2X9LA

Crystal structure of deacetylase-bog complex in biosynthesis pathway of teicoplanin.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
266
structure length
256
Chain Sequence
b'TRLLAISPHLDDAVLSFGAGLAQAAQDGANVLVYTVFAGAAQPPYSPAAQRMHTIWGLAPDDDAVLYRRKEDIAALDHLRVAHRHGRFLDSIYRKLPDGRWLTAAVNDHSPDSDHDLVGEVADDIRSIIDEFDPTLVVTCAAIGEHPDHEATRDAALFATHEKNVPVRLWEDLPYAVFKSGAVELPQGFRLGSADVSSVKPEMRSQKFQAVERYSSQMVLLNGNNLFDRLDEHARQNAPHGGYGETTWPVVRSDDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACYL GLM PEUDO-TEICOPLANIN DEACETYLASE
publication title Regioselective Deacetylation Based on Teicoplanin-Complexed Orf2 Crystal Structures.
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
molecule tags Hydrolase
total genus 88
structure length 256
sequence length 266
ec nomenclature
pdb deposition date 2010-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 2x9lA00
3DFIA 5CGZA 1Q7TA 3DFMA 4XM0A 5B2FA 3WL4A 2XADA 5B2EA 2X9LA 2IXDA 4XM1A 1Q74A 1UANA 3DFKA 4EWLA 4XM2A 3WL3A 5BMOA 4XLZA 3WE7A 3DFFA
chains in the Genus database with same CATH superfamily
3OEYA 1V11A 2X2PA 4P38A 1U11A 2FPLA 3SQXA 2W83A 5FLKA 1NXXA 4QTYA 4IIYA 3WIOA 2CD7A 3AI3A 4MVJA 2YFHA 5FI1B 4ZPXA 1P2VA 4NG5A 1F8YA 1X1EA 5HGXA 1D1PA 1UBTS 1PUIA 2GPBA 4RIHA 4PXSA 4UZEA 3UUEA 3DTYA 3MW8A 1AGYA 3DT9A 4Z99A 3X1WA 1UPBA 2P2DA 2KLBA 2P65A 3ZE0B 3ZUPA 2J6HA 4QWMA 3BE6A 4Q9LA 5C5EA 2H48A 4KH0A 5I7UA 3LDGA 5JVDA 2JZOA 1LV7A 3W1WA 2A35A 4DV6B 1UDCA 2JEZA 1EWVA 5TPZD 4RJTA 1FFGA 2BLNA 5LBTA 3ASYA 4OPMA 4FYWA 5IF9A 1S96A 1G9XA 5AHWA 2P2LA 5JDIC 1DP4A 1KETA 1PR4A 3UMSA 4R98A 1PT8A 3RARA 4BDTA 2C9MA 1S02A 3ZNNA 1TCVA 4M1OA 4NF2A 2PRYA 2ZJAA 1SZPA 4EFNA 5KYWB 2AOWA 3K0CA 3VR6A 2B25A 5AKLA 4RVHA 1P4GA 4GQAA 2X0JA 4DPMA 2VDRB 2J46A 2VT6A 4MK4A 1IVYA 3VYUB 4IDOA 3KCNA 1L1QA 1A5SB 2QQ0A 4P6VF 5C3UA 3A9SA 2RJOA 1P4RA 2NW6A 2PTGA 4NDZA 1PVDA 2XOKD 1VL5A 3OUZA 4XQ9A 4GAEA 3HFRA 5JOQA 1CU1A 1HBJA 3OJXA 1EDDA 1U9IC 3VDXA 1GVNB 3W5IA 1AUVA 4B3SB 3LIPA 1GPJA 1EDZA 3VHLB 4MV8A 4JLBA 1X1AA 1WABA 2EBWA 3HVHA 1UODA 4U39A 2XBLA 2HYDA 3KZOA 1TIPA 2IXFA 1R16A 2RGGA 4E70A 1M72A 1MF7A 1RYDA 2FEKA 2HNKA 5ARDA 4FXPA 4LPSA 4ZKEA 3FNBA 5A4DA 1TAUA 1HF3A 2PKEA 3QVOA 3CU5A 3CISA 4NK5A 3HKDA 5IZCA 5IWAB 3PJRA 2WPDD 1QF6A 2VDJA 2XUIA 1T0HB 2PD4A 2Y1DA 3DHNA 3N70A 4YJ3A 5K4AA 5TR9A 4DQLA 3ZQKA 4YAIA 1DXQA 1BWRA 4KUHA 2J0QA 3CG4A 3L5OA 1C9DB 2W6QA 3S5UA 3CCFA 2YMMA 3ZD8A 4MUGA 3A1UA 4JLAA 3FDZB 4WEOA 2B1IA 2XI4A 2JVJA 3GJ4A 2AD1A 1CY4A 1GIAA 3S1AA 3A06A 3U7JA 4J0FA 4LF6B 3MZ0A 3SFZA 2YJNA 2C61A 2XMBA 2VDLB 5G1OA 7MHTA 2AQHA 3DCIA 3JCZA 1U9YA 3L0CA 4MS4A 3RTAA 3WKAA 4BNKA 1I2DA 2PEYA 3CLSC 1H85A 1Z5OA 5F1YA 1KWKA 4WWHA 1F4VA 2H2WA 4RD0A 1G7RA 1O5OA 3UWOA 4GKJB 3O1HB 2XHZA 1G5TA 5LKAA 3G2KA 3D7RA 3I4CA 4TV9A 3JVUA 4K9DA 1OC2A 4TV8B 3L46A 1IUNA 1ONNA 1B00A 3PPWA 1GTJ1 2XDWA 4YJDA 1RACA 1VIVA 1JZQA 1YS4A 3NORA 3PGA1 4LI0A 1GKLA 4OF4A 3LQ4A 1TMYA 4QUEA 3HWX1 4JBWA 4C29A 4X90A 3GP8A 5EPEA 1UOOA 1ENOA 3VKVA 3B9RA 2I8CA 1EXWA 1G16A 3JY6A 4YMIA 5LQJA 4CL3A 1XZGA 1WX1A 2AR7A 4YAEA 4DLKA 3OT1B 2CHGA 4QLOA 4MO2A 3ZDRA 1IULA 1QZUA 3OQPA 4JY7A 5EJGA 2WSMA 4F2HA 4YAUA 2AWNA 1BHQ1 3IQZA 3EVAA 5KC9A 2E5FA 2B0CA 1JR3D 3VPCA 1RHQA 3OZUA 4G5RA 1EVYA 3TXYA 3ZG6A 3I5MA 2X5NA 3JQCA 2KJQA 2QRGA 4Q4AA 1NC3A 4NEQA 2J4DA 1PBNA 1YJAA 2GSDA 4KPEC 2GFIA 3BQ9A 4DZRA 1SKMA 1ZH0A 2X41A 3TQCA 4RA9B 2LRHA 1Q7TA 5CK5A 1R88A 1K7XB 2VVTA 2X0KA 1NJ8A 2NSJA 3C7AA 5CIQA 3WWEA 1LFDB 5BUSA 2DYKA 2ECQA 5ERYA 1P7CA 2I6XA 2ERCA 2NU6B 1FYEA 3M1LA 1ORDA 2F62A 4OIFA 4AMUA 2ECFA 1A9XB 3EG5A 2V97A 4P2BA 4BNWA 1J5EB 4Y9SA 3K9QO 4PZZA 1DTWA 1NONA 5DGXA 2PCJA 1JWAB 3JD0A 2WF8A 3QVUA 4JJAA 4X97A 3V4FA 1FJGB 1EPUA 4OYYA 1VE1A 3HABA 3MS2A 4MWSA 5AKXA 4DWVA 5IFKA 2QRJA 3W0LB 5GIPE 4E5KA 4LRXA 1YUBA 4LQ4A 1J99A 3AL0C 2PNFA 2PT7A 3ZBTA 5AJUA 2H0RA 4WDRA 3RPEA 1C3OA 2Q5JA 3CG0A 4DUZB 1KZ9A 2WKQA 2QKYA 3O4IA 1BVYF 1TZCA 4KRYA 4LWPA 4G0NA 3RQIA 4BMNA 2IDKA 3EDMA 2IV3A 4AURA 3RUAA 4ZEOA 1JX6A 1N2SA 1U9ZA 4QBGB 1KYXA 3TL6A 1GPUA 1GDTA 3QQ5A 1KI2A 2ORVA 4WFIA 4UNQA 1O6BA 3WDMA 1NT4A 2QLFA 2OAP1 3AJDA 3WIUA 5JDCC 3PFFA 5C5CA 2AQ8A 3K0FB 1KI9A 4Q12A 2WJ4A 5CVEA 1M73E 1K5DA 3EX7C 4Z1MD 4MEBA 2X6TA 4HOYA 2IGBA 2CMDA 4BMPB 3LOUA 1X70A 3UK0A 4EX7A 3AIIA 3EARA 4UOQA 3GLIB 3WFJA 5A5DA 2D6FA 3KD3A 1UQUA 1BWSA 2CHFA 1XJCA 3P2OA 4YQYA 2BFBB 1FDSA 4QNRA 4P9NA 1ULTA 4OO3A 4OH1A 2SKEA 3T1NA 4QBFA 2C5FA 4TTIA 5F2KA 3LHIA 4ZHSA 5KKCA 2V0CA 1WNFA 5IAEA 4B3HA 4TUYF 2APJA 4CU5A 4FUTA 1UXJA 2O20A 1JHUA 1RR6A 3WLOA 5EIWA 1EFTA 1M7HA 3MT7A 1DRWA 2A2ZA 1U8FO 3MUEA 1J9GA 1JDBB 4RV5A 5K3SA 4C0JA 4F6LA 1H2YA 2G82A 3PEWA 1P0MA 1DAEA 2C8VA 4A6EA 3JRWA 1U1GA 2MCFA 2UVDA 4B80A 5A4FS 5BR4A 4N6OA 2QBYA 1UKCA 3O4GA 2X8JB 1RWWA 3MB8A 4E5UA 4E32A 4CG0A 3OZVA 4YNBA 2FOIA 3SQWA 3DE3X 3JX9A 1CUBA 1NJGA 3IKMB 3D4LA 3JPYA 2J9GA 2JIOA 5T4HA 4EYGA 3ZR4B 4JVMA 4RPLA 3EEQA 2ODQA 3JU3A 5ESXA 3TCKA 3D8HA 4AX4A 3CJRA 3U4CA 2AN4A 2RHDA 3KR2A 2D4AA 3LLCA 3JR3A 3M6UA 3MLAA 4GECA 5I01A 3AVYA 2HMWA 3GT3A 4C07A 4Y9DA 5B1EA 2GKOA 3ICCA 1ZMRA 2FQWA 3PPYA 4RY8A 5FPTA 1XKLA 