2ZB2A

Human liver glycogen phosphorylase a complexed with glcose and 5-chloro-n-[4-(1,2-dihydroxyethyl)phenyl]-1h-indole-2-carboxamide
Total Genus 311
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
311
sequence length
809
structure length
798
Chain Sequence
ENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPNDFGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKASKFGAGTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glycogen phosphorylase, liver form
publication title Synthesis of 5-chloro-N-aryl-1H-indole-2-carboxamide derivatives as inhibitors of human liver glycogen phosphorylase a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 311
structure length 798
sequence length 809
chains with identical sequence B
ec nomenclature ec 2.4.1.1: Glycogen phosphorylase.
pdb deposition date 2007-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00343 Phosphorylase Carbohydrate phosphorylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2zb2A02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2zb2A01
3ZCPA 2IV7A 2QNBA 3UYKA 3C48A 1ABBA 2GEKA 7GPBA 3L01A 3G2JA 4W6QA 5TMDA 1IXYA 2ASVA 1NVKA 4REMA 4X6LA 4KQ1A 3VUFA 2GPBA 3GPBA 2QN8A 1PN3A 4X7MA 2G9QA 4N3BA 4LDPA 3C4VA 1GG8A 4HWGA 1SXQA 2ECPA 3PE4A 3CEMA 5IKOA 3OT5A 3NAZA 2BGUA 1AXRA 1KTIA 5JTUA 1AHPA 2IUYA 3DZCA 3L7CA 2XA2A 3BD6A 5ENZA 3RT1A 5LQDA 1GPBA 2F9FA 4FKZA 3G2KA 3Q3IA 4M60A 1P2BA 1Y6FA 1P29A 3E3NA 3E3LA 4HLNA 1Z62A 1SXPA 1WV1A 5TMBA 3MTBA 4RIGA 4EL0A 1JG6A 3BCSA 1RZVA 1GPAA 1PYGA 3E3OA 2Q6VA 3T5TA 2PYIA 2QRPA 4Z5XA 4XI9A 1RZUA 3ZCUA 1EXVA 3EBOA 3IA7A 4KQMA 3NP7A 1NOJA 3CV3A 2R4UA 2XCUA 4GZ6A 3T3EA 1XKXA 3DDWA 3G2HA 2ATIA 2F3SA 5BNWA 3VUEA 3GUHA 2QN1A 3HBMA 2C1ZA 4N3AA 3T3IA 3CUVA 3COPA 3FROA 1JG7A 3NB0A 3TOVA 2VCEA 2XA9A 1WW3A 2HY7A 1IIRA 3ZCQA 3HBNA 4GPBA 3H4IA 2GT1A 2F3PA 2FFRA 1L6IA 3ZCTA 3NC4A 5JTTA 2QN2A 1A8IA 1JIUA 1WW2A 1NOKA 2QLLA 3SYRA 2GPNA 1C8KA 9GPBA 1GGNA 1F0KA 4YI3A 4EKEA 2QZSA 4CTMA 1XC7A 3DD1A 3Q3HA 2G9UA 3VDNB 2BFWA 1FC0A 1Z6QA 1F6DA 2F3UA 1C3JA 1WV0A 1NLMA 1E1YA 4QLBA 3BCRA 3TSAA 3IAAA 1C50A 3SYMA 4NEQA 4MICA 3G2LA 2X0DA 3DDSA 1XV5A 3MT8A 4AN4A 3OTIA 2AMVA 3D0QA 3BD7A 2AW3A 3O3CA 1HLFA 1Y6GA 4RIEA 3QKWA 1LWNA 5TVGA 1NZDA 4N9WA 2SKDA 2F3QA 2GPAA 1VGVA 1Z6PA 4BFCA 1L5WA 5HXAA 3NP9A 1L5RA 5DLDA 2VG8A 2FETA 2O6LA 1L7XA 4NC9A 2PRJA 2SKEA 5GPBA 3CX4A 2PQ6A 4MRAA 3CUTA 4GZ3A 4F97A 3MRVA 1YGPA 3OKAA 3OTGA 3S29A 5IKPA 3NCHA 1YA6A 3MSCA 2XA1A 1P4JA 3S28A 4AMGA 2YJNA 3CUUA 2SKCA 4X7RA 4LEIA 2IYFA 1UQUA 2IEGA 5DU2A 4G2TA 3MS4A 2QRQA 3T3HA 4EL5A 3T3DA 4CTNA 4F9FA 2C4MA 1L5QA 1PNVA 4WHMA 2JLBA 3MT9A 2GEJA 4F96A 3MRTA 1P4GA 2G9VA 4MI6A 4X7PA 4L22A 3G2IA 1E4OA 2XGMA 3MTAA 3MS7A 3ZCSA 8GPBA 2H1HA 2C9ZA 3VDMA 2R66A 4WADA 2AZDA 1FA9A 3HBFA 3MT7A 3OKPA 4RIFA 1FU8A 1B4DA 2R68A 3NPAA 4YUAA 1NZFA 4RELA 5D00A 2PRIA 3MRXA 1BX3A 4EJ2A 2ZB2A 3RSCA 3G2NA 1M5RA 1V4VA 1PSWA 2AV6A 1XOIA 3OY2A 1FTYA 1QM5A 2QN3A 1FTQA 2C1XA 3OKCA 2GJ4A 2R60A 1WUYA 3D1JA 2XGSA 2XMPA 4RIIA 4XIFA 1O6CA 3C4QA 4BQIA 2X6QA 4FZRA 1GFZA 3L79A 1FTWA 4MHSA 4BQFA 2ACVA 3WADA 1L5SA 1J39A 4NESA 4BQEA 5DXFA 3TAXA 1K08A 2QLMA 3BDAA 4MI3A 3WAGA 2VCHA 3D0RA 3MQFA 4CDRA 2JJMA 2VSNA 1UQTA 3L7DA 4N3CA 1P4HA 2FF5A 3HBJA 1JEJA 1QKJA 4MHOA 2QN7A 1FS4A 3H4TA 4M7PA 1WUTA 2ACWA 2XCIA 4AY6A 2GM9A 2WTXA 4EKYA 5I45A 2IEIA 2BGTA 3T3GA 3MS2A 3CEJA 4GYWA 4RENA 4GYYA 3ZCVA 1JIXA 2XGOA 2PYDA 3OY7A 2P6PA 2OFFA 2X0EA 1Y8ZA 3BEOA 2QN9A 3BD8A 1P2DA 5C1DA 3CUWA 1RRVA 2JZCA 1C8LA 3S2UA 1GPYA 2G9RA 2IYAA 5D01A 3S27A 1XL0A 6GPBA 5TMEA 4CTOA 1FU7A 3RHZA 4AMBA 1XL1A 3QHPA 2R4TA 4RIHA 3S0JA 3ZCRA 1UZUA 3MBOA 3PE3A 4M83A 2H1FA 4GZ5A 4WACA 1EM6A 2QRHA 3CEHA 1NOIA 4N39A 1K06A 1FU4A 1H5UA 1L5VA 3EBPA 3L7BA 3AMVA 1P2GA 2QRMA 3UYLA 3L7AA 4YI5A 2VSYA 4RBNA 3T7DA 2IV3A 2IW1A 1Z8DA 3Q3EA 4PQGA 2QLNA 1GZ5A 3BCUA 2X6RA 4KQ2A 2QRGA 3CUYA 1JIVA 2KS6A 3MTDA 3WC4A 1LWOA 4AY5A 2X0FA 3OTHA 4MI9A 3RSZA 2BISA
chains in the Genus database with same CATH superfamily
1F8UA 3EFBA 4R2LA 1HYEA 1GTSA 3NHPA 1O6GA 2V7XA 3AU8A 4FHFA 4DA7A 4GYJA 1FRFS 1L8XA 1QZZA 1SHTX 1CZKA 2AFRA 3C48A 3EXAA 3L6UA 3SX0A 2A9KA 3ZZNA 2GEKA 3DFFA 1PZGA 4KRYA 4OJNA 1KR5A 2VPXA 3I52A 4NICA 1CVIA 4K9KA 2JRCA 2I3AA 3THXB 1FCJA 4D9IA 4FYMA 1UBTS 4IMJB 4PFJA 2BRUC 4K1XA 3CF6R 5LWQA 1P9NA 4TTRA 1I0IA 1R64A 2HWKA 1P18A 2W90A 2BV3A 4INPA 3RUHA 3MM4A 1P7PA 3HUUA 4M49A 4TRRA 3EZYA 1XRSB 3DOUA 1RWWA 1AS0A 4OI2A 2HJRA 2FXIA 2I22A 3OLZA 2PKYX 4K5QA 4US1R 5FHRA 5T67A 5DKFA 5DTMA 3M9LA 5C9ZA 3VPXA 1PJZA 4BQQA 1JLLB 3L84A 5EPUA 3RBVA 2JK0A 4AWAA 1AVTA 2CDRA 3C24A 5ENDA 3I76A 2JIZA 1D7AA 1H9BA 3FNGA 3FPSA 1J5EB 1EX7A 5CX4A 5AVOA 3W34A 5EWMB 1DKNA 4YMSA 5KDDA 3X1XA 3VKGA 4X61A 1UBUS 4F11A 1KJYA 4F3CA 2RCNA 2QF7A 2XE4A 5JSHA 5A62A 1IUKA 3ABIA 3C3XA 3M1LA 2HK9A 3B8EA 4QDXA 4YMIA 4B32A 4BWGA 2IS1A 3QSYA 4L02A 5KNCD 2O8FB 1HEIA 3NNDA 3LVFO 2PWPA 4PX9A 4KWIA 2JGIA 1SBZA 4YRRA 3LLSA 3ZJUA 1GT91 1YI0A 1H4QA 4J6EA 1L5HA 1G291 5AFSA 2J6BA 3T38A 4M1YA 2HI0A 3HTXA 1IQUA 1CFJA 1N5RA 3GYBA 3QE2A 2QSYA 5EMHA 3T5TA 2X76A 1HC7A 2PFGA 2PYIA 1N6OA 3QXJA 3HHPA 4U0KA 3UXMA 4UBKA 