3L6BA

X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
327
structure length
322
Chain Sequence
AQYDISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVRKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine racemase
publication title The structure of mammalian serine racemase: evidence for conformational changes upon inhibitor binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 118
structure length 322
sequence length 327
ec nomenclature ec 4.3.1.17: L-serine ammonia-lyase.
pdb deposition date 2009-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l6bA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l6bA02
3VBEA 2ISQA 5I7RA 2CLIB 2CLEB 5B36A 4H27A 4L27A 2TSYB 1J0AA 3DWGA 1UIMA 5B1IA 1Z7YA 2CLFB 1WBJB 3IAUA 1K3UB 1TJPB 1CW2B 4Y6GB 1OASA 3PC2A 2C2BA 5BW6B 3SS9X 4D9BA 2GN1A 5EY5B 5DW0A 5B3AA 2TYSB 3L6BA 1WKVA 3T4PA 5D86A 4D8UA 4LMAA 2CLLB 3VSDA 2D1FA 1KFJB 4AIRA 1TZ2A 1C29B 2ZR8A 4D9KA 1J0CA 1TYZA 2PQMA 1VE1A 1BEUB 5DBHX 1C9DB 4IL5A 4KKXB 4LMBA 1KFKB 3PR2B 5DVZA 2C2GA 2CLKB 2ZSJA 3PC3A 5B53A 5JISA 3FCAA 5IWCA 3PC4A 3L6RA 2O2JA 4D97A 2TRSB 4WX2B 2RHGB 4AECA 4HO1X 3V7NA 3ZEIA 4JBLA 2BHTA 3HMKA 4JBNA 4QYSA 2J9ZB 1TDJA 2EGUA 1VE5A 4XUGB 5I7AA 4L0DA 2ECOA 1Z7WA 1TTPB 2GN0A 2CLMB 2V03A 4F4FA 5IXJA 1QOPB 1BKSB 3R0XA 1KFBB 3CEPB 3AEYA 4D8TA 3RR2A 3VSCA 1C8VB 3X44A 5D87A 3DKIA 3VC3A 4COOA 1CX9B 2Q3BA 5I7WA 1K7EB 1TZKA 5HBGA 4ZU1X 1V8ZA 1PWEA 1KFCB 1A50B 5IW8A 5T6MA 2CLHB 4D9EA 1X1QA 2CLOB 4L28A 4OREX 2O2EA 5E0KB 3SS7X 1K8ZB 3FGPA 1D6SA 4L3VA 4D8WA 3L6CA 3IQIX 4OFXA 1FCJA 4ZQCB 2J9XB 4D9GA 5KZMB 5KINB 5B1HA 1A5SB 5C3UA 4D9IA 1RQXA 3X43A 4D96A 5CGQB 2RKBA 1TZJA 5CVCA 5I6DA 1J0BA 2WSYB 5J5VA 3VSAA 1K7XB 1V7CA 4D9FA 1WTCA 1JBQA 1A5AB 1P5JA 4HPJB 2Q3DA 1QOQB 5DW3A 4D92A 1V71A 4ZU6X 4HN4B 1K8YB 4I1YA 4PCUA 5B55A 4HPXB 2GN2A 1M54A 1A5BB 1E5XA 1WDWB 4D9NA 1K7FB 2BHSA 5D84A 3DWIA 5J43A 4D99A 5DBEX 4NU8X 2J9YB 2DH6A 5JJCA 1J0DA 2ECQA 2Q3CA 4HT3B 1KFEB 3IQGX 3BM5A 1UINA 1J0EA 2EFYA 1FUYB 4LI3X 2DH5A 5D85A 5I7HA 3SPXA 1KL7A 3TBHA 4D9MA 2ZPUA 1UBSB 3R0ZA 1K8XB 1VB3A 3AEXA 1PWHA 1O58A 2JC3A 5I7OA 4D9CA 1TZMA 4NEGA 1F2DA 3IQHX 2RH9B 1TTQB 1Y7LA
chains in the Genus database with same CATH superfamily
1DJNA 1XZNA 4M8NE 1A0OA 1XHFA 2DU8A 2GVZC 3FW1A 3PUZA 1G6OA 4AO7A 4EUSA 1LDYA 3AKEA 2BGUA 1VL6A 3GLVA 4Z8YA 5FNVF 2EP5A 2COUA 3BF8A 4BBZA 1LZKA 4DM4A 5AIBA 2QQEA 3Q7PA 5FRDA 3BFXA 5IPFA 2OCDA 4J8PA 3WK7A 1UPAA 1ORIA 3OQHA 5GM2A 2R8BA 3RS9A 4EKNB 1XCGB 2OVBA 1BEZA 2P9FA 4RFLA 4YALA 2R00A 3GEPA 5H70A 4EG7A 1R4MB 2J0UA 2BPOA 4MYSA 2B1JA 2GMWA 3KELA 4AYXA 4Z3OA 2TYSB 2O8BA 3CF2A 1FJGB 4MUGA 2C2WA 1XDBA 2BI8A 4KFRA 4FFRA 4C05A 4DQXA 1GZHB 1T2DA 4BN5A 1YF3A 3A4VA 5DHRA 2V3CC 1YVPA 2H4XA 2DWUA 1IZYA 2D1QA 2JJ8A 2ZIUB 4QJ5A 3W2IA 3JR7A 5KNCA 4JL5A 5HF6A 5EP2A 3OPVA 1ZJ4A 2VZEA 4FSHA 3R2JA 2BZSA 5TY0A 1UQRA 3I4CA 2ACVA 2QRPA 2P9TA 2ZRIA 4ZPXA 2V6GA 1NF2A 2VNAA 2IITA 3SVLA 2SHKA 1ZVMA 2G4CA 1U28A 3PXEA 4ZIRA 2O8FB 1RI4A 3K16A 3OD5A 2VJYA 4RNDB 1FK8A 1M67A 1TDJA 2O1XA 1II9A 3O7MA 2YR0A 1UXKA 4MYCA 4XQCA 2R1TA 3N2EA 3GLGB 1ID8A 4F1KA 1M83A 1PYGA 3NU1A 4LHXA 1ZH4A 1HEUA 2LWIA 2QRGA 1THMA 2HQBA 1H5QA 4ZZIA 1SQFA 2PD3A 1NLMA 1ULHA 4L6IA 3VV2A 4UPEA 3PGKA 5EHQA 1U0BB 3VVBA 3LKDA 4LYEA 1HE2A 4RKWA 2DFNA 3D3EA 1GDTA 3H5OA 2FEXA 2VRCD 3KETA 4P6VF 5AHXA 2D5IA 4U39A 4PRLA 4JZKA 4LPKA 4E94A 1NBOA 4MAMA 2OV1A 3IKJA 4QPDA 3G2OA 4R9VA 5C4GB 1TCAA 2DYKA 2OB2A 2EBWA 4IZHA 1CY7A 1NBMD 4HDRA 3K1ZA 1WBBA 4MGEA 2BJVA 4PPGA 4D42A 3AR4A 1SXJE 1WPGA 1GRRA 3IHLA 1Q7CA 4R83A 2OHIA 1PT9A 1FSSA 1GQRA 2Z3WA 4H9GA 5JMPA 2C98A 2XLCA 4P7JA 4REQB 3IEVA 1RD4A 2IZ1A 1D2GA 1QGAA 1XPJA 4N40A 4OI0A 4U5QA 1T5HX 1Y3CE 1ISGA 1NW5A 2X0DA 5DNUA 2ADMA 4NK5A 4E5NA 2E9SA 1W7AA 2HCTA 3EFEA 2PEZA 5E3JA 4MWOA 2QM0A 2AEFA 2HMVA 3GEDA 4NV3A 3A6HA 5K01A 3AF4A 3SVZA 1FMLA 4MLPA 4BCBA 5MHTA 1S6YA 4PG7A 1MKYA 2APJA 3AJ8A 1V4BA 3OPYA 3NYWA 1JHRA 1IHYA 1PW7A 1JFVA 1YE5A 2GAAA 3T7DA 4EW1A 4OU5A 1DQSA 4X9XA 4JOCA 1F4PA 1SHJA 2JKYA 4BQFA 1KJ8A 4FBLA 4AKSA 4C4ZA 1NY6A 1J39A 3IQXA 3AP3A 5FFFA 2RI6A 3M4JA 3UW3A 1V7QA 1K3FA 5JS1A 2QNBA 4YECA 1Z75A 3OQMA 4GH5A 1LX7A 3FPLA 4OYLA 1QX3A 4RU1A 1VHTA 5IAGA 4BNLA 5IASA 4WZAA 5F64A 1FF9A 1ZN2A 3ZCUA 1T1IA 4HGOA 4BKQA 3AEKA 2A1UA 3DO6A 3LO8A 1HNWB 5E4JA 2WIKA 1PJRA 4XWTA 2GD1O 1J1IA 2ODTX 3ZZMA 4DM7A 4LFCB 2WHPA 4J0HA 3NETA 5IKMA 1OASA 3G0DA 3DE6X 4DS3A 2HSWA 1G3IA 5AT1A 4YK7A 3C6BA 1VHDA 2VNIA 3Q8XB 2E82A 4KTTE 3JAWA 1UAYA 3PXBA 4FINA 2RBKA 1VPEA 4MRMB 4FCCA 4B81A 5IXSA 5BMVF 4Y6PA 4R3WA 3WSVA 3P32A 7YASA 2QSUA 4O2LA 3DT6A 3QXCA 1Z34A 2QD5A 2XI4A 2LZ0A 1XA4A 1XXHA 1XG5A 3DKRA 4C0BA 4F38A 2Z6QA 1E2BA 1RXIA 5NULA 4MWEA 3TG8A 4C0QC 3EVEA 1H6AA 1V95A 2NXJA 3H42B 5JWOA 1E6UA 2QQFA 1DLJA 3L8GA 4YP5A 4MVCA 4TSFD 3ACBA 2XMDA 1AA9A 2HPVA 4OBBA 1WXFA 2AI2A 2OFOA 5KVSA 3DTTA 3UPDA 3KT6A 4DLBA 2BHLA 3FYUA 3QVVA 4RKRA 1C0KA 4MWDA 1G2IA 5B7NA 5IJ9B 2AUMA 2IU6A 1UC5B 5I9MA 1GZ3A 2WG1A 3Q5EA 4GXTA 4DWWA 5IAOA 1GKYA 4PZCA 3WQHA 1MT0A 1ZD4A 4ZVNA 4B6FA 2H8GA 1Y4AE 3KKLA 3HSSA 2GTPA 4DJEC 3AUFA 