4JMPA 2HLPA 5DOZA 1P29A 1DKNA 1KVQA 3CLRC 1MOQA 2Z8YM 3FKSD 1OFTA 4JK3A 4EHLA 4MO9A 3HVKA 2MMGA 2P9BA 1NR1A 1N6RA 1FRZA 2XZTA 2AJ8A 4F72A 2QK4A 5A3JA 1MABB 4FJ2A 4L8FA 3VTZA 2J9YB 2IVFA 3EA4A 4RXMA 2Z6UA 2G9RA 1QTIA 5FPQA 1O6GA 5HX7A 5DO9A 3VKWA 2IUTA 2NTJA 3C8HA 3PUWA 4GUAA 4KXUA 2CGEA 5I51A 3QKUA 2RJNA 1R4NB 2WQZA 3ND6A 1O96B 2VCHA 3C7KA 3E27A 2BJHA 1ZG3A 4DVJA 4EI9A 1T6NA 4GBGA 3DZFA 1EUYA 4EABA 2WHYA 2YHIB 3TNLA 4Q03A 4B87A 2A6PA 1PL6A 3EZLA 4QWWA 2P6PA 4JIMA 4HTFB 3VHQA 3VR5H 2V7EA 4RKRA 2J3QA 2V96A 2DBZA 3F1KA 3J80A 1RCUA 1UKBA 2XVYA 4B1FA 1JFRA 4F3KA 2GESA 1FMTA 1GGHA 1XEXA 5KDDA 4BECA 3AUTA 1H4VB 3U4QA 4WERA 1X7ZB 3KAJA 1BVRA 1DUIA 1I3MA 2CUKA 2YWFA 3MWFA 4G09A 2QY6A 1YVEI 4EGFA 4DNQA 2XCRB 4RHYA 2O8EB 3N0WA 1RI2A 2BSXA 4PIVA 3LWDA 1Y89A 3S0JA 3QVMA 3L5KA 2R11A 5HKBA 4HLUC 3C6ZA 3ETGA 1NPYA 2ZRHA 1T9DA 1V6CA 3V4OA 5IHXA 4WASA 4C4ZA 3VHXB 2X4LA 1YI8A 2WIFA 3D6NB 4JKIA 4OB6A 4C0LA 3TLBA 4D8XA 5DYIA 3TRHA 3IVGA 2IYLD 2GD0A 4MB2A 1KH2A 4ZOLA 1C1XA 2Q1YA 2RHWA 4MX8A 5KNDD 5CVDA 3TK1A 2Q3LA 3BMQB 3G5TA 3UB2A 1K27A 2B6NA 5GJBA 1QQ7A 2ZAOA 3AUAA 4MWBA 4IVQA 2QLBA 1UBMS 4JP1A 1IXYA 1CLUA 2PLNA 3LT0A 4JJ8A 2UDPA 1D3AA 1VM6A 2HF8A 1W49A 4M55A 4CWAA 4XWAA 4CBVA 5KSOA 3NIWA 3QFFA 4FW9A 3EVNA 2YHSA 2P4SA 2IVZA 1KJWA 5FIUA 3LVQE 2CLMB 4LVNA 3S2UA 4BBPA 1TVEA 4NL4H 4RGQA 5GZ6A 5EWMB 1RZ3A 1DLIA 2H3HA 1WHTA 3B7PA 2F1RA 1WP9A 1L7AA 3K70C 1KQGA 4HN4B 1ZJ6A 1A97A 1ULBA 1VLMA 2F9FA 1JAYA 1F5SA 1PYDA 2BVNA 2OORA 4LMRA 4ZV4A 1IB0A 4K87A 5KYGA 1GILA 4WTOA 1NJ2A 3IHKA 1RRKA 1USIA 2YXEA 1MJ5A 4D9CA 3N7TA 3EIFA 4LPKA 3QJYA 3X0DA 4PLTA 1Y8RA 2UZAA 4P82A 1QQAA 5CYGA 5LKRA 1KEVA 5DN6A 4C7MA 2P9TA 1N0IA 5AESA 4R16A 3HI6A 1E7WA 2G80A 3NRJA 4P32A 2NZWA 4TLEA 1MJHA 1K7EB 3ONWA 2JAHA 4LXGA 3BKXA 1EK0A 4MRMB 2I29A 2WWTA 5JTTA 3GLHE 3VSDA 1M2JA 1Q20A 3ETNA 1FDOA 3W6ZA 4FZRA 1K5GA 1OXVA 4OYLA 2FX5A 5LU8A 2QAGB 2WD7A 1KGDA 5GADl 3UWKA 4GKKB 4X84A 3M6FA 5BWOA 4O8CA 5E0OA 4WJKB 4XXHA 4Q7KA 4URWR 2B8WA 5BNFA 3GPDG 2I2BA 3R5TA 2HHCA 1KK2A 2WYHA 1NMXA 1HKHA 3DR3A 1L5LA 2DEUA 2ZUBA 2BPOA 2ZJZA 2B9EA 3A6ZA 3CH5A 3FUXA 4HGZA 4IXMA 3PQ8A 3PIRA 1PK7A 3BL6A 2YDXA 4ZAZA 4NCJA 4U7WA 4Y2RA 3JYHA 2C98A 2JCGA 5EJAA 3TZEA 1J0CA 4KQ2A 3R75A 3REFA 1JBQA 1D2EA 2VSQA 1D2RA 1Q17A 4FINA 1SUCA 2PQ0A 1XAGA 3H5NA 2EXXA 5IKMA 1RAHA 3U0BA 3UHJA 4F8YA 2JEYA 1IHOA 4CLDA 3PDHA 4FT4A 2QMHA 3H99A 3NTQA 4I7EA 3PYXA 5SYAA 5CYFA 3M2PA 3QEJA 2LUOA 4EUNA 1IWOA 5AQ1A 1Y6FA 1O0BA 1VJ0A 1NMEA 1ST2A 1V1JA 4FCVA 4XD7D 1CWUA 1SC3A 3LNTA 3HB7A 1GPNA 4GGPA 5EZYA 5IXJA 1G8FA 1E1YA 2EKLA 2WM8A 4H3VA 3LH5A 1G6HA 3DMYA 4X7MA 5A0FA 4DNPA 3MTIA 2YUTA 2YINC 1D07A 1HZZA 5GONA 4X66B 4LOAA 4OGWA 1VDMA 2HK8A 1SQ0A 3UYLA 1I4LD 1WUIS 2GEVA 4EHHA 1H6DA 1C8BA 2OFOA 1TADA 4R83A 2CZQA 2FSUA 4F86A 4IQGA 5AKHA 1NLYA 2WAMA 1LBHA 2G9VA 1APBA 1U99A 5BWNA 3EUWA 1ZESA 3IUSA 1N8TA 4Z9YA 4KR7A 1YRYE 1JHMA 4HS4A 4ND6A 1BSVA 4TKMA 3ZHCA 1YS2X 2X7JA 4P3KA 3T1TA 2QJRA 4QRDA 1Q1BA 5FL7A 4X6UA 3S28A 1C7JA 5CJ2A 5ER9A 1H22A 2ZRAA 5KX5F 4A36A 3NM4A 4BTEA 5IS2A 1CUSA 1KDVA 4WNIA 3ELWA 2JRCA 3L0DA 5BSUA 2ZRNA 3HA2A 2HF2A 3Q3HA 1Z0KA 2BDEA 3MNFA 3FIUA 2BHLA 4IILA 1ZXLA 3V7NA 3KVVA 2IF0A 4YAKA 2OCXA 4CXMA 2R7KA 3P27A 2XODA 1KDYA 3L6UA 1WXHA 2F43B 4DMGA 1SXGA 2VJBA 1IEXA 3U4GA 3LECA 3CCCA 2AKAB 3L1HA 2FWNA 5HF9A 3UCEA 3CCBA 1E6UA 4I4TB 1P9OA 2VNHA 3HE3A 3DV0A 1IG0A 1U4NA 2X7HA 3IIEA 3MYYA 5H70A 4B33A 4BEWA 2H11A 3OLWA 1BC5A 1DELA 3OF2A 1XTSA 1UF9A 5BW6B 5CCBA 3RG8A 3ZIAD 4O08A 5IM4A 1T35A 4RKQA 3DLHA 2A4MA 1XTZA 4L51A 3WO1A 1OWOA 1UT6A 3K9HA 2Q4BA 3PUXA 2Z57A 5FV4A 5ALPA 1PJTA 5I9SA 4QQRA 5LLSA 3BSYA 1M0SA 3COSA 1J1ZA 1I7NA 2GAAA 2HDHA 1Y9AA 3KT0A 3HB9A 4HX5A 4I1SA 5CX1A 1WSWA 2C59A 3EBLA 4JLNA 1XO1A 3V4SA 4BBZA 4P58A 3HVRA 2J0UB 1YR9A 5FYQA 4QYXA 3CW9A 1G9SA 2HIHA 4DV1B 4M9CA 1EFRD 2BOVA 1GTRA 1SK9A 2V6FA 4KKVA 4P84A 4NVRA 4U7PB 4PWZA 4PBTA 1V8PA 4KB5A 1EVJA 2CHEA 5G0WA 2R65A 2SCUA 2VPPA 1DWUA 2BM9A 2PRJA 4MS3A 4RE6A 4C7VA 4DHWA 4EKYA 5K9ZA 4NRDA 2YY6A 3I01M 3AR7A 2NZUG 2ZRPA 3QPCA 1O9BA 3HDVA 3FSEA 4QFBA 4MV7A 1B26A 3WNQA 4D8TA 1H3EA 3GAZA 5LQMA 1W4BA 4F5EA 3WGKA 1FP4B 5DCYA 4Y98A 4DWOA 3A11A 2OD7A 3VR4H 4X94A 5DWQA 1M75A 3FG9A 1C0LA 4HQ0A 3URMA 4KNVA 1NXOA 4B48A 4ND8B 1OXSC 1I36A 2H1FA 4X7BA 1C1DA 1JBEA 3A9TA 1UK9A 3VO2A 1JLSA 2K7ZA 1NX9A 1VPTA 2CHUA 2PGAA 2C77A 3KE8A 4WXRA 2YKGA 1G2QA 2NN3C 3LNCA 3PRKE 1U9IA 2A0FA 2Q2OA 2B98A 2FE1A 2Y05A 4FKBA 4G0WA 2BC9A 5EN4A 1JJBA 4FYYA 1N36B 2P6RA 3D3WA 4I1RA 5B53A 4IY1A 2R8YA 2I8LA 1NVKA 3PDIA 3AEYA 2XF2A 5A7FA 2G5TA 4FDAA 2FVXA 4BQOA 2OC9A 1FX0B 1N6NA 1ZZGA 3H6GA 1UQTA 3NLLA 1AZWA 1RJ9A 4Y6LA 4DC0A 4WD3A 4C22A 2Q0XA 1PJ3A 2BCGY 1CETA 4Q9NA 4IV0A 4EJSB 1Z6ZA 1JQAA 2FSVC 3BIWA 3H2HA 2BD0A 2WRZA 1ISJA 1TAHA 2WKSA 3CZCA 3MJCA 3EEOA 5C5DA 3FUUA 1NYQA 4LXXA 1VCHA 4TS9A 4FS3A 2GPAA 1Y37A 1VIDA 4O63O 2DWCA 4QATA 2AT1A 2ONYA 4MUYA 1C80A 3A14A 1Z74A 5AJXA 1XUOA 4MARA 4ZHQA 1F3LA 3GJXC 3PQ6A 4A7PA 5C1BA 1E69A 3UQYS 4IDPA 4CKYA 4O2LA 1CVRA 2AI2A 2QW8A 3G5MA 3TZ6A 1G7TA 3WKBA 5B2FA 2Q5OA 3ZHYA 4EI8A 5B6IA 4CKCB 2F9MA 3SSNA 5L6MB 4C7JA 2OT3B 3H42B 4IG9A 