2ZB2A

Human liver glycogen phosphorylase a complexed with glcose and 5-chloro-n-[4-(1,2-dihydroxyethyl)phenyl]-1h-indole-2-carboxamide
Total Genus 311
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
311
sequence length
809
structure length
798
Chain Sequence
ENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPNDFGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKASKFGAGTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glycogen phosphorylase, liver form
publication title Synthesis of 5-chloro-N-aryl-1H-indole-2-carboxamide derivatives as inhibitors of human liver glycogen phosphorylase a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 311
structure length 798
sequence length 809
chains with identical sequence B
ec nomenclature ec 2.4.1.1: Glycogen phosphorylase.
pdb deposition date 2007-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00343 Phosphorylase Carbohydrate phosphorylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2zb2A02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2zb2A01
1K08A 4PQGA 2PRIA 3S0JA 2ECPA 2PYIA 3RSCA 2X0EA 1UZUA 1BX3A 1WUYA 2QLLA 3T3DA 3CEMA 1JIVA 3T3GA 3L79A 1AHPA 4MHOA 3HBJA 1XC7A 3L7DA 5ENZA 1WV1A 1JIUA 1FTYA 2XCIA 3ZCUA 1Z6PA 2HY7A 4MI3A 1P4GA 3ZCQA 4KQ1A 3CEJA 3T5TA 2G9VA 9GPBA 3VDMA 2PQ6A 4GZ3A 2O6LA 3WADA 4X6LA 2WTXA 3ZCVA 1M5RA 1AXRA 3IAAA 1QM5A 2GEJA 1WW2A 3T3IA 3BD6A 1IXYA 2VCEA 3BCSA 8GPBA 3BDAA 2JJMA 4AMGA 3GPBA 4F97A 3VDNB 2ACWA 3RSZA 2C4MA 3ZCTA 2SKEA 2YJNA 3MRVA 4CTOA 1ABBA 2ASVA 3DDSA 1H5UA 3OY7A 4LEIA 3L7AA 3S28A 2IV3A 4YI5A 2X6RA 1J39A 2BGUA 3MSCA 2IEIA 3SYRA 5BNWA 1P29A 1EXVA 2QNBA 4MICA 3ZCSA 3MS2A 2GPAA 1P2BA 4RIEA 3MBOA 5DXFA 2H1FA 2G9QA 3TAXA 2H1HA 2R68A 3CUVA 2QZSA 5TMEA 3OKAA 2P6PA 1NVKA 2X0FA 1NOIA 3MTDA 3Q3HA 5IKPA 1L6IA 3CUYA 4X7RA 1L7XA 2VSYA 4MI6A 3D0QA 5DU2A 1GPAA 1IIRA 4WADA 4HLNA 3BCUA 1Z8DA 3OTIA 4M60A 4CTNA 2SKDA 3C48A 1P2DA 3T3HA 1C8LA 4FZRA 2ACVA 3NCHA 4GYWA 2QLNA 5I45A 3MS4A 2FFRA 2C1ZA 1FU7A 3CX4A 2QRMA 1SXPA 4M7PA 1L5RA 2QN1A 3C4VA 3BD8A 4AMBA 3OT5A 2PRJA 4F9FA 1E4OA 3QKWA 3CEHA 4XIFA 2GEKA 1C3JA 4X7MA 2XA1A 2AZDA 2JZCA 3NP7A 4NEQA 5GPBA 2XGOA 3MRXA 3Q3IA 3DZCA 1GFZA 2X0DA 2IW1A 2GJ4A 2SKCA 3WAGA 4AY5A 2OFFA 3EBOA 1A8IA 5JTUA 5DLDA 1FU4A 5JTTA 4YUAA 1NZFA 2FETA 2KS6A 4KQ2A 4M83A 3EBPA 4F96A 3T7DA 4GZ6A 3MTAA 3IA7A 2XCUA 1FTQA 1PNVA 1LWOA 4EKYA 1JG6A 4GZ5A 2XA9A 2Q6VA 4NC9A 3NAZA 3VUFA 2IUYA 1XL1A 3HBFA 1P4JA 1KTIA 4G2TA 2FF5A 3RHZA 3DD1A 4BQEA 1YGPA 2AMVA 4REMA 1L5QA 3TOVA 3L7BA 3NPAA 3O3CA 4RIFA 3QHPA 2ZB2A 1WW3A 3S2UA 2BGTA 3PE3A 3NP9A 2GPNA 4N3AA 1UQTA 4RIHA 1SXQA 1O6CA 1XKXA 2QRGA 3CV3A 4GPBA 2R66A 2IYAA 3FROA 5HXAA 1PN3A 1Z62A 3MS7A 3TSAA 1Y6GA 2QN3A 3OY2A 2AW3A 3MTBA 3G2NA 3G2IA 4CTMA 3H4TA 1F6DA 1P2GA 2QLMA 3VUEA 2AV6A 3ZCPA 1NZDA 1FS4A 4RENA 3UYLA 1L5SA 3CUTA 1F0KA 3SYMA 2XGMA 3NB0A 3MT7A 3S29A 4XI9A 5IKOA 3CUUA 4RIGA 1PYGA 1GGNA 2ATIA 3GUHA 1RZVA 4FKZA 4Z5XA 4BQIA 3COPA 2F9FA 1C8KA 2QN9A 4L22A 5D00A 4RELA 1FTWA 2QRQA 4EL0A 1L5WA 4AY6A 2GM9A 1EM6A 3WC4A 4QLBA 2PYDA 4NESA 3G2HA 1Y6FA 4N3BA 1XL0A 4N9WA 2VCHA 4HWGA 1NLMA 5TVGA 3BD7A 4W6QA 1JEJA 3MRTA 1JG7A 1QKJA 2XMPA 2R60A 3HBNA 5TMDA 1K06A 3DDWA 1E1YA 1V4VA 1JIXA 2BFWA 1RRVA 2BISA 2C1XA 4EJ2A 3G2JA 2QN8A 1RZUA 3S27A 3OTGA 2GPBA 2QN2A 4MRAA 4WACA 1YA6A 2F3QA 3E3LA 1PSWA 2IYFA 3OKCA 2F3PA 3HBMA 6GPBA 3L01A 2GT1A 4RBNA 2IV7A 1FC0A 2F3SA 4BQFA 3PE4A 3MT9A 1HLFA 1GPYA 3BEOA 3D0RA 4EL5A 2F3UA 4KQMA 4GYYA 2XA2A 3C4QA 1P4HA 2G9UA 4LDPA 2QRPA 4CDRA 4WHMA 3NC4A 3E3NA 3RT1A 5C1DA 3OKPA 1L5VA 1GG8A 4EKEA 1WV0A 4RIIA 2JLBA 2QRHA 2X6QA 1XOIA 4YI3A 4MI9A 2VSNA 4N39A 3Q3EA 4BFCA 5TMBA 2IEGA 4X7PA 2R4UA 2R4TA 1XV5A 2QN7A 3D1JA 3OTHA 3MQFA 4N3CA 1FU8A 3MT8A 3L7CA 3AMVA 4MHSA 3G2KA 2XGSA 5D01A 1GZ5A 3UYKA 7GPBA 1UQUA 1B4DA 1C50A 1WUTA 5LQDA 1LWNA 1Z6QA 3G2LA 1VGVA 1GPBA 3H4IA 3T3EA 3ZCRA 3CUWA 1NOJA 2VG8A 3BCRA 3E3OA 1Y8ZA 2G9RA 2C9ZA 1FA9A 1NOKA 4AN4A
chains in the Genus database with same CATH superfamily
2Q6KA 3GGDA 3IQXA 4MR7A 3TWOA 3UWKA 5LIRA 1I6KA 2HXGA 1K7SN 3KQOA 4CR7A 3F2IA 3NHRA 1R8YA 3DWFA 4KYVA 3OU6A 2DFVA 2I6TA 5ALPA 3WGHA 1J2EA 2MSNA 2ZJBA 3BGSA 4JITA 5M3BA 4DNQA 4LYYA 3KHKA 2ZEJA 3F8WA 4RK7A 5ADUS 2K6GA 5IJ0B 2VRBA 1TTTA 4C1BA 1GRNA 2DUWA 4AF8A 5HF9A 1DAPA 1H69A 1MB4A 1ZU5A 2H0QA 5HX7A 4ND7A 4PFQA 3R5SA 4Z1MA 3FCXA 1XC7A 2HA7A 3R4CA 1K1EA 2OSBA 4FSDA 3PDWA 4LF7B 1NZJA 2ZU0C 3E5NA 3NHWA 1NN5A 2CVZA 3G0DA 3NTUA 4FYWA 4WMLA 4PC7A 2HCJB 1P4SA 4TV9F 4Y2HA 3E03A 4B46A 3DR5A 1D0IA 4K1XA 4J16C 2ERYA 4HUJA 2JLVA 1FMTA 1U65A 1A2OA 3BUSA 4X9XA 2KHZA 3NTOA 4BNDA 4PV7A 2JEYA 2D7JA 3F7OA 2H9AA 3LPMA 4YMWA 3QVVA 3CEJA 5AI6A 4JU9A 2JAOA 2A58A 3R5KA 4A5SA 3OM8A 1U0JA 4L0CA 2FU5C 1LTHR 1CY7A 5KKCA 2VH1A 3D3JA 5LDDC 2GZSA 3NGMA 5A2QA 1UIMA 3GNLA 3QVMA 1OI7A 2OZKA 4Q16A 1G3RA 3F71A 4PLFA 4X60A 4IAOA 1PBTA 1JG1A 4GM4A 4FN4A 1Y3AA 2GZDA 4GX1A 5HF6A 3W06A 4EI2A 3O8RA 2WF6A 1ECJA 1LJ8A 1YFKA 2GEJA 5B6JA 3GOQA 2J3IA 3O1JC 1KOJA 1L9XA 5IMSA 3AETA 5DMHA 4J16A 2EP7A 1O0SA 4E1AA 5CYOA 4QGSA 1RADA 1RP1A 1U0TA 4CT4B 1U2DA 1USUA 1QO7A 3OTOB 1U9ZA 1SKBA 3ELUA 4Z86A 4CEIB 