2X9LA

Crystal structure of deacetylase-bog complex in biosynthesis pathway of teicoplanin.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
266
structure length
256
Chain Sequence
TRLLAISPHLDDAVLSFGAGLAQAAQDGANVLVYTVFAGAAQPPYSPAAQRMHTIWGLAPDDDAVLYRRKEDIAALDHLRVAHRHGRFLDSIYRKLPDGRWLTAAVNDHSPDSDHDLVGEVADDIRSIIDEFDPTLVVTCAAIGEHPDHEATRDAALFATHEKNVPVRLWEDLPYAVFKSGAVELPQGFRLGSADVSSVKPEMRSQKFQAVERYSSQMVLLNGNNLFDRLDEHARQNAPHGGYGETTWPVVRSDDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Regioselective Deacetylation Based on Teicoplanin-Complexed Orf2 Crystal Structures.
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
molecule tags Hydrolase
molecule keywords N-ACYL GLM PEUDO-TEICOPLANIN DEACETYLASE
total genus 88
structure length 256
sequence length 266
ec nomenclature
pdb deposition date 2010-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 2x9lA00
3WL3A 1Q74A 5B2EA 4XLZA 3DFFA 5B2FA 2XADA 4XM1A 1UANA 3DFIA 5BMOA 2IXDA 1Q7TA 3DFMA 3DFKA 3WE7A 4EWLA 4XM2A 2X9LA 5CGZA 3WL4A 4XM0A
chains in the Genus database with same CATH superfamily
2BH2A 1BROA 4F2PA 1J1ZA 2ZJYA 4Y2SA 1KE2A 3SF8A 3K1JA 2X8WA 2SHKA 3TLAA 2ZVJA 4WZBA 2ZTLA 1NFRA 1H22A 2YYZA 5FTWA 2NAFA 2RGNA 3T3PB 4PFSA 1I3NA 3RS7A 4CNBA 2OV8A 4AY3A 1ZONA 5FYDA 4EKNB 3K94A 2QMYA 4OHMA 1KDPA 4LE1A 5JJKA 3CE9A 1T9AA 1C8BA 1JBEA 4GGOA 3MTDA 3KTAA 4P7GA 2A1UA 4YMIA 3RRYA 4B4VA 4KODA 1NVTA 2BY4A 3K09A 2JLUA 2OB1A 1ZIYA 1RRGA 1US8A 2F3RA 4LSGA 3TRIA 5GIOE 3F9IA 1W36B 3KUDA 2AJBA 1W5SA 4C4PA 2IOFA 3GFSA 3VOSA 4CM4A 2WTUA 2JGDA 2H11A 4QKQA 3UOAB 5LZ9A 5KO2A 2I1LA 3JWHA 2LWIA 3PUVA 2VDPB 2ZB4A 3L1JA 4ZIRB 3HCWA 1XWIA 4IW3B 5D7NA 3SQNA 1Q0TA 3IQEA 3DNMA 5BQFA 2V5AA 3QY9A 1T9GS 5LQMA 1S96A 4DJ5X 1ST3A 1ZMTA 5EKTA 2G5TA 1Y4SA 5LP6C 4P81A 5E9JA 2W6MA 4POOA 1KVTA 3IIEA 4LOIA 4ZQEA 4BP8A 3CX6A 2FNAA 3TQQA 3LXRA 1V2HE 3TAHA 3R3ZA 1KKMA 3PYMA 1ND5A 3M1IA 3QIVA 3U3ZA 1Z8DA 2ONZA 4BO5A 2Z6UA 2WD7A 4O0MA 5JWOA 2W6OA 5DNDA 2CXSA 2FYTA 5CX4A 1RHRA 3ZNPA 3N3BC 3GAZA 3PC2A 2F67A 1CUJA 1POWA 3D2BA 1U2RA 3O8NA 3WL3A 5ERXA 5TQ0B 3QMVA 4FR5A 1TJ4A 1W59A 1WSBA 2R8EA 2J0EA 4NE7A 1RYEA 4PVCA 3PGJA 4UDOA 1NFQA 1VCIA 4ERNA 1AT1A 2VPPA 5JD3A 3EX7C 3QH4A 3ROKA 1AS2A 3EFBA 3ZQUA 1NQ5A 1ZJ6A 2ZRCA 3ON5A 4S3MA 3KWJA 1KEUA 2O2DA 3CF4G 4Y2YA 4QTZA 3G3EA 4XIFA 5EERA 4Q82A 5B3LA 3ZHQA 1YS7A 4CMEC 2IS4A 2ZWAA 4Q00A 5BQ3A 2V7QD 1W1WA 2SCUA 1VG8A 3C4JA 1R18A 3H4IA 1WCIA 1I1QB 2QDXA 3G2HA 4O4LF 1MLDA 1Y4ZA 5F21A 3WK6A 4BAGA 5ES4B 1JFSA 3DO6A 2DXIA 1VG0B 1R0SA 4Y2RA 2XB6A 4D3DA 2ZRLA 2OA0A 3GJQA 4R9SA 1DKOA 4E5KA 1P2DA 1RWMA 2OKCA 4QODA 1Q0QA 1SG9A 4HAVA 3OLQA 1CQPA 3OFNA 4IDOA 4W8HA 1THMA 3FCSB 5COQA 2HPAA 4Z0PA 1P0PA 1P81A 3VSDA 2ZPAA 4BGEA 4C0KA 5D3ZA 2C9ZA 4HUQA 2ZSBA 3HUUA 5BN4B 1N2IA 4LZOA 2CLOB 3WJ2A 3RFTA 1SVOA 2ZUUA 1C2TA 2DWOA 1O97C 3DE3X 3HCEA 3JCZA 2WZBA 3SXUB 4EYOA 1T36B 4ZV4A 1H5UA 5AJZA 4KIJA 3KJGA 3UJAA 3IOYA 3ZS8A 4MA4A 2OGSA 3ENWA 4KK4A 3WGNA 5I5EA 1E8MA 1RFGE 4OL9A 1UXIA 1HORA 1O89A 2GN2A 4YO7A 3S6JA 3VMFA 1TQ2A 2Z3WA 3OQBA 4MR8A 4XLZA 5A1JA 1DBVO 2F7SA 1KTVA 3EEYA 3RPEA 1GY8A 4MHOA 5KTRA 4OHXA 1K86A 2ODEA 4HDNA 2WG0A 1GG9A 4PLWA 4ESEA 2C9CA 2IZ1A 4BFXA 5AM3A 1CFJA 2IL1A 3RYHB 4DR7B 3G6KA 2YC2C 5CR9A 2DUNA 2AZMA 1ZICA 2XH8A 1Z6AA 1YZKA 4M89A 3LT2A 3UT6A 2ZB3A 3BMNB 3R5HA 4YCMA 1QF9A 4HNHA 3TUJC 2WUFA 1N32B 3WLNA 2PIAA 1UMKA 1XCGB 2B25A 2F3PA 3QUBA 1FX0A 1BJRE 3FX2A 4FHFA 1U3DA 3BB3A 4W4TA 5F64A 1Z08A 1KAOA 1TTQB 1E98A 3PSAA 3OOSA 4RLQA 4I3FA 2NUTB 3QVTA 4F97A 3CZ5A 4RS3A 3RUAA 1RWBA 1ZD2P 2E1RA 2P8SA 2V59A 4EX6A 2V7WA 4PZZA 5K0SA 4IAOA 2ZXUA 4DLYA 1LDBA 2UYQA 3NIWA 5ENZA 2IYWA 2W8BB 4BNLA 2FAXA 3CRW1 4LECA 4G0UA 1Y8CA 1JYSA 2DBVO 4DV4B 4A15A 1XC7A 1R16A 3TQTA 1E9BA 5AVUA 6YASA 3QKWA 3QVWA 2OZEA 4HDOB 3L79A 4YALA 1PG5A 1I3CA 1F3OA 1NVGA 1TJ5A 3FPKA 3LCCA 5AK6A 3DPSA 3IVMA 5DLYA 4EGSA 5A3JA 2GF2A 3O93A 3JZAA 3O8LA 5KYWA 1X8XA 1A8UA 1QRAA 2X41A 1F17A 4LWPA 2IF0A 2NVBA 3SOPA 2D8AA 4D56A 4CHTA 4FJ2A 3OQIB 6PFKA 5FH9A 5JEDA 3A3NA 2XT9A 3CN7A 3L0IB 4D92A 1SQSA 2YY7A 3JAKA 3L1KA 4CUZA 3GLHB 4K9MA 4RELA 1R2QA 1QQ7A 2WF5A 13PKA 2GEFA 2ZETA 1HBJA 1Y6GA 3O1HB 4Y2TA 5JAUA 3I52A 3NGMA 4WK2B 3OZ7A 4F5YA 2CFSA 3KEQA 1XGKA 2UVPB 1NKTA 1YK1A 4KQJA 5BRAA 3X1XA 4V39A 5IFLA 3D7KA 1M5TA 4LRWA 3W79A 1IDN1 4RMGA 1JJBA 4Y8VA 2JH3A 2M6RA 4UE6A 4XIJA 1GUDA 3KEOA 2R25B 3HRHA 1LY1A 1XZ8A 4B0OA 3ZJ5A 5FLXA 5HCNA 3ZQ6A 4I3GA 3JRXA 2EARA 1TK9A 3KSRA 3PD0A 3N5CA 4RYLA 1ZR4A 4WRRA 1KI8A 2Y66A 3W5DA 2FUCA 2PV7A 2OXRA 1R0LA 2WKSA 4PSKA 3S5JA 1RM0A 3DWFA 3O3NB 3QBJA 5REQB 1ECGA 1GFSA 4TUYA 4LIPD 1U2ZA 2ZJOA 3BD9A 3SC6A 4W1SA 5KNDA 2JD0A 2BHRA 1TM4E 4YUVA 2PO7A 3RVQA 1ISHA 1U7WA 4MS4B 3RVNA 2SNIE 1RWNA 3WLHA 4LFAB 2VTDA 2P9QA 4FHCA 4BNWA 1XALA 2WNHA 2F64A 4GF5A 2B5OA 4OM8A 1SUEA 1G6KA 3MFQA 2Q6VA 2Y92A 1Y98A 3H9UA 3E84A 2C00A 4QT0A 4AJHA 1FDRA 1IN6A 1CEEA 1ZSYA 3GCXA 4BIIA 1PJLA 3L0SA 1TLTA 5JT1A 5HNKA 1M2OB 5IAJA 4C0AC 4IWXA 1CW2B 2Q0SA 3PNOA 1HR0B 4RTOA 2Z98A 4JJFA 1PNVA 3DDSA 5DNVA 4UDYX 4MLDA 4NS1A 5DGCA 4Q1EA 5AYVA 3RSLA 1E96A 1N2ZA 2QN3A 2ZRFA 3GZTB 3ZOZA 3ZYCA 3GZNB 