4L9WA 5LP6F 1AURA 4LW8A 1JIVA 4OK5A 3QBDA 4R1LA 3AI2A 3NQ41 3K6SB 1EEHA 2G0NA 4WPGA 1ZMXA 4J0KA 1BCRB 3HJGA 4FWTA 1PGJA 4D4JA 1OTHA 3D7KA 4YAFA 4KX5A 4ZD6A 2VTVA 4DBLC 3D0OA 3I92A 1GAQA 3Q3GE 3OKCA 4WUTA 1MEEA 4EZIA 2HBZA 1ZA1A 2P2CA 2VP0A 3KK0A 3TNJA 3JPWA 2FW6A 2Q3JA 3D1JA 3HKCA 4DLXA 4IFIA 4NECA 1HRKA 3IJRA 4KE7A 4N54A 1DX4A 4ZARA 4NENB 1HTWA 3EC7A 3KB6A 4O4JB 2F3QA 2YNMD 4OJKA 5HCIA 1FC0A 2OXRA 2VJAA 3SGLA 3X3HA 4EQ6A 1RWOA 3TKYA 5JFGA 3KT3A 4PSVA 3RVOA 4PPGA 1EG2A 3DYVA 2GBLC 5AFSA 1MRZA 1CR4A 3B5IA 5K20A 3GGJA 5BV1A 4EYOA 1NKTA 3EZ2A 2VT7A 2QE6A 3A36A 1P5JA 2OZEA 1DJPA 1XMSA 1P2GA 1HE2A 4QECA 4F2WA 1BROA 2BZGA 4JVOA 5E7IA 3GP5A 3OVMA 1CF2O 1WY7A 3HUFA 4MV0A 3IUEA 4PLYA 4OTZA 4UAUA 3ROPA 4XGQA 3SG0A 1HR0B 4R8MA 2WE8A 1NNEA 5LQCA 1JJ7A 1JSLA 2LVBA 3D9QX 3UPUA 3NM5A 2QTWB 3K0EA 2CUNA 2Y6UA 4LJAA 1YOBA 2IYPA 3EEYA 2ZUSA 2W6CX 5JRDS 4IZIA 1K6EA 5I7RA 3JQQA 2PGIA 1VB5A 4QUKA 1TC1A 1IN6A 1KMHA 4N5LA 3ZHUA 3FAKA 3RCBA 5IN5A 3VJKA 5E6SA 4XLTA 5FI3A 3FFXA 3VZQA 3FTDA 2XMRA 4IHJF 4A23A 2I6TA 5ICEA 3P2JA 4R84A 2HNAA 2VAPA 4KWEA 5JO9A 1YMVA 2QTAA 2G4CA 1GQQA 2ZRQA 3A6LA 3EGDA 4E4YA 2P35A 1ZD5A 1RSZA 1M5UA 3PE6A 4JDPA 5E9WA 2VXBA 2ACVA 3G6KA 1XJQA 1OWMA 1IHUA 2DG2A 1R74A 3CEMA 1YL7A 4MGIR 2PGXA 1ZHOA 4NH4A 5K45A 4IFEA 1QG6A 1J8VA 2CVOA 3GD7A 3IPYA 5CX4A 1PFYA 1NI5A 5HDQA 3PFBA 3H0EA 2ODTX 3AF4A 4IIXA 2PGDA 5CT8A 4OQQA 5FUXA 5TF4A 3WLKX 4F9FA 4Z6KA 1IBLB 3GX1A 3O95A 3JQ7A 4Q3DA 3DMPA 3GZTB 4U2EA 1N2CE 2ZBFA 2PZMA 4FZVA 5EJFA 3IHLA 2GD2A 1SXPA 3H17A 1FUKA 3NHYA 4XM1A 3OQVA 2CL0X 2VZEA 2WJZB 1NFQA 1WXWA 3DBLB 3DSRA 3FR8A 3QU4A 1GV0A 1V71A 4B7AA 3GAFA 4E11A 3QLUA 4TYWA 1DBSA 2XDAA 2ORWA 3ETDA 4R2WA 1XNGA 2TMYA 3VJLA 4X95A 3HFGA 3I58A 4HI0E 4G0XA 4EUFA 1WA5A 4NBWA 5G0VA 1SURA 4LHWA 4WADA 1USKA 4KR2A 2HD4A 4QYTA 2XZDA 3T0GA 4EPYA 3BA1A 4C01A 3NANA 1PKXA 4IX9A 1T6ZA 1Y42X 1F14A 1RTKA 1SVLA 1XVAA 3WQRA 4TWZA 5FTLA 1VRVA 1EVZA 1RYHA 4OXXA 4EAQA 3RLIA 3WLEA 3QF4B 3H1EA 4QQNA 2C8LA 4HP8A 2VAWA 1F5NA 1E2KA 2CDBA 3H5IA 1G2OA 2W90A 3D81A 2RGRA 1VKOA 2FPOA 4EK9A 4P3YA 1J33A 4JIGA 1KH3A 4R5MA 1BDIA 4HVLA 1C7IA 1NIJA 2HRQA 4B8ZA 1Z0DA 5BSVA 1I7SB 2J3MA 2EL9A 4YMSA 5FCDA 1C0EA 3EF3A 1E3LA 1G18A 2YWGA 2IP1A 3FPFA 3LUCA 4HH4A 1HEYA 1KP2A 2BEWA 2RI6A 1UWVA 2V65A 5DGIA 5AVOA 3CKKA 4ITUA 2JATA 1NBIA 4UUMA 2ZJ5A 5DLEA 4F7WA 2ETXA 3QKRB 1QHNA 4LX0A 1Y5NA 1ZHFA 4HFJA 3KJFA 1IZ9A 4H60A 4U63A 2CJPA 2J3LA 4XEHA 2I67A 1FL9A 4XPZA 4ARZB 4HUQA 3LT2A 2ZIXA 2E87A 3SJAA 1PG2A 3K9NA 3Q7SA 1ORIA 1WE2A 4Y2TA 4LXTA 4OBWA 4A6XA 4POOA 3GEMA 4B6PA 1XLTC 1Y3FE 4FSDA 3FDXA 4ZGGA 3AHEA 4L8YA 1AS3A 1E7MA 2WZBA 4LRTB 4DA8A 5CYPA 2DPHA 2Z5FA 4GG1A 4F1WA 5ICMA 2B30A 4MCHA 4TPKA 2O50A 4G41A 4HDKB 4RABA 3TZHA 1Z18A 3X43A 3DEAA 1QU2A 2IYQA 3MOGA 3PPIA 1O7JA 1DL5A 2SKDA 4O2RA 4TTTS 2VJYA 3NT5A 4E2ZA 5KHOC 3LCUA 1BJTA 2ZJ7A 1VRWA 2ZRIA 1VHDA 3G7NA 3LO5A 1LXCA 1YRQA 1L3CA 3M9WA 4U7FA 2QRHA 4UXHA 5FPHA 2B1JA 1ECLA 4KTVE 1U7WA 3R23A 1CULC 4H1VA 4W63A 3RJTA 3WJ2A 2PA3A 3ZHXA 1TCAA 4ZU6X 2B37A 3GCXA 4MROA 1KQPA 4FGJA 4Z86A 2IDMA 4E5NA 5TDHA 1B93A 1JMKC 1XA4A 1I0IA 1WB4A 3CRZA 3GROA 4IP0A 3OZDA 3NVMB 4KXFB 1OF1A 1HKUA 4URHA 2BGLA 5G3ZA 1HMPA 3DMNA 3R3YA 4B6OA 1NVWQ 1DU4A 2IQ5A 4LWQA 1G21A 4FUQA 1FUUA 3EY4A 5J1TB 5CDFE 2IXEA 5I7SA 2G7ZA 2DZDA 3AL2A 1GQOA 5A6SB 5ITSA 1XR3A 4HLUA 2QJFA 4HH1A 3I09A 5KKAA 1J07A 4KWTA 5L3VA 2BFWA 5BPHA 1OFHA 2W2XA 1CD5A 4ZOCA 3GJTA 4HDMA 2I4LA 2VHZA 2MINA 4N5DA 1ZNWA 4J1TC 4X8OA 3HTXA 2GR9A 1VPEA 2ST1A 2PRZA 2TECE 3FCCA 4G25A 5FHQA 4A5OA 1FRVA 3KEQA 1KQ3A 1D09A 2BBSA 2BHSA 1M2FA 2COKA 3GRVA 3LUDA 4GWGA 3RIEA 2HU2A 2JGIA 4NCIA 4KODA 1E9CA 1U0EA 3COYA 1FS5A 5CEEA 4WNCA 3TB4A 1BX3A 3E9MA 4BX9A 4BNDB 5DKFA 3M49A 1JIXA 1UFVA 2BEVA 1FNMA 3QUTA 3LBIA 2BIFA 4J43A 5DF1A 4FDVA 4Q9KA 2X1VA 4JLOA 1TF7A 3VSEA 2BDTA 3IAM1 3IVCA 3ZYCA 4DAOA 3SC2B 3A9VA 4OLAA 2VH1A 2QLLA 5DNUA 4RENA 2C1XA 4WBXC 3AM5A 3QM1A 4KAAA 3EVDA 4RTKA 2I9PA 4RWEA 3NT2A 3NDRA 1YDHA 4ENVA 3HLTA 3W04A 1K7SN 2F4NA 2DM6A 3LA6A 1QP0A 1YMQA 3P5SA 2VI5A 1VE9A 5F78A 1CE8B 3FLMA 2WJ6A 3QIAA 1CKEA 1AUQA 1MOZA 4NESA 3ZUGA 4G85A 4O5OA 5ED0A 3RUHA 1VL6A 1B0AA 2P0AA 4QREA 4MITA 1GAJA 4Q02A 1DVRA 5IAJA 1Y9ZA 4EUEA 1WXXA 3LKVA 3R4VA 1S9DA 5ARBA 1B1AA 3QBTA 1T5OA 5HEKA 4OXQA 3C41J 4PAQA 4HNGA 3VR2D 4DY6A 1LVGA 1I4EB 1T36B 1MFPA 3D8RA 3FWYA 3KPYA 4J90A 4MPTA 4NX2A 5JH7A 3GU3A 1PYGA 5T8KC 4RTQA 5L3QB 2IGTA 1SIUA 3B5EA 5AKGA 4IS3A 4RAQA 4Z0PA 4WXYB 4UATA 3FWPA 1U2PA 2YOGA 3HA5A 4RZSA 4QE3A 2G25A 2IWRA 4DIBA 4EQZA 2ON6A 4PV7A 2IY7A 2RH5A 2Y66A 1MRSA 3P4XA 4LTNA 3E5RA 5JC8A 2C00A 1IFXA 4YP6A 3EF0A 5D86A 2UUCB 4RZUA 2IP4A 2A78A 1Y81A 2JCSA 2W2LA 3OTQA 4MQEA 4PYQA 4QDOA 1JWLA 1ZP6A 2NYUA 3TE6A 4F6RB 4R7GA 1A9QA 3P26A 2Q0QA 2FUNB 5E1DA 3S55A 3WWDA 1AQNA 1C5KA 1ZRNA 2W4IA 1LA2A 5BOSA 3CVJA 1TK2A 1G8JA 5CPBA 4WY2A 4YMHA 4Z4GA 2H8GA 3LY9A 1BX0A 1XX6A 2D2IA 5L4NA 1V4VA 2QX6A 4JD5A 2JHAA 3FTCA 4J3JA 1YJCA 2XDQA 2EP8A 4Y2SA 3RD5A 1JR6A 2PLRA 3ASUA 2LCIA 3HBFA 3URKA 3GXBA 1LTQA 1Q91A 5K0CA 5FLYA 2NV2B 2Q7XA 4F5WA 3KSMA 2JZNA 3PLRA 3L8MA 3IBGA 1G8GA 3WLTA 1BS1A 3AOEC 2P30A 4AZ3B 1V4NA 1XU9A 