA 3T5TA 3ZWCA 1LBQA 1PHPA 2I78A 4M0DA 3NFYA 4EG6A 3C24A 1GVNB 3DHYA 1DUVG 4Z4HA 2FMTA 3W2IA 1YVUA 4G5RA 4F45A 3C4JA 4DZZA 5IUNC 1H4SA 2DBZA 3TSAA 4CR8A 2OGUA 1OX6A 2ZYWX 2DCUA 2GM5A 1HT0A 4MQ6A 1TJNA 4N7MA 4YREA 2XB4A 2ET6A 1XEXA 2HJ9A 3U5ZB 4WOCA 3KQKA 4DQVA 1U7TA 2ZI4A 2BMJA 2AG6A 4A0GA 2XXAB 1SUEA 1Y4DE 3QVWA 8ADHA 4FGLA 1JHYA 2VJYA 4EB8A 1A2OA 2IYTA 2VKTA 3DVLA 3L8GA 3WB2A 3LQKA 5FBRB 1SUCA 5FOQA 4EO7A 3ZBUA 4ARCA 2UVQA 1I2DA 1S7GA 4P4UA 3TZLA 5C81A 3CLSC 4RIIA 2Q1WA 3ZE8A 2QRNA 3F74A 1MABA 2AKAB 1B23P 3DQPA 2NXJA 4OJMX 3A9SA 2BKAA 4R4JA 2AVDA 1JH9A 4UTOA 4GOOD 4JJAA 4D45A 4G5FA 2FZVA 2W2XA 4Q47A 5JS2A 4GP7A 3CF6R 3IBTA 4FT2A 5BMOA 4YRTA 3V1LA 3VXKA 1Y1SA 3ND8A 5EGNA 4XQ0A 1JV2B 2LGJA 2F55A 2JCVA 3TOZA 3MF4A 3E3MA 1FP7A 1M6HA 2V1XA 3LX6A 1GU1A 4M6WA 1JB9A 4B3BA 2QX8A 3C6QA 5AVZA 2GN4A 3SS8A 3FMVA 5F76A 2FWIA 1M10A 3VOTA 5AHXA 1UMDA 1P3Y1 1P6XA 1OAOA 2GN1A 2G0AA 4AP9A 2Z83A 5KNLA 3IDZA 7ABPA 3DZCA 2JZCA 4CHGA 1NBMA 1XZBA 4S12A 3G0CA 1UBGA 1XB2A 3SX4A 1L5HB 3V4SA 4R2IA 3OZAA 3DAPA 1CY8A 5BW8A 1ZVJA 3FYSA 4PSVA 1R5BA 3SG0A 1BTOA 3KKQA 1PT5A 1PR9A 1H2WA 4RE6A 2HL6A 2CV1A 2WE8A 1R74A 1RQ7A 3KJFA 4J2TA 1VHJA 3OH8A 3G2LA 1DWOA 3HJRA 3KT0A 4FYKA 5CA1B 2GCOB 4NCKA 4YB8A 3IQFA 4WUVA 3K09A 5EMHA 5LMZA 3JWHA 1GLVA 3DV9A 5BN3A 2CB9A 1P9WA 1JZSA 2AWNA 2YHIA 1H85A 4DIBA 4DT1B 1M2GA 5JNSA 2Q9UA 3UJ8A 3RUDA 4FK8A 3FPKA 3T1NA 1FP4A 4QPDA 3EDQA 4BFSA 1H4QA 3MLBA 2UAGA 3K1YA 2IX3A 5F7OA 3LC0A 2YBDA 1IL0A 1QBGA 1OROA 1PQYA 3KXDA 4JP2A 2CXHA 5GJVC 2L69A 2BGJA 1XAHA 1QXSA 4QULA 1GPBA 2EZTA 3RC7A 3AUXA 5A62A 1OC2A 1V4NA 4MO2A 3D4PA 4IDDA 2JFUA 4J2OA 3V6LA 1U2DC 4YRGA 1QZUA 1AKMA 3TOCA 1T0IA 4R2LA 4UW9A 5KOJB 1POXA 2XYHA 3KE8A 4RQUA 3RJZA 3D1VA 2IXDA 5TT0A 1NFRA 2NSJA 1GAWA 4EBFA 2GO1A 2W4IA 2PWPA 2HADA 5A7GA 2G4LA 4XJVA 3TW8B 4BMOB 4DIUA 4X5OA 3FCOA 3LUDA 1GNVA 4JLKA 1RBQA 1MNAA 4MS4A 2H9AA 5KYWB 3E35A 4H7KA 3BDVA 1E5VA 3ELUA 3PHLA 4OP3A 4PO8A 4H16A 4BP8A 5C8VA 1JIUA 2FR0A 4K6CA 4Y1EA 4OOEA 3N86A 4UTZA 5MN6A 4CLRB 3HCAA 3ZZ0A 4QPPA 4UM9D 3VX3A 1E0SA 1CJVC 3LY8A 3ZZ1A 5KTRA 1V47A 3ESDA 4W9RA 2JCGA 3ZLBA 5AJUA 3HLTA 3QKIA 1C14A 1VG8A 1O87A 1T24A 2VH2A 1N5OX 3PHHA 4S1VA 4BYGA 2DU8A 3RU7A 3RFXA 2XNHA 5LQKA 1TECE 2Y93A 2AK3A 5A9RA 2CMHA 1MB0A 4FBMA 3B1JA 3CH7A 3ZK7A 4MV1A 5IF9A 1G2IA 2GASA 2VAMA 2YXLA 4MYTA 3ETDA 5DN6A 4B74A 4BEBA 1J5XA 1NJ8A 3PLRA 1CUHA 1EVYA 2IXGA 4N5MA 1GILA 4EGCB 1XK6A 1JEYB 4KREA 4CMCA 4ODIA 3K6KA 3UFBA 3MINB 1M0SA 1P0FA 3VYRB 3OAAA 3G0IA 1F6DA 4Q37A 1EGHA 4PSKA 3VPCA 4M38A 4R0NA 1CF2O 3AYXB 4LHSA 4G56A 3W8EA 1PZMA 1Y4AE 4H7HA 1Y9JA 2XJ9A 3ZC3A 5I6DA 4L57A 5JASA 1LBSA 4MQFA 2IYYA 221PA 3NBXX 1T5IA 4C2TA 1ZN2A 5C5CA 4U7TB 1DJMA 4YC7A 1DXQA 1NNLA 5CTJA 1Z8FA 4C0HA 3Q8LA 4ZVOA 2GPBA 3JSAA 1P7WA 3WQHA 4M4SA 4A1FA 1SM4A 4ZI7F 4TUYF 1KF0A 1EVQA 2WMYA 4AL4A 3OU2A 3QEAZ 5IBRA 2NTNA 4IDEA 3ENZA 3V9AA 4YROA 2C3MA 3M6IA 1K88A 4Q82A 5K3AA 2I91A 1Q0PA 2O59A 3A6DA 3OOSA 4R1OA 4L0DA 2H16A 5DLPA 4YJKA 2H8KA 2AHOA 4YTEA 1HFWA 1RU3A 5LJIA 2P41A 1VI5A 2JH9A 3HXOA 2VHZA 6NULA 3ER9A 2XMSA 3NIDB 4X6LA 4ER3A 3OURA 1Z4OA 3QPDA 2XUJA 4YDRA 4HAVA 1A5TA 1VPVA 3G68A 1W96A 2GAFA 2AI1A 3K9BA 4LY9A 4BLRA 4OBEA 4Y2YA 3NBYC 4PG7A 4AKEA 3TOVA 5SY4A 4F6CA 1NTOA 2WB2A 3GO4A 5A71A 1D9ZA 3I6IA 4TOIA 4X1KA 3UXEA 3WYBA 1FFDA 3NC0C 1X7ZB 2DFPA 4K28A 1L7NA 1EDDA 3N7TA 1J24A 4I19A 4LZWA 4BIMA 5IAOA 4GO1A 4FYJA 4HPJB 4RACA 3ED5A 1A9XB 1IM8A 1U0RA 1Q19A 2YZ7A 3DC2A 1X2EA 1ZFNA 2ZI6A 1XYGA 3E58A 3M6AA 5LP6C 3OQ1A 4DNFA 1WSAA 3NHZA 5DLDA 4B45A 3UPUA 1CQIB 1MX9A 2H4XA 1TCBA 4MQBA 3EZXA 2ZRMA 4D8XA 3GBPA 3RBZA 4EHDA 1U8UA 2KLHA 3V1NA 3M5CA 4A36A 2J3QA 4O4JB 4LAFA 4Y2XA 2DY1A 3VM6A 2G7MC 4CI0B 4DJ5X 1FRNA 1YQXA 2Y0BA 1HLFA 2X77A 4ZQCB 3TH5A 1FTGA 1YOVA 3H0CA 1YB4A 4X00A 3IUBA 4R9RA 2QQ5A 1GN9A 5CHYA 3F96A 2JGJA 4WBXC 4I6GA 2FK7A 1O95D 2NU6A 1H4TA 3GIDA 1SCKA 3QY9A 5JHHB 3W04A 2JZNA 1WD7A 3JVDA 3KSAC 4YUVA 5GZ1A 3BD6A 4TZKA 4LVUA 2JK1A 3SJ7A 4AZSA 1MZVA 1JDZA 2HI0A 2W6ZA 3CLRC 3S2FA 3CW9A 1IY9A 3ZCRA 2MYTA 3RYIA 3URKA 1Z29A 1Y0BA 2CVZA 1VJGA 1RKBA 2CFRA 2ZSIA 2R11A 1VIVA 2VZ0A 5ALEA 5ALLA 4B6GA 3L1JA 5IVPA 5AJVB 4PHFA 4EDHA 4A91A 4EKIA 5CITA 5LP6B 3KKKA 5KTMA 7AT1A 4G5SA 5DYIA 1T36A 3UH1A 1Q95A 1E8MA 4LKRA 3FI0A 1WETA 4AU1A 3BCSA 4UZFA 