3L6BA

X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
327
structure length
322
Chain Sequence
AQYDISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVRKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of mammalian serine racemase: evidence for conformational changes upon inhibitor binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Serine racemase
total genus 118
structure length 322
sequence length 327
ec nomenclature ec 4.3.1.17: L-serine ammonia-lyase.
pdb deposition date 2009-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l6bA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l6bA02
2C2GA 2J9XB 4JBNA 5DW3A 5B36A 5IXJA 1CX9B 4KKXB 3VC3A 1KFEB 1CW2B 4NEGA 3L6CA 4AECA 5CGQB 3T4PA 2DH6A 3X44A 4HO1X 1X1QA 1Z7YA 1K7XB 2CLKB 2ECQA 5I7WA 5D87A 3AEYA 3IQHX 5D84A 2EGUA 1C8VB 1KFBB 4ZU6X 4COOA 5DW0A 4H27A 1TYZA 4NU8X 4D9BA 1KFKB 4F4FA 4L3VA 1TZ2A 3HMKA 2BHSA 5B3AA 2ZSJA 4PCUA 3BM5A 5B53A 5I7RA 2CLOB 5D86A 2Q3CA 3PC2A 1UINA 2RKBA 1KFJB 4Y6GB 1C29B 4D99A 1KFCB 1WKVA 3R0XA 2ECOA 2GN2A 1TZMA 3AEXA 1J0EA 3L6RA 4HPXB 1WBJB 5D85A 1TTPB 5J43A 1A5SB 3ZEIA 2TSYB 3PC4A 4D96A 1C9DB 1A50B 5JISA 1V71A 1A5AB 2JC3A 4LMBA 4ZU1X 5I7AA 1VE1A 4D8UA 4AIRA 1A5BB 1F2DA 1K8XB 3L6BA 1PWHA 2Q3DA 4LI3X 5I7HA 2TRSB 3TBHA 1WTCA 5J5VA 2WSYB 2ZR8A 1FCJA 1P5JA 3IQGX 4L28A 3VSAA 5E0KB 2CLLB 1VB3A 1K7EB 4LMAA 1RQXA 3IAUA 4I1YA 4L27A 5CVCA 5B1HA 5I7OA 3IQIX 2GN1A 4D92A 1QOPB 4D9IA 3SS7X 1V7CA 4D97A 1QOQB 4ZQCB 3VSDA 5JJCA 1BKSB 2RHGB 5DVZA 2CLHB 1FUYB 4HN4B 2GN0A 5DBHX 2J9YB 4OREX 1K7FB 5I6DA 3VBEA 5KZMB 5B1IA 2BHTA 4D8TA 5DBEX 1TDJA 1TZKA 1J0BA 1TZJA 2EFYA 3SPXA 1K8ZB 1VE5A 3PC3A 3RR2A 4HT3B 1JBQA 4XUGB 5EY5B 2PQMA 2ZPUA 4HPJB 1UIMA 3VSCA 1M54A 5IWCA 5T6MA 1TJPB 4D8WA 2D1FA 2CLMB 2Q3BA 4QYSA 3DKIA 2ISQA 5KINB 1K8YB 2C2BA 4JBLA 5C3UA 1K3UB 3DWGA 3PR2B 4OFXA 4D9MA 3R0ZA 1WDWB 3X43A 1TTQB 2CLIB 1V8ZA 1J0DA 1UBSB 2CLFB 4IL5A 4D9KA 2RH9B 3V7NA 1OASA 4D9EA 5HBGA 1Y7LA 5BW6B 1BEUB 1PWEA 3SS9X 2O2EA 1E5XA 3DWIA 2J9ZB 4D9GA 2V03A 4WX2B 5IW8A 5B55A 2DH5A 2O2JA 4D9FA 1KL7A 2TYSB 1D6SA 3CEPB 1J0AA 1Z7WA 4D9CA 1O58A 3FGPA 1J0CA 2CLEB 3FCAA 4L0DA 4D9NA
chains in the Genus database with same CATH superfamily
3EG5A 5H16A 1HF3A 3Q3VA 2P5YA 2NZ8A 4D74A 4XQ9A 1YDEA 2WU0A 5JO0A 2JATA 1K6IA 1MRNA 3UB4A 3QWIA 5KU7A 1V6SA 1YOBA 1U2EA 2RH5A 4X1KB 1VLQA 4QFBA 2A5JA 3IJRA 5EA2A 3EZLA 3NGLA 4ZHSA 3I2JA 2OGUA 4PIPA 2ZQYA 3VR2D 3A36A 4UQLA 4V02A 1JJVA 1TQ8A 4C2AA 3D4BA 1NNEA 2R86A 5GGYA 3CLUD 3RFFA 5BQFA 1N2GA 1YWGO 4NFSA 5T7BA 2W8ZA 3N87A 3DZIA 1GFSA 5D2CA 2W4MA 3RTDA 4QQ8A 1N2JA 1XMQB 3E9MA 3JPWA 4ZI7F 4IVQA 3UV7A 1G42A 2I6UA 3LA8A 5KSYA 1H2YA 3L40A 5HTKA 4AURA 4PZAA 2Y1OA 1QPZA 4CKYA 1X70A 3WDMA 4GE3A 1NLUA 2H4HA 3AH8A 1UEXC 1E9VA 4CZ2A 5EE1A 5FI5A 2C5GA 1FOEB 1ZM4A 4ZOLA 3ZJ4A 2ZWMA 3GLHE 4RACA 2GASA 2PV0A 5A3VA 3VYRB 1NHWA 2VTBA 4ZVLA 1Q16A 1GSAA 3EK2A 1MAUA 1I4LD 3L8FA 1R4ZA 2X8LA 4RY8A 4X44A 3T9DA 1THMA 1A97A 4TLEA 1TU4A 2QZPA 2C9ZA 4AP6A 2BHLA 2F64A 3K2QA 2VT2A 4S35A 5AKJA 3BL5A 1QG0A 2QRKA 3ETGA 3PG5A 2IOFK 5F4BA 3G85A 1NQVA 2G40A 2HFKA 3E35A 4C04A 3VMFA 5MN6A 1HSZA 3K09C 1JIXA 4HDSA 2QL6A 5D00A 5I5GA 3VSDA 3W2HA 1UC4B 2I9KA 2FW6A 2B61A 4UXJA 3KD2A 2WWGA 3WKBA 3J81A 1ORWA 4Z9YA 2VDRB 2ZS8A 4RZQA 3M6AA 3DO5A 4TTPA 3HN6A 2G71A 3C39A 3HCRA 2G25A 5CTAA 3RU2A 4DFDA 3PGJA 1PDVA 2BHTA 4E03A 4FX2A 4MUAA 5DBEX 3I9FA 1E9AA 3T3EA 1P5ZB 3JVIA 1XC7A 1VPLA 1YFKA 1CCWA 2VO1A 4PFJA 4XVRA 5IVIA 1Z8FA 1FW8A 1S2MA 1D2HA 2Q4RA 2CXQA 3NBQA 3QX9A 1U0SY 2AFRA 3CEHA 5BXQC 1FE8A 2J3HA 5DNUA 4QFDA 3T7JA 1M75A 5HQJA 4CT0A 3WK7A 5L4NA 4WZZA 2QD1A 4DA8A 1V4BA 2QD3A 5ARDA 1J39A 1WF6A 4EEZA 3FWNA 2O5RA 3GROA 4GLBA 3CKMA 1L7PA 5BUSA 5G0TA 2VP2A 4DWWA 4BLWA 4MV4A 1KSGA 5ADVA 3ICPA 4I8XA 1CT9A 1XCPA 1LVHA 2UZ1A 4J91A 2VJKA 3NAQA 2B6NA 4RK7A 3VOSA 4BNGA 1PWEA 3G6WA 2V3CC 1I13A 2H9AA 1I0ZA 4RELA 3I9LA 4YV2A 1MFPA 1M8PA 3KYCB 2AOUA 3IEXA 2Y1XA 1DARA 2XZOA 2RG7A 2VDJA 3A0RB 1ULSA 2ZFUA 2H08A 2FW7A 1Z12A 3D3JA 1FFHA 2EFGA 1K4MA 4L0DA 2WIJA 1H85A 1Z4IA 4XIJA 4MI3A 1F4LA 1LFAA 2Z9DA 1XZFA 2QP3A 3AOEA 4RD4A 4ZKDA 2RI1A 1MGPA 1XALA 3TUIC 5I7SA 2OORC 4CMHA 1CPYA 5LQDA 2AG6A 4KE8A 1MLDA 2PJDA 3Q98A 1Q0TA 1UPUA 2Q9BA 2FEAA 5LNK6 2D59A 3MT8A 3H8VA 2WY2D 3O38A 5HDBB 1UANA 3SAJA 4FWTA 1Z6TA 2J5KA 1SIOA 4F3YA 4MDHA 2FPOA 3O75A 4HNUA 1EK5A 3HKEB 2P40A 2QNIA 3H5OA 1Y8AA 2H57A 3OBBA 4O3FA 5ESXA 5I8PA 2JBHA 2I1LA 5I7RA 3ETNA 1BOOA 1BN7A 3WOHA 1GEGA 4U7JA 4EHFA 2GUGA 3ORRA 1M6VA 3TLXA 3B1WA 1G5FA 4MQEB 1K2WA 2ZG6A 2PD4A 1B8UA 1DKPA 3H11A 4G4JA 4HPXB 2Q6LA 1OXTA 1PR1A 4LJ9A 3JWIA 3LJKA 4FHCA 1FJHA 4AJ1A 3L41A 1DIRA 4GSKA 4L8LA 4G65A 1PJRA 1TF2A 4JLBA 1KQFA 2XMBA 3EPKA 3EY4A 2W0SA 3SHVA 5A06A 5DDIP 2OV1A 4LI3X 4MJLA 5FH9A 1BE0A 3OIYA 5EKSA 5K8CA 1OKKA 8LDHA 1OU4A 1Y5NA 4KO2S 4BAUA 4DG9A 4IMJB 4YRSA 1I0LA 4BB9A 1PZNA 5B7QA 4PYJA 2VEOA 4P36A 3PKJA 1NXWA 1PTKA 3I2KA 4R9SA 1LWOA 1RLJA 3RHFA 1L8QA 3PX3A 2GPJA 3KU4A 4GWKA 5DWVA 3BDIA 5LKAA 3HYCA 2O8NA 1NIJA 4DLAA 2R4TA 4LISA 3UUGA 4AJJA 3ZBPA 1DNPA 1JDPA 1EFCA 3KLOA 3U7EB 3BC1A 