3QEBZ 4BE9A 2NACA 3P71T 3GEHA 3F6YA 3GG9A 4DDUA 2VP5A 1SUDA 1RWQA 5A9SA 4ODIA 4RPCA 2FOXA 1GG5A 4IEEA 1DWPA 1XB2A 2VHJA 3HXMA 3N59A 4HNHA 4TTPA 4GW3A 4FYPA 2H4ZA 3BK1A 1FLVA 1DLJA 1F6DA 3JATA 3LCRA 1DBIA 2YCBA 3EPPA 4WJLA 2GHIA 2QPAA 5DM70 1D4AA 1EAYA 1XZNA 3ZTYA 5L4LA 5LBUA 1M66A 1QIHA 3WKDA 1EJBA 2A57A 3G3EA 4L5YA 4RJJA 3HDQA 2ZIAA 3R7WA 1RPTA 1DX6A 3HWWA 3AI7A 4MDYA 2FPPB 5IX8A 2WM3A 2DTXA 2Z2YA 4IJVA 3NEAA 4TRMA 2EWWA 2DQ4A 4PFJA 2I6UA 3NAGA 2DRIA 3GVHA 3MCZA 3PXUA 4WLNA 1LBEA 3RU3A 2VYNA 3PRJA 4O5AA 3F3SA 4JB2A 1HE4A 5DK4A 5TRTA 5KMGA 5KTNA 2IOQA 3GLHB 1VE3A 4E7OA 3MELA 2EFHB 3A70A 4AM8A 3H8JA 4BLOA 3OU6A 5F3WB 3WQQA 4CR7A 1U2SA 3BGVA 4MRRA 3I6YA 4R1UA 4F84A 5KU1A 3IKVA 3ET5A 1OBHA 5ENVA 6CHYA 3VNVA 4YP0A 3I3OA 5BY2A 1VMIA 1ZCFA 2HYIC 5JZBA 4EIWA 2Z1MA 4HWOA 5HUJA 1KK1A 3K0AA 5AW7A 1XG5A 3X1DA 1TZ2A 2QMYA 5JO0A 1D4ZA 3KR1A 4X20B 3ZBQA 1E1NA 4MRAA 1YFJA 4MICA 3FCYA 4E08A 2O8CB 1OJLA 1ZU5A 2PHZA 2Q49A 3MFQA 3VPXA 2VYVA 1UBFA 4OQNA 1GZSA 4H31A 4NV1A 1R66A 5EE9A 5MGBA 1DAHA 5HM8A 2IEDA 1X3SA 1BGXT 1C41A 1FP2A 5JRJA 3VVCA 5HZGA 4MUMA 3O4FA 4OHCA 3S8EA 3HK2A 2B6HA 1OLSA 4NEGA 4OCZA 4NCXA 4MUIA 4LJYA 4YN3A 2LPMA 1V16A 4BP8A 2V7GA 2V3VA 3EAFA 3GW8A 3O2JA 1EB8A 1Y1TA 4WESB 2GJ8A 4QXOA 2HU8A 3ORQA 3NIFB 2CJFA 2NTNA 4CU2A 3GRKA 1R0XA 2V54A 5JNUA 3RYCA 2JIMA 3OEHA 2O59A 3CZQA 4ZZ0A 2PKYX 3DEZA 3KEMA 4LSWA 2ZRFA 2XD4A 4AROA 4FHGA 1RKVA 2HT1A 1A8SA 1A1SA 2IY8A 5BRAA 1Z5VA 3QX9A 5KWSA 1EFDN 3DH0A 3NDJA 5AM3A 2OD2A 3DW1X 3B8HA 4XQCA 1HK7A 1ES9A 3IVAA 1T1SA 2WT9A 1BXZA 3UXMA 3KOYA 2J67A 3W9YA 4Y0AA 1EGMB 3UWMA 3AGPA 3C45A 5GOTA 1WXEA 3AMVA 4B8YA 3EGVA 1YE3A 2IV7A 5JCOC 2FZLA 2P4HX 1TVCA 4ITVA 4KN9S 2RGDA 5H68A 4NICA 4D6YA 3DKRA 2Z2ZA 4JGIA 4ZYVA 1WRBA 2JGRA 3RREA 4H3HB 4K9KA 4PYMA 4WCDA 4ERXA 4X45A 2GZHA 1Y82A 2VA9A 4K9MA 2GN2A 2ID8A 4LDQA 2RARA 3H8VA 3NTXA 3PDCA 4J03A 2AK3A 2Q9AA 4PYIA 1KEEB 3OO1A 2E1PA 1X9HA 3R20A 1CNMA 4DA4A 4C7OA 3W3AD 4XR4A 3PD1A 1J39A 1Y6RA 1GN8A 1R9MA 2VBFA 2YWJA 2ZIVB 3IRUA 1T5SA 3V5NA 4UEJA 1YK1A 4CM7A 1GZVA 3VTAA 3ND5A 1V43A 1E1MA 3K05A 4S1VA 4ZAWA 3FDFA 4CCAA 1Q0TA 1UOEA 4IEIA 3NEYA 1Z6XA 2FSVA 4ILKA 3LDUA 3I9OA 3NTOA 4D9NA 2M6RA 2ATIA 2QUHA 3AVWA 4EKNB 2JGDA 1A9OA 3DE1X 3OZ7A 2OXIA 1E2BA 4QOGA 3AW9A 1ZMOA 2BT4A 4M8KA 2X23A 4ZCIA 1WIWA 3WV4A 1R0LA 4TX1A 2RMKA 1Z56C 4OIMA 3S5JA 5DSXA 3RJ5A 4MB0A 1U7UA 3OEED 2A9FA 4KN8A 2XQIA 3AWDA 5E6RA 3RC3A 1PG0A 4QGBA 2NU9A 3USES 2ROQA 1ZITA 3DMRA 1PU2A 1OGIA 2VJPA 5EC8A 4BIMA 4NCHA 1X1RA 2FXVA 4OGGA 3U7IA 3TIGA 4P0TA 3WFIA 4HNSA 3DPIA 3NHMA 2FE4A 1J1IA 4FNMA 2JLVA 2EARA 1LPMA 4PYJA 2ZIEA 5LXTB 2J5RA 2VUSA 2EKBA 3BN3A 3QUBA 2DU8A 1HDGO 1KO5A 1FFEA 2IE0A 3EZGA 2ODAA 3OLVA 1QGED 1CDDA 2HPVA 4IDDA 1M1NA 1JDJA 3BYZA 4U9IS 3EBOA 1GQYA 1XPUA 2VHEA 1FSSA 1KPIA 1XWWA 2RONA 4MIEA 2OUKA 4QJBA 5KDLA 1T26A 3AIMA 3OTHA 2WU4A 4ER6A 1BQ4A 4FYXA 1V3TA 4IFBA 3A9RA 1RQ7A 3PQEA 4AG6A 2HKIA 3BB3A 3IQWA 1M0EA 1XVVA 1TYAE 2ASVA 2PS9A 2HCTA 2C7QA 5HF8A 2C58A 4KR9A 1YRWA 2X3FA 1BWQA 4L5JA 4RS4A 1S2GA 1GPYA 2GEDA 2GBLA 4YCMA 1JQEA 4TKVA 1ESMA 1WOMA 2QTBA 4DV2B 3L7AA 4HZGA 3R8CA 1ID1A 4CLOA 1IQUA 3RI3A 4RMHA 5TJ9A 4RTLA 1W34A 3NCTA 2AG5A 1F20A 5JAMA 3AO0B 3MT8A 4GYWA 4UHEA 4AJ9A 2CSXA 1Z29A 1WXIA 3JD1A 3TZKA 5BV2P 1TMKA 1CZLA 3FGNA 1AKMA 2VUHB 2OKGA 1FFSA 3OECA 1ORRA 5B30A 5J2TA 4XUCA 3ZWPA 3O8CA 1QG2A 4B3XA 2F3PA 3DMGA 2FPKA 1ZUWA 5EUBA 3ZQUA 5AMXA 2JFHA 3H6HA 1V39A 3O8DA 3U4AA 4M83A 1ZH6A 2VDKB 2H2DA 2H92A 4QBTA 1KMIY 1JJIA 3W6OA 3INGA 3KOWA 3WMRA 3L1IA 1TKRA 3BRQA 2C97A 1JJFA 3LQRA 1YZGA 4U2FA 2WSLA 3RQSA 1DBRA 3TCNA 1TM5E 2J33A 5TGZA 3V55A 4PN7A 1JZSA 5T7BA 3ER8A 3GZ4A 4PY2A 1E62A 4YX9A 5K0EA 3SFVA 5AOBA 3FMIA 1QOPB 3RF6A 4FOPA 2XNJA 4C3ZA 4V38A 3A58B 4G0OA 5LOVB 1QH8B 1RQ2A 1H1DA 2JL1A 4EG1A 1MB4A 3JSXA 4R31A 4XWWA 1VKNA 1ZIDA 3IMFA 3CBQA 4JNKA 1IL0A 2E2WA 2ODBA 2WU1A 4KR0A 4R81A 3GLGA 4IOKA 1NW4A 2RBKA 1NVBA 2BFCB 3B9PA 1PZGA 1WV0A 1XFAA 2V8BA 3VZPA 3DZBA 4F0JA 5FNVB 5JECA 1EHCA 4NNPA 1P6UA 1Y1QA 2GPTA 2XNDD 3O2NA 4P3OA 1XJWA 2AJBA 3K1AB 4PGAA 4RD2A 2ZYGA 3GRRA 1X86B 3G13A 3R7LA 2PK3A 1RBZA 3UV3A 3JRXA 3B2QA 4R2JA 4NZPA 2OL4A 1VGQA 3EN0A 4PX3A 1F2UA 4GM1A 2NYRA 4MW2A 4NV3A 4ZYZA 4XJXA 2W2KB 3HH8A 1YZVA 1ZM2A 3CHYA 2L0XA 4M6WA 5CDYA 4J7CA 1AQYA 4EJFA 3DM5A 1WHSB 1XYGA 2DBQA 2VXCA 3RH0A 1G3RA 1SOWA 4Q7LA 3ABQB 3KQOA 4EVSA 1TI7A 1RYZA 1JG1A 4Y1RA 5GOZA 4HHEA 3CX7A 3G89A 3T38A 1ECBA 2GS9A 2QUJA 2J6CA 5JMPA 1E79D 3SS7X 2VSOA 4ZQGA 2B4TO 4F3NA 1TDJA 2P6NA 3CKLA 3N0VA 2RG1A 5CW1A 2DERA 4MLPA 1OC4A 1EK1A 1HFJA 3GHHA 1T25A 1TNDA 3I2FA 4JI5B 3E4CA 5FEUA 4PHCA 5H5JA 2BAGA 2EVWX 3FRJA 3EIEA 3I2GA 2YCLA 5FOWA 2FRDC 4NJEA 3C24A 3UENA 2P62A 1P33A 3RHSA 3N5KA 1LY1A 1OASA 2WHPA 4FOLA 1Y4SA 1Z4KA 2QD5A 4KE8A 1PEDA 1PIWA 3MUOA 4QPZA 2Z08A 1V1RB 1HEIA 1NASA 2ZYVX 4Y2UA 4XE5A 1EJ6A 3WGLA 4LF9B 2ZUUA 4R8LA 3T9EA 2Y77A 5TQ0A 4CJXA 1P4HA 3RTEA 3SF8B 3KLPX 4GD3Q 4IJMA 1VXRA 3NRBA 4OU4A 3WFZA 2CL7X 3MEQA 4TRJA 4M98A 1AKVA 3LHSA 4UPDA 1LPOA 1YAJA 1JEDA 1H2EA 1NTRA 4YQEA 2H3EA 4U0JA 3FNQA 2PKQO 3B9QA 1RD4A 1PGQA 3EUEA 3HJNA 5CLIA 3SHOA 2R86A 1B6RA 1BJRE 1N2EA 2R6AA 