4KGXA 3HUFA 1CB7A 2A7XA 3IMGA 2HF2A 1MFZA 4AJ9A 3GL9A 2WG0A 2GXQA 4XUCA 2O0MA 3D54D 2FWAA 4N12A 5KYKA 3ZGNA 3QOFA 3P0JA 1IZZA 4XWTA 1H1TA 1OD6A 5GM2A 1L1EA 2PWYA 3WK6A 2EKQA 3JATA 2AYXA 3M7IA 3FIJA 2AMJA 5C4GB 1HE8B 1LTQA 2ZJ4A 2Q5IA 1WF6A 1SQ5A 2LCIA 4D57A 1SCUB 1BDIA 3KJGA 4YCBA 4IF4A 1H2XA 1QH1A 1HDGO 1P0QA 5FOWA 4E70A 2QTRA 4L6IA 2ZUEA 1KWGA 2XWPA 4CMJA 2GLUA 1NNUA 1ZOLA 1GKIA 2DQSA 2JIDA 2B3DA 1XEXA 2FMKA 3EIHA 3HWX1 3NEYA 2V7QA 1NATA 3REGA 1UK7A 6REQA 1OY1A 3FTDA 1GUYA 2X8LA 3I2JA 4R1SA 2JLUA 4MUJA 3GEDA 1VHTA 1NSFA 3ZGOA 1OLOA 1DNPA 2BHTA 1XT6A 1HO3A 4KQKA 1T9GR 2F3PA 3ROFA 3KSRA 4XUEA 3IVGA 3SC2B 5J9FA 3FWPA 4XDZA 4FDUA 3VU1A 3AUKA 3W6OA 4CU5A 3J7AC 3NIWA 1T4GA 4PBSA 2QIPA 1EDZA 4IXWA 3EUAA 1JXOA 2HK8A 1JL3A 4E12A 3JAKA 4A2PA 2ZYIA 1YRYE 4O4IF 1DTSA 4RNDB 2B21A 4V1CA 4B3MB 2XUQA 4YI3A 4N5MA 4AYXA 4ZK6A 1XC7A 1QKIA 3DD1A 3HYCA 2EKPA 1TX4B 3KZ1E 4PNHA 3W8EA 2H52A 4KO2S 3DC2A 5A6VA 2LP4Y 3LKZA 2D1YA 2OGUA 1F2UB 3DLBA 2X40A 2ZRQA 4KXFB 3U3JA 1ULBA 4HC4A 3FG9A 2WVAA 4OQZA 5K8TA 1S02A 4UTPA 1A4RA 2H4FA 2PX8A 3AWDA 5LQJA 5C1PA 3SYMA 2VUHB 1X7WB 3NDJA 4NEQA 1U5AA 3EQZA 2E4ZA 2EEZA 4CEHA 1RAHA 3MEQA 2HWXA 1CY1A 2PMFA 2VHUA 3K0EA 1J2EA 3NBFA 2OPHA 1E2FA 3FCOA 4XFKA 3R3JA 3LOUA 1SWVA 5F77A 4ZOLB 3LX6A 4DC0A 3D0QA 2J0UA 1J9EA 3G68A 1TDJA 1Y8RB 1E96A 2AEMA 1W52X 3OM8A 3GHHA 2RGEA 1BD4A 3FAKA 3LQFA 4HG2A 2OCYC 4N9WA 1EUQA 3A2MA 3ICPA 3ME5A 3AR2A 3IAS1 1VGVA 1U4SA 5DNAA 1YKFA 4L8FA 5GJWC 1NW5A 1Z6PA 1JTFA 3ABSB 4KZPA 2QZ4A 4XEUA 5K3AA 5T5QA 3Q8LA 3P2YA 2W8BA 5FTJA 5BSHA 1TKRA 2M1ZA 1J6UA 4E5VA 5JVDF 3SBEA 4EY4A 3TTXA 3BJRA 3ZEAA 4CLOB 3PNKA 3R7NA 4GXTA 4I1IA 1FFEA 5HKLA 2R86A 2DXIA 1A50B 5COBA 4YY3B 1W5FA 3MTIA 5CFRA 4MWTA 2XBLA 5HF6A 2H7CA 2R8YA 4K9RA 2WUFA 3V5NA 1HEUA 1XDZA 3UZUA 3ZLTA 2ANCA 3VHXB 2XKBA 3GP5A 5A0VA 2ZSIA 4XWKA 2XT9A 4ZHQA 3UK2A 3DTVB 2A92A 4O29A 4QC2A 5EPOA 1DV2A 5MN6A 2GXUA 2F1RA 4FOTA 2Q4TA 2WJ3A 3D5EA 1ZOOA 4LW8A 2H1CA 2QSZA 3JSAA 4GPEA 5IANA 2BFAA 2FEPA 3M1IA 3NV9A 1OYOA 1KGDA 4X7RA 1ZN7A 3KCQA 5T3UA 1JW9B 2ZIXA 1KFCB 2FPUA 5EXTA 4MQFB 4X85A 1I3MA 3HDTA 1CR2A 4LBZA 3D1VA 4K9DA 2VEOA 1N2EA 3T3DA 1CU1A 3UKDA 4H3KB 2DT8A 3CMCO 3FKSD 3DL4A 4AKGA 4F9FA 4IWXA 4CMEA 1PIWA 3UWSA 2RBEA 2HKIA 1MFPA 3OHSX 3P2KA 4LOLA 4YCAA 5F1PA 2JASA 1G8GA 2NXCA 2UUOA 1ORHA 2QXTA 4IDPA 4YNBA 2XVXA 3KALA 4KUGA 2BR3A 2V74B 1BE8A 4IHJA 5IVIA 4JROA 1NPTO 5T6BA 2H1RA 4A0GA 1VLQA 2QM8A 4WJLA 1JDBB 1HT0A 1US8B 1SCAA 2H00A 4P3NA 1W1IA 3A1TA 1U80A 3BAFA 1NNLA 2DPGA 1PW5A 3R7DA 3B6MA 5SYMA 4D42A 4P2GA 4RY8A 3O82A 2IYVA 3ANMA 1P77A 4UM9D 5IWCA 4GL2A 3LSYA 2J6IA 2HQBA 4ZV9A 4OPMA 2Q49A 4EW6A 3QITA 1XYGA 3TLGA 1XTRA 3RIXA 2H3HA 2QRUA 5HIAA 1SZCA 2AZTA 4KPUA 2C7OA 4G0UA 2J5QA 1AOXA 1CUDA 3DONA 3JD4A 3SNHA 1RQ2A 4CF6A 2GB4A 1NBHA 2P8SA 4JFRA 1W49A 2DR3A 1SBIA 1N4AA 2W6IA 4QJ3A 3CVWA 2X7XA 1EU1A 3K1TA 4IVQA 4RAQA 2BH2A 5EIBD 5EKTA 5IZ4A 1JHAA 3LO5A 3JWIA 5B58T 2PGDA 1YMQA 4RE5A 2B20A 3E0QA 3V4FA 2DPLA 3V1YA 5AIAA 1RLMA 1PX2A 4Q3OA 1KYYA 3OG9A 1SU7A 16PKA 2CEKA 2ODEA 5C4MA 3RYCA 4C7VA 1EDOA 4WBNB 1DJQA 5EE5B 5FWXA 4DNFA 2FP3A 3WGKA 3O8BA 4CM8B 4KKXB 3O3OB 5BSUA 3GUCA 5JZOA 2ZB8A 3O1JC 4BLVA 1QM5A 2WC1A 3BIFA 5BW8A 1Q1AA 2MT9A 2RFLA 1UPFA 1UBKS 2R5WA 3B52X 3IFSA 1UWLA 4QYIA 3P4XA 1L8AA 3KFVA 1KSHA 4N49A 2JF0A 3S1LA 1WUYA 2EX4A 1AKYA 5B1DA 5BVHB 3TM5A 4BAGA 4R71A 2QUZA 2C20A 1AGXA 4IEEA 2HSWA 1C3OB 3TLKA 4J90A 4ENQA 3WG9A 1F17A 1YTUA 4BYMA 1H2EA 3RLIA 1K9SA 4QX6A 1KVQA 1P17A 13PKA 3FPGA 1J39A 2DJIA 1AY0A 2FK8A 4AWXA 3FVTA 2EF1A 1UJ5A 3L4BA 5K45A 5K6TA 4EATA 4IHAA 3EGOA 1TRKA 2L2QA 2AL7A 2RGNA 3QBTA 4UOQA 3SX4A 3JVDA 4KRXA 1IN7A 1TMYA 2XQGA 2H65A 1FSGA 4OBWA 3U9TA 3QEAZ 3GEGA 1R6BX 2JJMA 1ENZA 1LA2A 4I4TB 1UDWA 4H0CA 4PXAA 4E5SA 1H23A 3ZPXA 1P80A 1EFCA 5BUZA 1DXOA 3H9BA 1TVKB 3BQMB 3UW3A 5KYXA 2BMEA 2VI5A 1VKRA 2X58A 4X8MA 1J07A 5COQA 2IV2X 1P4AA 1BRTA 4INOA 1JR3E 4TKVB 4AM8A 3UUGA 2WHPB 3FMIA 4J2OA 1MQ8B 3P32A 5I47A 2C8JA 4OAOA 4H6PA 1YR7A 2A58A 3JRWA 2BM8A 4KGVA 2ZJZA 4D56A 3X1DA 3ED5A 5BVGA 4I9GA 4J7UA 1M2KA 1M1YE 2AI3A 4GOND 1JDNA 3EZ6A 1SA0B 2YOGA 3L6EA 3GNTA 2A7QA 5HIMA 5IAEA 3MCVA 4A4DA 4WOJA 4TSFD 5G0VA 5I7WA 3AM4A 2AYZA 3MWJA 4UEKA 4EKYA 3GW8A 3PGXA 2P6OA 3BWYA 2GHIA 4IV0A 5G41A 4KQCA 4RMNA 3L4BC 1PQYA 1V2GA 3G9ZA 1P6QA 3O47A 1H2HA 4GYWA 1DXQA 3URKA 2PH3A 2RGNC 4JBNA 1MGPA 4LCEA 1MP0A 1E7RA 4G36A 4C03A 1W76A 2A5JA 3EN0A 4U7GA 1VI5A 2QI9F 3TR0A 1KVRA 1LUAA 2VOJA 2GH1A 4ZZ3A 1S1MA 3AYXB 1V3QE 3N8GA 1E1LA 3LDUA 1BDBA 1NNI1 2FX5A 3KYDB 4L15A 4N40A 5EUBA 2G7MC 2YOHA 1AT1A 1ORDA 2ZUFA 4BXOB 4N5IX 1BMTA 1GUFA 4H7DA 1IJFA 1WMBA 1RRVA 3ELUA 3JWEA 4NBWA 1K2VN 2NYUA 4S1VA 4H1UA 2K87A 1Z82A 1E5LA 1I6MA 2ATVA 3I01A 1UH5A 2DTXA 5DN6A 5HGXA 2IYRA 1V5WA 2RK3A 4LJ8A 3S27A 5J23A 2O2SA 1UM9A 2CKDA 3I9LA 3G5LA 3GPDG 4C29A 2ECOA 2JI9A 3BS4A 4DDMA 2NG1A 2E2WA 4HAXA 3PDIA 3VR5D 1DBRA 1S2DA 1S89A 3WYEA 3WSTA 1K7XB 3QPDA 4S05A 3WBFA 2PGXA 5LIRA 1JKFA 2G09A 4PG4A 1BCRB 2FV8A 3LT4A 1RWVA 3RF6A 1VKOA 2XOXA 4JN6B 4P3PA 4U4AA 2DHCA 4RJ2A 5ARBA 4ZTUB 4YUWA 4FINA 2OZLB 4EI7A 3KJQA 1NFQA 3CT4A 3OLYA 3W79A 1R9NA 5A9RA 5DM70 4KMRA 3ZCRA 3TG2A 