3HRIA 1RM4A 2PUVA 3ZR4B 3HU1A 2YYSA 8GPBA 3IMFA 1BA2A 1ZIXA 3JQAA 1TKCA 2GK4A 4KFCA 4QRHA 4KXLA 5F73A 1I2CA 2ZDHA 4HXGA 3TVYA 4HT3B 4AL4A 2XA9A 4ARBA 1MRSA 2WM8A 1MRZA 3MJCA 3QHQA 4TN5A 3GT0A 4CQMA 6AT1A 3EEFA 3BZUA 5A9SB 4Q3OA 5LQKA 2ERXA 3JYLA 5M29A 5DXJA 3LHKA 3HS3A 4P83A 1I7DA 2PWYA 1GQSA 2FQQA 4OXNA 2HF7A 2C9CA 3C85A 5E4TA 1UUFA 3FUXA 3WNZA 3A31A 2CY0A 3IVAA 4IIEA 4TUYF 2CLFB 5HRCA 2O6HA 3COPA 5COBA 2H1OA 3IKVA 3VU1A 1K6XA 2WD9A 1CR0A 4G0NA 1U2PA 3MFQA 4UDXX 4L9SA 3RAJA 1G3RA 2K6GA 3OFND 5J4YA 2I6XA 3JQCA 4HLUC 2KI5A 4DSTA 3GMIA 4MYHA 1PV1A 2IYOA 1XU4A 3AJAA 3EPPA 3N39C 3F5DA 3PVZA 4L0QA 1M7HA 1SOMA 4PPGA 4YWJA 1C9NA 1JRLA 4F6LA 5JAMA 1QQ7A 3WTBA 1U63A 2I03A 2WI8A 1XZAA 1XZEA 2BJWA 3TKYA 5IEJA 1FSZA 2O8EA 4CM7A 3V42A 1SXJA 4QXMA 4BQQA 3T5GA 1HRKA 4AZ3A 1PK7A 1AHHA 2F8LA 4GC5A 3CH6A 3TW4A 3U5TA 4CUKA 4TYYA 3DBRB 4JVSB 4JLPA 1JDNA 4RZXA 5CFMA 3IUMA 3ADBA 4QBTA 3PIIA 2VP5A 3BFVA 2EG5A 1NY5A 3S99A 2Z5LA 3SVLA 1VMKA 2X40A 2G4VA 4L57A 3KQHA 2V6FA 1XE3A 2PEZA 3REQA 5DPMA 5G02A 4MWCA 1IIBA 5IJAA 3D7NA 1P29A 2D1TA 3QXJA 3R1IA 1PR0A 3NDRA 1IBLB 3U4MA 1C7JA 3H1EA 9LDTA 1SUSA 2W2XA 2JCYA 4ENUA 4CLEA 1W581 2VNAA 3G68A 2LXNA 1GOTA 4RL6A 4X84A 2PIAA 2PGJA 3KTAA 4RIEA 1ST3A 2PWAA 2MMGA 5BNFA 2X2FA 1F1BA 3K1AB 4HJRA 4DV2B 4MS4A 1Q1BA 5CXSA 4JJ7A 2HJSA 1Q57A 4Z7OB 3NEYA 4J43A 3O74A 3PC4A 4JROA 3H7IA 2BR3A 3OZTA 3RU3A 4GMHA 2P1ZA 1U6JA 3RTBA 3NPAA 3M8KA 4JB8A 4RPKA 4A8TA 3U5ZB 4TMVA 5U4QA 4WECA 3WGIA 1MX3A 1MXFA 1OMOA 1PJ2A 2ZIUB 4YWHA 2OA0A 4C7JA 4U9UA 3ICEA 5EWLA 1FCJA 3IVRA 2KBFA 4ENTA 4EG1A 1OXMA 2FNAA 4RX1A 4DMKA 2QTCA 1XXHA 2HK6A 4LYFA 4YRIA 2F3QA 1SY7A 1U8TA 3RABA 4GPAA 1DWPA 3D6MA 4UM5A 1EIWA 1UM9A 2XT0A 2SNIE 4EYOA 1GG2A 3Q3IA 1UAGA 1UPXA 1T4CA 3LCJA 5FOSA 4EHKA 1N6IA 3UJNA 3N6VA 1T9DA 5LBTA 1XTZA 2RC5A 3B38A 3S5JA 2ATIA 2P27A 1MPXA 4HB4A 1YJ5A 3UWSA 4AY4A 1DAPA 3MWYW 3R4VA 4JOCA 1GSOA 1KNXA 2PFGA 2AK2A 1C1YA 2XNDD 4MCAA 2C3MA 5HCIA 3GAMA 4M2LA 2Y93A 2EQBA 4P7BA 5HM8A 2J4DA 5DHAA 3WG9A 2B1RA 1YIAA 1BX1A 5C0OE 3NJ8A 4EB0A 5ENDA 4C1NA 4CMEA 3A04A 2GJSA 2CB9A 5CFPA 3OU7A 4AUMA 5TQJA 5LQRA 3K5PA 4I36A 4CTMA 5DHUA 1Q44A 3KLMX 4HCJA 4RF4A 4MGKR 5F5NA 2WEKA 3V7NA 3C3JA 4LDAA 3AIIA 4QUHA 1U9CA 1YK0A 4R69A 4WNAB 4PAGA 3ZLBA 2J0SA 3EG9A 2FX3A 4PQEA 4MYRA 4F38A 3O4FA 4GOJA 3UF0A 5CFNA 2XVZA 2YIDA 3OE1A 1JF8A 2W42A 2P1DA 5DYYA 3CZCA 5IW8A 1J90A 5GM1A 1Q7RA 3P5SA 5M7EA 1C0EA 2R00C 3DFKA 4W8GA 4U2GA 4ZK6A 4G23A 4WE3A 5JSKA 3NFYA 4A6EA 1RXEA 1T9KA 4Q7EA 2APJA 2RGUA 3BQ9A 2YIJA 2VZ8A 4ZMRA 1TOAA 2HGZA 1K97A 1ACMA 1JGTA 4MUKA 3LU1A 1PX0A 5H81A 5J23A 5F3WB 3NHYA 1IMOA 3ORYA 3RO7A 4KKXB 3R3JA 4BRZA 3PQ6A 4PN7A 1QR6A 4KUHA 2ZXFA 2QVYX 3CH4B 2CMFA 4P8RA 4UNSA 3MQ4A 5KJFA 3T0FA 3GPBA 1KEKA 3LKVA 2BP7A 3ABZA 3SXPA 5AW0A 1W0KA 2SHKA 2WSSD 3OC0A 3PL1A 4HTFA 2ZBEA 2JFGA 3SE0A 4E08A 1IOLA 1BEEA 1JKFA 1W5BA 3R0IA 4ICIA 2XLCA 4LEIA 4OJQA 2IEGA 3ZWQA 1F4VA 2JBAB 3I72A 5CLJA 2JGRA 4JI8B 1ECBA 4BO4A 1QLHA 4I9FA 1KC3A 3I76A 1Q15A 2SKCA 3RC7A 3WB2A 4KFTA 4B3JA 4YMVA 3LQFA 3BRWD 5BQ3A 2IPAB 4TT3D 4RXMA 5A04A 4WACA 1RPAA 1ONSA 4BFWA 5ALPA 1Y9EA 4ZAWA 4K9MA 5KJ1A 4Y2XA 4LOIA 2GESA 4G5QA 4PX3A 5EUBA 3AB7A 5C80A 1DUIA 4COKA 4DQ0A 2UYYA 3H1GA 5KNCD 2XGSA 2NN3C 3HKBB 3N58A 1YQEA 5AJYA 5TS3A 3T5TA 1XZKA 1XTJA 3HYRA 2ZZMA 1O95C 3EVGA 5FBLB 5SICE 2ECKA 2X9VA 3D43A 1YC5A 1T10A 1V3TA 2RBKA 3HZZA 3OQ1A 4BV8A 4PSAA 1YULA 2HJVA 2J46A 1QZUA 1N2OA 2OZLA 5DYIA 1PCXA 1DWUA 2ZTHA 2PUWA 4RXUA 2YW9A 3OCYA 2NU8B 2CXUA 3SWWA 4YMTA 2YV5A 3EAGA 5K05A 3C14C 4G9BA 1H5NA 1U8UA 4FOLA 2HXSA 4MRSA 1AGYA 1XHLA 2VEDA 4G4GA 1QO0D 2YMQA 4FQ7A 4IRXA 4ZAFA 2IW1A 4YP9A 1QTIA 1RMQA 4RGYA 5KSOA 4ZVUA 4D92A 2XCRB 1UT5A 3GEGA 1AKNA 4FCWA 2EQ5A 1R6VA 6CHYA 3R0VA 1DC6A 2Z3WA 3FB1A 5GM2A 2PKXA 2OHFA 3A3OA 5FLKA 2MTBA 2J59A 4II2A 3LWBA 4OREX 1YVUA 4RF3A 2AUTA 3FXAA 4L50A 3OLVA 3RK1A 1E2FA 1OI2A 2XADA 4E13A 4KIJA 1A7UA 1T0IA 2XVMA 4JP3A 3EWSA 4E4RA 1Q5PA 4MR8A 4DWVA 2D2FA 4HDAA 4JFAA 3LXRA 1B23P 2PX4A 3B1VA 3FCEA 3RU7A 1ZNQO 2WK1A 3GT4A 3Q2KA 2MSCB 3F8SA 3QG1A 1MH9A 4DSUA 3PRYA 2QV7A 1EVJA 4RLFA 1QRTA 3WHLA 4KSBA 4PAMA 4B3CA 4JJ6A 4MEAA 1KRHA 4ZQGA 4AX8A 1ISJA 3PNMA 2B2NA 1JHQA 2I7CA 2ONJA 1QUFA 4XJVA 4NQRA 2X0JA 1LU9A 4UBOA 5A1TA 2PUCA 2ATEA 3FPFA 3ASYA 4HSGA 1JILA 2ZKLA 2FR0A 4PC1A 2HY7A 4BZXA 2BKAA 2I34A 1DJMA 1OD6A 1UBJS 2TYSB 4K8RB 1I33A 3D02A 3DVLA 4F92B 3GAFA 1YB6A 3BRCA 4MIYA 4DIUA 1KOFA 2Q8QA 2XHEA 4RD6A 4N76A 2PZEA 3OWOA 3OT5A 4MHOA 4G84A 1VKZA 3WGJA 1UBRS 4D45A 5KWIA 3BGSA 3RH0A 4OJYA 4K9PA 2XCIA 1W59A 4WXYB 2A86A 5I4CA 3O8RA 1GCAA 3LT0A 5B3JC 1JQ3A 4EARA 4LQLA 3U44A 4BNHA 1QSGA 1Y7HA 5HG0A 4EVQA 5CM9C 1TEHA 4P93A 4DY4A 3NOXA 2PXHA 1I3MA 2BI4A 4RM2A 5B58C 1EUCB 4GKKB 3BD7A 4C6RA 5FI1B 2GD2A 3A2KA 1A9OA 2ZTVA 2J4FA 3GH1A 2V7EA 2IV7A 3UJ3X 2VQFB 2GRUA 4IXDA 1QONA 2FKAA 3BQMB 4FLMA 2BI8A 1CUEA 2RGXA 5JCOA 1I3OA 4J0EA 4B17A 4EMBA 3AY6A 5CT6A 5JNVA 3KO8A 4L6AA 2RIPA 4YEDA 3AM1A 3B9PA 3NIDB 3BTOA 2ZREA 3G9QA 5ECYA 2IHVA 1IBMB 1RTKA 4FFRA 2CV2A 1O95A 3PQ3A 4DV4B 2R79A 5KOYA 1Z5UA 4W1QA 4KPUB 4UFOA 1JSRA 4OQPA 3AEUA 1EFAA 