3MIZA 2XYVA 3A6JA 5BT9A 3V2HA 3ZWMA 1VSBA 3OQIA 2ZI5A 3H5OA 1U5BA 4I6GA 3EXHC 1GUDA 3OWOA 1FYVA 3LQ2A 3TQIA 3UXEA 3TCXB 4G3XA 3WNVA 5D1HA 1UL1X 1VHQA 4QBIA 5AM0A 2QAJA 1US8A 3QFTA 5SYMA 1N2CB 1HA3A 3QEMB 2OVFA 4WZAA 5K3FA 2WMNB 2BEUB 3ZV7A 4WNYA 4OHKA 4EL5A 2FZKA 4XSGA 4JHXA 4FB4A 3KRTA 4XB6B 3V3TA 2W37A 5FAXA 3OIYA 3E6AA 4ISCA 3PCTA 4NXMB 3PBKA 1NA5A 2QOEA 2X5JO 1MJGM 1QQBA 2NXEA 5JS1A 4EO7A 3JQ8B 3N7AA 2V7VA 1JU9A 3A1VA 3QLVC 1D0SA 3VUEA 3B6JA 1Z8FA 3AEUB 1J0XO 4NU5A 2VYQA 4F91B 3VKGA 5I9BA 4I4TF 4CV1A 2OFPA 1K88A 2W98A 3FMOB 4QD3A 3N2LA 2YVAA 2NO1A 4MVJD 3FLBA 1KFCB 1DEHA 1JG3A 1MRNA 1UEXC 2HRCA 3FDJA 3SYMA 3V42A 4NBSA 3BGDA 4JB8A 4J1TA 2I76A 1R50A 2IU6A 3OJ0A 3ZE8A 4DJTA 1VYUA 2GZMA 1NP6A 3DE2X 3R6TA 1BX1A 4TQGA 2V3CC 3TW8A 1IY9A 2WFAA 4MR9B 5F2OA 1IONA 4ZI2A 4CI0B 3GJZA 3JWJA 1VJRA 3W2FA 1T2FA 4LWOA 2P67A 1JIIA 1I5RA 1NV8A 3V97A 1SXQA 1YB1A 4D4IA 1QH0A 1E7YA 2FN7A 2VNSA 1G0NA 2BRUC 5SYNA 1CRPA 4F3TA 2ZYUX 1CQWA 4OXYA 3DNPA 4MLZA 3TEFA 2HJ9A 3DEJA 3IQGX 5I7FA 3VHXA 4CTMA 1A7KA 3EPRA 3PJDA 5IT0A 3CN9A 1RQLA 2QP4A 4V0LA 5LR6A 5C8XA 4LC0A 1MNAA 4LZZA 4UDNA 5E1OA 3U19A 1OV6A 1JA0A 1UBKS 3EPHA 3VR6D 4DRXA 1II0A 4RHTA 4Q1FA 2AOUA 2Y99A 5L3RA 4WL0A 2FLKA 1ZOIA 1ILWA 4N6NA 3GGGA 4I5EA 4W9RA 2FJUA 3E15A 2J31A 3U09A 4AZSA 3TPFA 1G4AE 2LTAA 4JLMA 1NQAO 4AXBA 2XQVA 1N2BA 1NOIA 4JYAB 2PSHA 4MIYA 1SQSA 1K3UB 1C9NA 3AFGA 3PITA 2BMJA 4JUBA 3QLTA 4MWCA 2PT5A 5HQTA 3WGNA 3CLUC 3W8FA 1Z6QA 4MDFA 1EP9A 2GK7A 3WOHA 1U5CA 4QTTB 4UARA 1OLUA 5T3YA 4G07A 3D6FA 3W7AA 1QPGA 3EXEB 3VAAA 3WYEA 1UP6A 3Q6MA 3KUUA 4WW0A 1HETA 3BWEA 5ALNA 5BSHA 4LI3X 4AKIA 4ADSG 4ECEA 2NZVG 5IUJC 1G6KA 4O3FA 4WHMA 3U81A 3K71B 4UNPA 3WLPA 1U7PA 1CQXA 2PQ2A 1L8QA 1P17A 3AYZB 3OG9A 4J7UA 5I8ZA 4BQSA 2UXBB 1N7JA 3GLUA 4L2IA 4BVFA 3CE6A 1BQEA 5KU7A 4MVWA 4RANA 1HDZA 5CAEB 4TS3A 3PHIA 5BNZA 2NXNA 5J40A 4DDHA 3THXB 4E46A 1ZMTA 3EXIA 4QDTA 1UMCA 3GGDA 2BELA 4I6EA 4OU5A 3N28A 2ENWA 3BDIA 4U5XA 1QF7A 2ZKIA 3F47A 1NY6A 3LF1A 3QKWA 4R1SA 3P9NA 4QJ3A 1BW9A 4A91A 4ZIRA 5LDDC 4GXQA 2OZVA 4ZDKA 1CUUA 4XIYA 3QPVA 2OCGA 1CC1S 1UBCA 2G8LA 1X0XA 3REQB 4PIMA 3LQFA 4EKGA 1SKUA 2IHKA 4Q6WA 3SZMA 3TF5A 1J4AA 1KZ1A 1N75A 4OQXA 1OXTA 1Q0PA 3H5RA 4LZNA 1JH8A 4Z3KA 1ZNQO 1Y4ZA 4CM9A 3D5TA 2IIVA 2YQ5A 2ZBEA 3OETA 4BP3A 4DUGA 4E22A 1QB7A 1JE1A 2DX7A 1VJ1A 4WGGA 3AOEA 3W6UA 3FIJA 3LTEA 3ENNA 4EHIA 1SPXA 2EEZA 3P94A 3NBMA 4H77A 4QUJA 3FYTA 1A9ZA 4OA5A 4GPBA 4ZVSA 3VDQA 3OIFA 2VJOA 3NC4A 4M3NA 1CJUC 3IIIA 4MS1B 4O4JF 3B53X 4AQYB 1M1ZA 1P0CA 2PGLA 4O0LA 1JEOA 4CCWA 3GJ6A 5CVVA 1E9FA 2ZSBA 4B31A 5EWJA 1G6OA 4PNPA 2HA6A 1K9VF 3LDHA 5BN3B 1Z5UA 3BERA 3H83A 3F8SA 4E5VA 3GXOA 2XE7A 1EH5A 1E8MA 3KQHA 4REOA 3M3DA 2G83A 4TTJA 4QM6A 2X2OA 5FBVB 1SBNE 2R68A 1KZ7B 2O8VA 4JR2A 4Y2YA 2UZ0A 3U62A 2ZRGA 4MYSA 4DV7B 4HB4A 4Q5IA 2AS0A 1KAHA 2CSUA 2WF7A 1SXJE 5T67A 3D2AA 5CA1A 5TPWA 3AFMA 4O02B 1OX6A 5A1JA 3GPCA 1ULSA 4CL8A 3HO1A 4WBNF 4Q34A 4G0VA 3LP6A 5CFZA 4CQMA 1ZDMA 2RHTA 1U0JA 3HR7A 4TVOA 4WUVA 2NM0A 3AUJB 3IPLA 4YQZA 1ZC4A 2CWDA 2QEQA 3FNIA 4RETA 1LC0A 2WJAA 4FFNA 3PEUA 1BGVA 1KK3A 1P80A 1FMFA 3PQ2A 2ZIGA 3RU7A 4BO8A 4M9RA 1XXHA 4QDKA 4X54A 2R44A 5K1ZA 5AVWA 2C31A 2C7OA 2P7HA 4MKRA 4P1ZA 1O2DA 5B36A 1IEQA 1GA4A 3V2GA 3OTOB 5JSKA 4LYJA 2VTBB 2PWYA 2QTNA 2RHJA 1JLRA 1V48A 3ZXUB 2XB6A 4EG8A 5F64A 1H93A 2PL3A 2QAIA 2DFLA 4ND3A 1FLNA 3RSZA 4HXGA 3OH8A 1N7GA 4CKEA 3AUXA 4MVJG 1NF2A 4O2BB 3WWYA 1BN6A 2Y1EA 3VNAA 5CBPB 3KJHA 1L4LA 5D3ZA 1W96A 1PJZA 1UDRA 4LDPA 4UBNA 5LLTA 1J25A 1CX9B 3TNDA 5EP2A 5JJLA 3C6XA 4EHDA 4MWEA 3T7JA 4LZOA 2IEAA 1G20A 1Y6JA 2DUUA 2PL9A 3N0RA 1BMDA 3FMPB 3ZLVA 4XWYA 4CLRA 1FFBA 4KW7A 4RTNA 4RQUA 4BKRA 4NCAA 4IHKA 1YKFA 4M0MA 4K6HA 5F98A 3ABIA 1ZINA 3KFVA 5CB4B 1FVHA 1EX1A 2R6DA 4RVOA 3O2SB 5FFFA 1VKZA 4FE7A 3PPVA 5ISMA 1POWA 2YIMA 1C9JA 5JDCA 1VE7A 2HWUA 3IAUA 2VQSA 3O9ZA 3W2EA 2K7FA 3DKIA 3E8MA 2O1EA 3P9SA 4WY5A 3E03A 1BD3A 1Z36A 3CLTC 4KN6A 4AUKA 2K2QB 3K0KA 1HDEA 1W8IA 1DJNA 4RHXA 5JCOA 4CIWA 1EX6A 1QX3A 3GVIA 1KH1A 2D0IA 4HNVA 3NMUF 3WDSA 2QPOA 2J9XB 2YJ3A 1XE3A 5EEHA 5EUQB 1ZEMA 1Z6TA 3AEQB 3JTEA 4MI9A 2XX3A 5EHGA 3AP3A 3RHFA 3V00A 3D4BA 4BJHB 2HHHB 3C14C 2A67A 3PNMA 2BTQA 4DIKA 1M2OA 5A4AA 2MSKA 2WTEA 4FHEA 4AXXA 2B4KA 1TUBA 2Y0CA 2KBFA 2DXIA 1YDEA 2ZTLA 5FPPA 4B3FX 1KYTA 2FQ1A 3L8FA 3W8DA 3CBGA 4O4HF 3CF0A 3HUUA 4ATNA 1UFOA 3JYLA 5HYVA 3OLCX 2YTZA 2JFFA 1BG6A 1YVPA 4IIJB 3DTVA 3G5UA 3KUKA 5ALQA 5C0OE 3WO0A 1HMYA 5F3RA 3VO8A 4JKOA 5BSFA 1QVZA 1AGPA 5JHGB 3HJRA 5EINA 3ZLBA 5AM2A 2VJMA 5H4GA 4PHGA 4RESA 4MW6A 1SBHA 1Q7CA 2IY9A 3ESYA 3GNLA 4FYIA 4D0GA 3G85A 1AQJA 2AC2A 4Q4HA 2GN9A 4I55B 5FWXB 2JBHA 1R6AA 1YB2A 1YGPA 3H11B 3EH1A 1CQJA 5DXJA 4BNVA 5K8VA 5H9WA 4P54A 1ZW6A 4XDYA 2A9OA 1QQTA 5I5EA 2WZCA 4E6PA 1WPRA 2BP7A 4RYLA 1SVMA 1ZL0A 4OJQA 1RYYA 4POAA 3DVQX 4Q7JB 2X9GA 2OK7A 1QV7A 1CXZA 2QUBA 2Q8QA 2HZ7A 3BTUA 3CKMA 3MRSA 3UFBA 1QUEA 1QMGA 2ZBGA 3PC6A 1X1TA 3Q0IA 2CDAA 2ISSD 3BMXA 3ZNPA 2E85A 3KQYA 1S2LA 5LDGA 3FCUB 3SJUA 4HEA6 4INZA 2FN3A 4OM7A 2QR5A 1OYOA 3CO5A 3TFWA 4YR9A 2Y1WA 1C7QA 1SXHA 1MO2A 4YK7A 1ZM9A 3ECCA 4XVCA 1X42A 2BH9A 3M6XA 