1FVXA 1Z15A 3O4VA 5AVOA 2FLKA 5C52B 2VK4A 3KXKA 2P30A 2G3YA 2QJWA 3PWKA 5FTMA 1K5HA 1DKRA 2ZIZA 3ITKA 3ODPA 3OC0A 2TSYB 4M1YA 3SIWA 3TSZA 4F06A 3I04A 1HE1C 4PAGA 3H1TA 2DULA 4UXHA 4HNTA 3L07A 3FYUA 5FPTA 4V1CI 4HVTA 1IOWA 2C82A 2WNHA 1GNQA 3MEQA 4OB7A 4RV9A 5FUMA 4D80A 1FFBA 1JWAB 1KC1A 1DADA 3IS3A 4QHTA 1JLKA 2VHWA 1U2EA 1TI7A 1CHDA 2ZRAA 3GRAA 1MJNA 3QMMA 4MVJM 2EGGA 3F6YA 3NTOA 3FWNA 1UOQA 4HQ6A 3DXXA 5FRDA 2WSSA 3TS1A 4JI5B 4YRJA 1W49A 2OP1A 4FHDA 4OK5A 2VPYA 3WK7A 2H51A 3S1SA 2O2DA 1RPTA 5IKMA 1MQ8B 3GLGB 1TE2A 4WLNA 3FLMA 3IO5A 3NQ41 4DMRA 3V55A 3AIMA 4ALIA 3Q2KA 3V4PB 5HBRA 3DLIA 2Q3MA 1EP9A 1LQ2A 1S3GA 4Z0HO 4HY3A 4NI5A 4Z1MA 4N47A 1Z4IA 1KFEB 2IY9A 2CBXA 3TECE 1MV8A 1Q7GA 4R9VA 1KQPA 3ETNA 3GD7A 1KS9A 4HK4A 3RUEA 4PZEA 4IUYA 5TEWA 4DPLA 3VPBA 4YASA 2AC2A 3PJEA 5FXMA 1VE7A 2CVFA 2KQUA 2W4MA 2YXNA 4HDCA 4PRZA 1HK7A 5ED4A 4DSOA 3CUWA 1Z33A 1W4BA 2DR3A 3CNBA 1WY7A 4G1MB 4M7PA 4XJSA 1BS2A 3F4BA 5J40A 1U8EA 2PXAA 3UMMA 4TTQA 3F73A 3X1DA 4JQOA 1JUDA 2X19A 3A3PA 4PF1A 4RGBA 5DI3A 2NU8A 3AH8A 2WM9B 2CHGA 1NIPA 1OVMA 4P3NA 5C4IA 3I42A 3EPPA 1T6NA 1SR8A 2J32A 4PGFA 3UCXA 2LRHA 3ZI7A 2CJPA 3G2HA 3LP8A 1AS0A 5H5JA 6CHYA 1VKHA 5IP5A 2RGNC 1SGWA 3QSGA 4YAFA 2AD5A 5AW9A 2O3TA 3GCWA 3IJRA 3U81A 4AJHA 3QBTA 2J85A 3HSSA 3JD4A 5CM2Z 4RLQA 4QEKA 4M3NA 2F6RA 2VAXA 3PUIA 4RMHA 4BKRA 1DI0A 1YCFA 2J0UA 1FK8A 1FTNA 1WLYA 3BHJA 4UBLA 5G2OA 3ICCA 2W2KA 1YQEA 2A2ZA 1TFRA 1YR7A 2H1WA 3IPXA 3KPYA 4ZYZA 5I8WA 1CJCA 1I0LA 4NHOA 4G5OA 5DFAA 1E92A 1DT3A 3AFNA 1I1QB 1L4NA 1P1CA 2QWXA 3DPIA 4UASA 3P9KA 4ZIRB 2ZAYA 5I9IA 3U49A 4OFWA 4Y9DA 1DXHA 4RHYA 1VYHA 1LC3A 2A33A 2DQSA 1II8B 2G0NA 4DL9A 4WCVA 5CGZA 1RXSA 5GVRA 1M73E 4UMEA 5YASA 2YJ5A 3G6WA 3HFRA 2UYQA 4ZHQB 1P2DA 5L3VA 5CT8A 4U7FA 1EG7A 1VYVA 2XTJA 4D9BA 2MMCA 5B55A 3EYAA 1IXSB 3AEUA 4B4DA 4Z51A 2Q2OA 2PTHA 4HFJA 1P2VA 2AXEA 3HVKA 3LXMA 3LY9A 4R8SA 1U7HA 2I55A 3HK2A 1F2TA 2Q6IA 2ZSAA 2AA3A 3A4LA 3GCDA 2B6NA 4WFKA 2UZIR 4Z3DA 2J5BA 4TQ9A 2UUCB 2YOHA 3LHSA 3FYDA 3UB3A 1KYXA 3WGGA 3QEBZ 1XA0A 2B1JA 1WMSA 1BS1A 2I4RA 2W2LA 3HXMA 1MVLA 3DVAB 2OHVA 1S8NA 1ZCBA 2IYFA 4US2R 2HCTA 1YONA 1WUJS 4GMDA 4PC6A 3AYZB 3OF3A 3HCFA 1WBDA 1SVIA 3D6NB 4YT5A 1U11A 3BFPA 3F6RA 4R0MA 1NVGA 1S89A 3H5IA 1IBRA 4JCCA 5DT9A 3OZBA 4M46A 1JSZA 4EVSA 4FB5A 1BWRA 4LXGA 3F3YA 3N8NA 1CEQA 1I0ZA 4B09A 4B4UA 1Z38A 1T9CA 4FP9A 4BLOA 1I36A 1TVCA 2CZGA 5H9WA 2BJHA 2DPMA 1E3SA 3U1VA 5GPBA 3FSGA 4EJFA 2AT1A 2W37A 2YWRA 4RQBA 5E9WA 1O0BA 2LDXA 2VTDA 2PN1A 1F4PA 2YRWA 5AIAA 2WZDA 4PE5B 2REQA 1MFZA 3LK7A 2F9MA 1O97C 1ZD3A 2HGSA 2I7XA 1LSOA 2ICAA 3AETA 4JQCA 4Y6LA 1IWBB 4DMHA 4E51A 5JC1A 5LZ5A 1ISSA 2P35A 4NFYA 3GPDG 5DX0A 2BSQA 1CETA 2R8YA 3GRKA 1TQ6A 1BFUA 4WN3A 3RC9A 3BK2A 3GJ7A 1YU6A 2X2EA 1BXRA 3EPKA 2QIOA 3T5AA 1G8GA 1I1OA 1PJCA 2FQYA 3SIRA 4PC2A 3GWZA 5C2JB 5C3MA 3Q88A 3KLBA 5EJ8A 3U7IA 1X0XA 2PPVA 2BMDA 1PG2A 4BNIA 3KB2A 1ATZA 4I4IA 3Q2OA 4LHZA 1ZNYA 3FOWA 5L3RA 5H3CA 1Z2AA 3PWTA 4QT4A 1NURA 2XB6A 1CNMA 4EOGA 4KE8A 1HYEA 2M98A 2Y1DA 5AVYA 4DA6A 2XGOA 3I2FA 3E9EA 1LXCA 4MW4A 2R6GA 3P9YA 1L7DA 1HUQA 2WAOA 1T43A 2NG1A 1AMUA 1T9HA 1GKUB 4XASA 1R8QA 3EFOB 1HDRA 5I7OA 1T1SA 1O8CA 5EIOA 3AVWA 4HRVA 3JU3A 3VVBA 3LT5A 4ISCA 2EL7A 2N47A 4MQ4A 4LDRA 4DJEC 4M0CA 2YOGA 1YC2A 4DCSA 2DHDA 4R1TA 4TTPA 1FUKA 5CJPA 4MTLA 2AG0A 3P0FA 3ZUGA 1RI2A 4KIGA 4PLWA 1G5QA 3Q0TA 1NPTO 4EUSA 1NWCA 1MG5A 4LSGA 1QB7A 1FYWA 2DB3A 4J6EA 4NULA 2ETVA 2XOEA 1YK1A 5FF9A 3GELA 3P4XA 3KKPA 4D9IA 1NULA 2I1QA 1NMYA 1L8LA 1XZKA 3ZDFA 1LPPA 3WBBA 1FPQA 1HT2E 4JLPA 3ND7A 5BORA 1ONNA 4QHSA 2CCJA 2HHLA 1Q1QA 2A9FA 3WSTA 5K0ZA 1GYQA 1HDXA 2R79A 3DAYA 2RB4A 3IEVA 4LX8A 1D1PA 2DLNA 2L42A 2AEFA 4CIYA 2WQ6A 2GRUA 3DL4A 3CSSA 4EZIA 5ALVA 4DDWA 1EWKA 2HMTA 1U94A 4EKYA 3EVNA 4RJKA 3OQHA 2A5LA 5IWCA 2VF7A 4QNNA 4M1WA 2XRZA 3B6IA 1QIJA 1EMDA 3T7KA 5DPMA 4YRKA 5KYGA 3RHSA 4DWJA 5JHGB 3TB6A 5F2EA 1QO7A 2B1GA 1DJQA 5KQPA 2GGSA 1J0BA 3T1TA 2CNOA 3AW8A 5H68A 3NANA 1PU2A 1TDJA 3BIFA 2RH8A 3BMOB 3R44A 4FNAA 3QUTA 4M54A 4P81A 1Q7EA 1VCNA 4TWBA 1XTZA 4FQ8A 1WW8A 2D8AA 4YPFA 1XZLA 1RIIA 1Y5RA 2GK3A 4BKMA 4YAKA 3KS9A 4N41A 1AKEA 2X6QA 4L50A 1DAGA 3F5FA 3OJLA 4PPGA 4WA7A 4YECA 5GM2A 5B7GA 3IEMA 3B1VA 3THWA 2X6RA 4TYMA 2A3NA 2OY0A 1TF2A 2IUEA 1YDMA 3VPXA 5F3DA 2QLBA 