3MUOA 1P61B 4DJJA 3N8NA 3UNXA 4KFSA 3WRXC 3IJ5A 3MA0A 2VVTA 1F6DA 1IG3A 1R9NA 1X0XA 3BE6A 3EA4A 4GBED 4UEOA 2NUPA 4UDOA 4YBRA 2HTEA 3U4CA 1O89A 1PSDA 1XKXA 2FPXA 3C4QA 4GM0A 4TZTA 3WNVA 3H2SA 1Y3DE 4XQ0A 4F3CA 2AJLI 3S3TA 4YDRA 4DT1A 3IP7A 2B21A 4NBSA 1SD2A 1R3DA 2OEPA 3VZPA 1OLUB 3IAS6 3NOQA 3SOZA 1DBRA 4ME6A 5JWHA 5TY0A 2YFHA 4A9AA 3PE3A 3UXYA 3PYLA 4UNQA 1KR2A 2I1WA 2XGGA 3FAZA 4Q1CA 4GS5A 2RG1A 2PT9A 2EFYA 2VDVE 3HCPA 4UTNA 1KY4A 1PEYA 3A1NA 3GA5A 3RROA 3UK6A 3Q72A 3PPYA 1MD9A 4MQUA 4K6GA 3L4BC 1SC6A 2FPUA 2ZSEA 4FR2A 3FUVA 4LJAA 2WHEA 4JQSA 2AH5A 2G08A 2WHYA 3VYWA 5CEFA 1JB9A 1RPTA 1NRJB 1FUEA 1OGYA 2N1MA 5EC8A 4BE7B 1HL3A 2AKAB 2I6FA 1XPJA 4IRMA 3OD5A 4BCBA 2A9VA 1RI5A 1AU9A 2A78A 4JMPA 4MO9A 1GQFA 4YT2A 1VFNA 2R60A 5EJ9A 1J2JA 3OFSA 1ZD3A 4RTMA 3R9IA 2JF0A 5CAEA 3RAEC 5DEIA 4LV8B 4JLWA 2F8MA 1SUDA 1XAGA 5JZVA 3UG7A 2YIMA 3N59A 3FHJA 1QS0B 4DQXA 1JAIA 3CZAA 1UMBB 4JLUA 4LK3A 4NNOA 4RDHA 2OOKA 1W8DA 2QL5A 2W6PA 5BYBA 3R7LA 4CIYA 4BLQA 3QM1A 1C8LA 4HAUA 4HQ0A 5LMNB 1ODFA 1S6YA 1WUIS 1ZBQA 4RJTA 3NW9A 1PRYA 3OFJA 3ZIAD 1O9HA 2ANBA 1OBHA 3JY6A 5T67A 2XCTB 4QBHA 1IDOA 1OXKB 4BRWA 1Z82A 4X94A 2AYZA 5K2MA 2UU9B 3OTIA 3I6MA 2IP4A 4PSKA 3QE3A 5GOTA 1HE8B 2I8AA 5D5HA 3ZQUA 2C7QA 4QUAA 3L5KA 3PCRB 4XSVA 1OXXK 2MSNA 2OHJA 3GEBA 3MXTA 4MI1A 2Y1WA 4JN6B 5HBRA 3T4XA 4UU1A 4JZKA 2EJWA 3U49A 5ILQA 3FZNA 4REMA 1LWNA 1JIUA 1SUWA 2JIOA 5EJ4A 1TMOA 2P91A 4X90A 4CMKA 1DC3A 1DZIA 2CK3D 1SZPA 1E61A 1TCUA 2NVBA 3IUNA 2D8AA 3NAZA 4KN8A 3UA3A 3X1ZA 2J48A 4CN9A 4H1WA 1W34A 1ADJA 3L04A 1M73E 2P75A 1EFUA 3F1KA 4MS1B 3SYMA 1PUXA 3TR5A 2CWWA 5JAPA 3HN2A 2CJPA 1DTWA 2WOJA 4A0GA 2VKTA 2XHZA 4REQA 4NBVA 4NMWA 1R8YA 3K0FA 4ZEWA 4S1TA 5A62A 1GTG1 3E81A 1WXWA 1M0WA 2AEEA 1PNVA 2R8YA 2R8ZA 1H1DA 3DDCA 1XD2B 3GLHB 4WPGA 4US2R 1GRRA 1HKUA 3HDGA 4LKOA 5EMLA 5FORA 1C4OA 1CUVA 4NONA 4TWJA 5C5CA 3N8IA 2HLPA 5EGNA 4OAPA 4R1PA 2GN8A 1XCOA 1DG3A 1FXSA 2AOUB 2FPPA 3CN9A 3DONA 4J7UA 2AEJA 3HH8A 1HWYA 4FDLA 1ORIA 5AR1A 1XI2A 3PQ5A 1BDHA 3HVHA 1OR8A 1P0PA 1S7CA 2FOIA 5EE9A 1IN4A 1NI4A 2XA1A 1K7EB 2J07A 2GZDA 3N75A 1I2AA 3MWGA 5FQOA 2ZANA 4CLHA 4FKBA 1GGFA 4POAA 3WKCA 2GM4A 3FUWA 1UBNA 1XYYA 4MVJE 1MC4A 1ZUIA 4Q1VA 4PLHA 4YRFA 5ES3A 3WR5A 1UOOA 4R9UC 2GPTA 1ES9A 2H7CA 1P9RA 2N3ZA 2YINC 3EISA 2AI1A 3PUYA 4PG4A 4ZQCB 3R7FA 4D81A 2D2VA 3ZU4A 3G17A 1FB5A 2AXQA 2HK9A 5AKEA 5C8DA 5LWQA 5ED4A 3L3BA 1ZXLA 5LXTF 2PSHA 3H9QA 3QPVA 4D3YA 5JAUA 3C5CA 2EP8A 2XUPA 4LJRA 1C9MA 4L73A 5H82A 1F3OA 1A8UA 3GFFA 5I9TA 3UCFA 4CG3A 5CDUA 1HG1A 4NG5A 4DQVA 1QKIA 5K2OA 2XDAA 2ZRFA 4MR8B 4XUGB 3NYIA 2ZYRA 3I1YA 4HJXA 1S2GA 5GJCA 2GUWA 2YHIB 3BILA 1VCMA 2D1FA 1P4JA 2XCUA 4PPYA 2AEFA 3CT4A 1H5QA 2JDIA 3IFSA 1O94A 2L17A 5DP1A 5HP4A 2R8EA 4FFVA 3U3DA 1SCKA 2HMUA 4YMIA 2CMKA 3HBAA 4JAVC 2C94A 3OOWA 1PTJA 2YJ5A 4RY2A 4YRCA 3TK1A 3VNSA 4XVCA 1K3UB 1EP9A 2FWPA 3RVNA 1REQA 1YE3A 3GEDA 1TKAA 4UTXA 3LRPA 5CIWA 4BNJA 2C3PA 2EP7A 3IXMA 4DCMA 4LYGA 2XXAA 2PKYX 3TQRA 3K9BA 3Q7IA 1JHUA 2ZJ1A 2PX8A 1OA1A 3EVDA 3G8BA 1HOTA 4N3AA 4BASA 1VLJA 3KM0A 5ESRA 1CUFA 1RHUA 3LV8A 2QYOA 1RM3A 2AF3C 4BCDA 5A3SA 2A2ZA 1MDBA 1QCCA 1XVAA 3RC2A 1F6WA 4FUTA 1UMDB 1DJOA 2PLRA 3LBAA 4LRSB 5FFNA 3A2LA 1U3VA 5KOJB 3OZGA 4BS9A 1JEDA 2EZTA 4LCBA 1V3VA 1K98A 5TGDA 2O0MA 5ALKA 3IE0A 3KWFA 1F48A 4E2ZA 3KQNA 3ROQA 3MW8A 2ZUVA 2G09A 2PGAA 3R24A 4HYTA 4G1FA 4WZAB 4BVLA 2CCJA 1J7KA 3THXA 1FFYA 3LUKA 1A96A 2GR9A 2DHCA 4NEGA 3NHSA 4R5MA 4DMMA 3F3KA 4IPTA 3RRYA 1WY5A 2ZSHA 2QM8A 3LXXA 5DSTA 3ELUA 4WBNF 2WSMA 1ESNA 3FDJA 2V74B 2EP5A 3P9XA 2JBWA 4LVOA 1Z5VA 4B76A 2NU6A 1Z0AA 1ISRA 1EGAA 1LJUA 1RP1A 1XYGA 3IOBA 5AJTA 5CFZA 2WIGA 5IVHA 2H7YA 3CURA 1QH1A 3HV0A 4EI8A 3FHOA 1L7OA 4OQXA 5C7YA 1Y6FA 1DBIA 1UL1X 3A1DA 4WY2A 3PNPA 4HDSB 3W5AA 4EIWA 4N41A 1E59A 3C6XA 3JVEA 4YRKA 1J8MF 5D5QA 1HQYE 4HUQB 2FWAA 3ZWYA 1IHPA 1PNOA 1EXWA 2HLDD 5DNYB 3JQ8B 4EJSB 2R6AA 3QOXA 3LFTA 2VSNA 4Q9HA 3L0DA 4DLLA 2XXAB 2YASA 2D2IA 1ZDMA 4MKHA 4JDUA 2D7JA 4CV0A 1SN7A 3MM4A 1Z2PX 5KX5F 1IRXA 4N7MA 2JBAA 1WCIB 3OZAA 4S1OA 1BQ3A 2OAQ1 2YZGA 2YZMA 1EDBA 1M76A 3PJGA 3ZE8A 2CKMA 1KI6B 1QHFA 2QM7A 3GFTA 2OT3B 3QFFA 3T12A 3U9SA 3VZQA 4DV3B 4F6RA 2D1RA 4OHOA 2ID4A 2ZJ3A 1OYYA 2X3YA 4R2JA 5J40A 2KYRA 2FE4A 2YNMA 2NT3A 4RK5A 5K3BA 1EZZA 3RWMB 3OTGA 1WMAA 4LX8A 4MRAA 4HAXA 3N2GB 5L7WA 3F5QA 3L9WA 3NALA 1BXRB 4NBTA 5MDHA 1KOJA 4LMAA 2YFYA 2DGDA 2CL5A 3WP0A 2XR1A 4JP8A 2Q28A 3AR2A 4MHSA 4DM4A 3N8KA 5FL7D 1VYUA 5I4KA 2ADFA 3IXQA 4ZV4A 2NUTA 3T9FA 1T8WA 2GZ3A 4WCFB 2WVAA 2NTYC 1UXIA 2QRJA 3PTLA 4IEEA 2PXXA 2GLXA 2JFOA 3K92A 2VHUA 3NTOA 1G6HA 3KZCA 4PVCA 4RENA 3HE3A 4EHNA 4KQHA 4Y67A 1E20A 2GM3A 1QCZA 2VS1A 5B2ZA 3O3NB 1HFJA 1CY4A 2OBBA 3BGWA 4DLWA 5DZSA 1W85A 1DKLA 4CLOB 3VA7A 1P6UA 1AKEA 3QFCA 1G8JA 1XMPA 2YYAA 4KXFB 3WP1B 4HRXA 2I8CA 2E82A 3IT3A 3AY3A 1WVIA 3U3KA 3CFYA 2QYHA 4N8EA 2DQZA 1UBOS 2IYVA 2HADA 1T9GS 4PG6A 4NL4H 4UUNA 1JA0A 5EHGA 2J30A 4MWEA 4E31A 1EM6A 3MNFA 4QBIA 3QE9Y 3G2NA 1UJ2A 2QUAA 1XIVA 2Y2VA 3M3PA 3NRBA 2XKJE 3AIMA 1QKJA 3DMFA 4JT2A 1TQ4A 2BAGA 1HEYA 3MCUA 4PG7A 1K9SA 3UKOA 1EWVA 