2JJ2D 2YMPA 3PNVA 2PUGA 3TSOA 1UBKS 2ZB4A 4OB7A 1UMBB 2I1QA 1FVXA 1DRWA 1BU5A 3I2HA 5ECWA 5KNLA 1YDFA 1Y1TA 4KKVA 3ZS9A 4EJ6A 1CLEA 1RWVA 1V8BA 5LIPA 3AZPA 4X97A 1C7RA 4MEBA 5SYAA 2VHEA 1K27A 1N5MA 2L0XA 3EGXB 3O1HB 4L0CA 4YO7A 4IKEA 4C0HA 1JNXX 2F43A 2ZIZA 1OREA 2H2DA 2GEFA 1BD4A 3AM5A 5KWJA 4PBTA 4F2WA 5L3QB 5BQ5A 3CJRA 3L8ZA 1A9YA 1EP3B 4I4TB 4FIDA 2PZMA 1UJ4A 2YINC 3OJWA 4AJIA 4H4CA 2ZSIA 1AN0A 1PZNA 1K7XB 3WWYA 1JBQA 1IHXA 4JLOA 3TYXA 1TJYA 2C61A 1ZS9A 1W5FA 4PTYA 3ZVMA 2Q29A 1KOGA 4RXTA 4MJLA 2YBDA 5KKCA 3B52X 1H0SA 1V11A 1VBNA 2Y66A 1T2CA 3UXMA 1PLLA 1XDZA 3AR6A 4EGQA 4HI0E 3CFYA 2M1ZA 2YJNA 3UGTA 4DJJA 4V0LA 3SP1A 4EKGA 2PUCA 3VU9B 5LA6F 2FQXA 2XBLA 5KYKA 4KNVA 2HA5A 4EYQA 3R6GA 2SKCA 1ANKA 1J0DA 4XOUA 5D3MB 1HURA 5EJAA 4KR0A 3ZBPA 3JTEA 4AUNA 3C7AA 3EDRA 1Z83A 3RRJA 4C4SA 4XWWA 1SQ5A 1GP2A 2FTKE 1G64A 3MJSA 2C7QA 2PUEA 5BWNA 5I7SA 4Z1MA 2YJ4A 3PHHA 2JGIA 3ZQ6A 3ROPA 5MF6A 2Z9DA 1HQYE 3GA7A 2KLHA 3C6MA 3IOBA 1TD1A 4OM8A 4G97A 1T8RA 2AXPA 4HYYA 3UJ3X 3AL0C 4BJ3A 1S01A 1F2DA 1XZDA 1K3TA 5AW8A 3TFOA 4O33A 1LVUA 1P6XA 2V3WA 3MMXA 3OQVA 1X7ZB 4XA8A 3JD1A 5LZ5A 3RK4A 4DSTA 4FDUA 3HLKA 3EMBA 5CD9A 4NOMA 5KWVA 3FBTA 2C2YA 2YCBA 5FWXA 3ZD8A 2WWWA 1KEPA 4FX5A 2DHEA 3WIOA 4BATA 4BMXA 4FE3A 1R6BX 3KL2A 4JC8A 4ND1A 4TTSA 2X4GA 4BP8A 4U1RA 3B20A 4TUYF 1LNSA 3TGLA 2FXIA 1KZGB 3C74A 1TKAA 2PGIA 3I58A 4U63A 3TL2A 1IN6A 1J2JA 1YRQA 4U2GA 4WZBB 4YUXA 1ZD2P 4RSHA 5B2FA 5CEJA 3G79A 3PNPA 1GRCA 3MNFA 4HY3A 1ZMBA 3NOQA 3K9LA 3WMEA 1QRUA 3KB2A 1MABB 2A9RA 1N0WA 3HVJA 5HMMA 3KB8A 1P81A 2E1PA 3VRHA 4FYKA 2HIAA 3FBWA 3PEEA 5DYWA 2DR2A 3ZWQA 3KSRA 3PC4A 3M6LA 1VPLA 1Z2CA 1RU3A 4JYCA 2E4WA 4HDAA 1LKZA 3FZNA 1JTFA 4A3SA 3DEJA 3WJ2A 4IDBA 5K6TA 3L6EA 5AM1A 1GOTA 1CJVC 2C31A 2B9EA 1IHPA 1ONSA 2YJ6A 4UHCA 1Z5GA 1F6BA 3IUEA 1OXTA 4BV9A 1RXWA 1JYFA 4M8SA 5CAEB 4EECA 1J8YF 3ZNNA 3JYHA 3BQNB 2QYTA 3IP6A 4DMUB 1L7BA 3WLSA 8MHTA 5JD4A 1OLUB 3W8RA 5A3RA 3NBQA 4FLMA 2BGIA 1DKMA 3T5GA 5DM60 3ZK9A 5CG2A 2JCVA 3VPGA 5BVHA 2DTEA 4RK5A 4I9HA 4ZV4A 3Q3JB 2EIHA 1JJVA 4LE1A 4RZ3A 1M0WA 1HLGA 3ZH2A 1LDEA 3CJQA 4G0QA 5EP3A 1MO6A 1DKOA 4MQLA 4B6EA 4BUZA 1K92A 4PONA 2WKPA 3DVSX 4D9GA 1E7MA 1FX0B 2LR0A 3JASB 3K0HA 4WCDA 1YTUA 3X43A 1LRLA 1ABFA 1P62B 3R9XB 1TUEA 1JHPA 3GLUA 4KRYA 1P1FA 1H2HA 2YIJA 2YYZA 3WGNA 2XCIA 4EX6A 1U98A 1XZPA 2NZVG 1JIKA 1E9AA 2EW1A 4G5HA 4LOKA 4WLFA 4XDYA 1Q1NA 3D6UA 3O73A 4QUHA 3BYZA 5TE9A 3V8BA 4ZD6A 2YZ7A 3N05A 2XAUA 3R5KA 4M8IA 4I4CA 1GTL1 2XDQA 4QASA 1RAEA 2WUGA 3EGDB 1SOAA 2A0XA 3DWEX 4YP0A 1EFRA 5K0GA 2VHVA 3I04A 2FP4B 3M83A 3ZV4A 2W22A 3RT9A 3GLGE 4JI7B 2VJDA 3PJDA 2H11A 3FOZA 4COKA 2W48A 4NWIA 4EDFA 1IM5A 4ZOCA 4IHJB 3BHMA 4B46A 1NBWB 2MU1A 4YAOA 1R6DA 3IT3A 3KYCA 1ZHHA 3LF2A 1NC1A 3LYAA 3LCRA 1BQ4A 4K5QA 4PLZA 3RD5A 3V4OA 4CYMA 3K71B 2IPMA 2Q5LA 3SF8B 1SPXA 4F4DA 1P4RA 1KKMA 2XGJA 1Z0UA 5M3BA 4AWBA 4I9UA 1E2UA 1FMTA 1GSOA 2BFOA 3B1VA 3EHEA 1O58A 5A71A 3E9RA 4ADSG 3IS3A 1M6VA 5TT1A 1E3TA 3SIWA 3N6VA 4QUKA 4I2VA 4FM9A 1W9HA 3QU9A 5I7RA 1PX0A 1R8JA 1ZIPA 2IWHA 3LRXA 4HH4A 3T1OA 2PT6A 4EFNA 1HYQA 1UBTS 2I4OA 3IJPA 4W9NC 5TS3A 3M6VA 4L16A 4MKGA 1JQ3A 4P7GA 5F4ZA 1JDTA 1L4LA 3KQTA 2YKGA 3RYTC 3JD0A 3ABSB 3NP7A 4P08A 3CLRC 1PGPA 3F6PA 3TW8B 4IIUA 1YJBA 2X0NA 4BFSA 1JDZA 2VAMA 2O3TA 3RTEA 5DTJA 5EUBA 1OLSB 3L7DA 2V97A 1ZW1A 1X7XA 2QRZA 1NPDA 4XDGA 3TL3A 2W6NA 4F2GA 4K9OA 4L4RA 2O0JA 3H8WA 1N5JA 3RF6A 5B58T 1QU2A 3TVTA 3VC2A 3GEGA 3K1AB 1A7JA 3WQQA 4B2YA 2DY0A 3N5KA 3NXSA 5CJJA 2ERYA 4IL5A 3AF5A 3UFBA 3O4FA 2RGYA 3PR2B 5FBZA 5DZSA 4XM0A 1NBHA 2ZIVB 4QDUA 1U0RA 4KPEC 4LY0A 1PR0A 4JODA 5B3JC 4RK6A 2ZQYA 4LOHA 3U4AA 3VGJA 5JNWA 2Z08A 4PG8A 3KKEA 1CZOA 2P78A 1IG3A 2PSEA 3NHMA 2HD4A 4CEIB 1R4AA 1X1RA 4BVHA 3WBBA 1V3UA 2W6ZA 4OG2A 2C97A 3Q12A 2A1TS 3LFTA 1G8FA 3I1FA 3OX4A 2XIQA 1HMYA 2CEKA 4R1MA 4X3PA 3ZXSA 2NP6A 5K9ZA 1ORTA 3L8HA 3OBIA 1K7EB 3IIIA 1OY1A 1ZK2A 1QHHA 4UAGA 3TAUA 2H2AA 3R3WA 1V8ZA 5L7TA 2C00A 3FLEA 1EDOA 2F3UA 1YIOA 3MVEA 1S2MA 5FORA 1LK0A 4URYR 3WRYA 2RBGA 4D9JA 1W87A 3X1MA 4LRQA 2QN8A 4EZBA 4EJFA 1EUCB 4TMXA 2XYPA 3NMUF 2WVAA 3BMNB 4OKSA 1NKVA 1WEKA 2JKVA 1U3FA 2XZDA 4FUQA 4OQPA 1VFNA 4P4TA 3GB9A 5U4XA 3H4MA 2P6RA 5F9FA 3PUHA 4D96A 2JCYA 3QJYA 4YRGA 3OUUA 2VTBA 1NBME 5GJWC 1II0A 1KSHA 1JEYA 5DT9A 4M86A 4CCYA 3V80A 1YQQA 2AOUA 2BCGY 1XEFA 3KCNA 2HRZA 4RZHA 3X1KA 1PVVA 2I7DA 1VECA 3E7PA 1NIJA 4EWLA 2JIRA 1ACMA 1R5JA 4QE3A 3OAAA 1Y5MA 3RG8A 3HLTA 2WEKA 3AY0A 4N8SA 1SXPA 2YMQA 5C4IA 1YJQA 3EEBA 3GFRA 4OQYA 5G1NA 1YCHA 2AKYA 1RQLA 1T8YA 4KQGA 4IG4A 1PWXA 4DWJA 2F4VB 2ILVA 2VNJA 1TMGE 3RVBA 1UPTA 1ZL0A 4OVKA 2GBLA 2JZNA 4LYGA 3UT5A 3AEZA 3K72B 4AG3A 3AI2A 1H4SA 1FYEA 2OE2A 4RO0A 1R6XA 1KNXA 2Z5VA 2HBYA 1NW9B 1NQTA 4HNVA 5B6IA 2C9BA 6PFKA 3LDGA 4E13A 1GCOA 3CUYA 4GLBA 4N3BA 4F4IA 3OT1B 1GGEA 2FPIA 2A3RA 1U3WA 2G6BA 2GDJA 3C8DA 1R9MA 1XN1A 2AG1A 2GEDA 5F12A 3KPJA 2EBHX 2QTTA 4Q1BA 4F11A 3ZDAA 4HLQB 3KKMA 2ET6A 1ODSA 3IUBA 1EPUA 1V3TA 3DXFA 1R4ZA 4Y6SA 1RRKA 4TL7A 1Y5RA 3P9RA 3D0OA 1P31A 3JQAB 3K31A 4FQ5A 5B2ZA 5LA6A 4CBVA 5LWHA 4CF7A 1G4HA 3AOGA 3LVFO 