1TIPA 1Z39A 4D3SA 3C7TA 4DTCA 4HSGA 1JG3A 1ARZA 1RYMA 2DF8A 1T5TA 5K3DA 3T5AA 2ZPAA 5CA0B 3DE2X 1ENPA 5E6UB 3VR3D 3GGCA 4LKRA 5EP2A 3HVRA 3I53A 4I81A 4IDBA 5CGZA 2AWOA 3PI6A 1QK4A 4BMVA 5JS7A 1FYVA 5DBFA 1R50A 5L9AA 1NONA 2G8NA 1RQ7A 4W63A 4OU4A 2FUEA 1NJSA 5FF9A 3FGZA 2DZDA 3NDPA 3ZUPA 5HJ5A 4BNDB 1DS6A 2IYTA 3LHDA 5JJ5A 3ND9A 4K46A 5K0ZA 5G1NA 2JGRA 2PH7A 4PO1A 2EFDB 4LQDA 5IJ0B 1TF2A 4GAEA 4J0IA 3CE6A 3ZE6A 3KOYA 3BORA 2DH5A 4JA2A 4KR6A 3LY5A 2KSQA 4BMXA 4ZC1A 1DDIA 2PPVA 2AHRA 1P2SA 1RPAA 2CV1A 3ZWVA 2LE0A 1P1BA 5I3ZA 1ZCJA 2E5WA 3K09A 3DV2A 1GZ5A 3HSKA 5ICCA 1ILWA 1V4NA 1VI6A 1RQNA 2VA8A 4WUVA 5FEMA 5TGTA 2HM7A 1X7XA 2GPTA 1QV6A 5DIFA 2X23A 3L07A 4JWKA 3RAJA 5CNKA 5AOBA 5KCMA 3C7CB 3ZK7A 1XKTA 1T29A 1UIMA 4B2LA 1JXQA 1V6SA 3DULA 1IPFA 1MPXA 1B8UA 2QUHA 3JALA 4OGKA 3WMRA 5IS2A 1EUYA 3AVYA 1QYIA 4PYKA 2RHOA 2XR1A 3KC2A 3KKKA 4PYNA 7REQB 1O94A 1RBMA 2ZU6A 1M83A 5DIZA 2WQZA 4QREA 2BMWA 3QEBZ 4Z4IA 3OQJA 4ZT4A 3MQ4A 3UIEA 3U61B 1NJ1A 5FI1B 1H1LB 4B6PA 1WDKA 4ZQHA 3IYLW 1UANA 1Z6GA 1E6MA 2X2OA 3O8NA 3B7WA 2XMQA 4FFNA 4IDNA 4M9ZA 3IUMA 4WOCA 1RZRD 1H3NA 5BSTA 3VYSB 1SURA 2J9YB 3PYMA 4X7BA 2C9DA 4LXHA 1U8FO 1KSJA 3AZQA 4W6QA 2KQUA 1NVKA 4OLAA 2C98A 3KAKA 1U7ZA 2X5OA 2HPVA 2VZEA 4RADA 2JLWA 5CFLA 1MOSA 3FHJA 1CY0A 3JYHA 2BFFB 4NHOA 5BRAA 1GEGA 5JQWA 3FCUB 3DNFA 4KI0A 4AB1A 2GX6A 1Q44A 4MV7A 4HQLA 4Y9TA 1JT9A 5BWBA 4TMYA 4F2DA 2HTFA 4H9GA 4MIYA 3G8YA 4IDAA 3UOGA 3HXPA 1FZQA 4G1BA 5ELXA 4EI2A 1Z74A 2VHXA 4N18A 1GUZA 2VNHA 4BFXA 1QQ7A 4B6GA 3ZWCA 2CWDA 3N2IA 4L6CA 4TV8F 5SYAA 3SQWA 1GU7A 4YCDA 4B83A 3CXRA 4D96A 3D5TA 2B8JA 4ZQBA 1O94C 4FYIA 3BRSA 3HEBA 4MUXA 1IG0A 1WVGA 1J2RA 2VT7A 2VATA 2Z2IA 4UCFA 3U13A 4E6EA 2ZYAA 2G0NA 2ZB3A 3L7CA 3PQFA 2GUWA 4MB6A 2Z04A 4IQGA 1XXHA 3W05A 3QVWA 3G2KA 4ZANA 3I2FA 4OJTA 3NKLA 3OZ7A 1WABA 4YPVA 1Q1NA 1MX3A 1VIAA 2BF7A 5LKRA 5C1IA 1L7QA 1E3WB 4CJXA 9MHTA 2O48X 4WK0B 2YASA 5EQTA 1GGEA 5LQKA 3OAAA 5IHPA 3N39C 2PFKA 5TY0A 2V9PA 4CQNA 3BKWA 1K6IA 3BQ9A 3NIFB 4K7JA 1XU4A 4Q19A 5A4JA 3DWEX 3O3NB 4RZQA 4N65A 2Y76A 4I1VA 1GRVA 2OAP1 3N28A 1E7QA 4GX0A 1WDWB 3H5VA 4LCBA 4EI9A 1KFBB 2FPIB 2Q5OA 3DE6X 5JROA 2RKBA 4Q7QA 3ISTA 3V4ZA 5JADA 3BH7A 1E62A 2JKVA 1TFRA 4XI9A 1ULUA 2YW9A 4LS3A 1I0ZA 4RY9A 1Q92A 2I9PA 4DQLA 5C8YA 1UT5A 1E92A 4HNUA 3EC2A 1P0IA 1T0PA 4DDWA 5FPTA 4FYJA 1FMFA 5JAQA 2R00C 4UQPA 2R4UA 3SMQA 4KCGA 1WKBA 2IODA 4O1HA 1N1EA 2FGKA 1R4NB 3GDGA 4QM6A 2WYWA 3G3EA 1M5UA 1XU9A 1NYQA 2VR1A 4M1OA 5ELLA 4HOYA 1QP0A 4JJ7A 3PI7A 3OE5A 1O97C 3G59A 1E3IA 1ZBQA 3UUFA 3IDFA 3N6RA 3WBJA 1R8XA 1I30A 2HDHA 3BYZA 1YACA 4JJ8A 1MAHA 4QBIA 3TNLA 3WSVA 3QJ5A 5JD6A 5LQCA 2IX3A 1E7WA 1KQFA 4NFSA 4OQDA 3LV8A 4LA4A 3UHOA 1QTQA 3H5AA 3LCCA 4CV0A 5IZCA 2WHEA 4KXLA 3BGVA 2NZWA 4DV7B 1G6Q1 2NU6A 4NL4H 4RWEA 2YFHA 3HBNA 4FCVA 3ZCQA 4DZTA 5F9MA 1LBIA 2QL9A 4PAQA 1LD3A 2K4MA 2NU7A 1TXGA 2RGUA 3IXMA 4NPHA 2D1QA 3L4EA 2J4FA 3LGAA 4MPDA 4OFBA 3CTPA 3OWHA 1DAOA 3WZ2A 4C4OA 4RFVA 3H75A 2WHXA 1GGNA 3CGWA 3UN1A 1B6TA 1UP4A 5J5AA 4DBLC 2P6UA 5E7QA 4M9XA 2FUG6 2G4VA 3BHMA 3IERA 3KTAA 4EJMA 3KPVA 1UMDA 1MG5A 1ZKMA 4HGZA 4UTRA 1XD2A 3PUIA 1M2OA 1AO0A 5EMJA 4DHWA 1ZGHA 3ZOZA 1HE3A 2QTAA 4ZKEA 4FHGA 3KSDO 5IDYA 3INRA 1DO0A 2Y9PB 2ZFUA 3OZXA 4HTFB 1HKHA 4P58A 4M54A 4QPNA 1NXXA 4XE5A 1BEUB 2AOVA 3AUSA 4NDZA 2G07A 3IAAA 5CXUA 5JDIA 1GSAA 1CPYA 2YJ4A 3EJWA 2QX6A 4GH5A 4JUAA 3N3AC 4NSNA 3S44A 1BXGA 1URPA 1GPLA 1M2VA 1U7OA 3OPQA 4IIJB 3TM4A 1V41E 2P0EA 4PNPA 1NKVA 1PKEA 2J3HA 3QMPA 5E3IA 4G5SA 1C0EA 3D59A 4ESEA 4KQEA 3HFSA 1NPDA 4WJKB 2E1PA 1ZFNA 1CUJA 1NVGA 1TA4A 3GUVA 3K9QO 4JODA 5IZCC 4BWFB 2PT7A 3OM1A 4M0CA 1RAEA 5D51S 4CLRA 1LZKA 3EGXB 4HWRA 1ATIA 4RPIA 4TSRA 4DLSA 5I5EA 2V1UA 4MUAA 4RIEA 4BWYA 1DTWB 2FSFA 3IPLA 2WMNB 4N54A 2SKDA 1FRVA 1YGYA 2AOTB 3FCSB 3HCEA 4II3A 1RS0A 4AMVA 3PKIA 3ZH9B 1DHRA 1YZFA 3GCXA 3K31A 4MK4A 4OQEA 1BVYF 1LTHR 3EZ9A 3O0DA 4D0RA 1M1XB 4TVSA 3TD9A 3J7TA 4KIJA 2PZLA 3OWOA 1T8YA 5DYNA 3KLOA 1UK9A 1WUKS 2VQDA 1V8OA 2RHWA 2SKEA 1QDUA 3DF9A 4N9QA 1YUMA 4IOKA 1D9ZA 1EP9A 3WTCA 2O1XA 2PZFA 1SBNE 3OE1A 5JG7A 3QPAA 1H8EA 5JDIC 3TEMA 5FLXA 4DDTA 1CUYA 1W0CA 1KK1A 4HWKA 5KZMB 1JVSA 4PU0A 2PS0A 1BW9A 3UH1A 1ECGA 2OCDA 3FYDA 3BGSA 2BEJA 1AXGA 1DAHA 5DO9A 2B1QA 5CH3A 4MLDA 1P4JA 1PFYA 4PLVA 2OXIA 4OHYA 3GD5A 1VZ2A 1V8DA 4GNKA 2ZQYA 2Q0SA 3RT7A 1E1DA 3V4PB 2NIPA 2Q7XA 3IQGX 4RTLA 1H3FA 1N1DA 1NQWA 1TIBA 1UOEA 1YR8A 4F56A 4Q3KA 1C1HA 2IYEA 1UQUA 1XZMA 4L76A 1YS6A 5JNLA 1N2HA 2E3JA 3J81k 3V8PA 4KYTA 4FMCB 1MRNA 2CE2X 1YS9A 2B5WA 3SLRA 3PFHA 2JIQA 2W2QA 3FSEA 4PXYA 1SVIA 2BGNA 4BKOA 5KAMA 1ZO8A 1Y4ZA 2J5RA 3QQ5A 4NQRA 4EEZA 3RUPA 3TRIA 4BCBA 4UPDA 2E89A 4C7OB 2HNKA 1Z2CA 1ML4A 2QEQA 1FS6A 3MLBA 4J0CA 4WHMA 2JLBA 3IKLA 3SM9A 4BMSA 4BVAA 1DT3A 5K3OA 4EA9A 5H9VA 5E4TA 4BPRA 2HA6A 3OIYA 3SDZA 3V3KA 2A1TS 3ND7A 1F5SA 1DIHA 2R84A 2ZJ5A 3W2TA 1E4OA 1XKLA 3IUNA 2GCPA 3MTAA 3OEED 4RKYA 4ZJUA 4NONA 2BGMA 4TWBA 5EHIA 5HBGA 1GNRA 1RU3A 2X4GA 4DQKA 3NS7A 5DXJA 9ABPA 3MTQA 5AHWA 1FOEB 1NQUA 1T6ZA 1NLYA 2VHWA 4XGNA 5AWFC 3V1NA 4GX2A 2AK3A 2QL7A 4M1ZA 2RHLA 3ELBA 4MR9A 4ALKA 1ZRNA 3I30X 1E9AA 1OILA 1T4MA 2PK3A 2IIBA 1ZNWA 