4BVKA 4KGXA 1JQKA 1KI7A 3B78A 3DE1X 4NBLA 4C6HA 4PYKA 4RK7A 3ZDZB 3HDVA 1EE2A 4KPUA 1AQNA 2GM9A 3WLLA 3A1CA 4OYRA 5DYNA 5GGYA 4YFYA 2X0JA 4O1MA 3KUCA 4BFCA 1I6LA 5K20A 2J48A 3WK5A 3UATA 1KJJA 3D7LA 3TXYA 3C3JA 1XUOA 3VZSA 5KJEA 2I3BA 1WETA 3BDVA 5GJBA 1SN7A 3NFYA 2XUAA 1J5XA 4BX0A 3ZU6A 2J9GA 3V4RA 4ZJUA 3LKBA 4N5DA 5FWAA 1JDSA 1RADA 1Z34A 2PGDA 2PZAA 1YB6A 4CTOA 2BD0A 2P6PA 4F93B 2YRWA 2VNAA 3L1IA 2ZJ7A 1KORA 4EHKA 5KSZA 3VNUA 1BN6A 4D8VA 3B3FA 3L7BA 5IAAA 1UBMS 3LWZA 4O2BB 2ATXA 5ALNA 3OX4A 3AF4A 2FR8A 4I4TA 4NPCA 2RG7A 4IHJF 4UUAA 3IUSA 4G1UC 1NNI1 3KEGA 1C80A 3ZK9A 4UU8A 2DQ4A 4AG5A 4PYMA 1N2OA 2HDWA 4ZRDA 2XX3A 5E9QA 4M49A 2NTEA 2JH9A 2NX2A 4KIGA 3ELUA 5FNVF 1SRQA 3PF9A 1GGKA 3R6DA 4DEVA 3K92A 4DAEA 3AF0A 3L84A 2PS3A 5I45A 3GBVA 4QO8A 3OD5A 1HFJA 1T8SA 4EMTA 2I2BA 5A3SA 4B4OA 2HRBA 3TS1A 3B1ZA 3GQBA 1YB5A 4UD6A 1AKRA 3O0DA 1WF6A 3NU1A 5ED4A 4AKIA 3KEFA 5G4LA 5JI2E 3OQNA 5FP0A 4JUBA 1E9FA 5DP1A 5GJWC 3JWGA 4ZVPA 5IABA 1DEHA 5EE9A 1N1DA 4FCCA 5CB4B 4BC0A 1Y5NA 2VG8A 3MCAA 4K3UA 3RTGA 1XU9A 1Y1SA 2A3RA 4DCVA 1F12A 1FK8A 1ZI9A 2FN4A 3SDSA 3DKVA 1M6EX 2B8NA 3TPZA 1L7OA 4K6OA 3UKDA 4U9HS 4URWR 3KO8A 1TAQA 5TPWB 3SQOA 1LLFA 3LV8A 4ENRA 5JNUA 3R7SA 1NVXQ 4Q3AA 3ZZMA 5E8JA 3IS3A 4UFOA 1W29A 1XLUA 1F0NA 4IV8A 4B35A 3FNRA 3RBVA 4DNPA 1R0WA 1Z22A 2BIFA 5DCWA 3AV3A 1FW8A 5KWVA 4IMRA 4U2EA 5INTA 1JL3A 2O06A 4EATA 2J0UB 2DPYA 3TLGB 1XF1A 4R8LA 4E6PA 3DB2A 1P4HA 1TX4B 2VXOA 3CW8X 3F5SA 3FCEA 4Q48A 2F3SA 1S3GA 5CK4A 5ED0A 2YN4A 1F0YA 3IQHX 4AXBA 4F84A 2LGJA 7REQB 2VYNA 4P3NA 4XYLA 1YMUA 3ILYA 1ZJ5A 1R10A 3U7RA 5HJEA 1XZPA 2N9UA 4GXRA 2BONA 2RGXA 3L1HA 4DBLC 5JUWA 2WUWE 4MVWA 2G1KA 2X5NA 4QVIA 5AW9A 5KJ1A 3U7JA 1WB5A 4NYJR 1Y6ZA 1MX3A 1A9XA 3U0BA 4CYMA 1JXOA 3VTFA 1KIFA 8ADHA 3DKIA 1ORRA 3MBIA 3IEMA 5LLTA 2BBWA 1RJGA 2AX3A 1KSHA 1AGXA 1ETHA 1ZJJA 3AU8A 3OJ0A 1L5LA 2VAXA 3QKRB 4IICA 2PLWA 1YAHA 4BVEA 1QIJA 3S3TA 4ZGGA 4URFA 5LP6F 3CO5A 4K6CA 1U4SA 5LOVF 1V1MA 2A9JA 1U90A 5DEOA 2FPIA 4N49A 1M34B 2G40A 2IIBA 2QAGB 3R3VA 4RY8A 3WLIA 4KWTA 2PUGA 2I7DA 4JSTA 3SDBA 1T8UA 2CK3A 3L4EA 3HU3A 4FYIA 2XLCA 1XTQA 4DV7B 3L0PA 4N41A 1BXKA 3DDWA 1RVDA 4EYEA 1BMQA 5CFOA 4UBLA 2VZLA 2Y1FA 2RHWA 4EA6A 2M6SA 3LWBA 5AM1A 3HFGA 3CF0A 4ZAYA 5DLPA 1GP2A 3JXEA 4J0HA 4DHWA 2O3JA 2RC5A 4IIJF 4ZPXA 5JBQA 5IVHA 3P52A 1GAWA 4YAWA 4UQPA 2PLAA 1BYIA 1S8FA 4RY9A 3D2AA 3ZDXB 4B76A 1KH1A 4DLVA 3CLTC 2AT1A 3ZWQA 1EVZA 4DUYB 4YECA 4RESA 4V0OA 1OFUA 1IB0A 3BD7A 1IBSA 1Q83A 4H17A 5BSFA 4YPFA 4HADA 1EGVB 2I66A 4NY1A 3QKTA 1EI9A 1XPRA 4NU6A 3ASVA 1G7RA 2FWPA 2H9IA 3CBGA 4RZHA 5JNVA 2OXFA 3I5UA 4AD8A 2BGKA 2H7YA 4RGQA 3T99A 1PD1A 2YRXA 3T9BA 5JAMA 3B12A 1GRVA 2VEDA 2Y77A 1E6EA 3JR7A 4TT3D 3DVAA 4K1XA 4CEHB 1H4TA 1KZHA 3EGOA 4TTSA 1G2IA 3QJ5A 2GBCA 1X7ZB 3AH8A 1C4XA 1S5PA 4Q4HA 2BFWA 2IYQA 1EQUA 3L8FA 5JVDB 2Z2KA 5CLGA 3EA0A 1OI7A 1UQRA 1YI1A 1NULA 4GKKB 1EXVA 2GZMA 1Y4UA 1Z8FA 2I3GA 2O8BB 3OOJA 5I4BA 2WF7A 4NZPA 1U04A 4UATA 5BO5A 3GN1A 2GLTA 3FNEA 2ABWA 3QEBZ 1XMQB 4P33A 3WBFA 4G4IA 3CGWA 3T38A 1BMFD 2O3UA 3MGKA 4CV1A 1AQUA 1NXVA 1T24A 5DRTA 2CBZA 4ILEA 5F2EA 1M8GA 1NTOA 2X15A 1Y9EA 5EINA 4FDLA 4HNAA 3U26A 4OB8A 1EU1A 3OQMA 1GU0A 2DWQA 2FETA 3A06A 3DM5A 1JDPA 4G0VA 1EG2A 4TSFA 2WC1A 3HVHA 1EZZA 3H2SA 2ERCA 1BX0A 1V5WA 4Q1FA 4TLAA 4US1R 2OHGA 5JQWA 1QWSA 1VC2A 5TF0A 4JV5B 1GQQA 3V8BA 1MFPA 1D6NA 2D2XA 3R3HA 1MW9X 2MDTA 3KCQA 3NH6A 4FD2A 4FOLA 4HVAA 4RMNA 3EOBI 4RTQA 3HJFA 1PRYA 1X1AA 1XAJA 2D4HA 2YY5A 4NK5A 2D2IA 5AVWA 1SB9A 1P80A 4F9GA 3A9RA 4P3XA 5KNDD 3UFXB 4MIOA 3F6PA 1JQ3A 2HPZA 3JQ6A 4PQYA 4JXZA 1VMIA 1YS1X 4Y18A 4X1OA 3BGDA 4BB5A 3P5BA 1RM4A 2V55B 4F2GA 3N0VA 2PYZA 1WBBA 3RHFA 1TM3E 4DPLA 5IDQA 3SJCA 4A10A 2C2BA 1FMCA 2HREA 3KKKA 1WO8A 3GCZA 4P86A 2GO1A 2QAJA 4OUDA 3I2KA 2W2PA 2XYVA 3ABSB 3KT8A 4EQZA 1JF8A 2GDZA 4HJXA 3MZ0A 3QVGB 5J5AA 4OXQA 4TT8A 2AZXA 1FSGA 4HX5A 1HTBA 1ZWKA 5IJ9A 2B6HA 1ONOA 2O5CA 4JYPA 3GCGA 3QBTA 3F3KA 1CP2A 1XEWX 2GPSA 3DTTA 4Y0VA 4JASB 3H4TA 5EIBC 3U1TA 2FE1A 1D0IA 2G9ZA 4C3VA 4BDTA 1XQ1A 1RLUA 5DK6A 3OFSA 1CX9B 4R9VA 2G72A 1EK5A 1EWKA 1HKHA 1ZLXA 1H0SA 3A36A 4G84A 1Q3KA 1UR5A 5IN5A 5JIBA 2A0FA 4YP5A 4PBSA 3DE6X 4BCCA 5HKAA 2UUOA 4KPUB 5FFFA 3ZWXA 1K06A 1ONSA 3RU2A 1SHLA 2QYSA 2VNIA 2WOOA 3BK7A 1AQIA 3GVHA 5HUJA 4Y1EA 4Y2JA 1WSAA 2YWJA 1TF5A 3EN0A 3EXEB 3HCFA 1OIWA 2NQ2C 1DZIA 5AR1A 5DHSA 4CLDA 3Q9LA 3H2BA 3I64A 4JJ4A 2PA3A 1GZ5A 4INJA 2C3MA 1C9KA 4NH0A 4EDFA 5A6VA 1R7RA 2WZCA 1Z4NA 3OEEA 1QZZA 4P7BA 2JFQA 4KMSA 4HX2A 3O31A 4TS1A 2AEFA 3L93A 2LCIA 3R3YA 1TA9A 4L9SA 3W6OA 3AFMA 2XVXA 1UP7A 5GONA 1WHSB 4NAVA 4L27A 4DA6A 3N87A 5MDHA 1XHLA 4GGMX 4F8EA 1L5GB 1KZ4A 4ZQGA 1I14A 3A6LA 1UDAA 1AKWA 1YRQA 2H2AA 1LDMA 1H6BA 5HBRA 1EHYA 3I04M 3TPFA 3R1IA 3LFHA 2J0SA 3PX2A 4L7VA 2VHUA 4XUGB 2I2CA 1R4NB 4PZDA 1MIOB 3VU0A 1NVAA 1TTHA 1DI0A 1W5TA 1IBKB 1XFDA 4TKVB 1X1CA 1CDOA 1SUIA 1SBQA 5H70A 4BMZA 3AETA 2AN4A 3VJKA 4REMA 5BSWA 3CH6A 4Q34A 3BGIA 3VC2A 1E9DA 2FKNA 2GR9A 4RCYA 4LEIA 4RHEA 3IUNA 1W46A 3KQYA 2WP8J 4R16A 4B3RB 2UV8A 3AEXA 3L92A 4JXJA 4LDJA 3WI7A 1WCYA 1G18A 4B4UA 4QOEA 1CY1A 1BRMA 2B8WA 2HJHA 4LRTB 