1PNQA 4NSNA 5H02A 4DIDA 5BR8B 1YB7A 4DDKA 4JC0A 3X1KA 4HUTA 5DV9A 1XCLA 2FQYA 4AS1A 1KSHA 3F3YA 4ZRDA 1U9YA 1CFJA 2CMFA 3SPXA 1O6ZA 3GPBA 1O03A 2F43A 3KXPA 4FEYA 3A2KA 4RJJA 5DW0A 4RVFA 2XXJA 1VSBA 3BL8A 3L7KA 3D3EA 3AYXB 2YHBA 3PQ3A 4MDEA 4B4VA 4ZCMA 4OB6A 4KFTA 3IL2A 4ER7A 4S04A 2YJNA 3HO6A 2AN3A 1YL7A 4AM8A 5H70A 3LQ4A 1H5UA 1Q0RA 2W42A 1WXHA 1OH7A 3K7EA 3S28A 1TM1E 4J29A 1IHPA 4OU5A 3SXJA 4AJ2A 4CMAA 1W9MA 5JNWA 5LWHA 3KDPA 4OFBA 3RF7A 3WLPA 4MGHA 4Z9BA 5EJ4A 3H86A 3Q7RA 1NV9A 1BWRA 2HC9A 4CLXA 3W9SA 1HMYA 1OXSC 4QDZA 5ARCA 3OO1A 1TEXA 2QBYA 4LHXA 3DLPX 2NSLA 4YMGA 2H54A 1QG0A 1KGSA 4ZC8A 4B7AA 2GZ1A 4R5HA 5DSTA 5EEGA 4PG4A 2IYYA 1VJ5A 4EKGA 7YASA 2IYOA 2V5AA 3BJMA 3E8SA 4G41A 3N0WA 3THXA 1BMFA 5ALDA 4RPGA 1G41A 3EVZA 3ONDA 5CGQB 1NIJA 3T4UA 1Q16A 3LA8A 4XW2A 3ZNPA 1PL0A 4RL4A 4CF4A 2W0MA 2XLCA 2NW6A 2Q2QA 1OY1A 3AHEA 2OKCA 1T91A 3P4UA 4K3UA 4MUHA 2CLOB 1OZAA 1ENZA 5EUCA 2GN8A 4JP2A 3W8EA 3WGKA 3QUCA 4IOKA 3H3XA 3TK1A 5DU2A 2IYEA 2A9RA 3TLMA 1TLLA 1E1CA 5L53A 3Q7EA 3SY8A 4QJ4A 4X6YA 2DFDA 3UAWA 1ZX1A 2XYPA 3K1ZA 4M60A 3PNKA 1PUJA 2BKXA 3OD5A 4RCVA 1E1LA 3KOUA 1T6BY 5FBRB 1JKMA 3QX3A 2COEA 3A14A 4UEJA 4XTRA 2FEAA 5DBEX 1HSZA 2JK1A 3I4CA 3N2GB 4ZEXA 2E9SA 3AP2A 4N8DA 3GJQA 5ER9A 4FFRA 4QYXA 3ZZ0A 1CF9A 4FJ2A 4IX1A 1ADJA 5JOQA 2ST1A 1KS9A 4XWWA 1PL6A 3NV7A 4ZXPA 5JJCA 3QBTA 3WMXA 2XDWA 3KEOA 3ORSA 3C7DB 5DTJA 1VP9A 4I9UA 4U8HA 5AJZA 4EIWA 4CLRA 1EGHA 2CL0X 4BAZA 5DXJA 5IVKA 5K99A 1E0DA 1P1HA 1W4LA 4EZBA 3K70C 3CCBA 4QYWA 3PUHA 3I32A 4MW0A 1LK5A 1QFYA 4OA5A 4PYLA 3UMMA 1IHYA 1L8OA 4DY4A 4FHEA 4JB2A 3ZXYA 4XM1A 3TLEA 2PX6A 3UMYA 4CNQA 1VLVA 1XQ6A 1ZO8A 4IIJB 4YT8A 2FDXA 2HT1A 2BFFB 1FYXA 3KQQA 2IELA 5G4KA 2IYNA 3DNPA 1CFZA 5T6MA 3WLEA 2QYSA 3K0BA 4HO1X 4R0MA 3LLSA 3ORFA 2FR1A 3P9CA 1QWSA 4CM7A 1PV1A 1Z74A 3GLGB 2HQBA 5BYJA 2KW5A 3WAGA 2EGUA 3OA2A 1UAAA 1LK0A 3CNNA 2OFFA 1ZGJA 3FOCA 4LOIA 4DIKA 3EEFA 2BMEA 4P4LA 4DLNA 5LD2C 1EM8B 4RDHA 4MO2A 4ID9A 2KS6A 2IC5A 2NQTA 2VJKA 3KT3A 2R62A 3OJLA 2YINC 2YS6A 2JA2A 1JNYA 3EXHB 3GLFE 3MJRA 3WISA 1ZSVA 1DI0A 1HO3A 3STVA 3EARA 4XYLA 1W4AA 5A7GA 1FMCA 3TNJA 3VKGA 3FJ1A 4H6XA 4OJKA 1D4FA 3VX4A 3IA7A 2O9JA 2XF8A 5FFNA 4J6EA 3BSWA 4B6FA 3FJYA 3ZZTA 1TZKA 4Q9HA 2O2XA 3EDYA 2OO7A 3PX2A 3GY0A 3HV0A 2OQRA 4INZA 4YEDA 4CMBA 4F3KA 1ACLA 2KB0A 4X54A 2RI0A 2VP4A 4DOMA 2RH8A 1AB5A 3X1YA 1X9GA 3LW7A 1KE1A 3FSEA 4CUZA 5JMOA 1FJGB 1QU2A 2ISCA 4XUDA 5T3UA 2QX4A 5JRZA 1H2EA 3OKFA 3ZS9A 3KHTA 7AT1A 1IUOA 4K46A 3ZJVA 2C1EA 1GAQA 1G16A 2OEPA 3Q2OA 4WGGA 3WP0A 4BLTA 4F4IA 1MIHA 3GJZA 1BHQ1 3QVXA 4WPGA 3RV3A 3WI7A 1IUNA 2C8LA 4EX6A 5F98A 4OM8A 2ADOA 1GPLA 2DPGA 3W4IA 4EYEA 4YCSA 3AK4A 5CH5A 4ZTZB 3RH0A 4Z3DA 4JBNA 3STHA 5JSFA 3ADBA 3DKRA 2N75A 2B3TA 4WN3A 5IBPA 3ET5A 2CL6X 3N2YA 4KGVA 2LPMA 5JMTA 3A9SA 4C5CA 5IVIA 3S1AB 3HKCA 3W7BA 3TFOA 1ND6A 2AC7A 4LRXA 2XMSA 2J30A 3RS9A 3O9MA 1L5HB 2SECE 3EYAA 1U3DA 3DV0A 4G0MA 3ZU3A 5JNVA 2VQSA 3BH6A 2VDPB 3HGTA 4UUPA 5HCIA 2NG1A 1CUWA 1CNFA 4IXTA 4F93B 1F8GA 1G59A 1IAVA 2JFYA 4OLBA 1VLQA 3B5IA 1C9MA 4LZAA 2FB9A 3HI6A 2OCAA 3MAAC 3QP9A 5HIIA 2IV2X 4KUHA 4MVJI 5CT6A 3NWJA 4IICA 2FQWA 1J0DA 2E4AA 3AEXA 1Z9BA 2XOKA 2Q29A 4G5SA 1VE6A 3TJZA 2VNIA 4V0NA 3OQHA 3R8FA 1XJCA 1G21A 3FAKA 5IT5A 3QFFA 1Q0QA 4YP9A 5MHTA 4X1YB 3DZBA 1XYVA 2HZ7A 3PXCX 1ZD5A 3WLLA 1BGXT 2A33A 4O2AA 3GLHA 4QODA 2VS1A 1IQ0A 4D81A 4B6EA 3B6JA 3KE9A 1C0IA 5FWYA 2XGMA 3HKDA 4JCCA 3ABIA 2VNAA 4BO4A 5IC5A 2DQ4A 1N6NA 4JYCA 5DI9A 2BN4A 5EZYA 5TX7A 4FMCB 4W5TA 4G09A 4TTJA 1U8AA 1GSIA 2RC5A 3OCYA 3E82A 4BZWA 4DLRA 1LA2A 2QVCA 3MAJA 5KAMA 1BO6A 3EXEA 5BUZA 4QBHA 3LHIA 1LTQA 1C2TA 4K0RA 1BIFA 2GXSA 1Z36A 2QL9A 2V45A 4A0RA 4CKCA 5FO0A 4C0WA 1XBTA 3TEMA 3TR0A 4FMDB 1C8KA 3D2BA 3HJRA 3JYHA 3VR3A 3U4GA 1E3IA 5BR4A 2IS1A 4BPBA 3P97A 2GM9A 4YCCA 4RTQA 2BJHA 1P2TA 4E6PA 5JROA 1CJKC 2Q8PA 4ARAA 1X6VA 1ZVMA 4H3KB 3WB2A 3GLVA 3G0HA 1HDCA 1KFEB 5LVAA 4RPLA 2ADFA 3IQHX 1GU1A 4G07A 4QBKA 3KPYA 3S2SA 2O05A 4K86A 3ZE0B 3QE3A 1X15A 1P0FA 4NESA 3U7QA 4WWHA 4BNYA 5JD3A 1P1FA 2J0SA 2OL4A 2V7BA 5HNKA 4YYEA 1NUTA 4RVDA 2KM1A 3HCDA 2CHVA 3K09C 2B8TA 3MOGA 3JQ8A 2WPDD 4MMXB 4D42A 2HHCA 1PWXA 2FLVA 4MQ5A 4P35A 3L9XA 1JG7A 3O4VA 3SZGA 1GAEO 2XMPA 4MAAA 1EUDB 2ZBFA 3HY4A 4J75A 4EMBA 3A1NA 1P4RA 4YR7A 3R6DA 2HDWA 4AYTA 3FUTA 4DMGA 1GKYA 1QF9A 5CTJA 5IXYA 1Q77A 3B9RA 1RRVA 3I2GA 4IIEA 1JIIA 1L5ZA 3GPCA 2IEBA 4LQLA 3KYDA 3UW1A 3M1AA 5FUMA 5JUWA 2ZUDA 4M38A 4G9GA 6CHYA 4ZVQA 1O5OA 2BJWA 2JAWA 2PX2A 3DXFA 3LKBA 4JIMA 4HNUA 2X77A 1VG9B 4G24A 4RVGA 4KE6A 5JAHA 1ZWLA 4PYJA 3ZQKA 1PSWA 1VYUA 1FP2A 3OD1A 1F0NA 1E2LA 1VL5A 1XCPA 3IP7A 3OKCA 4MV9A 2J6BA 2BEVA 1QNFA 3DBOB 3JATA 4DSOA 4CGYA 4D6YA 3KV1A 3KXIA 5A7FA 3K09A 3SVLA 2W22A 1JXQA 4BNZA 4PIMA 2I7VA 1VE3A 3VR6A 2QTAA 2C78A 2OZPA 1FJHA 3C3XA 2XNKA 3DPUA 5EJ9A 5HEKA 1TAUA 1TPZA 3FNRA 4J90A 5KWVA 821PA 3IEMA 5EIXA 3W5SA 2EZUA 5KWSA 2FUCA 4BX2A 2QIPA 1G7RA 3N8GA 1FP1D 5AOBA 4PAMA 2ZT6A 1JDZA 3TAUA 1XWFA 1YB2A 1WUHS 2P9QA 4QM7A 1KI6A 4Q1BA 3FYCA 1B23P 4X44A 1EFPA 2WINI 1TGYA 1JFFB 3GDWA 5AKEA 3TEFA 2BEUB 2XGGA 4CL3A 3QPWA 4CQJA 3ZGVA 3JYPA 2VJYA 4LKRA 4D4GA 1U8CB 2E4UA 