4Z2AA 5AIBA 1E9DA 4IF6A 4K9QA 4R1NA 3TNFA 3VR1A 1TU3A 3OVMA 3ZDFA 3RROA 3NQ41 2BC9A 1WUJS 3E81A 3K5IA 4BP3A 4IEFB 3IDQA 3WGUA 1YWGO 4NBRA 2C29D 4AY2A 4HGNA 3ZNOA 4BO3A 3RK1A 3UJPA 4BCCA 1JMYA 2YR0A 1NFFA 2XSZD 3A70A 3HFRA 4MX8A 3UWPA 1JILA 4D5GA 4MGYR 1KAOA 1I6WA 3OTQA 1ZXBA 2FPOA 3HO6A 4KU4A 5FOXA 3IUYA 4TRJA 3MRXA 2D74A 2ZQZA 2CXQA 1P74A 3OO1A 4TS9A 1TGYA 2W0SA 2ZPTX 4HUQA 4IJUA 2NVUA 3AW9A 3GFBA 4OKIA 4HT3B 3LSTA 2OG1A 4C2UA 1NR7A 4DNOA 1MD9A 2UYOA 4CKCA 4AX8A 3TKYA 4EB3A 1M5RA 1YB6A 3B89A 5TQVA 1VBFA 4ALNA 3GRYA 3TJRA 1PSWA 3OZEA 4CIXA 2JLXA 4PCLA 3K9LA 3OHPA 2YHIA 4WNAB 3N05A 1FX0B 2C3MA 4N7MA 3WQQA 5HM6A 5SZHB 4PHCA 5CM2Z 3GR6A 4N5NA 1IYZA 1RHQA 4X45A 5FJJA 2V0NA 2WE8A 1HDCA 1JKJA 4I1YA 2R60A 5LZ4A 3IV6A 4ALIA 5J43A 2REQA 8AT1A 2W6OA 4H6WA 4R2XA 1IB0A 4REOA 3EVTA 1ONPA 2X3FA 4XWYA 4TGLA 2VF4X 3ZLUA 3JARB 5A7FA 4CTJA 3QEMB 1GCOA 4ALLA 3AERB 3G7NA 1ZJ4A 3FNQA 1RWXA 2UXCB 2O57A 3EF3A 3OESA 2JFGA 4RV9A 5LM3A 1E79D 3R20A 2YYSA 2L42A 3D0KA 4P98A 2FZVA 2G1AA 3H2BA 1RLIA 2GCEA 4U2CA 1PGJA 3OMLA 2J3DA 4JJ4A 5KSOA 2F55A 3CLRD 1DCMA 1D6JA 3GARA 2Z4RA 4FFOA 1Y9ZA 5A1JA 3GJSA 2I3BA 4L3VA 3MJHA 3EZ2A 2VYFA 1T0BA 2GILA 2RJNA 3O4FA 2D1RA 5JCJA 4QOJA 4OLFA 3EY4A 1AX9A 1U1DA 2Y4NA 4JCOA 3UJAA 3ZX5A 2F3RA 3L8GA 2XIQA 4NAUA 3QNWA 3FPKA 4O33A 3KVNA 1L5KA 1SU6A 1F4PA 2OC9A 3L7DA 4RSMA 3KRTA 3GIDA 3LT2A 5D86A 3CC8A 2B1IA 4XVUA 5JZ9A 2RGYA 2QDKA 3S8YA 1DIBA 2OOKA 5H16A 1R0BA 3GLFB 3HKEB 2I4MA 1CEQA 2XUZA 1IWPB 4LYAA 2JJ2D 4XDHA 3ERCA 4GLBA 2WF9A 2ZDGA 5FADA 1RYBA 2CCJA 5C18A 4QASA 4GI2A 3A1FA 1V9CA 4CVNA 3DZ8A 1DUVG 3FZQA 2E5FA 1IEXA 4KRFA 5CDHA 2VWPA 4P35A 5K9ZA 3UO8B 4Q1DA 1YULA 4NOLA 3Q8MA 2BT4A 2LTAA 2GYVA 2IEIA 3KOWA 3OURA 3SS8A 4CDMA 4PLHA 1QRAA 2V54A 4BX0A 2CNDA 3WLMA 3P4YA 2G4CA 3OBBA 1X0XA 3TOZA 5CDYA 2R47A 2QTCA 3ROZA 1YA4A 3ZXUB 2Y2VA 2ORED 4YXWD 2PYDA 1GUAA 5C7LO 1JH8A 4RTPA 1IN4A 2OFFA 2PUGA 4E4TA 1W581 5KU7A 3GEPA 4LYJA 2J33A 2QN9A 1W75A 1PS8A 2R1VB 4X9XA 2Z08A 4YCCA 3RM3A 3EGWA 3AINA 4R2IA 5K8UA 2GWHA 1Z0IA 3HCBA 4D3ZA 1XNRB 3ESXA 3R77A 5FHQA 4LNUA 2AXEA 4R1MA 2WT9A 4BP1A 1T36B 3K9CA 3K6SA 2A5LA 2XTAA 3NWBA 1RACA 5D3MB 2OXFA 3D6NB 8OHMA 1JA9A 2HCFA 2PX4A 1L4KA 2ONZA 2EFGA 4IY1A 1MABA 4BNZA 1E58A 2CFTA 3K2IA 3B3JA 2Q21A 3O1HB 4U3JA 3QLJA 3UNXA 2NACA 3QLEA 2WQ7A 3ITKA 1RQXA 4U00A 4P6VF 1Z36A 4EO7A 1K63A 4X1IB 2L0XA 4A73A 2CFRA 1GPH1 3Q7SA 3EZXA 5E7MA 5B64A 4X3OA 1I32A 1OYVA 1R9GA 1LQ2A 1QO9A 3EXHC 1E2JA 2R97A 3QJGA 2FE4A 4YRLA 3PE3A 5L3QB 3T1TA 1AUVA 3U5TA 3GP3A 3R4VA 1IDOA 4KAFA 3AK4A 4WOPA 1ADBA 1C1YA 5B36A 1EQ2A 1S4MA 1YS7A 3KJNA 4QBGB 2XX3A 1SQFA 4L7QA 1EK5A 5JALA 3EPJA 1PSDA 1PRYA 1GKLA 2XT0A 1EJ0A 4MRPA 4YJ3A 2OQIA 3OCZA 3I83A 2C2ZA 4NBNA 1GL3A 3UMRA 1C7EA 4HNAB 3UKOA 3QI2A 3I2GA 3FDIA 1ZXLA 1WMSA 3AFMA 2PX5A 1ZLYA 1ZNQO 3EDYA 2A1UB 5A3VA 5AK3A 4BC0A 5IF9A 1TUBB 1Z6YA 3RU9A 4W9MC 5JRZA 1WVIA 1BMFA 4QHSA 3L7AA 1NI5A 3A6EA 2UYCA 1J5PA 9LDTA 5A4DA 2FYTA 2QD4A 3CIFA 1DVRA 2IW1A 3TSOA 2EGHA 4MUBA 3OSZA 3F90A 4MDEA 2KLHA 1NN3A 1G8YA 4B48A 5KOYA 5CB4A 2Y92A 3QH4A 3RTDA 1PG2A 3SWWA 5EUQB 1NBME 3EAGA 3RK0A 2ZTUA 2RGCA 4LRSB 5DTQA 4E1VA 1Z0AA 4FFWA 1V8FA 3IAFA 3F47A 4DCTA 1IOZA 4KXXA 5EKUA 3K53A 3HP4A 3LK7A 4EW1A 1T5DX 2AC4A 3PD7A 4GU5A 4K9SA 3A9TA 4KP7A 4LV6A 4WASA 2QT9A 3URMA 2I4TA 4D98A 1K8RA 4C1NA 3LKBA 3ER6A 4DQXA 4HVCA 2G1PA 3JXEA 5CHYA 2IYXA 1XA3A 2NV6A 5HVNA 1IEQA 5A4AA 1TYEB 1FS5A 2C54A 3CSUA 3NRBA 4I55B 2ZBUA 3NYIA 4NMWA 4WXRA 3GMIA 4NCBA 5DXAA 3TMKA 5IYZF 5EUCA 3IDZA 4TVBA 3OQ1A 4D0LB 2A33A 4KDFA 1IH8A 4M55A 4ZVPA 1RLUA 4A0HA 1DWQA 2W2PA 3TQSA 1XX6A 3SBDA 4BO0A 1WXWA 1N7HA 2BEVB 2IDJA 2GBIA 2O8DB 1E8MA 1G8AA 2PMWB 3ICVA 3CFYA 2FUNB 4CKBA 1DADA 4IH4A 1KAQA 1WB5A 2GLTA 1B43A 1YVPA 1MZVA 5CNJA 2GAJA 3CNOA 4JI5B 4A03A 4P3OA 3QM1A 1RR6A 3B36A 1YH3A 3AUXA 1F4LA 4N3BA 4AG5A 1N1MA 5L3SA 2IH5A 4EA8A 2E9SA 6YASA 3UMVA 3LFUA 2Z58A 4LXUA 1DBVO 4EDHA 1SD1A 1DAKA 2A0UA 3KU1A 4DXAA 4AXXA 4B3TB 1GVHA 3DKKA 3QKSA 4EJSA 4DCMA 1JHVA 3NAZA 5T8KC 3V8NA 1ADJA 1VPTA 3ENZA 3OM9A 4EHLA 1QR2A 4XD2A 4MWSA 1YO6A 1AZTA 4R2HA 3DE0X 2C7VA 4W8HA 5FOTA 5ALQA 4A8TA 1LDYA 2C4UA 4D8UA 1NV9A 1USWA 3IAHA 3BUSA 3ULKA 1S2MA 4UVGA 4FN4A 3O4JA 3R41A 4LYGA 1SQ0A 1WDMA 4GD3Q 8ADHA 1PV4A 2BGRA 3QG5A 3W78A 2WZDA 1UZAA 1RJ9A 4ND4A 3GJ4A 3B1YA 4PGHA 4MGIR 1N8SA 3PL1A 1T9KA 2VHCA 3QWHA 3P0FA 3Q2OA 1G21B 1MH1A 2V7UA 4URHA 5EEHA 4ZT7A 1W34A 4Y98A 2YZNA 4B45A 3TPZA 2QK4A 3FGNA 4QG3A 3FOAA 1QYDA 1JG6A 4FLMA 1Z4KA 2R6AA 2VDMB 2H2FA 1R0RE 3JVUA 1AKNA 1D2CA 4GPTA 1TQ2A 4TTJA 1DFIA 3EMDA 3RUIA 1Y33E 2C88A 3W9YA 2AKAB 3K7EA 2H6EA 2WAMA 2HWWA 3C39A 4EJSC 1H8HD 2GXSA 4GOXA 4BNTA 2C9MA 2I0FA 1U3UA 5FLKA 1O4WA 3A3OA 5IK2A 3UQYS 2D62A 1IIBA 3GNLA 4RVDA 1GPNA 2NPIA 3W3AH 3OA2A 1OI2A 2DP4E 3C6KA 4BATA 4BEBA 1FY2A 5D84A 3H04A 2X5JO 2GJAA 1E8NA 1S8FA 3CX3A 4LVUA 5KJEA 1ELOA 3EA0A 3FKSA 5JAPA 3F5FA 5LJIA 3OU7A 3IOBA 1ZAKA 3NWPA 5K3BA 4B87A 1DXYA 1MB2A 2FWBA 1EUDB 3MCUA 4I3HA 3ROGA 5HPYB 4YFVA 2ZXUA 3WV4A 2A78A 5AVYA 3TLBA 2Q5QA 1V16B 3S6JA 2IT1A 2ATIA 5GOZA 1UQRA 4QTTB 3QJYA 4E2YA 4UFPA 2R0QC 3THXA 3EZNA 3HDQA 3LY8A 3ND8A 4PQFA 4ZI3A 5BMVB 2DLNA 3KL2A 3S55A 