1GRVA 5ESWA 4DV2B 1KJQA 3IURA 4U2FA 3H5RA 2E4ZA 2OBLA 3RRBA 3W2HA 4M0DA 3T15A 4C9BA 3KQNA 3EW7A 2BMJA 4XDZA 4R0VA 4H60A 3KR9A 3WFJA 5DW0A 1DKLA 1JI0A 1QIFA 3U0BA 4DUGD 3SVTA 4L3OA 2XCSB 1KQ3A 4GLOA 4HDNB 4KBYA 3AL2A 5I8PA 5FTNA 3FWKA 4DJ5X 1JRLA 2WW8A 2KW5A 4HQLA 5CT9A 4BLSA 3O91A 3K4PA 1KAEA 2RE8A 2C57A 2QN7A 3GIWA 4D46A 3FX2A 4X8HA 2A0UA 1OTYA 4TMTA 1TYZA 3G2PA 2II6A 4EY7A 1UBFA 3SQOA 5F76A 5D00A 3ELYA 3F8TA 2FE1A 4G24A 4DQUA 3WLAA 4BFLA 1O8CA 3ESRA 3I30X 4UATA 4E14A 3PFIA 5IJ0A 1IOLA 5KKAA 1II8A 1E77A 1E2EA 1SM4A 3CIFA 2P9HA 3DD1A 4M37A 4P93A 4ZOAA 5EKXA 4KQIA 1YDGA 1HYBA 4ENUA 4RELA 5FOWA 5BN4A 5HUHA 3H1EA 3STTA 2O57A 3K35A 2V0CA 4NZ9A 1WDTA 3ZCQA 4JL6A 1K1EA 3NQ41 3RANA 3SNHA 3QQPA 2VKTA 3ZQKA 1OB2A 3WB1A 1S8AA 4C7BA 3FB1A 4IJQA 5A02A 2FSFA 3AEQA 4D1YA 2H51A 1MD9A 3KPVA 2E4UA 4WBNB 4P83A 2LCIA 4D6XA 1N7JA 1TZKA 1MZVA 2YMMA 4NBWA 5BRJA 3O3NB 2BTQB 3U80A 2O2EA 3H2SA 5NLLA 3BTSA 3HCFA 2FMFA 2RHLA 3K1YA 3GRCA 4WESA 4AKIA 4F2DA 4GSYA 2ZRGA 1CUJA 2AYZA 2HA0A 2Y76A 4S35A 4JT2A 5ALZA 1E6EA 5EP1A 3ZYZA 1ZHOA 4TVSA 4PS0A 5T4EA 4CM6A 1IAQA 4BO9A 2YQZA 2J7KA 1L4FA 1P2TA 2C7PA 3H9BA 1QBGA 1XR3A 1R0XA 2XF2A 2NYUA 4BBPA 1DQYA 1K68A 1KZ9A 1UBUS 2ID9A 3K9HA 4JVLA 4NE2A 2QTVB 1T6XA 2OCXA 2FZVA 4N39A 4UD2A 2PH3A 3I9JA 1S2GA 2BP7B 1JR3D 2IUSA 1O6GA 3HKDB 2F1JA 3C7CB 4U7FA 4OSOA 1N2CB 4ARAA 2PZJA 2ZI3A 5JNUA 1YQEA 3MMPA 1QRSA 1R9NA 1FRFS 1X1AA 3ZN2A 4GPTA 5DLPA 3QFSA 3DOHA 3IHKA 2ADFA 4PNPA 1PD0A 4LOLA 4RVUA 2R87A 4WFKA 1XZGA 3ZGNA 1AXRA 1LK7A 1I32A 2AB0A 4L5CA 1IXZA 3OQIA 5LXTF 1YRBA 4YPVA 3AESA 1OLXB 4AFNA 5A4KA 3CO0S 3D5EA 4YJFA 3PWZA 1DPGA 3VYRB 2AZTA 3PNLA 4N5MA 2XXJA 3RC8A 3UV7A 1IBCA 3EEIA 3LIPA 1ISHA 2OV2A 4Y2VA 1RHMA 2XRYA 3BGIA 1AXEA 1P39A 4AZVA 2XBMA 4Y2SA 2VK8A 3GJ7A 3DPUA 5CRIA 4YCSA 1LVGA 3VHLB 4F3TA 1Z0JA 1EVZA 4B3HA 5JAIA 2WKWA 3E5RA 3RSOA 1PJTA 1C9NA 1MDBA 1TADA 1XP8A 3B85A 1JDBC 2QYSA 5IDQA 4QTZA 5CH3A 4W5TA 4NR0A 2BVNA 4G0PA 4Y9TA 1F9EA 3JPWA 5HFJA 4UUPA 2XB2A 1FUKA 3UGKA 1RLOA 2QW8A 4G0YA 3CY6A 3BIWA 4J9UE 4IY1A 2PL3A 3RVRA 2FLVA 4JI1B 5FPYA 3Q85A 1P4SA 3W5AA 5C8ZA 1LJUA 5JCJA 4B3RB 3AP1A 4BQRA 1E7WA 2DTXA 4ARCA 5JYCA 2IP2A 2FEWB 1RJ9B 1VG9B 4RWEA 5I4BA 3QE9Y 2ZBGA 1XZAA 3EWAA 4EG1A 1A8IA 4A10A 5EWLB 3VSDA 1I8TA 3WYNA 4XPIA 5IP5A 3HWWA 4MUFA 3ULKA 3UUGA 2C3PA 1XO1A 3RF7A 5AKGA 3QH4A 5JUWA 2OFXA 4HNAA 3T9CA 3SC4A 3NBFA 4JR0A 2X5KO 3QF4A 4RPJA 4FCTA 3INGA 2YJGA 1DXQA 4QYTA 4WD3A 2HREA 3S2FA 1CP2A 4FKZA 2WFMA 3VOAA 4LDQA 4EY3A 1S7GA 2VIIA 3RG2A 4MS4A 2AF3C 3CRW1 4IIGA 4KRFA 5C8YA 1EE9A 2B83A 3G5AA 1MRNA 4QX6A 5JNLA 2SNIE 1MB4A 1QOZA 1W1WA 4DSNA 1TYEB 2MSDB 2HWWA 2IS1A 3A36A 4I9FA 3WB0A 1E9EA 5J4HA 6AT1A 1ZO8A 3GJQA 4NJMA 2WJGA 3EQ9A 4B2PA 1YKFA 4UNRA 5ALLA 5KHLB 1OXXK 2DEUA 4K46A 1B42A 1WL8A 3TNDA 2AYXA 4IO1A 3NUGA 2X8WA 3T3OA 2ZETA 1G2OA 1ZYUA 4HXYA 4G63A 1KH2A 1V1MA 3KWLA 2N1BA 2A9FA 2GFHA 2YYYA 1YJ5A 2Q1YA 1Z4PX 2F67A 2Z04A 1Z2PX 4PSKA 4QYMA 3PFGA 1V7ZA 2ARKA 4FFMA 4R01A 4TTIA 4MLDA 2PLWA 1YR7A 3BWMA 3BGSA 3RASA 2CHEA 1LRKA 3BORA 1TZJA 1GPDG 3QITA 4IOJA 4K6GA 4KIGA 4O4IF 4WKPA 2D13A 3WDLA 4HBGA 1G9XA 1PT5A 2FG5A 1RQGA 1KI1A 5ILGA 1KY5A 1ISJA 2X9GA 5INTA 1EVKA 4H77A 4I9GA 5BRNA 2OHHA 3ZBUA 5HQTA 3FIUA 3EQ8A 4NKRA 4QXQA 4R2WA 1KI2A 3CCCA 2BHNA 3AFGA 4YI3A 4GG1A 1LLFA 3KXLA 5CH8A 5EXSA 5LQCA 1B16A 2O1EA 3IP8A 3DDZX 3OTGA 4L74A 3ZE2B 5ADUS 4I55B 4N6NA 2ALJA 3F3SA 1GNRA 2H57A 1XTIA 4Q7EA 3G2QA 3E7XA 3UK0A 3H9UA 1U0SY 1XDSA 2IFTA 3HCRA 3RJ9A 3TNYA 4RH3A 4KN9S 1LS1A 1LBEA 3B2EA 4LZAA 4AKTA 2FG7C 1AGXA 4QZVA 2VI5A 3U9SA 2PSFA 4O59O 5JDIC 3CKMA 3N8HA 2D2EA 3BWVA 4Q4AA 2E6UX 1RPZA 2H08A 1KI9A 2E5WA 1SGWA 3G6WA 4Y2PA 4PFQA 1T10A 4RF5A 3RRXA 2IEBA 4YMLA 4OPMA 3RNLA 3GARA 5KNCD 5BOSA 3SJAA 3I37X 3ZV7A 3GHHA 1PJAA 4P3XA 5EFZA 3VNVA 5CIQA 3JQGB 1E61A 3L7OA 2FVYA 2Z4RA 3I5YA 4B5KA 3QSGA 3KTFA 3GQBA 2OHVA 4NH4A 5E7MA 1QHSA 1XLTA 3H7IA 4DR7B 2YS7A 2FZWA 4RUKA 5BWOA 4O4JB 3FNGA 4H1TA 5B30A 2FHSA 1N7HA 2FJUA 1B26A 4GQBA 4YFVA 4B6SA 3DE5X 3U1BA 2H4JA 1NP7A 5LCXA 2C77A 5BT8A 1QQ7A 4H1VA 5F51A 4DMMA 4EFMA 5BR4A 3M4ZA 4KO8A 4L75A 4FYXA 2X1VA 3PVCA 4EPWA 2WAAA 3SYKA 3D7RA 2PK3A 1LNQA 2OYSA 1IZ0A 2AFHB 3WGKA 5FV7A 3LSTA 2BSQA 1W4LA 1JG2A 5CM8B 5B3LA 4ZI5A 1X14A 4WHMA 1E79A 2C84A 1QLHA 1U7TA 2WIGA 5FULA 1O1YA 3W9SA 5EQDA 2AVDA 3W79A 2ZOSA 2GNOA 1IWPB 3HMKA 1NQVA 2C4KA 1RPNA 3I76A 3ANMA 1LXCA 4E5MA 2GBCA 4OMUA 4DRXA 1WZEA 4TKVA 3K5PA 3UATA 5CFQA 1JPNA 3AWDA 3MSXA 4ZCPA 2YWRA 3H2ZA 5UKDA 3P7MA 3EBLA 5EUQB 3E15A 1PBNA 1HDRA 1FYWA 5CK5A 3TLBA 4C7XA 4RENA 3BXZA 1B6SA 1IG0A 4J0QA 4WQMA 3RM3A 4NBRA 2OD2A 1SVOA 1JEAA 4FW8A 3WYAA 1PJBA 5DYTA 4QA9A 1RAAA 3PHIA 4WINA 1CRZA 1P17A 2HY7A 4QXRA 5LLSA 4EZEA 2DG2A 3CUTA 3LZ6A 1AHNA 2O0HA 4OUDB 2V0NA 5KYTA 4QAJA 3IE1A 4DR4B 2HWKA 4YBZA 5CB4B 5J47A 2FPUA 2G76A 4KU4A 1XRRA 4XKJA 1XEXA 2ODBA 1RQXA 2CCJA 1RJDA 4C14A 1G2QA 1WSAA 1R0KA 4KB5A 3LZCA 1RWMA 1QIGA 4EA7A 2P11A 1TU3A 2QBYB 1T9DA 2X2PA 1WTCA 2AYYA 1L7AA 2OC9A 2KS6A 3KWJA 4PHCA 4L9AA 2VUUA 1CRWG 4HQKA 4LRXA 4XX1A 5K0LA 3FMVA 3ICOA 5D3KA 3ZDYB 3SJBA 5F9HA 3RCBA 1XVVA 1M1UA 5KYWA 