1ZIYA 2J07A 2OV6A 3D3WB 4H0FA 2QX9A 3P2MA 1USWA 4W1PA 5G0TA 4DRXB 3C5WP 5E4JA 3AY6A 4KEAA 3E3NA 1N2HA 2G40A 2YZ7A 4MWSA 2QORA 1U63A 1HUQA 2X5JO 2Z6VA 3S5UA 2JCXA 1Q84A 2FWIA 1FCJA 4N3GA 5IM5A 5LA6B 5KTSA 4FYYA 4IKPA 1ULBA 3H5RA 2B82A 2OHVA 1JGTA 4TVOA 2EX0A 5BOSA 3W5BA 1CULC 1I9GA 1OXKB 2CW5A 5C1BA 4EUKA 5BW4A 2ANBA 4BMZA 3FFWA 4O08A 1TTPB 1MOSA 4KQHA 2FW0A 2H2AA 2OGWA 3LBFA 3Q3EA 2RMKA 2X40A 3IMCA 4B6JA 2P65A 5TF0A 4BVHA 5FTWA 3NYRA 1O6FA 3CG0A 3LY9A 4ARVA 4KRGA 5CDTA 2WNIA 2WNHA 1EIWA 2QPAA 4N6NA 3ICQB 3C8DA 2WJGA 1ISPA 2FZCA 4ZWNA 4MZXA 1CQWA 1TCVA 3AEZA 5LBUA 3TDNA 2IQ5A 3L7LA 5AM1A 4CMKA 5KPDA 1GXSA 3GJRA 1EFHA 5HKLA 2ZBEA 4HH1A 3FLMA 1E3LA 4PZYA 3W6NA 4NU0A 2QR3A 3MGKA 4DRZA 4AJPA 3PIDA 2J3JA 1KARA 1MPTA 1V3QE 2I65A 4RV9A 4HCJA 4HSGA 4RUKA 3T1VA 5CB8A 2Y1FA 2JVJA 4YUYA 5JU6A 1H23A 1L6RA 4BJHB 2DRIA 3ENKA 2E87A 4L9SA 4LJ4A 4TTTS 2DLCX 4EEXA 3S8EA 3OJFA 4YJ2B 2FSGA 2ZBQA 1F14A 3LFTA 1EA7A 5FOWA 2H4FA 5DTRA 3P9RA 4FU0A 4NJMA 3I0ZA 4NMXB 4C0BA 3QUSA 2OMEA 1KPIA 4K6OA 5K3FB 2DKNA 4JKOA 4M54A 4GQAA 3DXYA 2AYZA 4RKEA 1N57A 2JCVA 3DONA 3H5AA 5J5VA 3QU7A 3S6JA 4IEIA 5K7SA 4DUPA 1AKNA 1G19A 4LF6B 1AS0A 4BC1A 2VZLA 3TLBA 1NXXA 4ZAYA 4D9MA 2YJ5A 3UHPA 1I01A 1JB9A 2VPXA 2NWQA 3B6IA 5I7EA 3M1IA 2ETVA 3RM3A 5IFKA 1SZPA 5GZ3A 3MWKA 4HY3A 5GZ1A 2IH5A 1ESEA 1RYEA 2FKNA 3L40A 3MCVA 4Z4IA 2VA9A 1D03A 5SYMA 2C84A 3H11A 5AVWA 1X7YA 4E7PA 4XLZA 2Q6IA 3F6PA 4G1UC 1AXEA 2C94A 2GO7A 2NGRA 1NTOA 3CJQA 4QZVA 1MORA 3GBSA 3LBIA 5E8RA 5HDQA 4GDFA 1E2HA 5AVKA 2ZI3A 1XEFA 2RHOA 2DUNA 2Y1WA 4RABA 4ZA2A 3WWOA 4ZI2A 1RKQA 2JLRA 3BIXA 5LP6C 2J48A 3L92A 1V1RA 1HURA 3LY8A 4HFRA 3AESB 1WQ4A 4CM5A 4HT3B 1WMDA 3BWXA 1QDUA 3QLTA 5CT8A 4PPQA 1NNEA 4AXXA 5G1NA 4MYUA 1T5HX 2ZE6A 3MW8A 3Q2IA 1UFVA 1A2KC 2HY7A 4H7DA 4IJ5A 4KFSA 1SHKA 4KWCA 4RJ2A 3EPHA 3DMYA 3ZCQA 4G6ZA 4KQ1A 2AX4A 3DQPA 4IOMA 1M7BA 4R1OA 4YS6A 4O5AA 5DTQA 2YY7A 1WBJB 1TEZA 5JZ9A 1RDFA 4RMHA 2ODEA 1E1RD 3C98A 3O2NA 3KFVA 4Z2YA 4D8UA 2AVDA 2XYRA 3LZDA 4ZCIA 1VJCA 2R6ZA 5FLKA 4Q12A 4Y9RA 1XX6A 1TVCA 2BFAA 2P79A 3S40A 1RC8A 3GJ4A 5EVJA 5GQSA 2HMTA 1U2ZA 3OO0A 2C20A 2D5BA 3MWFA 1TKBA 4OATA 2HBQA 4MGIR 1M1YA 3H0CA 3URMA 4AZ0A 5J47A 4WXPA 2IZ7A 2XUGA 5EUBA 4D9GA 4GFDA 3T1HB 2HH9A 3TPCA 4Z54A 1F51E 5LP6A 5ECDA 4Q9KA 4DV0B 1L7QA 1NWCA 4G36A 4L72A 1MFZA 2ERXA 3N2NA 4D9NA 1MXFA 1JLHA 2WOOA 4WESA 3T3IA 3B1XA 3H1PA 5KMGB 4J0DA 5PNTA 2ECOA 2G9NA 1H6DA 2ZYGA 2RCNA 1FSSA 1WXDA 5IAAA 1SCUB 4YUVA 1RD4A 4M3NA 4OG2A 5TPZA 3R7LA 4D25A 5HS6A 1PZEA 3HMKA 3MVEA 2VAPA 2HK7A 5SICE 1R6AA 2H07A 3DVQX 4AQYB 1EU1A 2FPWA 2JFOA 4DJFC 1CSEE 3TCKA 3GH3A 4MV3A 2ZETA 1CHDA 3I52A 3N5CA 1YOVA 3CS3A 3GGOA 3O3NB 5JDCC 1TJ3A 1GNRA 3SEQA 3PC7A 1YZLA 2PUAA 4LA4A 5TQ0A 2VRCA 3ZTYA 2Q0SA 3UJHA 6REQA 4OL9A 3NT2A 2V3WA 4CKYA 1RAEA 3M5CA 3T9EA 1GR0A 4RDIA 4UC0A 3WIVA 4ZDJA 5FBVB 1TU3A 3MINB 3ZDEA 1QKKA 4QUAA 4B8WA 2RGNC 1P61B 4ZKDA 3ZG6A 4LZLA 2CLEB 1CY8A 1NGSA 3RKUA 2XYHA 5HP4A 1C9DB 4UHJA 3K72B 3KM0A 3SIPA 3LGAA 1N77A 3LD9A 1O9GA 4K7JA 4C04A 4F1KA 2IS4A 5DM0A 3MSCA 3A9TA 3C3YA 5BNWA 2ZBDA 4WAUA 4L3VA 3ZEAA 2Z3WA 2H0RA 3Q3JB 3VSBA 3IX7A 1IWBB 1NBMA 1F12A 4RLSA 4RZIA 1RC0A 1P2BA 3FKJA 2O5EA 5DWDA 5DXFA 4S2EA 4E51A 1FFXB 3BYZA 3MXOA 5FUVA 5HIMA 5I7VA 3TIVA 1V6CA 4F5DA 1P2VA 2VZ0A 4MLCA 3DTTA 4WOJA 2XVYA 4NFHA 5TMEA 4UCXA 4GPEA 1IZ0A 1E3WB 3THWB 4PWYA 1A50B 2RIPA 3JD1A 1TVMA 4OJQA 5IKPA 2A92A 4FDUA 4PZZA 2WHQA 3PC8C 1D5WA 3ZXSA 3WGZA 4YV2A 4MS3B 4AF7A 1BCSB 3EIQA 4PVCA 1L7XA 4D0RA 2AJ8A 1V35A 3NBXX 3E4CA 2VSYA 6ABPA 2DF8A 1NFQA 4UJ3A 2CT8A 1H4VB 1H9BA 1WU8A 2QM0A 2VYFA 4YHBA 2IDZA 3NETA 4KVGA 3WYAA 4C07A 3EE6A 1J20A 2R7AA 3CPEA 2YRXA 3ZUPA 5IC4A 3JQBC 3CJTA 2YFYA 4JQZA 3ELYA 1K0FA 4QPZA 1PNRA 2CNLA 3R3ZA 3H2SA 5IH3A 4R1PA 1C7EA 5H59A 4WUTA 1U2PA 2ZIZA 5FNVB 3OQIB 1ZKDA 1CJVC 4Q4AB 2L17A 2WA1A 4S3MA 1QYIA 2HCFA 2ZG6A 1Q7BA 2O7QA 3L6UA 1FU7A 1S1MA 3H2IA 3RC3A 5LXTB 1SXPA 4ASUD 1NURA 2QJWA 3R3UA 4YAKA 5DNAA 5JAMA 4YIHA 1ZVQA 4BO0A 1XR3A 2IX3A 1QGYA 3PC8A 2DHDA 2GILA 2Q3JA 4P4TA 1CUYA 4QPCA 1OWPA 2EL9A 4XGNA 2OYRA 1TF5A 3WK7A 4DIEA 1V4BA 2H1VA 2XEXA 3IAEA 4FQ5A 4PR3A 4E33A 5FOQA 1QORA 1QH0A 2C95A 1XMJA 5CBPA 2I2FA 1W581 5LDGA 4DBLC 4MV4A 1L7NA 1PHRA 2HRQA 3DVAA 4LBZA 2DHEA 4IXWA 2CNKA 4B3DA 1Y8CA 1TUGA 3KJHA 4PHHA 2FOXA 5FL7D 1OR8A 4DTCA 5I47A 4ZOEA 3WAKA 5CVUA 4Y9DA 1CQXA 1WAMA 2R87A 2QTGA 3LUGA 1ULTA 3QEMA 1GO2A 2IW1A 2FUEA 4FS8A 5TPWB 1FOEB 4O6VA 3OFSA 1Z4NA 4TTIA 1RM5A 5EXEA 3H1EA 3PQ7A 3H05A 1XN1A 4UEQA 4Y2TA 3C3CA 2O8EB 1XXHB 3M6FA 4GDMA 3ZVRA 5BXQC 1N6PA 1VI6A 5FP0A 3UHAA 2BUAA 5CBKA 1DT3A 4QAQA 4KO4S 4Z2AA 4M1TA 2WF8A 1V7PC 3EUFA 4G4IA 2OCIA 4M83A 4QDTA 1Z5OA 1NJFA 5ANRB 4KAJA 3KSZO 3V4FA 2EU8A 2GCPA 2QL6A 2OWDA 4FZ5A 3EQ9A 1OPRA 1OI3A 1SQFA 3PIIA 1LDEA 5D3QA 5GZ6A 3K9QO 4CTKA 4H1WA 3R0XA 2ETXA 3SBOA 1XTKA 3STXA 2EBWA 2FFHA 2W6JD 1CJTC 4ER5A 2KJQA 2J3KA 1MH9A 5EMLA 2ODAA 1SZJG 4GBED 3T1OA 1ZL0A 1CY6A 4XQ9A 3ZY5A 2PH3A 4JC5A 4WQMA 1OOEA 4IINA 4EB3A 2YXLA 4LE0A 1JJFA 3VC7A 5KDDA 5FR1A 1Y6RA 2RJNA 5KVCA 3C3MA 4HX2A 1WU7A 1VL6A 3WBBA 2IHJA 2H29A 1CEYA 1NN3A 5HZGA 4RH0A 2VYND 4X91A 2OKGA 2CLFB 3M6VA 5TXGA 3SE0A 3AM4A 