2I33A 5JSFA 1ZH4A 1GDDA 1DJNA 1UKAA 4N3AA 2PRZA 2MSDB 4G1UC 1BXRB 1JTVA 4HZGA 2VRWA 3UWOA 1I7SB 1I7NA 3OFKA 1DJMA 4R7TA 5E7IA 1TMGE 3KAQA 3UMMA 4CUZA 5F78A 3KQLA 1LEHA 3JWJA 4N0DA 3PNBA 2FFRA 2DGDA 1G64A 1TQ4A 3DEHA 3PWZA 2O2EA 3K72B 3WNBA 4OSEA 3AFHA 1JLLA 3ASYA 3GFFA 4B7XA 3EPLA 4G4IA 5JCOA 4AJJA 4AZ0A 5KWJA 1O08A 2P2NA 4RDHA 3QUTA 1ORVA 4KWHA 1MC8A 2LCFA 2NVWA 2QHXA 2VFAA 3K1YA 2CNBA 2ZP1A 2QZSA 3IIMA 3TYXA 4WZAB 1PWZA 2AQKA 3NTXA 3O90A 4HWPA 4NKRA 4OG2A 3QVKA 1OKKA 2JDID 3E4CA 2NW6A 3VDNB 3GEEA 5IJZA 4BE7B 2IHKA 1CRZA 2WE7A 1HE1C 2YWCA 5IUNC 3B38A 2XNKA 3FSGD 1WV0A 1XVTA 4KFSA 1NQAO 1YRBA 4U7PB 4ROTA 1P4RA 1E1YA 1SPBS 2P0AA 2VJKA 1SKAA 3UWMA 1AB5A 3P9PA 4YX9A 2QDXA 4K87A 1UKBA 3FOBA 1FRNA 2HB6A 4Z4HA 2IBTA 1HH4A 3ZK8A 3NMUF 1G4HA 4XX1A 4Z86A 1H1DA 3OQBA 2PN1A 4XZ3A 4NXMB 3NHKA 2CE7A 1V5GA 4NY1A 5EJ9A 2PUJA 3GHYA 2YW2A 4I1PA 5K0GA 2HUPA 1ZWKA 2VEDA 3ZDYB 4EG7A 2BKXA 2P1DA 2EIXA 5F3DA 3VAAA 5B3LA 4HGYA 2PMEA 4OATA 3TL6A 4RA6B 4B8YA 1KYZA 5CXQA 4M1QA 3CE9A 1K97A 1IC6A 1DC8A 5CK4A 3ESRA 3QLVA 5JCOC 5BUCA 1U0BB 1NRIA 1JDJA 2XKAA 2XY4A 3IOYA 3NIDB 4IXDA 5H80A 1BGVA 4Q7LA 3NP9A 5AJXA 1UJ2A 4K0RA 3E53A 3TLJA 5JV5A 2XV1A 3W6ZA 3Q40A 5KBYA 2HSJA 4GR5A 4QLAA 1KMCA 3S40A 2PSFA 3ZHSA 3JVEA 1P5FA 1E3SA 2PQ6A 1T1JA 3ZTWA 5CD1A 3CUTA 2GUGA 1N0WA 3MJRA 5C5DA 5LWHA 1SUBA 1N2SA 2CFOA 3IO5A 4JWTA 4KSYA 4FI3F 4QBFA 1R1DA 3RU7A 3NH6A 3GT7A 4JNKA 2HRDA 4QGFA 3DJFA 2UYHA 5FB3A 2O2CA 3VVBA 4Q01A 4DE5A 4ZDJA 1L9XA 1R4MB 3RC8A 2Z2YA 3S28A 2ZANA 1KBQA 2NPFA 2DBQA 1NR1A 1MVLA 1BX1A 1RXIA 1Y9EA 2ID8A 3FYSA 3MRSA 4ND8B 4Q47A 3JD2A 2W22A 3SC2A 1XZLA 4A16A 4MDFA 1M0SA 1N1GA 2GASA 1NW4A 3MMZA 2XF2A 5FUXA 2Z57A 3IMKA 4MV8A 3QLVC 2AWNA 2I1LA 4UBOA 3A7EA 3TQFA 2ID7A 4MWBA 1CP2A 4QEDA 3RYTC 1H4VB 4I5IA 1SBCA 3DL0A 2GAIA 2X86A 4O2AA 4ZEXA 5JH7F 2Q6KA 2P9CA 4RD6A 2KBFA 4S0ZA 5ALXA 4F8JA 1F2UA 2E6UX 1MC1A 1G7TA 1OUMA 3LK6A 4JEHA 4N1AA 2CZCA 4F72A 1G3UA 4YUXA 2NTVA 1QC5B 2DKFA 4X8OA 4Y6SA 3QVJA 1X7WA 1Z3IX 2H8KA 1RQRA 3HADA 3R3YA 4M7WA 3RYHA 1X19A 3W7AA 2ZYVX 4DSTA 4EW3A 3DZDA 1WKVA 1VPWA 1LU9A 2D59A 4EY7A 4PFKA 3ZDAA 1OZAA 2PSEA 3W1EA 1FYWA 2BDUA 2NSYA 3C5CA 2IYUA 3DMYA 4OTZA 4F5YA 2XITA 2AQHA 3LAWA 3RSOA 5CT5A 3IPYA 4R84A 4DY4A 1QQAA 1YJ8A 1PZFA 1Y8RA 1OWLA 2YJ5A 1EM8B 3D2AA 4DNXA 5B1EA 2PS1A 2D7JA 2P41A 4L5CA 4ZVMA 5B2ZA 2TMDA 4KQGA 2G70A 2GN4A 4LNAA 1F7UA 2ZBDA 1RXSA 3JZIA 4L1KA 4P9NA 1C7IA 1I1NA 3EASA 3KJZA 4LK3A 4O63O 3LVQE 1AKRA 4PR3A 2R68A 1H2WA 1QVZA 5EKDA 1ETUA 2X9GA 1EFLA 4R9NA 4KQXA 4XIIA 1WQ3A 5F9FA 2O7RA 1F1JA 3PQ5A 4Q3AA 1WQ4A 2XWJI 4J91A 4L7VA 3ET4A 2HZ7A 4OHKA 3SSMA 4RM2A 3ICEA 2BEWB 3WL3A 4EJ2A 1M1UA 1UWCA 1UIRA 4Z8XA 1CRPA 2NO4A 5EZSA 4IDQA 3CRQA 5HE9A 3BULA 3IQWA 1Y42X 2QX8A 2ZRDA 3JQAB 1ZMBA 4D02A 3HO8A 4GP9A 3VHXA 4ZIRB 3RVMA 1UAAA 1DKUA 3F3SA 4MVJH 1Z63A 4FCTA 1XOIA 1XLTC 3TD6A 1C14A 3H4MA 4YRSA 3SKXA 3DTVA 4UHCA 3AVUA 1S9DA 1MX9A 2QUIA 2GQ0A 2QN3A 4DZRA 5EIHA 4ZARA 1NASA 5LXTB 2C1XA 4FE3A 4RKFA 5G1PA 5D5QA 2WKWA 3H5RA 4EBBA 1RT9A 4D44A 4US2R 3CG0A 3SQOA 1O87A 4L50A 5CTJA 4FHDA 4LYEA 3QU5A 4MQFA 5AW1A 4BQIA 3HB4X 4L3WA 1QWSA 3E82A 3M6FA 2YUIA 3DAPA 1B3BA 4B35A 2YYZA 3P5SA 3V34A 5GADl 2CY0A 1WWKA 4DJ5X 5KX5F 1QNLA 1A5AB 3DKIA 3CRVA 4KDCA 5D3QA 1CX9B 1XZDA 2AN4A 1TYZA 2FG6C 1X1BA 3LUAA 1F9AA 2TMKA 5DWQA 4HX9A 3B82A 4DREA 2PJZA 3CLTC 4PNZA 5SY6A 3RPEA 3WJAA 4BGVA 4BECA 5AW0A 3JASB 2WTBA 4MUFA 4LJ7A 3IEPA 1UC4B 3FJYA 4LKOA 4TM8A 3W7BA 1GCGA 5C5CA 1PGOA 2BTQB 3EVNA 4IDFA 4LWPA 1QE5A 3OPXA 3RG8A 4Q3BA 4GBED 4QU8A 1EDBA 3U3MA 4OXNA 5JQGA 1JGTA 3L6RA 4BQNA 1UXOA 1UKYA 1U9IA 2BMDA 3CA8A 1N5MA 5KCZA 2B5OA 1E18A 5ITVA 3QKIA 1MA0A 2HXSA 1ZW1A 3DZHA 3K5WA 4MQUA 4ERNA 5MFPA 5GZ3A 3DBOB 3R3HA 5C8DA 5EMMA 3LZDA 4JIMA 1KDTA 1XGKA 1XYVA 2JHFA 1W4ZA 2XYGA 4TTVA 3UWDA 4UCWA 3ZXXA 1NVVQ 3W2GA 3CBGA 4OA8A 1SHLA 2R48A 3KHTA 3A37A 1IU9A 4RTJA 1QP4A 3OUUA 1IHUA 1U3DA 4TMZA 3ZWAA 1MLDA 3KUUA 2BFCB 1RE1A 1SUWA 3ASUA 3LDAA 3UVEA 5JLJA 2EGUA 1TM3E 4D9JA 2QZJA 3IXLA 1CQIA 2GM9A 4DIBA 1DWPA 3WBBA 4D4GA 5KQMA 3G6KA 1RJDA 2A67A 2UUPA 4F8YA 5FX2A 3KE8A 3T9EA 4KSBA 2PD3A 4DA6A 3QOYA 5BYAA 1YZTA 4HLDA 2RHHA 2G08A 2FPXA 1K7YA 3AKYA 3O8QA 1J2YA 1SVKA 1ESMA 1JJAA 2WQ6A 5CEJA 3PIDA 1JDBC 4RHXA 3OY7A 3WB0A 4M9UA 5HF8A 1Q50A 4V24A 1W73A 2PA3A 2X3YA 3BEOA 4QPZA 4V38A 4CM8A 1UPTA 4L9SA 1UOPA 4FGLA 4RA9A 3IALA 3R8CA 1P2DA 3D4NA 2LXNA 1E9CA 1O9BA 2IZ7A 2YS7A 3I9MA 3PVZA 1Y7IA 3IURA 1UXHA 4QUGA 3LLCA 1Y8CA 3PNOA 4U7FA 1U7TA 1IBKB 4QT0A 4EGJA 1O77A 4MSUA 3S2SA 1C3EA 3GI1A 1C80A 5JNRA 1N6KA 2JH8A 3BTUA 1ZJ5A 1C3OA 1ZMTA 2V6BA 4YJGA 4BHTA 1I3OA 4XVCA 1YCDA 3I6MA 4YRMA 5FAKA 1FDIA 2WNSA 4EG8A 5M5BA 5HTOA 4MB2A 1NX9A 1T5IA 2RCYA 2ADMA 1U3CA 3C1TA 3LGSA 1PT6A 2HW8A 2LUOA 2WAYA 4JLUA 4MTLA 2ZBPA 3AB7A 3GX1A 4JEUA 4K81B 3OIGA 5LP6A 2ORVA 2YWBA 1GA6A 2C8LA 2GWRA 2CDAA 5LBTA 4BJHB 3NHMA 3NUGA 4MROA 1THGA 2YXNA 3PHGA 5FWDA 1X8LA 1CG6A 5C37A 2JFXA 4R3NA 1W35A 1TD1A 2QJRA 1II8A 3C7KA 2I03A 5JBIA 2H1FA 5JZSA 2V7VA 4I4TA 1UPAA 2J7KA 3ICCA 3EEIA 3OU2A 3EFHA 3QUAA 1VMEA 2XMGA 1TVKA 4E31A 1GRQA 4P5EA 4R40A 4MW4A 4V1CI 1E9BA 4EYGA 1RDFA 1Y1TA 1BNCA 2GZHA 2QVGA 4GLJA 1JAXA 