2BZSA 2V5UA 3DR3A 4EW6A 2I8LA 2C84A 1OLXA 1T2VA 1PHPA 3K53A 4WNCA 1R6XA 5EAIA 3C3KA 4NCNA 2O2JA 4C3OB 1ILWA 2I6GA 16PKA 4DR1B 3AWDA 4QG3A 4E5YA 1A8SA 1RM0A 3AUJB 4XYMA 3QKWA 4I4TB 2NSDA 2KS6A 3OHPA 4KDFA 1IQUA 1IEWA 1P0QA 2JFVA 1GSHA 4R16A 4XTCS 3WADA 4EG5A 1TPZA 1NPDA 3A28A 3HDYA 4X8MA 3OHSX 1O54A 3DFUA 1JWBB 4OG2A 3I04A 3K35A 2VHTA 4WNIA 5IN4A 3LPNA 4HNAA 4AT1A 3FNHA 2B7BA 1JFLA 5KCMA 2X8AA 3PR3A 3SICE 1KJQA 3ZE9A 5E3JA 1O8BA 3VU8A 3ZWOA 2NAPA 2OCLA 3HJAA 4MWTA 1NUTA 4PLFA 4TKUA 5DHTA 1JLMA 4R6WA 3EVAA 1HGXA 2J6CA 4X8HA 3TAUA 4GX5A 1VBNA 1BXZA 4J9UE 3WJ2A 3OEHA 3TCNA 1W6UA 1DBVO 2HREA 1VG0B 2YRWA 1E5QA 5I9BA 4ZI5A 3AKZA 3EJWA 1QE0A 2OO5C 1H6DA 3H8SA 1AY0A 1Z17A 2CT8A 1FEZA 1ZIOA 1HNZB 2A4KA 3BB3A 4C0AC 3FAKA 1Z88A 3I6ZA 4RQTA 3ES9A 4CUZA 3UAYA 4PLPA 4RVFA 3EDQA 3NHKA 4IIJB 1EBUA 4RD1A 3ZCQA 2XB4A 5DO9A 3S40A 3EGCA 2JJQA 2C2KA 2F1JA 3O2NA 3OETA 1OZGA 3C7CB 4HLNA 1UM8A 1ZSYA 5TQ2A 4EY4A 3SQWA 5AESA 1W0JD 4ITUA 4R05A 2ODEA 4R1OA 1N9GA 2QTLA 3PLAE 3M9LA 3NT4A 4YJGA 3WLMA 1ZKDA 2A0XA 4AIRA 1N2EA 4MLPA 4R8LA 4V1CB 3V7WA 2ZRAA 3W8EA 4LN1A 3WRYC 1IZ0A 3ZOKA 3GW8A 4LZNA 4YJ2F 2C7BA 3JWEA 5HKLA 5J5CA 5ERGB 3GEEA 4BQOA 2CLLB 1E69A 1XVIA 5AH0A 2J7KA 1E3EA 4ZCTA 1RPZA 4JC0A 5DEOA 2HCFA 1B2RA 1NJFA 3FCSB 4G9EA 4OI1A 1TA4A 3NHLA 3VDMA 5FBQB 4F91B 3DTYA 1NUHA 3ZQKA 3GN2A 2WT8A 4IH4A 3SVZA 1DBSA 1GNVA 4XEUA 3O93A 1PLKA 1Q7EA 2JJ2D 2QQEA 4PU0A 2ZUSA 1Z0FA 3WL8A 3TTSA 3HLKA 5J2UB 4DGQA 5WRFA 3A1WA 4NOLA 3ESQA 4NK4A 1E5LA 1ORRA 2NUPB 3PC7A 3QWHA 4FOSA 1J2EA 3VR4D 1UBCA 2OYSA 3BJMA 4AS2A 5H8WA 1BKDR 2BMWA 4QVIA 2AFVA 2PLNA 2WU8A 4WNYA 3SCZA 3ZU5A 4GNRA 3CZ9A 1VLHA 1EBBA 3PUVA 2M98A 4NOKA 4TXMA 3N0WA 2X0KA 3WFZA 1NT2A 1XR3A 1DIOB 1MENA 4RQAA 1QVZA 4TYPA 2MCFA 3NHUA 1J6UA 3GVCA 3OKAA 5IF3A 4LDNA 5TMBA 3H8WA 4EVSA 4UBNA 1P1IA 3EXHB 3F8WA 4I5GA 4WGFA 2GB4A 3KYDA 4K9DA 1RJWA 2A84A 2VN8A 4AQ7A 2O2EA 4RK4A 3RG2A 2FPGB 4GZ6A 1LBQA 1QF9A 2I76A 3C6BA 3LDHA 5AKXA 4PSUA 3CB4A 5AW9A 3SJUA 3RU9A 3EZ9A 1ZR2A 5IEBA 4FJ2A 5IK2A 3U4AA 2FWJA 2GXQA 2HMVA 3DUFA 1SU6A 2WYIA 4MV0A 3H2KA 2G17A 1WMSA 3ZN2A 3DWEX 4OBEA 4TKVB 1EGHA 3ZJVA 3H5IA 3FMPB 1TT5A 2XB8A 5E3HA 3DEFA 3URKA 3HWX1 2BE7A 2I55A 2X8JA 4KIWA 2CFSA 2A1TR 3MIIA 4LHVA 1VMIA 1EJ0A 1V5WA 5K0BA 1BS2A 1LPAB 3WSVA 4HO1X 1PFWA 1RHKA 7ADHA 4NVRA 1F4PA 1Z35A 1U3UA 4GBJA 4G0ZA 1N2IA 3MD0A 3OMLA 2DSTA 1F06A 2C4HA 2VPWA 2XAAA 3FLBA 1NGSA 3Q9SA 3IILA 4EP1A 2P3SA 1PN3A 3E4DA 2C1XA 2WM9B 1JECA 2QRMA 3W0LB 1KYQA 1V9LA 4NU8X 3DFMA 1G8FA 1WLYA 3HMKA 1EUDA 1C7ZA 3FFBA 4GICA 3GCDA 4MVJG 1U7HA 1GZ7A 1AA9A 1V8OA 2HA4A 2AD5A 3BM5A 4XJTA 1DBWA 2IUFA 2WWFA 1KOGA 3CSDA 4RMIA 4B71A 3BWCA 1ZCFA 1XF9A 4P3YA 2IS1A 1UC5B 1AB6A 3FCYA 5CK5A 1F9EA 1OWLA 2PKQP 1AK9A 4UZFA 3L0PA 2O5VA 3HNRA 2EX1A 4OGFA 4YPFA 1KMQA 3E5RA 1X7DA 3L1IA 3DB1A 4EAAA 4CLRA 1SBCA 2CE7A 4LWOA 4ISBA 2Q5IA 3CM0A 2X6RA 4PAOA 3KR1A 2JLVA 1CUIA 5BW5A 4UVIA 3D7SA 1HOXA 4ZVVA 4C0WA 5FUYA 2IXGA 3OI7A 3IOCA 3JYOA 5IYZB 5L95A 4AO7A 3EGDA 2DHDA 2OD9A 3MWDB 1KKLA 1OWMA 4O1IA 2SCUA 1N0HA 4O4JA 2C2ZA 4BBJA 5IG2A 5LMZA 2XCSB 2EFEB 1J1UA 4RS3A 3TQHA 3OPVA 3SS7X 2W6ID 3OPQA 4PLZA 2YKGA 4CQJA 1UFOA 1OAKA 3R3UA 1MO2A 1XK7A 4QC2A 4ZO8A 2UXBB 2FRXA 1AO3A 3H5WA 4WA7A 1YQWA 5EPOA 3TOSA 5GP1A 4YDQA 5I6DA 2OAP1 2AOXA 3CLTD 3T1HB 4Y9SA 1Z28A 4QHSA 2HU7A 1C2YA 2Z5FA 3RV4A 4KWCA 2QLTA 4QXRA 1NXPA 2J6IA 3M2TA 4YAGA 3QX3A 1ZXXA 4K9NA 3SVTA 1JFSA 2FDCA 4PLYA 4LOKA 2WU4A 3CPHA 4N4AA 4E2XA 3RDPA 3DOFA 2Q4OA 3HYLA 4LBVA 1N8KA 4RTSA 1LCIA 2HUPA 1DVRA 4E7PA 5JD5A 2ZUDA 2ZYGA 5LA6B 3TBFA 1KEEB 5LZ9A 4YP0A 1NA5A 3I3OA 3L0SA 2C58A 4IKPA 4CKBA 3B8HA 5KU1A 2N9UA 4XD7A 3NM5A 1DX4A 2F1OA 1RRGA 3Q7RA 4MROA 5CNIA 4V0MA 5TGZA 1YB2A 5AVSA 1MNQA 4AS3A 3JAWB 1RLIA 2R85A 3C3BA 4FNAA 3UHOA 1M1NA 5KWSA 1A8IA 1KK1A 1XWFA 4FNOA 1IUPA 3PQ8A 3SEQA 4YT8A 1KJIA 2FMHA 3Q3HA 3QG5A 2FW9A 2VP9A 3D1JA 1EUZA 3NC0C 2SCUB 3LOUA 4BV3A 5T4HA 1ZLYA 3DAOA 1QF6A 1FQWA 3N9IA 3TTWA 3DWIA 2B1IA 1EGMB 2Z08A 2GTIA 2ZS9A 1DEKA 4CXMA 3GJ8A 4C03A 3IO5A 2QXUA 2BFAA 3PQEA 3QTBA 5FWDA 4RTQA 3TMAA 4RHYA 4MDFA 3PWZA 1AF4A 2O3JA 3C3WA 3K9NA 3V5NA 5KAMA 2XOEA 3ZY4A 4C06A 1X1TA 3CNHA 1B8NA 1I2MA 3T4UA 3VTKA 2JGFA 4DCSA 3ZDEA 2ZZNA 1I7SB 3LD9A 4EPYA 3BHNA 5FI0B 3OZDA 1S1CA 3CUSA 1N9KA 1LTHR 3D7MA 5DK6A 2EZ9A 4C88A 1O4VA 2QRNA 3AHGA 2YJGA 4Q3BA 3WK5A 3INGA 3QVOA 1G7CA 3A9SA 1CZRA 1U2QA 1XXHB 4YRLA 3T52A 2HIHA 2OFPA 3RVQA 4JJFA 2NNLD 3D3KA 3UT0A 5ITZA 2QE6A 2VP4A 3AL3A 1FMJA 3KB2A 4QELA 1RWMA 1TLLA 4X1KA 5CW2A 5G41A 3IESA 3E8SA 1DZ3A 1CR2A 4JKIA 3GP5A 2P0EA 1QUEA 1ZY2A 3RTAA 4KYUA 4BUJA 4MQMA 2F9MA 3KJNA 1JG7A 4CTJA 2I3ZA 4YY3B 4JUDX 1UXHA 3RJ5A 1XDGA 4Y7CA 2PTHA 2R9VA 2VQDA 1HFEL 4ZHQA 4C2UA 4IGEA 4X0EA 1JHAA 4A82A 3AT1A 3R7BA 2FSIA 3AFOA 1QC5A 2C03A 1Q0PA 2G9RA 3OEWA 3AQIA 3WIVA 3IPAA 4MZDA 4DARA 1VSTA 1UC9A 1SA0A 5J4HA 1D2MA 3N7AA 4I4NA 2XB6A 3VU0A 4V38A 2AW5A 1WSWA 1SUEA 1PJ3A 3B48A 3IKLA 2R3SA 4TPKA 5A0FA 1KS9A 3IE2A 3NHRA 5J1TB 4G36A 2AN9A 1Q2UA 2JNWA 1LZLA 1E9SA 3DTVA 4GF5A 4PHHA 4A16A 4NS4A 4KC0A 2NZVG 3BULA 3QI7A 1CUJA 1TD1A 2FP4B 1ECPA 4LBYA 4AN4A 2DBRA 