2C83A 1CUDA 3A3OA 4L15A 5EHGA 1WB9A 1P9NA 4FDMA 4J0KA 1OKKD 3BWEA 3BC1A 3RJ9A 3MJSA 3MHPA 4H7IA 2FW7A 3P19A 5FO1A 2UXCB 2O8VA 2BP7A 4FGUA 3R3JA 3RBAA 3SSAA 1A98A 5BORA 1RYYA 1QXSA 4M8NE 1ZI6A 2VJPA 2VT3A 3AB3A 1M2KA 1TECE 1ZH2A 1M2VB 1XD9A 4CFSA 3B48A 4DEXA 2O05A 4BNFA 1FFYA 1VDMA 2CL5A 3GUCA 2WJYA 4WJZA 4B6JA 3ENVA 2HR1A 4PFKA 1FTWA 2C1EA 2HTFA 2JI6A 3LUKA 1P2UA 4RHTA 4W99A 1JR2A 5EPOA 4ZANA 4ZCRA 4FHDA 4JBWA 3VR6H 2QSJA 1QUFA 4MUBA 3TYXA 2OHHA 3IKJA 3CCFA 1UK6A 2QZSA 4NR0A 3RK4A 1TT5A 3X43A 4A4DA 2A4MA 3D6NB 2GEUA 4IDEA 4PYNA 1HYHA 1C1DB 4JNCA 5FOWA 3R7WA 3RIHA 1ZNZA 2DX7A 2WU8A 5DHFA 1TYBE 4EMSA 4ZFNA 4IINA 3GA0A 4LQDA 2YZNA 2NU7A 3SC2B 1G59A 2VXCA 3QLVC 5HQTA 1SK9A 2BMAA 2PANA 2V7XA 4INPA 2GD6A 4QTUB 5BUSA 4WKNA 3F2IA 2X2FA 3OIYA 3OD1A 2G63A 1ZK3A 2C2MA 4TXHA 4WNAB 5B1EA 5G0SA 4ONEA 4Q7EA 2VIIA 3P2IA 5MFZA 2OMKA 2A5YB 3NWOA 4L5YA 1R66A 3R0IA 4R7GA 4YAKA 2VH5R 5L3QA 4OQNA 1F5NA 1POXA 4BMDA 4ALLA 1X3LA 1H8HA 1G1MA 3IE1A 3OIGA 3O47A 5JDCC 1MPTA 1AMNA 2ZIFA 1E0SA 2BLLA 2YHSA 3N0XA 4PO9A 4QU5A 5DSZA 4IGFA 2P9BA 1T4MA 4H7DA 3GFPA 3OCXA 3IC5A 2IHZA 4QFDA 1X13A 1OU0A 4C0SA 5BSKA 4XKJA 5I6DA 1EDEA 5LL6P 3EPJA 1IEVA 5TMDA 2I6QA 3LLUA 4L74A 2GN0A 3R3XA 4J9UE 5EEGA 3LWNA 4AAYA 1T3GA 4WOPA 3SKVA 3HC7A 4TQUS 1T3HA 2QAGA 4XPIB 1CB7A 2C0QA 1C8VB 4MVCA 3CM0A 4DLUA 1Z7EA 3FYHA 3R77A 4I5FA 4QUHA 4TS3A 3EF0A 4UCWA 4YT2A 4CM8B 1JIQA 3PQ7A 4BDSA 5HZKA 3ONFA 4NJMB 3ZLJA 2PXAA 5BR1A 2QR3A 1DJPA 2BFEA 1I2ZA 4DJTA 4JKIA 5F9HA 3VPXA 2GAFA 3X1MA 3H1GA 4HH1A 1S8AA 5HILA 4D9EA 4YV0A 1GQSA 4EUKA 3WLRA 5AVXA 4LMRA 2MT9A 3GLUA 4WKGA 1PYDA 3EVNA 4MW2A 4M21A 3BF8A 4PRYA 3REQB 1MAWA 3LT0A 5FWXA 3TOVA 5TGZA 5J4HA 3T7AA 1O8BA 1TVKA 1XCJA 4AZ0B 2QVYX 4EKGA 3HJAA 4LJRA 5DGDA 1UWKA 5EC8A 1OTHA 4Q39A 5AJWA 3ZY5A 5HZHA 4HLUC 1T13A 1AKTA 4B6OA 2B98A 1QCYA 3T3DA 3IDSA 2EJBA 3K9GA 3SDZA 4TLMB 2QTRA 2YY6A 1PWHA 4QBKA 4NQZA 4Z99A 1V3QE 2HXYA 4YJFB 4ZKEA 4CPDA 4JVLA 5DNYB 1AN9A 4HX9A 4MRPA 2VLBA 3LIIA 5C1BA 5C7YA 1NC1A 1Y8RB 2JK0A 3DFIA 4HWOA 4HLCA 3AEUA 2VDMB 4L4UA 3SC4A 3USES 3FWZA 2IE0A 4F45A 5ALYA 1JVSA 1IWOA 1VL2A 2ZSUA 3DHNA 4M0EA 1KRXA 3DP7A 3V7NA 1M7GA 4UUQA 5DI3A 4K9NA 4WZAB 4CV3A 2BFPA 1P2GA 4OAOA 1NVKA 2VCHA 2OD2A 1IQPA 2OV4A 2D2FA 2X1MA 2HIGA 2JDID 2XTAA 4LJ6A 4NP6A 3S4YA 4DLLA 2PUHA 1FLDA 4ZCMA 5DX1A 1DO2A 5K2OA 1CUHA 4NI5A 1YT5A 1NZJA 2E7ZA 1CY4A 1SQ6A 1I0ZA 2JJ1A 2WABA 3B1VA 2GKOA 3DZFA 3JWJA 3KKQA 3GPBA 2RHGB 2H3EA 3E3AA 5CNKA 4ZAGA 3RBXA 2OLKA 1CWUA 4GSLA 3RRMA 3Q9NA 1FDVA 3ZKWB 4DZZA 5DSXA 1LVHA 4QLOA 1E1KA 3RWOA 2ZU6A 4IBOA 1DDIA 1IM8A 1UUFA 2GCIA 2J6BA 3WKAA 3M4ZA 3MWGA 3JTEA 1L4FA 3L7IA 3LP5A 5F5NA 1TO1E 4RAQA 4ZTZB 3IXLA 1RVV1 3R6TA 2RE8A 1W4ZA 3HA2A 3Q7QA 3QELA 5H02A 3DFMA 1BO6A 3DMHA 2QVZX 4GYYA 1S89A 4KX3A 4JDUA 4OYHA 1J8FA 1EEXB 4YTEA 4GP7A 4BNDB 3N6XA 3ZVMA 1WSDA 3T15A 2X58A 3B53X 5HKKA 4Z86A 3PFKA 3DLTA 1G5IA 3CSDA 3GRZA 4MHSA 4LNUA 3E18A 4R7TA 4K0KB 1K27A 1TLLA 4S1TA 1KJNA 4QOJA 2ZBRA 3D1VA 4Y9TA 4D44A 2HK7A 2OBYA 4GD3Q 1XNRB 3EXG2 3H86A 2X1LA 3DO8A 5CVTA 3SZMA 2E0IA 3QKUA 4EA8A 1M1UA 2GEVA 1GYRA 2FSVA 3O8CA 1A95A 2O57A 1NV8A 1O6BA 1U1IA 3N39C 5DX8A 5ADUS 4NBUA 3TL2A 4L22A 4BBZA 1B16A 2GRUA 1BW9B 2HQRA 2MR6A 1N6KA 2WDPA 3RYFA 3CZPA 3IKLA 1XJ0A 3NORA 4FHZA 4G9GA 4L57A 2RCNA 3HI4A 5G1OA 1L4KA 4RD2A 4MGKR 1DE0A 4OK5A 2R751 5HMMA 2EW1A 3G88A 4OHUA 5JNSA 3QX3A 3A1EA 4JBXA 4IRUB 2IP2A 3LPLA 3VSAA 5KTNA 4QWWA 1A2BA 3ZWWA 2IA5A 5DV9A 4DQXA 1J07A 2IYAA 3BZBA 2VAMA 4RZ2A 4GPTA 1GG8A 1NLFA 3ICWA 4GOXA 3LC7O 2XE7A 3NVAA 3FLMA 4IWYA 3JD2A 3LK6A 4E2WA 3EPPA 3JATB 4YT5A 3R75A 4MDHA 5LB4A 5EJEA 1R6TA 1I6KA 1QLJA 3AC0A 5JARA 2YOHA 1RWVA 1VKJA 2NTVA 3TI9A 3T1YB 4NK4A 2P2YA 3D3WB 3IT3A 3ZZNA 5JAPA 4PXSA 1G8GA 2ZYIA 2Q5HA 5E9WA 2ETXA 1HE4A 1DCFA 3GVIA 2IH5A 2O8CA 3JWEA 2RGDA 3VU9B 1J70A 4TRMA 1JLLB 2CXUA 4WOCA 5TQ2A 1C7FA 3ABOB 3C8UA 2H4JA 1DHTA 2Z83A 2JJQA 3S27A 1UJ4A 4WUVA 3W04A 1MNAA 3TRDA 4YJGB 4BVJA 5HGJA 3I3SR 4Z54A 5A1TA 4YIHA 1NU8A 5CGQB 5FLKA 1M7HA 2ZSHA 1QPBA 3GF4A 3OQPA 3TNJA 1YRBA 1I3KA 3ZEAA 4DCSA 4EB0A 1E6UA 5CU7A 3GHYA 3URMA 1L5QA 3LS2A 3DYBA 1NFFA 2FMTA 2FZVA 3OY7A 3WYEA 3IO5A 4BB0A 2FPPB 1C8KA 4GXQA 5CVEA 4RTSA 5EEHA 2O4CA 4QAQA 5KQGA 2XOKD 2XIQA 1Z0DA 2IUFA 1OLUB 2PLRA 1H0HA 5FPSA 4ZEVA 1OB2A 5MGBA 2PVCA 2QX4A 3PE6A 4ZOEA 4DKXA 3T0IA 1HWYA 3GT4A 5FAXA 1FU8A 3IV6A 1BCSB 3VNRA 4DNOA 3PQ2A 4RFSA 2F43A 5K9ZA 1UOPA 4RLHA 3VR2A 2R11A 3VAZA 4C3ZA 4HD8A 3DKRA 1H8EA 4DMGA 1BRTA 1WL8A 4JSRA 4N7BA 1CLEA 4CN8A 1C3EA 4RVNA 1IPEA 1O97D 1KY3A 1YQDA 2YWBA 4ZCPA 1WR8A 5EWMA 5EZYB 1V2GA 3LX4A 1RZVA 2HA0A 2ZRGA 5FA8A 1Y3CE 4M1SA 1XA0A 4KFCA 4Z7OB 4E12A 1IHYA 1OYYA 1XX6A 2WTNA 1TZMA 4K9SA 5F77A 1CVIA 2GFHA 2VP3A 3BH6A 4B0PA 5JSQA 2ZI4A 1I4TD 2VJMB 2AOUA 1MR3F 4PEVA 3W78A 4PNHA 3DVLA 3I2GA 4UUOA 2RI1A 4CLHA 4UOEA 3K05A 4GR4A 2WQ7A 1J7JA 2VAWA 2CZCA 3K30A 2XW6A 6LDHA 3WXBA 1BHJA 1WD7A 2NUPA 4HN9A 3AEKB 3KKLA 4PC1A 3T94A 2VPZA 3C97A 4AKEA 4FGKA 2CHFA 2DT5A 3IRVA 3NIFB 2NXCA 4LC0A 4ZREA 3CEAA 2IPNA 5E2AA 1RZ3A 5JFGA 5M34A 3HJBA 3K0BA 3P0FA 5A71A 4E0BA 5HRAA 1EFVA 3EWIA 3EF3A 3KKMA 2NT4A 2QKYA 4DC1A 1C14A 4C7BA 5ECWA 