2BOVA 1CS0B 4DJDC 4EG6A 1PFYA 2ZT7A 2VK8A 5AM4A 4TYWA 5ES4B 5ADWA 1IJFA 1E0KA 3BF8A 2FDRA 5KOYA 1BVRA 3BTSA 1FYWA 1G1MA 3DEKA 2PFKA 4HVAA 4RM3A 2FW6A 3X2FA 2ZI6A 5EJ6A 3NR2A 5H83A 4YXWA 1BSVA 4MWBA 3G2MA 4Q4JB 2W83A 3ASUA 2WTBA 4JP5A 3UKJA 2IH4A 2DCUA 2V54A 3UJNA 1ORTA 3A6GA 3IUQA 3QHPA 3OE7A 3BMNB 2JVIA 4XJVA 3NEYA 3RR2A 1MQ9A 4OH7A 1R18A 1KIMA 1EFVB 1GEGA 4G4SO 4GC5A 5NLLA 4PZCA 1YU6A 2IGTA 3OX2A 3OUTA 3RS2A 2XE7A 4DSAA 3FF1A 1C3XA 5EXXA 4CM4B 2BZSA 2OB2A 5K0JA 1VJRA 1J1IA 4F4FA 2VDQB 3IIKA 3TB6A 3WWDA 2B1QA 2EIXA 4F6RB 4KITB 1FX0B 2VSFA 4W7SA 3U40A 4U5XA 2VYVD 1NKTA 4WV3A 4CMIB 2OAP1 3T6KA 1RM0A 2JHCA 1SVUA 2R1TB 1Y1RA 2GGSA 3ONFA 4GPAA 3S3TA 1WXGA 4BFTA 421PA 4ZDWA 1NSTA 4ZAVA 1ECPA 4I3HA 4DGSA 1M74A 4UAUA 3HXTA 3HR4A 4PHTA 4JI3B 4AN0A 1G8GA 4TWBA 2J6CA 5F4BA 4ZMRA 5C80A 3M6XA 1TYAE 1TUIA 4YUZA 2Q3FA 2PUJA 2N46A 2Y93A 2Z2ZA 2HMUA 3IXLA 3KB2A 3OSUA 3QWBA 4G01B 2O50A 1I3CA 1XZLA 3QXJA 3LTNC 3OMXA 2QLMA 5A0VA 1V9SA 1KBZA 1UIRA 2BI7A 2EQ5A 2N1BA 3SK0A 2J0VA 3TQIA 1ZHOA 4KMOA 4M88A 2C4NA 4KGZA 1LX7A 2G17A 1LC3A 3ZWDA 3RYHA 4DLSA 3FBGA 4TWZA 4MEBA 2UUAB 2FN9A 5AVXA 1GZUA 4CMGA 5F2OA 1M3SA 2E6UX 1TOAA 3RRBA 1IWPB 1E1DA 4RIGA 1ZGBA 4E7OA 1K7EB 3JQGB 3MF4A 1ADYA 1JFRA 5ALTA 2WYUA 3AG5A 2WJIA 1EFUA 4KE9A 5EIBC 4KGDA 5A4KA 3IV9A 5DRTA 3COPA 1ZJ4A 2G5PA 4KWIA 5LZ5A 3WIOA 3R3SA 3KPVA 2YZKA 4V0LA 1YR3A 1REQA 3LUJA 3GX1A 3SBXA 5KINB 2PXXA 4F4CA 5MN5A 2GA9A 4MPTA 5F73A 3SD7A 1VBMA 2TECE 5E3HA 4HV4A 3AXTA 3BXXA 2I9PA 3NYWA 3BK2A 1EINA 1TZBA 3Q6NA 2JGDB 3GJ7A 3WXBA 1H5NA 4RM2A 3HRHA 4GKBA 2PYDA 3ZX5A 2C00A 1G2IA 4REOA 4TKVB 1EXMA 3RTBA 3HXMA 1FQOA 1FDOA 1K6XA 2V0CA 4JSTA 1UM9A 2H5LA 1IOWA 4U5QA 2H1OA 2RGRA 3NALA 2GNPA 4B76A 1ZUD1 4Q7EA 4RK1A 1IATA 3MHPA 3K2EA 3PDUA 4Y8VA 3ZDDA 1WXXA 3N5KA 2HSDA 4CEHB 4CMCA 1UWLA 3CO0S 4UTNA 3PQ2A 3A7EA 3MC1A 5LZ9A 1ISMA 1SVWA 3K5IA 3GFRA 2AR7A 3DAPA 3HG7A 5PGMA 4EM6A 4FGLA 1SBHA 2RGXA 2WUGA 1EK1A 1QKJA 4X0EA 1NYLA 2A2ZA 3ZKWB 2AWNA 3A9CA 3A6ZA 1WF6A 4YP7A 2WK1A 1WXIA 3F9IA 1AMOA 4JSRA 1E98A 2HMSA 2QX8A 4MRSA 5KNCH 1EJ0A 3D5TA 3ZX4A 3PYLA 4R1NA 1PO7A 4P2BA 2C77A 3RJ5A 1W93A 1SBCA 1E6WA 2ZWOA 1UDBA 5LZ7A 3S27A 1I94B 3G89A 1VPWA 3L6BA 5AXCA 3WVNA 4BCCA 1C1HA 1S2GA 1JKIA 1XTIA 4IGKA 4BBAA 2DY0A 4B6RA 3I9FA 2X76A 3PEWA 3ESRA 3I6BA 3A6KA 4QU0A 4J7UA 4EQZA 5F3WB 4XOUA 3PGXA 1FS5A 4Y2YA 4MVWA 3ZZNA 5CXQA 1II8A 3ZI7A 4M36A 4OVKA 3UCXA 5CD9A 1G3IA 3C70A 4E4RA 4KQEA 3IUEA 4MUBA 4Y2UA 3ZV7A 3G2PA 4UMFA 1ZAKA 5ISMA 1N5MA 1YJ8A 3ONNA 3AF2A 5LBIA 1QDLB 2V3VA 1LVGA 4IMJB 4OI4A 3DGFC 4JT8A 3VTZA 3DLTA 5HZMA 2DWCA 2JLXA 2Q5OA 1F3LA 3AEUA 3CBQA 3FKQA 2VJLA 1B6SA 1W0KD 2GYWA 2WP0A 3UG7A 1JWLA 1M2GA 1WHTA 4CKWA 1XDUA 4TMKA 5IDYA 3RTGA 3KSMA 1F4LA 2G1PA 1TLFA 1SBYA 3AW9A 4DLBA 2WFLB 4K0KB 4DHEA 1B8PA 2WTMA 4RZ2A 1E8MA 4S1VA 2BAGA 2SICE 1P81A 4UTOA 1E2KA 1F38A 3R3HA 4GLBA 1LPOA 2B6HA 2MSLA 1NNSA 1XTJA 4F1JA 5JDIA 3LC7O 2CYBA 2IUFA 1OIWA 3KL2A 5F1OA 1VRCA 5K3SA 4PY2A 1EHYA 2IU3A 3WLOA 1K6JA 1V96A 4MQFB 3SLKA 4MEJA 1GPWB 1OWNA 3IAM1 2XZDA 3D8SA 3RV4A 4A26A 4EA8A 5HRUA 4Y6OA 5JSHA 1RU3A 1KI4A 3SS9X 4COOA 4HLQB 1EJ2A 3UK2A 3OG9A 4HDQB 4JP8A 3GMSA 3A6LA 5D86A 5FNZA 1SVOA 4L02A 1YB6A 3KKOA 5BN1A 3ZWBA 5JH7F 2IEGA 1ISJA 1SEPA 2H57A 2GBLC 1YR2A 4J0EA 5EYPA 3RBAA 4HNRA 1HGXA 3CB2A 5EQFA 4HBGA 1N36B 3VR4D 5EQTA 1VHWA 3HXOA 2HF7A 1JILA 4J1SA 3FVVA 3ED5A 2D4HA 1FX1A 2ZYVX 3AVPA 3HCRA 4DR6B 4ETWA 5LU9A 1JH9A 3A9WA 1Z0IA 2G63A 4MVJE 3ZIDA 2CLIB 2WJ4A 2WJWA 3NM6B 5I9MA 2G83A 3ETLA 4IHJA 4IMPA 2ONZA 4J07A 4ZO6A 1NUUA 2IWRA 4E1VA 7REQB 1L4GA 1XD2B 3PEUA 1B1AA 2PGAA 2PX5A 4QTZA 1GZ5A 3RUEA 1NQUA 3RS7A 5BV8A 1OFGA 3MYRA 1SUDA 4PYNA 1DRWA 2OYCA 5K6AA 1A9XA 5CNMA 1N6LA 4QUDA 5AT1A 2F8TA 2H0AA 5AVJA 1GILA 4ZOCA 4OSPA 3EFHA 4U9UA 2QLBA 5DISB 2NTJA 3ZD7A 1R2QA 4BFZA 4EJSB 1P74A 1JJVA 4CDMA 5A3RA 2F8MA 3HCFA 3ETGA 1JRLA 4RZ3A 1BJRE 4REQB 3I53A 2V74B 4MUYA 1IG3A 3RVPA 1M66A 1DG1G 3LECA 1OZFA 2RAPA 3ITKA 3KKZA 1UK7A 3QYJA 4PQGA 5AVRA 4WL0A 3U4QA 2GCEA 1K0UA 2P67A 4ZO8A 1I5EA 5B2FA 3AR5A 2EGHA 4C1NA 1PTJA 2QAGB 3K1YA 4Q9DA 3RLFA 1HOTA 4BYGA 1C0LA 1A5BB 1AKRA 1PJTA 5JAZA 3H0EA 2QP4A 2D2IA 1WMBA 5MGNA 3RSLA 1MV5A 3H6GA 1W4BA 3F1KA 4LY0A 3G13A 4WZBE 4RNCA 1QTRA 1YI1A 3DO5A 3CEMA 2CLLB 2QEQA 3GZ4A 1CDEA 1I0IA 3R7FA 3T7KA 4WBXC 1SIUA 1C7IA 2H1IA 2PMWB 3H9BA 4FGUA 1W36C 1PR2A 4C4SA 3F98A 3HBJA 1KO4A 3AGQA 1KH3A 2Q6TA 1CETA 3KKQA 2OG2A 1Q0SA 2J08A 2ZREA 4ILEA 4Z49A 4L4UA 1CKEA 4CMJA 3RIGA 3FZQA 1G3UA 1C14A 1JQDA 1MIOB 4RYDA 3TD9A 4S0XA 4TMWA 1QSGA 2DBZA 1OLUB 3R5JA 2X5OA 4RACA 4U9IS 4FSHA 2FW8A 2P9EA 4UEOA 1EK6A 3ZQJA 4C6SA 4TT3D 1CV2A 1U7PA 1XN4A 1Z8FA 3IV6A 4WNAA 4XTCS 2FN7A 2NUAA 3QA9A 3GGCA 1PS9A 5A4DA 3B1YA 1TO1E 1DDIA 1DRKA 3UJAA 3WB9A 1D7AA 2RJ3A 2JFUA 1NVXQ 4I9HA 8LDHA 1FFSA 2ID9A 2HYIC 3R4VA 4EFLA 2JJ2D 1W2HA 3LG2A 4DLYA 1UMBA 1J24A 4FW9A 5KTTA 1UOOA 1PNTA 4A7PA 3VNSA 2VZ8A 1D6MA 2WHXA 2Y99A 1D2CA 2PQ6A 1QGZA 3DOFA 1D3AA 2IQIA 3BWMA 1H66A 3LPCA 3ON5A 3OZXA 3V34A 5AW8A 1OBVA 2I4RA 2R6AA 3AP1A 3VFDA 1D2RA 1EX7A 4K03A 4BTLA 3OPYA 3CLUD 2Q62A 1NW6A 1XGKA 1XLWA 4MV0A 2QUHA 2PCLA 3CZ9A 1XTBA 4M8NE 1YB4A 1HDRA 2ZJ2A 4AURA 1J0AA 