4JVSB 5IC5A 2GK3A 1BX3A 1JHYA 2Y2UA 3DMYA 3ZZNA 2UZ1B 2Z2ZA 3N7UA 2EZUA 1WPRA 2NVWA 5KJEA 2QTBA 4IFEA 1MHPA 5HF5A 1Q83A 1Q16A 1ADCA 5GJCA 3A4IA 3D4IA 3FFAA 3QW2A 5GM1A 4F8YA 3BHJA 1CETA 3UJBA 3G9ZA 1XDWA 1QH1B 1X1CA 2N3ZA 3GGDA 4OJMX 1ZPDA 1KMNA 2R2AA 5HZKA 5KNBH 2AEEA 2DHRA 3V32A 1H6DA 2ICAA 5HK8A 1RSZA 4C88A 3N2NA 3B9RA 1N57A 4FTWA 4F97A 3HJTA 4XLLA 3AXTA 1KI8A 1VMEA 4OJNA 4OLHA 5CFLA 1QYRA 1Z63A 5KAPA 5HJ7A 4LYJA 4S0ZA 3LWBA 2GF0A 4B09A 4ZDKA 1VJCA 2CVFA 4V0QA 1RS0A 3BGVA 5HE9A 1TEHA 3VUFA 4C4TA 3NHYA 4LRSB 3V7YA 2ZAGA 2ZIXB 4Q1CA 3ECSA 3T1HB 1ARZA 3QNWA 1F12A 3G9TA 1H2WA 3GJRA 4FHZA 1X0XA 2PTHA 2PRSA 4MZXA 5LXTA 5JBIA 1N2CE 2HA2A 5G4LA 4CKWB 1N9KA 4IJMA 5K45A 2O0MA 1FEZA 2QD1A 2B1GA 1IZ7A 4UUMA 2YVAA 5F2EA 3O8OA 3ZDBA 2NX2A 1QTRA 1E0JA 4ZV7A 4NMLA 2CSUA 4PGMA 5D01A 2IVZA 1GQ2A 1XZKA 3GP5A 3K6JA 2IODA 1NVAA 2AD5A 1PJ2A 1TE2A 2WKRA 3TNLA 5KDOA 1QONA 4IJUA 5AUPB 3A1DA 4HDKA 3HO1A 1AN9A 1RHKA 1WMAA 1GAXA 3D1VA 3OTWA 2YVUA 2C5GA 4CLOA 3PDHA 3LPAA 2AF4C 2BGNA 1R00A 4IWYA 2BF4A 3T5CA 3OPYB 4F5DA 1ZJWA 4W82A 2YBEA 1SU4A 2C96A 2F3QA 5CJPA 4DPMA 1PV4A 1YQGA 2Z1MA 5B4TA 1QWSA 3Q9NA 1KSGA 4E21A 1AGNA 4YMGA 1IDOA 2GK7A 1OJLA 1L7OA 1VIAA 3WICA 1WZUA 3E81A 5AOVA 1K6EA 4JAVC 2GZHA 2ZS9A 2I1VB 4OQFA 1G5QA 2CLMB 4IUCS 1OHHA 3MT9A 1I2DA 4PXYA 3K70C 1R9JA 3M6UA 4YX9A 2OORA 2W2NA 1ZMOA 1HT2E 3NVDA 1NMXA 3R6LA 4YCMA 2IA5A 1MTOA 1N9GB 4OFBA 4X20B 1BDBA 1CK4A 1YZVA 2A1UB 4L8FA 4TMYA 4WUTA 5MGBA 5K2MA 2QD4A 4QOGA 3PPYA 2ZI9A 4B2IA 3L8FA 2P8JA 4GXRA 3TOCA 3UPTA 5E2AA 4HGYA 2WHPB 3FLMA 2EDCA 4D4JA 1X74A 4DDVA 4HJXA 1QYXA 3BL8A 2F7SA 4G5XA 5F7JA 4X65B 1LC0A 1MQ8B 3U4HA 1U7ZA 3OLCX 1PTJA 2K4MA 1QFYA 4WA7A 3FNHA 1Z9BA 3UMCA 5I6DA 5IAKA 4ITUA 4Q66C 5JCPA 1NRJB 4BO0A 2G07A 4Z1MD 1P4JA 5DFAA 3VOTA 4E09A 2ZU6A 1Z4JA 3BL6A 2CD7A 3P71T 2XMCA 5BSKA 4R8VA 1GQSA 4KL8S 4XIJA 3Q8LA 3OIDA 3VI4B 4FUTA 1E60A 1RRGA 2VEDA 1NRWA 4TT3A 1L1EA 1XVLA 1ATIA 1FQOA 5G41A 1P33A 3G3EA 1ABBA 1RM4A 1JR3E 1EXWA 3V7UA 5HWSA 4OIFA 1ZGHA 4WBXC 5CYFA 3FYUB 3PKZA 2BRUC 1T5SA 1P0FA 2BZGA 2G7ZA 2VJOA 4JQOA 2VEOA 1G41A 1YC2A 3D8RA 3WXMA 2EEZA 2ZUCA 2ZUWA 1KOFA 2IU4A 1ISIA 4GW3A 1EE2A 2WJAA 3A1VA 1WCIA 2FA9A 3GEEA 1NUHA 3A9UA 1NQ5A 1NLFA 3WWEA 1W581 2H4YA 2YIMA 2IDKA 4KSCA 1RR6A 1PE0A 3W8NA 5H81A 3K9FC 5ARCA 3E3MA 1E9RA 1GAJA 1KI6A 2C54A 1I36A 3A11A 3E5HA 2WOJA 2WU1A 3UJ9A 4US2R 3D4NA 3N70A 3LFHA 3L0BA 2NWQA 3R0IA 2J59A 3F71A 3JALB 3NFYA 4DDHA 2ZE5A 1VL2A 4ZTZB 2I91A 1LDMA 3OKPA 1JU3A 1U3GA 4RGQA 1RPTA 4HOYA 3RWMB 3T5PA 2PMBA 2ECFA 4H4DA 2FFAA 3QI7A 4EW6A 4DLWA 2HRDA 2X86A 3F6CA 4HKTA 3T34A 1Z6XA 4O0MA 4E22A 5I48A 1J9GA 5BT9A 5JZ9A 4L95C 3OCWA 5LOVF 1TJ4A 4Y2QA 5EQJB 4BP9A 2WUWE 5IMSA 5IRCD 2IH2A 1U8CB 3O75A 1N8SA 2C3UA 2RHOA 3NOOA 2AW3A 1A4IA 1V11B 1ZZGA 3MCVA 5ALFA 4YLYA 1A9XA 4H59A 3AUKA 2OP0A 4M1YA 5E6UA 5JS2A 2ZI5A 4LZPA 2O8VA 1I2CA 1L5YA 2W0SA 4KVAA 1OGYA 3WMRA 3W0LB 1JECA 1RDFA 3I6MA 4BE4A 4XDHA 1TYAE 1MJHA 1JLHA 5TDHA 1S2IA 4J3FA 2AG8A 5KYGA 1NVXQ 1NU6A 3SJUA 2PL5A 4MWZA 4YR7A 4TRNA 1NHGA 4BZQA 1QFMA 3V4LA 3I9V6 1Z35A 5CPBA 5LNK6 3AEUB 3TIVA 1DTSA 2F1HA 3EC7A 1Z4LA 1EVEA 5BURA 1HLPA 3C70A 1M1NA 2FOIA 2JD0A 2RH5A 5EUMA 3ZWXA 3JQEA 2Z8YM 5FA6A 1G4AE 2FPLA 3E9ZA 4TVBA 4YIHA 2GPAA 2WF6A 1XRMA 3KQOA 3KX2A 4OYYA 4CKCA 3Q7QA 1QDLB 3HUFA 1SJ9A 4DV4B 1JTEA 3H5LA 4HN9A 5G0VA 1EIWA 1E99A 3X2EA 1Y6ZA 4GYWA 1PJLA 3LPCA 5KI6A 4JDUA 2PKEA 2E4YA 2JBWA 4HCJA 1YRAA 4IEEA 3LX4A 4NAHA 4OLJA 1KMHA 2E1RA 4UEOA 2VSYA 2AHOA 1AHHA 1PYDA 2B35A 2OGZA 4I1UA 4KLNA 4II3A 2PFGA 4R98A 2EWMA 1MC1A 3HXOA 3H1TA 1CKEA 5GADl 4L5AA 4LVUA 4Q12A 4EA8A 4C2AA 3ESQA 5B12A 3TR5A 4GX2A 3SYLA 1I9CA 3PSAA 1ISSA 5C7YA 5H7XA 1CCWA 2P4UA 2EX4A 3MGCA 4I50B 3O5AA 2XDYA 2VFAA 3HYSA 1JJ7A 1N1GA 1E3DA 1KETA 1REQB 2FNAA 2XIJA 4K6KA 2CVZA 4D7AA 2PXXA 4DDKA 5HKAA 5IH7A 4LEIA 4CLRA 2Z6AA 1XUOA 1RAGA 5JW6A 4X3OA 4D0RA 3I2IA 1OW3B 5FNVB 4D9NA 1VPTA 4XWGA 1ZDMA 1IJFA 1ORVA 1RTTA 1J23A 5DCUA 1KQFA 1Z6GA 3EXFA 2B6NA 4KK3A 4NTZA 3QOXA 4W9MC 5EJ2A 4BO3A 1JLSA 3FDZA 3P1JA 4WKOA 4RMHA 2CB9A 4UKDA 4LJ9A 1SWWA 4BQIA 1KFEB 3G8YA 4Q3BA 3I5XA 3IYLW 5T41A 3PE4A 2Y9PB 1K6XA 2H0RA 3NHPA 3KQHA 2GVDC 1KL7A 1P9WA 5FBKA 1CR2A 3FNEA 3G0CA 2WLSA 6CHYA 1FS4A 3CLTD 5K3OA 5C35A 3GL9A 3VQTA 3PRHA 4TT8A 3T3HA 3UJPA 2JS7A 1DTEA 1EA5A 2JGDB 2OVFA 3FGOA 5FWAA 4AP6A 4UXIA 2JEOA 3PHLA 1L5OA 2PYDA 1GG8A 5B36A 1JNYA 5F7OA 1PUJA 2JEZA 1Z7BA 2I4NA 3EVGA 2AUNA 4P3NA 3KQQA 3KYDB 1Z7EA 4L76A 4GDFA 2ATIA 4FOPA 4FN5A 4DV6B 1Q0PA 2P6OA 3NWPA 4KRXA 1SXHA 5ER6A 1HE3A 5T4HA 4QGSA 5BWLA 3EPHA 2FR8A 1PR3A 4WDRA 3WS7A 3ZU2A 1SIOA 2XTZA 1T8PA 3NYRA 5EY5B 2R8OA 3TJZA 2HWYA 1DI0A 1IJBA 3OFJA 2H9YA 4RY0A 2PKRA 4WJLA 3NIGB 2VG8A 1ULZA 2RHJA 4TS4A 1UPFA 3MUOA 5EMKA 2W42A 1T0PA 4ZVMA 1HG1A 3FMGA 1PZXA 4M9CA 5DYGA 1ZRHA 4CV3A 4D9KA 3MBKA 3GZTB 3PI7A 4IDAA 1NXWA 1PGNA 2HCJB 4A03A 3TXAA 2HHCA 3DHYA 4QQKA 4L4XA 4UE6A 4W5HA 1R18A 1R8QA 2WTEA 3A1FA 1L4KA 2HJWA 3THSA 4IG9A 2BAGA 2O3UA 3WIVA 2DQYA 1J2RA 3AU9A 3GWZA 2C1XA 4KQEA 4ZA2A 3ZI4A 4B7AA 5IT0A 1U3DA 5E6SB 2R4TA 1NUQA 1XWIA 4RABA 1JQJC 1L4BA 4XUDA 1B0ZA 