3TOXA 1R0WA 4GOKA 1W93A 1X3LA 4KQFA 2LD4A 4OQ4A 2QD4A 4PPFA 1N2HA 2UYCA 3F74A 3JD3A 5LYJB 1Q0UA 2C7BA 3S7TA 1KERA 3BEOA 3I9FA 1GZ6A 3W06A 3QV2A 3W6NA 2G08A 1DG1G 2BJWA 3JRNA 5GTDA 4JLSA 3V9AA 1CS0A 3TINA 4LF4B 1BHJA 1UBEA 1RAEA 4J1SA 4AAYA 2R5FA 2QN9A 4LRUA 4OUDB 3WMEA 5C32A 5DNWA 4BV2A 1KS2A 4MH0R 2R1VB 3U7RA 1CUAA 1DXYA 3D3EA 3L41A 2HA7A 3A4VA 2YX1A 2JLRA 3U37A 3IODA 2J3JA 2J5QA 2B2XA 2PWPA 3P97A 4LSMA 3T3HA 3BGWA 1XEWY 3CMCO 3L8CA 4EOGA 1RMQA 4YRRA 4Y2XA 2FWMX 4LBYA 4YIKA 4RV4A 5AIAA 3EK2A 1ZICA 2X8AA 2ZWPA 5J3JA 3OCVA 4C7BA 1OYYA 1P1HA 3RDPA 4FCCA 3R4CA 2VL7A 5HBRA 3FFTA 1IC6A 3BXPA 1XGKA 2GBFA 4PFSA 5AJTA 5JUWA 1WBBA 1M6NA 4U9HS 5L7TA 4HLDA 1QH1B 4JZYA 2AB0A 2DLCX 3WRVA 3FZYA 1Y1LA 1SHTX 3FR7A 1UP4A 2C5AA 2V4MA 1UCFA 3KCQA 4ER7A 5IDXA 1F2VA 2XWQA 4MR7A 4EFKA 1Z34A 4ZVMA 2CL6X 4L6CA 2JA1A 4CFYA 4F71A 4DR7B 2P3OA 4HWGA 2BI4A 3TVYA 1JXOA 1K4MA 3EHDA 3I04A 1WVIA 3JVEA 4JYMA 2PX0A 5DN6D 1V3UA 4TXLA 2OKCA 1N0UA 2VDVE 5HUQA 3DV9A 5L45A 1E7RA 3EJ6A 1T1IA 3B2NA 4TM7A 4LQLA 3ZQ6A 3I0MA 4Y2HA 1R8SA 4M0CA 3WWZA 4F1JA 1B16A 3RO7A 4ND7A 1AKYA 2VNAA 4YA6A 4M99A 1FU7A 4BMDA 2EJWA 2ZSIA 4KQCA 1QDUA 3GWGA 3O26A 2DULA 3F6SA 4P22A 3AM4A 3VYWA 2JBAB 3L7CA 1L1EA 3PDUA 4TN1A 1Z75A 3M6IA 2O5CA 1UEIA 1WB6A 2ZBPA 1R5NA 5IAGA 4B3JA 2QE7A 4N0MA 1UMDA 3JQAB 4RVFA 2IA5A 4RCYA 4B4OA 2C9CA 2G5GX 2RKBA 2H51A 4FMCF 1P0IA 1W9HA 1SBIA 1OT5A 2ZPAA 3L3BA 2OHJA 2UZ1B 2VWPA 2W2NA 2DQZA 2YIJA 2G76A 2IHJA 3C16C 5H83A 1TU3A 1F8GA 2JFZA 3CRVA 1R8JA 3ZGNA 3TRKA 2NZ2A 4X65B 1D2CA 4PYNA 2E4XA 5AUPB 4BXOB 1F2TA 1UDBA 1HYEA 3MOSA 5BW4A 1ZSVA 1T9CA 1X39A 4XVHA 1ISIA 2NU8A 3EXFA 4KU4A 1U0BB 4CG1A 1G8HA 1FNBA 5ESDA 3A28A 3LXXA 4DRZA 1AU9A 3HZOA 4HDNB 5IK2A 3RB8A 3O84A 3KSDO 4B2LA 2EQAA 1N9ZA 5ITZB 2FRDA 1YVUA 4DN6A 3PFWO 4QDJA 2WNSA 2RB4A 1PEAA 2AMVA 1K2WA 4TLBA 5J9FA 3SR0A 1BXRB 2CBZA 4D9MA 3ND9A 3PUHA 4HN9A 4PX5A 3TKLA 2X9NA 2WBLC 2ZSAA 3CV3A 5HP4A 4TWBA 4AIIA 4AN1A 1W581 3UGKA 4Z5XA 2A3RA 1SK8A 3GB9A 4K8RB 2W43A 4YBZA 4E13A 2NVWA 4J0DA 1MJFA 4PPYA 2BGKA 4OLHA 5FTNA 4UDXX 2IUFA 1AQLA 4CHTA 2C4KA 1JZTA 4AWBA 2VF2A 1DXOA 3I2KA 2DLNA 3ELUA 3IR6A 3F46A 3IUQA 3T0IA 3UKOA 3ZIUA 1TFRA 2MSWA 1VP3A 3H2SA 5ALSA 5ICCA 1CR0A 4IJKA 3ESXA 1VI6A 1SUWA 4TMXA 1VPDA 5DP1A 1TPZA 4YONB 1HQDA 1FQKA 4M49A 5J47A 4PQGA 1P5HA 1SOVA 2QD2A 2QLNA 4D0NA 2YR0A 3K20A 1WJGA 5L3ZA 3EXHA 1WULS 3DTNA 3PNLA 4KK3A 4DR1B 2JA2A 3ADCA 1N1GA 1Z2NX 2QUAA 3QUCA 5FL7D 2ZR8A 3TX6A 3MD0A 1NW6A 2JJ8A 2RH4A 3UHAA 4HKTA 5EIAA 4X64B 4R1OA 3RGWS 2R6CA 3NC1C 2QTHA 4M89A 3MCVA 1DAFA 2HR1A 4PBSA 4W5NA 3WRWA 5ELXA 1Q0QA 1QJ4A 1P1KA 5FA5A 1VSUA 4WA8A 1Z0JA 5B7NA 4JC8A 5KJFA 3W79A 1P81A 3EF1A 4AK9A 4UD6A 3BXFA 1K6IA 3GNTA 4MMZB 3UPDA 4DCUA 2GNPA 1MOPA 2OSVA 2RGNA 3BFXA 3Q8XB 1C4XA 3BF8A 4INAA 4P2GA 5AHOA 3NIGB 4KGDA 3KU1A 3V8RA 1LBIA 2XITA 1UJ6A 3LDAA 3QLVA 4IDNA 2J45A 2OGZA 1RLIA 3DE0X 4GVLA 4YAJA 5DE3A 4UCQA 4PZEA 1Q0SA 3M34A 1KQFA 3K32A 2W9XA 4M0EA 5REQA 2MSDB 4L4SA 3ZVLA 3OURA 1TC2A 3IBTA 4KYUA 2C2MA 1N4DA 1Y4AE 1RVDA 2QD1A 4IO0A 3DJYA 2Q62A 3IV6A 1C8KA 3VYRB 2N1BA 1ABBA 4ND2A 1LK7A 4B35A 5MN6A 4KRXA 1TEXA 4M87A 2I03A 1AM4D 3U7GA 1EFAA 3DF9A 3WC4A 5KYNA 3KV3O 1RIFA 3AR5A 3GRFA 1S2OA 5JRZA 1XP5A 1EFPA 1UFKA 2J0EA 3EPLA 3IDZA 1M8GA 2A0KA 3VU9A 4LJSA 4KRGA 4LXQA 5EKUA 4CF5A 5BOVA 5HIAA 3DXFA 4XVQA 2BRUA 2HIAA 4ZO6A 4OREX 4A10A 3PLAE 3QITA 1TUIA 4RHCA 4M1QA 2KWIA 1H9AA 4LKOA 1TUGA 1Q14A 1U2RA 3CNHA 2WKRA 3U7HB 1OX4A 2FWJA 3K35A 3X2EA 1CB0A 3LCMA 4JODA 2G3YA 1H65A 5FFMA 4XUDA 2AX4A 2IW3A 5KYYA 1I7PA 3TDNA 3TTSA 1JECA 1X6VA 2ZE8A 4HYTA 1RRPA 2R4TA 2QMQA 1FNSA 3IEKA 4BU1A 3RGGA 3DUFB 4ZZ1A 3PI6A 1RZUA 1SCNE 4BRSA 4AP5A 1LWOA 3ISTA 3TSOA 1LK5A 2KHZA 1ZGGA 1V2HE 2OHGA 1VHWA 1ECGA 3L9WA 1FQOA 3DAPA 2PKCA 3F90A 1N4AA 1FFYA 2I65A 5FJIA 3BSFA 2XPCA 1KOLA 3JQ9C 1N9GA 3O8RA 3B51X 1NI3A 3D6UA 2Q3EA 4E3WA 3D8BA 1WO8A 1OR8A 1MT0A 3ELYA 1PWXA 1SKAA 2C88A 3PNYA 3LT1A 1VHJA 2EKPA 1MBZA 3MF4A 4R41A 2Z8XA 1PTKA 2IFTA 4TWAA 1DUVG 2CXTA 3CX8A 3GJ3A 5YASA 4DHEA 3LQ1A 5EE1A 1OH7A 3ZHOA 1RYMA 3TTYA 2R62A 3DB1A 3STTA 3F5MA 1N8KA 2X4DA 2NT4A 4EATA 1GPWB 3S7ZA 3FTPA 4AJKA 1R3DA 3QTLA 4JBGA 3NH9A 3PFKA 3W1EA 4ZP1A 1M0TA 2ZP1A 3PXEA 4NPCA 3RE1A 3WAKA 4NAVA 4A92A 4EI2A 1KL7A 4HGRA 5HKOA 5AXBA 2FFBA 1FSZA 2EU8A 3SC3A 4PGGA 2R3SA 3BFKA 1L4FA 4RLSA 1AXRA 4Z9XA 5LD2C 1ZJZA 3KYDA 2ECOA 5FI0B 3TSZA 1DFIA 4GC5A 2DY0A 2EZ9A 3DONA 1NVVR 4TZTA 2QN6A 3CVYA 2OFXA 1SRQA 2OK8A 1EJ0A 2XUPA 2AL7A 1ST3A 1XAHA 1Y9DA 3B3AA 3Q0EA 3TSYA 3CLSD 2WIDA 4YUZA 1PFWA 1CZOA 2C2GA 2D2XA 2X0RA 4H7FA 1NLZA 4HC4A 4K6KA 3V1KA 2NXWA 2B5VA 3GUZA 2OO7A 2JJ1A 1G5FA 1SQ6A 3HCRA 5EIBC 1MIOB 1S8AA 3NETA 1ZK2A 2IEIA 5LXTF 1OAOC 3ET4A 4MHOA 3FWHA 1BOOA 4IDGA 3BXGA 4BFVA 1A8IA 4AY2A 1U31A 1JAIA 1D9XA 3HBJA 2O1SA 2QVBA 3CGWA 4UREA 3UJBA 4AN4A 4EGQA 4IF4A 1MV8A 3ZVKA 3THWA 2J7PA 1ACMA 1XZPA 5EHZA 3RT9A 5IJ9B 1AY0A 4YJ2B 2M1XA 3RVDA 1W6UA 2VZ8A 4G8JA 3QX7A 2NUTB 1BZYA 1QAOA 4TLCA 3HKBA 3PQFA 5HFNA 3VU0A 4ZYLA 2A5FA 2EX0A 1MQ9A 3DXYA 1BE8A 5JVDB 3RWBA 1R18A 4BVJA 4D74A 3BD8A 1XU7A 1WEHA 3VH4A 1VPVA 5E2BA 2BJVA 1SEPA 2IOFK 4ACAA 2IOFA 3RLFA 3VGPA 