3QENA 4QOIA 2OD7A 4JC5A 1E4EA 2C5HA 1I4WA 4KIUA 3JYOA 4LDZA 4LDNA 2WHPA 4TKVA 1GG9A 1T2EA 4FLEA 1LK5A 1BYUA 4LTMA 4M1TA 4WTOA 3KUCA 2D6FA 4FQ8A 1H4TA 4JASB 2X5NA 4E2WA 4HDOB 4WXHA 3PJEA 4D7AA 5DBEX 2WDPA 4E6PA 1M2FA 3I05A 3HVJA 1SA0A 3B78A 3OOWA 1NBOA 4HR7A 4G37A 3RYIA 3ONVA 5CDFA 2BFDB 4HVLA 4UZSA 1NSYA 1FFCA 5ENVA 5CP8A 4CQJA 3E35A 1YFZA 4CIWA 5JARA 3R5KA 3D8TA 4TMWA 4AJ1A 1K92A 2R1ZA 2QLBA 3PHLA 2QTBA 1PNOA 2VP6A 3CZMA 3DZFA 4HAIA 4HFRA 4JP8A 4NBVA 2C07A 1Q17A 1CJCA 1MPTA 1V7PC 3L46A 5HILA 3T4UA 4ENUA 2BPOA 4DCJA 1X2BA 3L5KA 3RIEA 4FNMA 5DNCA 1JLRA 1JEQB 2EU8A 3UM9A 5LYJB 4EEXA 5TLSA 5AKLA 4AY5A 1RRMA 3KYDA 2W2VA 5J2UA 1O2DA 4H08A 2MYUA 1TIKA 3BA1A 2BISA 1D0VA 1I4OA 3BE5A 4A0RA 2E7ZA 3U1TA 1COWD 3L8DA 1L4EA 3S2EA 2R6DA 2FSIA 3B60A 3KQSA 1DOHA 4MQLA 1RCFA 1VJ0A 3FPLA 4KGZA 4AKTA 4U6QA 2FGJA 2RHGB 2WT4A 5KEIA 1X74A 5I6DA 4EG6A 1P8AA 5KKNB 1FPQA 2I4LA 4YS6A 5CA1F 3RFCA 2BEUB 1IXYA 1R0SA 1SXJD 1XK7A 3DXZA 2CL5A 4BNGA 3RARA 2HMUA 1XAIA 3KBBA 1BCRA 2CXHA 3NBUA 1SCIA 2O2HA 1OAOA 1O8BA 1TFUA 1LW6E 2J31A 3LBHA 4TTPA 1CUBA 3HHEA 5CG2A 5BYBA 5LZ9A 3M34A 1YQWA 4OO3A 4HWTA 4MVJP 2WSLA 2TS1A 3D6HA 1WU7A 1YZKA 1ZRHA 2WVGA 3N2KB 3CEMA 3H3FA 4PG6A 1RXYA 1RMYA 1HRDA 3V3TA 3K4QA 3OT5A 4P54A 4RDCA 2PE5A 3NDRA 2C78A 3A1CA 5CA0A 1NTOA 3HNPA 4YLGA 3RJMA 2QUAA 3U17A 4PZDA 4DOMA 1EI9A 1QYWA 3H9JA 3T9DA 3AVOA 3FKJA 4PLTA 3ZC3A 4DAOA 4R54A 1NVUQ 2Z5FA 2JA1A 2ZWMA 3PIRA 3GT0A 1JH9A 4CLHA 3H18A 1GPBA 3VFDA 3L9XA 1DKPA 1RKVA 4KH1A 4BNDA 1P0PA 1G2OA 4YRGA 4LVCA 5BN1A 10MHA 1L7AA 3OQIB 2NNLD 4HB4A 2DPYA 4WV3A 5I7HA 5IJ0A 1GSHA 2HPZA 3G2PA 4TVOA 3EE6A 1M2WA 1EMDA 3MWFA 5D87A 2QM7A 1WPQA 2Z8YA 4FYWA 3NHSA 3PENA 3PXCX 4C4YA 3O91A 2I4NA 4FBGA 3VPHA 5I4CA 2OV1A 4BJ5A 4KTVE 4IQ0A 1FFWA 3GLGB 2ZJFA 1WAMA 3V7UA 1RZVA 3T5GA 1BS2A 5G0UA 1IATA 3F7TA 1ZKDA 2QPAA 3D7LA 3D6MA 1OFTA 3K1ZA 3PBKA 3TUZC 4WESB 1WSBA 3L8CA 3DVSX 2PTGA 2AVDA 1IFXA 3CB4A 1CJSA 2PH5A 5FFFA 3UCXA 3NNNA 2XGJA 2GNPA 3M6MD 4B7CA 1M10A 3H2ZA 3NBQA 1J8VA 3T52A 2FPSA 1G66A 1JXAA 1XRJA 2BKUA 2PMBA 3EIUA 3FDZB 1O54A 4HVTA 4JXKA 1P4SA 2AZ4A 2YZ2A 3BHIA 3IHLA 4IUDS 4KX5A 4DJEC 1CUEA 3NW9A 1UPBA 1ZIDA 5EYPB 5EZ5A 2NO1A 1FMTA 1H1LA 3I34X 4LY6A 3TNYA 1CY7A 5C35A 3IE1A 4ND6A 1GR1A 3B1FA 3Q7TA 4F91B 3MWKA 2IHNA 6ADHA 3ZIUA 1VG9B 2PEYA 2Y6VA 3KPUA 4CKWA 2AI2A 4MNTA 2A1IA 1UBCA 4B74A 3GT4A 1XZHA 3AEZA 1EDEA 1YC5A 5ES4B 2EVWX 4N0EA 4B75A 1EGQA 1T8UA 1B6RA 1QFJA 2GM5A 3CINA 5K0BA 1VJCA 2ILVA 4IINA 1BQ3A 1NFRA 4URZR 2XUKA 1PQPA 3FWNA 1N8KA 3V33A 5LNK1 2VYVA 4YYZA 1TJNA 3IEUA 1U2DA 2BGIA 4Z7JA 4BQRA 1U3VA 2OHOA 4GPBA 3JD0A 4Y6PA 4ARIA 4PN3A 1J9ZA 4JR0A 3QX9A 4ZYLA 1SWWA 1F48A 3W1WA 1BWQA 5BYKA 1YS2X 1P7WA 2VJOA 3OCUA 2LKDA 1G6KA 2QN2A 1FLVA 1TRHA 4PG8A 2GPNA 1RYZA 4X6XA 4FGZA 5CNMA 3LF2A 1Z15A 1NUQA 3PWTA 5CPFA 3SNKA 3SKYA 3EYAA 4UXIA 3WIOA 4W9RA 1GWNA 3GRCA 3JCZA 1WXQA 1EP3B 2F3UA 3IA2A 2AC2A 1CR6A 2OUIA 3CLSD 2B1RA 4RKEA 5DM1A 2PMDA 2I6TA 2QVYX 1PCXA 2OZEA 3HCRA 4M99A 2PV7A 4BZWA 2QQGA 3N74A 3GOQA 5L4SA 2YC4C 1E3WA 4LYYA 2AE1A 4WA8A 3QWBA 3CF4G 2FUCA 3H84A 1Z35A 1IN5A 5E0KB 4P4NA 1UT8A 4CL2A 2ADOA 4A3SA 4WPGA 3GROA 1CSEE 3PGJA 1V1RB 2HF8A 5TEVA 3DDSA 3ICWA 4II7A 1GV1A 1U2DC 1PS9A 3ZV4A 4HWOA 4BNWA 4BV9A 4C4PA 2FI1A 2EFHB 3CLKA 2XZPA 3HB0A 1T9AA 2CXNA 4KAJA 1MO2A 4GXQA 2FPIA 4WZZA 4X54A 4JOQA 4XD7A 1ZU5A 5ECWA 2NSJA 1I0LA 2VHZA 1UK6A 5CIYA 1QO7A 1VB5A 1XVVA 1DC3A 1K6EA 1KMHB 1YRHA 1LW7A 1UBRS 1ABEA 5K4GA 3QXSA 1A7UA 2PKCA 2QW8A 3A1SA 3PZRA 1OXSC 2B8WA 1MEOA 1Y1PA 3PGVA 3RSHA 1ZA1A 3WDKA 4F21A 1RWBA 3MHTA 3U31A 1E79A 4RPGA 2GBFA 1G2IA 4OHFA 5EN4A 4ZYWA 4GEKA 5IAAA 3GLSA 2XCSB 3F3YA 5FTNA 5A6SA 3B6IA 4GZMA 2YWJA 1R4NA 4BFYA 4CV2A 2HADA 4KACA 4TT3A 4BNIA 1YI1A 1DO2A 2YY7A 1LS6A 5KVSA 2XEXA 3KELA 4MUKA 1JWAB 4UUNA 4EENA 3TX6A 1YBVA 1AQYA 4YCMA 1D1SA 3ZZUA 1GQRA 3FPJA 1GNLA 5AKXA 1TMKA 3AEUB 4CKEB 4AK9A 1UXGA 1YA6A 4BPBA 4YJHB 2HCTA 3TQQA 3LNCA 3PTAA 3QU2A 4B8WA 3HJBA 2J3MA 3UC9A 5HKOA 4FOSA 5K6RA 1A97A 1PE0A 4JBIA 4A5SA 1FW6A 3OA0A 1OZFA 3Q8WA 3TF5A 3C1OA 3E6AA 5DTRA 5DVZA 4Z4QA 3UGTA 1EQUA 3E1KA 3VI3B 3U7FB 1EXDA 2Z5GA 2WWRA 1E9RA 4XR9A 3SICE 1B8OA 4MDYA 4CG3A 3GJXC 2A4KA 2WR8A 1LPOA 2FP4B 3X1WA 4DV2B 4L5IA 1TK3A 1CY8A 5GP1A 1C7ZA 4QAJA 1LPMA 4EVIA 4JLAA 2WWVD 4BN0A 4BRZA 5JYBA 5JYCA 2J8ZA 3K9NA 4MWEA 4RACA 2V58A 4QJ4A 3A04A 3P20A 1D2AA 2DFKB 4CTKA 1U0OC 1KHHA 2X4IA 1Z56C 4ZTBA 3NH9A 1U2RA 4G65A 3PQDA 3F4LA 4FU0A 1G5IA 4H31A 4Q7EA 4QOFA 3V2HA 5I7UA 1QYXA 4HTFA 5IKMA 1IVSA 5DRYA 4XLZA 3CG4A 4FJ1A 1P4GA 4G24A 1NMSA 2L18A 1Q7GA 3GRUA 3TAUA 2BFEB 1HX7A 1PR2A 2NXNA 3ZWKA 5B4UA 3WA7A 2HSZA 1EAYA 5J58A 1J0BA 1CJVC 2JFOA 4IIJA 4G0PA 1SXIA 3WLFA 1CR1A 2XYQA 1H6CA 5F5LA 2VDKB 4ZVTA 3LVBA 3U60B 3KR9A 4UMEA 2GN9A 4NABA 4K03A 3H5WA 3S2YA 4BP8A 3MIZA 1RD4A 2OT3B 5G0WA 3GLVA 4O4JF 4ODIA 3EGXA 2JG3A 5KUTA 1EFDN 5KAPA 3I04M 1HYGA 5H70A 3UV7A 1DTWA 4TQUS 1U0SY 2ZZNA 5EZYB 4OHPA 2AOTA 1N6NA 3PPIA 4JHLA 3HCFA 5BWCA 1SHKA 1TKAA 4PC6A 4QVGA 5MN4A 2FWJA 3F5SA 2E4UA 2ZKIA 3HJCA 2XKKA 1CE8B 2FKNA 3FCEA 1NYRA 3Q9SA 4X90A 4XXHA 3UC5A 4DLPA 2R6GA 4PPNA 3WR5A 1A98A 4Q4HA 4PZEA 2NVBA 1V5IA 2JIRA 1VFNA 1Q0QA 3KU4A 