3FYDA 2OWDA 1Q0QA 5AK5A 4MOWA 3I23A 5JC8A 2QX4A 2R3SA 2HCRA 4OKIA 4WLVA 1M6VB 3BHIA 4JP1A 5ALRA 2AEMA 4QJ4A 3WNQA 3B51X 1YB2A 2PVCA 5CDHA 1B0PA 2QUHA 3IE2A 5J5CA 4RIGA 5CD1A 3PQFA 3OAAD 5IC6A 2EDAA 2V6JA 5AXCA 4YMUA 4MPTA 2XWPA 4FGUA 3L1VA 3HDGA 5KJCA 1NUPA 1U80A 4C7OB 1OWLA 2PL9A 3H5VA 3LUGA 1JHXA 1LW7A 3DMRA 3KQVA 4PZZA 1FOEB 3I0MA 3TK1A 4DQDA 1RQ7A 3A25A 2IP4A 3LXXA 4MQ6A 4PG4A 5FOQA 4OH7A 1FTSA 3TW6A 2ZVQX 1PHPA 1O03A 2JBAA 4B2LA 3ZGXA 3K0KA 3OU6A 1SBHA 4NNOA 4RLHA 5THXA 5B64A 4A9AA 3EVNA 2RMKA 3QXHA 2F3RA 3OM8A 4OCZA 1LBTA 3SOPA 4BTLA 1VHJA 3QEBZ 3DTVA 4UM9D 5LNK1 3FR7A 2V5UA 3PFFA 3QKUA 1C3EA 4KBGA 4KMMA 5CB0A 2Y6UA 3RADC 1SU7A 5G4KB 1O6ZA 2PJUA 1HQCA 4M60A 3V8VA 2D7JA 2ECQA 4PYLA 3EF3A 2ZITA 4WZAE 3T7TA 5GOTA 3H75A 1A1SA 1H6BA 1CEXA 1QP8A 1ZXLA 2ZJFA 3KQMA 2VNKA 4HGNA 1A82A 2W58A 3C6YA 3S8EA 4RPCA 1WHSA 3HR7A 4JENA 4DKJA 5BMVB 4JEHA 4HH3C 2GBGA 2HDWA 3OLXA 1PWHA 2DFPA 5FQNA 2IS4A 3DMPA 4MHOA 3HDJA 3Q6MA 1J09A 4HDSA 4X93A 1U2DA 5KWIA 1KBOA 2V6IA 1G7RA 4U7GA 4ZTUB 1BX0A 3DMDA 4DY4A 3WLIA 4B35A 1EQUA 2BV3A 5I5GA 1OI7A 2GEVA 3GDWA 4FJ1A 5C80A 4O5AA 1XU9A 4HP8A 3MWLA 1QV6A 1O5TA 1RRPA 1YJ8A 2XODA 4IGKA 4IMRA 2PS9A 3M6IA 4MR9A 2NXNA 4RQTA 3VJLA 5CFZA 3LK7A 1LUAA 1BA3A 1P4HA 3SXUB 5BPFA 5L6LB 3QVKA 4RQUA 4JN6B 3AM3A 4GZ3A 3C98A 1OH8A 1VHLA 3UH1A 1PKEA 3LX8A 3QW4B 5HGJA 2VP9A 4Y2UA 3FYHA 4CCYB 3WTBA 1WKVA 2YXDA 3FYCA 4R69A 1QIJA 5JARA 1DZ3A 4JJ7A 4DIDA 1C8LA 5AKHA 2WJYA 3SLKA 3M3DA 5L7YA 2NUBA 2HJRA 4NARA 3LD9A 1T9BA 2VC2B 1OTHA 1TMOA 4J3JA 4PFSA 5FKJA 4FJ2A 3GLTA 1P75A 1UFKA 1AGYA 4Z7JA 2Y0BA 1FQKA 5SYNA 1UPCA 7MHTA 5FLKA 2E18A 2JGJA 2QUKA 2P1RA 3JYPA 3UV3A 4U2EA 1LTHR 1X3LA 3QV1A 5D5QA 2YY6A 4GDMA 1SUEA 2RK3A 2CXPA 3PGVA 2QPLA 3KOMA 4QDXA 3GG9A 4RCZA 2NACA 3E9YA 2Y1FA 4U00A 3THYB 2RGWA 2EHJA 3EUAA 2VYNA 3TOZA 3WLRA 5LOVA 4C2TA 4PO1A 3KZOA 5JVDF 1T3TA 3Q2KA 1Z8FA 4UM9B 1M2FA 4GNRA 3IDOA 2QL7A 5SZKB 3I9KA 4I1PA 3D5QA 3OCVA 4M0LA 1GPMA 3IKTA 3DBIA 3HY4A 2K7ZA 2WSMA 3C3XA 1B2LA 3M33A 1R12A 2NXCA 3WNVA 5DYIA 1Y6FA 1E4OA 2RB4A 4WZ6A 2IYLD 4UOEA 4AI6A 1F2UB 2CZCA 4IXWA 3S4YA 1YB1A 4GU5A 2NO6A 4FKBA 4QOJA 1P6QA 2DLDA 4RHYA 1G38A 2FGJA 3GJYA 3NEYA 2R8EA 1E66A 3QMMA 3QIAA 4FYJA 4YGXB 3ZNQA 4IRMA 4TS9A 1C4WA 4RVDA 2JGFA 4B85A 1P77A 1C0PA 2PX8A 2YFKA 1TC1A 3L9WA 2WJJA 4DJDC 3EFBA 3ZDDA 3R20A 4JOQA 5DT2A 3T12A 5IC4A 2XYQA 4O6VA 4LE0A 4TTQA 5EE9A 1P9LA 1VE7A 1T9ZA 2VO1A 3RROA 4EBBA 4Z4EA 2C5FA 3MWDA 3RHFA 2HO4A 1WB9A 3KZMA 1TCBA 5IKXA 1ZCJA 4A8TA 1F1JA 3RWOA 1AQLA 1IQ0A 4IOLA 1RMQA 2G06A 1M8FA 2HSDA 2PSDA 5BN4B 1WB5A 2H5IA 3AKYA 5ESDA 2B36A 1R1DA 3GDOA 4TUYB 1YRYE 1DAGA 1F3LA 2W2KB 3BMXA 2G67A 2V7XA 5D7NA 3VAZA 2I2CA 5JCJD 1ODTC 3IC5A 4NOLA 1CJMA 1CUZA 3AEQB 2Q7XA 3GJSA 1NT2A 2GN8A 3AH8A 3MRSA 4JOSA 4QHSA 1B6GA 3C3CA 3U4IA 5DHAA 1FRQA 1U2GA 1AQIA 1D3AA 4NAUA 4HS4A 4E33A 4LA4A 1BO6A 4HX2A 3Q9UA 5JCOC 1PFUA 4JA0A 1HYEA 4BUCA 4D9HA 1FNNA 4KGVA 3QYAA 3VPBA 1U9YA 3LG2A 1E4EA 4S12A 3AKDA 4WK4B 1ZK1A 3D6TB 2CLEB 2NV0A 2WUEA 1SCKA 3KQWA 4I3HA 3DOCA 1G66A 1SD5A 1T5LA 2PA0A 5IEJA 3JD2A 2HBRA 1AHPA 1DAPA 2QQ0A 4UMVA 1TLFA 2HIGA 4FZJA 5HJ2A 3U48A 2JCXA 2ENWA 1OBFO 3H83A 3FOFC 1AC5A 3ZV3A 4JFRA 4QVKA 3U3MA 1H5NA 3HL0A 3VAYA 4MW7A 5LBTA 3Q10A 3P2IA 4KZKA 3RVOA 2CBXA 1N5LA 2BE9A 2D1TA 4A15A 1PEYA 2M1XA 4PNHA 2YTZA 3GGOA 3PF9A 1XNRB 3CNQS 1DBQA 3T3NA 2Q4EA 4RH1A 5DO9A 2ODQA 1MQSA 4RGVA 3IVMA 1OXKB 2P9BA 2JLVA 3AVVA 3CVYA 2NUPB 1G8AA 4UARA 4KIFA 2FAXA 3DVAB 4GRIA 2I78A 2IXDA 3Q98A 4W9RA 1ZIOA 1H9BA 2O2DA 4JVMA 4O2BF 4HFMA 3ZXXA 4S3MA 3EFHA 2H2HA 3FE2A 4J9VA 1DE0A 1NVBA 3A04A 4BVKA 5CBKA 2ZRHA 4JMLA 1WETA 3H99A 4RVFA 1BROA 3TIIA 2B8NA 3OU2A 4RIFA 1JAYA 3N53A 3PF8A 4BMNA 3ILHA 1NLUA 1YBFA 2YX1A 1SCDA 3KFLA 5EWMA 3U31A 2FMIA 4XGNA 4F56A 1FLVA 2WF5A 2VPWA 4LAFA 3QU7A 3BJIC 1N2JA 2R1VA 4X1YB 3JAKA 4CMEC 1Y6JA 5LOVB 1P1KA 1TT5B 1J4AA 4J1TC 3V8PA 4CM4B 4ZODA 1EBUA 1P91A 3P9SA 2J6BA 1WVMA 2BMVA 1A7KA 3FGPA 4QGGA 4DV7B 3D8NA 4Q39A 5CFRA 4V0MA 2G04A 4B82A 4B0OA 3UG7A 3IQIX 1ZH6A 2GPNA 1C0LA 1JL3A 3EK2A 2WKQA 4C01A 1MAWA 4S2UA 2ODWA 4J75A 3L0PA 3OSZA 4AG5A 4CMCA 3EMVA 4V39A 4X5OA 5KU7A 1JALA 4C04A 3EUFA 3NCTA 3W5HA 2DUUA 2ES4A 2IDMA 1V7CA 2BFDB 2QN2A 3S2SA 2C9ZA 1IN7A 1V2HE 1XJWA 4OOFA 2D6FA 3VR3A 4HX5A 2DCUA 3DHNA 3GVXA 5JEDA 2IGBA 3D7NA 4UBJA 3TS1A 3UB3A 2WMOB 3T9BA 1Y89A 4DT1A 3WGGA 2YHIB 3FUXA 4F9EA 1QORA 1QHNA 3L4BC 4B4VA 5ERYA 3B70A 1HTBA 2V45A 3CIOA 3SM3A 3WA6A 3VGPA 4UPVA 4B6OA 1VCOA 2ZS8A 3C7DB 5F23A 1ECBA 3I34X 1JDBB 1UDCA 1JXAA 2X8JA 1EVLA 4MS4B 4QTXA 5CLJA 3COVA 3R4CA 5JSZA 3P0EA 2C7BA 5HMLA 1Q84A 2VHZA 2NU7A 5FWDA 3AKZA 4K81B 3GFFA 5FBLB 4CCAA 2XRMA 1RAIA 4B43A 1H4TA 3GVHA 1QG0A 1RNLA 1RM5A 3HH8A 3C1UA 4OM7A 2QP3A 3FPKA 1L5HA 1EFVB 4BFUA 3NEAA 5DTMA 3KWMA 1IM8A 4DJFC 4JYPA 4WVFA 2GF9A 3CC8A 4UNSA 2I66A 2RJNA 1XJ0A 4JIGA 2WYWA 2PZLA 2J07A 3NWJA 4JIMA 1V1MB 3F6YA 1YI1A 5EHXA 1DEOA 3BQMB 3IMEA 4XD2A 4UTOA 3R7AA 1E79D 4F84A 4EVRA 2QMEA 3IAUA 3MTBA 4MI3A 3T9FA 2CVQA 1LY1A 1KJWA 2JHAA 4PAGA 4DLKA 1C3OB 2PT5A 1NJFA 1N6KA 1NW8A 2UVPB 1S2OA 2CGEA 4DIBA 4IZOA 4ZCRA 1CQJA 1OAAA 