2I4NA 4UD2A 3ZHVA 2RAUA 4B4KA 3WGLA 4TPKA 2NNWB 4B1FA 2GRAA 5DGTA 4AJ1A 4DDHA 2REOA 4RHFA 1JT2A 4J8PA 1W4CA 1JU9A 3DYBA 3G23A 3OLWA 3QPDA 4K6GA 3IOEA 1YQUA 5GGXA 1FS6A 1GJRA 2YMMA 1JDPA 3BDVA 1Z5ZA 4CBVA 1B8VA 4LY3A 2H2HA 4EARA 4OAQA 4RD2A 4GOOD 4AMGA 4UNRA 5ERGB 5HIAA 4ZMSA 2IIVA 2IZ0A 4I4TA 4J7CA 5KOHB 2CE7A 3FRIA 1QHNA 4R16A 2JFQA 3KUCA 3V9PA 4AZVA 5HK9A 4LTDA 2E21A 1DUIA 1JW9B 2V5UA 4MV6A 5CK4A 9LDTA 2CVHA 2GKSA 4KO8A 3HJHA 3PHHA 2HF8A 2WILA 4E1BA 1AQNA 4GBGA 3GJ8A 2G76A 1ESMA 1M67A 4ARZA 1T1EA 1BVYF 4OOFA 3O8QA 3JAWB 1Z37A 2PD6A 3W78A 3ZW9A 4N0MA 4B44A 5BQ3A 4N12A 3RTAA 1VGRA 1JG2A 3TBHA 3JYQA 1GRQA 1UBCA 4YP6A 3R23A 1Z3IX 2GWHA 1NVTA 1U11A 2X2OA 4HADA 2J3LA 4OH1A 3H13A 4JEHA 4PC6A 3ANSA 1GTG1 2V6JA 4R0NA 5DM1A 3HFSA 3VNAA 3QBDA 4G8CA 1M6NA 3SYRA 1T0IA 1HE2A 2X2FA 4EI9A 2DQYA 3GVCA 4ZYYA 3KSDO 5BN3B 2XZOA 5KYWA 1VCMA 5J4HA 5GJVC 3ZCSA 5C46F 4BNJA 2YWDA 3X1JA 3CVOA 5CRIA 5DWVA 4E09A 3B3GA 3BTOA 4LDQA 2F1HA 1GKLA 4QUHA 5BN5A 1UP4A 1YCGA 2Z3ZA 3C0KA 3JQEA 1EIZA 3COJA 4B6PA 2ZWMA 3LNTA 3E58A 3RSFA 3LSTA 5LUAA 7MDHA 1KJWA 1LNSA 4ENWA 2XCOA 5EMJA 1YBAA 3ABQB 5EG5A 1YR6A 4PIVA 3DE6X 1C1DA 4WTOA 3RVJA 2HHHB 2QV7A 5G0VA 2JGLA 3SR0A 2GN0A 3LT4A 4C4TA 3EZXA 3W7VA 1NLUA 1VYVA 2E4VA 2H8GA 4GI3A 4M0KA 1GSAA 2X8BA 3E61A 2JIRA 5DHSA 3JQ7A 3BVPA 1P1RA 3BD9A 3U60B 2E85A 3NWEA 5CIQA 4YVFA 1T5TA 2C83A 4A27A 3R0VA 5HIKA 3D9QX 1LPPA 1A8SA 2B6NA 3PGLA 3E22A 1L4EA 2A0XA 2B83A 2OBMA 5KCZA 1ZM7A 4I5IA 4C6TA 4FZRA 4TROA 5JO9A 2W00A 4KO3S 5I4IA 3AJRA 2PUTA 3I83A 1YH3A 4B3BA 1YBMA 5AI5A 2C96A 4LJ8A 4DMCA 4AYXA 3ZJTA 2C58A 4IDHA 3T7SA 2BGIA 2Q3MA 3ECCA 4QE3A 4M87A 3M9LA 1UAGA 1UXJA 1E3QA 4M22A 4CCYA 4DUYB 3RDPA 1KI3A 2BUBA 4HFMA 5AW9A 1MZPA 1EWTA 2MSEB 2QI9C 3N3BC 1VHQA 4OY3A 1F60A 4FGWA 3DKPA 2AZDA 1FDSA 1WABA 1UXGA 1YBHA 16PKA 5IJ9B 5L3SA 3W1VA 3DOCA 4M7RA 5EESA 4B3XA 2GJ4A 3D6TB 5L9AA 3OF2A 3INNA 4ZANA 1QG2A 3FTDA 4P08A 3A04A 5IEJA 3IHKA 4NNOA 5HK8A 3JVIA 2P4QA 2Q3CA 1SKUA 4ACBA 4AJNA 1BJTA 1TMKA 4LYFA 3AJ9A 4TV9B 4ZP1A 3KTDA 1COWA 1DKNA 3NBMA 4WN9B 3GCWA 2A1TS 4R54A 2BM9A 2XD9A 3VV2A 3K53A 1FLAA 4LK2A 4LV5B 4Z6KA 1EEXB 4U2KA 3PX7A 4TV8F 3MWDA 1ARZA 1OU0A 3IQDB 4B48A 2YWJA 1XYYA 3IAS1 4QQFA 4QYSA 4HGNA 2XCTB 3SN6A 4KO1S 3CHYA 2O0LA 3TMKA 4EHBA 2R7NA 3L0BA 4HAIA 3CKYA 5FAXA 2RHMA 3GRKA 2JBHA 2FPUA 2PR7A 4GSYA 4IMRA 2XWQA 3B7WA 2WC1A 4EKYA 2BFPA 2C42A 3LDGA 1KQGA 1QHFA 5DCYA 4EMSA 2AUNA 5LJIA 3BSFA 5BWLA 2CMDA 2YFKA 3FDFA 1PX2A 2XA9A 2XMRA 2XMGA 2J6IA 4LHZA 2W2TA 2DPXA 4NFLA 5JCJD 3N3AC 1M7HA 1AIPA 4NYIQ 2PQMA 4UVHA 2I0FA 3HBFA 4KQFA 3THRA 1PFUA 4MUJA 1ONBA 2W2KA 1GZ6A 1M1NB 3CSUA 4PX3A 2YVKA 3HFJA 5CVEA 3IKTA 4FFLA 2WKSA 4H4DA 3DD1A 4LDJA 1KTVA 2V7UA 2IOFA 3HI4A 4FD3A 1Z47A 2Q3HA 1XK6A 1E8DA 2B4AA 2VT2A 1TYCA 3KZXA 4IS3A 4LOJA 2CNDA 4Q1VA 2JHFA 4URFA 3VISA 2QMEA 4E3WA 5DK6A 4BASA 1SXJD 5B58T 1NXSA 1PUIA 4ABTA 4RY9A 3U48A 2C7GA 3TLCA 3DL0A 3KHSA 4QT0A 5GV8A 3RT7A 3TW6A 2ZZKA 4OUDB 2FNAA 2F4NA 4RPIA 1QONA 1YRBA 1PGJA 3LUFA 4BCBA 1JI3A 5EPOA 3BBPA 2VLIA 4E88A 3SIWA 3AFHA 2K7FA 1H0SA 1ZD9A 1U9IC 4R3NA 3STYA 1CWUA 2R66A 2FEXA 1BG6A 2OC4A 2UV8A 4RADA 3S99A 2H1WA 3H84A 4YALA 1PN3A 1VE1A 3SBDA 4PAOA 2EYQA 2WPDA 4G8DA 3ZJ4A 3N87A 3OY2A 3MUNA 4GOKA 3DEJA 2FK8A 2XNCA 1OCEA 1VCOA 1ZSYA 3ROTA 3RYFB 4DIFA 5LNK6 3SVTA 4O4HF 2G36A 4YAOA 2PAFA 3GV0A 5FBKA 5DBGA 3DZGA 3F1LA 1PEKE 3H4TA 3NPMA 2QWXA 4IIFA 2BKAA 3FCSB 2YMLA 3VUEA 3H7AA 3UMRA 3BE8A 3UJBA 3UYLA 1KRXA 5EEHA 1EP1B 3LU1A 3N8IA 3ZU4A 3UAYA 3HE3A 2AUTA 3GUZA 3HR8A 1ORIA 3I6ZA 1JVSA 4NV3A 3MT7A 1Y1PA 4X85A 3C6ZA 4IPTA 3TUZC 1Y4ZA 4JENA 1E6CA 2O2YA 2WHPB 3TE7A 1IPFA 4QQNA 3UGTA 1W8DA 2YJ6A 2CDCA 3ZWNA 2GHRA 2C9OA 3QF4A 3QJGA 3A2NA 5FO1A 5FT9A 2CYAA 2JI6A 1NTRA 1RCUA 4H6VA 1UP7A 2ZJ7A 4CT5A 2I2AA 4DR2B 2FW7A 3P2EA 3QLVA 5DLEA 1NQOA 2LCQA 5REQB 3S44A 4G5RA 5DNUA 4OO3A 4QLOA 4WKCA 3D3QA 5B2ZA 2OBNA 1B93A 1PLLA 1L1RA 4J76A 3SC2A 1N7IA 1XD8A 2GEFA 3DMRA 3QPUA 4ZCLA 2HQ1A 1JWAB 3AI7A 1MFPA 3CLTD 2BBWA 4ZGGA 5CEJA 3EUWA 2O20A 2I2WA 4E21A 2M6RA 1FNCA 1C0PA 2J3HA 2ZYWX 4H7IA 3LVRE 3LYHA 4RYLA 1ZH6A 2H31A 4R8SA 5ECGC 2MHCA 5HWSA 1AKMA 3F6SA 1R3UA 4RAOA 1T0HB 4KTTE 2ORWA 1V11B 4DM7A 2O2DA 4KRFA 3KFLA 1TEVA 2W2OA 4ZQIA 4KW7A 4DNXA 2JFHA 3OUUA 2B2NA 2O0MA 2RG7A 1GGHA 1P62B 3P20A 2FMFA 1LW7A 3JQDA 4C2TA 3FYHA 3KKEA 2FDCA 2W58A 3P2IA 1UKCA 1A88A 1JHYA 4IIHA 2DH6A 2YYAA 3IEUA 3K9LA 1GVHA 3W5DA 1IY0A 4TS9A 1HXHA 1Y8QB 3INTA 5L3ZA 1H4QA 1BD4A 4WBSA 1G3QA 2UYCA 2GPBA 2QN2A 2XW6A 4B4DA 1TM4E 2TS1A 1E62A 2XE6A 2RC6A 3AHJA 3K0AB 2P3SA 2WU0A 3TIGA 3P4YA 3A06A 2QR2A 1HF3A 2X9VA 4I50F 4Y2RA 2PYZA 5DHTA 1F3OA 2CHEA 4A03A 1BU8A 5KQMA 2VYCA 3AUUA 1E2FA 3PFNA 3WLRA 4NBTA 4R1SA 3TGPA 4HDRB 3OC6A 3ZHYA 4OB7A 1H8ED 3DS8A 1Q7GA 1EXNA 1L7EA 4CMEA 4W5NA 4D9HA 2G08A 2QSUA 4AMYA 3L1KA 2ZR9A 4EUEA 4FHDA 1EESA 3WTCA 2BIFA 3LBAA 3M4NA 5FD8A 1UMCB 4F7DA 3QVJA 1N2IA 1GY8A 3HEBA 1NUSA 2BFCB 1OFTA 3PI7A 1QJCA 1PT9A 1C2YA 3TR6A 4P4GA 2XODA 2GXQA 3IILA 3N0TA 4JJFA 3WQSB 2CEKA 2VF5X 2NQ8A 3FOFC 1QTNA 1RJGA 3U1VA 8ADHA 4BLWA 4TZ0A 4FMBB 3RT1A 2ZWIA 4WUVA 4EW6A 4X20B 1X70A 4TQ9A 5DCWA 1GWNA 1VKRA 3OKPA 4B7XA 5I51A 2O8CA 4RVNA 