1SPBS 5DHPA 1JA0A 1LQTA 1ZIYA 3D7NA 4OYLA 4ABTA 1K7XB 3NV7A 1LSUA 3PC8A 2ONCA 4N49A 3M8KA 4PPNA 1RKQA 1JJFA 4QODA 3WZ2A 3OZUA 2ZJFA 3P2KA 5CDYA 3BWDD 4GKJB 1HDGO 2C29D 2VPQA 3T3DA 4C04A 1ISGA 2A14A 4R1MA 3KYDB 3IA7A 1RBMA 3C3YA 2BEWA 3Q9NA 3CQ9A 1PR3A 1XCLA 1YQDA 1ZXXA 2GJAA 5KYKA 1UZAA 1XCBA 2QTVA 3U4IA 1K9SA 3RVLA 5LWQA 2JVIA 2VP5A 4D56A 2YZKA 3MOIA 4XSHA 3ZWPA 3TRDA 2GZ3A 4XJXA 4MYHA 5DIZA 2EEPA 4KE7A 4YAWA 1KEPA 1MJGM 2IYLD 4MROA 3D3KA 1OWMA 3N6RA 1H94A 3QLVC 4H27A 4MUFA 2D1QA 4CT5A 3VUFA 3ZIDA 2V7WA 4OI1A 3H1BA 2W2VA 2XITA 2O52A 4KLZA 3ZDQA 4HQRA 4UAJA 3VZRA 3ZYCA 1EDEA 3K0CC 5FP0A 1MRSA 3RANA 4B5KA 1I5RA 3OCWA 3BCHA 4L3VA 4MV5A 3NS7A 4FTWA 2NYRA 4WW0A 2E89A 1E1LA 3RV4A 3UXYA 2O3UA 3V3KA 3GJ8A 3ZWQA 1UWCA 1SVKA 2HWWA 4INJA 5MGBA 3IURA 4IGIA 2BHNA 5H16A 1E1QA 2FNAA 5TS2A 1QE0A 4ZVLA 2D5IA 1K4MA 1VSBA 5EXEA 5FO1A 3PJRA 2V74B 3CNEA 1Z5UA 4CF6A 4MRSA 5T6MA 4G1EB 3JTMA 1PR5A 1S1MA 4DLKA 1A4RA 3NALA 1PW5A 4L8VA 2CUKA 3BIOA 1VZ3A 1ZOPA 5CB0A 4AMGA 2KLBA 3DMNA 5A02A 1BQEA 2XZPA 3JD1A 3UFXA 5AUPB 3HCCA 1LBEA 4TKMA 5CEJA 1L4YA 4HPXB 4IIGA 4YV2A 4FONA 5AM4A 1KZ1A 1BE0A 1NN0A 1HZJA 3HPRA 5E3IA 1MW9X 1DWPA 2Y4NA 4EJ2A 4BMSA 3ES9A 4P36A 4L9AA 4OUKX 1JKJB 3Q10A 1U0LA 4K0KB 5E9QA 1Y3AA 4XLLA 5DLQC 3UHJA 1JHAA 1YA6A 4B6SA 3LWNA 4S1NA 1C3VA 5C0OE 2GCGA 1E3TA 3U40A 5AW1A 1A8PA 1KRHA 1EHCA 3K16A 4QDKA 3H5RA 3QBEA 4ID3A 4MGHA 4OSOA 5KMGA 4V3BA 4FDTA 4PCVA 3S5UA 2B0JA 3N0XA 1LWOA 1XCOA 1LD3A 2BBWA 1T35A 2OM6A 4PLFA 3PXBA 3PKJA 1GFWA 5D85A 2XA9A 2DX7A 4N5HX 4XLTA 2WPNA 1E1MA 2ZITA 4HX5A 2F8SA 3ILXA 1WPQA 2KM1A 3AEYA 3TVDA 4K6FA 1L4KA 3MELA 2WU0A 4Y9TA 1AC5A 2AOUA 5AVUA 5LOVB 3SF8B 1OXSC 1IY8A 1UKEA 3AQIA 3D5TA 3NBZC 4OH7A 2F4VB 2FUKA 2XB8A 2E48A 3GN2A 3ZXUB 3BORA 3U37A 1G3RA 3LUKA 1SG9A 4O2AB 1GAEO 2P6UA 2L2QA 1AKNA 1KQNA 5KQSA 1E2PA 1EINA 2VXOA 2NP7A 2FR8C 3VSBA 1LX6A 2UUBB 5IJWA 3OUZA 3CVUA 1J7JA 2R1TA 1ES9A 2J9YB 3C5CA 3FDFA 5LXTF 1E58A 1RFGE 4M9UA 5DK4A 3DLCA 1XQXA 2HA5A 3JQ9C 1FP6A 3R7NA 3ZCPA 4F12A 3K70D 5EHIA 3IAS6 5TQVA 3TR5A 1WKCA 1VG1A 3L7JA 4ZV9A 3ZJ4A 1Y8RA 1Y8QB 4PYNA 1G5RA 4YP1A 5L3QB 2NYUA 2BI7A 3U9SA 3UWPA 5JH7A 1GL3A 1JE0A 1G42A 1XRJA 3FDZB 1E59A 2RCYA 3IHTA 4UM5A 1S7CA 2IV7A 1P2FA 3VZDA 2HGZA 3W6UA 1I7NA 3P5BA 4AO7A 3FYCA 1TZ2A 1K7YA 4FYXA 5EWJA 1YI8A 1V11A 3O8DA 5A6VA 1EK2A 2Z6VA 3LOPA 3DOOA 5DASA 3TXYA 5JCJD 4B85A 4XXHA 5CB6A 2AJ8A 1KY4A 2OG1A 2YRXA 4UD2A 4YUYA 3HWSA 2C2YA 2FZLA 2G77B 3A2MA 4GNRA 3T5CA 5KSOA 2IXTA 2ZM5A 2NVWA 1I2AA 4ND4A 2PKWA 4KG7A 5EINA 3FRJA 2ZM6B 2H0RA 5IDYA 3IVGA 2QLJA 2RAUA 4EJ6A 5B7QA 1TQ2A 3BT7A 3UT0A 1VJ5A 4IX1A 2CFSA 2OYSA 1DEOA 1DQPA 1I9CA 2OMKA 1OBOA 2FRDA 1NKVA 1Z08A 3NEJA 4N8DA 2EZ9A 3WFJA 3FZNA 2XNJA 4NFLA 1PD0A 3TLXA 1U9ZA 1W94A 1X92A 4LXQA 5HFAA 4GUAA 1QFJA 1WO8A 4O4LF 3X1XA 3OE7A 4CODB 3LKVA 3TIVA 4AROA 4RANA 2R3SA 1FXSA 3LE8A 2XLBA 4EKNB 4RZ2A 1XNGA 3OWOA 1FQKA 4GM1A 3COJA 3ROZA 2YV2A 2Q2NA 3BAFA 4G9EA 4EENA 2HNBA 3Q8KA 4XCXA 4OM8A 4YAEA 4GDFA 2P3QA 2L82A 1EWQA 3BGDA 1JQAA 4X1IA 4XJTA 3JQFC 3QVGB 5B4TA 2AR0A 3PQ4A 4GPAA 2J3KA 4MVCA 2XYVA 3GMTA 5ER9A 1IHUA 3QIAA 3G2QA 1D1SA 2Z4TA 2GJ8A 3H6HA 3LLCA 4ND1A 1SXJD 3RAJA 1FS6A 3B8HA 4I0WB 3ONWA 1EDZA 3ILSA 1Z0UA 1Z88A 3UMGA 2WMNB 1JHDA 4DM7A 1Y63A 2ECOA 3A14A 2D2XA 2NADA 3PL1A 2R7KA 2QBYB 3U7HB 1Y1LA 2DR0A 2ORYA 3G1WA 5DNEA 3USCS 1DIBA 4GP9A 1ZNXA 4RVOA 4CL0A 2FKAA 1EDBA 4M8SA 1PBNA 1FW6A 3HCWA 3OZ7A 1PJTA 3SE7A 1QGUB 2WUFA 3U3RA 1LVGA 1BE1A 2H0QA 3HVHA 1SVLA 3HWWA 3NVMB 2ANCA 5B3AA 4A8TA 2PLRA 2VPWA 3EEQA 2OCPA 1Z4JA 3LU1A 3O4RA 4R68A 2ASVA 4P4TA 5FTKA 4DYHA 2AC4A 4IL5A 4QOJA 4ZAXA 3S40A 4UTXA 2QRPA 1N5LA 2Z9BA 4C7BA 1XSEA 1SOAA 2P1ZA 2ECPA 3BWYA 2FSFA 1P73A 3WTBA 3WSWA 2VF4X 4N9QA 1ZK4A 4MITA 2AZXA 4HHEA 2QLNA 3RK4A 3AO0B 1X3LA 2C5AA 2Q5HA 4I5GA 4MKZA 4DEYA 1A3CA 1T8SA 3E7WA 4EW3A 2R00C 3AHFA 3VR4A 2O2HA 4ZJUA 2H2GA 2VRNA 3WMFA 5JCXA 4V03A 2GN0A 9ABPA 3ZDCA 1AN9A 3PSHA 2AD1A 5H82A 4PG4A 4K6GA 3X1KA 3AJAA 1C3EA 1Y5NA 4H1UA 1ZCZA 4OQDA 4EI7A 1Q83A 5FA8A 3SVZA 1KORA 4RHTA 2EP5A 2QORA 3KOMA 4ZI7B 2QUJA 2O57A 2PKCA 1OD6A 2AIRA 1OJLA 3DBLB 3KKLA 1TU4A 3A9TA 3I1YA 3KQLA 4DN6A 2D2EA 3RFUA 2RIRA 1F06A 4KN8A 4PYQA 3WV4A 1QRSA 1Q16A 2AFIE 2XOXA 4Y2UA 3RGWS 3C2QA 3FRIA 4GMKA 2H4HA 1Z0AA 4WVLA 3MT0A 1NUSA 2YWJA 