1QHXA 3FOWA 4P58A 4U7HA 2VJMA 2VJBA 5CIYA 3P9PA 5FUMA 4CWAA 2DSNA 4CE6A 2OKCA 3VR5H 4PNEA 3FVQA 5FLXA 1E1LA 4ALJA 5KQLA 5D6OA 2RD2A 2HX1A 4G0MA 4O8ZA 2VUTA 3VPCA 3VR6A 2X1MA 3QEAZ 3M34A 3NR2A 1RKUA 5L4NA 4LMBA 1AMOA 2V5VA 4MS1A 2V1XA 5HDQA 4LJ5A 4MTCA 1ISFA 4PYNA 3UQYS 3CPEA 1JN0A 4QOEA 4DBLE 2RHGB 4D0NA 4BCCA 3ZEIA 1P7WA 2YJ3A 3I52A 3GLSA 3IO5A 3P2KA 5K0TA 1Q7TA 1GTSA 4TTAA 2ZRAA 2VATA 2PR2A 1A69A 1ZFNA 4AC9A 4ZCIA 3LNCA 2ECOA 3QKIA 3FTCA 4JX8A 2IT1A 4RVGA 3OPXA 2VOEA 2W83A 4PLPA 4JS0A 4RVOA 1UWVA 2IPAB 4HNHA 5EEHA 4C6RA 4AL4A 4P3PA 3JATA 1OAKA 1M74A 1U0LA 2GCEA 2QE6A 3DZFA 3BE4A 3X44A 4F71A 4Q37A 4PRZA 3QLJA 1DWQA 1B74A 3IT0A 4JP5A 5JFOA 3UGJA 3SZGA 4QQRA 3QX8A 4JY7A 3IQWA 4WNYA 3RC3A 3V48A 1VZ2A 1KE1A 5EYPA 1E9SA 2AC7A 3K5HA 2FZ4A 4GE0A 1KSFX 1SU6A 3GQBB 5KDLA 4RVNA 1LSUA 4IPTA 4OFXA 3N2IA 5EIWA 4R1OA 3X2SA 4NPCA 1WUJS 1YA8A 2GBPA 2ZR0A 5E7JA 2VWQA 2FFBA 4MUXA 3GELA 4OO3A 1ND5A 1CE8A 3BCHA 5FDFA 3LTNC 5FL7A 2IHUA 3GDHA 1Z6YA 3O9VA 5H9VA 2ZIEA 2A58A 2QVXX 1XAGA 1FDWA 3VYTB 5DIZA 2FW1A 3MERA 2Z95A 3G59A 3MELA 4QBFA 2X8LA 521PA 3TZ6A 1A8PA 3JQ9A 1D4FA 1PEKE 2B4AA 1BE0A 2XYHA 3GMDA 1Z5NA 3EVCA 3QVJA 3G7UA 4PLTA 4WN9B 4CFYA 3AHHA 5FYDA 3V3KA 3VKUA 1NX6A 4ZU3A 1Z0KA 3BX1A 5FUWA 4AMYA 2IEIA 5THQA 4NH0A 4LBYA 2JARA 2XPCA 4H7DA 5MN4A 3KXKA 4QWMA 2GARA 4OXRA 4PF1A 2R6DA 2VT2A 4XGKA 3BRWA 1XGKA 4HT3B 1P0MA 1FNMA 1ZWLA 1RQRA 2WIBA 1QC5B 4AY4A 2EEPA 2RH4A 3I0ZA 1MT3A 4BVEA 1E1QA 5KYVA 1U1IA 4CI9A 4D98A 1WXXA 3PC7A 3EGIA 3HKEB 5JAQA 4WTOA 2HNBA 1E2DA 2OUKA 4OXIA 4S1PA 5JQGA 2B1IA 2RHBA 4PWYA 1H0KA 1VJ1A 5KBYA 1JZTA 1OZ0A 2WM3A 2X2FA 3A9CA 4TS1A 4XVUA 2D1YA 3C3EA 4FEEA 3O93A 5DN6A 1I7QB 1UIMA 4ZQEA 1AK2A 1FDVA 3RK0A 4ER7A 1Z2OX 1XEXB 4G5SA 4CM7A 1D9ZA 1R8YA 1PKXA 2ZI4A 3EVFA 4GQAA 2O5VA 2HMTA 2WYOA 4HWRA 2J4DA 5ELLA 5ILQA 4D45A 3RRFA 3PD7A 3KHKA 4W7HA 1ADGA 1OH7A 1J24A 1P2UA 3AVQA 3QVSA 2VSNA 1K0FA 1GR0A 3QTTA 1OHHD 1L2TA 2ZYHA 3MTJA 4RWZA 5I4KA 3T4XA 2A2ZA 1AF4A 4PIMA 2WB4A 2EBFX 1FFYA 4G8BA 3IB3A 5EXDA 3ROFA 4HZUB 4AQ7A 2V1UA 4J03A 1Y80A 5HHTA 1Z4KA 3L3BA 1YZNA 4R1NA 1W59A 2ESRA 1C7IA 1QH8B 6LDHA 2Z0MA 3QVWA 3S27A 1QHGA 1EYZA 2QQGA 4D3SA 3RLFA 1Q1QA 3Q41A 1OVMA 2GA8A 2JASA 4DZRA 1TYBE 2ZYVX 1MW9X 3ZOZA 2P6MA 1OVGA 4NBNA 3V34A 5FV4A 4ICIA 4WX2B 2I6XA 5EE0A 2VDRB 1XF9A 3RC7A 3EAQA 3P0FA 4HQOA 2PWZA 1PG2A 2VK4A 4LJ7A 4G01B 5FUBA 4AF8A 3ICQB 5EFOA 2O8CB 1EDDA 3T7SA 5AVUA 4XUEA 2O48X 1ZKDA 3E2IA 1ZOSA 4ZC1A 3TTVA 2FWMX 2O9JA 4J0EA 3FDFA 3UKOA 1QV7A 4TM8A 2QSYA 3AF2A 2WY2D 2P91A 3OCJA 3D3KA 2Q3EA 2XUIA 3H4TA 4EX7A 3A2MA 1B93A 2FSVA 3KUXA 3ZD6A 3UMRA 5FT9A 1BN7A 4TL9A 4YAKA 1IK6A 1OI4A 1VKNA 4TT3D 2G88A 5AVJA 1R5BA 3I2GA 3KBOA 2F3SA 1JIUA 4ZEXA 1JSXA 3URMA 1UKBA 3FSRA 4Z4FA 3H3XA 5HRCA 2P9EA 1DFIA 4J91A 1CR0A 4QUBA 3WGVA 1KXZA 1U1FA 4EI8A 2X0EA 1L5QA 2GCNA 5LXTB 3NHJA 1SC3A 5J2TF 2X1HA 1RM0A 1BVRA 1MGPA 3QBVA 4IQ8A 3VO2A 1HDXA 2W6IA 1PQWA 4EK9A 3U3ZA 4F4UA 3WLTA 4DWVA 3KUUA 3K5WA 1V9LA 1UOOA 2FZLA 3SCZA 4OK6A 3HI4A 1B73A 1BU8A 3H2GA 1T91A 1BKDR 1F51E 2GK4A 3R3JA 4PYOA 5IYZF 4CDRA 5LQUA 5CVEA 3WIUA 2VSFA 2O7RA 3QG5A 1VLJA 1WP4A 2FMHA 4LBVA 4RVSA 1I2MA 1Q7EA 1W2GA 3A0UA 3A28A 4H6WA 3X1JA 4QULA 4EUHA 1R16A 3A1NA 3BILA 3G82C 3T61A 3W8FA 2RJ3A 3K9BA 5KJ1A 3IHTA 2AMLA 3JYQA 3OC0A 5I9TA 1XRQA 4DG5A 3BA6A 3TINA 5CFNA 1L1QA 3M5DA 2UU9B 4N48A 4ERXA 3LV8A 1NYTA 1V6AA 3WBJA 1ZHFA 2NYVA 1G4UR 2XUHA 5JXWA 1MW8X 4EEKA 3ZHXA 4N0MA 4FD2A 3F78A 5DTIA 2FFHA 1P7ZA 3WAJA 1UF9A 3W8EA 2XVZA 3NHAA 3F5MA 5KPJA 1KZ4A 3R0ZA 1ZXXA 1I24A 3ACCA 1CB7A 3B89A 2OQRA 2ZT5A 2HWXA 1E59A 2J0VA 3EODA 2H7XA 4LOAA 5TJHA 1W85A 5IM5A 2CMHA 2WAYA 2H1WA 1JDJA 1QRDA 3ORFA 3V6MA 4UEJA 3MUNA 3DNMA 3ACDA 2GM3A 4KXMA 3LE8A 3VBEA 4IMPA 1EM8B 1NYQA 2PKXA 2WG0A 1RFLA 1NNUA 4XTCS 5E9QA 2R5NA 3NKFA 3PIRA 3GGJA 5EQTA 2IHYA 2ZWIA 4M1OA 6NULA 1WBJB 1UJ6A 1K3UB 4PR0A 1TVCA 5G53C 3DLIA 4BAZA 3JU3A 4XCXA 1O6CA 2ZJ3A 4FGWA 3WKCA 4Z5XA 3WQBA 2GRJA 3I6ZA 3GCXA 3PXUA 2FG6C 2Q0QA 3PWKA 3KXIA 2WMNB 1G20B 4EF6A 4F85A 3N2ZB 3UTDA 2V55B 3NS7A 1K75A 1ZUNB 2H9AA 1WV1A 3NYIA 3OQ1A 3PDIB 3WKAA 5KYXB 1N5OX 4B8ZA 5F1YA 2RGRA 2UUAB 1J42A 5D5HA 1KFJB 3C7KA 2AI1A 2FUCA 4D8XA 4O0LA 3ED1A 1P0PA 1O0CA 4OHYA 3D3WA 1P74A 4ALIA 5I7UA 2B8WA 3IR5A 3EISA 2Z9CA 1E2JA 2N0SA 4V38A 1SRRA 1BN6A 3VBCA 5FI5A 1UWCA 5HZMA 2J9RA 2OLJA 4GLFA 3K6SB 2N46A 4IIJF 2P3LA 4YRQA 4HB0A 2XKBA 3T7JA 1KVQA 4O4IB 2XQJA 1USUA 1XZIA 2AK2A 5EE3A 1QIDA 2X5OA 2EKDA 1WCIB 2GN0A 4W1QA 4DC0A 5C53B 1INLA 4WLEA 1IIBA 2CLCX 5P8WA 3WA7A 3I2KA 5G1OA 3M6XA 4N7RA 3UA3A 1M0EA 4KMOA 2CNNA 3Q40A 1BXGB 3IRVA 2COEA 4G0OA 1ZBQA 1Y1PA 2YFYA 1PR9A 1LA2A 1X7YB 1WABA 1E3QA 2VQEB 2PZ8A 3WDSA 3QUTA 4ZO4A 3GFPA 5LQDA 3PNKA 4UFPA 3NNDA 5BP7A 4G81A 1X87A 3BRSA 3HCNA 1RWWA 4IXDA 5JWHA 1HX7A 4A8JA 1NLZA 3ABOB 2G83A 4B4KA 1KPGA 2NO0A 1YNOA 1V8DA 1ZJJA 3GN1A 3QLVC 3C1AA 4XPZA 1M0SA 2XOKA 1YQUA 2HAEA 1I0LA 1CUBA 2BFPA 4YDRA 2XQFA 3W3AH 4WASA 1AV6A 4IMJB 4C78A 4Q19A 4DADA 3PLRA 3ZCXA 1VQ1A 4L6AA 2IUFA 4GMKA 1NN1A 1XYGA 1SK9A 3HU3A 3WFZA 2W7TA 4K2AA 1X86B 3K2IA 1OWOA 4P80A 1YFKA 4EQ6A 3PV0A 5F3DA 1MIOB 