4D79A 1T0HB 1TTPB 3I1IA 1NT2A 2O8NA 2ZIVB 3HB9A 5AP9A 1HFKA 2X0RA 4U8HA 1WF3A 5FPPA 3WB1A 2R8OA 3AI2A 4PRLA 3UUEA 1KY5A 1JNYA 4RJLA 5JHHB 4RGBA 4IIHA 4WWHA 2JAQA 5FNVF 3T7SA 5DLQC 1HKUA 4QPJC 4ZYUA 2Y0CA 2PIDA 1Z17A 3BVPA 3OCCA 3UAGA 1F38A 5HIKA 4QGHA 4O2BB 5TJHA 4RY2A 4Q02A 5GINE 2IXEA 1DQNA 3PU6A 3ANNA 3BC1A 3NVAA 3QMVA 4IH1A 5JOQA 1N0VC 1CZNA 4IO0A 4B81A 4DIMA 3RFFA 3WJ1A 1Q77A 4RHEA 3TZQA 3BL6A 5AK6A 4MV4A 4HJRA 4NBLA 1VZ3A 4QEZA 4XH9B 3GUZA 4IQ8A 4RIIA 3ZNPA 4RK1A 1OB2A 3SJ7A 1DKOA 1NLZA 4ZCPA 2BMFA 2IC5A 2EWMA 5BYJA 3BJEA 5A4FS 1F51E 5KO2A 1GGFA 2I66A 4FGSA 4RHCA 1QNFA 4M7RA 2ISQA 2H92A 1S3IA 2K7FA 4YMTA 1KZ1A 1VYVA 3A1EA 2OCAA 2Y68A 3JQGA 3Q3VA 4YC7A 1MB0A 3MBKA 3B5JA 1GZ3A 3AQIA 1Z7EA 4A8JB 2C8KA 2YWXA 1LSOA 4C7OA 3PEUA 4HQRA 3DVRX 1T9CA 1ZM4A 1V7QA 2P9GA 1L5OA 2VCHA 5JPDA 2NPOA 3A4TA 3ROPA 3WGIA 1J0AA 1T35A 1WZEA 1GKYA 2BFBB 1FUEA 1PWEA 2C7GA 2TMYA 4GNRA 5CIWA 1AKTA 4S24A 2JI8A 2YFQA 2C00A 1FYXA 2AOXA 2JIMA 3C6YA 4PSVA 4PYJA 1G98A 2PXCA 1YCFA 3N9IA 1NF9A 3TFQA 3HI6A 4BL5A 1N2XA 2WTNA 3PHBE 3IO3A 4KG7A 4IG4A 2YMMA 3A4LA 3HR4A 2F7SA 3L3BA 4KE8A 4PGAA 3WYCA 1ZI6A 2V96A 4XB2A 1SUPA 4DVGA 4URYR 4B33A 5EJAA 2PX2A 4CIDA 1XZJA 5JAUA 5L40A 1SVWA 1IY0A 5TB5A 1NWHA 3A6HA 3HL0A 1OT3A 2OSBA 3IMEA 5KKAA 1MORA 1XQ9A 2RHBA 5CVCA 1EH5A 2X2PA 4OQLA 4KWTA 2ARKA 3GT3A 4RVUA 4AZ3B 5A7GA 3VJRA 1B0UA 1Y4UA 3K0FB 2A0FA 2G1KA 5BWMA 1HDZA 2D0IA 4K8RB 4UREA 2DQZA 4RENA 1H9CA 1Z37A 3HYTA 3T5DA 2B30A 2BM0A 5CCXA 2QL5A 1RQPA 2REBA 2HD4A 4QD3A 1K6XA 4RZXA 5KWIA 3CJQA 3TD2A 4XR4A 3ZE1B 4OKSA 4UEWA 4H3SA 1KEVA 1VPEA 1IHXA 3OIFA 4AP5A 1GHTA 2X1MA 4Q39A 5DX0A 4DDHA 4DR1B 1TUEA 1XTBA 4WNAA 1FX0A 1SBYA 3BIOA 3ZY6A 1S3SA 5E4YA 2BUCA 1DRVA 1G0OA 3DCJA 3KLMX 3CUWA 3KHUA 3UT6A 1FNCA 3DVQX 2UKDA 2VNAA 3IH5A 4WQMA 2CN1A 3E2IA 3MOGA 3EHDA 5CFPA 4CQLB 1MNAA 4ZI2A 2YY6A 4TLLB 5JSYA 5KTRA 2RJOA 3R3UA 5FO0A 1QG0A 3SJZA 2AFVA 5SZJA 1NF8A 3QEMA 4YRNA 1C9KA 3AERA 6GPBA 3A2NA 3HBLA 3O21A 4G8DA 1W30A 2CNLA 5FTKA 1WULS 3DOOA 2ZS7A 3T3EA 3H8JA 4X0EA 1GL7A 1SRQA 1XZCA 1Z2OX 3AY3A 2HOQA 3RWOA 4F3KA 4AMBA 1BDMA 1K8YB 3GRVA 4I9HA 1QMGA 3HB7A 1XUOA 1U6KA 3E4DA 1QG4A 3T3NA 3LUPA 2O8BB 1ZINA 3FVVA 2B98A 1W5AA 3TX2A 1TO6A 4BQOA 1Y9JA 4Q3EA 4CEJB 2XZDA 1VHJA 1Z7WA 2Q5JA 4GZ5A 2ZVDA 1H8HA 4IV5A 1P1RA 4JELA 2IYWA 2QRHA 2ZRNA 2IEDA 2Z98A 3I37X 4FIZA 1V5EA 4DRZA 1A5ZA 3L04A 1G3RA 4P4UA 2Q2NA 5GM1A 3WMFA 4N39A 3AOEC 2Q0HA 4HF7A 1X6VA 1B00A 2Q6OA 1P1CA 2BGWA 2DWPA 4REQB 4D9KA 3QPUA 1JHOA 4KEAA 1B15A 4X65B 4JNCA 1GU1A 2KYRA 1JIKA 1QO0D 3AMVA 3GNSA 4X6YA 4RAOA 1E1RD 1HG1A 2Q6LA 2CLOB 2QRMA 3L4SO 4DNPA 2CUNA 1BA2A 1F20A 3AR6A 4Q9HA 1AE1A 1FW8A 5B57C 5IM4F 5BUQA 3PQEA 4P1ZA 1TVEA 2R8RA 3EFOA 1ICEA 2NO0A 2PH1A 5DGXA 1UMBA 1SMKA 2O5RA 3ETDA 3OT1B 1Y5NA 5D1HA 5LMUB 3IKTA 4KAAA 1U0GA 2OMKA 1WSWA 2VK4A 3CXUA 4YRKA 4LY3A 2GKGA 4F6LA 5JNUA 1Z0FA 4GQBA 2DPHA 2MYNA 2XCOA 4M8IA 5TE9A 2QMYA 4UJ3A 2OWDA 2LVBA 2VNSA 1TJ5A 3C70A 2OCBA 1MEEA 3R7WB 1CR4A 3Q15C 3F7MA 4EKIA 2JHCA 5GGYA 1XTPA 4IIGA 1JMVA 2DUMA 3QZUA 4OAPA 4E13A 2I6SA 2FH5B 3B12A 4W5WA 4HPXB 4ME6A 4N5HX 2ZZMA 4DJTA 4O4LF 5KS2A 5BW5A 5DM60 1AV6A 3IDOA 3PUHA 3F1LA 2XQVA 2HU2A 3GD7A 3VHLB 4EPTA 4DPLA 1VLLA 4LJLA 4COOA 2XXAB 4HPWA 2OBNA 3WGTA 1T36A 5F76A 1RP1A 3E15A 3IAS6 2NZYA 2I78A 3EG5A 4K2AA 3GN1A 3QPCA 5D3MA 1BFDA 1ZUIA 3IE0A 4Q9IA 2OBLA 3TRKA 3ZXIA 3ABQB 1YBHA 2CNNA 4BTLA 2ZITA 1AZSC 1QCZA 3AJDA 4D92A 4AX4A 4CPDA 3ZV7A 3QA9A 1YDEA 2DFTA 3OX2A 1UR5A 3C98A 5IJWA 4F04A 4OLBA 2R6ZA 2W6QA 2FEWB 3AVPA 3RSSA 5I4KA 1UBLS 2FW1A 3TPFA 4C2AA 1NN0A 3C3CA 4X1IA 1I2BA 3W2FA 4LSGA 3ZYCA 2Q4OA 1NDUA 1VTKA 3IODA 5EUMA 4MAFA 4G5HA 3PPVA 4MA5A 4QNRA 5L3QA 1VE5A 4JMPA 3GPLA 4HX2A 4MVJA 4RFSA 5BSMA 1T3ZA 1JBQA 1G2QA 1VHWA 2GM3A 3GRFA 3IRVA 1J1ZA 2QGNA 2WOJA 4BB5A 4XJTA 3MMPA 4C0JA 1P2VA 4HNGA 1GD1O 2XNDD 4YAKA 4B85A 1U2QA 5IEJA 1ADFA 3HFJA 3L18A 2WT8A 2YMPA 3BM5A 4ZD6A 2J07A 1YUBA 4RVHA 1VBNA 4WLUA 4HPJB 4CU2A 3WRWA 3A06A 1EHCA 2XYPA 1HDEA 4HNAA 5TPWB 2D0DA 5LQDA 1E20A 2DY1A 4HB3A 4KRGA 3TQOA 2X13A 4CMHA 2P4UA 1A8SA 2IEBA 2O54A 2WG2A 5DGTA 4OJQA 3ILSA 2R1TB 1Z0JA 2A1UA 4EVSA 4YCNA 2CDNA 3ACDA 1P7YA 2CUTA 1CETA 4AL4A 4LFBB 4HLNA 4L5YA 1SC3A 4JEIA 4Z9YA 3FTCA 3QYJA 2DX7A 4JL8A 2ZT8A 1C9EA 2XOKA 2YQ4A 2R5FA 3G88A 1WBJB 1NAHA 2VSQA 4B84A 4CR8A 3U6KA 2JS7A 1HR0B 4CF4A 3L7KA 5LQUA 5EHGA 4MJXA 3H7IA 3K5PA 4NJEB 2O8CB 2FK7A 4EKGA 1T8RA 2HMTA 2WJIA 1ZNYA 3FSRA 2D5IA 2O6HA 2QTHA 2R7KA 3PHCA 2X2FA 3ACBA 3OPYA 4AXBA 3RLFA 3S2ZA 5HRCA 5JW6A 4GHWA 4OP1A 3HJFA 1NRWA 1QGZA 1RWQA 3PHHA 3U1VA 3WWDA 2RHDA 3ZY4A 2C7QA 3AKZA 2IXTA 4WN9A 2NNWB 4LRWA 2BBWA 4A2CA 4I55A 2P77A 1YHYA 1Y6QA 1A5TA 2XJ9A 2ZRLA 4KYUA 4YTEA 3UJ9A 1IQRA 1QRUA 1I3CA 2VKQA 4L4UA 1M6HA 4EB6B 2ONJA 5K05A 3A8TA 2C5SA 2PS9A 2H2HA 1CNEA 2HT6A 1X0VA 3R7FA 5B58C 1QIGA 4NPAA 5JQGB 4FK8A 1LPSA 2WM9B 4MW5A 3H87A 3ZJYA 5LLTA 4M46A 2AXPA 3ZJVA 2QD1A 3LP6A 1CIPA 1J99A 3ADPA 2CCKA 1DG9A 1JLKA 1L8QA 3EW7A 5J4HA 1LRKA 1XSEA 2YZMA 4URFA 4BP9A 1Z22A 2QYSA 2EZ9A 3WGMA 2NUTB 4O3FA 1EBUA 4C7BA 2NVOA 1QANA 2WM8A 2A9PA 1YDHA 2GT1A 1CZHA 3HCPA 2C97A 3V6MA 4PHTA 1N8TA 1VDZA 1CQZA 3BWBA 3P94A 5E9JA 3VISA 