2H48A 4PCUA 1RZRA 1VL6A 3EFHA 3EVAA 4FCWA 4QNNA 3VPDA 1UDWA 4DCJA 2HJVA 3BE5A 3L3BA 4CG1A 3DR3A 2Q8QA 3L6RA 5ALEA 1Z4IA 4R1OA 5FNVB 4KQWA 4RW0A 3U81A 1USUA 4MVJE 4HB3A 2C7VA 1BH6A 2ECFA 3N8KA 3O9ZA 3RC1A 4A2WA 4AUMA 3JQAA 3E0QA 3K0HA 1W36C 4GVXA 3DEIA 4LYGA 2Q07A 3KKOA 3TB4A 3UWSA 1A50B 2FZLA 3I4CA 4XJVA 3VUEA 3WISA 3RAEC 1IFXA 3WWEA 5JFTA 2AXPA 1C4OA 2B7BA 1IRXA 5I9IA 3U5ZB 3CB4A 4BFTA 4OJQA 4PLGA 1IWBB 4Q7LA 4CMBA 2WG2A 1OLXB 4EABA 1TA4A 2JATA 1VGRA 4GS5A 4CM9A 4MWEA 2GOYA 4NRDA 1QZUA 1UKCA 1LDEA 1KVUA 2ERXA 2QXUA 3DOEA 1OVMA 2XIJA 2N1MA 4MPTA 4ZT3A 5JU6A 4N8DA 3PKIA 2RHRA 3EXIB 4BE4A 4PWYA 2ORYA 2NNWB 1GSHA 1VHDA 1EK6A 3HL0A 3OIVA 3ZCRA 4F4UA 2YFQA 4F6RB 1ULBA 3U4CA 1ABFA 2EJCA 3NDRA 4RUKA 5IJXA 1H6DA 3VVMA 2VNKA 1W93A 5EL0A 3QMPA 5SY9A 1FDWA 3GFBA 3Q3IA 3A28A 4DR1B 1AB5A 2QWXA 2K2WA 2RH4A 5FA5A 7ADHA 4I4TB 3NYIA 5GPBA 5A6SA 1DX6A 1SVSA 2JFYA 3ESRA 4MVJM 1FQJA 2Z09A 1TRKA 3FUTA 2O2ZA 4D41A 3KB2A 4YDSA 1YA6A 1PN3A 3WYDA 2DT8A 4BRZA 2DETA 1B8PA 1HOTA 1U7TA 3AI2A 4JUDX 4B4WA 4LC9A 2W2OA 4FYMA 5KPDA 2QRPA 3GFTA 5A5DA 1UINA 1JLHA 2QNRA 2DSTA 2WDZA 4LRQA 4R2IA 5K6AA 3GRVA 3NM6B 3A11A 3G0BA 2NUAA 3HKBA 4TV9A 5KNDH 3B70A 3GLSA 1FPQA 2VSYA 1IRIA 3ZHVA 5TJ9A 5KIAA 4FWTA 4WXMA 2Z2YA 3ZU3A 5FL7D 1H05A 1IN5A 2BM0A 2Y1CA 2VAPA 3O92A 5A05A 2IXDA 3AXSA 1XI2A 2CHEA 4JQZA 4P4SA 2IEIA 4Z3OA 3W8EA 1V0JA 3BCHA 1G8SA 3KU1A 4BZXA 5IUKC 3W0LB 3F74A 3IAS1 3C70A 3VR4A 5ITWA 1B73A 1I9GA 2FW8A 1JJAA 3FHJA 4FQ7A 1F38A 1RWQA 4UBIA 3LRTA 4BASA 1II9A 2VF4X 1TD9A 2G0NA 3KXPA 1Z39A 2PVPA 3TINA 5I01A 5DI3B 2HWYA 5T64A 3ZE0B 4J0GA 1O95D 3V1UA 1Z4LA 4B2PA 2H54A 3HFJA 1JB1A 2VJNA 1C3XA 4KK3A 4MKIA 1MIHA 2MWMA 2HK9A 2BE9A 3W6PA 3BSSA 4KITB 3GUZA 3MLBA 4WVFA 4U1RA 1LC3A 2Y27A 4FOOA 2D4AA 3QOWA 2XITA 4Q1BA 1KGSA 3AP3A 2J07A 1XNGA 3CF4A 4DQVA 3KQMA 5K3FA 1G19A 1MCZA 1GPKA 1NW3A 2PFKA 2JRLA 3C6XA 3GPIA 4RA6A 4BLPA 5AI4A 2P9EA 4F5ZA 3H87A 1JHQA 3ZTWA 5HJ7A 3N0WA 2QLLA 4C7JA 2AC7A 1JSZA 3ONDA 3ENZA 4ETNA 4XDZA 2CLDX 4O2AB 1JZTA 1PNOA 2O2YA 2ZQZA 3SWWA 2FFRA 2QBYB 2B92A 4MQ5A 4KOEC 5CFQA 4GBED 3VU8A 1ESCA 1VZ3A 3TX6A 4M0DA 2CVFA 3ZLUA 5IDVA 1A9XB 1JJFA 3OWHA 3TLKA 3A6KA 4JLJA 3HR8A 2PX3A 5TY0A 3K15A 1JWAB 1I01A 1VLZA 4YVFA 4EPWA 1HF3A 3D5EA 1LS6A 1JFFB 2ZPTX 4W1PA 3JYPA 3U3JA 5E4YA 3DKKA 5BSHA 1JG3A 3FYSA 4KQ9A 1FLAA 4KPYA 4RVDA 2I9KA 4OP1A 3CRMA 4K6MA 3WDMA 3X1DA 1JUDA 1L8LA 2EQAA 2GYUA 4R3NA 1NNSA 4EUSA 5LWHA 9MHTA 1GSIA 1VCOA 3RG8A 2BHLA 1UKYA 4D74A 2WHXA 3K2IA 4LZNA 1AUVA 4I1YA 3S44A 3QXXA 4CF3A 3X44A 5AW3A 1T1EA 3PEFA 2FDCA 4DLXA 1W1IA 2VJDA 3DM9B 4FFRA 4EEXA 3RVRA 3OZAA 5L40A 5LP6A 2P78A 2P6UA 2XDQB 3CISA 3GEHA 3TH5A 1HE3A 4QVKA 4KLNA 1NI5A 1JTFA 4URVR 2ZIAA 1KK1A 4RH3A 3NI2A 2DP4E 1TAUA 3VZRA 1Y7TA 2VTKA 2Q5CA 2D5BA 3HKDB 1NRIA 2ZBQA 1N5IA 1IAVA 2BN4A 2J9XB 5CH3A 1C9EA 1FP2A 1VB3A 1KYYA 2VSNA 3BBPA 3V8PA 3MMXA 2GEJA 2X3FA 3SIPA 2JEZA 3TB6A 4REOA 3VDNB 4Z6KA 3ZGNA 1ACLA 4K8RB 2BEUA 4NCBA 2D2EA 4UMVA 4ND8A 3EE6A 5AOVA 3IEUA 3RKSA 4DB4A 1YL6A 1E3LA 2FSVC 2DUUA 3Q8WA 3AX6A 4FE4A 4G5XA 3T1NA 3UW3A 1M5UA 1HT2E 2HIAA 1OLSA 1UMBB 3ETCA 3KXLA 4GMKA 1PYOA 3ZOKA 2IHTA 1KMHB 2FSGA 5AOBA 3IUEA 4XDYA 4AKGA 1T91A 1AN0A 2BOVA 3G79A 1X1SA 1WG8A 2CDRA 1WXFA 1U8XX 3I1FA 3HR4A 1IM2A 1AKQA 3TQCA 3QFCA 4BS9A 2PQ0A 3RQIA 5AFSA 1WMFA 2PL5A 2OQRA 2CHQA 5ARCA 2KJQA 4FIZA 5GJVC 1GR0A 1I13A 3EPRA 1EUCB 1X7ZA 3JTMA 3R7LA 4EJSB 1KI4A 3NTUA 4UNQA 2H2HA 1OLUA 2Q3LA 1I80A 4HQRA 1TFUA 2SCUB 3PZBA 2H1IA 2R1TB 1X70A 4RH0A 4K03A 2AC4A 2NMVA 4LOHA 1W0KA 3QYJA 3B6ZA 3UH0A 3I39X 1KEVA 3AW8A 5SZHB 2JIMA 1RAHA 2D0DA 2PS1A 1Q11A 4Q3DA 3HSYA 2I5PO 5IPFA 2WHPA 4IL5A 3SJAA 3T1TA 1P5HA 1WJGA 5B7PA 3L9WA 3I9V6 4CTMA 5AI9A 4GMFA 2OILA 1AH2A 2HMYB 1E2MA 3VR6A 2D00A 3E1GA 2CCJA 4DJFC 3PS9A 2D3TA 3M6LA 5CDTA 4XXHA 1O54A 5DHTA 5TEVA 3DF7A 2PZFA 4MULA 2NVUA 4B33A 4HB4A 4INOA 5HS4A 1MJGM 3GCDA 3H2IA 2GJKA 1HE1C 4X71A 1DKUA 3PD1A 2CC2A 1AD2A 3THSA 5B7QA 4TZKA 4WDQA 2YS6A 4NOKA 3V8MA 4PWZA 5FJJA 1YIOA 1E4OA 1X92A 4YCAA 1H5QA 2AUTA 2QP4A 5DHUA 3I37X 4JU9A 1U6IA 3F6RA 9ATCA 3HXQA 4OB6A 4CFYA 2AXQA 4JC5A 4ZOAA 4AT1A 1U8CB 3KQQA 5AQ1A 1U2PA 2OC9A 3KDPA 1SHKA 3M33A 4P7KA 3OIFA 5AM2A 5J59A 5B57C 2X2EA 3P9ZA 2CJYA 2RIRA 5CM2Z 3I72A 4OI0A 3C3MA 5EE1A 2EYUA 3MOSA 1IATA 1JWLA 1R5BA 3G0OA 2NZUG 3ITDA 3L8GA 4WBNB 4G24A 1T34A 5DVZA 4F3TA 5ER6A 2WK1A 4YXWA 3FPSA 1Y80A 5AVYA 3S2ZA 2LIPA 3KQTA 4FE7A 4A1OA 4MKXA 4R01A 4YRCA 1SZCA 3L0DA 4XD2A 1HO3A 3PNMA 1SQFA 2WJVA 2PFSA 5C8DA 1E6MA 1R6BX 1ZCJA 2IRWA 2XGMA 3H9GA 3V00A 3OM0A 4DZRA 4URUR 2FK8A 2G04A 1YJ8A 5FXMA 1X1TA 1YL5A 2BGLA 2CXXA 3O4IA 2A58A 2JI9A 4RETA 1YVDA 1H0RA 1OXBB 4QBTA 4S1WA 4LWZA 3JV7A 3REFA 4DABA 2C7BA 4V1CA 2RHMA 2ZS9A 4ZEXA 5DIZA 1GNRA 4Y9DA 1S01A 5IJAA 3QWBA 4G1EB 4CKEA 2QN9A 5DH9A 4EVSA 1U9IC 2WD8A 4QM6A 1SD5A 2ECQA 3A4TA 1LRJA 2NQTA 2R96A 3C39A 4OF4A 4CJXA 3AVXA 1ND6A 3BMOB 4U2FA 2L0XA 4C4OA 1GA6A 2H07A 3FBTA 3NYQA 4RXMA 2IPOA 9LDBA 3WBBA 5BN1A 2H9AA 1KA9H 1UPFA 2Q29A 2VKTA 3HYRA 5DNWA 3OQIA 5CVJA 4UZEA 5EHQA 5FOTA 5LYJA 2XRZA 1ZGHA 3U56A 1WDMA 3JAKB 3D7MA 5HR5A 1THTA 2QRUA 3M6XA 1AK9A 5H4HA 1ZVVA 2VDKB 2OHFA 