1ZBDA 3AILA 3E1GA 3SHFA 1EBFA 4AUMA 2UZ0A 5KJ6A 3KAJA 4S24A 1A1SA 3WRYA 3ZYZA 5IARA 4YNBA 5JR3A 4XE5A 1E2JA 1PJRA 1RJEA 2PHZA 5GINE 1PTJC 5FL3A 4P31A 3GGDA 5KYUB 3LUJA 1TNDA 3UAWA 3RS0A 5TMPA 5EXSA 1C1XB 3PD7A 2CDRA 3NHAA 3RLIA 4GR4A 2ZUWA 1E4EB 3U4AA 3E22A 4F60A 5AM3A 5JZBA 1QQTA 5KNDH 4G0OA 4FCTA 3SMQA 1USWA 2Z0MA 3ADKA 2J9GA 3NXSA 3OECA 5C18A 2HHHB 1TO1E 1JW9B 1DTWB 3RSLA 3K6JA 3OZIA 1B1AA 1XTRA 1T9GR 3GVHA 5BYKA 2VJDA 3D4LA 1XN4A 4DUYB 3JRXA 4YJ2B 2HEIA 5HMMA 3P19A 1SHJA 1KO1A 2BGWA 4MW5A 2P2LA 2CHUA 4XR9A 2HDOA 3DOUA 2O5EA 1GSAA 1LJ8A 3CONA 3GP8A 4TV8F 3JQEA 5AXBA 1Q0ZA 3KHSA 1KARA 3SNKA 1E1CB 4ZZ2A 1I1HA 1NX9A 2JCBA 2VK2A 5BPFA 3ORSA 2AJTA 4CQMA 3DTVD 1HEYA 3LIIA 2C5LA 4JP3A 1XJCA 4H7DA 1NLMA 2BW0A 3I0MA 2XEXA 4BMZA 4LNUA 3H6KA 1XTPA 1Z0SA 2CFIA 3OOJA 5EZSA 4HXEB 1E62A 1K0UA 4RXTA 2R7MA 2F3SA 2QRUA 3IUMA 5FNVA 1TO6A 1U02A 2I6GA 5BN5A 4MW1A 3FA2A 1P61B 3OEHA 3L8EA 1THTA 2UZ1B 2CWWA 3RS4A 1W0KD 3C8ZA 1ZHFA 1J2UA 2PSHA 1BHJA 4EFLA 1NP6A 3GFOA 1P81A 3DYBA 4ZI2A 3HEAA 4J43A 3JQAB 5D5QA 2YW9A 2AYYA 4E5DA 1EX6A 2FE1A 5K5EA 3J80A 4ZVUA 1TT7A 4W1QA 3EGIA 4X93A 1U6KA 2XUIA 1B42A 1TCUA 5CTAA 1RM4A 2X8WA 5FIUA 1XR3A 3KQOA 3T5GA 2FEXA 3PG5A 5JCZA 4KAJA 3EZGA 1XZNA 4JDPA 2YQ4A 1GXSA 1CJUC 1H8EA 2HV9A 4MW0A 4QTZA 4HWKA 4YCBA 4RC9A 4RTRA 1U9IA 3D2CA 1O9HA 4M9ZA 3ZU4A 1K63A 4A8HA 4QYXA 1J49A 2ETXA 3OX1A 1ZH0A 1XEAA 2PUHA 2EFYA 1C30B 4KQWA 5AK4A 2C31A 1IE3A 2HAEA 3FIJA 1M54A 4HXGA 1ZZEA 4P08A 3RVJA 3BL6A 4JJ8A 4GR9A 3WGNA 1T10A 4AWBA 3UGJA 3UEOA 4EKDA 3RV3A 3CE9A 1QONA 2VUHB 2ZDGA 4CRWB 3PNVA 4J7XA 2FQXA 2Y9MB 5ESWA 1CFJA 4DMMA 3RVSA 3T34A 1N6RA 1DV2A 2V3VA 1SEPA 2V58A 2GEDA 3I34X 4ZCMA 1R6XA 4HAZA 4DSZA 1BMFA 3STHA 2ZYAA 4QRDA 5JSZB 4CLOB 2IYQA 3GW8A 5I9MA 2OBYA 3C0KA 1ACJA 5AI0A 4AP5A 3A2KA 1F2DA 2HNAA 1HRKA 3WLFA 1XZQA 4AICA 4YACA 2YQZA 4MKIA 2EFJA 2H0AA 3JQ8B 3IRVA 1AS3A 2DFDA 4L0MA 4CM8B 1TYCA 3TTXA 4PBSA 3NT2A 4OLHA 3MGKA 5J23A 4A5SA 4EPVA 2PUDA 3N2GA 2IZ5A 4K9PA 1H5QA 1S2NA 3UXHA 4X3CA 3C6BA 2A6PA 4OKIA 3AZPA 4E22A 2A0UA 2D1YA 5FBHA 1NYQA 4FMCB 2XXAA 2PH1A 2WTBA 3R6WA 3PR1A 5SYMA 2C2XA 2WM2A 2MR5A 3ROMA 3QI7A 4XIFA 2WJPA 1WQ1R 3PFNA 4RGYA 5CX1B 5F64A 1DJPA 3ZLTA 4QJ3A 1N7HA 5HPYB 1E6EA 2PH3A 4XOIA 3ILHA 1SVWA 4WL0A 4Z7JA 4X84A 2A0KA 2OHFA 1LRJA 2RDMA 3M6VA 3VPSA 3WK4A 2C78A 2P2CA 3U6BA 5EMMA 3GDHA 1JIJA 2Q6OA 3VO9A 2B4KA 4A8JB 4RXUA 4H1HA 4DPMA 1Y34E 5MF6A 1RI1A 1UBCA 4C76A 3O90A 4C07A 3OFNA 2O14A 4DCNA 4RENA 2ODPA 3HXPA 5B1EA 1N1GA 2DECA 1DNPA 3VZSA 1YS7A 2KMLA 5IXSA 1AVTA 1SOUA 3KQMA 1FOEB 4UUOA 5JYEA 3S81A 1IPEA 1NG9A 2RKBA 3HRIA 5K20A 3LX4A 2WSBA 2RGCA 4B3RB 1XVLA 5EMKA 1N2CE 4B7CA 2HCFA 5CB8A 2XWBF 1L3IA 2FOXA 2QMEA 2D1TA 4DR3B 4FYPA 3ID6C 5GM1A 5IJAA 4GPEA 3ONNA 3HJTA 1E9SA 1H2BA 4F8YA 3FBGA 3OU6A 5J9FA 1N2JA 4E2FA 1V3VA 1VFNA 3HYCA 4W99A 1L5HA 3T9AA 3LP5A 5HVNA 2CK3D 2Q5IA 3KB1A 3OTHA 2VDLB 4B3TB 3ODGA 4KIFA 4PRYA 2P5SA 1KVUA 3H7IA 5EXDA 4FR5A 3NWJA 3WKDA 4RTSA 3QMVA 4DA7A 2C8JA 2XBLA 5CA1A 2GCOA 1I4OA 1RADA 1XC7A 3ND6A 2XNKA 3RIHA 2YN0A 1N5IA 1YIOA 4G3XA 3RODA 3K73O 4H6WA 4D0LB 5K03A 2ANBA 4DT1A 4ZT4A 1ODKA 1TMYA 2BCGY 2BHLA 2GK7A 1RQLA 4ZAZA 3SXJA 2WU4A 3O1HB 4R0VA 1Z2PX 2AYZA 2QHXA 5AK3A 2B3DA 3CT6A 2WJZB 4NMLA 3B1ZA 2GJKA 1EXNA 3PR2B 4TLLB 3BZBA 3TQOA 1XZCA 1XVTA 1TKAA 2W6CX 4LRTB 4U3JB 1CUBA 2VR1A 3T1VA 4EGQA 5K4HA 1XD8A 1QIMA 3HU2A 2C5FA 4D99A 1HF3A 1LPSA 4WHMA 3OZSA 3V1KA 4IZ6A 4URVR 1XU4A 2AG1A 4PN7A 6REQB 5FLYA 1E1YA 1V6AA 1YRYE 3R6GA 4YQEA 3UJ7A 5KOJA 4HDRB 1ONOA 3PXGA 1VJRA 2XWQA 4IIEA 1GNPA 1DAEA 3BFXA 2IDZA 4IJ5A 3TW8A 3S7TA 2E5WA 2OA0A 2WE7A 3A1DA 1ILWA 3WL6A 4LF5B 1L4LA 2OVFA 5FL7D 4DYDA 3NUGA 1E0KA 2PGIA 4FFDA 4J0GA 2A0XA 4RIHA 1CRZA 4ETIA 3ZY3A 4LUCA 1JMYA 1N6NA 4XIIA 3IXLA 1T2CA 1XN1A 4UZSA 5JANA 4PHTA 2O8VA 1PR0A 2XWJI 4CLRA 4PX3A 2OKCA 4JYZA 3WGZA 4Q66C 5CBKA 2FE4A 1OLOA 3IVCA 3O95A 2CJWB 4D4MA 2VXYA 1TYDE 5JSFA 1BIFA 3TJZA 1B8UA 3F6EX 3KZ1E 1P6UA 2BT4A 2PT6A 3FETA 1XA4A 2W48A 3ZIAA 1U2DA 2Q6KA 1PUJA 4RK1A 1P45A 2JDID 3KVYA 1I7SB 1RRFA 1A9SA 2J5KA 1RI3A 1JQJC 1J56A 1EZZA 2J5RA 1UXKA 2A57A 3CZ4A 3I5MA 3L7AA 3COWA 1DU4A 4CCYB 2LCFA 1LLFA 4D92A 1TKCA 2QLFA 1JEYA 1WBJB 3CM0A 4G81A 3MINA 2X22A 3MQ4A 4FMDF 3WNQA 2GO7A 2JLQA 4EL0A 5FWAA 2QF7A 1W4AA 1SCIA 2VN8A 3ETCA 5GJBA 