2C94A 4HEQA 5B4UA 1AKYA 2JGRA 2QTCA 3LGSA 2WT8A 1E7SA 1YU6A 2BMEA 4CEJA 1H9AA 1JHZA 4BO5A 3GUZA 1PVDA 1XLUA 1XOIA 1GEEA 3O7WA 4NPAA 4OXYA 4IRXA 4EHFA 4B0PA 1ONPA 3SIXA 4WXEA 1E3WA 1I1HA 3KOWA 2QUAA 3OZVA 2R7AA 5BOVA 2YZ2A 3RSFA 4EMUA 3E1GA 3C97A 1K6JA 4CUKA 4C7VA 4P4SA 5JSHA 1M6HA 1IY0A 1M1NB 5AW7A 3JD3A 4FCWA 1Z5OA 5B1YA 5JTTA 3O82A 5TMDA 3W6PA 4CKCB 2PNFA 1I7PA 4FP9A 3GNTA 3U7RA 3F67A 3CTPA 3U9LA 1MVOA 3ETGA 1JDUA 1EKXA 2FPGB 4RBNA 4ECAA 5E1BA 4BQQA 4WJKB 3X2FA 4M9ZA 1CLUA 1X13A 2QJRA 2FWRA 3AG6A 4U6NA 5IDXA 1GITA 3GEBA 1MP0A 4FE7A 1SUBA 3NDIA 2PO7A 1JFSA 4GUAA 4YJGA 3EGEA 2ONZA 3LRPA 2G9NA 1CUUA 4RKYA 4ENSA 3A4YA 2AQHA 2G7MC 4E30A 3W05A 1Z6QA 3WL7A 3OHMA 3WHIA 5ADHA 2HGZA 4CEHA 1R5OA 1GSHA 4XI9A 2GHRA 2RH8A 3DBLB 4YAWA 4MKFA 3KC2A 3KT8A 4M4SA 4RFSA 4C29A 1ZUHA 2HQ1A 2TMYA 1ZA1A 1QQ6A 3O4GA 3TFQA 3X0DA 3IVGA 4YLGA 5LUAA 3VKWA 2QTLA 2BDTA 2R25B 1ZR2A 3GROA 5CIWA 1WA5A 3R7FA 3AXSA 3VNBA 1GADO 3M1LA 3FY4A 3JQ7A 3WJ1A 3ZKWB 2AKEA 1QYIA 1D6NA 1JE1A 1UP7A 3F5DA 5F21A 4TS3A 1K0UA 1V16B 1K86A 3Q6IA 1VYHA 4KXYA 1EWQA 1G6HA 4XH9B 1I4WA 3VR4D 3LQ1A 1NMEA 4J0DA 2VPPA 2VSQA 4LDPA 4MV6A 2Q2OA 4F5YA 4GO1A 1NG1A 2MSKA 3DOFA 3GXOA 1RBYA 1WQ3A 1AGPA 1T2UA 2B25A 3IMKA 4MW1A 2Q2VA 3WWDA 4G0WA 4DIMA 2CFOA 1GQOA 4KE9A 1VSVA 2DVMA 2JI8A 2ST1A 2W2VA 3ER6A 4K40A 3BBLA 1P3Y1 4ZP1A 4Z2AA 2IHNA 3EWSA 1TI7A 2SICE 1R5NA 3DTVD 4N82A 3HNRA 1MPTA 3NH6A 1W75A 2OKGA 5CVUA 2KB0A 4XWOA 3L6CA 5BNFA 4V3BA 1IYZA 2P6PA 1WSBA 3P27A 4HFRA 2SCUA 1XTZA 4MVJM 4UTPA 3RYHA 3PSHA 4ZT5A 1PJSA 1Q6YA 2PM8A 3TTYA 1Q0RA 3BMOA 2QIPA 3K0CC 5EIAA 1GDDA 1UBCA 2OA0A 3NBZC 2G36A 1SR8A 3L92A 4YAGA 2LGJA 3NWEA 3P9IA 4OBXA 1RYMA 3K0FB 2Y9MB 4EI7A 4BKMA 4KOAA 3HWRA 5EGSA 3T99A 1YE8A 2FQWA 4KNWA 1O7JA 1YJAA 1KZ7B 3FFWA 1VJ0A 4M53A 1PFQA 1SC6A 5BR7A 2F48A 1OR8A 4IJWA 4CM8B 1D8TA 1G5RA 2GQ0A 2XMRA 5LYYA 4FMBB 5HKKA 2XT6A 3BF7A 4FLFA 5A62A 1Y4DE 1M1YA 4C6HA 3DZCA 4PXAA 1VSUA 4MWGA 3V1MA 1LJ8A 2FYTA 3IUPA 2O2IA 5FWYB 1WXWA 3BVPA 1NXOA 3DB2A 4HAYA 5ALNA 1DUVG 4YP7A 3C8HA 4DNQA 5KSOA 5FI1B 1Z62A 1L7MA 5K3DA 3C5HA 3KBBA 1UZMA 4Q4DA 3CGWA 3G89A 3R0JA 3L0YA 5BN5A 1A77A 1ENPA 4B44A 3UN1A 5JATA 4HWGA 1Q11A 3PFBA 1QYDA 4ZVTA 6GPBA 4LXXA 3FZGA 2OCAA 3VFDA 3L7YA 4LZWA 1P9OA 2AS0A 4G0XA 4YDHB 3ZTTA 1OXSC 3QOYA 2Q1XA 5EJ7A 3ASZA 3G0GA 4IKPA 1E5QA 2K7FA 1TYDE 2BEUA 2OBXA 3WIEA 5C1OA 1R0CA 3A4NA 3RGWS 1OUMA 2HJGA 4B34A 1QX4A 1DVRA 4JSRA 2CL5A 2JBAB 2RIRA 4L0QA 1HR0B 2JFXA 4CKBB 1L7PA 4RSMA 4I36A 4G1CA 3U4QA 2VYND 1JB9A 1L0BA 3BCSA 2B6HA 2A30A 3Q3GE 1NOJA 4QNNA 1V1RB 4J90A 2DETA 3KJZA 3F96A 4FC7A 2HFKA 3KAQA 1ODIA 4KYVA 1FFBA 2R44A 2QLNA 1IEQA 3K9QO 1KIAA 2A86A 3P9YA 2OGWA 3N0WA 3FCAA 3OP4A 4R9NA 4AY3A 3ONEA 3IJRA 2AX4A 4C1BA 1G21B 3HU2A 2XUQA 2HFJA 3IUMA 2FJ0A 1GCUA 3K09A 3QK7A 4OGFA 3NG1A 5IULC 1I5RA 1NM5A 1T6NA 1DC7A 3HA5A 3TTTA 3RREA 2G77B 4CGYA 5C8DA 1ADFA 4DLAA 4RD1A 4JLBA 1AUOA 2HSEA 1EIZA 4NF2A 5KQRA 1PDOA 1T8SA 2OV8A 4KPUA 4V0RA 4MSUA 2FLKA 4EGCB 2P4SA 4EUEA 1I6WA 1KKUA 4OQXA 2WG2A 5IXYA 4ARIA 1DKQA 4KXUA 4L0MA 1FJXA 1DAEA 1OX5A 3UKDA 2QX6A 4DSOA 1IEWA 2X4LA 4D9EA 4FFOA 4HAZA 1H2AS 2I80A 3KDPA 5EJ9A 1YB4A 2RC6A 3E70C 1W29A 3BE5A 1E2LA 3IEMA 3HXMA 1I7DA 1SKYB 3L04A 2VS1A 1GARA 2VSXA 2WP0A 4L8VA 1E62A 4QC2A 1GA1A 4UASA 1NW7A 3U1TA 3S1LA 1L4MA 2QJWA 5KZMB 4JCOA 4YJ3A 1TF5A 1L3IA 5H4HA 4IIJA 3U7GA 4F9FA 4TWIA 4HDRB 2JRCA 3QEMB 1M5RA 5LSAA 1U5AA 5CG1A 1QE0A 1LDNA 1TCCA 2H1CA 1NI4A 4PNZA 4V1CI 5MDHA 3ZWDA 4LK3A 3EGVA 2IV2X 3FSJX 3O3CA 5CVTA 4OJQA 4TROA 3RRMA 1H94A 4HB2A 1GLVA 3WK8A 4Z49A 4HAIA 1H42A 2H4WA 4IV8A 5DGIA 3CA8A 1S7CA 1HA3A 3C3JA 3OX2A 3Q6NA 4QU0A 1JG6A 5JECA 2EP8A 3HDVA 2ZSKA 2XNSA 2C7OA 3ZXUB 4MV3A 1MC8A 1V3VA 3KEGA 4WT7A 2HDHA 4H6PA 4ZC8A 1T4GA 3R24A 2Q3CA 4NU6A 1W4RA 1X7WA 1Y1KE 2KMLA 1QIIA 4N9QA 4LXUA 1YZFA 4IMIB 1UINA 1NMZA 2D7CA 4TXJA 3U4GA 2WAMA 4BDTA 3FSEA 2ZJ0A 4JFAA 3Q7SA 1M6NA 5DBIA 4O4LB 2JVKA 3QKSB 2QMUA 5K8TA 3ZWBA 1L4NA 3RSHA 1YWGO 3FI0A 2R1UA 1UBNA 2WM2A 4FDMA 4IUBS 5C1DA 5IT4A 2JHCA 1Y8CA 3EAGA 2UYOA 5HCUA 3VZCA 1DIOB 1QDEA 2DWCA 2ORWA 1C3JA 1L8AA 1Z6ZA 3AHEA 3UIEA 1FLAA 4JGBA 5JJ5A 3DSRA 3O0DA 1GYPA 3FUUA 1GSIA 2FDXA 3WLFA 2BFEA 1JFRA 1RLMA 2ZJ7A 4X60A 2GHIA 3UYLA 4AJPA 7REQA 3IOYA 5C81A 3NRBA 2VNHA 1H9CA 4O2AA 4UDYX 4O2RA 4EEXA 2OZPA 1MJGM 3S6JA 4LTDA 2IYSA 2P79A 2PEYA 1D4ZA 3BIXA 1HPLA 2G9RA 3A9RA 1M2GA 3CSSA 1EGMB 3JPYA 3OEYA 4I8XA 1JEOA 2AJ8A 3ITDA 3TXXA 5J9FA 1K4MA 1U2TA 2WWHA 4FEYA 4KUGA 3LA8A 4HV4A 1E8NA 4IDNA 3WGHA 4GP6A 2Z3VA 1QO0A 1W52X 1Q74A 2XQKA 1SUCA 3PA6A 1HZZC 5ALJA 5BR8B 4O3MA 3KTDA 8GPBA 5C2JB 4G1BA 1P73A 2IEGA 3FOAA 4G89A 1ZRSA 3L6RA 4Q1DA 4NP6A 5DVZA 3U5ZB 3A2KA 3EIOA 3GJ0A 1O96A 4JGGA 3TKLA 2X0KA 5FBRB 4EJSB 2GM4A 3CLUD 4NJEA 4Q82A 5DNCA 3T0IA 5K6AA 3F8WA 4LJ6A 4M0FA 3ER8A 4LQLA 3GD7A 1SB8A 3DV0B 1V43A 3THWA 2B21A 1V26A 4H4EA 4UTVA 5LKRA 4KXWA 3HZOA 2HEGA 3QX9A 4NFSA 4YCAA 5IT5A 4RDIA 1C9JA 3VR3D 4Q9DA 4X7PA 3ZWOA 2FMTA 4GGOA 2FPXA 3X3HA 1YJCA 1D09A 4WKGA 1JDVA 2H48A 1SO8A 2JGAA 2D06A 1SIUA 2WAXA 4INPA 2VLBA 3CRNA 3TLJA 4IVPA 2X1LA 4BBJA 1HDZA 4H18A 2PH7A 3VU8A 