2P4HX 4D9FA 3OO0A 1V5GA 2Z8YM 5CD1A 1GPJA 1RHQA 3LPCA 2FFHA 4JQCA 4OYLA 4FMDF 2KSQA 4G0QA 1OH6A 3OU6A 3K0FA 4P7JA 1SXJD 1ZD3A 3AHCA 4Y2GA 3V9AA 2PH1A 4YJDA 4DR3B 2GNAA 4MPJA 4DUGD 3NHBA 1CR6A 2PH5A 1JDBC 1A8HA 2Q5LA 2W0MA 3UXYA 1N1MA 2QZ9A 1WF3A 5GOZA 4UDNA 4RIFA 1R9JA 3NHRA 3OLWA 1LUAA 5CHYA 4BATA 1XDBA 3RTCA 3ZJVA 1K8RA 2FFAA 2F4NA 2QD4A 1ZGAA 1MB4A 2FVYA 2H4ZA 3ZW7A 1FYEA 1RD4A 4D57A 2O19A 4A0QA 1ZRMA 3UK2A 3N8IA 4N7MA 5REQA 4JJ6A 2QW8A 2C2ZA 3UKJA 4NYMR 3GYGA 1XYVA 3L6BA 1KAHA 4ENSA 1WDTA 2IU6A 3K72B 1IHUA 1VJCA 2WD7B 2AVDA 2IHVA 2NZ8A 3GWZA 2I3ZA 3WGVA 4KO3S 1RKBA 3IAM6 4RY2A 5BN5B 4C05A 2X8AA 3MWDB 1XEXB 3D8RA 1KH3A 2GYVA 1E6WA 1ZP6A 2GF9A 4K28A 2I2AA 4RGBA 1QOQB 4Q4CA 4BEJA 1VL1A 2O50A 2QX9A 3ACBA 4GYJA 2HUPA 4PFJA 2QX7A 4QUIA 3LUPA 1G3RA 1Y7IA 2YINC 5EP3A 5AUNB 4YRPA 2NADA 4H3VA 5CDGA 1GZSA 1A96A 1THGA 1SC6A 4NEQA 4NE9A 521PA 1CZRA 4LJ9A 2J5RA 2ZYAA 2JGDB 2WUEA 2QA5A 3O8QA 4FX2A 1XTVA 3QKSA 4HPJB 3UTDA 4FMCB 5GV8A 1PSDA 2C07A 3IGFA 4C7MA 3HXOA 4HS9A 3H19A 5BWNA 3WGZA 2EG5A 4S12A 1XRPA 4O2AA 1FTNA 1RWWA 2C5AA 3EH1A 3HN7A 4NSNA 2BJHA 2IYOA 5LDGA 2DKNA 4PO3X 3BMQA 4AN0A 1RYHA 3JAMA 1F0KA 1XKQA 3WAKA 1UT5A 1I33A 3DT6A 4E94A 4HXGA 1X7WB 1TMKA 2I9PA 3F6CA 3DF9A 4PGGA 1NE7A 1W5AA 2JG3A 3C16C 3SM3A 1E3MA 5EYPB 4ZAXA 2ZZKA 2BGWA 1VPTA 4HUQB 4COOA 1U28A 5BN4A 1L6IA 5KKCA 2ZANA 4HEA6 4MWTA 3PUZA 3X1WA 3KUKA 4ARBA 2GCEA 3GXBA 4OGGA 1JN0A 4OLAA 2B83A 3TSZA 1LPOA 1KAMA 4U7TB 5IM5A 3ZDFA 4CUJA 3S81A 4U7WA 5EI5A 4LQCA 2PZ8A 5ECGC 4RADA 2Y1GA 3AIOA 3RGGA 3I1YA 2IH4A 4MQFB 5KS2A 4OHRA 5AHXA 3ANXA 1FRZA 2L42A 5BV0A 5JI3E 1T3SA 1B0AA 3DE5X 5ALQA 3SCZA 3EC1A 2OLEA 2V03A 4KXNA 3KSDO 3MSXA 4MSUA 4HG2A 1KHTA 4LYDA 3T5MA 3PSHA 4EYKA 4CM8A 4LHWA 4D4GA 3FCXA 2H5EA 1O9HA 4UMEA 5F1YA 2ID8A 1VE9A 4LPSA 2D2VA 3LDGA 4F11A 1RLTA 1YHYA 1ZDMA 2JFPA 1JB9A 2RK6A 2J5XA 2ZBPA 1YZFA 3JVUA 5DBHX 1E58A 2IYSA 4YMVA 1BX1A 4KWCA 3HKEB 4Z9XA 5LZ7A 5FL7A 3I30X 4BN5A 5A4MS 2DHEA 3DLIA 4IGAA 1TB4A 1KPIA 4H7PA 1EBFA 4PVDA 1VXOA 1NOJA 1WMEA 4CU2A 5K1ZA 1Z36A 4ODIA 3UWMA 4QUDA 4LZAA 2E4WA 1GV0A 2JKVA 4M7PA 4MMYB 5KB3A 1ISMA 2HA4A 2J7PD 3N75A 4R2JA 3GFQA 5H1YA 1WZIA 3W4IA 5EJ5A 1B0UA 4QU8A 5EPUA 2ZE6A 3P7MA 3K0CA 3VR3A 1PR9A 2O6HA 4R84A 3RHTA 3V34A 3PXUA 2F8MA 4MRMB 2J3EA 4IJ6A 4CIWA 3OTQA 5JH7F 4EJ2A 1OHHA 1TJNA 3CLSC 5IBCA 2BCEA 2EKZA 1HQYE 3SR4A 2GB4A 4BKMA 3R4VA 3DMFA 4YYEA 4LVUA 2ENWA 3TR5A 1J2JA 4PZUA 3GUYA 1LV7A 1I2DA 4QDXA 4Y0AA 1LSUA 1KEKA 4PR0A 1QE3A 2GHIA 5T8KC 1NA5A 2LBPA 4IYJA 1X7YA 2IU4A 3KFXA 2ZVQX 2F3QA 4LX8A 3CZCA 1E1LA 2HHJA 4QREA 2C42A 3WAGA 2YN2A 2NTJA 2I67A 3U44B 3CKLA 3NTOA 1EJ0A 1G8HA 1WOYA 2JEOA 3IEXA 4OBXA 5TMBA 3QMMA 5IVIA 1KJYA 3Q6MA 3H4VA 2OV2A 4I55A 4CMJA 1HV8A 4P4NA 4XVRA 5B7NA 1TJPB 2EDCA 2OAGA 3C4QA 2ES4A 1XV5A 2BHNA 1CPYA 1QHFA 2VPQA 4FONA 4RF3A 2IY7A 4WBSA 3GCWA 2KW5A 1RRKA 3DHEA 2G25A 1ZK1A 3PQFA 3TD6A 3ZXXA 2REOA 2CUNA 1RI1A 1D0VA 1SURA 2P91A 5D01A 1EMDA 4RZSA 2GN9A 2IYEA 1U4NA 1KVRA 1S1MA 1CV2A 1IEXA 2OK8A 2P2DA 3AYXB 3EBPA 1JE0A 5T3UA 3PHGA 1XNHA 3CMMA 2EQBA 3H05A 3R44A 3BGWA 4NAHA 4WPGA 5WRFA 2WQ6A 2C4HA 4XEUA 4CKBB 1RJEA 1UZNA 1OAKA 3F9RA 1E2UA 1RU3A 4YB8A 3R8XA 2L19A 2GZRA 3BXZA 3PDCA 1ZN7A 5AO9A 2PBRA 3HXKA 5EIAA 5FTJA 2VK8A 1Z5OA 3DR5A 5HUQA 3PE3A 3H1EA 5JAZA 1W4CA 1QC5A 2C94A 2HZ7A 4N3GA 4R1SA 5KWEA 4DY6A 3ICVA 2J4FA 3UAVA 4G2TA 2BLNA 4S0XA 5ALDA 1C1XA 4I9FA 3BB1A 2D7JA 4BO7A 4H7KA 2VWHA 1H0KA 3CUSA 2Y9PB 1NHWA 1IM5A 1JPVA 1UANA 2NP6A 4MVJI 2PH3A 1VE3A 2MU1A 3INTA 4D6PA 1IMOA 1OZFA 1QH8B 3R0QA 1T2UA 2C2WA 1M6YA 2VP6A 3FUCA 3IBYA 1JEYB 1ANKA 2GPJA 4A6PA 5IZCC 2DYKA 1AA9A 2X40A 2W4IA 2Y3IA 2FXIA 3O8OA 1DAEA 4BYGA 4FDUA 4DDWA 5JATA 1PR5A 1ZUHA 2IYLD 1V4VA 2IXFA 4EI7A 1W19A 4JOCA 3U6KA 1LK5A 3T9FA 4ZZ3A 4GMHA 2ZU0C 3GZNA 1B8OA 1CF4A 1RLOA 2O2SA 3AM3A 3CEMA 3FOCA 1PU2A 4GI1A 4X60A 4A0RA 5KU7A 4ZCSA 3K9CA 4EX7A 3A26A 3UHJA 5LZ5A 3PJFA 3FOZA 4XDHA 3VYVA 2JJ8A 1KO1A 4D4LA 4LDRA 3CW2A 1IXRC 2ZIXB 1NDQA 1C0PA 1HK7A 2CJWB 3BOSA 4XYEA 5FBQB 4ZJZA 1INLA 1TIPA 1VRCA 1T1JA 2D3WA 3DEAA 2FWBA 5C5IA 3GLGA 2FZ5A 2BCJQ 2IEYA 2ODNA 4NCIA 3UW1A 4YJGA 3D43A 3MAJA 3AZPA 3UJBA 4CR6A 2ZR8A 1S0UA 3K0KA 4RPIA 5DHRA 1FQKA 1E9RA 1YR6A 4XASA 1SCQA 3MFYA 2RJNA 3R5TA 4QELA 3TNFA 1NZFA 3STTA 1MV8A 3MT0A 2PSSA 4BO1A 4G1BA 4E4TA 4RL6A 1WTCA 3N2ZB 3RRNA 3JPYA 2NU9B 4D45A 1TEZA 4JP5A 3R7DA 2Q7XA 3VR3D 3CJTA 2HA3A 3DDHA 3CR8A 4NBNA 2W2TA 4D9GA 4WH0A 2QLTA 1SKAA 1E9EA 1J8VA 2G1AA 4AJ1A 3NCHA 3K6SA 2NPFA 4CW7A 4W9MC 1P75A 3E3LA 1LFAA 2HO4A 2ZAMA 5BOSB 2G1UA 1NKVA 1BWPA 2AEEA 2I29A 4RVUA 2QMUA 1NMZA 2YNMA 3G1TA 1T9HA 5TJHA 4ER3A 4Z7NB 3DZGA 3NTXA 1RYBA 4I2VA 1X1RA 1JXQA 5KPJA 1ADYA 4C0QC 3RRXA 1RMQA 3K32A 1QF7A 1EA5A 2VUTA 2QM3A 4GHWA 2XGGA 3FD8A 3C3BA 1BJTA 1XAHA 2J3KA 2PS9A 2YHBA 1R5NA 1P1RA 5EWMB 5HIMA 1SBYA 3C15C 3PD7A 3FMPB 2J09A 2PGLA 4BRUA 3SS7X 3DW3X 3W2HA 3FMFA 4DB2A 3FCCA 5DM1A 3KJXA 3RVPA 1ID8A 1V6CA 2ZDHA 4BB6A 2VN8A 4TQ9A 4J16C 4EY6A 4A9AA 1I36A 2VS1A 3G2KA 5CA0A 4KQ2A 4RMHA 4N01A 3RUIA 1VXRA 1SOVA 1SU6A 1VLMA 1GNQA 3W5AA 1LK0A 1ONNA 4MQEB 2JBHA 4WK0B 2B1RA 2O2HA 2OMEA 3A9SA 4MARA 4ND2A 5EAIA 4YCNA 