1BROA 1N2ZA 1R8JA 3DUWA 3PGMA 3OFVA 1UKAA 4BZZA 5ES4B 2W70A 3HB0A 4RF3A 3M4YA 3WGMA 3NIWA 4PFKA 1QCYA 5M2QA 1Y81A 1BEEA 1VSTA 2QRVB 2WU1A 4BEWA 3IP6A 1KYQA 2C9MA 4UPEA 2F90A 7REQB 3DB2A 1G21B 1RWVA 1RYYA 4MYUA 4QXPA 2P9EA 3FR7A 1OFGA 1MIOB 5B4VA 1C2YA 2YCLA 1KE1A 1RAFA 4BDSA 4WFJA 1G3MA 4LY6A 1W5SA 4QWMA 2XMGA 2VJPA 1T8WA 3I58A 3IMKA 3I9JA 1QU3A 1JU9A 1BOOA 1BQ4A 3H5LA 3NOXA 4OHCA 1KYYA 3GC6A 4Z3OA 5HE9A 5HTKA 3PNQA 4Y6RA 2FPXA 4U8GA 3W1WA 3RIYA 3NT4A 2CYCA 4G5GA 3AU9A 4J6FA 2C58A 2YS7A 4HI0E 4UCQA 2XYGA 1FL9A 4P4SB 1XDDA 3QYFA 4JFRA 1FLVA 4D96A 2QTWB 1RW4A 1C0EA 4O1MA 2G1UA 1YSCA 3BXXA 2JJ2D 3USZA 1XV5A 3ITEA 3NFRA 4M8LA 2WIFA 3K0FB 1PYDA 2P7IA 3DO8A 3I53A 1D2EA 1O94A 2IS1A 3PDCA 4LYGA 4F0JA 4E94A 1AURA 5E6SB 3P9XA 1NBWB 5JE8A 3LRXA 5DOZA 3GUUA 4NU6A 2HV8A 4AM8A 3D0RA 1X7ZA 2P4QA 2HA2A 3W4IA 4NNOA 1NMZA 1RXYA 4YJ3F 2BKLA 2H8GA 4B82A 4GVLA 4YI5A 3BH0A 4PX2A 3LHIA 5AVRA 1A9XA 4DE5A 4O3MA 2ZYVX 3TSYA 5DO9A 1H2FA 1NE2A 2G5CA 1CQIA 3U09A 3LM8A 1KL7A 4EHAA 1F4LA 1TQDA 5E0KB 3IEPA 1MOPA 1YK0A 2V6MA 4H6VA 3ZU6A 4JI1B 2GN9A 4O4JA 4QTXA 3O4GA 5ERYA 5CCEA 1L5VA 3B12A 1EVEA 3L8CA 4XOUA 5TEVA 3SHQA 3IUQA 1QAQA 3VV2A 3WADA 4Z7OB 4OA5A 1NDHA 1GJRA 4J94A 3RIXA 4BVLA 5LFAA 1A04A 1FNDA 3FH0A 1V95A 3EIWA 2QRGA 3WBJA 3R6LA 4V0NA 5K3EA 2BBTA 4DUGA 4RA6B 3R40A 2I4MA 4PQEA 1MAAA 3R3JA 1PX2A 3E27A 2W6JD 3H2GA 3SBEA 5FHRA 2WKPA 1PYOA 1ZJ6A 4F91B 3L18A 3X1MA 1OIXA 3KZKA 2XCLA 5JCOC 1KZ7B 4LZJA 1YS4A 4HAXA 4PO3X 5BVHB 4HNVA 1USVA 5KINB 3GLIB 1D2RA 4GI1A 4JWTA 3THSA 3T5MA 1YH3A 1MEOA 4P0TA 5BRAA 1ZX1A 3O74A 5SY6A 4AD8A 3ZHCA 2Z6UA 3R5SA 4CV1A 2HKIA 2HTFA 1EM8B 5LP6A 1ECFA 4CE6A 2HYIC 1IXKA 1NUTA 1ZIOA 4C7KA 1IQRA 3PU6A 5LUBA 2O7VA 2ZWMA 5IFKA 5JNVA 1E3DA 3TIFA 1T6XA 4K9OA 5IM4A 4B2YA 3CZAA 5LQAA 5F1PA 3EXG1 2BDUA 3H0KA 4I9FA 1TK2A 4W1RA 5HDBB 3QFSA 2QLTA 2O5RA 1VQ1A 4LOAA 3ZI0A 1RYZA 3ZWMA 5I7SA 4IW3B 3LX5A 3K1TA 2BFDB 2C9CA 2SICE 1E6MA 1SQFA 3DKIA 3F90A 4PHCA 3J81A 2BE9A 5JAOA 1JEQB 2JJ1D 5C1DA 3ZD7A 4H1VA 3IOEA 4Z3KA 2PBRA 2I33A 4KFSA 4LY0A 3KTAA 2HQOA 3O73A 3TLZA 3PC6A 5HS4A 3DR5A 4E6PA 3OBBA 3ZZNA 4AMYA 2V97A 3MHTA 2J5XA 1W4ZA 3HWX1 3S28A 1Z37A 3ASUA 4ZA2A 2B8EA 3UAOA 1PP4A 1EXVA 3EVEA 5K6AA 3E5NA 1AF7A 1RRGA 4W5NA 2GEKA 2PZBA 3GG9A 2KWIA 3VR3D 5WRFA 4DBLE 3IPRA 4A0HA 3GLGA 5BWOA 1G5FA 2HR1A 4R7TA 3HP1A 2QW0X 5IJ0B 4QXAA 1GGNA 2WTAA 4LDPA 4NPAA 1GA6A 1GOTA 3VKVA 1NMXA 1YJCA 4ZMSA 3WA7A 2DQYA 2AL7A 1OT5A 3GP3A 3AY7A 3OY7A 2PL9A 1RACA 1E1RA 1HFJA 1SBHA 4NAVA 2JI4A 4OFBA 4HVAA 1L5WA 4BAUA 4C14A 4EW2A 3KQQA 4XYEA 3SYRA 4IDNA 5AQEA 4A3SA 2AFRA 2TECE 4IIHA 3OPNA 1QHFA 3T5PA 4XYGA 3L4KA 4M1QA 3RRYA 2G09A 2ZB7A 1CJSA 2IEBA 4KNYA 5FOXA 1HQCA 2OBMA 3I01M 1K5GA 1WEHA 4J29A 2Z8YM 2G9NA 1MLDA 2IDJA 3AFIA 3QFRA 4JWKA 5DHSA 1NC3A 4CG1A 4F3TA 1I3KA 1JAXA 4RCYA 3ROFA 1AKYA 4EB6B 2UZ4A 2ZTVA 4QGBA 4LXUA 3PDWA 2WKRA 1ECPA 1VRCA 2EC5A 3O9ZA 2IHKA 2XTNA 4A6DA 1IZ9A 1UKCA 3EPRA 1NI4B 2NUPB 5HE8A 3I23A 3M81A 3JAKB 4IDPA 4CZ2A 3TIXB 4C4RA 2HU2A 4QXRA 3DV2A 3QBJA 3GAFA 4MZXA 4RPLA 3TNYA 3WO1A 5F9HA 3L0DA 2FB9A 1ZM4A 3RGGA 3C1AA 1KFBB 1W73A 4TS4A 3LDGA 2IV2X 4C1NA 3L4EA 3D4IA 4BX3A 4CGYA 3C3BA 1D4AA 2IYOA 2O07A 2V6GA 1M8KA 3CLHA 4BFCA 4KMOA 5K4GA 5LXTB 5KPDA 3S8MA 4J0IA 4EJSB 1U1FA 4PRKA 4WXHA 3T1YB 4AKIA 1GUZA 2WJYA 2AG8A 1WCV1 3OUTA 1N6HA 4L27A 4LY3A 4NMMA 3I52A 4QFCA 4BZPA 5KOHB 1MQAA 1UL1X 2JASA 2W11A 2ZW9A 2RGWA 4ZIRA 3RSFA 2OBBA 2BP7B 4OBXA 3KAKA 4EJ0A 3RAEC 1II8A 1IOLA 1OLXB 1HYGA 2ZYTX 4CNQA 3ANMA 1MFPA 3TCXB 2F4NA 1EHIA 3KP1A 4IVNA 4K0RA 4I3FA 3KVNA 3CXRA 1L4UA 2AWOA 3N6XA 4FHCA 1RPJA 5K8JB 3I09A 3E9YA 3MQ2A 4ZJZA 5H1YA 3I2HA 3V8NA 4KR6A 1RSZA 1Z5PA 3B53X 4IV8A 5HS6A 2RGNA 4TLMB 5EZYF 1J33A 1NR5A 2YICA 4TXJA 4KCGA 1U0HC 1F51E 1XZIA 4O4IF 2B5OA 3RC2A 3RDPA 2Y1KA 3DCYA 3MHPA 3K9GA 4YXWA 1KQGA 4LGMA 4MKRA 2IHUA 2BJVA 2OCDA 1K92A 1LPBB 1CT9A 4QL3A 8GPBA 3LQRA 1NF9A 2KYRA 2ERXA 2AQKA 4G5QA 5GWXA 2E5LB 1XVAA 2PBLA 4TTVA 4ZO6A 1VKNA 3MB5A 5EKDA 1NXVA 5D7NA 4PFQA 4KODA 3II6X 4MGZR 3C3AA 2OGSA 2OKGA 1YR3A 3BBLA 1GTRA 2IA5A 1SOMA 1UOOA 2ZYSA 4M8NE 3GLRA 4B75A 5ITVA 3C3MA 1VA5A 1GRNA 3RVKA 4JI8B 1ISFA 1W35A 3W9BA 5LKRA 2Z5VA 4R84A 3PPVA 4V0QA 3N8DA 3DHEA 3ZCUA 5KQLA 2PGJA 2DPHA 4NDZA 3FJYA 2CXXA 2A9OA 4WOJA 3C3JA 3WLAA 3M5WA 2QLMA 