2VUHB 1Z4KA 1R27A 3IP8A 3PWKA 4B40A 1Z6GA 3EASA 2WLTA 1QK4A 4GZLA 4MVJP 4YRAA 3PGMA 4Q3DA 2NXJA 4B3JA 4EA6A 3DAOA 4RD3A 1YKSA 2QTWB 3F5FA 3I9MA 2WMDA 3LWZA 4Q1AA 5TGDA 2C82A 4DKXA 1SCBA 4ZGWA 5I48A 4QBIA 3PZBA 4KNVA 2P1ZA 4ISCA 2JLAA 1K7CA 1BROA 1FNBA 1P1BA 2FUNB 4JJGA 4BKQA 2I76A 4FFBA 2AZ4A 4JBHA 3S5JA 5AUOB 4ZFNA 5BRNA 1WTCA 3OOEA 1LGYA 4GLOA 2DCMA 4BJ1A 1KOFA 2P0EA 4RHCA 1UPTA 1AN9A 4EENA 2RHTA 3E2MA 3GLSA 3PQEA 4IIVA 4QGHA 10MHA 3L0OA 3L8YA 1FZQA 4FYPA 4KLCA 3QPCA 1SHUX 4WBNB 1AO3A 1TMGE 3G2QA 3HLTA 3IVXA 5CA0F 2B99A 3BE6A 2VXBA 4K2HA 2FFBA 5HJ7A 2VNKA 2JZNA 3UYKA 4CQLB 3LI2A 4A16A 4Q3LA 1TMOA 1E1RA 3GFPA 3G0OA 2VP2A 1LWNA 2VJCA 5CLHA 4BRWA 4PSCA 1R9MA 1FDVA 1GFWA 5G41A 2CD9A 2FLWA 3GG9A 3LMKA 4HLDA 3IBCA 4K88A 4GAEA 4ZQFA 1W5SA 5FADA 3V1UA 4EELA 3OVMA 5LR6A 4IH1A 1XCBA 4NE9A 3B52X 3E3OA 1OBHA 5DH9A 3QX9A 4Q7LA 4DFDA 4DLAA 4H6WA 5CDHA 1KS2A 5TY0A 1DIGA 1DIBA 4LHSA 3H3JA 4AN4A 4MP6A 1XVIA 2JI8A 4BMXA 2XOXA 4UU0A 2FSFA 4R2LA 2HHLA 4D44A 5B55A 3OLQA 1CP2A 3R74A 1G1AA 1ZLYA 2N0SA 3JARB 3JQPA 4JH0A 4YACA 5JARA 1C3OA 1TMYA 1UZUA 3X2EA 4PSDA 3UT0A 1BX3A 1HE4A 2VUIB 2Y05A 4C22A 2Q21A 2BTOA 3T5DA 1XFDA 3SM9A 3I1FA 3GD5A 1RHQA 4CKEB 1XP5A 4ECEA 4ZU6X 3UF0A 4ZTBA 721PA 4OXKA 2NAFA 3IE0A 2GD1O 3U7IA 1CZOA 1L7MA 2OXEA 2H4YA 3HXQA 1DAIA 3I1YA 3ZGYA 1T9DA 4ND8B 2HU2A 1NAHA 2LCIA 2AXPA 3VR0A 1Y9EA 1E4VA 1CYDA 1Z6AA 1T1RA 4UZEA 3UENA 1B6GA 1JIUA 3D02A 1NXPA 4I1OA 1QRRA 4UXHA 4FTWA 4BZQA 4DNFA 5BWCA 5C5IA 4BUJA 4INJA 3VHXB 1KL7A 1WPGA 1MJ5A 1OVMA 3GGPA 3HP7A 4IHQA 3K0CC 4HNSA 1PL7A 3O8BA 1ZIOA 2O4UX 2PKWA 2CJYA 2DR0A 3GDHA 4NQZA 5B1DA 2BFDB 1TUBA 2Q7DA 4DLTA 1VHTA 4MQEB 3CRVA 1LDNA 1RWPA 2CKMA 2J6HA 1P3JA 3DOOA 4EHNA 1FVFA 2BP7B 2V59A 2YWFA 3KYJB 5FIUA 5JSYA 3T5TA 3RVKA 4EECA 1S8FA 4ZGBA 3B70A 1SVLA 4A2CA 3VDMA 5G4LA 1QFMA 1OGYA 1GV0A 1PFVA 2VOJA 4RD4A 1EDDA 3QA3E 2BMDA 2JGIA 1K8QA 2WU1A 3DBHB 5A1JA 1S1CA 2PVPA 2QVBA 3WQRA 3U44B 2J67A 1PTKA 4GZ3A 4EHJA 4KR6A 4LVOA 3WP1B 5HDBB 3O2SB 3ES9A 5AHOA 5EP4A 2XZLA 4LCJA 3CINA 3KEMA 4QFCA 4F4UA 1T8RA 1XQYA 3BSYA 1NJ5A 3PHIA 3R41A 3RRNA 4BDTA 1XJQA 3K0CA 1ISFA 4HS9A 3RUCA 1ZW1A 4O2BA 5SZJA 3A70A 3M5DA 2BL4A 4NYJQ 5TE9A 4RORA 2PSSA 5LZ8A 2HJHA 1N25A 1SURA 2C3YA 2XEDA 3RBXA 2ENWA 4CI9A 2JLCA 1ZCAA 2FJUA 2YWCA 4ZARA 1BW9B 2OFWA 1T6XA 1RMQA 2B4QA 5AVQA 1L3IA 1ZRMA 4QYIB 4BFLA 3JU3A 1U2GC 2CWWA 2HAEA 3N75A 5FWDA 4Z7OB 4XDHA 3WMGA 1SBIA 2G1UA 1P9NA 1ZHHA 2C3PA 3LO8A 3RSZA 3GPIA 4GXNA 3ANTA 1NUHA 2OZLB 2VQDA 4IDBA 4IP0A 4W9MC 1PU2A 3VOSA 4N01A 3F8TA 3TPZA 1M34B 1YFZA 4LHVA 5IJ0A 4TZ6A 4JI4B 2C4TA 4AJHA 3DCYA 3ETDA 4ASUA 3U7FB 4RMNA 3HNOA 1QP0A 1XRMA 2FWRA 3GB9A 1D9ZA 1VBFA 4BGDA 2HA4A 2CXPA 1TAHA 1VIAA 2EAUA 1XU4A 3QWIA 4A9AA 4BKOA 1RM3A 3UWOA 2HOQA 4E0BA 3QG5A 1BQ3A 4NZNA 5J2TF 1IRXA 4B32A 4EYKA 4HAVA 1TFRA 2O1SA 3L4EA 4IHKA 1QBKC 1T1GA 5J4LA 4BE7B 4PNEA 2E4XA 1EJ6A 3GMDA 3G2OA 2QVZX 3TLJA 4EEZA 3G88A 1Q1NA 5EJGA 3REGA 5E95A 4EDFA 5FL7A 2ZXUA 3L8ZA 1NNI1 3FNEA 1HZZA 3NHAA 3OIDA 5K6RA 1DXYA 2ADMA 2DU8A 3CUVA 3BJIC 3QV2A 4DCTA 1NQ5A 1O9BA 3UV7A 4KAFA 4EK9A 4TX1A 4BRSA 2J5XA 4EHFA 1NVKA 2NZWA 2FPKA 1ILEA 2G25A 2OHXA 5FYDA 4FGJA 3OWOA 3O84A 1WZNA 2FRDC 1DOHA 3L77A 3FNHA 2ILVA 5DN6D 4RMGA 3G5TA 4IQGA 1WKVA 3QE2A 2WFZA 1E61A 2H1RA 3L7JA 4OI2A 1D2HA 1QH8B 5JFOA 3VOAA 4IH4A 2W8BB 2P9BA 2JI4A 1AOXA 5I7SA 4DWWA 4WW0A 2I2XB 1M6HA 2FOIA 4MLPA 1JQJC 2VF2A 1U1GA 1GRRA 3T7CA 2YKGA 3WLAA 3I6QA 3Q6IA 3C48A 2Z6UA 2R6GA 3PEEA 4P7FA 2PKCA 4WZAA 1Z73A 2CMHA 2XNSA 4U63A 4ZVSA 3NCHA 4NG4A 4R83A 4XFDA 4DCSA 5ICCA 1J8QA 1R0SA 4CEIA 4CQMD 4CV0A 1RRGA 1X9IA 1P8JA 3A4TA 1GUDA 1BOFA 2G80A 2WF5A 1X42A 2VYNA 1XP8A 3GNTA 4HF7A 4NXMB 3O31A 4RGBA 121PA 2O0HA 4NCHA 4CV2A 2XUHA 2JARA 1G4HA 5IUKC 4O4IB 1AGPA 2FRDA 4DPLA 2P7HA 3K6KA 3O4FA 5B4UA 1H8HD 1UBUS 2VWHA 4TVKA 3VBCA 4MQ4A 3WNDA 4Q19A 2PL9A 1DTWB 3CRZA 2VH5R 2ZW9A 3KKPA 3L5KA 4ZQGA 2AZXA 3B9BA 1QZ3A 4LZJA 2ZJ1A 3L9WA 1D0VA 1CERA 2B1RA 3COYA 2RKOA 4DW8A 2PBRA 2GTHA 1Z2PX 2EHJA 1SB9A 3MRXA 4AXBA 4D4MA 1UZNA 3DFZA 2H4JA 1JHZA 4Q5IA 3W34A 1WXFA 3SYLA 3GFBA 4DQUA 1LPSA 1OTYA 4FP9A 4Q18A 5CAEB 5KTRA 4BYMA 1U6KA 2IHVA 4MHTA 1NI3A 3TZ6A 3HUEA 1Y82A 2ZOSA 3FMVA 1RXWA 3NTVA 4O4LF 3ETJA 4TS1A 5DLDA 3K31A 4J43A 1CE8B 1JDVA 3O6VA 2YMQA 2X3UA 3BB1A 1HQYE 2H17A 5TC4A 4RF5A 4CFSA 3GFOA 5K8JB 1KYTA 3T4PA 4EABA 3EMDA 2VJNA 2NO7A 4C7OB 1CLUA 4Z53A 4H1TA 4GI5A 1L1FA 1Y4SA 1FUUA 1JXMA 1TAQA 2XMBA 4HPXB 4LZZA 2G4LA 4ZHQA 3GLIA 4DE5A 2R6R1 4WIAA 4D3FA 5FXMA 3P0JA 5TGZA 4AUNA 2XCUA 1I7SB 4DLUA 8MHTA 1JDSA 3IDFA 2IP1A 3L6CA 3WSTA 4NAHA 1J5EB 1B26A 4JT9A 4UMEA 2EP5A 1CT9A 2KWIA 1D1QA 1N2ZA 2O14A 3LDUA 4NCKA 4TXMA 3TTSA 4BV2A 1TT7A 1QGDA 2FE1A 2ZI4A 3CTPA 4BWYA 4BX0A 1RXVA 1IEXA 1WSWA 1N0VC 2QG9A 2WEKA 3ILYA 1IBLB 1HFJA 2WUEA 4A4DA 5LQMA 2BJVA 2R11A 1XL1A 3FOEC 1KTIA 3AEQB 1GL3A 1SUSA 2HMWA 4MKIA 3NHJA 3N2GA 3G0GA 2JFZA 2W6MA 3JQRA 1QO9A 4NI5A 4PXYA 3WGUA 2AMVA 4D4JA 2A88A 1IY2A 1GZ3A 2GF2A 3TOCA 4UE3S 5CJPA 3L7BA 4DIUA 3QOWA 2GR9A 2HTEA 3CH4B 3O3CA 1G66A 1XA3A 2WHEA 3MGBA 1O6GA 1SU7A 4HEQA 4U7JA 3TDKA 4OXXA 5CNIA 3TTTA 5JW6A 3GG2A 4PQEA 3N7AA 1K63A 3NHPA 4QTXA 1QWOA 3KQSA 1QANA 