1EFRA 1JR6A 2EHJA 3HMKA 3QPWA 5BUZA 2ZJ5A 5D7BA 3TLGA 4YT8A 4DR5B 4PLCA 2AMJA 1X87A 3GJYA 2WINI 4WASA 1VJ0A 5T3YA 3ZR4B 4RTJA 4AJPA 4QYSA 3HJTA 3SJUA 4DG9A 5I8PA 2KI5A 4M9RA 4EJSC 3ZY4A 3CXRA 4P08A 2FEPA 4PTYA 2UVQA 2DTDA 4PNEA 5H9WA 5JR3A 2VA9A 2OPHA 2RI0A 4YRTA 2XQJA 1YULA 1Y9JA 1TIBA 1T29A 2BBOA 6ABPA 4AJIA 3MXTA 3R6GA 4D9NA 4G9BA 1CF9A 4I7EA 3IPRA 4E88A 4RQUA 3NAZA 1XCPA 3E8SA 4BIMA 5ETJA 4ED9A 3EDMA 3WP1B 3RUFA 2BKVA 1H9AA 1M2NA 2CVZA 3CR7A 4A8TA 1XMPA 3WRYC 1C0EA 1JEOA 1MAHA 1NXPA 2P4UA 3RREA 5IS2A 3CEPB 1DC4A 2DFTA 2H4XA 4R83A 1SG0A 2J3LA 2NZVG 4EH1A 4DCGA 3TE7A 1GKYA 2QJWA 3OSUA 4L8YA 2A78A 2C0PA 2J87A 1M6VA 3CUTA 3GVCA 5EXDA 4A7PA 3PXAA 3ADBA 1PFKA 3P2MA 1USGA 4OMFG 3W9YA 3LGXA 5J3JA 4DPMA 1Q7TA 1SOAA 2ZT7A 3I9LA 3TLJA 1JDBB 1F2TA 3IX7A 4ETIA 4QXQA 2QE6A 2QUIA 2VWQA 1XA4A 3DVRX 4GT1A 1DKLA 5AJVB 1XRQA 4PRKA 3VU3A 4YMSA 4WDRA 1MXHA 3WYFA 1J9ZA 4FC7A 3CKYA 1UMDB 4JOSA 1MQAA 3E2IA 1VCNA 2JH8A 4LY6A 2X1VA 2G71A 2IODA 2QQFA 2R5NA 2ZCUA 1USKA 2GGSA 4G0MA 5EMHA 1FTYA 3Q9SA 4AU1A 2O8DA 2BP7B 5DCLA 3AOEC 3P5SA 3ZIDA 4UPEA 3FGPA 1JDJA 1KEEB 1ZFNA 3RVSA 5BN3B 1ENYA 2X6QA 3BFKA 1Z38A 1NVVQ 4CQLB 5KSWB 4KYTA 4TN5A 1UK7A 2XNHA 2NYRA 3CUVA 4LDQA 4YCSA 5DU2A 2WRZA 3KOXA 1BXRB 3U3DA 3KE9A 2BSQA 3N2YA 2MYPA 4I5GA 4YAUA 4ZALA 5CDSA 1G17A 1O9GA 1H2WA 4KQ1A 1EVKA 1PK9A 3ODPA 3T8YA 2HEGA 4OBBA 5G02A 2C59A 1AZSC 1M8KA 2J45A 3FPHA 3GEMA 3U3MA 4AKSA 4F1WA 2GWHA 2XVAA 2ZSAA 4JHXA 4M8KA 5BSMA 2L2QA 2OD9A 3WQQA 4EZBA 4N6OA 3AJ8A 1VLQA 1Q2UA 3IQDB 4NZNA 1H65A 5IC6A 5JXHA 3FKSD 1Y8QA 1B76A 2VDJA 1ZOOA 5BYJA 5KU1A 3V6LA 3I12A 4U7JA 3VM6A 1QMPA 3EMBA 4J43A 4XD7D 2PZEA 5B1SA 4LF5B 1TK3A 3CCBA 3KV3O 3OE7D 1GGMA 2DAPA 1MTOA 2V65A 3ICOA 2SBTA 3LECA 1YZVA 2X86A 2PZGA 2ROQA 4YBRA 3C43A 4IXTA 2FUKA 1BE8A 1YO6A 2IHYA 3H2GA 3QOFA 3PFGA 1PBNA 4GVLA 3UWOA 2WB2A 3DNPA 3OJFA 4B7ZA 2GVZC 2OGUA 4V2UA 3MWYW 1N2HA 2CL6X 2HMUA 4G5YA 4LGVA 4E2XA 3DLHA 1H1TA 1BSVA 1OXMA 2W4MA 1GQYA 3EDOA 3LXMA 4ZK6A 2ZRPA 4ZEWA 1OXXK 3KOZA 2QVLA 1NE2A 1PDVA 1OI3A 4KI0A 4EVIA 3HL4A 1E2EA 1LW7A 3KYCA 1SFRA 5C37A 3L7MA 1QP4A 4E32A 2C95A 5KQRA 3VJRA 5KX5F 1EFTA 2EZUA 4DM4A 3L8CA 4KR6A 1KDRA 1XWFA 2R2GA 1RFLA 1T8YA 1SIWA 2B94A 5B36A 4LAFA 3KTOA 4LTDA 2YWXA 3EOAI 1GUYA 1LGYA 1ZXBA 5A3QA 1ESDA 5IJZA 4BKOA 1FUKA 2I8LA 3Q88A 5AKLA 1ARZA 4KIWA 4Z1MA 2HFKA 1DELA 5CH5A 1NN5A 4TVSA 5C7IO 5CFZA 3JQ8B 2PUWA 5CVVA 3ST7A 3RIXA 1FXWF 1QH1A 3SIWA 2P5SA 1F48A 1PJ2A 1WXXA 2J6HA 2OGTA 4ND5A 4OATA 3PHJA 3LGAA 1UZLA 1WNFA 1TZBA 3U5TA 1ZJWA 3BDAA 4CODB 4WGGA 1DRWA 1HEUA 1SU4A 2VDWA 3ML1A 2XWPA 4OCZA 2XBLA 4KTVE 4RMJA 3MS2A 5HM6A 4DCPA 3KVRA 1BXZA 4JR0A 5JH7B 1YR8A 3T5BA 2X2PA 4PZCA 2IS2A 2I03A 3L7LA 1JHXA 2MTBA 3QUSA 4YRDA 3B5JA 3VNBA 2NVOA 4M4SA 4K9OA 4QOFA 3MWEA 2WKPA 3A1SA 4PU0A 1GTMA 5CA1B 3PKZA 1GO2A 4Q5IA 1OPXA 4GM0A 2Q5QA 1XPUA 1IN1A 1TE2A 1GQ2A 3JD3A 4C89A 4M87A 4ZHQF 5KVCA 2QN1A 2PGNA 4FFLA 2V0CA 5C0OE 1V16B 1V71A 4KSYA 2C2HA 3LSTA 2EX4A 4ARZA 1X1QA 5COBA 3JVDA 3D9QX 4BHTA 1N3BA 2B0CA 3MD0A 5CDYA 3HJHA 1YR7A 2PSEA 3AEUB 1I9CA 2H2WA 3DNFA 3QVUA 5FWDA 4HNVA 4B3JA 5TEWA 3JQFA 4IV0A 3QUTA 4KNVA 5CCDA 1MT0A 2GZ3A 3TVDA 2FSSA 2CCGA 5D6NA 2F1KA 3DZIA 4OH1A 1RQNA 3FAKA 1N78A 3C5WP 4JQYA 3PPXA 1XELA 3H5RA 4IQ0A 2QSYA 5DNEA 2WT4A 3T3IA 4MWZA 2HO5A 1L5HB 4FYVA 2PMKA 2ONYA 1F8YA 3RK0A 4IRXA 2AQ8A 2F1HA 2EEPA 4PPQA 2WICA 2AOWA 3C3KA 2XRFA 3RADC 1MG5A 5F7ZA 4GPZA 3OLCX 3UOGA 5LQDA 4Q9HA 1E1RD 1Z16A 3F5QA 1CNEA 3KAPA 5EWJA 4U5XA 5A4KA 4IEIA 1SKUA 1F2DA 1XG5A 3D2CA 4HB0A 4BLTA 1XZFA 5CX1A 1M2FA 5B3JA 4G81A 2AD1A 3VSEA 1UODA 1X7XA 2PLNA 2N75A 1DAMA 1OW3B 3L4BA 1FYVA 4L4XA 3T7DA 4F12A 1RM5A 3U9SA 3QU4A 1AJEA 1YB2A 1E7SA 4DIOA 4HWRA 4AIIA 3H1FA 4KXVA 4GWKA 3N28A 4PC3A 5JQGB 3D6JA 3H9CA 5E6UA 4NX2A 4G07A 5CNJA 3UANA 4ALIA 4BN4A 4C08A 1KO5A 1JZQA 2YOGA 2V54A 1EJBA 2DBZA 3SNKA 3MCZA 2HMWA 5KC9A 1DC8A 4UUBA 3LOUA 3SFVA 1SR8A 1USVA 2J3JA 2UZ0A 2YJZA 4J1QA 1A9OA 4RCZA 3UXEA 4GLOA 2ZWOA 1JMKC 4ZTUB 1ST2A 4GPIB 3DXYA 4FLMA 4DMLA 3L8HA 4RLSA 2P27A 1YD7A 3M3HA 4YQYA 2M6KA 4CZ2A 1J5EB 5IXYA 2WPDD 3A2KA 2GBLA 2QD3A 3MJTA 2JGIA 1FDUA 1HYEA 1L5VA 1JS1X 1KXJA 1NMXA 2HA2A 3EEIA 5E1OA 2JNWA 3SGLA 3WIEA 4GUAA 4AC9A 4B32A 5KYYA 1FXUA 1WMDA 2M6LA 3EULA 2I4IA 2QVXX 3AETB 1U8ZA 4JITA 4JK3A 1UXKA 1Y82A 4RXUA 2OO5A 3NHWA 1PLJA 1U0GA 4MQEA 1VSBA 2VHCA 4HZUA 4YAOA 3CLTD 2Z1MA 1BWRA 1QGUB 5DN6D 3JVVA 1OT3A 1JEEA 3A27A 2J5QA 4ON9A 4WESB 4OX9Y 3NAQA 1HQCA 3EVZA 4OB7A 3R7BA 4HTFB 3MJFA 3AERA 5FBLB 1FQOA 3VDXA 4WBNA 3B3GA 1DQSA 1YKFA 3RS2A 4CCWA 3BTUA 1QOZA 1N2EA 1UC9A 2H4HA 1DAIA 1XD8A 3N7AA 4KMMA 4PRLA 3SKYA 3T9DA 1LCIA 5CPBA 3MGGA 3SJZA 3V7UA 1QYVA 2GT1A 3EPHA 2O8CB 3PNQA 1Z2OX 5MHTA 3FSRA 1J9EA 2V74B 1AZLA 4ETMA 1EFRD 1NNUA 2H2GA 1BFKA 3LE8A 4OP3A 4PONA 1G8PA 2F8SA 1EWVA 4JYAB 2GEBA 2WF9A 2DY0A 2AR9A 2PKRA 4I1VA 2NZ2A 1AK1A 1VYUA 1PT8A 1MRZA 3X2EA 1T9DA 4LHSA 1U11A 4W7IA 3KTDA 2DLCX 1D2MA 1C3LA 3B2QA 2BUAA 2V7GA 4BQQA 3A6GA 1SBHA 2O20A 2AJTA 3AY6A 3HJGA 3MUNA 4FC6A 4MW5A 3X1YA 4MUNA 4BTLA 5IN4A 3C8HA 3OUTA 2ORVA 2HKIA 1RTTA 1BVUA 1GNSA 2H1LA 3N74A 3VUFA 1GKLA 2OORA 3IFSA 4RSRA 1M6VB 1FDTA 