2JKZA 2KWIA 1YZHA 1Y8RA 2ZSAA 4ZI7F 4R4JA 5BV1A 1SUIA 3CWQA 1P8JA 2HRBA 2XUGA 3DKPA 3C3AA 4ZZ0A 4GOJA 4M1WA 2ZKIA 2XCLA 3QXJA 3SHTA 4YCBA 3ZWVA 2WPNA 3GK3A 4AP9A 4YJDA 4ZARA 2ID4A 4AJEA 2C8LA 2NO5A 4HL6A 5CGQB 4A2PA 2QLLA 2ZJ8A 3RIEA 4E03A 5F1OA 2I3GA 3EVZA 3AHFA 3RNOA 3A37A 3ETDA 2P2CA 2AMYA 3ZZTA 4RHCA 3SE0A 3GU3A 3HRHA 1NJ5A 4V0SA 5J2UA 1TECE 3BXXA 5AM5A 3JYNA 2WTMA 2Z2KA 1WIWA 2GPYA 5FFMA 7AT1A 4FPXA 3PX7A 3M2PA 2OD7A 3YASA 2C42A 4ROTA 2PVSA 3AFOA 1V5WA 3L0OA 2YN0A 3H13A 3MWEB 5DBEX 2OHFA 2UZIR 3A05A 1Z47A 3H6GA 4J0JA 4KZPA 4L8YA 2WUDA 1ZEJA 3N8NA 1CUIA 2B7CA 2RGCA 2HI0A 1ZD8A 1XKQA 1M6YA 3GYGA 3P0HA 1TJNA 1EFHA 2ZLBA 5GZ3A 3SJZA 1PQYA 4BTVA 1M2EA 4OU4A 1L8LA 1GA4A 5I7HA 5HKLA 3DM9B 2X2EA 3PD0A 4LRTB 1IZ9A 3BWYA 3IILA 5B1DA 3GLFB 3MYYA 5K0NA 1B4DA 3ZW7A 2QTMA 3EIHA 4DCGA 4OHXA 1EH5A 3JAKB 4FFBA 4MVJG 1C30A 2CFSA 4JYZA 2RGEA 1MX9A 4FDTA 1SKUA 5E4TA 4GWLA 4WK6A 5E9JA 3VR6D 1RZRA 1CJCA 4UUAA 3KVRA 4BQOA 5I8ZA 4GKVA 5BSFA 2EV9A 4IIEA 3IUSA 3AF3A 3L6OO 4CL3A 2BDUA 5FCDA 3ZH9B 2GD6A 3CNEA 3IOEA 1SVSA 3HVHA 2YHSA 3CX6A 4WUVA 2IEYA 4HH1A 3TZQA 3PC8A 5K20A 2BSAA 4JELA 3QMVA 2Q99A 5KYYB 1SXJC 5TVKA 4XYGA 3ZTWA 1OWPA 5ALSA 2CJFA 5JYEA 3HXKA 3OY2A 2HZBA 3CLSD 1ZESA 2ZFUA 3LRTA 4EIWA 3GCZA 5ERXA 1FU4A 5DEIA 4F8JA 1VMAA 3FCCA 4ZEVA 5BWBA 1J2EA 2O20A 4A1FA 4Y2HA 3DE4X 5ICEA 3AKCA 1SAYA 2L17A 1CS0B 2DY1A 5AXBA 2WT4A 1XMVA 5EJIA 2XKJE 2HXSA 1B8PA 2J6IA 5HFAA 3EEOA 3AQIA 1AKQA 5ALWA 1GZ6A 1E58A 4EHJA 4ZJUA 2GXAA 4B7UA 2C2GA 3AR7A 1D6MA 2X8JB 2JLQA 3S3TA 3TE6A 4F3KA 3NH9A 2IH5A 2G5GX 3S0JA 3CMCO 1LH0A 1VBFA 1GCAA 2H0QA 2WJVA 5J4LA 5K0BA 3GJXC 4QYSA 1FMJA 3C5WP 1E4YA 4ML3A 4S1TA 4CQLB 4GVPA 2PH5A 5FL7D 3K0BA 2W6PA 1D2CA 1C8KA 3P26A 3DF9A 5HTOA 1LFAA 4KHZA 1G5HA 1Q17A 1QDUA 2ZPAA 4Q47A 5F2KA 1NQOA 1DBIA 1KWGA 3C16C 4EA6A 3PYLA 1FDOA 3OPQA 3ASUA 2BR5A 2CJWB 5K3BA 1JXMA 2D3WA 1P4AA 4R8RA 2NTVA 2VR1A 3DEKA 2AL7A 4L2IB 1T2VA 2ZYDA 4M89A 5T8KC 3UKJA 5AJYA 1P61B 2NVUA 3JWIA 1NVEA 2JLWA 3E58A 1WXIA 3F6SA 3LFUA 3ZGVA 5KO2A 4C3OB 5KCMA 4OHZA 4EFLA 2R0QC 3L5OA 3ENWA 2RSLA 3BRWD 2YQ4A 4LC9A 4PWZA 4J0CA 3ZHCA 1DWPA 2IY9A 2JFQA 4MS3A 5KTOA 4F9GA 1C7ZA 2YWCA 1CQJB 5CLIA 3B3JA 2H17A 4PRYA 2VJMB 2FQ1A 1E1QD 3PPIA 3TKAA 2IBTA 4HEA6 3IUJA 3NHBA 4GLJA 1XFAA 4RD2A 1ZNWA 5FJIA 5LYJA 3IIMA 2BOVA 2MJLA 3EAFA 1H2RS 3ZDXB 4XYLA 3CRQA 1V9SA 5CLQA 3WRXC 5KPDA 3LC1O 3PTLA 4MR7B 2OCGA 2A4KA 3V1TC 3A9VA 4LHEA 4MS1B 1QXSA 1QYCA 3GUHA 4H7JA 4MIEA 2QMHA 1IHOA 2Z56A 8ABPA 3RTAA 1H22A 2VDKB 1NF3A 4ZAYA 1L5LA 5DN6D 4QHTA 1GAWA 2I2AA 4YRJA 4BFVA 2CHVA 4Q9HA 3WADA 2QOEA 5L3ZA 1E6LA 5LDGA 1E1MA 1VJ5A 3VZQA 4MWTA 2DFDA 2GBFA 5LL6P 1NI3A 2FWPA 1Z8DA 2W8BB 2ZRKA 4KR2A 4NHOA 1QTQA 1QHEA 1ZD1A 1QP4A 2IXFA 1ELOA 2JAPA 4LWOA 1X8XA 2J0SA 3GZNA 2HJSA 1QR6A 1RIIA 2OZKA 1OU0A 2YUIA 4DDMA 3QUCA 4P32A 1EINA 4NNPA 1A8SA 4ZEOA 4EB6B 2ZYWX 2P9QA 4E3WA 3RYIA 1LTKA 1QZZA 1Y7LA 3V4RA 2G0TA 1KYQA 1WLSA 4M9SA 5IMBA 4X41A 2EKQA 3D43A 1UDWA 4XVCA 1LQUA 2HQOA 1EA7A 3JSAA 2JFNA 3QKRA 3ZE9A 3GCDA 3LUBA 3EXG1 3R5SA 1FFXB 3W5VA 2HJ9A 3KR2A 2AQ8A 3ICPA 2KBFA 1BDMA 1FFSA 4F46A 3OZBA 3FPEA 5ALHA 1NMQA 3HNOA 2I4TA 2VF2A 3L6BA 5KNCH 4J76A 5JVDB 4LKOA 4RCYA 4WOBA 3KTAA 1IH8A 2BJWA 3I2JA 2D2FA 1LDBA 3LQ2A 2AUTA 4O4IA 1VHWA 5DGCA 1Z68A 2YC2C 3L8DA 5FOXA 5DCWA 2OBMA 2QXTA 2A88A 2P90A 2W4MA 3QUAA 4WZZA 4MRSA 3QM1A 4Y9UA 1SZPA 1E1NA 2PX6A 2FR0A 3KR1A 3CT6A 3NIBA 1UXGA 3JWHA 3WAGA 1MTZA 1DG1G 1T24A 3CF0A 2VJCA 2PR7A 1JP7A 2GD0A 3LVRE 3FGNA 4JYAB 3IEUA 1FY2A 3HXTA 3PENA 4LI0A 4QJ3A 3BRCA 3O8CA 4URUR 1L9XA 1KY2A 1Z8NA 3DC2A 3QBDA 5C18A 3LDFA 1VRVA 2QM7A 1I6LA 2DPXA 3TH5A 5KTRA 2VP3A 4Q1EA 2XUJA 3PUKA 5DHUA 4PRKA 4FGSA 3H3FA 4ZU1X 1IWOA 5JPDA 4EBFA 2NV6A 5EN4A 3LXUX 1CG6A 4QOFA 1CYEA 2MINA 1KYWA 5KDDA 2VCEA 3FNQA 4P0TA 4X3CA 3OECA 1YULA 2QMQA 2LDXA 3SKXA 2PU5A 3MGKA 3H0EA 1RRVA 4LGCA 1DC4A 3DEAA 4MV8A 5E3HA 1ADBA 2GFIA 1MH1A 2YWFA 3G0OA 5T67A 3ZHSA 1YKSA 3ISJA 8LDHA 2QZSA 3EIEA 2H92A 4MITA 4RHXA 1WMFA 4CKYA 5LFAA 2CEAA 3G5TA 4JROA 2B92A 1S89A 2PNJA 4O4HF 4ZFNA 2CXRA 5BYBA 1AQNA 1Z08A 4D6PA 3LNTA 4OEHA 5DCYA 1J97A 4NENA 2NO7A 5GQSA 5LJLA 2MT9A 2GETA 4EPYA 4DARA 1SCNE 2EFGA 1JB1A 4O25A 2D7DA 5CLHA 2O05A 3RVKA 4E4TA 1FS6A 1S1MA 1U99A 3SHVA 1MMFB 5AYVA 3GP8A 4LZJA 1OV4A 3TCKA 4ZO8A 2WTBA 3AZOA 3EXIA 4UBIA 4ZAWA 4WH0A 2VHWA 3JQ8B 1NQXA 1UK6A 3UFXA 2GZ2A 3ZWNA 4R1TA 1F8UA 4RZIA 5AK6A 5AKXA 1LQTA 2D1SA 4C0AC 1KIMA 5JJCA 1UKYA 3ZPXA 2ZM5A 2PGXA 3ETHA 1AHIA 2X0IA 4PHTA 5F1PA 3SQLA 1OIWA 1FBNA 3P2OA 5D1HA 3VTAA 1B00A 3BK7A 4DCCA 4YUZA 2YV3A 3H11A 5ANRB 2DXIA 4GR9A 2CV1A 1SZCA 1I3MA 2BGRA 3LQYA 1N32B 1DKRA 1SKQA 1Z36A 3ELWA 4QLAA 3DQPA 4UJ5A 4Z0TA 2F1IA 3L0SA 2BFMA 2WMDA 3RGGA 4U6SA 3CG4A 1L7EA 1NN5A 4HEA1 1USGA 4G23A 2ASEA 4O2BB 4OUKX 4UEKA 5CHEA 5PGMA 1WQ4A 2C9MA 3ZCTA 5I7FA 4BXOA 4MUBA 3AJEA 3F2VA 3I12A 2EWVA 3DP9A 3I2YX 3IESA 4LXYA 5AR1A 3OO0A 1Z4OA 3NX4A 4CZ2A 5J59A 1PS8A 5JXHA 1GFWA 3EEFA 4RJTA 4K6CA 1TL7C 4NJOA 4LE2A 5DF1A 5E38A 2ZUUA 1Y3BE 1GZ5A 1M33A 3T9AA 2WC1A 5I45A 1JT2A 2RGBA 1BVYF 3KP1A 5DI9A 2IYZA 2YXBA 3HCAA 4XGRA 4S24A 5DEOA 2PQMA