4D4MA 3N6RA 3HJFA 1XA3A 2HNKA 3SJBA 3UMVA 2VCYA 1KK3A 3NIFB 2WYUA 1XQYA 3VM6A 4H1UA 3STUA 2BEUA 1V5FA 2GEFA 1NOKA 3QEKA 5SY9A 1GCIA 1JDUA 5BWBA 3QBJA 1NJGA 4AG6A 3PNOA 1SQFA 3RS8A 4R83A 5A02A 2BGRA 4H3KB 4NJMB 1M0SA 4L8GA 1Z0SA 2OCXA 1J23A 1OFTA 2ZTLA 3C48A 1JBQA 3OJWA 4L9AA 4L78A 3RKRA 4OXYA 2Q5FA 5FA6A 3TW8B 4ESEA 3U3OA 1YKSA 4QO8A 2LDBA 5DHSA 4DPLA 2YVKA 3RVKA 4I08A 1DTWB 1L6IA 5IHPA 1XRQA 4RD3A 4R9VA 4R0NA 4XDGA 3HKCA 4EB6A 3LHSA 3D7RA 3S68A 2PJRA 2C4VA 4BO8A 1Q21A 4HEA1 3PRKE 3UWKA 3MS7A 1R9JA 2WUGA 4PHCA 3W9BA 3TJZA 2M6SA 3IDFA 1FMCA 1GL3A 3LUDA 5FUQA 4UQOA 2OXTA 4Z3OA 3F46A 2UXDB 1PU2A 2VNKA 3BIFA 2JD0A 4K9QA 4N39A 5JXWA 1QP7A 2ZRLA 3AZOA 3MZ0A 2IEZA 2WSSA 3MTDA 4YALA 4R7GA 3T61A 3EMBA 2B35A 4YO7A 1G5TA 2DPLA 4J0GA 4B2YA 3A14A 5EFZA 3J7AC 2ZRBA 4OQNA 3WNCA 3DE5X 3HWSA 1KDYA 1MV5A 2FMUA 2AQIA 4P92A 1ZOOA 2G5TA 4U3JA 5ECDA 2FLVA 4Q9KA 4DLSA 3CMCO 4MVJM 1NTRA 5C8YB 3Q7QA 1GXSA 3ZS8A 5LP6F 1ADGA 4B73A 2SKEA 4CM4A 2HMAA 2NQTA 1X38A 3KRTA 3GN1A 5EQTA 1ZJ4A 3X44A 4PX5A 3AP2A 3QFHA 3HCWA 1A4UA 3SBXA 3G1UA 1MCZA 3E9DA 4I14A 4LUCA 5DLPA 3U7JA 4FZ3A 2H8KA 4YXWA 3GVXA 4UNNA 2P5TB 1OKKD 3HCNA 4M0UA 4AJ9A 1RWWA 4MWDA 1GRVA 4I5FA 2BC9A 5AHWA 4XVUA 2G88A 2HSWA 2W43A 3Q0EA 3KDPA 2O8CA 4HY3A 1I3LA 1SCNE 2VHCA 4LOJA 1R88A 2WINI 3HB7A 1ETHA 4EGFA 4F86A 4KRFA 4KQIA 1U90A 4PFKA 5KQRA 2JCXA 3KVYA 5DP2A 1W19A 1FY2A 1MG5A 1QGAA 2VJQA 4GFDA 1LQUA 3RE1A 2AVNA 5IYZA 1PR4A 5AK4A 3WYCA 1NDQA 3VR2A 5AXBA 4B4DA 4X85A 4TTSA 2QZSA 4MA4A 2J3JA 5EJAA 1Q0LA 3O90A 3R7SA 2UYCA 2G06A 1JI0A 2G0TA 3UJPA 3KXPA 1Z33A 2GT1A 1PD1A 1QCDA 3O31A 5CHEA 1DL5A 5IDWA 1VE1A 1JAZA 3O8DA 1VGQA 2BUBA 3G2HA 4J0IA 3GHYA 3UB2A 5JAOA 4D6XA 4URYR 3SBOA 1SXHA 3B82A 3PT9A 1WY7A 2JFYA 3HKDA 3HWRA 4N82A 3FPLA 4UBMA 3FSEA 5DJ5A 4ZQHA 3V4FA 4DW8A 2CUNA 1IWOA 4E4YA 1LH0A 4NAHA 1RADA 1MAWA 1UJ5A 3HU3A 5E0KB 5K0NA 3R5HA 1TEVA 4K9KA 1K6MA 4EUEA 4EZIA 1A8PA 4UJ3A 3C4JA 3S2SA 3DEZA 2QSZA 2XTMA 5LZ5A 5BN4A 3RGGA 5DKFA 3WHKA 1QOQB 5K3SA 3KDSE 4WKOA 3OPNA 5BN5B 3VU9B 1O77A 3FFTA 1KU6A 1VA4A 4JLVA 5KVCA 2F6RA 2JIQA 1ZHOA 3DP9A 2YNMD 3INRA 3LFHA 4OMFG 2JAUA 1X7WA 5DGIA 1RZRD 1G59A 1BW9A 3AR7A 2N0SA 5EKDA 3SFVA 1N6OA 1GILA 2PQMA 1QYVA 3UENA 3GFVA 2IDJA 3HL4A 1BFKA 5T6MA 1TJPB 2G9VA 2REBA 2PMDA 4NYIQ 1L7DA 3OSUA 3NHWA 3USCS 4EJ2A 2ZR0A 4EYQA 3GR6A 4MEBA 1BNCA 3K7EA 1SKMA 2KBEA 4FS8A 2Z6VA 4B3RB 4GQIA 1L7QA 4G6ZA 4WY5A 4JXZA 1T3LA 2X15A 1G6OA 2VSFA 5EZQA 1ZU5A 4LBZA 3KQTA 1TNDA 2GK3A 2PQ6A 1GFWA 3SS9X 3V1LA 4BGIA 2YICA 2AWNA 4CMBA 4KE7A 3L9XA 2H2GA 2XQVA 3PJEA 4W1PA 4UTRA 4BFZA 1ZD1A 5CU7A 4H7JA 3VKHA 2G1JA 5H59A 3S6JA 4Y2TA 2H5JA 1JE0A 4H15A 3AM3A 4YI3A 2NUBA 1CC1S 3D6TB 1CZHA 4QXAA 1CJTC 4R31A 4U2FA 5AM4A 3WGTA 3S2GA 5J4LA 4V39A 4ALMA 2FP4A 2IKQA 1MX9A 1XB2A 2BFWA 1IXRC 2F3PA 2OCBA 3K0BA 1M8GA 2RHTA 5EIBC 2W4IA 3GXBA 4UW9A 4XD2A 3WWDA 4WAUA 4FZRA 2IYUA 3HUFA 3FSGA 4MIKA 5B1DA 5GZ3A 3HGQA 5I7WA 1BDMA 5A2QA 4A91A 3PF8A 2NMVA 5EWJA 1LV7A 4Z3DA 3VNBA 2PS9A 1YCGA 4HDQB 4N12A 4IJMA 4I1SA 1E7YA 1ZP6A 3NATA 2JFQA 4OYLA 4N3NA 3T5CA 4EO7A 4ER7A 4IIFA 2IYRA 3KYCA 2CFRA 3EPHA 2GX6A 3CF6R 3ILYA 3KV3O 1A9XA 1YVEI 1XTQA 3GLFE 3OAAD 5K6AC 4EG4A 3AVUA 1ODIA 1Y6RA 1KJYA 4WZAE 1W35A 1RAHA 1VCHA 4M88A 5E6UB 4YAEA 3TFWA 4R2IA 4M9CA 3BEDA 2OXFA 3KAKA 1GG8A 4PEVA 4GZLA 5EG5A 2XRZA 5D3MA 2E6UX 2FMTA 2P11A 1SH7A 1UBUS 4PBSA 3ACDA 1YUMA 2MSLA 2PR2A 3TSAA 6ABPA 4LVUA 2QJTA 2ZRHA 4MMYB 4ZQBA 4A03A 4IIJA 4QU9A 2JGMA 3GJ5A 4HGYA 4Z6KA 3VSAA 1P45A 4GOKA 4I5IA 1MO4A 2ALJA 4ZKEA 3A6HA 3VJKA 1RYNA 3W1WA 3IYLW 4Q9NA 4HVCA 3A9VA 3ZYCA 3IBCA 2XUGA 2ECPA 4E5KA 3EULA 3JQDA 2B99A 3GF4A 1Y1RA 4YRBA 2FA9A 2FETA 2QX4A 3D3QA 3SSNA 2GQ0A 1GGJA 1GL7A 1GZSA 1N34B 4V3CA 5FULA 2Z6QA 4M1EA 4DZZA 1XVVA 1HDRA 3W3AH 2X76A 3PSAA 4JKOA 3ZCSA 2V7QA 5C5DA 3KOZA 3OZRA 4XRGA 5FR1A 3KJEA 4WT7A 2Q99A 3NBUA 4RTOA 1KH3A 2A5FA 4RY9A 4QGHA 3UANA 4BCCA 2FF5A 3EEYA 1D04A 3EIXA 2C4UA 4OX9Y 1HYBA 4EKNB 5BSFA 1PX2A 1C5KA 4YP6A 2GJAA 1CY8A 1S2DA 1YRWA 3R5SA 3FPSA 4KQ1A 4EX7A 2GZRA 3H2YA 1H3NA 2O05A 1IJBA 1SHUX 4X92A 3GLIB 3S70A 1IOZA 2YW2A 1NW8A 4UUPA 3A4LA 4E33A 4C7MA 1F38A 2O14A 3COSA 1SCDA 2DT8A 4P7JA 1T3GA 3WWZA 4WFIA 4EL0A 2NTVA 5FOTA 3M4YA 4B3IA 3AO0B 2HV8A 2XTJA 1LA2A 5A71A 1DS6A 1N5JA 3ZBQA 3B6IA 4FI3C 2I6SA 3IQXA 3LT1A 4FW9A 1OOEA 3RUPA 4B82A 3FPCA 2C5LA 2IOYA 4I1VA 1NSYA 4ARVA 1P4SA 4JBIA 4R1NA 4MQ6A 3AETA 4DV1B 4CU2A 2H29A 3K9GA 3P9ZA 4GLOA 1ZIPA 5REQB 1JR3A 1AKWA 4XKJA 1J97A 1PSWA 3V8PA 4RJLA 1ZD2P 2JI4A 2V3VA 3K1TA 1T9GR 1QYDA 2H00A 4KIFA 4U2KA 1PFKA 3SHWA 4O4IA 1J70A 3QJYA 1YRHA 2ZI6A 3ENQA 3DLCA 4LYYA 4C4TA 2HSDA 3PE6A 4JLOA 1XLUA 5IJWA 4EDHA 5BN5A 4LDPA 5TS2A 4FUQA 4EPRA 4JWKA 4G8BA 4PFQA 1JAHA 4FGUA 1SCIA 1OBVA 1YQDA 4XPIA 4KLNA 3DVAB 1WCV1 1U81A 2V4ZA 4RLSA 1I5EA 4ND2A 1SCUB 4IKOA 421PA 1S02A 1CQJA 1LTQA 2YYZA 1TMGE 3DV0A 1J9GA 2VJCA 3ANXA 5THQA 5ITZB 3DYVA 3AEQA 1KZ6A 4ZJZA 2P77A 2IW3A 1Z36A 4DZTA 3IBYA 3RYFB 5JTTA 2RKBA 2XKBA 4KHPB 1E2IA 3NHPA 1UQTA 1JJFA 2AJDA 2QP4A 4P3XA 4PC2A 4XDZA 6YASA 5JALA 2WR8A 2H16A 3UJAA 4MGHA 4PZ0A 3EPRA 4RJIA 3VR4H 5C4IA 4BVHA 