1YL7A 3NM4A 2XJ9A 3R7NA 3ZTYA 3MERA 1V11A 3IPAA 3V2HA 2CVHA 2PGJA 2PL1A 4EUFA 1J42A 2GK4A 5IJ0A 3NW9A 1Z2PX 1N0HA 4C4RA 1S9HA 1CVLA 1Z26A 1N34B 1WE2A 3LW8A 5ADWA 2BFEB 1NMSA 3NBUA 3VH1A 4BQIA 1T5IA 4DG8A 3LHDA 1R9MA 3GMTA 5JPIA 1ZBQA 3L6EA 4KUEA 4M0UA 1T9ZA 3FYDA 4BUCA 2PBLA 5H0IA 1LBTA 4UC0A 3HB5X 1QQTA 3VPBA 4R8MA 3R5KA 3RTEA 5TMEA 4TT3A 2HB6A 1TW2A 5L3QB 3UUWA 2YH2A 2B30A 3IE0A 3OEWA 5A06A 2E48A 2WZDA 3WKEA 2HNAA 2PSFA 3KR2A 1RIIA 3FWHA 4ECAA 1G3QA 5GGXA 4BMNA 4UU7A 4YJKA 2CSXA 1VB5A 3GX1A 1II8A 1QDEA 1PWXA 2G0AA 2W11A 2XYQA 2ZRHA 3D8HA 3G2PA 1I24A 4RVGA 3DMYA 5TPWA 3B9RA 1BVYF 3RU7A 5MGNA 4OREX 3H13A 1WV0A 3CLRD 4A6DA 3ZVNA 1DMSA 2XDWA 4JC0A 4RANA 2QOEA 4EI2A 5FIUA 3UJ6A 4MQMA 3AFOA 1XCMA 3N8NA 2TMKA 1Y3AA 5B6JA 5B12A 1OYVA 2HQOA 4YJFA 4O3MA 1JR3A 1XTJA 3O83A 2P5TB 2ADMA 2ISSD 1KK2A 4WBNF 4UARA 4G86A 3SU8A 4EVQA 4X66B 1GGHA 1CZUA 2F9MA 5I4CA 3RC3A 3RYHA 4FKMA 2F9FA 2I2DA 4Z8YA 4XX0B 2YVUA 3VQTA 3TX2A 1EFKA 3LC2O 5FLEX 1BE0A 4L8FA 2R48A 3AWDA 4AP6A 2FU5C 1L4HA 5IKPA 1OBHA 1YE8A 2PKCA 2YQ4A 3CT6A 3LKZA 1DT3A 1GRRA 3A1FA 3FNGA 1QO0A 3KJQA 4JKOA 5KYTA 1U0SY 1E60A 1D4OA 1FE8A 2PSJA 4Q3LA 1A9SA 1FJGB 3OE1A 4L5IA 1L2TA 4R1PA 4WHMA 4CF6A 4JLPA 3JQQA 1DC5A 2AB0A 2FQQA 4G5GA 4PLFA 4E5YA 2O23A 4DCTA 2O1SA 3M4YA 1KQNA 4D6YA 2E55A 2GBFA 1GKIA 3HFSA 3QFRA 3UMBA 4BBAA 1SA0A 1LWOA 3NWPA 3WJ1A 3CPEA 1IYZA 5IKXA 5ALKA 5FBVB 1DJMA 3QG1A 2JVKA 1W35A 4U2KA 3UAGA 4JI2B 2HGSA 4O4IA 5FV7A 5H80A 4NU8X 3PXCX 4RXTA 5TX7A 4BFWA 3LFTA 4O6VA 4FFVA 2AS0A 3PPIA 5FTLA 2G8LA 3DZDA 1TK2A 2BEWB 4B7XA 4E30A 3MTJA 4BEBA 1G5FA 3KR0A 1GJRA 2QTVB 3BULA 4O59O 2SICE 5JZBA 3WLAA 1RPJA 3E6AA 5JS7A 2W0SA 1GD1O 1NW4A 1DAGA 2GHTA 1WMAA 2C1XA 4POAA 5K4HA 4YAJA 3AY0A 2XWBF 1QV9A 4K2AA 2C04A 1NAHA 1NWHA 4LTMA 1KFCB 2P30A 3RDPA 4F9TA 1YMVA 2OCKA 3ROFA 1T8TA 4TZTA 2P9HA 4BZWA 1IZ0A 3EUFA 1THZA 3N6VA 5AHRA 1SRRA 1OJ7A 2ENUA 4MOWA 2HRQA 2AN9A 2VDOB 3L43A 4HDMA 4TTIA 2D6FA 4HAIA 5AH0A 2GSDA 1N9ZA 2PWBA 1JDNA 1CD5A 3G9ZA 1SBIA 5D2CA 1K7CA 1W5FA 4WEQA 4PRZA 5IAEA 2K7ZA 4JEUA 4JBLA 4L2IB 1T8RA 1WXHA 1JA9A 4V1CI 1ZMRA 3M5CA 1GZ3A 1GVNB 5ANRB 3AM1A 2Y2VA 4B79A 3WTBA 4KDCA 3IA7A 2NSLA 3JATA 1CHNA 2JS7A 1C29B 2Q0HA 1VSTA 4W8OA 5JCXA 5JAHA 4PC2A 1BE1A 1VGQA 4URZR 5J2UA 4PHGA 2XCUA 5IAKA 1CU1A 2CXTA 4KLRA 3FZYA 2ZM5A 3VR2D 1JKXA 2XE6A 1E5QA 1H6CA 1ZY2A 5IBRA 1CYDA 3DOCA 1XTZA 2X0IA 5F2KA 3VU9A 2KB0A 4YNBA 4M9UA 2PRYA 1R00A 1OD6A 3L05A 2OQIA 3RC2A 3FZGA 3SZ3A 5CDUA 3PWTA 5JAIA 2WSLA 1VI6A 2FY8A 3NRBA 2O8NA 2GZ2A 4R2WA 4EARA 3DMPA 3M1LA 2P35A 4RK4A 1XMJA 4WLVA 2VHZA 4FFWA 4DG5A 5DI9A 2IXTA 4J1TC 1N2XA 4N7JA 5ICFA 3K0SA 3QPUA 2ZZMA 1QKJA 2EYQA 4A91A 1VOTA 3OZFA 2R97A 2JC3A 4B34A 1ORVA 2KLHA 4KDFA 1DCMA 3Q3JB 2WIBA 1Q19A 1P1JA 1P2FA 1ZNYA 5KTMA 3ILSA 4Y9UA 2RI6A 1EVLA 2AOVA 1O0SA 2WJJA 3K1AB 4H59A 3GEDA 4LMPA 1FXWA 3OPYI 2K5UA 3QA9A 3I9OA 3FZEA 3K1YA 3QFHA 4ZCQA 1E59A 4LJLA 5JQGA 3BRWD 5AKGA 1P3DA 2A9OA 1HDYA 5E6RA 1U1DA 1T0BA 2IZ0A 2QSUA 2XHEA 1EG7A 3OJEA 4G0OA 3RK1A 1A27A 3H2HA 3ZV3A 4PN3A 4ZHQB 4X6LA 1QFMA 1V3VA 2YQZA 3Q1KA 4KH0A 4FFOA 4ZDWA 4BLVA 2GXSA 3L01A 1PUXA 1TKRA 2IY8A 3UOWA 2WJHA 2O1EA 5CIQA 1PWEA 1MG0A 1AKEA 5AQEA 5CEJA 2WT8A 2DR3A 3TZEA 3X3HA 4A03A 3RHSA 4A0FA 1K7YA 5TF4A 5AVSA 4PIPA 3LZDA 4GQAA 2P1DA 2YVQA 4QXAA 1OYOA 2V1UA 4MLPA 2I6GA 4H6XA 4LF6B 4MQUA 4Q1DA 4D5GA 2HU8A 2ZRMA 4DUZB 2ZB7A 4R98A 4R6WA 4OHYA 1UJNA 4P5PA 3UK0A 3ET5A 5DMXA 4YUAA 1Z0KA 4JI8B 1W2HA 4UNRA 3PU6A 1KO4A 4JBHA 3EQ8A 3EXHB 2I6SA 4GWLA 3OHSX 1QHYA 4KFUA 4WD3A 1ESEA 3ZCPA 4DR2B 1PG0A 4J1TA 3UJDA 4OAPA 2JLSA 5K0FA 1MOSA 2DPXA 2A0KA 2YRFA 3G2MA 1BCSA 2IDJA 4KQMA 4NCKA 4LDNA 4Q3EA 4CMIB 4B6GA 1E2JA 1D4FA 2QJTA 2XMQA 2IELA 1JR3D 3HUFA 1EBUA 1CUYA 4FQ5A 2JGAA 4L75A 2XUGA 5FD8A 1PL6A 1KAEA 1TQDA 1ZHHA 3HYSA 5JMOA 2QX8A 1OLSB 1UMBA 1XL1A 1E92A 3RROA 4BX8A 2Q45A 3EXFB 5BNFA 2EL7A 5FPKA 2WE8A 4HF7A 4IIFA 4HDRB 1E66A 3G8BA 3RG2A 1D3AA 2B7CA 3GOHA 3PEUA 4OMCA 5J47A 4P53A 5HFNA 4KNYA 1JVBA 2PGOA 3U0VA 4BNYA 1S6YA 1R6VA 4C76A 1JJIA 1NJ2A 1DCTA 5KHOC 5BUCA 3T1QA 4UXIA 4XJSA 4L3WA 3BWVA 4ROSA 3GPLA 1OLXA 1NMQA 4KVZA 4OQMA 4FU0A 4NPHA 1NN3A 4R31A 3WWPA 1ADGA 2I78A 5HM8A 1ZIXA 4PCAA 3TD9A 1H6AA 1H66A 2QYOA 4NYIQ 3KUXA 3TKAA 2WAXA 1I6WA 4FKZA 1WABA 1IXKA 1X6VA 4L8GA 1J33A 1GYPA 1K9VF 1REQA 4B3BA 4E6EA 4A26A 1WULS 4R0VA 5KOHB 3F8TA 1VLVA 4YQFA 1SCIA 3SQDA 2FDXA 5HPYB 4D8UA 1XTSA 3RKUA 3PFFA 3E9NA 3JQEA 2PYIA 4MW6A 3RFUA 2ZWIA 3DBHA 4TMFA 4CQMD 5DTIA 3WICA 1W2WB 2BTQA 2AFIB 2RH5A 4E5NA 3AKCA 1HPLA 3U2QA 4DCOA 3CLUD 4O4IF 4G1CA 2ORIA 3R9KA 2PZBA 1Z0IA 3QVXA 1QIMA 2IZ5A 3M2PA 2CMGA 4GE0A 2DFPA 5F7JA 5CP8A 4N5IX 4KGVA 3D54D 1DEXA 4WLEA 5C8YA 1R37A 4GSYA 4B9AA 3THXA 4XM0A 4IJVA 4ZZ2A 1E77A 3OQ6A 4KE7A 5IF3A 3KB8A 1WQ1R 2G6TA 4RMIA 2ZBGA 3HNOA 3QUCA 2XWJI 1MTZA 2Z2XA 4R3WA 1D4ZA 3TOCA 4EW2A 5J4KA 4JLNA 3V46A 1ORDA 1UZUA 1M34A 1MB2A 3AEYA 4LDZA 1P5FA 1ZA1A 3DEJA 4DRXA 2BBSA 5EJ2A 1MDFA 3ICCA 4HPWA 3QU9A 1K98A 2FOIA 1C1DA 3L0ZA 4AL4A 4ALMA 1YHZA 2WTEA 2A5LA 4DGQA 1BXGB 1NMYA 2YXNA 4CL2A 3B38A 1E20A 1LQ2A 1L5ZA 5DWVA 1WP9A 2N0SA 1Z17A 1VMEA 1NRJB 2GZSA 3MN1A 4KIUA 3HACA 5FO0A 3TIFA 