3WS7A 1XRNA 5H7XA 3W34A 1NW7A 3HUTA 4BNMA 4C2AA 2D3TA 2FVYA 4ZYUA 5L3ZA 1UPFA 2FEKA 2GA9A 1JXAA 3ESCA 2CLIB 3MOSA 5B12A 2FOIA 2EFEB 2IEAA 2HCRA 4BQQA 4DEXA 3IQEA 1UP7A 3S2GA 1E4OA 2BPOA 4KXXA 3I9NA 3VKFA 5ALXA 4FGKA 3ADOA 2AQIA 5ESXA 3ZHRA 5I3CA 4KWCA 2QYTA 3D8SA 1X80B 5EXXA 4DA4A 3SZGA 1ZAKA 3EWIA 1T2NA 2FW7A 2QG6A 5KNDD 1SULA 1VPDA 2GXQA 3N3AC 4G5HA 4F72A 3IV6A 2WNIA 3DOIA 5BQFA 2O2EA 1N36B 1AO3A 2X42A 4CCAA 2Q5OA 2YWBA 4O1IA 1RRKA 1H3FA 2FLWA 1XU7A 2IY8A 4IVQA 4KI0A 5FWXB 5K8CA 3H42B 1FMCA 2ALJA 3UATA 3WXMA 3LZCA 4UM9B 4I2VA 5A06A 4DCPA 3EFOA 4E0BA 1ZS9A 4FDUA 1FNCA 4AJEA 3X1YA 4POAA 5EQDA 3MS2A 2HK7A 4QG7A 1O5TA 1POWA 3DE1X 5KU1A 3UCEA 2FUG1 4PFJA 2J3JA 3DE0X 1XDWA 1VSUA 4YO7A 3R5FA 4S1TA 3L79A 4CLHA 5HIMA 3ZEIA 4NPCA 2ZDQA 2O6LA 1V4VA 1HI9A 2DERA 1XWWA 2O0LA 5K0GA 2ATCA 1MC4A 3JWEA 4Q15A 4PTZA 1DX6A 4BO0A 5B3JC 3A4YA 3KX2A 3JQBC 2GPWA 3CW2A 2OWDA 2FPIB 3E61A 3K5IA 3ZDYB 1XZFA 2ZS9A 1OCEA 3PA8A 4BNKA 5C8YB 5FI0B 4DWVA 3WMWA 2AJBA 4LXYA 4FYWA 1AB6A 1R7RA 1AXRA 2XADA 4JQSA 3GGPA 2D0DA 1K2WA 2CL7X 4HRXA 3K9FC 3ZE9A 4GXRA 1U0OC 4GEKA 5KAMA 3H65A 4PRLA 1Q15A 4IWNA 1SUWA 2VP2A 2AEMA 2WV7A 4NFSA 4DSUA 1JIXA 1H2YA 2R8ZA 3B48A 4QGAA 3LP6A 3N8IA 1E9AA 2QZ9A 1SJ9A 3TLGB 1XFDA 1DQRA 2W6ID 3T7DA 1ORHA 2Y66A 3TDKA 4DJFC 3DOFA 2CUZA 3MUOA 4FQ5A 5I4KA 3G89A 1G41A 3QXCA 4NU0A 4DLPA 3T3PB 2C4VA 4KMMA 4HZUB 4CQLB 3BMOA 4MRPA 2ILTA 4HLDA 4ROTA 5EYPB 3T3EA 3UBTA 2DR2A 4FFLA 1XD2B 2P5YA 2BF4A 5AXCA 2JVKA 2XBMA 1R0ZA 2OLJA 4U2EA 4FJ0A 5BNTA 2WYWA 4XYMA 1C4XA 1Z0DA 3U3XA 2EP7A 3AESB 5K0BA 4RADA 4GG1A 3KYCB 4JB8A 5CX4A 2FN7A 2JANA 3OZDA 3PENA 1XQWA 5B4UA 4JXZA 5G1PA 1HEIA 3L6EA 5ALKA 1OLUB 2BFBB 5DYWA 5EP1A 4JL8A 5JSUA 5JAUA 3VYWA 2W93A 1TPZA 1KO7A 1GPNA 3D54D 1FMLA 4RVUA 1VL2A 1DAIA 4L76A 2X8BA 1E8DA 4UZEA 1X1SA 4YMWA 2GN8A 4WMLA 5JC8A 3ENQA 3WRWA 1MG0A 1II0A 1Q0LA 4I5EA 3NI2A 1HOXA 1JALA 2YUTA 1TLLA 2AZ4A 2QY9A 3IOMA 1JEEA 3KYDA 4MCAA 4OUDB 3HDTA 1YDWA 1A95A 3GBVA 3VSDA 1W0JA 2XZOA 1ONBA 4C06A 1EFPB 1H8HA 2GKOA 3CSDA 3N8GA 1AMOA 2PBFA 4HLQB 4YAOA 4D25A 2Y8EA 3SGLA 3V1UA 1R0WA 4X61A 1M9NA 1SN7A 5CYPA 4AECA 3KR9A 3EOBI 4M89A 3EZFA 4YMIA 1KOLA 3ZE7A 4OK6A 1ML4A 4RPKA 4NFHA 2PJZA 3PFBA 3G5TA 1I30A 2Z58A 1N0WA 3K30A 4FFPA 1K3FA 5E2IA 3T4PA 2VSQA 3X3HA 3U3OA 2YWEA 4Z4FA 3A31A 4ZALA 1ETHA 3RBXA 5DTIA 3GDOA 3KCQA 1NSTA 3NXKA 4RD3A 1O2DA 1CTQA 1PS8A 1IYZA 5LN1A 1XROA 5KX5B 3Q3HA 1MC5A 3QOXA 4JX8A 3M83A 1HNWB 4W6ZA 5ELMA 4FE4A 2Z2JA 4V39A 1OB2A 4CMGA 2J0EA 5ADUS 2FG5A 4ZN6A 1V7CA 3QELB 3U13A 2FHSA 1R6AA 3C3WA 4ZO4A 3JALB 4RSHA 4IIUA 2FUEA 1Z13A 1IIRA 4I1OA 4K5QA 4Z8XA 4BMYA 2CF6A 3E9QA 4BHTA 5E3HA 3PXAA 2F64A 5F35A 3TEJA 3B1YA 2LXNA 3DWFA 1B73A 3P2MA 2OXCA 4RZ3A 3SU8A 1G4HA 4GWKA 4E4YA 3H2JA 4DNPA 5AD1A 3ZU5A 5KQGA 5JS6A 1O6ZA 2QGNA 3VH3A 2PRYA 4FNMA 2V6IA 1WABA 3GFRA 2OB1A 3IE2A 4FHGA 1H6BA 1NZJA 2YMMA 3PGVA 4G5XA 4KN6A 1GGMA 4LCBA 4RVGA 3QLVA 1YBMA 4TXHA 5JAPA 4KL8S 1M2KA 3DDNA 1Z26A 3OX3A 3SR0A 3IBYA 1ZJZA 3UGKA 3GX1A 5EKSA 1AOXA 3MJCA 3FROA 3F5MA 4B3XA 3K0CA 3G5AA 16PKA 4QDOA 5K3FB 2WM8A 1GZDA 3PPYA 4JVLA 4LMBA 5AW6A 1VBFA 4LWQA 3ZZMA 3E2PA 1URPA 1MDFA 3P9CA 1T0HB 2OQ2A 1E2UA 4LYEA 5KCZA 2FMHA 2J6CA 4D9KA 3P8ZA 3BRWA 3EMKA 3BE6A 3F7MA 3T1OA 3NC4A 4AXXA 2NGRA 2DLCX 5ADVA 2VJBA 3F97A 4GKAA 1WZ2A 1H4VB 1KMNA 2ZRLA 4IZOA 1SC9A 4KX5A 1E5QA 4ZT7A 1UH5A 3LH5A 2AKEA 5K8TA 5LOVA 1APBA 1KYTA 4GGOA 1NVXQ 4TQAA 3SF8A 3TAXA 2GZAA 3VO1A 2FWRA 1QUFA 4P3KA 1W1IA 4KK3A 4P34A 4JUDX 2IE8A 4EJMA 4Q9JA 6ABPA 3CW8X 5A9TA 1XTBA 1E1NA 2FH5B 3L49A 4O2AA 3NCHA 4DXAA 2E18A 3R7FA 1DKLA 1TM1E 2DPYA 1GEGA 1QHYA 1T8UA 2OHGA 1EFHA 2DKOA 3NVDA 4MXDA 3ZZUA 4BLVA 2GEJA 2XE7A 4MVJH 2O3RA 3OO1A 5CXSA 2D0OB 1VXOA 4HV4A 3D43A 1ZJWA 2IIPA 5JJBA 4MPTA 1L1FA 4N6OA 5LYJF 5JO0A 1TX4B 1Y8QA 4B7XA 2QTAA 4HWOA 4BVBA 4AY3A 1NIJA 3RVDA 4X8MA 3BMNB 2V0CA 2DG2A 5IDQA 4DV0B 3MTDA 3L0SA 4WZAB 1UMCB 3FDZA 2CLDX 4BKOA 3I0ZA 4MP3A 3A7DA 1EWYA 1NDUA 4Y2TA 1G7RA 2DJIA 1VGRA 3GJYA 5ALMA 3AGPA 1ULTA 4G4SO 1GTL1 1I7PA 1I2BA 1WB4A 4R2JA 4UM8B 5LJLA 5DW0A 1MX5A 1JYEA 2CZQA 4OQZA 2PJUA 2HRRA 1VP3A 2R86A 2ZSDA 3M33A 4KGZA 1R0KA 4ZT6A 1G6OA 2OSBA 5KNBH 4UHFA 1LLDA 2VNAA 1QE3A 1VL8A 4GMXA 4ND8B 4QJ4A 4HCJA 4YGXB 2XECA 2AE2A 1SCBA 2M6SA 4P3OA 1GCOA 2BKEA 3ABRB 4AYWA 4X6YA 1Z74A 