2QM0A 2FXIA 1RS0A 3EDRA 5ALXA 3VTZA 5D6NA 1P2BA 5F3DA 2D4HA 1CLUA 4D56A 3H0CA 4EUNA 3WRXA 4QUIA 2QM3A 5DLEA 2IYXA 2R00A 5ECGC 1LBTA 2GARA 3DMTC 3EVFA 1KY2A 2Q3DA 2CDAA 3GEHA 1XU7A 3PB3A 4WK0B 2I2FA 3HXQA 1R0BA 4AP9A 3KVRA 2YHSA 3P9KA 5J5VA 1YA8A 4K6CA 3BN3A 4LRXA 3USZA 5EQDA 2OILA 2IEYA 4ZVQA 4O4IB 2M32A 1QMPA 3R5TA 5EJ2A 3TWOA 1LK0A 2C4WA 1BFUA 4QO7A 3V2HA 3BXZA 4BMNA 4C21A 1C0LA 5BMVB 4NHEA 5HIKA 1P6QA 1G21A 1DAEA 1TXGA 4XARA 5JSHA 5P21A 1QYXA 2V8OA 1PT6A 2VUIB 3F96A 3RANA 5BP7A 1ZR4A 4KX5A 4RH1A 3EDOA 2VTDA 5BT9A 4KKVA 3PI6A 2PRKA 4MUMA 3BCUA 2PD6A 3WZ2A 4RLQA 4EHDA 1NW9B 3I09A 4OU5A 4I4TA 5IDYA 5K3AA 1IG0A 2L42A 5I9IA 3CVYA 3ZGZA 1N1GA 1NUAA 1OTYA 5KYXB 4BOYA 1YASA 2IZ0A 1Y4SA 2QPOA 4J75A 1W2HA 1MAVA 3ZG6A 4A92A 1WJGA 3EXAA 4JI0B 1F2VA 1YXMA 3H1TA 3HDHA 1Q7GA 3LVRE 2NGRA 2R6R1 2B4KA 3WYAA 4AKSA 1U8CB 1Z08A 4OHZA 1F0KA 2PL3A 4ID9A 4ZCIA 4KREA 1KOLA 4I8DA 1KQ3A 4A6XA 1LX6A 1WDWB 8AT1A 5EJGA 3SD7A 2PZAA 3AW8A 4P58A 2Q9CA 1ZIDA 4KLRA 3DOIA 2IC5A 4OKSA 5AWFC 3WO1A 5HOEA 2YXEA 5EYPA 1QYRA 2DAPA 3AV0B 4M7OA 4MS3B 5HKOA 2Q2NA 3WGVA 2AWOA 3AHIA 3ROMA 1Z63A 4B7AA 1HYHA 1GNLA 1J2YA 5BN3B 3W04A 1PQ4A 4PLGA 2ZIXA 3FBGA 4C5CA 1RRFA 4PW0A 3C70A 3KKNA 2Y1CA 4P81A 2W6QA 3EA0A 2Y6VA 4PSVA 5IF9A 5K51A 5IJ0B 3D8SA 2YJ3A 2ZBGA 5FPSA 5DGXA 2VDNB 1H0RA 3MCAA 3NIWA 1CTQA 4NE9A 4ZCMA 3ZDDA 4PR3A 3OZBA 1E3TA 3IHLA 4INOA 1Z4QA 1W5AA 1XWIA 3GPIA 2WNHA 4LOAA 1G7TA 1NMEA 1FNSA 1IHUA 3A4TA 1A9SA 1XMSA 3DC2A 3INYA 4UARA 5G4LA 2RIRA 4W8HA 4QZVA 2X7JA 1W6RA 3PUHA 4LJ5A 4XASA 3E18A 5IDVA 5B1YA 1U2GC 3OLQA 1FP4B 2CHUA 2ZRDA 3PUXA 2JAOA 4J1NA 3KR0A 1M6HA 3GFOA 4NPAA 4YJHA 5TQ2B 3VH3A 4N1AA 4IINA 4BGEA 3HVJA 4DVGA 4J0KA 1WD7A 1KQGA 3LDGA 2B1JA 3FZYA 1DHRA 4GUAA 4B7XA 4UU7A 4DKXA 3PNKA 1S1MA 3QVGA 1W88A 3EHEA 3FHLA 3P94A 4OHCA 3WQSB 3WMFA 4FMBB 3PHIA 1JMKC 1AX9A 2J09A 1Z68A 1A4XA 3HXOA 3HEBA 1LDNA 4QASA 5BQ5A 3IP9A 1F8FA 2CDBA 4NPCA 2DOKA 2PQ2A 3GC6A 1TU0A 1R66A 1WW8A 3LX8A 3ZZMA 4G0XA 4TV8F 3CRNA 1BD3A 4OGKA 4BYGA 5CYFA 3BSWA 2GJKA 5BQOA 1FK8A 3QVUA 3C7AA 1JEQB 1P1JA 3ZJTA 1WTCA 4KQJA 4M9ZA 1EFRD 2XXBA 2IX9A 4L28A 5I51A 3CE9A 4BVAA 3QF4A 1WBBA 3L8GA 4UU0A 4YRZA 3KT8A 1QG6A 1W1WA 4X41A 2PKQO 4NYJQ 4O2AF 1BS9A 2FZGA 4WUTA 1JQ5A 1PR6A 2V65A 5EJ8A 4QGSA 3QENA 3O2SB 2WTEA 4R5HA 4H9GA 4HN2A 3FWZA 4HN4B 1FUKA 1OILA 5F2KA 2GO1A 4HXFB 4PCVA 5B4UA 5NULA 2VOEA 3HJBA 4S04A 4MQFB 2YS7A 3M5CA 1NXTA 5EOVA 2VYND 1Q91A 4KBYA 3TPFA 2D0IA 4PHGA 4DJTA 2VSYA 1ZHFA 2C95A 4BLSA 5A5FA 3JQBC 2NU8A 4WOJA 2A14A 1OGIA 2HV9A 1P2SA 3I4LA 3BHIA 3NUQA 4JJKA 4TKUB 4P6VF 3L7NA 4UBLA 1SNYA 1KHTA 1WRBA 2QVZX 3DULA 3MMXA 3PX2A 1ZM7A 1WCXA 2JGLA 3FE2A 4FMCF 4N5NA 4CJXA 1UP7A 5HJ5A 2JHFA 3I1JA 4D4GA 3TUZC 5AQ1A 4YPOA 2AHOA 2XMCA 3DC7A 5FHRA 5BORA 1R12A 1OI4A 2YHAA 2R4QA 5T4FA 4WOPA 3KHTA 3UK0A 4GRAA 5DTEA 1ZMBA 2Z1DA 1ML3A 3CF4G 4KU4A 1G63A 1ZKMA 3HYNA 1T29A 1GGEA 2R1TB 5KMGB 2HWKA 5EIOA 5ICMA 2AR9A 4D98A 1ISIA 3UUFA 3GLGA 1HQDA 2HCJB 2OGSA 3H2GA 3LY7A 1XJQA 1YQGA 2QIPA 2R1UA 5KYNA 2HA0A 3FDZA 1BSVA 3FW1A 5L4LA 4YJ3B 3CNEA 4Y6OA 1M7GA 5AI4A 3ITEA 1E89A 3UMGA 3C98A 4UNIA 4IKEA 4EI9A 1OXBB 3CV3A 3EAFA 1U8AA 4N7JA 5A4JA 4L5AA 3AB8A 1EE1A 2I67A 1NLFA 1NJ2A 1PJAA 1EVYA 4M8KA 3TZBA 5HIAA 1MU0A 1V8BA 5AUQA 2XKAA 3OOHA 3ON5A 1USUA 3DEKA 4CIAA 1VPDA 1V48A 2V7TA 4NZ9A 1YI0A 5JLAA 2GA8A 2QS9A 2VBIA 3T3OA 1R0XA 4HYYA 4TYWA 4TLMB 1JWAB 1SAYA 1R6DA 2IZ6A 1E2MA 2R65A 3OZCA 4BGDA 3KOMA 1JQJC 1QIFA 3RSGA 5A4DA 1QDEA 4E3ZA 3L43A 5CVTA 2FMXA 2IELA 3GELA 1YBAA 4JVMA 4TTJA 1IFXA 1PUIA 5I4BA 2FPLA 3PQFA 2F4NA 4DMFA 3AJ8A 5K45A 4LCJA 4K88A 5EIXA 3U44B 2HPAA 3IUYA 4YRRA 3DFZA 4YACA 5AUNB 3QKUA 1O2DA 1GWNA 5HX7A 4UE2A 1XKTA 2H4FA 2GCPA 2D7DA 1GUZA 3QEBZ 3E9YA 3R23A 4AWXA 1CR6A 1F2DA 3E3OA 3WWEA 2EHJA 5JBNA 2AHRA 3PRHA 4BVEA 2D0PB 4E14A 4HDKB 5JS7A 1UIRA 3D2BA 4AJOA 4GEGA 2XUJA 3FBWA 3IPCA 4FLEA 2Q46A 3GRPA 5DN6A 3JQEA 1XKLA 2XZDA 1Y1LA 4I66A 5CLFA 2IYSA 4RV9A 2YWHA 4JYMA 3HJUA 2ORIA 3JYQA 4XVQA 5DF1A 1EDZA 2VJDA 4CKWB 4EO9A 2HEGA 1Z6YA 1XTRA 2GBFA 3K31A 2WE7A 4WJKB 3K8YA 2CC2A 2BONA 4DXHA 1DCTA 4AU1A 2F9LA 4EUFA 2H54A 3BFXA 3HBNA 3LHIA 4AFNA 1NT4A 3PQ7A 2Y1EA 1B3BA 4B6RA 5C3MA 5U4XA 1TZJA 2JEYA 2TECE 1LK5A 2W2KB 1JQKA 3K6JA 4NU5A 2JI6A 2P6MA 3DT6A 4KSCA 3S44A 4B35A 4YRNA 3AHCA 2YN4A 2EAUA 3ID6C 4PINA 2EW1A 2NXNA 3EQ6A 3SZLA 3F7NA 3GFBA 4DUGA 4XAQA 3I83A 5J2TB 1F2UB 2RCNA 3EC2A 3PTAA 1NJ5A 1UKBA 1CUBA 4R3WA 3JATA 5IULC 3DKIA 4MW6A 4WESA 2H4WA 5ALWA 2VDMB 2FN8A 2WQZA 3IHWA 3K9WA 5BYKA 4DR5B 4IDQA 4TZ0A 3KPVA 4LC9A 1FTNA 2OV6A 3VR5H 3KPUA 3TO5A 3ZNNA 2B1GA 4ARUA 4CR8A 1MBZA 5BSGA 2CLSA 3E3AA 3ND9A 2H0AA 2XD9A 2CXXA 2VHXA 3BSYA 4HAZA 5HS6A 2NP6A 2QD4A 2VYVD 2ZIFA 2G7MC 1TO1E 2YYYA 1Z22A 3LCVB 4PLVA 4X1OA 3WLQA 4BNZA 1W5FA 3LW8A 4DREA 4YMSA 3RIHA 3KXKA 5KNBD 3ZD8A 1Y5IA 4KGDA 1CJVC 2R11A 4H4CA 4ZAVA 3C74A 1AXEA 1J06A 3LBHA 3O73A 2IUYA 1PR9A 1LSJA 3PFBA 1SXJC 1WXIA 2Z58A 4TSFA 2G83A 4JBWA 1KDVA 2VQ3A 4C3ZA 1M34E 3EFHA 4KODA 5KREA 1YO6A 3EVCA 1S2IA 4RSMA 1V3QE 1IBKB 1XCGB 2Y67A 3TZQA 4RJ2A 3CO5A 1SR8A 2QLJA 2ZDQA 5JPIA 5ILOA 1JA1A 2K7FA 1R10A 