4J2HA 4BX9A 5M7EA 1N92A 3VOTA 3H5OA 3ZWYA 1E79D 4RHYA 2P3OA 2B1JA 1EPUA 4ZT6A 1DUIA 4AICA 1NVMB 5EUMA 3HBAA 2EKQA 2C3YA 2HDHA 4IF4A 3NTLA 4HGPA 3ZZTA 1KNXA 2WKQA 4YRJA 5DM60 3R2JA 4Q3NA 4KCGA 2JKZA 1U1EA 5D5PA 3AR8A 3FI9A 3V4SA 2IWRA 5L8VA 3KOYA 2R6HA 1M1NB 1IOVA 3DQZA 1CJTC 2WG1A 3LLMA 2H8KA 1IZ8A 5JALA 1IPFA 1TEXA 3DLPX 4BFUA 1PQUA 2CW5A 3LLVA 4GOMD 4PQRA 5MFPA 5K3BA 1N6NA 1NBMD 4KQGA 3V8QA 2PQMA 4I46A 2Y93A 3LDFA 4GPAA 1Z12A 3QWFA 4NMMA 3USCS 4HR7A 3GLFA 4KAFA 1QBKC 1PDOA 4JLVA 1UBTS 3EQ2A 4QOSA 1UXHA 2J41A 3WR5A 2XYRA 2HAEA 1XCBA 1ZEJA 4CLOB 3BXXA 4K9DA 4NMLA 3HADA 1C41A 4FFNA 4KQIA 5JASA 2LE0A 1UDXA 4P32A 1K8XB 3PL5A 3SX0A 5AVTA 2A5JA 3FYCA 2AG5A 3RODA 1G8YA 1HNXB 3GQVA 2BEWA 3GY0A 4QPZA 1ZZGA 1RTKA 1DB3A 4JB2A 2NTNA 3OIDA 4MPRA 2CL0X 2ZXEA 2I2XB 4U8HA 1GZ7A 1GU7A 1P1CA 2G07A 4M46A 1NW9B 2C77A 4EG8A 5EY5B 3FLAA 1N2CE 3JAWB 2E4XA 4HWTA 2FX3A 4MV0A 2OORC 3TIIA 2ZW9A 3QE0A 2I4NA 5BURA 1TVKB 5K3FB 3BQ9A 4DCMA 4UTRA 1PP4A 2DPGA 4P4UA 2XQVA 4HQKA 1S4QA 3DV0A 1XSEA 3H1BA 3KK0A 5JSUA 3PICA 4DCUA 2NN3C 3VNQA 3NGXA 4P9NA 3COYA 4NF2A 3WMGA 1UWCA 1GTG1 1HTTA 3R8FA 1W0KD 2DHQA 4X63A 5AICA 5HF9A 4N0MA 4XPIA 1EM8A 3A6PC 4V0KA 1YJAA 2GPBA 1CUEA 4EFKA 4DJDC 3KV1A 5BN5A 5E3HA 2BKXA 1YV9A 3FMIA 1FRNA 3UMMA 1SWWA 4P84A 1P4JA 2GFQA 2XODA 3EW7A 4WN9A 3VHLB 2PJDA 4LRUA 3H1AA 4TUYF 2OBMA 2FOXA 3IPCA 4HO1X 1IZYA 1UIMA 4XQCA 4BNUA 4CKZA 2BFCB 2IYPA 1XDDA 4Q4AB 3PC8A 1U3FA 1XDWA 2G88A 3TTUA 2VP5A 3ZIAD 5CDHA 1I4OA 4E09A 4PSUA 3ZKAA 2B3DA 4GU5A 3A25A 3TRFA 3Q8LA 2ODWA 1UC4B 3QVGA 1JRLA 4C0LA 3G5UA 1ILEA 4KMRA 1Q20A 3RS3A 3SVZA 1D1TA 1NBIA 2WA2A 2WJWA 4QQFA 4YWHA 1L7EA 3U9LA 1OI2A 5IC4A 5EKDA 1R6UA 1DEKA 4K87A 4YXWD 4M22A 1UBCA 1AC5A 3O94A 4GYKA 4TLEA 2XYGA 2P2NA 2ZUVA 4EWLA 2R1TA 4WFJA 5LYYA 1VMDA 3QELB 4B45A 3T1VA 5C1IA 4Q7JB 1A2QA 4ZU6X 4ITUA 3IP8A 4YJHB 2WHQA 4MWCA 5IKEA 6REQA 3IP6A 1CHDA 1QG2A 2GD1O 4XB1A 2CNNA 1IY8A 1V39A 3VNSA 3VVBA 1X80B 3HBLA 4XM1A 3OVMA 2O1WA 3E7DA 1GT6A 2B2XA 2YWCA 5J4LA 1CQJA 2VOJA 2YJ4A 2C4TA 4UNSA 1FNBA 3AU9A 5DBEX 4J8PA 3E5NA 5JZMA 3UV7A 5KNCD 4I66A 4HQLA 3NDJA 4NMHA 5HMLA 3ELWA 3VHXB 3F2VA 2CFOA 3AOEA 1LX7A 3TLXA 5ICSA 3NXSA 5KHLB 1M2GA 2W4QA 1MORA 1VBMA 2MYTA 3BXFA 2JIZD 1C30B 3ED5A 3K8YA 3QYPA 4QX6A 1GZUA 4ARCA 2QVBA 3RYFB 4UCQA 3S40A 2CFCA 1Y1QA 2FUG6 1MQSA 2AW3A 4Q15A 4I99A 3CB2A 5B1HA 4KAJA 4P58A 4RHUA 1X9HA 3UGTA 1Q1GA 2O07A 2VK4A 1WXIA 1CY6A 2XD4A 3E03A 1JQAA 3KWMA 3OPNA 4GE3A 4NBTA 3NT4A 4PGMA 3U09A 4AN4A 5K2MA 1WUKS 3H8SA 1B15A 3R0VA 1QDLB 4RZIA 2F55A 1L7VC 3RSFA 3CY6A 1AZTA 2FX5A 4HH4A 3GN2A 4M88A 1T2CA 3K9HA 1G9XA 1AQLA 3E58A 3S1AA 1ZHFA 2QW0X 4ZVVA 4DJEC 2VTBA 1YSCA 4AUNA 1NSTA 5G0WA 4TTVA 2ECKA 3RFVA 3GRUA 2Y68A 4BNKA 1PCXA 3AF5A 3NM5A 4J3FA 1Y81A 1ECFA 4IUBS 4J07A 4D4IA 4DLWA 1ODJA 4K1LA 2BISA 1M9NA 1X77A 3ZWOA 3L7YA 4JBIA 3L1UA 1ZH8A 3MWEB 5JJCA 1JT9A 2XZPA 3CC8A 3SSOA 1C9YA 2QN8A 4K9KA 4OHZA 2NO7A 3DB1A 5I51A 3I2FA 3HA7A 4PZ9A 4HBZA 4I19A 3DE4X 3TFOA 3ABQB 1K8QA 2O2JA 3IVXA 3MCWA 3N6RA 5KCZA 4BKUA 5EKUA 1J8DA 5EE5B 5CITA 2Q6KA 2DY1A 1JU9A 1HSZA 2G9RA 4B85A 2B34A 3AHDA 4ITRC 4W1QA 5AW2A 3GRKA 2VYQA 3TW8A 4LDAA 1QDUA 1RKXA 4LCEA 1KQGA 2P75A 5K8JB 4ZP1A 1Y6FA 1M3SA 3SC3A 1FSSA 1AUQA 2E49A 1OXTA 4PBTA 1N8NA 1Q1BA 1MC1A 2Q6IA 2XUOA 3SF0A 1RYFA 2FV8A 2OY0A 3IHWA 1VHLA 1N75A 1IL0A 3OKPA 4DIBA 3UO8B 3WV4A 2DULA 1IWPB 2PNJA 2UZIR 4G09A 3V80A 1F7VA 3FRJA 4DDVA 2QE7D 2CT8A 2I65A 3NCTA 1QGAA 4ROTA 1XZEA 4OQQA 3V33A 4D46A 1WD5A 4XWAA 1J0AA 1J5PA 4U3JA 2VYND 1E1YA 1I1NA 3FPGA 4MJXA 5JANA 1CTQA 2HNBA 4Z1OA 1J22A 4GM4A 4FB4A 1UFVA 2HRZA 1NVFA 2LPMA 3L8MA 2YJ6A 5KX5A 3TR0A 1ZH0A 2WVAA 1Y1LA 4WGFA 4F4FA 2LDBA 3PLAE 1MOZA 3TOSA 3WKDA 4EY8A 4JVSB 1TVMA 4O33A 2FPGB 2R7LA 3NHSA 2IIQA 2OBFA 2XUIA 4KN9S 4EY4A 2BM1A 2O48X 2WFZA 3UT5A 3WK4A 1GOTA 3NVMB 1KJIA 4Q9LA 4BP1A 3LX8A 2G4CA 3QNMA 4QEDA 4QUKA 1XF9A 3G23A 2TMDA 3HCNA 4K81B 2NP7A 2IOYA 5B4VA 5TPZD 1ZK4A 1DUSA 2YMQA 3G1UA 1U0LA 3GJ4A 1QFXA 3QV2A 3QXJA 2Q1SA 4I4IA 4J7CA 4OJKA 4W6ZA 1RHMA 3RHZA 5M04A 4BKPA 1X42A 2NTYC 2XCRB 3A3PA 3HG7A 2Y0PA 3PEVA 2XF2A 2BH9A 3BRCA 3DZ8A 3TSAA 3UM9A 2WYHA 2W71A 4YMWA 3BMXA 3B7GA 2PKWA 3ANYB 1C1XB 3TRJA 5ERGB 3A0RB 1I30A 4V0MA 1OGJA 2WNIA 5B37A 5L45A 3GJ6A 1EFLA 1S7GA 2P6OA 2WJAA 4IS2A 2GAAA 1PJRA 2XCIA 2WMYA 1L4LA 2QB5A 1VSVA 1Y1TA 2Q46A 1NRXA 2ZJAA 5TGDA 4H1HA 2QRNA 4BCBA 2NO9A 2XZLA 2FJUA 3EB9A 4BTEA 2GTHA 1G21A 1E94E 4WECA 4BZZA 2CV2A 2WA1A 3PGLA 5DGTA 1BS1A 1C81A 2GM3A 5H16A 4J0JA 1ORIA 2A7QA 2IYNA 4KQKA 1NQVA 3CZ9A 2IDZA 3IODA 1PVDA 4Y1RB 2F6RA 4E3ZA 1JIUA 1R8JA 3BSFA 3E5RA 4U6NA 2H2DA 3VRHA 1RKUA 2OCGA 2EGGA 3QJYA 1RE0A 2JRCA 3BKWA 3KD2A 2HJSA 3P96A 5M2QA 1MH1A 4KFRA 4C7OA 1WMBA 3EYWA 1C7EA 3OUUA 2EEZA 2ZSDA 1EB9A 1YZUA 3BAFA 4DF3A 5COAA 3AEKA 3K3PA 1NBME 1NR5A 1OX4B 1X7WA 2AQIA 3LHIA 2CXOA 3GJTA 5L3VA 5LMCA 2HXSA 4E33A 3DG9A 2VJYA 3FOEC 3ZHRA 1TMOA 3QTLA 3QHQA 5CK5A 5HJ2A 3GLGB 1DV1A 3R5FA 4YUWA 1Q3TA 4UE2A 3VI3B 3ROTA 3E1SA 1OX6A 2AFHB 2XV1A 1UBJS 3PXXA 4L08A 4AULA 2OBLA 1UIRA 4ZYYA 2NSHA 3W3AA 3AEQA 2Y1OA 4NBWA 4NKRA 4O29A 4C5CA 1XXLA 2QXYA 1UAYA 4BU0A 1JSLA 3WG9A 2J3HA 3VPHA