4N82A 4HAWA 1M0EA 1XCMA 3DL2A 1W1UA 1QV6A 3OCCA 4RCZA 5DGXA 1R64A 2F3RA 3EIXA 1UOPA 2IRWA 3EXHC 3O8OB 3PVZA 3RIEA 4RZSA 3N8HA 5D6OA 1C8BA 1QFSA 2HQOA 6LDHA 3CWZA 2Y66A 1KE2A 1SXQA 3PUJA 1UZLA 3KJXA 2A0UA 3RABA 3PJRA 3HJTA 2H6EA 4IIJA 2HW8A 3P9KA 3R6WA 5CFLA 4KDRA 5ALSA 2FWJA 2BFFA 2IYAA 4LJAA 4MJLA 5HXAA 4YA6A 5HHTA 1WBBA 2EX4A 3DW3X 5C31A 1EH5A 1IQPA 1XXLA 5FA5A 5CDFA 4LFCB 1A1VA 4WNYA 2VDMB 3ELBA 3MTBA 3UVEA 3HABA 4N49A 1J25A 3GLGA 3OAAD 2V7VA 3FBTA 3Q10A 1YIAA 2ORIA 2W2XA 2HX1A 2XUOA 3G2NA 3HZOA 3B82A 4R9NA 4X24A 4B81A 1DVRA 4ITVA 3MLBA 2NXNA 3PJDA 1KEUA 1ZC4A 1C9NA 4HOYA 3TH5A 2YNMD 2OBLA 2O3UA 2QRLA 4L95C 5LQDA 5JZBA 4LDNA 4O4JF 3HWX1 3EXHA 3KZNA 2WJHA 4UAGA 3S2GA 4B83A 3VSCA 4PYIA 4WKNA 3CUTA 3H4VA 3ISTA 1GSHA 4PCUA 3FI0A 1F0PA 3U4IA 4B6GA 4Z4HA 5G3ZA 2Q9UA 3SQXA 2QD5A 3EGCA 3DOHA 2A9OA 1N2BA 3W5VA 1F7VA 4ZYZA 3WO1A 3LUKA 3W5AA 1T8UA 5A0FA 3Q9UA 2ATIA 3R8CA 5IVDA 1LQUA 3LZCA 5SV2A 3CF4A 1A97A 1AQYA 3KWFA 4R40A 2PWYA 1NI4A 2Q4RA 2YYSA 2EOAA 2FQ1A 2JAPA 2NUBA 1FMLA 5FTMA 3RC7A 4F72A 4ZEMA 2AEEA 5F78A 3W9UA 5CEEA 4KH0A 3EGVA 4AY4A 5D85A 4BN0A 3Q8KA 3VVMA 4PG5A 4D9EA 1UUFA 2XT0A 3H19A 1Z68A 2Q27A 1LC0A 5I4BA 2RKWA 2E18A 4IVPA 1GITA 3CX8A 4DA0A 1CZRA 4Q6WA 2VAMA 4I1IA 1W0KA 4MW2A 3BWVA 2SCUB 3P2YA 3VPFA 1GDHA 2F1JA 3HVKA 3JWHA 3Q9NA 4KR7A 3K20A 1UKZA 4V3CA 1WOYA 4UBJA 5KJ6A 1ZW6A 4MKFA 4RA6B 3S1AA 2I55A 4ZZIA 5EZ6B 2BM1A 4D56A 4FONA 4X61A 1UADA 4KFUA 3NEPX 1X87A 2YWXA 3IUNA 3WIBA 1L5HA 5JYDA 5KBYA 3FPKA 3LQQA 2I3AA 1X92A 4XWYA 3T5BA 2C7BA 3DMNA 1CJCA 1G2QA 1PX0A 4RV4A 5I6DA 5L6MB 3PPWA 4IJVA 1XZGA 4E5VA 5AW2A 2CVPA 3D8RA 3DO6A 1ZQ9A 3KQYA 4HG2A 4KL8S 4DLLA 1K89A 3SX0A 1P91A 1IULA 1KI1A 5C8DA 2QN8A 4M37A 5BSHA 4MINA 4HRAA 4QDXA 4OXYA 2VA8A 2F3QA 4CUKA 1IL0A 2HIAA 3I09A 1KJ8A 3WGMA 2OHHA 3SZUA 3VR4A 2JG3A 4E2YA 3PNQA 1ZM2A 2MR6A 4PTYA 1KY5A 2YIVX 3F47A 1LBSA 3T0FA 2J0UB 3WRWA 3EIEA 4AAYA 5FEUA 1AKVA 3OFND 4X1YA 3L01A 1SFRA 2WDZA 4I4LA 1JR6A 1XZAA 3KCQA 3NHUA 4ZOLB 5AK4A 5KC8A 2F3SA 1AU9A 2BGLA 4O29A 3PA6A 5E2BA 2VTEA 5HE8A 3RRZA 2QRJA 1DWOA 4OMUA 2PLRA 2YIJA 5DP1A 4FGZA 2VSQA 4A5OA 3LLUA 1NAIA 4I8IA 4OIFA 2DHCA 4Y2QA 2Q7OE 1LW6E 4AO7A 4JODA 1M2EA 5AVSA 4KQMA 5EHQA 4L3OA 2VHJA 4F3RA 4KACA 1C9YA 1LPMA 3PEYA 1KU0A 4EOGA 1EBUA 1G60A 3BB3A 4YHHB 1E92A 1MG5A 2XZTA 5CMLA 1BE8A 3PT5A 2OC9A 1TCCA 4ERXA 2J0QA 4CL8A 1FXSA 5FA6A 2F3TA 4Y1RB 4Q3CA 2I4IA 4PGHA 2XTMA 4L6IA 2C5BA 5B53A 4CIXA 3CMCO 4BWFB 2VIIA 2AMJA 1HNZB 2ZRAA 5J40A 1MJGM 4DC9A 3H2JA 1KFCB 2WAXA 4HWSA 4DV6B 2QRHA 1MO3A 2BPOA 4PAQA 4E03A 2BD0A 3CVVA 3LE8A 3MMPA 1N0UA 1Y5IA 3OHSX 2ZTSA 2NO1A 2AG8A 3Q88A 3FNBA 1XEWX 4Y0VA 4GPTA 4PONA 2YHUA 1EUZA 5JE8A 1JKXA 4DDVA 3G9UA 2R4UA 4IDGA 3WTBA 3N8NA 3IMFA 1VYHA 2UDPA 2YRWA 1DL5A 1EUDA 3IIEA 1SM4A 1XEWY 3IR7A 4H2DA 4TM8A 4NRDA 3VKFA 3AL3A 2ASEA 5EE3A 3VO9A 1I7PA 2KPOA 3CN9A 3CLUC 2IHUA 4HAXA 4A2PA 1XMOB 4OQNA 2YW2A 5IAOA 3BH7A 3ZDZB 2VK4A 1BGVA 5TQJA 3FB1A 4TT3A 4HDSA 3K70B 2VHTA 5K0CA 3E9YA 4NCJA 3F6YA 1SUCA 2J1LA 2PFGA 4B75A 5J2UF 4DDMA 3PCTA 1KHTA 4XE5A 3VYVA 1XPOA 2QTMA 1OLSB 1T3HA 2X4IA 8AT1A 1KI7A 3ST7A 3EF0A 5CK5A 4NZPA 2NPFA 2NU6B 2P3LA 3T9FA 2DFKB 4YV7A 3E1KA 2JJ2A 3NHMA 5H82A 3PNYA 1D2MA 2I67A 3AJEA 1P0MA 3ZZMA 4J7XA 3QEJA 5CFPA 5IHXA 2C29D 4Q1DA 3O90A 2HNAA 1C3VA 3EA5A 3GJ3A 3W3ZB 1YDHA 1PDWA 3B3FA 3M6IA 4MUNA 2YV4A 3LGSA 2RKBA 3B6ZA 2XBUA 5HFJA 4G84A 1K8ZB 2A5JA 3P52A 4PNPA 3HJFA 5GM1A 4HZUB 1Z7YA 1NSFA 2RGUA 3UJ3X 1PAUA 3H18A 2VHVA 1CNEA 4J9VA 2GFHA 1JFFA 2O2HA 2DM6A 3RSCA 2BEUA 3M8KA 3WWPA 5BVGA 3L4KA 3P0IA 1GSOA 3D3WA 3HY3A 4K2AA 1T29A 2NTNA 2IZ6A 3A6FA 3I01M 4DXHA 3NDIA 4MLDA 9ATCA 3GWZA 2GUWA 3O9VA 5AHKA 5JNLA 1A7UA 2OBYA 5KNBD 1K3TA 1R0KA 2H4HA 1HT2E 2II6A 3IERA 3UXHA 4RE6A 5FJIA 1PV2A 2CLCX 3SZ3A 1YDMA 1FF9A 4X92A 3KU1A 4BN5A 3SQNA 4BO6A 4LGMA 1E1QD 1S8OA 3HA5A 2BM8A 3UOAB 1BDIA 1GA1A 4OHCA 3QYFA 1JSZA 3DXZA 3QU9A 2R84A 3FNQA 4NPCA 1JQLB 3I4LA 2WFMA 2I3ZA 1QHIA 4BJ6A 5JSKA 1NG9A 3MWGA 3G5MA 1V8BA 2Y1GA 3R9KA 3GFQA 3OEYA 4UUOA 2EKLA 1TK2A 4OJYA 3HFRA 3VH4A 3PDHA 4BEJA 5CX1B 4P86A 3T4EA 4YV0A 3CRRA 1OX6A 1NV8A 1S9DA 4MRPA 1YQGA 1LPAB 1VE9A 3FR7A 2ZUVA 4HATA 4JGIA 3NFRA 4XX1A 1FTSA 5M04A 2O6LA 4C76A 3I2KA 1IMOA 4O0LA 3TZLA 2PPLA 3G1WA 1XIVA 3MJFA 3R0IA 2J5QA 2REXB 4P7KA 3AKDA 4RHUA 1ZH2A 4K8RB 4YJ2A 4Q02A 4N41A 5KNDH 2I4OA 2HLHA 3QGMA 3NWPA 5FTJA 4HXFB 1Z4JA 2PUVA 3ENNA 1JU3A 1Y1TA 3EVNA 4ENRA 1G21E 5L4LA 1UOQA 1RI2A 4NCBA 5EUQB 2A9QA 2P2GA 1ZM3A 1T4CA 3BC1A 3O7WA 5D3ZA 3Q87B 4KQCA 4G0YA 5AXAA 1JEEA 2XNHA 3DTNA 5K8CA 2OXIA 3YASA 4F3YA 2WR8A 1QQ6A 1KYWA 2DG2A 3CUEF 1E1NA 1NHGA 2RB5A 2B1GA 3OT1B 5B12A 1NPDA 3QVGB 4F97A 2QNRA 3O03A 4H6PA 2ODNA 2PFSA 3HZRA 5GONB 5DULA 2KBEA 2TMDA 4TWAA 4MR8B 2XD4A 3H0KA 1NFRA 1PJ2A 3OC0A 2WT9A 4HWRA 4KZPA 1S02A 1Y9ZA 4PRKA 4D02A 2FVXA 1NJ1A 3DDSA 1ZWKA 2GWRA 3S2IA 3GDGA 5AO9A 4UULA 4UPEA 2JPDA 2YR0A 5KU1A 4UNSA 4F3TA 4LF4B 4IM7A 2H18A 2WWYA 1CVRA 1G5PA 3ESCA 3GP3A 1J97A 2WV7A 3OE1A 1AVTA 1KGDA 3CA8A 1VHLA 1TYZA 1F8UA 3IAXA 4FSXA 1O95C 4NE2A 1RYFA 2OHJA 3Q8MA 3GA7A 3ZLJA 1PCXA 4H7EA 1AV6A 4KBGA 3DDOA 4E5SA 1JEDA 1TVKB 5A05A 3RUFA 4AMUA 4MV5A 4BWVA 5I01A 2B78A 