5FADA 5TSDA 4AF6A 3KIPA 4S2EA 1VJ5A 3U80A 1CW2B 4POOA 2AZ4A 9LDBA 4M6WA 3FVWA 3KTAB 1AQ6A 5LC1A 1WB6A 2PWPA 4MICA 4NCXA 4O4JB 3U1TA 1GQRA 1H8HA 2G07A 4Y6LA 3RFTA 4Z9XA 3V8EA 7YASA 5C1BA 4PCLA 1M1YE 5HDQA 4CDRA 2J5QA 5T4BA 2H5EA 3LAWA 1E3WA 4PYNA 4ALNA 3MGBA 4FU0A 4C4SA 1Q1GA 4HH1A 2PAFA 5L3SA 2WNSA 4ZJYA 3SC4A 4G1VA 1U31A 2WKRA 1F7UA 3K2EA 4DXDA 2BR4A 1UZLA 4JASB 1NNSA 4C3VA 2XMQA 4ND5A 3SG0A 1X7ZA 1X1CA 1JALA 1XVUA 2HQOA 3SK0A 3I3SR 2PD3A 1HNNA 2I0FA 4P4TA 4QQKA 4WOBA 5EUCA 2A0FA 2EIHA 3ZWWA 4A2WA 1J2UA 2XT9A 3AKEA 4MA5A 1DG9A 2ZUTA 1A9XB 5DASA 1VMDA 3PJRA 4MPJA 3VJMA 3DJFA 4XSGA 3LT2A 2Z56A 3QE0A 2FPWA 4Q4HA 1RRCA 3IERA 2FZ4A 3C7DB 2QROA 4X7RA 4WWHA 2QG6A 4PYMA 2PKCA 4G8CA 3RJZA 4CMIA 4D3XA 1EM8A 4H7PA 1GKUB 1WW3A 1I8TA 4R3NA 5AW8A 1YS4A 3K0SA 5BR4A 3RYTC 5CB0A 4NS1A 4LYDA 1SCAA 1TYAE 2GHIA 3O84A 4UD2A 5AJWA 3BBLA 5CRIA 4BFTA 3TNLA 3MJTA 4PC7A 3PFGA 2P9GA 1JT2A 3AYXB 5TEVA 4GRIA 1A2KC 3IT0A 3HFGA 2LW7A 4I1IA 2FYTA 4Q1BA 1WDMA 4JGIA 5CK4A 1KE2A 1AURA 3IHKA 4D8TA 4ASUD 1Z2OX 1QHNA 1TZKA 1G3IA 2NTEA 1RWKA 4XWYA 5FPYA 3WLSA 4CEHA 2UUCB 3TLAA 1KETA 4OP2A 2KW5A 4BO2A 1ZQ9A 2H8GA 3MC1A 2IP2A 4Q0MA 4RJKA 1RBZA 3O91A 3ZKAA 1SOUA 1YR6A 3WMWA 1CJUC 2GRJA 3HCCA 4EL5A 2X4GA 4B5KA 2VXCA 4WZBA 1IPFA 4CG0A 3H5VA 1G8MA 2E48A 1A98A 1T5LA 3UT5B 1SFRA 2RGEA 1Z5WA 3AUYA 3GCXA 3I34X 4KNYA 1R0LA 1VOTA 1Z15A 2PZMA 1U6IA 2DX7A 3EZ2A 4LGVA 5F64A 3NYWA 5FQNA 4HLDA 3FYDA 1FQOA 3V9AA 2H9YA 5AK3A 4G5FA 2DULA 1NBWB 4YQFA 2NAFA 1K2VN 1NY6A 2F62A 4D2IA 2AE2A 4WDRA 3WC4A 3M81A 1SEPA 4NOMA 3BWYA 1NWCA 3E03A 3PT5A 2XPCA 5DWDA 3RV3A 5B4TA 5JAIA 3FTFA 3EEIA 4XUCA 5I3ZA 1NYLA 2WLTA 3NBFA 2CHQA 5CMLA 1YBHA 3DDZX 5FR2A 3P9NA 4JLKA 3T7AA 1L8XA 1DGQA 1OGJA 4LFCB 2JDID 3HUEA 4GOND 1ZZEA 4LFBB 4OH1A 2ASEA 3R4CA 4WZBB 1M34B 4DRXB 3FIJA 2DLNA 3KYJB 4BHTA 3II6X 5FPPA 4G5HA 4COOA 2EKQA 3W8RA 2H65A 1OU0A 1F14A 5C4GB 4NV3A 3CY6A 5BV2P 5BN4B 2X8JB 2PN1A 3G8DA 3GL9A 4RWZA 1Y37A 3M0EA 3HUUA 2QOEA 2YFQA 3V4LA 3D0OA 1EB9A 1ARZA 3RUIA 2FU5C 2BSAA 1FFGA 2WKWA 4ER0A 4GP6A 5JNWA 5E2IA 2LIVA 3U7QA 3HLTA 2PRJA 5C35A 4L95C 4PXAA 2D0OB 3ZY6A 5K4HA 5AMXA 4W5RA 1UK7A 3FTNA 3QOWA 2NZ2A 3B3FA 1YQUA 5I9SA 2XDWA 4UEKA 4DJFC 2R1VA 1WZEA 2OLKA 3NS7A 3L5OA 3OT1A 4DAEA 2VQ6A 1AHNA 2W6MA 1WMFA 3ZDRA 1TLFA 3MYYA 4PXSA 3CW2A 5CB8A 3U3MA 3VR6H 2TRSB 2WJGA 2E55A 1KMHA 2MR6A 3QY0A 4IYJA 4BKUA 3IPXA 3S8YA 2Y0PA 3NM6B 4OATA 3VC2A 3OESA 4QG7A 3U37A 1UPCA 4EFNA 4P2GA 5IFKA 3PXBA 5TPWB 1HBJA 3L82B 1ZI8A 4RHTA 4Y6SA 2HBZA 3I04M 1ULAA 1TRKA 1EXVA 4G67A 1QRRA 2WFLA 4Y2YA 5FYQA 3V8RA 1NF2A 1LPNA 1M66A 2YWJA 5EUQB 2BKUA 1ZH8A 1IHDA 2HF9A 3GNSA 4MJXA 1MVNA 3WLFA 3R7NA 1UT8A 1XLVA 2G80A 2QYSA 2JJ1A 4HL6A 4L72A 1AQIA 4E5UA 4FFLA 4HLUA 3HM2A 3BD8A 2VP0A 4W6QA 1N7HA 1QYCA 3T3GA 4CU5A 5L51A 3FOZA 2HSJA 2MWMA 3TNDA 3NJRA 1ZHHA 4X6XA 5CB4F 2QTAA 4PS0A 2I1QA 5F7OA 1U0HC 4DEXA 4RTJA 1YQ9A 2HYDA 4IFTA 1P81A 3WDSA 1XJCA 4KZPA 2CSXA 5CD9A 5HGJA 4ZALA 4DN6A 2CF5A 2YXNA 3LNTA 4Q18A 3TZLA 2Q1YA 2BEJA 3MCTA 4RADA 1X7ZB 4D7AA 3EVTA 4JI7B 3KPWA 1VG9B 3GBPA 1FDOA 4QYIA 1KVRA 1UJCA 4TS3A 2NIPA 1UWVA 1OWOA 3GGPA 3M83A 1YVPA 3IP1A 1QPGA 4H3VA 4MB2A 4OF4A 2EBFX 3CIFA 1P31A 3DLAA 4DDVA 1NN3A 3MMSA 3PQ2A 1XSEA 4E1AA 4EFLA 1E1YA 1X3LA 4S0ZA 5E9JA 1H4TA 3V80A 1R0YA 2ZI9A 1XVTA 5JMWA 4XWKA 1J07A 5K09A 2X3FA 2GHQA 3H5NA 1SKYB 4DBLC 5E1DA 2O23A 1KI8A 2X6TA 2ZSFA 3DBLA 4L74A 1VTKA 2X2PA 2JEOA 2L2QA 1RIFA 1SHZA 4IIHA 3HDQA 5CEJA 1S8AA 2RAVA 4JLDA 1B8OA 1CP2A 5JCOC 3DLIA 3SMQA 1CJKC 3HB9A 4J4TA 4QUKA 1MAAA 1X7XA 2QR5A 1HSOA 4H3HB 2AJ8A 3QY9A 4BO9A 4DV6B 3FTEA 3HADA 5GONB 4LXIA 4E15A 4YV7A 3C45A 1HG0A 2J6HA 3GQVA 4UOQA 2IH5A 1DAKA 4H27A 3PWSA 1Z4OA 3CO0S 1NI5A 1RC0A 4JC5A 3U4HA 4QPCA 4B0PA 5JCJA 5A7FA 4XGIA 3H1FA 5C1IA 4HRAA 5GJWC 3D7KA 4FYWA 3I9V6 4J94A 2O0JA 3OFVA 4OI2A 3FVVA 1BU5A 3GDGA 1DC4A 1C9YA 2PK3A 2QLFA 1M9NA 3HVIA 4IF6A 4RPHA 4EF6A 1UKYA 1JNXX 3HVKA 2B9VA 5CVUA 3DGEC 4CLOA 4M7PA 2ZIZA 1PQPA 4BRUA 2IXFA 4JEMA 3B8EA 4UUMA 1A8HA 4QM7A 4R54A 4BMSA 4UEWA 3QJGA 4AQDA 1EWTA 1R5OA 3KQOA 3W9YA 1NF8A 2GBGA 3LCUA 5EZ5A 2ODTX 5FT9A 3IUEA 1E2JA 1KERA 2WOOA 1GUDA 2VI5A 3VZDA 1OXSC 3CLSD 5ERYA 2B5VA 2IEAA 2XWJI 4AB1A 2HCBA 4RMHA 2JLWA 1X14A 2Q4DA 3S28A 1RQLA 4QHTA 4C43A 3C8MA 4HWSA 1VB3A 2ZE5A 2BYTA 3IAUA 4B3DA 1GCUA 2K2QB 2WIAA 3I8SA 1YS7A 4ECEA 4EY7A 1Y8ZA 1CZNA 3COVA 1SU8A 4UUOA 4BJHB 2E49A 1BN6A 1ZM2A 1QQTA 4Y30A 2I3AA 2X5XA 3WYGA 4G2TA 4L5CA 2CHFA 2XJ9A 3A7EA 1SCBA 2KHZA 1CUGA 1OT3A 5EKXA 1KO8A 3RQSA 1R1DA 1J8VA 2G3YA 2DYKA 2JKVA 3BS4A 2B7LA 4NCIA 4WHMA 5IDQA 5C46F 2XEXA 1U7UA 4IEFB 4TV9F 3WY9A 5JQGF 2NUAB 1SPBS 2X0IA 1U0FA 1PFUA 4BX2A 4JFRA 5K01A 4M1OA 5DLQC 4F12A 2Q4BA 4HADA 4XJSA 1N8TA 2IHYA 3A70A 3SEFA 5EESA 1PR2A 3EOAI 3TSOA 4UDNA 1QVRA 2C82A 5FWAA 2WZDA 1W1IA 3TSYA 4BNVA 3ICWA 4EYGA 1W4AA 2ZRIA 3BDAA 3RVJA 5ADHA 2C2BA 2ZIGA 2WD8A 4D9MA 1UDRA 3GP3A 3ME5A 3E1GA 4FN5A 4I6EA 3KUCA 4TVSA 1EGVB 5F1PA 5FPKA 2PT7A 3BXPA 4G5GA 1KSHA 2GZHA 5CYOA 4ZVOA 2AYXA 1ODSA 3GBVA 3OTHA 4W8OA 3TI7A 1QO7A 3IOMA 3WYEA 1GPKA 2G77B 3LPAA 2AOTB 4GVXA 1W9MA 5ES4B 4WLOA 4BLUA 