3H8JA 2FSPA 1M1YB 2X14A 1BH6A 1CKEA 1QOZA 4G1BA 4YCAA 1N1DA 5TPWB 4AP6A 1RAAA 4MV7A 2JLZA 3HCNA 1YR2A 1WUTA 2Q7XA 1SUSA 2UDPA 3E23A 3OLYA 4H9GA 4MOWA 4S1WA 4ZXPA 5KS2A 2IS4A 3VC7A 5DNAA 3FF1A 1RRVA 4ON9A 5FORA 9MHTA 1VIAA 3C87A 2J45A 3LSTA 1EE2A 3KL4A 3OCYA 2XTMA 4C4TA 1HSOA 2ZB8A 3BWBA 5DYNA 1TEZA 1HT1E 4PWYA 2IHJA 2Y1CA 4R3NA 2E4XA 3I28A 1CR0A 3PFIA 2ZTLA 2I87A 4RZHA 5K3DA 3QVGA 4MEJA 2JJMA 2VYVD 4E14A 1JR3D 2UYYA 5A7HA 1NA5A 1J20A 3HZZA 4ZC1A 1UJMA 2V9CA 2WAYA 5BN1A 2PRJA 5K3SA 3F98A 3SF0A 3VOBA 4JN6B 5CG2A 3BJRA 2LNDA 2Y92A 2HWUA 1GZ3A 1LPAB 2WUVA 2YFYA 1H2AS 3RB8A 2C84A 1Q77A 2V7BA 4AJ2A 1K5DA 1WZNA 4PANA 3SLGA 1FLNA 4UUAA 4JR1A 3WBKA 1IEXA 4RD2A 4ESVA 4TWIA 2QBYA 4C7OB 4J7AA 1FF9A 2QX9A 2VKQA 4BV8A 4CM9A 5C46F 2EX0A 2XVMA 3AR8A 1TM2A 1W59A 4FSHA 4Q93A 4PNZA 4JLDA 2PCLA 4XM0A 3ITNA 1QGUA 1ZRMA 3O3NB 2VAWA 5FFMA 1UJ4A 2PD3A 2FSVA 1JJIA 3X2FA 2AXNA 2H2AA 3EEIA 1K2VN 3INGA 3MD9A 4WJZA 1F6BA 1HDZA 1QRDA 2G17A 2WG2A 4X62B 1RC8A 3OWXA 1Z5OA 1J6UA 1R15A 2HLDA 3E15A 2C7GA 5C53B 2GS9A 3BG5A 2K4MA 3IP1A 1KYIA 2FN4A 4XAQA 3TVTA 1REQB 4EI8A 1K3UB 5P21A 3GCZA 4U2KA 1FDRA 1XRMA 2SNIE 4WVFA 5GOZA 5A4MS 4UTVA 4J76A 2AF3C 4FMDB 4RPHA 4QPCA 3YASA 1YS2X 4ZP1A 4ETNA 4RKYA 2B3TA 5ALOA 2ZRBA 4FGUA 1J8FA 3ET4A 3OJFA 3PDUA 1LV7A 2OQRA 4IDFA 4M7RA 4LOLA 4UVHA 2A0YA 2MCFA 3SKXA 4RSGA 1BJTA 4LC1A 2JHPA 1NVAA 1BE6A 3ZGYA 2IT1A 4RPIA 1N6KA 1OXUA 1RJ9B 3BS4A 3F9RA 1DWQA 2NO1A 2ZUBA 4M1SA 5AW2A 2X5KO 2GZ2A 1IEQA 1RM3A 1KPHA 3MT8A 1CB0A 5TQJA 4CLDA 1TYBE 2AR9A 3R3UA 4C78A 3JXEA 2PX8A 3NH6A 2P6NA 5J2TF 2JS7A 4QAJA 5EC8A 3SNHA 1FFEA 2RGDA 5DTQA 5FAKA 1XF1A 4FR0A 3G0HA 1NQXA 4DJJA 3SCZA 3ZK9A 2NVOA 3DPUA 1C80A 1XI2A 4M2LA 4M0FA 4NONA 4QGFA 1CUSA 1Y3HA 2RHMA 4DRXB 4IXMA 2YVAA 3EZ6A 1CUIA 1Q3TA 2QI9C 3NIGB 1JXMA 4K9SA 3C1UA 4WJKB 3ABQB 3KUXA 1AGNA 4XGIA 3ANNA 3LECA 2WKWA 2V59A 1U7DA 2E4VA 2Y05A 4OM7A 4XFKA 2DUWA 4YWHA 1CY0A 5LZ4A 4N82A 3WY9A 1RRMA 1N6LA 1GYRA 1NOJA 3QG5A 4K3VA 5CJ2A 4GLOA 2BL4A 3PFGA 3ENVA 3CRRA 1KAEA 1W4CA 1NW5A 4H7JA 1FLDA 4AMVA 5JTUA 1HTWA 3KUUA 1C1XA 2R00A 3COYA 1B6SA 1E4EA 1V9SA 2GYUA 2MINB 4JL5A 2AX3A 2J41A 1G21E 4QXOA 1MEJA 2AJDA 5FQOA 2FI1A 4GOKA 5BSGA 1V45E 3KSRA 1DTWA 3E53A 3PHJA 3MWEB 3PUVA 4KZKA 4KQMA 4YJ3B 1GQYA 2QU8A 2BV3A 4RA9B 1IJKA 5F78A 5TGZA 5JMWA 2OGZA 5LUAA 4CR6A 4B3IA 3OZVA 4YJ2A 2WJ4A 5IAAA 2E55A 5E95A 3IKJA 4HLUA 1FJ2A 4G24A 4TS1A 2OWEA 5KTOA 3UG7A 5F9FA 1M1ZA 3QU4A 2P8JA 2XDQB 3IODA 3KR2A 4OKNA 5SY9A 5C5DA 1E1CA 4G89A 4PYKA 3U7GA 1TJ4A 4IDHA 4E3ZA 3L8ZA 1YE5A 2QJTA 1JHXA 1YS6A 3GGCA 4JC5A 3STUA 3UA3A 2GPNA 2PSFA 1KP9A 4WECA 5ILQA 4DG9A 2ZCJA 1PTJA 3SEAA 2W8ZA 1MV5A 2GLTA 3MA0A 2CMDA 2EOAA 2XQVA 3RM3A 2AK2A 2QRHA 3LOUA 2P69A 3H5VA 1GZHB 3HBNA 2UZ1A 1R1DA 5J5AA 3GAAA 1R0BA 3IE1A 4JBGA 4M9RA 4OA8A 5CVEA 2EF0A 4OLJA 2JBHA 3B3QA 3DCNA 5LA6F 4B40A 1M5TA 2CB0A 2G8LA 2OV8A 4F8EA 5DW3A 3LDUA 3QUSA 5FNZA 4IQFA 3JQAA 3V42A 3I8OA 3DHVA 3N7AA 3RYFB 4DM4A 2GCPA 1T0JB 2GBLC 2HRCA 3IOBA 1SIWA 1N8NA 1EGAA 3VOSA 3DOJA 4HS9A 1DE0A 4X95A 2FPOA 3MUFA 4M1MA 1C0IA 4AJPA 1KEVA 4ZCRA 1PK8A 1V7QA 1F8GA 4KLAA 3TR0A 4DLBA 4X97A 1PSWA 4DCOA 5JNTA 1IWOA 2CFOA 2PQMA 3FYHA 1CERA 5CLHA 3N53A 5CDFA 2M6RA 1L8OA 1XJQA 2EKBA 4RWZA 3ZVLA 4DMCA 4CUJA 4JJFA 1AHPA 1GSOA 2BGGA 2Q99A 3AVPA 3S8EA 1MOZA 4L4XA 4LDQA 1C30A 5T4FA 1C7IA 4W4TA 1GQQA 2I65A 4CVNA 3B1KA 2FYTA 3BGWA 3PB3A 4AJJA 3TUZC 5AK6A 1ZVVA 4DABA 3FPAA 2WUEA 4WN9B 2F1RA 4NJEB 1R8YA 4F1JA 4MULA 1ODLA 1FTWA 1RHRA 2HSJA 1TL7C 4RE5A 4O2BF 5AM5A 1Z06A 1NW3A 4A0QA 1W2WB 5CFLA 3KPUA 4CLOA 5JSZA 2YJ6A 2C2WA 4AS3A 3TSWA 2BN4A 3QWIA 4CYMA 4A8PA 2QRMA 4QNMA 4S1PA 1YHYA 2DFTA 1SVSA 1RWKA 3JQ8A 3VFDA 1PV4A 3OIFA 1I5EA 4XWTA 4AZ0B 1FU7A 4ZCLA 4EEXA 2RK6A 1IRIA 4P22A 1O8BA 3VDMA 5A0FA 2VDUE 1TT5B 4BN4A 3NAGA 4H0FA 3Q8XB 5THQA 2ZRJA 2LDBA 4WEOA 5KUTA 1Q44A 1PN3A 4Q3BA 2ZWPA 5J59A 3DDHA 4MQEB 5TR9A 3VTAA 4QUHA 5JARA 4F84A 2XCOA 1EK1A 4JOBA 2NPFA 1Z5NA 1N1EA 5TSDA 2ZSHA 1ZJ4A 1A50B 4RYDA 4GH5A 1T5OA 4PONA 4ENVA 4BYMA 1R4NB 5CX1A 3QVSA 4LGVA 4LYHA 4ZHQA 4RAQA 4JEMA 4B6QA 3A58B 4X54A 3T35A 1TUBB 2GB4A 5LC1A 2QK4A 1GLNA 3O8OB 3SYLA 2D06A 1U65A 3OD5A 3AT1A 3REGA 2OZPA 2F8TA 1MGOA 2OZEA 1CUWA 3QE4A 4CMIB 4A8JA 3U9LA 1O89A 1NN5A 1R8SA 1MX1A 1FRQA 1GNSA 1T6BY 2BKXA 3EVTA 4P33A 