2OB1A 2AMFA 2XE8A 2FMFA 3BXOA 4JEMA 3T1NA 3AT1A 1Y8AA 2BTOA 1JIUA 2GPSA 3FYCA 4TXNA 1L5NA 9GPBA 3UJNA 1DAPA 3WYDA 1GG2A 2HO4A 4HEA1 1DIOB 5K3SA 4BS9A 2HHCA 3DOCA 1KNQA 1E2KA 3DLHA 3K35A 3F8WA 3TN7A 1QLWA 3RC1A 1F14A 1L4LA 2ERCA 3SKVA 3BXZA 3KJEA 2IOYA 2JPDA 4V0ME 1V37A 4Q3NA 3H2IA 3B1WA 4TXJA 2J4CA 3OJXA 3RREA 4D99A 4M87A 3JQRA 3VU0A 4BO4A 3PPWA 1J90A 4OHWA 5BN3A 1QOZA 3BXFA 2Y27A 1SQ6A 3QTTA 4GI1A 2QB5A 1FDUA 1G21A 1DE0A 1SK9A 1YZQA 1E2BA 4EZEA 2X4DA 3M4NA 4HDMB 5HK8A 1HY3A 2GHTA 3RKUA 1T1EA 5KB3A 4LMRA 3WJ2A 1FX1A 4KR9A 3SQDA 2J67A 4UAVA 3S1AB 4IGAA 3UK6A 2C0PA 2YVLA 4KJZA 2XRFA 5IMBA 5T57A 4HEJA 2HL6A 1O9GA 1KOJA 2VT2A 4AJOA 3G5AA 3TZKA 5JLAA 5EZQA 3BEDA 4J8PA 3EUFA 1HLFA 5AJTA 3TSCA 3WGLA 1CUGA 2H54A 2MSKA 2NO9A 3M1AA 1K7FB 3PTLA 1DRUA 2QMQA 1RPZA 1NZDA 1HNZB 1UOQA 4LAFA 4ND1A 4BVJA 1PUJA 4QDOA 2ZS8A 2WJGA 1HYQA 1VCOA 3TQHA 3JPYA 4PIPA 4J29A 1HURA 3TDKA 1E64A 3RJ5A 3WLJA 4B0OA 4B71A 2A5GA 3SC3A 4NDNE 1E3MA 5EY5B 3O8OB 2VG8A 2O6LA 1F8GA 1RE0A 3DL2A 2EP8A 2IS2A 2OUKA 4HWSA 3OFJA 2UYYA 4JOSA 1AGYA 2DYKA 3OZIA 4GLOA 4LISA 4QWMA 1E2LA 2PUCA 4Z9XA 4KO1S 5AM4A 4YAJA 1BG6A 2JAOA 1JTEA 2Q3FA 4A7PA 2CD7A 3R8FA 2NP7A 1Z6AA 2HMAA 5IXSA 4YV2A 3OH8A 1HLDA 3LUGA 4OSPA 4TV9B 1BJTA 2EJUA 1VJ5A 2X14A 3G49A 5DEIA 5JZBA 2G72A 3NHAA 4L51A 3LC1O 3LTEA 3K9BA 3MSCA 2SHKA 5ICFA 1NC1A 2Q5EA 2WZCA 1JLSA 1THTA 2W9XA 3PX2A 4FVTA 3WGOA 1BVRA 2AH5A 5CT9A 1CFZA 4LEIA 2KWIA 1XCPA 3L8MA 4NARA 5HP4A 3KQOA 4EUHA 1E1NA 1SUSA 2GHRA 4M1EA 4RPJA 1ONNA 4NAVA 2NU9B 3R9IA 5CXXA 4D6PA 1FMCA 1RI5A 4N5DA 1T5OA 4TL8A 4J0FA 3KP1A 1YKSA 1MDBA 1QFYA 2G82A 3PFIA 1ZD1A 4WZAA 5EJ2A 3ITNA 2PDAA 2GFQA 3T61A 3DCYA 3TCXB 5ICEA 1VE9A 3H2HA 4D8WA 2QA5A 1JB1A 2XRZA 1QQ6A 5KQGA 5NULA 4QTZA 3OBIA 1O3YA 1QS0B 3MB5A 5BO5A 1HSZA 4M1MA 5A3JA 3IDAA 3WDLA 1TU0A 1DKLA 5L3ZA 1CF9A 1X14A 4RH3A 2PT6A 1M1YB 1IAVA 4OQMA 4GOMD 4D5EA 2VAXA 1FE8A 3THWA 4ND7A 1QYCA 4HDNB 4TROA 3VOAA 5M7EA 1VG8A 1XRRA 2O3QA 2G63A 2GBPA 2YYAA 2IPOA 2RHRA 4ML3A 1T1RA 5DV9A 3A3PA 5DCUA 4F5WA 1B1AA 5KTTA 2VTBB 5I8PA 2PUDA 5FUYA 1I80A 2VJDA 5CM9C 4WADA 1O6ZA 3K70D 3QXXA 4RA6A 3HFGA 2JFPA 1ZH8A 3RJTA 2Y2UA 3DW1X 1P33A 5JYDA 2TRSB 3ZU3A 4Q7JB 1G18A 4QEKA 3UY4A 4E7OA 4EJFA 4ZK2A 3DR5A 5CBKA 2PSHA 1HYBA 1G7SA 1XO1A 2KW5A 4UEOA 3A1NA 2PFSA 3IBYA 5I4BA 1S9HA 1JWBB 3GFPA 3VH1A 4FDAA 5M2QA 1I10A 4A92A 2B3TA 3ENKA 4MS1B 2WWYA 4PQEA 3ADOA 1SKQA 1E2UA 3GRPA 5FQNA 1CW2B 3N2LA 1M74A 4K9OA 4PYIA 5I3CA 1T9BA 3A14A 1PO7A 1JI0A 2BWJA 3HKCA 3R6DA 1RXWA 4BTEA 1VRWA 3AR5A 5B7NA 3R76A 5CFMA 2XHEA 4OI0A 3AHCA 3C2QA 2R9VA 3I9KA 3W9BA 4ANFA 1I94B 1FIUA 1R4MA 4ESHA 3H19A 5CG1A 4BBAA 5KYYB 3H5TA 2DAPA 5HIJA 4CL3A 4YRFA 4ND8A 1MO6A 2ODTX 4G8CA 5K51A 5JJBA 3PSAA 4PGMA 4QTYA 2BJHA 2XGSA 3V7NA 1ZOIA 4WY2A 4YJ2A 1LK7A 3OQPA 1CLEA 4IWYA 3TOXA 3NLLA 1P6XA 4FHEA 2CJPA 3OJCA 2JB9A 3IPAA 4Q93A 3QXCA 1M0EA 4RQAA 1LVGA 1GPJA 4OGFA 1Q0TA 4UUPA 2AXNA 1U2TA 1RAGA 4WCFA 3IT3A 1XZEA 1XG5A 4RVFA 5FR2A 3VR4D 4NZPA 3GJ8A 2QV7A 3K4HA 1B6SA 4A2WA 2W6JD 3PTZA 3ZHVA 3U4MA 2Q1TA 3EVGA 3N2GA 3ROQA 5F7XA 2OQ2A 2ATXA 3AF5A 3ONDA 3PP8A 3QELB 4JLKA 5HRAA 2XXBA 5HG0A 3NV7A 2EYUA 4W5NA 3WKAA 2JBWA 1WDLA 1QC5A 1VYUA 3FCYA 4DLKA 2EZ8A 2WUDA 4INAA 3I6IA 4RJTA 2QIOA 3ZVMA 1ZIXA 1PDOA 1EFVB 4GWGA 4MW7A 1SAYA 2VRCA 2W71A 2Y4OA 4MYRA 2O1WA 2FZ4A 1QP8A 1GTG1 1P4HA 1UL1X 2QR5A 2WYOA 3K5HA 3NVKI 1WPXA 2WD7B 4G1CA 4X1KA 3TIVA 1DQYA 4PYMA 5JS6A 1ZM9A 4GRAA 2JCVA 6REQB 2GNOA 1COWA 2BVNA 2P27A 3RU3A 2BUAA 2UZAA 3PUZA 4YAOA 1WMEA 1GYPA 1TZBA 2F6RA 3CZQA 3O73A 5F35A 4K0KB 2P6MA 2ZQ5A 1G7RA 3OICA 3HPQA 5BT9A 1P44A 2EW8A 3PA6A 3OIWA 2WUWE 1AZWA 3UB2A 3IMFA 1NJ8A 3TK1A 5BNFA 1ODJA 3KOMA 4LJRA 5K01A 4BVLA 4F4DA 4KXNA 3ISVA 1TCCA 1XAHA 1J0DA 1XP5A 2ZTLA 5HW0A 2W7TA 2BEWA 2EHDA 3AIKA 4I9NA 5I7VA 1FP4A 4GR4A 1WD7A 4MEJA 3PNSA 3QYPA 5GAJA 4CM3A 4GOOD 4JC0A 3IUPA 4CCSA 4J0QA 4IUBS 3ZIAD 1P1HA 2NOAA 2P8JA 4BRUA 4WXMA 1QWOA 2IP2A 2H1SA 3ELWA 1RIFA 3O7WA 3QQPA 3NUZA 1MKYA 2X0EA 3E5RA 1L7MA 1UJBA 2CXTA 3T7KA 1K5GA 3BD8A 1D1QA 2CZGA 1N7IA 5LXTA 3TVYA 4HAVA 3L0ZA 1W19A 5JAZA 4CIBA 3W8RA 4CEHB 2RKOA 3X0DA 5I9NA 4PAGA 2ZWAA 4E14A 1KJWA 3L6OO 4KIFA 2IYAA 3N3BC 3U37A 3W5JA 3PJGA 4CFZA 4JGGA 3DEFA 3DLPX 3HABA 4ASUD 1L1FA 3MMNA 5IABA 5E1OA 3ZDZB 3X1MA 4UD2A 3RABA 3SJCA 4AICA 3HVUA 4DM7A 3DQQA 3MT0A 4E21A 4NLLA 1Z75A 2WFAA 1J00A 4H7HA 5D8DA 1T91A 1S7CA 1Y3FE 1ODLA 4AIRA 2JK1A 3CY6A 1OX4A 5TMEA 3VZRA 5K8JB 1Z4MA 4LXYA 3OFVA 4F3TA 1F0YA 4IJVA 3S0JA 1EXMA 4UBMA 3ZTYA 1VLMA 1ZZEA 3JASA 4TZTA 2ISCA 2H2AA 2PRSA 3DQZA 3WX0A 5GZ1A 1V6CA 2BTQA 3MN1A 5FBWB 1SULA 3B1KA 1LI4A 2XUAA 1HETA 3AJ8A 3DL7A 3D7SA 4RKRA 1CUAA 2J0VA 4MPTA 4ZO9A 3RG2A 2FRVA 2WHYA 4OIFA 3N2YA 1I1HA 2IKQA 2P2CA 2VRNA 4MYHA 1C9MA 2DFLA 1NDQA 2I7DA 4MJ3A 3SR3A 4GM1A 4L8LA 4A6EA 1BKYA 2QX9A 1Q0UA 1U94A 5AI0A 2CLHB 3VKVA 3ZQKA 1NI4B 3OQNA 4X3PA 4A9AA 4U63A 3R5FA 4EFMA 2PQMA 1ONOA 1ZHOA 3RTAA 1D0SA 2CEAA 3HLYA 1AURA 4S2UA 1BQ4A 1M2NA 3QXHA 5IC4A 1J0EA 2BFCA 1AMOA 1RHMA 4ZO7A 1KQNA 2W4MA 1A2BA 2WIDA 4E5KA 3M6IA 2VZ8A 4ZVLA 1Z8DA 3B9BA 5H81A 2IGBA 4QXOA 2OAGA 5B7PA 1AKQA 5E7JA 3BWDD 3V9PA 2ERXA 3D2LA 1KDOA 3KEQA 1KDYA 5JASA 2X6RA