5HKKD 4OXXA 5E6SB 4MIEA 3U19A 3BUSA 4H60A 2PX5A 4JL5A 2IYZA 1TTTA 5LUAA 1FTYA 5FBRB 1ZGCA 2WHRA 4DSNA 4WK2B 5NLLA 4X9XA 3WLIA 4L8YA 4A23A 3DD1A 2FZLA 1FJXA 5BY2A 4DWOA 3VHXB 2G9NA 2CGEA 2I6QA 4IDDA 3VR5A 4UCXA 2OXIA 2VUHB 3SBEA 2CDCA 4DNOA 1TK9A 3V6MA 3THOA 1KA9H 5TDHA 4UAGA 2DR0A 4FMDB 1U02A 4AXXA 4IXWA 2IT1A 4DLUA 1LBHA 5EUMA 2Q0SA 1Z7YA 3MT7A 3RIXA 1VYTA 3I5XA 2VDLB 1Q19A 4JVNA 1E2EA 3S2YA 4E6PA 3DE3X 1VLZA 3FF4A 4C2BA 3RADC 4NR0A 1QF7A 1HDCA 1U1GA 2HGSA 2XQFA 3B3GA 4G26A 2G6BA 5BMVA 4XUEA 1E9DA 4C6TB 4OXRA 4HG2A 5ALTA 3P7MA 5LUBA 3UGQA 3ADDA 2IZ1A 2IHBA 1I10A 2IE0A 2UZ0A 5ESDA 1ENZA 1VI6A 1V5GA 1GTVA 2XYQA 4QTUB 5IHXA 4YMHA 2EDAA 5KCZA 2D2EA 4KVAA 4C5AA 3TW0A 3IA7A 3AZPA 3S29A 5KTSA 4UTZA 2PE5A 1N7GA 3P8ZA 2F3RA 1LI7A 1CQWA 3LWDA 2DRIA 3QBVA 5CA0B 3JQBA 3NASA 3BZWA 3SKVA 1P7VA 2AZMA 2DY0A 2CVZA 2VF7A 4YO8A 4KBFA 1KH1A 1Q22A 1E9RA 1Z6AA 4JT4A 4Q15A 3D0QA 5AI0A 1KE1A 1Y3CE 4IQ0A 4BMXA 2QQ0A 3K05A 4HS4A 5AVQA 4FEAA 4BLTA 5KNDH 2A5DA 4I19A 1NW6A 2Y0EA 2WSYB 2D5LA 2GYUA 2Q4EA 2ZSDA 4C01A 4JB0A 2ST1A 4C7VA 4AMZA 2QRZA 2HX1A 2C9MA 1GQYA 1B7GO 2ZGVA 1Z6XA 4IMRA 2VUTA 2R751 3LC2O 3TZEA 4H7DA 2ZQZA 3OLXA 3RIYA 2C59A 2QYTA 3O4IA 2BUAA 2RHGB 2DU8A 2PH5A 3WMRA 1X8JA 4V3BA 4CDNA 3CINA 4GPBA 1EX7A 3BMCB 1FP2A 2Q5OA 3EIWA 2OB1A 3IAS1 4X6LA 4BTVA 4IDFA 3O92A 3V32A 2GF9A 2EBUA 2XQJA 3I1FA 2AR0A 3PITA 5ED0A 3M1LA 4PONA 2Y9PB 5EINA 3SMVA 4HZUB 4DIMA 1BVUA 1YR8A 1DFGA 3DYBA 3S1LA 1GZHB 5DHRA 4F1KA 2I80A 1U9JA 2CXOA 1DO0A 2EYQA 3KKOA 2H6EA 2ZPUA 3ISJA 5D51S 3EZ7A 4MWBA 1Z34A 1G19A 3QSGA 5BV1A 1NVVQ 2OBNA 4EECA 1FZTA 4OUDA 3O8OA 2Y66A 3C3AA 2AZXA 3DVSX 2ENWA 5HIMA 3UICA 2AXEA 1BDBA 4FKZA 1MEOA 2HU5A 1D1TA 1HH4A 1W88B 4FR0A 1QIIA 3MJRA 1SQ6A 4PZUA 5K0TA 3RC9A 3LI2A 4PQGA 4INPA 3WGUA 4C07A 1CNEA 1YMUA 4RQUA 5LFAA 4HQRA 1Z74A 4NZOA 2HXYA 1UZAA 5KQPA 5IJ9B 2AUMA 4BE9A 1CIVA 1Y5MA 3AI1A 1YS9A 2G76A 3A3KA 4NDZA 4R68A 1JV2B 1RYMA 5I7UA 2QX9A 3BSFA 1HE3A 3TRIA 4ZV7A 1SQGA 1NYTA 2VPTA 3QZUA 3IIKA 1FVHA 1YMVA 2ZJ0A 5IARA 5GWXA 2O1XA 4ZDKA 2CLEB 2JH3A 3F6RA 2JLRA 1V0JA 2B6HA 2ZB2A 5FCDA 1Z2CA 3O83A 2BGNA 5DW3A 3ZS9A 4C4RA 4FS3A 3G82C 4YX9A 2P90A 1LDGA 2I7VA 2ACKA 3MB8A 3OJ0A 4PIMA 3W6PA 1JEQA 2OFXA 3FNRA 2OAEA 4RS4A 4YDSA 5BVHA 1YT5A 3Q40A 1A3CA 1QTRA 2OP0A 1RKBA 2TMKA 3OLYA 4F4HA 2CYAA 1T2DA 4UOEA 1OX4B 4HAVA 3TCXB 2WWIA 2ZATA 1JH9A 3LF1A 1OBFO 3TPZA 3KLPX 3KE9A 4IDHA 5IZCA 3VMMA 3CYFA 4YASA 2PFKA 4FILA 4Q7JB 1SUFA 3A8TA 3NVMB 2VYFA 4IOKA 4WUVA 3UC5A 2YRFA 1PHRA 4X45A 1FFDA 2O3SA 1Z0JA 3L7OA 2WT4A 4URVR 3EZXA 3CG4A 2IEBA 3ZBUA 4V1CI 4YCNA 3WV5A 1W25A 2NOAA 4KO4S 1D2CA 4FBGA 1Q3HA 3UPTA 1IMJA 1JIJA 4BL5A 5FOWA 4X60A 2P2SA 4RAOA 3AVOA 4UPVA 4ZOLF 3IUJA 2FG6C 3STYA 3BA1A 4ZYZA 1MV8A 3K0AA 1DKQA 5K03A 2AMYA 3AFGA 3NUGA 1X8KA 4I5EA 5CT4A 4H6WA 4KN5A 4N9WA 4ZVMA 2NU9A 3TLGA 1NL3A 4FCCA 4KAAA 4BJ3A 2RE8A 1K5GA 2BW0A 2GZSA 1V6AA 3O8NA 4KHZA 4F4DA 1EFLA 3BCRA 1FU7A 2BIFA 2RGAA 4NSNA 1WQ4A 3IA2A 1E3WB 1VCOA 3EA5A 4EA7A 4NU0A 1AIPA 1YC2A 2FCAA 4X1YB 3W3ZB 4Q24A 3LLVA 1I80A 5JG7A 2ZR9A 1WMEA 4UTOA 1OROA 1CY6A 1E58A 4XRRA 3RVMA 1EJBA 1S8NA 4P22A 2D13A 4L4YA 1XQWA 2BOVA 3DA8A 1TCAA 4W9NC 1JX6A 2WJJA 5LCXA 4ZHQB 5KYWA 3JASB 2XE7A 3RRNA 3RVDA 1RQPA 2X13A 1QQ5A 3ANLA 3ZGYA 1SBHA 1XCMA 1ZO8A 3MWJA 5EEHA 4Q21A 3QVVA 2Q7OE 3QUSA 4Q7LA 1CV2A 3VH1A 5EHQA 3N8HA 5DM4A 4ZT4A 3ITDA 4XWGA 3WLAA 5JE8A 1G98A 1DWQA 1GKKA 3LQ2A 3QTLA 1KJJA 1Y63A 2YH2A 3G02A 4HH3C 2I99A 3SC2A 3WK4A 2PDAA 5GVSA 1ZOLA 4BWGA 2IBSA 1IU9A 3RJTA 1SC4A 3CR7A 3N86A 3PV0A 4I55F 5A9SA 2A5YB 3PU6A 4KR6A 4UPEA 4IS2A 1X9HA 2YQZA 3L8EA 1PZHA 3FDZB 1H0HA 2RCYA 5E7JA 1MT0A 2IPLA 3ST7A 3DT9A 1OLXB 5AUOB 1KAHA 2BTQA 2ZAYA 3PEWA 2I2CA 1IZ7A 4OFBA 2Z9CA 4F72A 1G64A 2XUFA 2ZUEA 3TPCA 3IQDB 3L4BA 1XZIA 1Q3TA 2WP0A 4GMKA 3N2IA 4D26A 1GPWB 4AC9A 3E8XA 5IBRA 4YCLA 1Y7TA 2VT6A 3NBKA 4MLZA 4MVJP 2A92A 2C9YA 3AETB 3SY8A 1T1GA 3W4IA 2DQSA 2IL1A 2OZKA 2HT1A 1P19A 2OV2A 3GEPA 4JQYA 4ZANA 1LPBB 1I4EB 1W46A 1XU9A 3LO8A 3O4RA 5AM1A 1B4DA 1QFSA 4F8JA 2R6GA 2D00A 4UJ5A 3GNLA 2QTMA 1KDPA 1PS0A 2CFTA 4WSOA 3SJAA 2GLTA 3ANNA 1YVDA 1YBVA 4WTOA 4ZT3A 4B9EA 4KWEA 1BD4A 1QP8A 1X0VA 1NM5C 5T8KC 1AD2A 4YH1A 5D8DA 2XOXA 5J9FA 3JAMA 2X5NA 1PWZA 1T8RA 1X15A 2TS1A 4WBSA 1X1QA 5D3QA 1E6KA 3ULKA 3ZW9A 1E2QA 1YFJA 2DB3A 4AY3A 2E87A 1RI1A 2PU7A 4BZQA 3RIEA 1AMNA 1JKIA 1M2EA 4MRVA 1SCQA 3WGZA 4PNHA 5IAGA 1N0IA 3VH4A 1GV1A 3MINA 1KR5A 5EXDA 1DBPA 3H4VA 3HI4A 2F59A 4TV8A 1CVIA 5AOAA 1H65A 5E6RA 3SX0A 3VR6D 2A9QA 2NT4A 4MQEA 1KXJA 4ZQFA 5A2GA 4AJHA 2WWRA 5LOVA 5CURA 1E64A 1AV7A 5FL7A 3BIWA 4NCAA 3HP1A 4N8DA 4Z5XA 1I01A 4BGVA 1RHMA 4TROA 4R41A 1FL9A 1QV7A 2QUJA 4HWPA 4RK1A 4Y9TA 1TZMA 4XLLA 4MS4B 3G8YA 4NICA 4EGAA 3ZHVA 5IKXA 4RHCA 1FS4A 1QIMA 5J63A 2BF4A 2VCEA 3VO2A 5TNXA 4DE5A 4IG9A 5ALDA 2J5RA 3GDHA 4Q3LA 3ROFA 1E9FA 4M9RA 5KTTA 4RZ2A 9ATCA 1FMTA 1PJBA 1RW4A 2BGIA 2FF7A 2JI9A 5K8LA 4G1MB 5AVXA 3H11B 4BPBA 1N5IA 1NKVA 3PIDA 4QTZA 5K3FB 1G5HA 4D5GA 5B6PA 1QH1B 3N5CA 1FYWA 3PDWA 5DYWA 3DL2A 5JCZA 1OTXA 4UAUA 4DUGD 1NUQA 1T3SA 3QW4B 2AOWA 1T9BA 1TVCA 1EJ6A 3ESZA 5DB4A <