4B4WA 3A3PA 3CZ4A 5BRNA 4F4DA 2XVMA 3KR9A 2I34A 3KU4A 1CHDA 3T6KA 1U8CB 3TI9A 4GYJA 4YRSA 3OUUA 3NOQA 4N0QA 4JI3B 5TQ2A 2CZGA 1GAEO 3C7DB 3N58A 1RIIA 1NR5A 1RHMA 3JXEA 4CLHA 2R96A 1FRNA 1AB6A 4ZXFA 3WLJA 3KZMA 4HYQA 5JBIA 3FB1A 4TYYA 1TAGA 3B52X 1GTMA 3BB4A 3KZCA 3FGOA 4I5DA 1E1CA 5C4IA 2W42A 1N2XA 2NG1A 1N8SA 4FFSA 1GL6A 3GAMA 1J97A 3KL2A 4C89A 2XWJI 3MTAA 1Z83A 3ABOB 3RSGA 3D31A 3B6EA 1SNYA 3DT6A 3LZ6A 3UK2A 1Y8QB 1DMSA 1ND6A 1R4MA 4UU0A 2XLCA 3H87A 3W2HA 5F2NA 1QO0A 3ZVNA 4KVGA 4M37A 7REQA 1PSZA 1JYEA 3BGIA 4ZQFA 4ALKA 1SC1A 1XU4A 3BMOA 3INYA 5LP6C 3R2JA 4GRDA 2EBHX 3PLNA 4HGPA 4MB6A 3IP7A 4X1IA 2Z5VA 2OESA 1O9GA 3Q7TA 5ECWA 4A0QA 3FCAA 4HDQB 1OPRA 2V6GA 2OP0A 4YJ3B 1Z68A 3RS7A 5BSKA 2ZUCA 4YCDA 5LOVF 1RKUA 10MHA 1XTJA 2BW0A 4J0QA 1EIZA 1UKAA 3OPVA 4XYMA 3GPIA 1DV2A 1V3VA 3HN6A 1SQFA 3N2KB 4N3CA 4QGHA 4WCVA 5MDHA 3F67A 1C1YA 2XA1A 1A2KC 3SR3A 1VRCA 4WZZA 3T4EA 1NVGA 4MP6A 4P98A 2ZI7A 1PJRA 1GZUA 1K5PA 5BWCA 1AUXA 1Z6YA 3A1CA 1VCNA 3SDZA 4CIBA 4MPRA 4YRBA 2W6JA 3A05A 1J70A 3IERA 4IVPA 4KGZA 2REBA 3DZGA 1NN0A 4IEFB 4B7XA 5JQGF 2R1TA 1P2UA 3ZWAA 1QTNA 1Q0RA 4KIFA 1DQSA 2WYVA 2H5IA 2HV9A 3MWGA 3NYIA 2PRKA 4RW0A 4XWGA 3LKDA 2XUHA 1C30A 1NW7A 3QXHA 4KIUA 4QPNA 3CONA 3MWDB 1P1CA 3DCYA 3ZCSA 2Q0SA 4JENA 1L5RA 4WIAA 1UKZA 3ICVA 5CFOA 4DQDA 3H13A 4EB6A 4E7PA 2CXOA 1Z4NA 1YCDA 2A1UB 2C5EA 3FJYA 3X44A 4TVSA 1RJGA 2D1QA 3JALA 4EHFA 4BFSA 3GI1A 1E1DA 3ISJA 4BVGA 2AJDA 2JFUA 2CYCA 1COZA 4LIPD 4Y2PA 1O6FA 3CVVA 1KXZA 1V96A 1NW9B 4BN0A 3TL2A 1IUPA 2NAFA 1SXJB 3LBFA 1NLUA 1ZIYA 1X1BA 3D6HA 5C52B 4AKHA 1SA0B 521PA 4BO6A 3AVUA 3B3JA 2HMSA 4GYKA 1WWKA 1XKQA 3VHRA 2IYFA 2K2WA 1FW8A 1CR2A 1JL3A 4PLHA 5FJJA 1NIPA 1ZXBA 1PV1A 3FBWA 3FTNA 1ESCA 3QOYA 3I2JA 2QW1A 3OZEA 2H2GA 1AV7A 4L0MA 1MU0A 3R9XA 4Z2AA 2HPHA 2H57A 1E6CA 2IBMA 4UFOA 4DRYA 5K6AC 4D3SA 5KPDA 4AF6A 5DDIP 3QFRA 2V7XA 5HIJA 3JWPA 2D54A 2GF2A 3CLRD 3L1UA 2VTDA 1I9CA 2ZLBA 3FOAA 3PGXA 3VSAA 4CN8A 4YJFA 4IL5A 1SIOA 3DMHA 4EG0A 3F4LA 1I7QB 2PXAA 5MHTA 4AY5A 4JI6B 3AM1A 1OPXA 3ENWA 1EX9A 3FPCA 3H2BA 1SELA 4YMTA 5CVTA 1G55A 3NTLA 2JD1A 1XQ6A 4ROTA 1J49A 1YQXA 1A9RA 1J24A 1JFFA 2F00A 4L9SA 5FULA 4E1BA 2PMDA 2C9OA 2ID4A 4MJXA 1XNJA 1ENYA 1FTSA 3ONDA 2R6GA 3UHOA 1T1RA 2ZZNA 2QTVB 5DBEX 2AN1A 5FF9A 3H84A 1HG0A 1CR6A 3K9FC 1R15A 4KNWA 4XIGS 4FSXA 3MGAA 3U3DA 5AW3A 4FJ0A 1IH8A 4AG3A 5C9ZA 3EZ9A 2IX9A 1KBOA 5AK3A 2HM7A 4BVHA 3DOJA 3T34A 2ZM6B 4QXAA 3IV9A 4YP7A 3NG1A 2JHPA 1GFWA 2C4WA 3OESA 2PSJA 4PZ9A 2O1WA 1B0PA 3IGFA 4XGRA 4Q1CA 1FZTA 2FDXA 3JASA 4FHDA 1N9KA 5ALYA 3KUCA 5BN4A 3PUKA 3TL3A 2DTDA 1GTSA 4Q3KA 5GV8A 1O58A 3KP1A 2ONJA 4EGCB 3EC1A 1QGUA 2C5GA 3GEBA 4LCBA 3V7WA 1SVOA 4J0CA 1VG1A 1U2GC 4FBLA 5TMDA 4YFYA 1NN3A 3T35A 4OQDA 5KC8A 1YKGA 1M2NA 3MWKA 3G79A 5IABA 5JS6A 1YUNA 4MUAA 1L6IA 2ODNA 3FGZA 5JCPA 2KI5A 3MD9A 4L57A 4J0IA 3ZCXA 1IZ0A 1E3EA 1NN5A 4UMFA 2B5WA 2GCOA 1MNQA 2O2DA 2Y27A 2O8BA 2DJ5A 3KDPA 3YASA 1EVIA 4EYQA 3AXTA 5H3LA 2FPSA 2OAEA 2WY2D 2EF0A 2JG3A 3EIXA 4BEJA 2IUYA 3EA0A 2YHBA 2KLHA 4X1YB 2VDOB 5D8DA 3U44B 5AVKA 4DCNA 2XGGA 2PL1A 4WK0B 1AE1A 4Q47A 3RS3A 3PKZA 2QBYB 1FFXB 4E30A 4ON9A 1RKBA 3K70D 5ITWA 3TQRA 1GAXA 3A9UA 2JCXA 2PUHA 1Y6GA 3UMBA 3AILA 3TD6A 3IP1A 1CPYA 3P9YA 4WOBA 4M7OA 3RSQA 3EIHA 5JSZB 3WOVA 5IYZA 5MFPA 3NHLA 5EPOA 1I2AA 2ZTMA 4YCBA 3WRXC 4BHTA 3SM3A 4CE6A 1NDUA 4OHYA 3OPYB 3SSAA 5K8UA 3WGTA 3MBOA 1KS9A 3B20A 3PCRB 4PNEA 5BR7A 4UTPA 1EFVA 4OXKA 4MI6A 1Z82A 5B1HA 4C30A 1Q2XA 1PS9A 1MAUA 4QVIA 4WLEA 5DI3A 3UXHA 1OZAA 4G5GA 4LJKA 4Q3OA 1W87A 1NFFA 1RJWA 1TD1A 5KTMA 4A2WA 5LUAA 4Q1DA 4D98A 2H0QA 2IYVA 1ZRMA 1JG7A 4X1OA 2WW8A 2PD3A 4IXDA 5AT1A 1W9MA 3BE8A 3ZI4A 4BLTA 4HGYA 1WR8A 3F9RA 4P33A 3F9IA 1KNXA 2P9GA 1GUZA 4G1UC 1EUDB 4N5NA 3I05A 1VPLA 1DX9A 3U3OA 4LYFA 4RK0A 1E5LA 3CO0S 5LIPA 1YFLA 3G0OA 1N77A 1J9EA 4W1PA 4KDCA 4NZ9A 1AV6A 2AFHA 3FPGA 3OOSA 4MYDA 2W2LD 4AL4A 1QHFA 3O91A 3Q5DA 2GWHA 4KIGA 4QNNA 3QVGA 1DQYA 1T3HA 3H8WA 4A82A 1VLZA 4R2LA 2QX9A 2PBLA 5IJ0A 5IUNC 2MWMA 1QHEA 2OENG 2QNRA 1ZIXA 2YOHA 5LQUA 4HDRA 5FBRB 1P44A 4D4GA 2I80A 6REQB 3KQVA 2BR3A 4WQMA 5FR2A 5BSWA 3ZXIA 1DJQA 2DT8A 2A5DA 2Y1OA 3G17A 3HQ4O 1DGQA 3RM3A 3MM4A 1WB5A 5CFPA 3IMEA 3DZDA 4MV3A 5KNDH 3KFXA 2XZOA 3JYPA 4NE7A 3LQYA 3SSMA 1P31A 1VCMA 2OOKA 2ZOSA 3OE7A 1KOJA 3E8SA 5BSMA 1E1QA 3MIIA 2JC3A 4P7JA 1TKBA 5AJHA 3HU1A 4LZJA 4UJ3A 3BIFA 5CR9A 3NDBB 3M9LA 1TJ4A 3ZWBA 5JI3E 3LX8A 3LC7O 4D3DA 1W6RA 1P7ZA 1XF9A 2W48A 3ANTA 3T99A 3G2LA 4OHFA 1M2VB 5HS4A 4TTVA 3LC1O 1M6VB 4QSHA 3CPEA 2OCIA 2C2WA 1L5ZA 2WJHA 3KSBC 2BM0A 5DNEA 1JI0A 2PMCA 2ZE7A 821PA 2OWEA 3X1KA 1B6GA 1Z47A 1JKMA 2HIGA 1JSXA 2IQIA 2Z3ZA 1JTVA 4LOJA 2AE1A 4MUEA 3UC5A 2YDYA 3VDNB 2AEEA 2YJ6A 3BD7A 5ECGC 1RMTA 3NKLA 1E7SA 2IT1A 2R1ZA 1XCPA 3C5VA 2B7LA 3DFIA 3KDSE 1GG8A 5F4ZA 3NEJA 1E5DA 2AK2A 4TRRA 4JXKA 3VAZA 5AXCA 2HL6A 4XGIA 2NP6A 3FLAA 1BYIA 3E82A 1PQUA 2X1HA 1Z3CA 4GYYA 3K9WA 4DIDA 3OEWA 5EL0A 5LSAA 3PSAA 5D5QA 4HAVA 2GDZA 1WZUA 3O73A 1Q74A 5DM1A 2GM3A 2VYND 1E3WB 1ZK1A 5J23A 2C20A 1OXMA 2RIPA 3T5PA 3GN1A 3G5LA 1L5WA 4DSNA 1U1FA 5JNWA 2QYHA 2JGLA 3HO8A 1UPAA 5IKXA 4XFDA 2XNHA 4F4IA 2WSIA 