2G5TA 4K3VA 5JNRA 1TNDA 1B73A 3RJMA 3CURA 4GOJA 1N5DA 1V43A 3WFIA 1IB0A 4EY4A 1XMVA 5JH7B 2DX7A 3IJ5A 4IL5A 4W5OA 4FZ3A 4KIGA 2UVQA 4I1UA 1EGQA 4UEKA 5ALUA 4Z4FA 3R20A 1NYRA 2ZP1A 3EWNA 3RI3A 2BDUA 3V1NA 4ZD6A 2JI9A 3ZOZA 4PXSA 4JR2A 3M4YA 3PUKA 1Z4IA 2PBFA 3TQSA 5K0FA 2RDMA 1DQYA 4OV6B 4R8LA 4U3JB 4ZOBA 2I7CA 2Y0BA 4NFYA 4LC9A 4C5AA 1XZFA 2OP0A 4OQEA 3U37A 4EKNB 5TLSA 3UTDA 3EQ8A 4AF6A 2SBTA 1NX6A 2Z8ZA 4OLJA 3D0QA 4MI6A 4QO7A 4R8RA 5FWAA 3W4KA 4F12A 4KVFA 4AJJA 5AESA 3B8EA 4C0KA 3RRYA 4ZAXA 2INGX 4FNOA 1AHHA 1Y7IA 2CJXA 1AO0A 3A3NA 1DKRA 1TC2A 2A3NA 2AEMA 2GA8A 2WOJA 3OQ6A 4KMRA 5KMGA 2OM2A 4TQGA 1ZRSA 2H2FA 2PKYX 2ZSFA 2J5KA 4GEGA 2ZTMA 2NQ2C 1R88A 5ALJA 1C8LA 4HWPA 1KVQA 2B8WA 4JL8A 4O59O 5AK0A 3GLRA 3MQ2A 1JPVA 1T6NA 3FA2A 3OPYI 5ULLA 3FWHA 4OXQA 5EERA 3UV6A 3KC2A 2DWOA 1Y7HA 3RFUA 3TCXB 1Y33E 4D57A 1P75A 2JD0A 1A8HA 1H3FA 1I8TA 1RLJA 4QWWA 1MABA 1X7WB 1TZ2A 2C5LA 3BRCA 4YLEA 4CMHA 1RLOA 1KI8A 2HFKA 5JCJA 3DGEC 2UVPA 3B1KA 2A3RA 2QD2A 3AF1A 1X1SA 3B1FA 3CR8A 1QCDA 3KO8A 1PT6A 4IILA 1N6KA 1OX4B 2KMLA 5B57C 2JAUA 4NHOA 4OJMX 3JAKB 4QXRA 4XPIB 2A0WA 3HV2A 3PQ8A 3COWA 5B3LA 1FUIA 4O2AF 3TL2A 1R0CA 2XGOA 1SXJA 1E2UA 2XF2A 3IP3A 3Q3IA 5IYZF 4RULA 4L6AA 5KI6A 2C0CA 4ARIA 1E2NA 1SELA 1GQYA 2UKDA 4JOCA 2IX9A 1FQJA 1JX6A 4TZKA 1QYRA 4XRRA 2WUFA 3AILA 2PM8A 1VBKA 4XB6B 3W2EA 4G5FA 5EZYF 4BQSA 1AK9A 2PA0A 3U81A 3KOXA 1Q0PA 2P5YA 1MT3A 2XMCA 1OTHA 1U3GA 2HNBA 1Q1GA 1YK1A 1Z39A 2NUTB 3MUOA 4U39A 3ZHSA 1FU4A 2PT6A 3BZWA 3GRZA 4H1VA 3RFCA 4EBFA 3K9BA 4FYMA 3V7FA 1VFPA 1M1ZA 3A1WA 4FDLA 4F96A 4Q21A 4GO1A 5EE5B 1SUFA 2ZIXB 1RQGA 2B34A 2PRZA 3CRW1 4GZ6A 4QLAA 5AKGA 5A5FA 3L1VA 4B2PA 3NOXA 1E3WA 1AXGA 1VHDA 1XNRB 4QASA 3GEBA 4QBFA 4XLTA 4BGVA 5IZCC 4DM3A 2PU7A 4JLKA 1JE0A 2AQIA 4N76A 4MS3A 4CCSA 4HL6A 5A06A 1PYDA 2HBYA 3DV9A 1JG6A 3DVSX 3EEYA 4JC4A 3FF4A 3ZWMA 4CL0A 4F85A 1T9KA 3DB2A 1PLKA 5KYTA 1PZMA 4ZALA 2BFEB 1MX1A 4D2IA 1CPYA 3V3TA 1NASA 1TA0A 1VIMA 1VKJA 3EA4A 3TLXA 4P3YA 5E2IA 2ZJ5A 1I7QB 3VPCA 1V47A 4HMOA 2PJRA 4FJ1A 3CM0A 1JLLB 1L4YA 2YJZA 1I6WA 1L8QA 2YXEA 3C5HA 4NYMQ 1T1SA 2Q0XA 1NVMB 5FNVA 2O07A 5E4FA 4QOEA 4Q4AA 3WL8A 4YMTA 1SZCA 2ZRCA 4BPRA 2OD7A 4G5QA 1UEJA 1FB5A 2JGMA 2XVAA 3B78A 3H1TA 1EK5A 4L9WA 2GERA 3PFKA 4QDKA 5SZHB 3O95A 4RD1A 3INGA 5IZCA 1AHNA 1XRJA 3MFQA 3NH9A 1N8SA 3KKKA 2CLKB 3CC8A 3IH5A 1LBTA 3FTQA 1M2WA 2P9JA 2QAIA 4XIGS 4NBRA 1YZFA 3AW8A 3OZEA 1DE0A 2ZRPA 1A9PA 3OF5A 2NXWA 1O6CA 4MUMA 3HPRA 2KSQA 1WZEA 2Q9BA 3CV3A 2WT8A 3SJZA 3K8OE 4ZVOA 5BW6B 4A0FA 1MAHA 4UVEA 4M76B 5A5VA 1VI2A 3DBRB 5AM0A 1WCYA 2P2NA 2DE0X 2Z58A 1YJ5A 3DNMA 4G37A 2OENG 1TU4A 2GEUA 3JPYA 4G5YA 4L2IB 5CLQA 2B0CA 3SF8B 1KY3A 5BV2P 5IUJC 1Y6GA 2O8EA 2B7LA 4NDAA 3LCUA 2DZDA 1WD7A 3MELA 4BV8A 1KQPA 2OHIA 3PHLA 1OSNA 4E5DA 3EH2A 1BEUB 1F6DA 2OYSA 3GHYA 1SHJA 5IARA 4WZBB 2ZZMA 1SIOA 2VT7A 3WIDA 1FS4A 1L5SA 2OCYC 1DXQA 2XB9A 1ODLA 4UZFA 3SZLA 4MNTA 1VZ3A 3AF4A 1ADBA 1KAQA 2JGEA 1EDBA 3IMGA 5CLFA 3WMEA 3WYDA 4C3OB 4F0JA 1LF0A 3CH5A 1O89A 3L82B 4NY1A 4R81A 1E2IA 4NCXA 2HMAA 4EPXA 1B3RA 5ALWA 3UJ6A 3VTFA 4ZQEA 4B3TB 4GICA 2UYHA 5DYNA 4L4ZA 1Z4QA 1G63A 2HJSA 3B1ZA 4OEHA 1N0WA 1LBEA 4ENVA 5C32A 1S2LA 2QUZA 1SRRA 1GDTA 4EHHA 3U31A 3ZHQA 5KYGA 3PFCA 4Q1EA 4JQYA 1H8EA 2QLJA 1M1YE 3RUPA 1G18A 1CS0A 2D5LA 3C3AA 4J91A 4OUKX 1KRWA 2C31A 2WSLA 2G1AA 1FFBA 1NY5A 2VP0A 5EE0A 4B2LA 1RNLA 2HJGA 5HCNA 2QTZA 3OBIA 2BEWB 1J7JA 5H16A 1BEEA 5A2GA 4Q93A 2G71A 2W2VA 3IXQA 2Y2UA 3M1YA 1AMNA 1KAEA 3D8NA 3ZE8A 4PN3A 4TUYA 1M7GA 2Z83A 5BVGB 5B1EA 3BMNA 1DV2A 4QJ5A 1V39A 1EFVA 4YQZA 3R6LA 3AOGA 1TEHA 2YRFA 2CXSA 4CM4A 2ZSIA 1EFDN 5AK5A 3PT9A 3WGOA 4Y6QA 3OCUA 1K88A 2GH1A 4P58A 1UJ6A 3I8SA 4TLDA 5A5EA 1P2SA 1FX0A 4RA9B 3DAFA 3IKLA 3QXGA 4CMIA 3ZE2B 4A91A 3V4LA 2XQGA 2R1TA 5F2KA 1U9JA 1Y34E 4DDTA 5HQ3A 3QKUA 4RGVA 1WLSA 3ICVA 4EYSA 2GQ0A 1JEYB 4EB0A 4Y2JA 4ESHA 1SC6A 3L7NA 3LQFA 3MMZA 3SKVA 2CUTA 5HGJA 4CIVA 1D2EA 1R0WA 4JWKA 1Z88A 5KHAA 2Q9CA 2JFBA 2X1LA 3C39A 4RK5A 2BI8A 1DG3A 5DHRA 1U0OC 2Y6VA 4WCFB 4MXDA 3WWEA 5LSAA 4EY6A 1XPJA 3NUQA 4K9NA 5E6RB 3IQEA 2QM7A 3FPCA 3GEGA 2IT1A 2Q5EA 3MTGA 4B8ZA 4B9AA 1Z2CA 3MBKA 4TV8B 4HQ6A 2V7WA 1NBME 2ZKLA 4LV6A 3RYCB 2YDYA 4PTLA 4YMLA 3UA4A 1I51A 4R7ZA 5JPDA 4JLBA 2W6OA 1U5AA 4BNNA 2IYVA 3O82A 2GETA 3HADA 3K3PA 4QSMA 4TTPA 5AI0A 3UNXA 3KSBC 1J8MF 3QNWA 1GIAA 1W48A 3GELA 4RO0A 3DYIA 2AT1A 1YIDA 2XA2A 3UATA 5K0TA 3KWMA 1UKBA 3EVTA 3IDZA 3T9AA 2VWPA 1P4HA 2UZ1B 1VLJA 1SVMA 2ENUA 4UM7A 3SDSA 2QSJA 4TWJA 5KKAA 1WXEA 2YZMA 4KNYA 2NYRA 4X66B 5B1YA 1K7XB 5F21A 2WIKA 2FVYA 1SEVA 3LY7A 4IFTA 5LB2A 3FHCB 4DR5B 2C99A 1YB1A 1L5VA 2PGDA 3HB7A 1XEAA 4YH1A 4Y1FA 2FPIB 1EBBA 4B7ZA 4KWHA 2OORC 1CQIB 1YQDA 3CLSC 3B6EA 1JAHA 1BJKA 3CVUA 2R97A 2UZ4A 4IZIA 4N39A 5JI3E 2XJ4A 4CEHA 3O94A 1YDFA 2AVNA 4I19A 1ZP6A 5ITZA 1DFIA 1TW3A 2FZKA 4ZCSA 4P4UA 1SCQA 2ZTVA 1CUHA 5G0UA 2IODA 3HACA 2H8KA 3NKFA 4M0MA 4ZT4A 3Q98A 3SLGA 4FOTA 2QQEA 2YVUA 5A9TA 1F1JA 2C5AA 2Q0HA 2CJWB 4MWTA 4NIMA 3TYXA 4PPYA 5FH9A 4PNZA 2DUJA 3K8QA 3DEYX 2AMFA 4HI0E 3ZXXA 1FU8A 1ZVJA 2XCRB 1EZ4A 1UKAA 3A0RB 4FYIA 4WZZA 5CCXA 1UH5A 4YUXA 1VJTA 2Q6LA 4MHSA 3QITA 4FUTA 3RFVA