4YCDA 1DXYA 1Z4MA 3VZQA 2NZVG 2QLLA 4XIGS 3LXXA 4NK4A 2F2TA 3R5KA 2WY2D 2FZKA 5LNK6 1U0BB 4R3WA 4KPEC 3LVQE 1BFDA 1U3CA 1WMFA 4P8RA 1SZDA 3M6LA 1ZM3A 4KNWA 3TGPA 4W5RA 5JJLA 2Q21A 3BZUA 1T4MA 1Y48E 1N1MA 3HYRA 4N01A 3MWLA 2H7CA 4LQ4A 3LMKA 2P27A 3AHJA 2XYRA 2PEYA 4M9SA 1C3XA 4RK7A 1X9HA 3AF0A 2APJA 3PWZA 4Y1RA 4FFNA 4L4YA 1GRRA 2CNWA 1ULAA 4FEGA 2HRZA 3QSYA 3KZMA 2CSXA 2NIPA 3G8DA 1RJWA 2NO5A 1E7QA 3DKVA 4MWGA 4LZLA 5JPIA 3RSCA 5A5FA 4NCIA 5BNIA 3AJEA 4L07A 3QXSA 2Q28A 3EDOA 4LBVA 1E2FA 1WNFA 4RKFA 4XFDA 4C6RA 1G17A 4G4IA 3OT4A 4YH1A 3T52A 3WAKA 3HVRA 4I9GA 3TCKA 1EM6A 1UBTS 1UCFA 2PQ0A 2O5CA 3HADA 3IMFA 5AJYA 4OQNA 1SHUX 1KSJA 2CL6X 5J4KA 1QGAA 1SFRA 1OFHA 2GPJA 2Y1FA 3MMSA 5DHAA 3V8MA 4C6TB 5IT0A 1T3ZA 3C97A 3ED1A 3K70B 3MCZA 1QUEA 2YINC 5IVHA 5FBKA 4UVDA 4YMHA 2O23A 1U4SA 3OQJA 1Y5MA 3DAOA 3FE2A 3FNRA 5C80A 2XCIA 4X8HA 3C6MA 1VHTA 1W0CA 1GRCA 3K05A 3ZJYA 2A7QA 1P19A 1I1NA 2AR7A 1F20A 2FSHA 2QNIA 1NRJB 3EY9A 5KKCA 3HJHA 4FOPA 1D2CA 3TBKA 6REQA 3LOQA 3P9ZA 1F0NA 2DWCA 2ZB3A 5AYVA 1WDKA 3H2YA 3JD2A 3UMFA 1DZ3A 4HDRA 1Y5LA 3BGOS 3DZHA 4UNNA 2H63A 4BRSA 4XGKA 2RJOA 2QV7A 2WTEA 3EXG2 2LIPA 3LRPA 3OEEA 4KH0A 2YJZA 2P9TA 1YBFA 1TUIA 2X8LA 3JYOA 1G5PA 2JLUA 4TLAA 5LBIA 5JOQA 721PA 1UDXA 3W3AH 2IHNA 3JYLA 3B13B 3GCXA 1DMSA 1QS0B 2V6FA 2O2XA 4IOLA 3D59A 2IPOA 1AX9A 3DL2A 3LPAA 4KH1A 5DNVA 5FI1B 1TJPB 2G0TA 1COWD 1CUYA 1EE9A 2JHGA 2QJFA 4DY6A 3ZV3A 4JMLA 3U1TA 5D8DA 1AQNA 2K7FA 4BIIA 3VH4A 3DKRA 1EIWA 1MB2A 2JARA 5AHRA 4XWWA 5K51A 2CJWA 2PX0A 5CYGA 4UFPA 5K7SA 1G4UR 1U3FA 4L7VA 3OEWA 3R7SA 5FLKA 4YCLA 4L0QA 1JPVA 5BUCA 1X77A 5CU7A 1TZKA 1GWNA 3DEAA 3I6ZA 3ZNOA 3BMQB 5EL0A 4TGLA 5K0CA 1Z8DA 2V5VA 2GVNA 3O84A 1NMQA 2PKEA 5KJCA 1LKZA 1MZPA 1SBQA 4FI3F 1F0KA 1SXJB 2JLBA 5TPZA 2Z04A 2PMEA 5ALWA 1HDOA 1LTQA 4GZ6A 4CCYA 2PO7A 1DOHA 3ZCXA 2RHTA 4MUEA 5FV7A 1PT8A 4KKVA 2Q4TA 4JJ6A 1AS2A 3HVUA 1JJ7A 4HYEA 1UC9A 2PSDA 3OZTA 1IUKA 2E5FA 1CEYA 5C8XA 4EG8A 2JGNA 4XD7D 4QVIA 2HMVA 3EVBA 4PVCA 4UHCA 2XTZA 3IL2A 4JLWA 5JQGA 4J0DA 4FCCA 5G0SA 1CUGA 2QRVA 3A11A 3EHEA 1DT5A 1Z62A 2R5FA 5CXQA 1J90A 5EE3A 3OCUA 7REQA 1YTUA 1G21A 2BRUC 2ECQA 2QM0A 1MIOA 3PVZA 5JPDA 3AVQA 3D8RA 5KNCA 5KOIA 3P2YA 2AMVA 5HWSA 2XUGA 3Q3EA 4H4DA 4RNDB 5BQPA 1E3LA 5K4AA 4B87A 2BFEB 5JATA 5IT9A 1FFXB 4CFSA 1KJIA 5CCBA 2HRBA 5EMNA 4E15A 2WZCA 3MC1A 1X1AA 4DLWA 3KCNA 2V7XA 1DFHA 2VTEA 1IG3A 3GEMA 1YS9A 1G64A 3HG7A 4MRRA 5CFOA 3TLKA 4IRXA 1KPGA 4P4SA 2PUGA 5HGJA 3PXXA 3WJ1A 1YRHA 2V9ZA 1UBFA 2X5XA 1VL6A 4GYYA 1CZHA 3K0FA 4IJQA 5LBUA 4DRZA 5LZ2A 3O83A 1QM5A 3T6KA 3VR5A 4GI5A 4FZRA 2LVBA 5E6SA 4CKEA 4RTJA 1UZMA 4C3ZA 4D8UA 3E1KA 3TMAA 1KKLA 2ZVPX 1B00A 1E3JA 1U0JA 4AUEA 1JFSA 3E7PA 3HA3A 4PZYA 5DGIA 4TKZA 5I5GA 5CK5A 3FPHA 3NH9A 2OVBA 1L1RA 1Q57A 1XD9A 4ROSA 2VCHA 3AKZA 2Q45A 4B5LA 3W5JA 2R68A 1KI7A 1M6VB 4BNJA 4IO0A 5I7VA 5D1NA 5C32A 1NZFA 2BSAA 2VNHA 4IH9A 2XUDA 4KJXA 4A5OA 1N6OA 4ZQGA 1L4GA 1JTEA 1GFZA 2P90A 1W87A 2QXUA 4F2HA 5DCWA 5J58A 2X0KA 1D6JA 1A7UA 1JWBB 5DHQA 4CKBB 4RLFA 4WJLA 5AVXA 4KUGA 5HM8A 4JUFA 4CKZA 1P80A 2ZVDA 2R44A 1MHTA 1OVGA 4FWIB 5BR4A 2BWJA 3FUXA 1VRVA 2ZJBA 4MUMA 4RA6A 2RAVA 1CG6A 1IEVA 1MVOA 3SQWA 1L2TA 1M2EA 2G36A 2GQ0A 2Y0DA 1HBJA 4O59O 3NDBB 2I7VA 3A3OA 3O8CA 3C1OA 5HHTA 4UM7A 1JLHA 1GG8A 3N07A 3QFCA 1S96A 3WHKA 4TSRA 5BVHA 3GLIA 4D3YA 3DGFC 4XX0B 1Q12A 1WU7A 3DTVB 2GHQA 4KLNA 1LF5A 4DF3A 4AQ7A 4QM6A 3TM4A 4WLEA 2X3YA 4INAA 3IPAA 5TE9A 5HDQA 1SKMA 1EM8A 5EJEA 8OHMA 1ZOLA 2JKVA 2ZSEA 3R0QA 3PI6A 1X3SA 3DXFA 4B46A 4EF6A 2ATXA 4JNKA 3OTIA 4LXXA 3FHTA 1W1UA 1MVNA 4CTJA 1GPYA 2FPUA 4H15A 2CHFA 2AMLA 1LGYA 4DDMA 1AQJA 5GIOE 3GROA 3TEMA 1DC5A 3HJCA 3A9WA 1E60A 2BFDA 1BU8A 4LF8B 2IXAA 3NP9A 1W5AA 2EDCA 1JT9A 2NT3A 4WKBA 1JEQA 1KI2A 2G70A 2JA2A 3FKSD 3IFSA 1Q20A 4WI1A 4WSOA 1G8KA 2JATA 1NL3A 2GNPA 5KYYB 4G1CA 4DB2A 3PQ6A 3MTJA 5B57C 1NYTA 4URZR 3WYDA 1R37A 4A23A 2FA9A 3PIIA 2A9QA 2EV9A 2Q3FA 3L8DA 1I0IA 4HB4A 2FWMX 4EHFA 5C51B 1DJOA 4MVJD 4DLRA 1ST3A 2CLCX 2GJSA 3LKBA 1ITZA 4G97A 1QP0A 4WCFB 5BURA 2XCSB 4BX0A 2DBRA 5E38A 2WKQA 3VTZA 5L6LB 4BN0A 2BMFA 1LQUA 3FB1A 1WUKS 3GFBA 3HJGA 4M88A 4NEGA 5IJ0A 3HACA 1NP3A 2FPKA 2QDKA 3GN1A 3I6YA 2Y67A 3LQ2A 2QSYA 4FEAA 3QE3A 4JJ4A 3FNIA 4ZVVA 3FCCA 1B6TA 5DBHX 3HYNA 5JCPA 2ODTX 1JDVA 2FZEA