2WFMA 3JAWB 5C1IA 2FK7A 2W4MA 3STUA 5CLGA 5ULLA 2IX3A 5KYXA 1HNZB 4NSNA 1XMPA 3WAGA 3H65A 1MQSA 1IZ8A 1NVMB 4K05A 2YRWA 2VQ3A 3G0GA 4GE0A 3UH1A 1QK4A 4X6YA 3KYIB 5FUVA 4DCSA 3ZDDA 2V6IA 4NBRA 4OGFA 4PONA 5B7QA 4DLUA 1J2UA 3S68A 2VYVD 1QHGA 3Q2IA 4FB5A 1C7RA 1SU8A 5GINE 1XRQA 4MINA 1CCWA 2JI6A 2OP1A 4EZEA 5H16A 3WYCA 3DE4X 1ZBQA 2C2XA 4F21A 2WG1A 5B6JA 2QVCA 4L8LA 4O2BF 1F06A 1HLGA 1KJIA 2Q46A 2ONZA 4KUEA 4TMYA 5KINB 4ABTA 3TQSA 1N8NA 3IX7A 1YJ5A 2G1JA 1RZRD 2NU7B 3OEHD 2G63A 3WNCA 5DGHA 4F8EA 1N6IA 3SZRA 3T41A 3LYUA 3MSCA 1T8UA 4C21A 2C0QA 3ADKA 4G65A 1JYFA 1JIKA 2W8ZA 1ZUHA 3IP6A 4D9GA 4W5OA 3HVUA 1U7HA 4KREA 2QM7A 1AGRA 2PU7A 2VUIB 3L6BA 4RHEA 4KOEC 1KRWA 5IAOA 5CB4F 4MKGA 2NYVA 3BK7A 1O5TA 4KP7A 4V0MA 1HFKA 2HA5A 3L79A 3S2IA 2WTBA 3J7AC 1A1VA 1NI4A 4UNSA 4PLGA 1U28C 2AOTB 2JIZA 5G0UA 2FWPA 1ZXXA 3RK1A 2V0NA 4M0DA 1XDWA 2ZR9A 1UK6A 4GXTA 4N5MA 3JTMA 3WG9A 1VSTA 3PEYA 4LC1A 3LUBA 4J94A 4JOCA 4FZ5A 4TXNA 2PX2A 1E6WA 3OOYA 3PWZA 1E2GA 3R09A 5J2UB 1UM9A 4PVCA 2A1TR 3ABSB 3IXLA 1OIVA 3JQ9A 3NHSA 4LJLA 3CKYA 6PFKA 4G4IA 3PTLA 1ZYUA 5F21A 1Z4PX 3KQMA 4D0SA 1M1YA 1QFYA 2IYAA 1RI1A 4Q9HA 5EIFA 4B44A 2QTFA 1N5LA 4BO0A 3GVCA 4D8VA 4IJQA 2UUOA 2WEKA 3K4PA 2NSDA 4QIHA 3E9RA 3C3EA 2FZ5A 1GNTA 1UC9A 1PZNA 3GJQA 2AXNA 2DKNA 1YE8A 3TW4A 4IWXA 3WL5A 1MGOA 4YHBA 2CLDX 3IAFA 2WUDA 1QXSA 4XTRA 3RU9A 4NTZA 4A73A 5A4KA 3LF2A 4AU1A 1R6BX 5AVXA 1NOJA 2FLWA 2X5OA 4HEJA 4XQEA 3SIPA 4AMVA 1YFZA 4YXFA 2WJYA 3QWBA 1ZKDA 1Z26A 1G291 1KC1A 2C82A 3BJRA 3BWYA 4CMKA 1QCYA 2OXFA 2AZ4A 3JQ6A 3PKJA 2RGWA 2H85A 1CY2A 3QYFA 4ZVPA 1W19A 1XKXA 1MAVA 2YVKA 3AR3A 3HXKA 3QX8A 4XVUA 3WHKA 1J2YA 3AIKA 1O6ZA 3EDOA 3W2TA 3L49A 4I55F 4B45A 4DG8A 2UUBB 3HKEA 4OQLA 2H31A 3GP3A 3I42A 1FFDA 3WGZA 1XDZA 1GRVA 2AF3C 1OAOA 4LE2A 3OCXA 1JXQA 1KEPA 1T5TA 2OBBA 3HC7A 1VB3A 2G28A 4I1UA 4UXIA 4X8LA 4CNQA 4DEVA 4RNCA 4YB8A 3HJAA 2C9ZA 4B4UA 3QPAA 1NBMA 1S3FA 1E3JA 4DJ5X 4CL2A 1GR0A 3I1YA 4I46A 1SHJA 1IY0A 3PXGA 1YQEA 2Q1SA 3U40A 3OIWA 4JKYA 4LDRA 3GR6A 4X24A 4CZ2A 1Q3KA 2UAGA 3NBKA 1QZXA 2JW5A 1L7QA 1YXMA 4CIDA 1LJ8A 1UZMA 4LYDA 2Z3WA 2CLCX 4FMPA 2O8NA 4LG1A 4UAJA 4BLUA 1P7VA 1CUYA 3KUXA 1L7RA 3MGGA 4LNUA 4LXYA 1FQJA 3H0KA 1XK7A 3MT0A 3VSBA 1LC3A 2J4FA 4B4DA 3BT7A 3TW0A 2RKWA 2V6JA 8ATCA 1GLVA 4IQ8A 4OXRA 5LYJF 1Z15A 1SEVA 1ISMA 1KO4A 2NZJA 3GNSA 3KEOA 1JDBC 3L7JA 1G9TA 1JVBA 1P2BA 1RTTA 4NBTA 1QVRA 1G8YA 5DV9A 3SQOA 4LY9A 1OB5A 1DCKA 3PHHA 5KTKA 4LJ8A 1X92A 4YLGA 4MA0A 3T7AA 4KV9A 1R8QA 4QEKA 3ZE7A 1XD2B 2LV8A 2YASA 2HLDA 2GYWA 3RRMA 1YBMA 3QA3E 2HEIA 2QHXA 3OPMA 3DBIA 4QRIA 4TQUS 3R1IA 4YACA 3LBYA 2XLBA 1YH3A 3FX2A 4IW3B 4C3UA 1WZCA 2QXYA 3GFSA 4NYMR 4A2CA 4HAIA 2FSGA 2ZYWX 3F8TA 1B8OA 4L50A 2ZB4A 2V55B 3ZWCA 4ZQIA 1KVUA 5F51A 1L7EA 4BFCA 3H75A 2PUCA 1W0JA 2QLMA 4B8WA 3FNEA 5FUBA 2BGNA 3D3WB 4G5YA 5DOVA 3RBZA 1JU4A 1AO0A 2TYSB 4P4SB 1GL7A 3OC6A 5H81A 4EJ2A 1MAHA 2QSUA 3G7UA 2WWXA 5DRTA 3QFHA 3JS5A 3N0TA 4US2R 2XXAA 4RK4A 2OBLA 3A6DA 1VLJA 3O8QB 1F7VA 3L43A 3ADPA 1R9JA 4K81B 4J0HA 4S0XA 3W34A 1EHIA 1X7WA 3MWEB 3TLXA 4F6CA 3H05A 3KKLA 4WE3A 4MQMA 3T7IA 1IDN1 5JZSA 4QYIA 1XNRB 2UU9B 1F0PA 1RWBA 3CVOA 4R9NA 4DG5A 2HWXA 3PGKA 4ZVUA 1VIYA 2OM2A 3IEMA 3BS4A 3A1SA 3AY7A 3ENKA 2EX4A 5AVUA 2C95A 2NPOA 3H4MA 3TZBA 4C4OA 3C4VA 3HUEA 1GARA 4DCVA 4E3ZA 3ODPA 2JAWA 4QLBA 3I83A 3ON5A 5KDOA 4H7PA 3HXTA 3RVPA 2O8FA 5CM8B 1MCZA 1OFUX 2WIGA 1HNXB 2JIRA 1XNQB 1KIMA 2FSPA 1SJ9A 4H4CA 3OCJA 3A7DA 4BX3A 3TLGB 4UD2A 3OJEA 3A10A 3F7TA 3ROQA 3W90A 1KDOA 4PNHA 4C78A 3TOVA 5BRJA 1AKEA 4CODB 1IHDA 1JNYA 1ITZA 4TKUB 5E8RA 2DY1A 4ILEA 3AFOA 3BB1A 1R10A 2H8KA 2C4UA 2VP4A 5E2IA 3ETLA 2WV9A 1E61A 5HIMA 3TTTA 3M4JA 4TTQA 1TJ3A 3ENVA 3JR7A 2Q9BA 2NP7A 1YHNA 1ODLA 5DBIA 4ZMSA 5INTA 3QXSA 1KA9H 4JQYA 1CIJA 2QP3A 2AFIA 1YU9A 2VNJA 4QXMA 4COOA 2HXYA 3M4XA 4P0QB 3S44A 1JPNA 1H2FA 4L4XA 1I6LA 4FPXA 3UFXA 1UJMA 3WGQA 4BNJA 3BIJA 4D57A 5L40A 3QIVA 5C8YA 2II6A 2PIDA 2PRSA 2ZREA 1TT5A 3O4VA 4RH3A 1V8DA 1O3YA 3RS8A 2B83A 1KEZA 2CKMA 2O6HA 2D7JA 1A82A 2W6ZA 1ZL2A 4GC9A 4H1HA 5ERXA 3QRWA 2O9JA 2O3SA 4LXIA 1YR2A 4IQ4A 3L7OA 4FN4A 4QOFA 2R6HA 2NUPA 1L7NA 4QYMA 1E3SA 2FPIB 3P1JA 4WECA 1VTKA 3BWBA 1J6UA 5AK5A 9LDBA 5K4GA 4QFMA 3CX3A 3ZU5A 5CB0A 1FF9A 5CVUA 5K6AA 2P5SA 4RD1A 4JU8A 4B9EA 1UXHA 1PV2A 2R1UA 3VV2A 4M4SA 3IAXA 3VSCA 3ACCA 3K2IA 3D1VA 3TBHA 4XPIA 2GZAA 3OLXA 1EWQA 4X41A 1QMPA 3PB3A 5CCEA 4EZBA 1IPHA 2PT9A 4C88A 4NMMA 3FYCA 1NAHA 4NJMA 3L0BA 3TIIA 3C1TA 4HWRA 4RFLA 4IRMA 2YXBA 3RC1A 1PQ4A 3V2UA 3ZHZA 5LQAA 2D5AA 4LJRA 1S89A 3OZBA 3ZK7A 5M7EA 1QVAA 3TOCA 2NNWB 4KFRA 1N3IA 3NUZA 2GASA 2F4VB 1XL0A 5DRYA 3GFRA 2F8LA 3UN1A 5JAHA 4QODA 1YZYA 1YBVA 1UIRA 3IE1A 5A62A 4G5HA 3NGXA 5FR1A 4GWKA 3E2IA 4GIBA 3FYUB 4HZUA 4JITA 1N2IA 1BS2A 2WHQA 3UG6A 1IEWA 2BUCA 5KOJB 2FHPA 1MORA 2GZ3A 2ZYTX 3EW7A 4J9UE 5IMBA 3U3RA 2QAGC 2VR1A 4HNQA 2P2YA 2FMFA 5I7OA 1U7ZA 3I2HA 1JXAA 3MJRA 3QVXA 4JI2B 5B37A 2FCRA 4ZC8A 3HY4A 1QORA 3H8SA 2AI3A 3VGJA 4UPEA 4B3CA 3KB1A 4D96A 1IG3A 1K1EA 2XE4A 2Z6VA 3E58A 3KOUA 5KQSA 2I7CA 2X9LA 3DHYA 4RAOA 5EEGA 1AHIA 3GA0A 5HMMA 1J90A 1KYYA 4KMRA 1EM8A 2NWQA 4QUBA 3K5WA